3POIA

Crystal structure of masp-1 cub2 domain bound to methylamine
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
113
structure length
113
Chain Sequence
b'ECSGNLFTQRTGTITSPDYPNPYPKSSECSYTIDLEEGFMVTLQFEDIFDIEDHPEVPCPYDYIKIKAGSKVWGPFCGEKSPEPISTQSHSIQILFRSDNSGENRGWRLSYRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Mannan-binding lectin serine protease 1
molecule tags Hydrolase
source organism Rattus norvegicus
publication title Structural Basis of Mannan-Binding Lectin Recognition by Its Associated Serine Protease MASP-1: Implications for Complement Activation.
pubmed doi rcsb
total genus 21
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 3.4.21.-:
pdb deposition date 2010-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00431 CUB CUB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.290 Mainly Beta Sandwich Jelly Rolls Spermadhesin, CUB domain 3poiA00
1SPPA 5CKNA 1SZBA 3POEA 3POFA 3POBA 4LORA 3KQ4B 5CKMA 4LOSA 1NT0A 4LOTA 2QQKA 2QQLA 3DEMA 4LMFA 1SPPB 1NZIA 3POJA 2QQMA 3POIA 5CISA 1SFPA 2QQOA 4GZ9A 3POGA 5CKQA 2WNOA
chains in the Genus database with same CATH superfamily
2B5HA 2VY0A 2R49A 1XYPA 3WNKA 1PZ9A 1HB3A 1FV2A 1GWLA 1SFNA 3LE0A 5LEJA 3OUJA 1GQGA 2D6NA 2GMPA 3VBHA 3WINE 2WNVB 1W6MB 1LOAA 2IUWA 3ZX7A 2XHKA 3WOGA 4N43C 1YQ2A 3CDZB 1PMJX 3VV1A 3T2QA 2XMLA 2RDQA 1DDLA 2ZJCA 5FZ3A 3NV2A 2CHHA 1CAUB 1X50A 5DG1A 2HYKA 3MLLA 4Q4Y2 4QM8A 1JZ3A 2CU5A 1OD3A 3RNSA 1CAUA 3JBG3 1JZ5A 1S2EA 4ATEA 3PUQA 1YYNA 1SPPA 5FP3A 2E6VA 3WNNA 3PVEA 4LLFA 4BCUA 4IEPA 3FLPA 4LQRA 2QZ3A 3PJQA 3QCWA 5KHKA 4Q0QA 5LA0A 2P5BA 3POBA 4Q4Y3 2WNVA 4CDUA 4AF9A 2CDPA 2FDFA 1HXS3 3MIEA 1G7YA 1QH7A 1R091 2A73B 3C7EA 2BWAA 1N1YA 2WNUA 4NROA 4S2FA 5JPNB 4FFIA 3B02A 5L7OB 1DF0A 2DTWA 5J48A 3ZN6A 4LKDA 1WMDA 3T1MA 3EXUA 4GB31 1IKPA 3WNOA 4PT6A 4YW5A 1DYPA 5AVPA 4AI0A 1LU2A 4URAA 3W21A 4CUAA 3KWVA 3VBSA 1LHUA 3URFA 2CDOA 3J26N 4D6SA 1SLAA 2UWBA 4YRDA 3ACFA 3RSJA 1IZ3A 1F9KA 5C33A 4BHPA 4DUWA 3HBKA 2W87A 2YUEA 4G3YC 1N3QA 3ZLIA 2EAAA 1GP6A 1GP5A 4INDA 1DLCA 5FPBA 5JUVA 1H9WA 3IPVB 3POYA 1TME3 4MSVA 5E88A 2VBBA 4LT5A 1GZWA 3WP4A 2FZ1A 2Y33A 1YO8A 4PDWC 4KH9A 4UFHA 2YGMA 4JKLA 1JYVA 3KQRA 1F4AA 2VW1A 5C6CA 4NHYA 4YW1A 1W2TA 1ZZ8A 1PK6A 2VVDA 2WT0A 3MIDA 4GKYA 1OPOA 5DQ0A 4JGZA 4GALA 1FPN2 5F9TA 5FJKA 5C3PA 5SV8A 5KXDA 4R52A 1VJ2A 2ZXQA 5FYHA 4Q1PA 2W52A 4NUBA 5FYTA 2EXJA 4DEVA 1GP4A 4HVOA 4BMEA 1X9PA 2VZOA 4HN1A 3VZLA 1WA6X 5G05L 4BQ4A 5M0TA 3MF6A 2WSVA 2OYZA 4FXGB 1W03A 2VMGA 3ZXLA 2GAUA 4QHZA 3SQOA 1KS4A 2D97A 2MHFA 5FZGA 2B42B 1SBDA 4H7MA 5LY2A 1W0OA 4EWDA 1AR82 1EV11 2XJSA 5FPXA 5DXDA 1US2A 4QGNA 4QPIB 5FP7A 5FYCA 4XAAA 5A33A 5EHDA 1PGL1 1TZOA 1GLHA 2PA7A 1ASJ1 3O1MA 4Q4W1 3LA7A 2RS33 2ZOEB 4Z07A 3LAGA 3T2TA 2QBXA 2GNBA 3PLQA 1HX6A 4PLNA 1S2KA 5AVAA 3ZXDA 2VCCA 4Q1RA 5I8TA 4QDSA 3VBHC 1AJKA 5FXXA 3IWZA 2VMEA 4DZGA 4N7IA 5F6KA 2VZ3A 4QPIA 1C8M3 4HONA 4XFHA 1J58A 4BPZA 1N1SA 4AVVA 1JZ7A 2LS6A 1PNFA 2E7QA 3CLPA 5ABJC 2X53S 2QQKA 3C7OA 1D4M2 1TVGA 1E5SA 2EIBA 2XXZA 4XUTA 2XOMA 3ROUA 4A6SA 1WA4A 4GQ7A 2AZ5A 4MXVA 3GF6A 1YEWA 1SLTA 4QU1A 4BLJA 1MS3A 3BKZA 1AHSA 3GHNA 2VAUA 2VNVA 2VOTA 3I3EA 3K4AA 4CA9A 1T6BX 3V0BA 3U07A 4CUGA 2W2IA 1XYOA 3QD6A 5CYYA 4ASMB 5C3SA 1WKYA 1ZRCA 1GZWB 1LOGA 1V70A 1GV9A 3N7KA 4NHLA 5FPAA 3RS6A 1APNA 1ND3A 2PTMA 3PIJA 3A4UA 3MW2A 5JOYA 1HLCA 2BGOA 2GNDA 1X9TA 1R1ZA 3AZZA 4KNCA 3WDWA 4QB1A 1UZWA 1RUG1 5FV3A 2P3IA 1ZRIA 2ZBJA 3KF5A 4W4ZA 1O4YA 3GBWA 2B46X 3NJXA 3IM0A 4NN0A 4WZFA 3HNBM 4CDQA 5A6YA 2KXLA 3TEYA 2Y0OA 2ARCA 1FMD1 2VECA 5LA1A 4AEJA 1W06A 1GWMA 4QX5A 3USSA 3WR0A 5JR7B 1COV2 5BXXA 1NLQA 2AENA 3NJVA 4QXCA 5C9AB 4XIOA 4DINB 1ODNA 3PL0A 4QDRA 3ZSJA 5JDBA 5FY4A 4J25A 3OPTA 4YGBA 5DDJ1 3MLJA 3B01A 5FYBA 3SLIA 1VMHA 4K1ZA 3I59B 4QT6A 4XACA 5D8AA 3APBA 4PDWB 3BI3A 3I54A 4WM8C 4YW6A 1EP0A 4M00A 2B7YA 3NVCA 5FLHA 4AQ2A 5C9AC 1MS5A 1XSRA 2J7MA 2OW4A 3N7LA 4UAPA 2OZ6A 1EY2A 1SPPB 1Z0HA 2JEMA 5GJ6A 2FDIA 4RS5B 1JOPA 1XXNA 2R072 3V0AA 5FTTC 5LK5A 2ZGMA 4QM9A 3VKFC 2FQPA 1Y9QA 2WFF2 2HEVF 4ISQA 4AVSA 4OZOA 1NX9A 3NL1A 5CAZA 4Y4RA 3MV01 5G04L 4ARXA 1IPJA 2UY9A 1J3RA 3OUHA 1NCQB 4QX0A 1QJU1 4WVMB 1JYIA 3PVNA 4JVAA 4MO3M 2KM2A 2ZHLA 3FX3A 1YQ8A 4UFLA 1H4HA 5HXVA 1X8MA 3VD3A 3WW4A 4W65A 4UW3A 4MGZE 1YUDA 1UKRA 5EQUA 4M3CA 5FY9A 4A3ZA 2A70A 2DUPA 5FZ0A 3WP6A 4O9GA 4BE3A 3USUA 3KT4A 3I2OA 1YQCA 5ACA3 4JGYA 2QQUA 1J1TA 1J1LA 1L7LA 4I01A 4JDOA 2RM23 3ES4A 4XCAA 5FZ8A 5CBLA 2VMCA 5KBFA 1W6PB 4YLZA 2BRTA 2HKXA 4Y1UA 1RUD2 4XZUG 2E53A 1CZTA 1QJY1 3NWKA 4FFHA 3AYAA 5I0SA 3DKQA 5K8SA 2ADDA 2WZR3 1CPMA 1J3PA 4IL7A 2Y26A 4V1PA 4YWAA 2P6CA 1W0PA 1PO21 2DVDA 4GMP0 4DRRA 3BU0A 4PCRA 1UOGA 3AM2A 1RUD1 3S30A 3H42B 4Z1VA 5T55A 3THDA 5CU1A 2LROA 4B4PA 3NNMA 3CO2A 4ZXKA 4ITCA 2DBIA 2VE1A 2HWC2 3E6BA 2WNVC 3W59A 1GZCA 2OQ6A 3AP4A 1N1TA 2WT1A 4QPGB 4XF3A 5FPLA 3WF0A 2W91A 1H1AA 2JDAA 1GICA 1OQEA 3A7QA 4CXXA 1AR83 4Y1ZA 1S0JA 5FBZA 2HWF3 5FZHA 4L2NA 4D7TA 3V0BB 1NUKA 3B00A 4IETA 1HKDA 1RL3A 1NZCA 2ZKNA 4EV0A 1G9CA 1OKQA 1FMD2 3AL6A 3KS7A 1O7FA 2ZA9A 5FREA 3WG3A 3WVJA 2NQYA 2W5FA 3RMXA 4CDWB 2HH9A 4HSJA 3M3QA 2G19A 4F8AA 3BPZA 4XDOA 1POQA 2DCKA 4QXKA 3VDCA 3PUSA 4UI9L 1CAXB 1GNYA 2LUWA 5HI0A 4QKDA 3AP7A 2I74A 1LHVA 2MEV1 3A21A 1XU2A 2VR4A 3QACA 1RYYA 1XYNA 1T6GC 4PQ9A 1D4M3 1DBNA 1ZA7A 4MLOA 4AVAA 1FV3A 4JCKA 4BOWA 3FHAA 3ZDVA 1NA1B 1RINA 1UPSA 3FUQA 4XYXA 3BGAA 5FUNA 2VH9A 2PELA 4BB3A 2Q8DA 4AEMA 1W8WA 2VZSA 1NT0A 5LA9A 3ZYPA 4KGGA 4RN5A 3SMHA 2QQLA 2NP0A 1GMMA 1EYBA 1TQ5A 2CAUA 1RMU3 1YI9A 2JB4A 2ZABA 3CJIB 3I2KA 3DCQA 4L0PA 4MGIE 4L8QA 5CADA 4OHYA 4GB33 5FZ9A 1S0IA 3KHBA 5DAVA 2VZ1A 3E6CC 2GNMA 2C6SA 4FBFA 1W8OA 1BMV2 1QDOA 3I3MA 2WLQA 2XKPA 3J8F1 4S2DA 2BYVE 5L9BA 1DGRN 3M7AA 3UESA 3ES1A 4V2WA 2DF7A 2ZHMA 3J4UH 3WHTA 3RZJA 3KQ4B 3WEZA 4E8CA 1Y4WA 2VTFA 3WP5A 5B4NA 1K42A 2BW8A 1JZ6A 4AQTA 4XF4A 3LIHA 1RHI3 5FMOS 4OMCA 1O4TA 1SFYA 2PAEA 4FPFA 1E5RA 4GH4B 3RYRA 2P34A 4C8DA 2JDPA 4TTGA 2N7GA 4FOQA 2UU8A 4XUNA 3T1LA 2NM1A 3WDVA 2RG4A 3P3PA 2UWAA 1HJFA 1LULA 4N43B 4MG2A 4CCDA 2WUHA 4D3WA 4BISA 2RM21 2JD9A 5J96B 4ARYA 1H8VA 1JZ4A 1MZEA 2PHUA 5JI9A 3FE5A 1ZBA1 2AC1A 4JDNA 5ANNA 1OA3A 2YBKA 3AB0A 1RUF1 4XJZA 4Y20A 2YPJA 5K4LA 4QB2A 3D3AA 3HD8B 1YI7A 4COZA 4XQDA 3P1IA 1NCQA 3B9IA 2HWB3 3OYWA 1R083 2QQVA 3A0KA 5IYYA 4DY5A 3JZVA 1RVF3 4D69A 1VB4A 5F2SA 1WCQA 2WYSA 3VL8A 1ND2C 1GBGA 1ZNPA 3K51A 2PAMA 2WL1A 1ZRRA 3AYEA 3MF9A 4HKWA 4I0AA 4LK6A 4MGYE 4OI2A 4LNVA 3OGGA 4NRQA 1V6OA 1V9U1 3BTZA 2YDEA 4XXAA 3IMNA 2EALA 3LKJA 1IS6A 4YVWB 2R043 2UYBA 3PU8A 3FHQA 4Y3OA 5DN2A 4L92A 2DCYA 1KJLA 2J1SA 5FY5A 5FOJB 4P9XA 5KXEA 5BNOA 3WDTA 5D8AB 3SEPA 2YBSA 4M01A 1JUHA 3BIEA 2R073 3N9OA 1TNFA 2W1WA 1DGWX 3RPQA 4EWAA 2YC0A 4Z2AA 1AYN2 4LO6B 1VBE2 3WNLA 5DAQA 1VE0A 3VBFC 5AC91 1UMIA 2QJVA 2YC2A 4LPLA 3CMGA 3ZXKA 1POV0 2RS11 1V6MA 4BQWA 2YXSA 3LWCA 3H0OA 3L9JT 4PIZA 4RQPC 4CVUA 3WUCA 3V65A 4MUVA 3KZ4C 2GN7A 4X8NA 4MGTA 4BQ3A 1REEA 5DPNA 3KHCA 1UWWA 2WO2A 4PQQA 3SKJE 2WIIB 5IUQA 2Q8OA 4TZDA 3WCRA 3IB3A 1LNSA 4QXBA 4QU2A 5KC5A 5FPVA 5HCHA 5FOBB 3AFGA 3OPZA 3PHMA 2X8KA 3B3QE 1JU3A 2K46A 3WG2A 1F31A 3DYMA 1MVQA 3AMHA 1F5FA 2GC0A 1VB2A 1W04A 1S0EA 5BY5A 5LB6A 1Z7S2 3BN6A 4XZPA 1W90A 1VBA1 3CQOA 1WLWA 4L97A 2IXIA 4PLOA 5A3TA 1Y9GA 3LZZA 3ZSEA 3WHUA 3RZHA 2EXIA 4X6RB 5C8WA 1WWYA 3K3NA 1WCSA 2P37A 2V5DA 2A6YA 1EPZA 2D6PA 4LO8A 1HRV1 4CUBA 4UW5A 4NIHA 2WYFA 2YYOA 2PHRA 1UL9A 4W6XA 1C8NA 3OSDA 1RUC2 2RS32 1JODA 1AR63 5FQ0B 1O59A 2WA4A 3GXUA 3O12A 4KMQA 1ND2B 1PO23 4OUSA 4XJUA 2HBTA 3VKOA 4MADA 1MS8A 5JMOA 2B8MA 2QCSB 3WNMA 1CX1A 5DAXA 2BGCA 1X82A 4M3CF 3AKRA 4CUCA 5C8CC 1GOHA 4CCOA 5T5PA 1J3QA 4BK5A 5CA6A 3VLBB 3D8CA 1MR5A 5FMDA 1RUE1 2ZGOA 5A33B 4B8EA 5F3EA 4Q2FA 3CZJA 2ID4A 4AFMA 5GLUA 2P3YA 4AXOA 4P5HA 3JUUA 4CCKA 3I2IA 1AZDA 2D44A 1AXYA 5FUIA 3HIFA 3I2HA 3ST7A 3DEMA 1ZX5A 1NCRA 1VR3A 1XNAA 4ISRA 5KXCA 4K40A 3DECA 4LXLA 2WZPP 1AX1A 3I3BA 2X10A 2WQZC 3ZFGB 2QQMA 4HBNA 3VZKA 3ZO0B 1XJAA 3MO4A 5EJ3A 5EP9A 3AK0A 2Y6FA 2VNGA 3VBOA 3JB8A 5DG2A 3M4FA 1J59A 2OS2A 2PHDA 5AC92 1AR61 3OF1A 4N53B 2PLV1 3ZXGA 2JG8C 3GNEA 4GMP1 3ZR5A 2VZQA 4IDZA 2AYHA 3VHNA 2OIIA 1RUNA 2QVSB 1JW6A 1QJZA 3ZXFA 1H8TA 1AL22 4CPBD 1RUOA 4QPWA 1E5IA 2P17A 3IPVA 4BJ0A 1W2AX 2J22A 3BOWA 2R063 4XFBA 2B39A 2WABA 4NHMA 1S0FA 5FK7A 4DIQA 2HWE2 2JG9C 1S1AA 3FLTA 2VOWA 3OGRA 4OI0A 4XHBA 5BNPC 3KGLA 1M4WA 4HKLA 2WN2A 1NLSA 1IS4A 1H6XA 2VJXA 4SBVA 5LASA 5L19A 3O0XA 5CKQA 5LRRA 1RUI1 4Q0PA 4XFIA 5F3CA 2HYXA 1XE8A 2ZMKA 4F7ZA 3V64A 5JSOA 3B94A 4LBOA 4QQOA 2J1TA 4OLLA 1U0AA 2GN3A 4QKNA 3M70A 2K0GA 4LOSA 1F5JA 4FPCA 1V6NA 4P9GA 1IPKA 2Z4FA 4B1MA 2QFEA 1NY72 4YM1A 4FPGA 4IXLA 1K3IA 4H14A 2XVLA 5FZCA 1LKNA 3SH4A 2JX9A 1C28A 2HWD2 3V56A 4RR3B 3KV5A 4HKOA 4OZXA 5I0TA 3IZOA 3EBRA 5C4WA 4COUA 4IESA 3GYDA 3OPWA 3PTRB 4HT1T 5H9QA 3QBQA 1AL21 2JKBA 2KD7A 2YY1A 4I0BA 4RQPA 4UT5A 1UYXA 3VN4A 5LRSA 4QQPA 3PUHA 3SCHA 4AI9A 3CBNA 4AZZA 4KWJA 2DU1A 1BCXA 2WR9A 1DQ5A 3N4MA 2JDNA 2PFWA 2B4KA 4N7UA 4CCEA 1VBB2 3MPPG 1F4HA 1KQRA 2V09A 4QD2A 4NIIA 3ZMNA 5BNOC 1CN1A 1W6MA 2C5DA 2R0FA 2VG9A 1O6UA 2BVBA 4JTNA 1SQ4A 2W39A 4QMAA 5I0DA 3N7MA 3KT7A 4YM0A 1QF3A 3GALA 3VB9A 2R6QA 1ZRFA 1LODA 1AR72 1OKOA 2XL7A 2WINB 2ZKLA 3K2OA 2XL9A 5EFUA 4ONUA 2FZ2A 1HQWA 2AGSA 1JYNA 1IOAA 2WFF3 2AR6A 1K5MA 2WNOA 4PIYA 3RVHA 3U0ZA 5GM0A 5F6LB 3T2PA 2ARXA 5FXZA 1GZTA 3NV1A 2IVIB 2RDNA 3F2ZA 4P9IA 3MIFA 3VBSC 3MZHA 5IFPA 2VQ0A 4IV1A 3ZXEA 1O3SA 5A1FA 5DUUA 3IAPA 4AAXA 2DCZA 4DXRA 2BBAA 1FX5A 3AC0A 2JDUA 3OGVA 4ATFA 2XGXA 3OJBA 3TN93 2VQUA 4KL1A 1JI6A 2RJKA 4F3JA 1V9U3 2CAVA 3LD8A 3J7MA 1IQDC 4K3UA 5LA2A 1WUVA 3O1RA 1OOPC 2VZPA 1QU0A 5FJHA 1ENQA 3GM8A 5ISLA 1IS5A 1K5MB 1JS9A 5I0UA 4B3NA 5IAXA 2E7TA 4EN6B 4NJ4A 3RGBA 5BNQA 1WLCA 4LITA 5J36A 4LO7A 3SH5A 2JENA 1OA2A 3I2FA 2R041 1LOFA 1UY0A 4UFKA 3PNAA 5TSWA 4CP9B 4ZHNA 1WZXA 4NPLA 3QLQA 2XPJA 1ZZCA 1CAWB 4LTAA 4XJWA 3OBTA 5E8AA 1FOD1 3PU3A 1QJX2 2WFF1 1W8TA 1I1EA 3MIBA 4IGPA 4BLIA 4FPEA 1REFA 2R042 4LMFA 4NOTA 1W9SA 3KV4A 3UYJA 5FWJA 1LOEA 3ILNA 4URTA 5C3OA 5KXBA 2PLV2 3TBDA 2VXJA 5FYUA 1Q56A 3GZEA 4Y4YA 2JB8A 4JKMA 2O8OA 1CESA 3VD7A 3VHOA 5B2GB 3N9PA 4WM7B 2ARBA 2E33A 1BEV1 5A6ZA 1N47A 3MFAA 1OOPA 1CGPA 4A42A 1BZWA 2ZAHA 1AF9A 3SNMA 4HLTA 1W2UA 2EAKA 1RC6A 2ZEYA 3I3QA 3O5SA 4RR3C 4HETA 1PIV2 5FYMA 4XMAA 4YG3A 4AYUA 4DMIA 1CIWA 2C0ZA 4IEQA 1NQJA 4FVVA 3FZ3A 5CFCA 1UY4A 2A5ZA 3OG2A 1TNRA 5L73A 5C5TA 1ODMA 4NAOA 2JG9A 3N36A 4E9KA 1UQXA 5DUXA 1V00A 4P9LA 5F5AA 5FZEA 1AR92 2QZ2A 2CL2A 5DMYA 4XVHA 3KB5A 4IE0A 4GIQA 2PHFA 5DZEA 1US3A 2HWE3 3UL2A 2W9XA 2XVGA 4Q4X1 4BWOA 1QGLA 4AE2A 1RUH1 1KJRA 5F39A 3CJXA 2ZTNA 4NAMA 4AHZA 1XC6A 3HEIA 2ZX3A 3ZDSA 2QE3A 1QJX3 5GLZA 1ZBE1 2Y0IA 4XW3A 4DUVA 2Q4SA 3AMMA 3D4KA 2OUHA 1N3PA 1V6KA 1XRUA 2Q1FA 1SLCA 1BMV1 4E27A 2XJUA 5H9SA 2UWCA 3R6SA 2QTWB 1URXA 1G9FA 3ZPOA 2DTYA 2C9KA 2F4PA 5A3MA 5IJRA 3QOPA 4M4PA 4MOAA 2PQSA 4FT8A 2BPA2 1O5LA 2QQWA 2KA3A 3HMYA 2XUMA 4FQZA 2DYCA 4Q4V2 1XNKA 4ZXEA 3WW2A 3WSOA 2VNRA 4IV3A 1PZ7A 4R9CA 4ZONA 4COVA 3MFCA 4R8HA 2J1VA 5FP9A 4TLFA 1NCRB 4FPLA 1SLLA 3AJYA 2ZGRA 1OFNA 3LEMA 1EAH3 5JIUA 3UV9A 4DFSA 5HBAA 1VAKA 1HRI2 3NMBA 4V2VA 4META 2J1UA 3T0AA 2E51A 4GULA 2VCBA 5F2WA 4EZ4A 2GP3A 5HCAA 4AR2A 3VD9A 1PO13 2CY6A 2YU2A 4E4SA 4ZU7A 1COV1 5LZ6A 1SFPA 1EAH2 1OQDA 2Q8CA 5FZLA 1TE1B 1SG3A 1H2MA 4KQ7A 1K12A 3LSEA 4GXLA 3R4UA 3D0JA 5BNPA 4JHTA 3RZZA 1LU1A 2QQJA 4LBQD 5BNOB 2J1RA 5BPXA 2L9LA 2VOVA 3FBMA 1UY1A 1ND2A 4CP2A 1Q3EA 4Z92B 2RV9A 2K2SA 4Y5TA 4IQPA 4PI0A 4EQVA 2G9ZA 3CU7A 4AFCA 1OURA 5FRAA 1I6XA 4CZSA 3KV6A 3LPFA 4P9JA 5FPZA 2BWCA 4XETA 1CWPA 1TEIA 1C1LA 2ORZA 4NIDA 1WD3A 1MS0A 4BQXA 2UYAA 2BOJA 1QQP1 2R062 4Z82A 1R093 3TYJA 1G86A 1DGRA 3WW1A 4XE9A 4CCCA 3MHZA 3R0RA 4YZ5A 2CWMA 1MEC3 1VBC2 1YCIA 5C4WC 3VUOA 1WBFA 4N9IA 1Y3TA 2JE7A 1OSGA 2ORXA 4HXCA 2DVBA 4Q5OA 1ENXA 4ZZ5A 5IT6A 2FHRA 4HZFA 4AGGA 4I09A 4BDVB 3RJRA 4XURA 3R4SA 3TAYA 1VPHA 3SC7X 2DV9A 1QQP2 3JQXA 5HV4A 2X5IC 2XLGA 1UYPA 4BYYA 3KVBA 3O0WA 4BIOA 4COYA 4HN0A 4HL0A 3RWNA 2VMHA 4K1YA 3H8XA 2NZ9A 3WLUA 1UYYA 3H7JA 4FCAA 3O1UA 2OPWA 1CJDA 4I3PA 4LO5B 2IC1A 5LBEA 4C90A 3E5QA 5BV6A 1G9AA 4XFAA 1ZYBA 2EIEA 4YGCA 3VBRC 5FY1A 1LGBA 3SITA 1X8EA 5FYSA 1OUXA 1F35A 4AOCA 1QOTA 4RHV1 1NE6A 2RS51 1AR81 3VZNA 1UX7A 3VDDB 4E4ZA 4CDUC 4AGRA 3KM5A 3S0MA 2VUCA 2V4AA 3JB4C 3RDIA 5BYNA 3ACLA 5FAXA 4RHV2 2D6MA 2DFCA 1YFYA 2R0HA 2R1DA 1MPXA 2Z5WA 3ENRA 4Y26A 5FZ6A 5GZEA 4YVWA 5A7OA 5JSPA 1OF4A 5ERLA 3WV6A 4RGGA 3ZFGA 4PLMA 1QXRA 2KR2A 1PGSA 2PYTA 4CCLA 1Z7S1 3IN9A 3KT1A 3AYDA 2VQTA 2B9UA 1RHI2 2ZX2A 3WQ1A 3I7DA 3HT1A 3NRUA 1JOBA 1RUD3 1WCUA 5FZDA 1WW4A 1JTZX 2JE8A 2E7AA 4LIVA 2XQXA 4UW6A 4Y20B 2G9GA 3UK9A 4AEDC 2B45X 4XJ9A 1K5JA 3TN91 4P00B 4W50A 2J42A 5JI7A 1NA1A 3TOJA 4ZU5A 2Q30A 1X7NA 1W8HA 2AUYA 1O91A 2CV6A 3WF2A 2ZEWA 4XHXA 4TXWA 5FZKA 2D6OX 5ANQA 1KRIA 4XQ4A 4CPBA 2FCVA 2ZGUA 1SLBA 3TN92 3DL3A 1LTEA 3S5AA 3ACIA 3NJYA 1PGW1 1H0BA 2ARAA 3IIIA 5JOZA 5FWEA 5T54A 3QH6A 3VDBA 4JV4A 2NYYA 3UJOA 3BTXA 3AVSA 5HXMA 3ZFFC 3CL1A 4EN8B 1EPWA 4GH4C 1RITA 2XBO2 4TYSA 4CP0A 4CXYA 4XC9A 4P14A 2BJSA 4Q0UA 1KD7A 1H4GA 5KHJA 2OX0A 1KFUL 1WCKA 4I3GA 4OHWA 3RZGA 4JC1A 5IVJA 5FYZA 1H8TB 2VZUA 4XABA 2O8QA 1ZZ6A 1MACA 2R32A 3N35A 2CTVA 3AJZA 1K45A 3FL7A 4XTPA 3INAA 2D43A 3POWA 3RWKX 2ES3A 3ME2A 4LK7A 2VPVA 4XFGA 5A70A 4GWMA 3R05A 5T3NA 3PTYA 2C4XA 2H6CA 1W9TA 3ALQA 4BZ4A 4JX0A 1MZ6A 2QUOA 1WLTA 2VUJA 5BNNC 4BQ1A 1RUF2 3VHRA 1DG6A 5FZOA 2YC4A 2OQ7A 1HRV3 3KLSA 3ZIXA 5K0UB 3NNLA 2Q5TA 4AQSA 3WZ1A 4FFFA 4FO9A 5BNNB 5H9PA 2XJRA 3WY6A 3ILRA 1H30A 1VBC3 3PVOA 3LCPA 3VBUA 1NYWA 1SHWB 5E1RA 4YPJA 3ACGA 3ZFEC 5JZGC 4UFMA 1RUG2 1UX6A 1VAVA 3EB7A 1ST8A 3KCCA 2OZJA 4LBQA 1SEFA 4GWJA 1NA1C 3VBFB 4D6RA 2D3SA 1JZ8A 1A34A 3KF3A 4PJYA 1C5IA 2X09A 1G9DA 4PBOA 3USUB 2LM3A 4I2OA 3EHKA 1BK1A 1OLME 1S0BA 4AK3A 1AX0A 4AAPA 4XF9A 5FZIA 3S57A 1ZA4A 2WC2A 1ZZ7A 2LTNA 3A0NA 2W1QA 2RS12 1UCXA 4H55A 2PN5A 2R061 3ZFFB 4A7YA 4S2GA 4ES8A 5C3RA 3DN7A 2NN8A 3ZIWA 2ZMLA 4I30A 1W05A 3N3HA 4CEYB 1HW5A 4AVCA 1RMU1 1MQTC 4XDPA 2FCUA 3AZWA 5A7QA 2ZGKA 5JOWA 5KR7A 1VIWB 2IXJA 2LALA 1C4RA 1UYZA 3ZYJB 3MIGA 1CZSA 4EN9B 5JMCA 1AVBA 1S2BA 5JXHA 4EWEA 3I97A 5H9RA 1LHOA 4LEJA 5D2AA 3LB9A 1XBFA 4XF0A 2P3KA 4Q4X3 2OA2A 5DDJ3 2OKXA 1JHNA 4Y22B 5EJ1B 1TMF3 3T2OA 4NO4A 3VHPA 1GZ9A 1OPMA 1S0GA 3H3LA 4N90A 4LOTA 1KS5A 1H1MA 2VD7A 4PHZA 1ZBE3 5GZGA 3THTA 1NCRC 1UIJA 2QQNA 2EF6A 2GH8A 3GJBA 1SMVA 3R4DB 1UU6A 3ASIA 2VGDA 5DAWA 4K9SA 5CISA 3AXDA 1AL23 1OI6A 3TNQA 2W95A 1WBLA 3BTAA 4MYEA 5FP4A 2RM22 1MQTA 1QXPA 1VBD1 1JMUB 3ACHA 3P3NA 1FATA 1NG0A 1Q43A 3DV8A 4YNIA 4YW2A 5CFDB 2CGPA 1A78A 2WS91 3JQWA 4QB6A 3WF3A 5FPUA 1BLZA 2GMEA 2ZX1A 4FPOB 5E89A 5F3IA 3ZFEB 5JZGB 4CYDA 1QIQA 2VM9A 3VDDC 3O14A 3DPRC 3NAPB 4C0HA 1D2SA 3I49A 1H9PA 4FTBA 1ULPA 4UWDA 3KGZA 2WSUA 4Y22A 3SXWA 4YG6A 2YG0A 2UURA 2EA7A 2VQAA 5GZFA 1UN1A 2YB7A 3OD0A 1V0AA 3NNJA 1W0NA 3LQCA 1PO11 3MW4A 2EIDA 1V6JA 1XSQA 4ASKA 3PVBB 4Q0SA 1QHDA 3S7IA 2XKOA 3POGA 2H6BA 2RS52 2VTXA 3M3CA 1MEC1 3FFZA 4CCMA 5A3PA 3L2YA 3MUZ1 4CEYA 1UOBA 2G9FA 5DDJ2 5A32A 1OHFA 1W3XA 4G4FA 2MEV3 1SZBA 4LKEA 2ZGNA 5FKCA 2ADEA 2WDBA 3WXPA 5IAVA 3B93A 3ZFFA 2BERA 5CIRA 3ZOIA 4CRQA 1D4M1 1KXGA 5F5QA 2IXCA 1JHJA 3DYPA 4I0WB 4QGLA 3J9SA 3Q8BA 4NIAA 2QQPA 5FXWA 2ETEA 3I2DA 4IEVA 3I59A 2GDFA 3VDAA 5IVEA 4MXWB 3C7GA 4JKKA 3IKWA 2Q0AA 3D0SA 3OB8A 2BV4A 1BJQA 2K9ZA 3I4IA 2VW2A 3LPGA 4N43A 3ZKYA 5C5UA 1HQNA 1QJEA 2LW8A 2QDNA 3ZM8A 3ZYFA 4PF1A 3JXSA 5FZBA 1CONA 3QH7A 5EIYB 3DGTA 4OFGA 3A23A 3D6EA 1VBC1 3ZXAC 4CDXC 1LAJA 4GH4A 5J7MA 1I5ZA 2EICA 1D7PM 4QQLA 4CDQB 1W8ZA 1GQHA 2RR12 3OY8A 3T09A 3U11A 5FZ4A 3BIWE 5FO9B 4IV3C 4P08A 1GNZA 1B09A 3VZMA 5EZWA 5HPOA 2Z42A 2GNTA 5GLTA 1UPIA 1W8NA 5LY1A 2ZS6B 1C1FA 1ND3B 4NHXA 2YBPA 3A22A 3WG4A 4LA2A 3KV9A 4C91A 1FOD2 1OH3A 3SEEA 1G9BA 1O8PA 1QEXA 5A1LA 4IE7A 2V5YA 5FMOL 4E4HA 4Q4V3 4KWKA 4FQ4A 4IGOA 5GKAC 2HWD1 1V9U2 3DKWA 4ZS2A 2Y64A 5KHIA 1LEDA 3WW3A 1U5ZA 2XR4A 3BOPA 1VBD2 4Q29A 4RL7A 5FZAA 2W92A 2YU1A 2UY8A 2PMWB 2Y6KA 2HWB2 4OVEA 5IATA 4WZCA 2F4LA 4GJYA 3T08A 3WP3A 3HN3A 5K9YA 3WQBA 5KC6A 3VBSB 1T2XA 3FMGA 1ULCA 4B7KA 5CB7A 1PMIA 5LBCA 3LEGA 3L2HA 4YW4A 2SBAA 4YFZA 5IVFA 4JGYB 2XONA 2PAKA 4K20A 3IAQA 3WNXA 3ZYHA 3ABZA 4MXWA 3AMNA 5F1RA 4HANA 3GHMA 5L7OA 2MEV2 4MVTA 5FMBA 1MVEA 2IXHA 2WNUB 3HQRA 4WVVA 1OMIA 1POV1 2VCMA 4QXHA 4OYUA 5SV5A 1FI2A 2BTVC 4YZ3A 5T5LA 3PUAA 4Q4W3 4JTOA 1S4CA 3CEWA 1W8FA 3ETPA 4DO0A 4ZKTB 4WVWA 1VBA2 4WVMA 1NCQC 1UZ0A 3OEBA 4KGQA 1CAXA 4YSFA 2W94A 1UW8A 4M0NA 4UBHA 1OUSA 2E9QA 1S0DA 3U4XA 4L9BA 2WS92 4KU8A 5LW9A 3POJA 1LRHA 1L7RA 1VRH3 4CSWA 5IK8A 4GA9A 3W5MA 4RHV3 3K77A 5FMCA 1ZBE2 2YMZA 2A7AA 2O14A 2VNOA 3J7HA 5IK5A 1UZVA 4ZY9A 4AI2A 2RR11 5C71A 2D98A 4PF5A 4TSVA 3VKNA 3BB6A 2WWSA 1PVC2 2HJIA 4RGAA 4RSUA 1JUIA 5LATA 4BQ2A 4I02A 3VZOA 1VALA 1UU4A 2H0VA 3UETA 1OA4A 5A7PA 3OEAA 1W3VA 2RS13 2A6WA 3HN1A 4JDMA 4LBKA 5FBJA 4HMZA 2WO3A 1OLMA 3SCGA 5JWPA 3JD71 3ZFEA 5JZGA 2CGNA 3ZPYA 1YIFA 4N9HA 2VUAA 5KHGA 1I5PA 2WZ8A 4LBMA 3IT8A 3N9LA 1CD3G 3HQUA 2RDRA 4JQTA 1RHI1 1LGCA 1QDCA 4FPHA 3D82A 4FI9A 3M1HA 2AEZA 3H3ZA 4Y33A 4A4AA 1DP0A 1YHFA 3EQEA 5F8PA 1TME2 2A3XA 5CZKA 3VGIA 3UNPA 1EUUA 4PBPA 2W1SA 1RUG3 1PZ8A 2RMU1 4JRAA 4Q4W2 1LEMA 1YC61 2ET1A 1XE0A 1DQ6A 1UY2A 1XE7A 3AKQA 1SCRA 1UKGA 4FOYA 3X29B 4CU6A 3CF6E 4YZ1A 1IG3A 1MEC2 1RUC1 1V6IA 4BMBA 3T0DA 1LJ7A 3ZSMA 1DQ0A 3OGJA 3UKNA 1FPN3 5L7OC 4Q4Y1 5GALA 3IDAA 5JXIA 3KCXA 3W9AA 3FC0A 4M3CB 4IE5A 1DQ1A 1AJOA 4ORFA 4XBLA 1QH6A 2A6VA 1PX3A 1BVVA 3NAPC 1QQP3 2HBUA 4JGYC 1D4VB 2XB6C 4XAEA 1AXKA 3J8F2 3EJKA 3TRSB 4DPNA 2HWB1 2JG8B 1BQPA 3H50A 5GZCA 1COV3 3VKMA 4AI8A 2A75A 1PVXA 1ULGA 1W2OA 2RJ2A 3MV11 3ON7A 4NWVA 4OI1A 3WUDA 3ZYIB 2JDYA 3AKTA 5GLWA 2R1BA 1P8JA 4ZZ8A 1W28A 1NXMA 1OQ1A 5LCWL 1UMHA 1AYM1 3LFMA 3OUIA 2D3RA 4B4QA 1W8UA 2CYFA 2WAOA 3LA2A 1G6NA 1O3RA 2A6XA 4KWUA 1BVP1 3K46A 1VMFA 4QHOA 2GC1A 3TB0A 3VBHB 2FDGA 2I07B 3AXEA 3DXTA 3KMHA 1A8DA 4R4XA 1H6YA 1ULFA 1WLDA 5FYYA 3OGSA 5JIAA 3LDBA 1JYXA 4BH9A 1NQDA 4P5YA 4B1LA 5C9AA 5IHRA 1XOYA 1ND3C 4MHUA 1H2KA 2ZGPA 3EO6A 1PO22 3W58A 1E57A 4A6OA 2BFUL 1AYN1 2A71A 3ZSKA 3UKVA 2SLIA 5K0UA 3BODA 4FTEA 2WLPA 2ZHKA 4YVSA 3OBAA 3ZN5A 5BNNA 1DYKA 5CVRA 4P02B 4CEYC 4QGMA 1S55A 4C1WA 1UOJA 2IFWA 1OVPA 3LOBA 4FXKB 1F15A 1QXJA 1HIXA 5JAXA 4GAZA 4Q27A 4ZPIA 2MNGA 2IXKA 2CGOA 5APAA 2GZWA 1UO9A 3H8UA 5LK7B 1DGLA 4LLOA 2WZEA 1JZ2A 1PK6B 2VZVA 1VBB1 3VD5A 3D5OA 4IEYA 1MS1A 5E6HA 2GC3A 3H3UA 2VBDA 1HN1A 1UXZA 2VVEA 5B4XA 3RYKA 4PIXA 3WG1A 1LOFC 1KDMA 2VC9A 1ONAA 3F95A 2TUNA 3T4HB 2WS93 3T3YA 3WDUA 4CCJA 1N1VA 1VRH1 5A6XA 4K7JA 4W8JA 4M4RA 4OCTA 3NNFA 2R16A 1NAEA 2P4EA 3JCIA 3WT3A 1X33A 1JYCA 2JICA 4RFT0 5CNAA 1FOD3 4L11A 4UOJA 3LA3A 4HK8A 1PVC3 3LFIA 5C7GA 2RJLA 3AP9A 2XWBB 1FNZA 2YFZA 5GZDA 3ZYBA 3LSDA 3PMEA 4FOWA 4XPVA 1RUJ2 2XJTA 2Y6JA 3JD73 1VRH2 4BK4A 1Q8VA 1RVF2 5HCBA 4DS0A 4YGEA 5JSRA 5A3LA 2BZDA 3P6BA 4QAWA 1NKGA 1R081 2WWUA 2G4IA 4PI2A 4DXZA 2D5FA 3RFRA 2Y8KA 3DPRB 5K7PA 5CFCB 3WQ0A 4LORA 3M2MA 4EROA 1FAYA 1XPWA 3B5LB 1IKQA 2E26A 4YGDA 4XDQA 1OXCA 1RUH2 3ELNA 3Q9OA 3U4SA 1XNBA 4BXSV 3AMPA 5CG8A 1O3QA 4TWTA 3MIHA 4YVWC 5FY7A 4WM7A 4X6QB 4XTMA 2VUDA 5L9VA 2WQ4A 4NPRA 3RRDA 1GQPA 2A3YA 3NJZA 4IE4A 3JBG1 4WBBA 1FPN1 5EYYA 4FAGA 5IFTA 3MLKA 1CR7A 3O7OA 5IW0A 2JJ6A 2VVFA 4CXWA 3FWEA 2JG8A 4QHBA 1QY4A 1Y7BA 2BNOA 4JGZB 4CP1A 4XILA 2DCJA 1CJPA 2Z79A 1C3HA 3KVAA 4XFFA 3WNPA 5FYIA 4AWDA 4DUXA 4YM2A 4LULA 1JU4A 3TWIA 3HVDA 4G9SB 3M3IA 1W6QB 1EAH1 1FNYA 2JDMA 1VP6A 3B9CA 1DCSA 4BA6A 4ASLA 4R9AA 4A7KA 1Q8PA 3C7FA 4RD7A 1PIV1 2J1AA 3FBYA 2DVAA 1BYHA 2ZX0A 3BPSA 1AL0G 1W6OB 1XU1A 1YNAA 4XUOA 3C3VA 4XQWA 5D21A 3AZXA 3B7MA 5DABA 5LEKA 1MQTB 1PMHX 4A2UA 4H3WA 1MZFA 2ZZQA 4RYDA 3PDQA 1GOGA 2DVGA 4Y1YA 4KBZA 4XF1A 4DXTA 1WW7A 4EYUA 5CKNA 4OHXA 1SLIA 4CDXA 5DZFA 4XEZA 2Z69A 3U14A 4LHLA 3LIGA 3E6DA 4JHZA 3ZN6B 2VCAA 2W3JA 2BQPA 5DUWA 3OBRA 2IZWA 4J6GA 4NRMA 4UXAA 4E4DX 4AL9A 1R1A3 3E97A 4MV2A 2D3PA 4O7XA 3VL9A 3PUIA 1SCSA 2RVAA 4O9EA 1UY3A 4Y1VA 4CDUB 3TNPB 3AKPA 2RS53 5IVYA 4WVZA 3RG0A 4D6QA 2I45A 4DXSA 2ZEXA 4QX1A 5FZ7A 3J7NA 3VBRB 3OOXA 2ZACA 4NE9A 5FKBA 5JVVA 1OLRA 4D94A 4OUMA 2G1MA 2YV8A 5J3UA 2DVFA 2PHTA 5A6QA 1GUIA 1XB9A 2RMU2 5J09A 3GBGA 2HWC1 1XNCA 1YJKA 1O8SA 2X5IB 4FFGA 3ZYRA 4P9WA 3UGHA 5IK7A 4IEUA 5C8CA 1LCLA 1PO12 2XLAA 3B69A 4Q4V1 2WAAA 4FAHA 5CG9A 4BM8A 4IEWA 3UGGA 1ASJ3 3IBMA 1WMFA 4CE8A 4L99A 5FO8B 4RQPB 4XJAA 1CIYA 1PM4A 5L9RA 1QJY2 4K8FA 3P5BA 2B9VA 5HCFA 5C4WB 4GZ9A 4TLGA 2WRAA 4IW3A 4JZRA 4H7LA 3BTYA 4RR3A 1YIPA 1TG7A 2YHJA 5IVCA 1C8M1 3CIHA 3NW4A 4AGVA 1PVC1 1UOFA 1XQNA 1DQ4A 3LOIA 4YVSC 4HOOA 3VBUB 1NOVA 3WD5A 4OUEA 2D93A 1X36A 2EVXA 2VMIA 1IPSA 5E16A 4ZU4A 1I3HA 2VULA 3UGFA 4E2GA 1VLNA 2CSGA 4XOGA 2H0BA 3PURA 2ZGTA 3O1OA 3UT0A 2ZZJA 4WV8A 2NMNA 1LOCA 3GDBA 3VBOC 1Q5OA 3K4DA 3THCA 1F8VA 1DGWA 2TBVA 1LECA 4P9YA 5T52A 1QOOA 1OBNA 3GJAA 4K8RB 4HPKA 1QNWA 5IVVA 4A41A 5EJZB 3J8F3 2V72A 3FHIB 2XDVA 3I8TA 3T30A 5FY8A 1VBD3 3WDXA 2FDJA 2O0OA 2RMU3 1YFUA 1QJFA 1D0GA 4AEDB 2VMDA 5EV7A 2DUOA 3GGLA 2ZAAA 4BQYA 1O3TA 4QPGC 3S5QA 3WX5A 5DZGA 4F83A 1FYUA 2RHPA 2PQQA 3HR9A 2F6BA 2IVJA 4WM8A 3SCFA 4CEWB 4EZHA 4LBNA 1ENSA 3RI9A 2GP5A 3OY8B 3CZUA 5JLVA 1NLRA 3AVRA 3E5XA 1NE4A 2C24A 2ZX4A 4FPKA 3CHXA 5JCTA 2I2SA 3GCXA 1HXS2 4LO4B 2Q1MA 2ZPXA 1VMJA 2GALA 4LHKA 1RUF3 3ZR6A 3E1F1 4DY3A 2DUQA 2JDHA 4H2AA 1W9WA 2AACA 3OD4A 2OVUA 4N8MA 1AYM3 5T50A 1W6NA 5CFCC 1QJX1 2XQRA 4CTEA 3ZYGA 1GKBA 1GOFA 3NQHA 5DAPA 4SLIA 1UNBA 5JPMB 4QWNA 2Y6HA 1SACA 3FFQA 4UF0B 4Y24A 1CAVA 1SDDB 1UXXX 3C7HA 2DU0A 2P3JA 5FP8A 3H8RA 2FMYA 3IMMA 2RDSA 1NXD1 1HJGA 4LA3A 1F2NA 4AFAA 5A32B 2Y6LA 2IXLA 4JAAA 1RB8G 4DQAA 3G6JB 3JD72 3AL5A 3OBZA 3U75A 1WCDJ 2DURA 2QQOA 1O4ZA 1JBCA 1OFSA 2OUJA 4AW7A 5A3UA 4W6WA 1FXZA 1JXNA 4AEKA 5FQ0A 2WQ8A 2ATFA 3EMRA 5I93A 1FT9A 2ERFA 4MHRA 1AYN3 1BK0A 3U1XA 4RS5C 1AX2A 2E32A 3W5NA 3O1VA 4LKFA 3FJSA 2FCTA 1JOJA 4OQ8A 2FD8A 4EJRA 2GC2A 1HB1A 4S2HA 3AKSA 4IEOA 3NAPA 1U5YA 1DQ2A 1M06G 2J1EA 5FYVA 2HEWF 2OPKA 5ACA1 4C0BA 4Y1XA 3K75B 3ZSLA 2JXAA 4HVRA 4ZS3A 1JYWA 2V4VA 3HPNA 1H1IA 1UD1A 2HWC3 5F3GA 5F7UA 5CFDA 3AZVA 2XHNA 2VBPA 1GNHA 5I8SA 4NPMA 1C5HA 5F5CA 1VBB3 4NIGA 4WM7C 3UJQA 2JDKA 3GZTB 4D8MA 2XBO1 2Q1ZB 4IERA 1PGL2 1B35A 4KI5M 1YJLA 4QQHA 1QKQA 3WF1A 1EV12 4UFJA 3OCPA 1FMD3 5F5IA 2VL4A 2CWSA 4XMIA 4EN0A 4IV1B 5FZMA 2ZHNA 1PGW2 4CDWC 2BP6A 3HNMA 4Q8KA 5JXJA 1B35B 4LBLA 1ULEA 1KFXL 5FK8A 2R7EB 1RUI3 4LKSA 4UW4A 3BU7A 4AVBA 4XBQA 1IQAA 2FMDA 1ZREA 1C8M2 1U5XA 4M3CE 2NPIA 5FLIA 3DF0A 1PHMA 3WQ7A 1AR93 3N9NA 4AVTA 2D6LX 2WFPA 2E31A 5FFOC 3G7DA 1Y9MA 2QDRA 1G8WA 3AP6A 2XJPA 3M3OA 4QDQA 4E2SA 4XIKA 1V6LA 3H9AA 5A7NA 1CVNA 2IWGB 4IEZA 4HVQA 2JIJA 4Z2WA 4RA0A 2DFBA 4AFDA 3I2GA 4RFRB 3PJYA 3H1MA 3WCSA 3IDCB 1PIV3 3LDKA 1LHWA 1BEV3 1UU5A 3THPA 3U37A 3UKTA 5ABJA 1VBE3 1TMF2 1A6CA 1CPNA 3HBZA 3O0VA 4MX3A 3H1YA 3HNYM 5A7WB 4B4RA 2XUEA 1NZIA 4YZ4A 1W2NA 1RXGA 1H2LA 3FN9A 3POIA 1UZZA 5T5JA 3GZUC 2C26A 2ZGQA 1DU3D 3VBFA 1RGSA 2A6ZA 2ZMNA 4LUMA 4GB32 5FZ1A 3SKVA 4AI1A 4LBQB 1R64A 1UZYA 2ILMA 1O5UA 2W0XA 4XBNA 5FY0A 4J1WA 4KBBA 5DUVA 2QKDA 4OHZA 1OD5A 5I0RA 1RIRA 1OLQA 1R092 1HV1A 3JBG2 4CU8A 4LBJA 1LGNA 3NKTA 1AR71 2BDRA 1W9YA 3Q8CA 1SBFA 1GR3A 1OH4A 3ILFA 1B35C 3LF7A 1YQ5A 4M0HA 4IV3B 4IV1C 1QWRA 3AFKA 5FZOB 3JU9A 4OULA 4CDQC 2VTXJ 4IUGA 2WNEA 3NSTA 1R1A2 4BIFA 3NO8A 2WO1A 1WMEA 4R4ZA 1CQ9A 1GWKA 3KSCA 1LENA 3BUCA 3LDRA 4YM3A 5IWFA 2XVKA 1JN2P 1HQLA 3K48A 5L36A 2RE9A 3N9MA 4WM8B 1STMA 3PMSA 3LGRA 2A1XA 2A3WA 4JRLA 1RUJ1 1ZVFA 1RUC3 5F37A 1ACCA 1ZZ9A 4LR4A 3IDBB 5C70A 1WGPA 4RGKA 1XNTA 2JECA 2XJQA 1RTVA 1QOSA 4QPYA 1AYM2 4R9BA 2DBNA 4XXPA 5FDBA 1ZZBA 3MW3A 4CCNA 4HPKB 1NY71 1HV0A 4NHKA 3ORJA 5EPAA 4Z8BA 2AEYA 1GU3A 2BNNA 1BBT2 3GBFA 2VOKA 1OVSA 2BFUS 4KU7A 2BNMA 1LB2A 3U78A 3O1TA 5AFEA 1HDKA 4QX2A 2Q8EA 2JIGA 3DYOA 3I2JA 4CU7A 2D40A 3T0BA 1DZTA 2WJSA 4HSLA 4FPYA 4KG8A 4QX8A 4XCBA 2R30A 2JG9B 2VO5A 5F32A 3RMYA 1DIWA 2BU9A 2D7FA 4Y5Z0 4KG0A 1L3JA 2WNUC 1UMZA 2ZEZA 1HRV2 2E63A 3ECQA 4EN7B 1K5MC 1POV3 1W6NB 4QX7A 4UYBA 2YZ4A 5A3OA 1RVF1 2P6HA 1RUE3 1GYKA 2GU9A 2XH6A 4IE6A 4UBGA 4A44A 1OOPB 1TME1 4N53C 3RZLA 5CFDC 2ZGSA 3VD4A 1BKZA 4NRPA 2BEOA 2BUKA 2HWD3 1BXHA 2W08A 2VZTA 4NWWA 4AQ6A 2FDKA 2C1FA 3DXUA 5ABJB 1HRI3 4W6YA 1LESA 1JH5A 4B7EA 2X5IA 2P2KA 1W39A 2PHWA 2W1UA 1Q8SA 1E5HA 4DOUA 4E2QA 2V73A 1RXFA 1CAWA 3KCYA 4CEWA 3CNAA 3VDDA 4AG4A 2WZR2 2EXKA 2GH2A 3MEPA 2PLV3 1RJ8A 1UIKA 3KD4A 3RI8A 3HJRA 4B29A 1RUH3 5FO7B 2PHXA 4FPJA 4AEDA 3MBWA 4E8DA 3HAGA 2ZGLA 5FLJA 5EWSA 5A80A 1QJY3 4NMIA 4DRVA 2Y34A 1EUTA 4QPIC 1VBE1 1DLLA 3RQ0A 3WF4A 1LHNA 1RJ7A 1YFXA 2W46A 3BYWA 2VOXA 1WMXA 3H7YA 4LHSA 4KWLA 4GD4A 1IG0A 3BALA 1WD4A 4MGSA 3S6PA 4YARA 3PIGA 2HWF2 1Q8QA 2LRPA 4XFCA 2XLFA 4K6BA 4CDXB 1UAIA 3J7LA 4C1XA 4JQRA 1ZM1A 4YW3A 1OC1A 5KWRA 3VBUC 4QKBA 4Y5SA 1CZVA 1W6PA 1S0CA 1VBA3 4MGQA 5LBBA 4AFBA 1J83A 5I91A 2D5HA 1HXS1 2XWJB 4FP2A 1PNGA 2WA3A 3NV3A 4Q26A 4X8PA 2WWJA 3DUIA 1DZQA 4Q8LA 4YZ2A 1H2NA 1OT5A 3TEZA 1IS3A 3ZKUA 4MZUA 2WZR1 3K3OA 1TMF1 3POFA 1RUI2 5BUVA 3C2UA 5I8YA 1D0HA 1PM7A 4IGQA 2W68A 1Z7S3 5A7WA 3AP5A 3N9QA 5LBFA 5J37A 4YYOA 2BBVA 2X05A 1KDKA 1Q8OA 3ZXJA 2O1QA 5LWBA 5K0UC 3ZN4A 2IFRA 3AYCA 3LEKA 5BNPB 3IDEA 1BHGA 3K4ZA 1LR5A 1HB4A 2HWF1 3GCWA 4RS5A 3OYWB 3V0AB 3MUY1 1U12A 2AH2A 2RR13 3Q8FA 4O65A 5GLVA 1CAVB 1RMU2 1YQ6A 1WW5A 4TN7A 4UF0A 5IVBA 2Z2SB 2NMOA 1REDA 1AR62 3E5UA 5AC93 5FXVA 2C9AA 4PDWA 2JE9A 3DPRA 4D7SA 1BBT3 1ULDA 2CNAA 2YFUA 2DDUA 1R1A1 2WBKA 2VZRA 5D8AC 5T5OA 4DEQA 1W9FA 2HEYF 5D1IA 4OQ9A 3WDYA 1OF3A 1SBEA 2OXBA 4AI3A 5FZFA 3RZMA 4LHNA 1DFQA 4MGKE 4AHWA 1WW6A 2EIGA 3ZFGC 2DWRA 4D7YA 4D0QA 4YG0A 5CEHA 3M8LA 4FP3A 1ULOA 4LE4A 3TEWA 2YPDA 3NV4A 1YRZA 1YFWA 3VKLA 1Y43B 2PHLA 4CEWC 2P1BA 1QNYA 1W6OA 2DCTA 3POEA 5FIXA 1HB2A 1VAMA 3IIAA 4K21A 4OHVA 4R9DA 3I3DA 4A45A 3SHRA 5A7SA 1YWKA 4DB5A 4O61A 4OI4A 4ES9A 5EYXA 3ZVXA 4GWNA 2BVVA 1GFF2 1W6QA 1GSLA 5EXOA 1QJU3 3HQXA 3RYPA 1HRI1 1BEV2 2JD4A 1ZBA2 4N53A 1DYOA 2XJVA 2TNFA 2OT7A 1CX4A 3NNGA 1MS9A 3MDPA 1AR73 4JGZC 4MH0E 3VBOB 4HG6B 4GKXA 4HFSA 3POSA 2HLEA 4EE2A 1L7QA 4Q0VA 1ZRDA 5A3NA 1W99A 2MPFA 2JWPA 3CJIA 2HWE1 3SISA 4BXFA 4FSJA 5JOXA 2VU9A 2NLRA 3HT2A 4HK9A 4LE3A 3H8OA 1Z78A 1ENRA 4GMP3 5FUPA 4DNYA 3HWJA 4BQ5A 3O1PA 3FUOA 4YVSB 4OMDA 4QQ2A 3NKGA 2VMFA 1D2QA 2Y38A 2F17A 5KHHA 3W20A 2Y6GA 2ET7A 3T4VA 1PX4A 2TEPA 2XBO3 1LOBA 2YROA 3ZMOA 5J98B 1KGYA 1MS4A 3C8XA 3Q8EA 2X29A 5C3QA 3O1SA 2AREA 1RUJ3 1XNDA 3MPBA 4U36A 4U2AA 3SH3A 4J1XA 3TEXA 2VXRA 2GSYA 3ETQA 3FLRA 4FOVA 1A8MA 4QKFA 2QQIA 2Y60A 1JYTA 4XUPA 5FCCA 5A1AA 5IK4A 1N3OA 1AXZA 3CKHA 5A3WA 2ZCWA 5C8CB 1I9RA 2D6KA 4Q4X2 3AX4A 3RJ2X 2BGPA 3M3EA 4COWA 1U5IA 1AUYA 2BOIA 1SDWA 3CJIC 3MYXA 4QX3A 3HOBA 2XG3A 3BCWA 1AR91 2JKXA 2W47A 4LUKA 1ALYA 1DHKB 2WN3A 3MI8A 4YW7A 4AHXA 1KITA 4CDWA 2R071 2GMMA 3RZKA 4CP9A 1ZBA3 1VRBA 1RUE2 3OTFA 3BVCA 1A3KA 1DZRA 4CU9A 1C57A 2WKKA 4IEXA 1YXWA 3S7EA 2WT2A 4A3XA 5ACA2 2YGLA 3VZJA 5J1XA 5JR2A 3VBRA 4LJHA 5FR3A 1GANA 4LIUA 3H1WA 2ENRA 4XJ8A 1MZ5A 4UFIA 3Q8AA 5HV0A 1EV13 1H8TC 1UF2C 1YLLA 1HN0A 4QPGA 2WO7A 4NR1A 1PK6C 1ASJ2 2JDZA 2QNKA 4NVPA 4AHYA 4A7ZA 2FBEA 1QMJA 2RS31 2FDHA 3MICA 3AZYA 5CKMA 4GWIA 3ATGA 3AMQA 1J84A 4BU2A 4YFWA 4GJZA 1QJU2 1R082 1IGOA 3EYPA 3LEIA 1KEXA 2EXHA 5AFBA 5JXGA 4XUQA 2VW0A 4ET7A 3MGUA 1IHMA 3GZAA 1BBT1 3N7JA 4FTSA 3ITQA 2PXJA 3U10A
chains in the Genus database with same CATH topology
1SPPA 5CKNA 1SZBA 3POEA 3POFA 3POBA 4LORA 3KQ4B 5CKMA 4LOSA 1NT0A 4LOTA 2QQKA 2QQLA 3DEMA 4LMFA 1SPPB 1NZIA 3POJA 2QQMA 3POIA 5CISA 1SFPA 2QQOA 4GZ9A 3POGA 5CKQA 2WNOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SPP A;  5CKN A;  1SZB A;  3POE A;  3POF A;  3POB A;  4LOR A;  3KQ4 B;  5CKM A;  4LOS A;  1NT0 A;  4LOT A;  2QQK A;  2QQL A;  3DEM A;  4LMF A;  1SPP B;  1NZI A;  3POJ A;  2QQM A;  3POI A;  5CIS A;  1SFP A;  2QQO A;  4GZ9 A;  3POG A;  5CKQ A;  2WNO A; 
#chains in the Genus database with same CATH topology
 2B5H A;  2VY0 A;  2R49 A;  1XYP A;  3WNK A;  1PZ9 A;  1HB3 A;  1FV2 A;  1GWL A;  1SFN A;  3LE0 A;  5LEJ A;  3OUJ A;  1GQG A;  2D6N A;  2GMP A;  3VBH A;  3WIN E;  2WNV B;  1W6M B;  1LOA A;  2IUW A;  3ZX7 A;  2XHK A;  3WOG A;  4N43 C;  1YQ2 A;  3CDZ B;  1PMJ X;  3VV1 A;  3T2Q A;  2XML A;  2RDQ A;  1DDL A;  2ZJC A;  5FZ3 A;  3NV2 A;  2CHH A;  1CAU B;  1X50 A;  5DG1 A;  2HYK A;  3MLL A;  4Q4Y 2;  4QM8 A;  1JZ3 A;  2CU5 A;  1OD3 A;  3RNS A;  1CAU A;  3JBG 3;  1JZ5 A;  1S2E A;  4ATE A;  3PUQ A;  1YYN A;  1SPP A;  5FP3 A;  2E6V A;  3WNN A;  3PVE A;  4LLF A;  4BCU A;  4IEP A;  3FLP A;  4LQR A;  2QZ3 A;  3PJQ A;  3QCW A;  5KHK A;  4Q0Q A;  5LA0 A;  2P5B A;  3POB A;  4Q4Y 3;  2WNV A;  4CDU A;  4AF9 A;  2CDP A;  2FDF A;  1HXS 3;  3MIE A;  1G7Y A;  1QH7 A;  1R09 1;  2A73 B;  3C7E A;  2BWA A;  1N1Y A;  2WNU A;  4NRO A;  4S2F A;  5JPN B;  4FFI A;  3B02 A;  5L7O B;  1DF0 A;  2DTW A;  5J48 A;  3ZN6 A;  4LKD A;  1WMD A;  3T1M A;  3EXU A;  4GB3 1;  1IKP A;  3WNO A;  4PT6 A;  4YW5 A;  1DYP A;  5AVP A;  4AI0 A;  1LU2 A;  4URA A;  3W21 A;  4CUA A;  3KWV A;  3VBS A;  1LHU A;  3URF A;  2CDO A;  3J26 N;  4D6S A;  1SLA A;  2UWB A;  4YRD A;  3ACF A;  3RSJ A;  1IZ3 A;  1F9K A;  5C33 A;  4BHP A;  4DUW A;  3HBK A;  2W87 A;  2YUE A;  4G3Y C;  1N3Q A;  3ZLI A;  2EAA A;  1GP6 A;  1GP5 A;  4IND A;  1DLC A;  5FPB A;  5JUV A;  1H9W A;  3IPV B;  3POY A;  1TME 3;  4MSV A;  5E88 A;  2VBB A;  4LT5 A;  1GZW A;  3WP4 A;  2FZ1 A;  2Y33 A;  1YO8 A;  4PDW C;  4KH9 A;  4UFH A;  2YGM A;  4JKL A;  1JYV A;  3KQR A;  1F4A A;  2VW1 A;  5C6C A;  4NHY A;  4YW1 A;  1W2T A;  1ZZ8 A;  1PK6 A;  2VVD A;  2WT0 A;  3MID A;  4GKY A;  1OPO A;  5DQ0 A;  4JGZ A;  4GAL A;  1FPN 2;  5F9T A;  5FJK A;  5C3P A;  5SV8 A;  5KXD A;  4R52 A;  1VJ2 A;  2ZXQ A;  5FYH A;  4Q1P A;  2W52 A;  4NUB A;  5FYT A;  2EXJ A;  4DEV A;  1GP4 A;  4HVO A;  4BME A;  1X9P A;  2VZO A;  4HN1 A;  3VZL A;  1WA6 X;  5G05 L;  4BQ4 A;  5M0T A;  3MF6 A;  2WSV A;  2OYZ A;  4FXG B;  1W03 A;  2VMG A;  3ZXL A;  2GAU A;  4QHZ A;  3SQO A;  1KS4 A;  2D97 A;  2MHF A;  5FZG A;  2B42 B;  1SBD A;  4H7M A;  5LY2 A;  1W0O A;  4EWD A;  1AR8 2;  1EV1 1;  2XJS A;  5FPX A;  5DXD A;  1US2 A;  4QGN A;  4QPI B;  5FP7 A;  5FYC A;  4XAA A;  5A33 A;  5EHD A;  1PGL 1;  1TZO A;  1GLH A;  2PA7 A;  1ASJ 1;  3O1M A;  4Q4W 1;  3LA7 A;  2RS3 3;  2ZOE B;  4Z07 A;  3LAG A;  3T2T A;  2QBX A;  2GNB A;  3PLQ A;  1HX6 A;  4PLN A;  1S2K A;  5AVA A;  3ZXD A;  2VCC A;  4Q1R A;  5I8T A;  4QDS A;  3VBH C;  1AJK A;  5FXX A;  3IWZ A;  2VME A;  4DZG A;  4N7I A;  5F6K A;  2VZ3 A;  4QPI A;  1C8M 3;  4HON A;  4XFH A;  1J58 A;  4BPZ A;  1N1S A;  4AVV A;  1JZ7 A;  2LS6 A;  1PNF A;  2E7Q A;  3CLP A;  5ABJ C;  2X53 S;  2QQK A;  3C7O A;  1D4M 2;  1TVG A;  1E5S A;  2EIB A;  2XXZ A;  4XUT A;  2XOM A;  3ROU A;  4A6S A;  1WA4 A;  4GQ7 A;  2AZ5 A;  4MXV A;  3GF6 A;  1YEW A;  1SLT A;  4QU1 A;  4BLJ A;  1MS3 A;  3BKZ A;  1AHS A;  3GHN A;  2VAU A;  2VNV A;  2VOT A;  3I3E A;  3K4A A;  4CA9 A;  1T6B X;  3V0B A;  3U07 A;  4CUG A;  2W2I A;  1XYO A;  3QD6 A;  5CYY A;  4ASM B;  5C3S A;  1WKY A;  1ZRC A;  1GZW B;  1LOG A;  1V70 A;  1GV9 A;  3N7K A;  4NHL A;  5FPA A;  3RS6 A;  1APN A;  1ND3 A;  2PTM A;  3PIJ A;  3A4U A;  3MW2 A;  5JOY A;  1HLC A;  2BGO A;  2GND A;  1X9T A;  1R1Z A;  3AZZ A;  4KNC A;  3WDW A;  4QB1 A;  1UZW A;  1RUG 1;  5FV3 A;  2P3I A;  1ZRI A;  2ZBJ A;  3KF5 A;  4W4Z A;  1O4Y A;  3GBW A;  2B46 X;  3NJX A;  3IM0 A;  4NN0 A;  4WZF A;  3HNB M;  4CDQ A;  5A6Y A;  2KXL A;  3TEY A;  2Y0O A;  2ARC A;  1FMD 1;  2VEC A;  5LA1 A;  4AEJ A;  1W06 A;  1GWM A;  4QX5 A;  3USS A;  3WR0 A;  5JR7 B;  1COV 2;  5BXX A;  1NLQ A;  2AEN A;  3NJV A;  4QXC A;  5C9A B;  4XIO A;  4DIN B;  1ODN A;  3PL0 A;  4QDR A;  3ZSJ A;  5JDB A;  5FY4 A;  4J25 A;  3OPT A;  4YGB A;  5DDJ 1;  3MLJ A;  3B01 A;  5FYB A;  3SLI A;  1VMH A;  4K1Z A;  3I59 B;  4QT6 A;  4XAC A;  5D8A A;  3APB A;  4PDW B;  3BI3 A;  3I54 A;  4WM8 C;  4YW6 A;  1EP0 A;  4M00 A;  2B7Y A;  3NVC A;  5FLH A;  4AQ2 A;  5C9A C;  1MS5 A;  1XSR A;  2J7M A;  2OW4 A;  3N7L A;  4UAP A;  2OZ6 A;  1EY2 A;  1SPP B;  1Z0H A;  2JEM A;  5GJ6 A;  2FDI A;  4RS5 B;  1JOP A;  1XXN A;  2R07 2;  3V0A A;  5FTT C;  5LK5 A;  2ZGM A;  4QM9 A;  3VKF C;  2FQP A;  1Y9Q A;  2WFF 2;  2HEV F;  4ISQ A;  4AVS A;  4OZO A;  1NX9 A;  3NL1 A;  5CAZ A;  4Y4R A;  3MV0 1;  5G04 L;  4ARX A;  1IPJ A;  2UY9 A;  1J3R A;  3OUH A;  1NCQ B;  4QX0 A;  1QJU 1;  4WVM B;  1JYI A;  3PVN A;  4JVA A;  4MO3 M;  2KM2 A;  2ZHL A;  3FX3 A;  1YQ8 A;  4UFL A;  1H4H A;  5HXV A;  1X8M A;  3VD3 A;  3WW4 A;  4W65 A;  4UW3 A;  4MGZ E;  1YUD A;  1UKR A;  5EQU A;  4M3C A;  5FY9 A;  4A3Z A;  2A70 A;  2DUP A;  5FZ0 A;  3WP6 A;  4O9G A;  4BE3 A;  3USU A;  3KT4 A;  3I2O A;  1YQC A;  5ACA 3;  4JGY A;  2QQU A;  1J1T A;  1J1L A;  1L7L A;  4I01 A;  4JDO A;  2RM2 3;  3ES4 A;  4XCA A;  5FZ8 A;  5CBL A;  2VMC A;  5KBF A;  1W6P B;  4YLZ A;  2BRT A;  2HKX A;  4Y1U A;  1RUD 2;  4XZU G;  2E53 A;  1CZT A;  1QJY 1;  3NWK A;  4FFH A;  3AYA A;  5I0S A;  3DKQ A;  5K8S A;  2ADD A;  2WZR 3;  1CPM A;  1J3P A;  4IL7 A;  2Y26 A;  4V1P A;  4YWA A;  2P6C A;  1W0P A;  1PO2 1;  2DVD A;  4GMP 0;  4DRR A;  3BU0 A;  4PCR A;  1UOG A;  3AM2 A;  1RUD 1;  3S30 A;  3H42 B;  4Z1V A;  5T55 A;  3THD A;  5CU1 A;  2LRO A;  4B4P A;  3NNM A;  3CO2 A;  4ZXK A;  4ITC A;  2DBI A;  2VE1 A;  2HWC 2;  3E6B A;  2WNV C;  3W59 A;  1GZC A;  2OQ6 A;  3AP4 A;  1N1T A;  2WT1 A;  4QPG B;  4XF3 A;  5FPL A;  3WF0 A;  2W91 A;  1H1A A;  2JDA A;  1GIC A;  1OQE A;  3A7Q A;  4CXX A;  1AR8 3;  4Y1Z A;  1S0J A;  5FBZ A;  2HWF 3;  5FZH A;  4L2N A;  4D7T A;  3V0B B;  1NUK A;  3B00 A;  4IET A;  1HKD A;  1RL3 A;  1NZC A;  2ZKN A;  4EV0 A;  1G9C A;  1OKQ A;  1FMD 2;  3AL6 A;  3KS7 A;  1O7F A;  2ZA9 A;  5FRE A;  3WG3 A;  3WVJ A;  2NQY A;  2W5F A;  3RMX A;  4CDW B;  2HH9 A;  4HSJ A;  3M3Q A;  2G19 A;  4F8A A;  3BPZ A;  4XDO A;  1POQ A;  2DCK A;  4QXK A;  3VDC A;  3PUS A;  4UI9 L;  1CAX B;  1GNY A;  2LUW A;  5HI0 A;  4QKD A;  3AP7 A;  2I74 A;  1LHV A;  2MEV 1;  3A21 A;  1XU2 A;  2VR4 A;  3QAC A;  1RYY A;  1XYN A;  1T6G C;  4PQ9 A;  1D4M 3;  1DBN A;  1ZA7 A;  4MLO A;  4AVA A;  1FV3 A;  4JCK A;  4BOW A;  3FHA A;  3ZDV A;  1NA1 B;  1RIN A;  1UPS A;  3FUQ A;  4XYX A;  3BGA A;  5FUN A;  2VH9 A;  2PEL A;  4BB3 A;  2Q8D A;  4AEM A;  1W8W A;  2VZS A;  1NT0 A;  5LA9 A;  3ZYP A;  4KGG A;  4RN5 A;  3SMH A;  2QQL A;  2NP0 A;  1GMM A;  1EYB A;  1TQ5 A;  2CAU A;  1RMU 3;  1YI9 A;  2JB4 A;  2ZAB A;  3CJI B;  3I2K A;  3DCQ A;  4L0P A;  4MGI E;  4L8Q A;  5CAD A;  4OHY A;  4GB3 3;  5FZ9 A;  1S0I A;  3KHB A;  5DAV A;  2VZ1 A;  3E6C C;  2GNM A;  2C6S A;  4FBF A;  1W8O A;  1BMV 2;  1QDO A;  3I3M A;  2WLQ A;  2XKP A;  3J8F 1;  4S2D A;  2BYV E;  5L9B A;  1DGR N;  3M7A A;  3UES A;  3ES1 A;  4V2W A;  2DF7 A;  2ZHM A;  3J4U H;  3WHT A;  3RZJ A;  3KQ4 B;  3WEZ A;  4E8C A;  1Y4W A;  2VTF A;  3WP5 A;  5B4N A;  1K42 A;  2BW8 A;  1JZ6 A;  4AQT A;  4XF4 A;  3LIH A;  1RHI 3;  5FMO S;  4OMC A;  1O4T A;  1SFY A;  2PAE A;  4FPF A;  1E5R A;  4GH4 B;  3RYR A;  2P34 A;  4C8D A;  2JDP A;  4TTG A;  2N7G A;  4FOQ A;  2UU8 A;  4XUN A;  3T1L A;  2NM1 A;  3WDV A;  2RG4 A;  3P3P A;  2UWA A;  1HJF A;  1LUL A;  4N43 B;  4MG2 A;  4CCD A;  2WUH A;  4D3W A;  4BIS A;  2RM2 1;  2JD9 A;  5J96 B;  4ARY A;  1H8V A;  1JZ4 A;  1MZE A;  2PHU A;  5JI9 A;  3FE5 A;  1ZBA 1;  2AC1 A;  4JDN A;  5ANN A;  1OA3 A;  2YBK A;  3AB0 A;  1RUF 1;  4XJZ A;  4Y20 A;  2YPJ A;  5K4L A;  4QB2 A;  3D3A A;  3HD8 B;  1YI7 A;  4COZ A;  4XQD A;  3P1I A;  1NCQ A;  3B9I A;  2HWB 3;  3OYW A;  1R08 3;  2QQV A;  3A0K A;  5IYY A;  4DY5 A;  3JZV A;  1RVF 3;  4D69 A;  1VB4 A;  5F2S A;  1WCQ A;  2WYS A;  3VL8 A;  1ND2 C;  1GBG A;  1ZNP A;  3K51 A;  2PAM A;  2WL1 A;  1ZRR A;  3AYE A;  3MF9 A;  4HKW A;  4I0A A;  4LK6 A;  4MGY E;  4OI2 A;  4LNV A;  3OGG A;  4NRQ A;  1V6O A;  1V9U 1;  3BTZ A;  2YDE A;  4XXA A;  3IMN A;  2EAL A;  3LKJ A;  1IS6 A;  4YVW B;  2R04 3;  2UYB A;  3PU8 A;  3FHQ A;  4Y3O A;  5DN2 A;  4L92 A;  2DCY A;  1KJL A;  2J1S A;  5FY5 A;  5FOJ B;  4P9X A;  5KXE A;  5BNO A;  3WDT A;  5D8A B;  3SEP A;  2YBS A;  4M01 A;  1JUH A;  3BIE A;  2R07 3;  3N9O A;  1TNF A;  2W1W A;  1DGW X;  3RPQ A;  4EWA A;  2YC0 A;  4Z2A A;  1AYN 2;  4LO6 B;  1VBE 2;  3WNL A;  5DAQ A;  1VE0 A;  3VBF C;  5AC9 1;  1UMI A;  2QJV A;  2YC2 A;  4LPL A;  3CMG A;  3ZXK A;  1POV 0;  2RS1 1;  1V6M A;  4BQW A;  2YXS A;  3LWC A;  3H0O A;  3L9J T;  4PIZ A;  4RQP C;  4CVU A;  3WUC A;  3V65 A;  4MUV A;  3KZ4 C;  2GN7 A;  4X8N A;  4MGT A;  4BQ3 A;  1REE A;  5DPN A;  3KHC A;  1UWW A;  2WO2 A;  4PQQ A;  3SKJ E;  2WII B;  5IUQ A;  2Q8O A;  4TZD A;  3WCR A;  3IB3 A;  1LNS A;  4QXB A;  4QU2 A;  5KC5 A;  5FPV A;  5HCH A;  5FOB B;  3AFG A;  3OPZ A;  3PHM A;  2X8K A;  3B3Q E;  1JU3 A;  2K46 A;  3WG2 A;  1F31 A;  3DYM A;  1MVQ A;  3AMH A;  1F5F A;  2GC0 A;  1VB2 A;  1W04 A;  1S0E A;  5BY5 A;  5LB6 A;  1Z7S 2;  3BN6 A;  4XZP A;  1W90 A;  1VBA 1;  3CQO A;  1WLW A;  4L97 A;  2IXI A;  4PLO A;  5A3T A;  1Y9G A;  3LZZ A;  3ZSE A;  3WHU A;  3RZH A;  2EXI A;  4X6R B;  5C8W A;  1WWY A;  3K3N A;  1WCS A;  2P37 A;  2V5D A;  2A6Y A;  1EPZ A;  2D6P A;  4LO8 A;  1HRV 1;  4CUB A;  4UW5 A;  4NIH A;  2WYF A;  2YYO A;  2PHR A;  1UL9 A;  4W6X A;  1C8N A;  3OSD A;  1RUC 2;  2RS3 2;  1JOD A;  1AR6 3;  5FQ0 B;  1O59 A;  2WA4 A;  3GXU A;  3O12 A;  4KMQ A;  1ND2 B;  1PO2 3;  4OUS A;  4XJU A;  2HBT A;  3VKO A;  4MAD A;  1MS8 A;  5JMO A;  2B8M A;  2QCS B;  3WNM A;  1CX1 A;  5DAX A;  2BGC A;  1X82 A;  4M3C F;  3AKR A;  4CUC A;  5C8C C;  1GOH A;  4CCO A;  5T5P A;  1J3Q A;  4BK5 A;  5CA6 A;  3VLB B;  3D8C A;  1MR5 A;  5FMD A;  1RUE 1;  2ZGO A;  5A33 B;  4B8E A;  5F3E A;  4Q2F A;  3CZJ A;  2ID4 A;  4AFM A;  5GLU A;  2P3Y A;  4AXO A;  4P5H A;  3JUU A;  4CCK A;  3I2I A;  1AZD A;  2D44 A;  1AXY A;  5FUI A;  3HIF A;  3I2H A;  3ST7 A;  3DEM A;  1ZX5 A;  1NCR A;  1VR3 A;  1XNA A;  4ISR A;  5KXC A;  4K40 A;  3DEC A;  4LXL A;  2WZP P;  1AX1 A;  3I3B A;  2X10 A;  2WQZ C;  3ZFG B;  2QQM A;  4HBN A;  3VZK A;  3ZO0 B;  1XJA A;  3MO4 A;  5EJ3 A;  5EP9 A;  3AK0 A;  2Y6F A;  2VNG A;  3VBO A;  3JB8 A;  5DG2 A;  3M4F A;  1J59 A;  2OS2 A;  2PHD A;  5AC9 2;  1AR6 1;  3OF1 A;  4N53 B;  2PLV 1;  3ZXG A;  2JG8 C;  3GNE A;  4GMP 1;  3ZR5 A;  2VZQ A;  4IDZ A;  2AYH A;  3VHN A;  2OII A;  1RUN A;  2QVS B;  1JW6 A;  1QJZ A;  3ZXF A;  1H8T A;  1AL2 2;  4CPB D;  1RUO A;  4QPW A;  1E5I A;  2P17 A;  3IPV A;  4BJ0 A;  1W2A X;  2J22 A;  3BOW A;  2R06 3;  4XFB A;  2B39 A;  2WAB A;  4NHM A;  1S0F A;  5FK7 A;  4DIQ A;  2HWE 2;  2JG9 C;  1S1A A;  3FLT A;  2VOW A;  3OGR A;  4OI0 A;  4XHB A;  5BNP C;  3KGL A;  1M4W A;  4HKL A;  2WN2 A;  1NLS A;  1IS4 A;  1H6X A;  2VJX A;  4SBV A;  5LAS A;  5L19 A;  3O0X A;  5CKQ A;  5LRR A;  1RUI 1;  4Q0P A;  4XFI A;  5F3C A;  2HYX A;  1XE8 A;  2ZMK A;  4F7Z A;  3V64 A;  5JSO A;  3B94 A;  4LBO A;  4QQO A;  2J1T A;  4OLL A;  1U0A A;  2GN3 A;  4QKN A;  3M70 A;  2K0G A;  4LOS A;  1F5J A;  4FPC A;  1V6N A;  4P9G A;  1IPK A;  2Z4F A;  4B1M A;  2QFE A;  1NY7 2;  4YM1 A;  4FPG A;  4IXL A;  1K3I A;  4H14 A;  2XVL A;  5FZC A;  1LKN A;  3SH4 A;  2JX9 A;  1C28 A;  2HWD 2;  3V56 A;  4RR3 B;  3KV5 A;  4HKO A;  4OZX A;  5I0T A;  3IZO A;  3EBR A;  5C4W A;  4COU A;  4IES A;  3GYD A;  3OPW A;  3PTR B;  4HT1 T;  5H9Q A;  3QBQ A;  1AL2 1;  2JKB A;  2KD7 A;  2YY1 A;  4I0B A;  4RQP A;  4UT5 A;  1UYX A;  3VN4 A;  5LRS A;  4QQP A;  3PUH A;  3SCH A;  4AI9 A;  3CBN A;  4AZZ A;  4KWJ A;  2DU1 A;  1BCX A;  2WR9 A;  1DQ5 A;  3N4M A;  2JDN A;  2PFW A;  2B4K A;  4N7U A;  4CCE A;  1VBB 2;  3MPP G;  1F4H A;  1KQR A;  2V09 A;  4QD2 A;  4NII A;  3ZMN A;  5BNO C;  1CN1 A;  1W6M A;  2C5D A;  2R0F A;  2VG9 A;  1O6U A;  2BVB A;  4JTN A;  1SQ4 A;  2W39 A;  4QMA A;  5I0D A;  3N7M A;  3KT7 A;  4YM0 A;  1QF3 A;  3GAL A;  3VB9 A;  2R6Q A;  1ZRF A;  1LOD A;  1AR7 2;  1OKO A;  2XL7 A;  2WIN B;  2ZKL A;  3K2O A;  2XL9 A;  5EFU A;  4ONU A;  2FZ2 A;  1HQW A;  2AGS A;  1JYN A;  1IOA A;  2WFF 3;  2AR6 A;  1K5M A;  2WNO A;  4PIY A;  3RVH A;  3U0Z A;  5GM0 A;  5F6L B;  3T2P A;  2ARX A;  5FXZ A;  1GZT A;  3NV1 A;  2IVI B;  2RDN A;  3F2Z A;  4P9I A;  3MIF A;  3VBS C;  3MZH A;  5IFP A;  2VQ0 A;  4IV1 A;  3ZXE A;  1O3S A;  5A1F A;  5DUU A;  3IAP A;  4AAX A;  2DCZ A;  4DXR A;  2BBA A;  1FX5 A;  3AC0 A;  2JDU A;  3OGV A;  4ATF A;  2XGX A;  3OJB A;  3TN9 3;  2VQU A;  4KL1 A;  1JI6 A;  2RJK A;  4F3J A;  1V9U 3;  2CAV A;  3LD8 A;  3J7M A;  1IQD C;  4K3U A;  5LA2 A;  1WUV A;  3O1R A;  1OOP C;  2VZP A;  1QU0 A;  5FJH A;  1ENQ A;  3GM8 A;  5ISL A;  1IS5 A;  1K5M B;  1JS9 A;  5I0U A;  4B3N A;  5IAX A;  2E7T A;  4EN6 B;  4NJ4 A;  3RGB A;  5BNQ A;  1WLC A;  4LIT A;  5J36 A;  4LO7 A;  3SH5 A;  2JEN A;  1OA2 A;  3I2F A;  2R04 1;  1LOF A;  1UY0 A;  4UFK A;  3PNA A;  5TSW A;  4CP9 B;  4ZHN A;  1WZX A;  4NPL A;  3QLQ A;  2XPJ A;  1ZZC A;  1CAW B;  4LTA A;  4XJW A;  3OBT A;  5E8A A;  1FOD 1;  3PU3 A;  1QJX 2;  2WFF 1;  1W8T A;  1I1E A;  3MIB A;  4IGP A;  4BLI A;  4FPE A;  1REF A;  2R04 2;  4LMF A;  4NOT A;  1W9S A;  3KV4 A;  3UYJ A;  5FWJ A;  1LOE A;  3ILN A;  4URT A;  5C3O A;  5KXB A;  2PLV 2;  3TBD A;  2VXJ A;  5FYU A;  1Q56 A;  3GZE A;  4Y4Y A;  2JB8 A;  4JKM A;  2O8O A;  1CES A;  3VD7 A;  3VHO A;  5B2G B;  3N9P A;  4WM7 B;  2ARB A;  2E33 A;  1BEV 1;  5A6Z A;  1N47 A;  3MFA A;  1OOP A;  1CGP A;  4A42 A;  1BZW A;  2ZAH A;  1AF9 A;  3SNM A;  4HLT A;  1W2U A;  2EAK A;  1RC6 A;  2ZEY A;  3I3Q A;  3O5S A;  4RR3 C;  4HET A;  1PIV 2;  5FYM A;  4XMA A;  4YG3 A;  4AYU A;  4DMI A;  1CIW A;  2C0Z A;  4IEQ A;  1NQJ A;  4FVV A;  3FZ3 A;  5CFC A;  1UY4 A;  2A5Z A;  3OG2 A;  1TNR A;  5L73 A;  5C5T A;  1ODM A;  4NAO A;  2JG9 A;  3N36 A;  4E9K A;  1UQX A;  5DUX A;  1V00 A;  4P9L A;  5F5A A;  5FZE A;  1AR9 2;  2QZ2 A;  2CL2 A;  5DMY A;  4XVH A;  3KB5 A;  4IE0 A;  4GIQ A;  2PHF A;  5DZE A;  1US3 A;  2HWE 3;  3UL2 A;  2W9X A;  2XVG A;  4Q4X 1;  4BWO A;  1QGL A;  4AE2 A;  1RUH 1;  1KJR A;  5F39 A;  3CJX A;  2ZTN A;  4NAM A;  4AHZ A;  1XC6 A;  3HEI A;  2ZX3 A;  3ZDS A;  2QE3 A;  1QJX 3;  5GLZ A;  1ZBE 1;  2Y0I A;  4XW3 A;  4DUV A;  2Q4S A;  3AMM A;  3D4K A;  2OUH A;  1N3P A;  1V6K A;  1XRU A;  2Q1F A;  1SLC A;  1BMV 1;  4E27 A;  2XJU A;  5H9S A;  2UWC A;  3R6S A;  2QTW B;  1URX A;  1G9F A;  3ZPO A;  2DTY A;  2C9K A;  2F4P A;  5A3M A;  5IJR A;  3QOP A;  4M4P A;  4MOA A;  2PQS A;  4FT8 A;  2BPA 2;  1O5L A;  2QQW A;  2KA3 A;  3HMY A;  2XUM A;  4FQZ A;  2DYC A;  4Q4V 2;  1XNK A;  4ZXE A;  3WW2 A;  3WSO A;  2VNR A;  4IV3 A;  1PZ7 A;  4R9C A;  4ZON A;  4COV A;  3MFC A;  4R8H A;  2J1V A;  5FP9 A;  4TLF A;  1NCR B;  4FPL A;  1SLL A;  3AJY A;  2ZGR A;  1OFN A;  3LEM A;  1EAH 3;  5JIU A;  3UV9 A;  4DFS A;  5HBA A;  1VAK A;  1HRI 2;  3NMB A;  4V2V A;  4MET A;  2J1U A;  3T0A A;  2E51 A;  4GUL A;  2VCB A;  5F2W A;  4EZ4 A;  2GP3 A;  5HCA A;  4AR2 A;  3VD9 A;  1PO1 3;  2CY6 A;  2YU2 A;  4E4S A;  4ZU7 A;  1COV 1;  5LZ6 A;  1SFP A;  1EAH 2;  1OQD A;  2Q8C A;  5FZL A;  1TE1 B;  1SG3 A;  1H2M A;  4KQ7 A;  1K12 A;  3LSE A;  4GXL A;  3R4U A;  3D0J A;  5BNP A;  4JHT A;  3RZZ A;  1LU1 A;  2QQJ A;  4LBQ D;  5BNO B;  2J1R A;  5BPX A;  2L9L A;  2VOV A;  3FBM A;  1UY1 A;  1ND2 A;  4CP2 A;  1Q3E A;  4Z92 B;  2RV9 A;  2K2S A;  4Y5T A;  4IQP A;  4PI0 A;  4EQV A;  2G9Z A;  3CU7 A;  4AFC A;  1OUR A;  5FRA A;  1I6X A;  4CZS A;  3KV6 A;  3LPF A;  4P9J A;  5FPZ A;  2BWC A;  4XET A;  1CWP A;  1TEI A;  1C1L A;  2ORZ A;  4NID A;  1WD3 A;  1MS0 A;  4BQX A;  2UYA A;  2BOJ A;  1QQP 1;  2R06 2;  4Z82 A;  1R09 3;  3TYJ A;  1G86 A;  1DGR A;  3WW1 A;  4XE9 A;  4CCC A;  3MHZ A;  3R0R A;  4YZ5 A;  2CWM A;  1MEC 3;  1VBC 2;  1YCI A;  5C4W C;  3VUO A;  1WBF A;  4N9I A;  1Y3T A;  2JE7 A;  1OSG A;  2ORX A;  4HXC A;  2DVB A;  4Q5O A;  1ENX A;  4ZZ5 A;  5IT6 A;  2FHR A;  4HZF A;  4AGG A;  4I09 A;  4BDV B;  3RJR A;  4XUR A;  3R4S A;  3TAY A;  1VPH A;  3SC7 X;  2DV9 A;  1QQP 2;  3JQX A;  5HV4 A;  2X5I C;  2XLG A;  1UYP A;  4BYY A;  3KVB A;  3O0W A;  4BIO A;  4COY A;  4HN0 A;  4HL0 A;  3RWN A;  2VMH A;  4K1Y A;  3H8X A;  2NZ9 A;  3WLU A;  1UYY A;  3H7J A;  4FCA A;  3O1U A;  2OPW A;  1CJD A;  4I3P A;  4LO5 B;  2IC1 A;  5LBE A;  4C90 A;  3E5Q A;  5BV6 A;  1G9A A;  4XFA A;  1ZYB A;  2EIE A;  4YGC A;  3VBR C;  5FY1 A;  1LGB A;  3SIT A;  1X8E A;  5FYS A;  1OUX A;  1F35 A;  4AOC A;  1QOT A;  4RHV 1;  1NE6 A;  2RS5 1;  1AR8 1;  3VZN A;  1UX7 A;  3VDD B;  4E4Z A;  4CDU C;  4AGR A;  3KM5 A;  3S0M A;  2VUC A;  2V4A A;  3JB4 C;  3RDI A;  5BYN A;  3ACL A;  5FAX A;  4RHV 2;  2D6M A;  2DFC A;  1YFY A;  2R0H A;  2R1D A;  1MPX A;  2Z5W A;  3ENR A;  4Y26 A;  5FZ6 A;  5GZE A;  4YVW A;  5A7O A;  5JSP A;  1OF4 A;  5ERL A;  3WV6 A;  4RGG A;  3ZFG A;  4PLM A;  1QXR A;  2KR2 A;  1PGS A;  2PYT A;  4CCL A;  1Z7S 1;  3IN9 A;  3KT1 A;  3AYD A;  2VQT A;  2B9U A;  1RHI 2;  2ZX2 A;  3WQ1 A;  3I7D A;  3HT1 A;  3NRU A;  1JOB A;  1RUD 3;  1WCU A;  5FZD A;  1WW4 A;  1JTZ X;  2JE8 A;  2E7A A;  4LIV A;  2XQX A;  4UW6 A;  4Y20 B;  2G9G A;  3UK9 A;  4AED C;  2B45 X;  4XJ9 A;  1K5J A;  3TN9 1;  4P00 B;  4W50 A;  2J42 A;  5JI7 A;  1NA1 A;  3TOJ A;  4ZU5 A;  2Q30 A;  1X7N A;  1W8H A;  2AUY A;  1O91 A;  2CV6 A;  3WF2 A;  2ZEW A;  4XHX A;  4TXW A;  5FZK A;  2D6O X;  5ANQ A;  1KRI A;  4XQ4 A;  4CPB A;  2FCV A;  2ZGU A;  1SLB A;  3TN9 2;  3DL3 A;  1LTE A;  3S5A A;  3ACI A;  3NJY A;  1PGW 1;  1H0B A;  2ARA A;  3III A;  5JOZ A;  5FWE A;  5T54 A;  3QH6 A;  3VDB A;  4JV4 A;  2NYY A;  3UJO A;  3BTX A;  3AVS A;  5HXM A;  3ZFF C;  3CL1 A;  4EN8 B;  1EPW A;  4GH4 C;  1RIT A;  2XBO 2;  4TYS A;  4CP0 A;  4CXY A;  4XC9 A;  4P14 A;  2BJS A;  4Q0U A;  1KD7 A;  1H4G A;  5KHJ A;  2OX0 A;  1KFU L;  1WCK A;  4I3G A;  4OHW A;  3RZG A;  4JC1 A;  5IVJ A;  5FYZ A;  1H8T B;  2VZU A;  4XAB A;  2O8Q A;  1ZZ6 A;  1MAC A;  2R32 A;  3N35 A;  2CTV A;  3AJZ A;  1K45 A;  3FL7 A;  4XTP A;  3INA A;  2D43 A;  3POW A;  3RWK X;  2ES3 A;  3ME2 A;  4LK7 A;  2VPV A;  4XFG A;  5A70 A;  4GWM A;  3R05 A;  5T3N A;  3PTY A;  2C4X A;  2H6C A;  1W9T A;  3ALQ A;  4BZ4 A;  4JX0 A;  1MZ6 A;  2QUO A;  1WLT A;  2VUJ A;  5BNN C;  4BQ1 A;  1RUF 2;  3VHR A;  1DG6 A;  5FZO A;  2YC4 A;  2OQ7 A;  1HRV 3;  3KLS A;  3ZIX A;  5K0U B;  3NNL A;  2Q5T A;  4AQS A;  3WZ1 A;  4FFF A;  4FO9 A;  5BNN B;  5H9P A;  2XJR A;  3WY6 A;  3ILR A;  1H30 A;  1VBC 3;  3PVO A;  3LCP A;  3VBU A;  1NYW A;  1SHW B;  5E1R A;  4YPJ A;  3ACG A;  3ZFE C;  5JZG C;  4UFM A;  1RUG 2;  1UX6 A;  1VAV A;  3EB7 A;  1ST8 A;  3KCC A;  2OZJ A;  4LBQ A;  1SEF A;  4GWJ A;  1NA1 C;  3VBF B;  4D6R A;  2D3S A;  1JZ8 A;  1A34 A;  3KF3 A;  4PJY A;  1C5I A;  2X09 A;  1G9D A;  4PBO A;  3USU B;  2LM3 A;  4I2O A;  3EHK A;  1BK1 A;  1OLM E;  1S0B A;  4AK3 A;  1AX0 A;  4AAP A;  4XF9 A;  5FZI A;  3S57 A;  1ZA4 A;  2WC2 A;  1ZZ7 A;  2LTN A;  3A0N A;  2W1Q A;  2RS1 2;  1UCX A;  4H55 A;  2PN5 A;  2R06 1;  3ZFF B;  4A7Y A;  4S2G A;  4ES8 A;  5C3R A;  3DN7 A;  2NN8 A;  3ZIW A;  2ZML A;  4I30 A;  1W05 A;  3N3H A;  4CEY B;  1HW5 A;  4AVC A;  1RMU 1;  1MQT C;  4XDP A;  2FCU A;  3AZW A;  5A7Q A;  2ZGK A;  5JOW A;  5KR7 A;  1VIW B;  2IXJ A;  2LAL A;  1C4R A;  1UYZ A;  3ZYJ B;  3MIG A;  1CZS A;  4EN9 B;  5JMC A;  1AVB A;  1S2B A;  5JXH A;  4EWE A;  3I97 A;  5H9R A;  1LHO A;  4LEJ A;  5D2A A;  3LB9 A;  1XBF A;  4XF0 A;  2P3K A;  4Q4X 3;  2OA2 A;  5DDJ 3;  2OKX A;  1JHN A;  4Y22 B;  5EJ1 B;  1TMF 3;  3T2O A;  4NO4 A;  3VHP A;  1GZ9 A;  1OPM A;  1S0G A;  3H3L A;  4N90 A;  4LOT A;  1KS5 A;  1H1M A;  2VD7 A;  4PHZ A;  1ZBE 3;  5GZG A;  3THT A;  1NCR C;  1UIJ A;  2QQN A;  2EF6 A;  2GH8 A;  3GJB A;  1SMV A;  3R4D B;  1UU6 A;  3ASI A;  2VGD A;  5DAW A;  4K9S A;  5CIS A;  3AXD A;  1AL2 3;  1OI6 A;  3TNQ A;  2W95 A;  1WBL A;  3BTA A;  4MYE A;  5FP4 A;  2RM2 2;  1MQT A;  1QXP A;  1VBD 1;  1JMU B;  3ACH A;  3P3N A;  1FAT A;  1NG0 A;  1Q43 A;  3DV8 A;  4YNI A;  4YW2 A;  5CFD B;  2CGP A;  1A78 A;  2WS9 1;  3JQW A;  4QB6 A;  3WF3 A;  5FPU A;  1BLZ A;  2GME A;  2ZX1 A;  4FPO B;  5E89 A;  5F3I A;  3ZFE B;  5JZG B;  4CYD A;  1QIQ A;  2VM9 A;  3VDD C;  3O14 A;  3DPR C;  3NAP B;  4C0H A;  1D2S A;  3I49 A;  1H9P A;  4FTB A;  1ULP A;  4UWD A;  3KGZ A;  2WSU A;  4Y22 A;  3SXW A;  4YG6 A;  2YG0 A;  2UUR A;  2EA7 A;  2VQA A;  5GZF A;  1UN1 A;  2YB7 A;  3OD0 A;  1V0A A;  3NNJ A;  1W0N A;  3LQC A;  1PO1 1;  3MW4 A;  2EID A;  1V6J A;  1XSQ A;  4ASK A;  3PVB B;  4Q0S A;  1QHD A;  3S7I A;  2XKO A;  3POG A;  2H6B A;  2RS5 2;  2VTX A;  3M3C A;  1MEC 1;  3FFZ A;  4CCM A;  5A3P A;  3L2Y A;  3MUZ 1;  4CEY A;  1UOB A;  2G9F A;  5DDJ 2;  5A32 A;  1OHF A;  1W3X A;  4G4F A;  2MEV 3;  1SZB A;  4LKE A;  2ZGN A;  5FKC A;  2ADE A;  2WDB A;  3WXP A;  5IAV A;  3B93 A;  3ZFF A;  2BER A;  5CIR A;  3ZOI A;  4CRQ A;  1D4M 1;  1KXG A;  5F5Q A;  2IXC A;  1JHJ A;  3DYP A;  4I0W B;  4QGL A;  3J9S A;  3Q8B A;  4NIA A;  2QQP A;  5FXW A;  2ETE A;  3I2D A;  4IEV A;  3I59 A;  2GDF A;  3VDA A;  5IVE A;  4MXW B;  3C7G A;  4JKK A;  3IKW A;  2Q0A A;  3D0S A;  3OB8 A;  2BV4 A;  1BJQ A;  2K9Z A;  3I4I A;  2VW2 A;  3LPG A;  4N43 A;  3ZKY A;  5C5U A;  1HQN A;  1QJE A;  2LW8 A;  2QDN A;  3ZM8 A;  3ZYF A;  4PF1 A;  3JXS A;  5FZB A;  1CON A;  3QH7 A;  5EIY B;  3DGT A;  4OFG A;  3A23 A;  3D6E A;  1VBC 1;  3ZXA C;  4CDX C;  1LAJ A;  4GH4 A;  5J7M A;  1I5Z A;  2EIC A;  1D7P M;  4QQL A;  4CDQ B;  1W8Z A;  1GQH A;  2RR1 2;  3OY8 A;  3T09 A;  3U11 A;  5FZ4 A;  3BIW E;  5FO9 B;  4IV3 C;  4P08 A;  1GNZ A;  1B09 A;  3VZM A;  5EZW A;  5HPO A;  2Z42 A;  2GNT A;  5GLT A;  1UPI A;  1W8N A;  5LY1 A;  2ZS6 B;  1C1F A;  1ND3 B;  4NHX A;  2YBP A;  3A22 A;  3WG4 A;  4LA2 A;  3KV9 A;  4C91 A;  1FOD 2;  1OH3 A;  3SEE A;  1G9B A;  1O8P A;  1QEX A;  5A1L A;  4IE7 A;  2V5Y A;  5FMO L;  4E4H A;  4Q4V 3;  4KWK A;  4FQ4 A;  4IGO A;  5GKA C;  2HWD 1;  1V9U 2;  3DKW A;  4ZS2 A;  2Y64 A;  5KHI A;  1LED A;  3WW3 A;  1U5Z A;  2XR4 A;  3BOP A;  1VBD 2;  4Q29 A;  4RL7 A;  5FZA A;  2W92 A;  2YU1 A;  2UY8 A;  2PMW B;  2Y6K A;  2HWB 2;  4OVE A;  5IAT A;  4WZC A;  2F4L A;  4GJY A;  3T08 A;  3WP3 A;  3HN3 A;  5K9Y A;  3WQB A;  5KC6 A;  3VBS B;  1T2X A;  3FMG A;  1ULC A;  4B7K A;  5CB7 A;  1PMI A;  5LBC A;  3LEG A;  3L2H A;  4YW4 A;  2SBA A;  4YFZ A;  5IVF A;  4JGY B;  2XON A;  2PAK A;  4K20 A;  3IAQ A;  3WNX A;  3ZYH A;  3ABZ A;  4MXW A;  3AMN A;  5F1R A;  4HAN A;  3GHM A;  5L7O A;  2MEV 2;  4MVT A;  5FMB A;  1MVE A;  2IXH A;  2WNU B;  3HQR A;  4WVV A;  1OMI A;  1POV 1;  2VCM A;  4QXH A;  4OYU A;  5SV5 A;  1FI2 A;  2BTV C;  4YZ3 A;  5T5L A;  3PUA A;  4Q4W 3;  4JTO A;  1S4C A;  3CEW A;  1W8F A;  3ETP A;  4DO0 A;  4ZKT B;  4WVW A;  1VBA 2;  4WVM A;  1NCQ C;  1UZ0 A;  3OEB A;  4KGQ A;  1CAX A;  4YSF A;  2W94 A;  1UW8 A;  4M0N A;  4UBH A;  1OUS A;  2E9Q A;  1S0D A;  3U4X A;  4L9B A;  2WS9 2;  4KU8 A;  5LW9 A;  3POJ A;  1LRH A;  1L7R A;  1VRH 3;  4CSW A;  5IK8 A;  4GA9 A;  3W5M A;  4RHV 3;  3K77 A;  5FMC A;  1ZBE 2;  2YMZ A;  2A7A A;  2O14 A;  2VNO A;  3J7H A;  5IK5 A;  1UZV A;  4ZY9 A;  4AI2 A;  2RR1 1;  5C71 A;  2D98 A;  4PF5 A;  4TSV A;  3VKN A;  3BB6 A;  2WWS A;  1PVC 2;  2HJI A;  4RGA A;  4RSU A;  1JUI A;  5LAT A;  4BQ2 A;  4I02 A;  3VZO A;  1VAL A;  1UU4 A;  2H0V A;  3UET A;  1OA4 A;  5A7P A;  3OEA A;  1W3V A;  2RS1 3;  2A6W A;  3HN1 A;  4JDM A;  4LBK A;  5FBJ A;  4HMZ A;  2WO3 A;  1OLM A;  3SCG A;  5JWP A;  3JD7 1;  3ZFE A;  5JZG A;  2CGN A;  3ZPY A;  1YIF A;  4N9H A;  2VUA A;  5KHG A;  1I5P A;  2WZ8 A;  4LBM A;  3IT8 A;  3N9L A;  1CD3 G;  3HQU A;  2RDR A;  4JQT A;  1RHI 1;  1LGC A;  1QDC A;  4FPH A;  3D82 A;  4FI9 A;  3M1H A;  2AEZ A;  3H3Z A;  4Y33 A;  4A4A A;  1DP0 A;  1YHF A;  3EQE A;  5F8P A;  1TME 2;  2A3X A;  5CZK A;  3VGI A;  3UNP A;  1EUU A;  4PBP A;  2W1S A;  1RUG 3;  1PZ8 A;  2RMU 1;  4JRA A;  4Q4W 2;  1LEM A;  1YC6 1;  2ET1 A;  1XE0 A;  1DQ6 A;  1UY2 A;  1XE7 A;  3AKQ A;  1SCR A;  1UKG A;  4FOY A;  3X29 B;  4CU6 A;  3CF6 E;  4YZ1 A;  1IG3 A;  1MEC 2;  1RUC 1;  1V6I A;  4BMB A;  3T0D A;  1LJ7 A;  3ZSM A;  1DQ0 A;  3OGJ A;  3UKN A;  1FPN 3;  5L7O C;  4Q4Y 1;  5GAL A;  3IDA A;  5JXI A;  3KCX A;  3W9A A;  3FC0 A;  4M3C B;  4IE5 A;  1DQ1 A;  1AJO A;  4ORF A;  4XBL A;  1QH6 A;  2A6V A;  1PX3 A;  1BVV A;  3NAP C;  1QQP 3;  2HBU A;  4JGY C;  1D4V B;  2XB6 C;  4XAE A;  1AXK A;  3J8F 2;  3EJK A;  3TRS B;  4DPN A;  2HWB 1;  2JG8 B;  1BQP A;  3H50 A;  5GZC A;  1COV 3;  3VKM A;  4AI8 A;  2A75 A;  1PVX A;  1ULG A;  1W2O A;  2RJ2 A;  3MV1 1;  3ON7 A;  4NWV A;  4OI1 A;  3WUD A;  3ZYI B;  2JDY A;  3AKT A;  5GLW A;  2R1B A;  1P8J A;  4ZZ8 A;  1W28 A;  1NXM A;  1OQ1 A;  5LCW L;  1UMH A;  1AYM 1;  3LFM A;  3OUI A;  2D3R A;  4B4Q A;  1W8U A;  2CYF A;  2WAO A;  3LA2 A;  1G6N A;  1O3R A;  2A6X A;  4KWU A;  1BVP 1;  3K46 A;  1VMF A;  4QHO A;  2GC1 A;  3TB0 A;  3VBH B;  2FDG A;  2I07 B;  3AXE A;  3DXT A;  3KMH A;  1A8D A;  4R4X A;  1H6Y A;  1ULF A;  1WLD A;  5FYY A;  3OGS A;  5JIA A;  3LDB A;  1JYX A;  4BH9 A;  1NQD A;  4P5Y A;  4B1L A;  5C9A A;  5IHR A;  1XOY A;  1ND3 C;  4MHU A;  1H2K A;  2ZGP A;  3EO6 A;  1PO2 2;  3W58 A;  1E57 A;  4A6O A;  2BFU L;  1AYN 1;  2A71 A;  3ZSK A;  3UKV A;  2SLI A;  5K0U A;  3BOD A;  4FTE A;  2WLP A;  2ZHK A;  4YVS A;  3OBA A;  3ZN5 A;  5BNN A;  1DYK A;  5CVR A;  4P02 B;  4CEY C;  4QGM A;  1S55 A;  4C1W A;  1UOJ A;  2IFW A;  1OVP A;  3LOB A;  4FXK B;  1F15 A;  1QXJ A;  1HIX A;  5JAX A;  4GAZ A;  4Q27 A;  4ZPI A;  2MNG A;  2IXK A;  2CGO A;  5APA A;  2GZW A;  1UO9 A;  3H8U A;  5LK7 B;  1DGL A;  4LLO A;  2WZE A;  1JZ2 A;  1PK6 B;  2VZV A;  1VBB 1;  3VD5 A;  3D5O A;  4IEY A;  1MS1 A;  5E6H A;  2GC3 A;  3H3U A;  2VBD A;  1HN1 A;  1UXZ A;  2VVE A;  5B4X A;  3RYK A;  4PIX A;  3WG1 A;  1LOF C;  1KDM A;  2VC9 A;  1ONA A;  3F95 A;  2TUN A;  3T4H B;  2WS9 3;  3T3Y A;  3WDU A;  4CCJ A;  1N1V A;  1VRH 1;  5A6X A;  4K7J A;  4W8J A;  4M4R A;  4OCT A;  3NNF A;  2R16 A;  1NAE A;  2P4E A;  3JCI A;  3WT3 A;  1X33 A;  1JYC A;  2JIC A;  4RFT 0;  5CNA A;  1FOD 3;  4L11 A;  4UOJ A;  3LA3 A;  4HK8 A;  1PVC 3;  3LFI A;  5C7G A;  2RJL A;  3AP9 A;  2XWB B;  1FNZ A;  2YFZ A;  5GZD A;  3ZYB A;  3LSD A;  3PME A;  4FOW A;  4XPV A;  1RUJ 2;  2XJT A;  2Y6J A;  3JD7 3;  1VRH 2;  4BK4 A;  1Q8V A;  1RVF 2;  5HCB A;  4DS0 A;  4YGE A;  5JSR A;  5A3L A;  2BZD A;  3P6B A;  4QAW A;  1NKG A;  1R08 1;  2WWU A;  2G4I A;  4PI2 A;  4DXZ A;  2D5F A;  3RFR A;  2Y8K A;  3DPR B;  5K7P A;  5CFC B;  3WQ0 A;  4LOR A;  3M2M A;  4ERO A;  1FAY A;  1XPW A;  3B5L B;  1IKQ A;  2E26 A;  4YGD A;  4XDQ A;  1OXC A;  1RUH 2;  3ELN A;  3Q9O A;  3U4S A;  1XNB A;  4BXS V;  3AMP A;  5CG8 A;  1O3Q A;  4TWT A;  3MIH A;  4YVW C;  5FY7 A;  4WM7 A;  4X6Q B;  4XTM A;  2VUD A;  5L9V A;  2WQ4 A;  4NPR A;  3RRD A;  1GQP A;  2A3Y A;  3NJZ A;  4IE4 A;  3JBG 1;  4WBB A;  1FPN 1;  5EYY A;  4FAG A;  5IFT A;  3MLK A;  1CR7 A;  3O7O A;  5IW0 A;  2JJ6 A;  2VVF A;  4CXW A;  3FWE A;  2JG8 A;  4QHB A;  1QY4 A;  1Y7B A;  2BNO A;  4JGZ B;  4CP1 A;  4XIL A;  2DCJ A;  1CJP A;  2Z79 A;  1C3H A;  3KVA A;  4XFF A;  3WNP A;  5FYI A;  4AWD A;  4DUX A;  4YM2 A;  4LUL A;  1JU4 A;  3TWI A;  3HVD A;  4G9S B;  3M3I A;  1W6Q B;  1EAH 1;  1FNY A;  2JDM A;  1VP6 A;  3B9C A;  1DCS A;  4BA6 A;  4ASL A;  4R9A A;  4A7K A;  1Q8P A;  3C7F A;  4RD7 A;  1PIV 1;  2J1A A;  3FBY A;  2DVA A;  1BYH A;  2ZX0 A;  3BPS A;  1AL0 G;  1W6O B;  1XU1 A;  1YNA A;  4XUO A;  3C3V A;  4XQW A;  5D21 A;  3AZX A;  3B7M A;  5DAB A;  5LEK A;  1MQT B;  1PMH X;  4A2U A;  4H3W A;  1MZF A;  2ZZQ A;  4RYD A;  3PDQ A;  1GOG A;  2DVG A;  4Y1Y A;  4KBZ A;  4XF1 A;  4DXT A;  1WW7 A;  4EYU A;  5CKN A;  4OHX A;  1SLI A;  4CDX A;  5DZF A;  4XEZ A;  2Z69 A;  3U14 A;  4LHL A;  3LIG A;  3E6D A;  4JHZ A;  3ZN6 B;  2VCA A;  2W3J A;  2BQP A;  5DUW A;  3OBR A;  2IZW A;  4J6G A;  4NRM A;  4UXA A;  4E4D X;  4AL9 A;  1R1A 3;  3E97 A;  4MV2 A;  2D3P A;  4O7X A;  3VL9 A;  3PUI A;  1SCS A;  2RVA A;  4O9E A;  1UY3 A;  4Y1V A;  4CDU B;  3TNP B;  3AKP A;  2RS5 3;  5IVY A;  4WVZ A;  3RG0 A;  4D6Q A;  2I45 A;  4DXS A;  2ZEX A;  4QX1 A;  5FZ7 A;  3J7N A;  3VBR B;  3OOX A;  2ZAC A;  4NE9 A;  5FKB A;  5JVV A;  1OLR A;  4D94 A;  4OUM A;  2G1M A;  2YV8 A;  5J3U A;  2DVF A;  2PHT A;  5A6Q A;  1GUI A;  1XB9 A;  2RMU 2;  5J09 A;  3GBG A;  2HWC 1;  1XNC A;  1YJK A;  1O8S A;  2X5I B;  4FFG A;  3ZYR A;  4P9W A;  3UGH A;  5IK7 A;  4IEU A;  5C8C A;  1LCL A;  1PO1 2;  2XLA A;  3B69 A;  4Q4V 1;  2WAA A;  4FAH A;  5CG9 A;  4BM8 A;  4IEW A;  3UGG A;  1ASJ 3;  3IBM A;  1WMF A;  4CE8 A;  4L99 A;  5FO8 B;  4RQP B;  4XJA A;  1CIY A;  1PM4 A;  5L9R A;  1QJY 2;  4K8F A;  3P5B A;  2B9V A;  5HCF A;  5C4W B;  4GZ9 A;  4TLG A;  2WRA A;  4IW3 A;  4JZR A;  4H7L A;  3BTY A;  4RR3 A;  1YIP A;  1TG7 A;  2YHJ A;  5IVC A;  1C8M 1;  3CIH A;  3NW4 A;  4AGV A;  1PVC 1;  1UOF A;  1XQN A;  1DQ4 A;  3LOI A;  4YVS C;  4HOO A;  3VBU B;  1NOV A;  3WD5 A;  4OUE A;  2D93 A;  1X36 A;  2EVX A;  2VMI A;  1IPS A;  5E16 A;  4ZU4 A;  1I3H A;  2VUL A;  3UGF A;  4E2G A;  1VLN A;  2CSG A;  4XOG A;  2H0B A;  3PUR A;  2ZGT A;  3O1O A;  3UT0 A;  2ZZJ A;  4WV8 A;  2NMN A;  1LOC A;  3GDB A;  3VBO C;  1Q5O A;  3K4D A;  3THC A;  1F8V A;  1DGW A;  2TBV A;  1LEC A;  4P9Y A;  5T52 A;  1QOO A;  1OBN A;  3GJA A;  4K8R B;  4HPK A;  1QNW A;  5IVV A;  4A41 A;  5EJZ B;  3J8F 3;  2V72 A;  3FHI B;  2XDV A;  3I8T A;  3T30 A;  5FY8 A;  1VBD 3;  3WDX A;  2FDJ A;  2O0O A;  2RMU 3;  1YFU A;  1QJF A;  1D0G A;  4AED B;  2VMD A;  5EV7 A;  2DUO A;  3GGL A;  2ZAA A;  4BQY A;  1O3T A;  4QPG C;  3S5Q A;  3WX5 A;  5DZG A;  4F83 A;  1FYU A;  2RHP A;  2PQQ A;  3HR9 A;  2F6B A;  2IVJ A;  4WM8 A;  3SCF A;  4CEW B;  4EZH A;  4LBN A;  1ENS A;  3RI9 A;  2GP5 A;  3OY8 B;  3CZU A;  5JLV A;  1NLR A;  3AVR A;  3E5X A;  1NE4 A;  2C24 A;  2ZX4 A;  4FPK A;  3CHX A;  5JCT A;  2I2S A;  3GCX A;  1HXS 2;  4LO4 B;  2Q1M A;  2ZPX A;  1VMJ A;  2GAL A;  4LHK A;  1RUF 3;  3ZR6 A;  3E1F 1;  4DY3 A;  2DUQ A;  2JDH A;  4H2A A;  1W9W A;  2AAC A;  3OD4 A;  2OVU A;  4N8M A;  1AYM 3;  5T50 A;  1W6N A;  5CFC C;  1QJX 1;  2XQR A;  4CTE A;  3ZYG A;  1GKB A;  1GOF A;  3NQH A;  5DAP A;  4SLI A;  1UNB A;  5JPM B;  4QWN A;  2Y6H A;  1SAC A;  3FFQ A;  4UF0 B;  4Y24 A;  1CAV A;  1SDD B;  1UXX X;  3C7H A;  2DU0 A;  2P3J A;  5FP8 A;  3H8R A;  2FMY A;  3IMM A;  2RDS A;  1NXD 1;  1HJG A;  4LA3 A;  1F2N A;  4AFA A;  5A32 B;  2Y6L A;  2IXL A;  4JAA A;  1RB8 G;  4DQA A;  3G6J B;  3JD7 2;  3AL5 A;  3OBZ A;  3U75 A;  1WCD J;  2DUR A;  2QQO A;  1O4Z A;  1JBC A;  1OFS A;  2OUJ A;  4AW7 A;  5A3U A;  4W6W A;  1FXZ A;  1JXN A;  4AEK A;  5FQ0 A;  2WQ8 A;  2ATF A;  3EMR A;  5I93 A;  1FT9 A;  2ERF A;  4MHR A;  1AYN 3;  1BK0 A;  3U1X A;  4RS5 C;  1AX2 A;  2E32 A;  3W5N A;  3O1V A;  4LKF A;  3FJS A;  2FCT A;  1JOJ A;  4OQ8 A;  2FD8 A;  4EJR A;  2GC2 A;  1HB1 A;  4S2H A;  3AKS A;  4IEO A;  3NAP A;  1U5Y A;  1DQ2 A;  1M06 G;  2J1E A;  5FYV A;  2HEW F;  2OPK A;  5ACA 1;  4C0B A;  4Y1X A;  3K75 B;  3ZSL A;  2JXA A;  4HVR A;  4ZS3 A;  1JYW A;  2V4V A;  3HPN A;  1H1I A;  1UD1 A;  2HWC 3;  5F3G A;  5F7U A;  5CFD A;  3AZV A;  2XHN A;  2VBP A;  1GNH A;  5I8S A;  4NPM A;  1C5H A;  5F5C A;  1VBB 3;  4NIG A;  4WM7 C;  3UJQ A;  2JDK A;  3GZT B;  4D8M A;  2XBO 1;  2Q1Z B;  4IER A;  1PGL 2;  1B35 A;  4KI5 M;  1YJL A;  4QQH A;  1QKQ A;  3WF1 A;  1EV1 2;  4UFJ A;  3OCP A;  1FMD 3;  5F5I A;  2VL4 A;  2CWS A;  4XMI A;  4EN0 A;  4IV1 B;  5FZM A;  2ZHN A;  1PGW 2;  4CDW C;  2BP6 A;  3HNM A;  4Q8K A;  5JXJ A;  1B35 B;  4LBL A;  1ULE A;  1KFX L;  5FK8 A;  2R7E B;  1RUI 3;  4LKS A;  4UW4 A;  3BU7 A;  4AVB A;  4XBQ A;  1IQA A;  2FMD A;  1ZRE A;  1C8M 2;  1U5X A;  4M3C E;  2NPI A;  5FLI A;  3DF0 A;  1PHM A;  3WQ7 A;  1AR9 3;  3N9N A;  4AVT A;  2D6L X;  2WFP A;  2E31 A;  5FFO C;  3G7D A;  1Y9M A;  2QDR A;  1G8W A;  3AP6 A;  2XJP A;  3M3O A;  4QDQ A;  4E2S A;  4XIK A;  1V6L A;  3H9A A;  5A7N A;  1CVN A;  2IWG B;  4IEZ A;  4HVQ A;  2JIJ A;  4Z2W A;  4RA0 A;  2DFB A;  4AFD A;  3I2G A;  4RFR B;  3PJY A;  3H1M A;  3WCS A;  3IDC B;  1PIV 3;  3LDK A;  1LHW A;  1BEV 3;  1UU5 A;  3THP A;  3U37 A;  3UKT A;  5ABJ A;  1VBE 3;  1TMF 2;  1A6C A;  1CPN A;  3HBZ A;  3O0V A;  4MX3 A;  3H1Y A;  3HNY M;  5A7W B;  4B4R A;  2XUE A;  1NZI A;  4YZ4 A;  1W2N A;  1RXG A;  1H2L A;  3FN9 A;  3POI A;  1UZZ A;  5T5J A;  3GZU C;  2C26 A;  2ZGQ A;  1DU3 D;  3VBF A;  1RGS A;  2A6Z A;  2ZMN A;  4LUM A;  4GB3 2;  5FZ1 A;  3SKV A;  4AI1 A;  4LBQ B;  1R64 A;  1UZY A;  2ILM A;  1O5U A;  2W0X A;  4XBN A;  5FY0 A;  4J1W A;  4KBB A;  5DUV A;  2QKD A;  4OHZ A;  1OD5 A;  5I0R A;  1RIR A;  1OLQ A;  1R09 2;  1HV1 A;  3JBG 2;  4CU8 A;  4LBJ A;  1LGN A;  3NKT A;  1AR7 1;  2BDR A;  1W9Y A;  3Q8C A;  1SBF A;  1GR3 A;  1OH4 A;  3ILF A;  1B35 C;  3LF7 A;  1YQ5 A;  4M0H A;  4IV3 B;  4IV1 C;  1QWR A;  3AFK A;  5FZO B;  3JU9 A;  4OUL A;  4CDQ C;  2VTX J;  4IUG A;  2WNE A;  3NST A;  1R1A 2;  4BIF A;  3NO8 A;  2WO1 A;  1WME A;  4R4Z A;  1CQ9 A;  1GWK A;  3KSC A;  1LEN A;  3BUC A;  3LDR A;  4YM3 A;  5IWF A;  2XVK A;  1JN2 P;  1HQL A;  3K48 A;  5L36 A;  2RE9 A;  3N9M A;  4WM8 B;  1STM A;  3PMS A;  3LGR A;  2A1X A;  2A3W A;  4JRL A;  1RUJ 1;  1ZVF A;  1RUC 3;  5F37 A;  1ACC A;  1ZZ9 A;  4LR4 A;  3IDB B;  5C70 A;  1WGP A;  4RGK A;  1XNT A;  2JEC A;  2XJQ A;  1RTV A;  1QOS A;  4QPY A;  1AYM 2;  4R9B A;  2DBN A;  4XXP A;  5FDB A;  1ZZB A;  3MW3 A;  4CCN A;  4HPK B;  1NY7 1;  1HV0 A;  4NHK A;  3ORJ A;  5EPA A;  4Z8B A;  2AEY A;  1GU3 A;  2BNN A;  1BBT 2;  3GBF A;  2VOK A;  1OVS A;  2BFU S;  4KU7 A;  2BNM A;  1LB2 A;  3U78 A;  3O1T A;  5AFE A;  1HDK A;  4QX2 A;  2Q8E A;  2JIG A;  3DYO A;  3I2J A;  4CU7 A;  2D40 A;  3T0B A;  1DZT A;  2WJS A;  4HSL A;  4FPY A;  4KG8 A;  4QX8 A;  4XCB A;  2R30 A;  2JG9 B;  2VO5 A;  5F32 A;  3RMY A;  1DIW A;  2BU9 A;  2D7F A;  4Y5Z 0;  4KG0 A;  1L3J A;  2WNU C;  1UMZ A;  2ZEZ A;  1HRV 2;  2E63 A;  3ECQ A;  4EN7 B;  1K5M C;  1POV 3;  1W6N B;  4QX7 A;  4UYB A;  2YZ4 A;  5A3O A;  1RVF 1;  2P6H A;  1RUE 3;  1GYK A;  2GU9 A;  2XH6 A;  4IE6 A;  4UBG A;  4A44 A;  1OOP B;  1TME 1;  4N53 C;  3RZL A;  5CFD C;  2ZGS A;  3VD4 A;  1BKZ A;  4NRP A;  2BEO A;  2BUK A;  2HWD 3;  1BXH A;  2W08 A;  2VZT A;  4NWW A;  4AQ6 A;  2FDK A;  2C1F A;  3DXU A;  5ABJ B;  1HRI 3;  4W6Y A;  1LES A;  1JH5 A;  4B7E A;  2X5I A;  2P2K A;  1W39 A;  2PHW A;  2W1U A;  1Q8S A;  1E5H A;  4DOU A;  4E2Q A;  2V73 A;  1RXF A;  1CAW A;  3KCY A;  4CEW A;  3CNA A;  3VDD A;  4AG4 A;  2WZR 2;  2EXK A;  2GH2 A;  3MEP A;  2PLV 3;  1RJ8 A;  1UIK A;  3KD4 A;  3RI8 A;  3HJR A;  4B29 A;  1RUH 3;  5FO7 B;  2PHX A;  4FPJ A;  4AED A;  3MBW A;  4E8D A;  3HAG A;  2ZGL A;  5FLJ A;  5EWS A;  5A80 A;  1QJY 3;  4NMI A;  4DRV A;  2Y34 A;  1EUT A;  4QPI C;  1VBE 1;  1DLL A;  3RQ0 A;  3WF4 A;  1LHN A;  1RJ7 A;  1YFX A;  2W46 A;  3BYW A;  2VOX A;  1WMX A;  3H7Y A;  4LHS A;  4KWL A;  4GD4 A;  1IG0 A;  3BAL A;  1WD4 A;  4MGS A;  3S6P A;  4YAR A;  3PIG A;  2HWF 2;  1Q8Q A;  2LRP A;  4XFC A;  2XLF A;  4K6B A;  4CDX B;  1UAI A;  3J7L A;  4C1X A;  4JQR A;  1ZM1 A;  4YW3 A;  1OC1 A;  5KWR A;  3VBU C;  4QKB A;  4Y5S A;  1CZV A;  1W6P A;  1S0C A;  1VBA 3;  4MGQ A;  5LBB A;  4AFB A;  1J83 A;  5I91 A;  2D5H A;  1HXS 1;  2XWJ B;  4FP2 A;  1PNG A;  2WA3 A;  3NV3 A;  4Q26 A;  4X8P A;  2WWJ A;  3DUI A;  1DZQ A;  4Q8L A;  4YZ2 A;  1H2N A;  1OT5 A;  3TEZ A;  1IS3 A;  3ZKU A;  4MZU A;  2WZR 1;  3K3O A;  1TMF 1;  3POF A;  1RUI 2;  5BUV A;  3C2U A;  5I8Y A;  1D0H A;  1PM7 A;  4IGQ A;  2W68 A;  1Z7S 3;  5A7W A;  3AP5 A;  3N9Q A;  5LBF A;  5J37 A;  4YYO A;  2BBV A;  2X05 A;  1KDK A;  1Q8O A;  3ZXJ A;  2O1Q A;  5LWB A;  5K0U C;  3ZN4 A;  2IFR A;  3AYC A;  3LEK A;  5BNP B;  3IDE A;  1BHG A;  3K4Z A;  1LR5 A;  1HB4 A;  2HWF 1;  3GCW A;  4RS5 A;  3OYW B;  3V0A B;  3MUY 1;  1U12 A;  2AH2 A;  2RR1 3;  3Q8F A;  4O65 A;  5GLV A;  1CAV B;  1RMU 2;  1YQ6 A;  1WW5 A;  4TN7 A;  4UF0 A;  5IVB A;  2Z2S B;  2NMO A;  1RED A;  1AR6 2;  3E5U A;  5AC9 3;  5FXV A;  2C9A A;  4PDW A;  2JE9 A;  3DPR A;  4D7S A;  1BBT 3;  1ULD A;  2CNA A;  2YFU A;  2DDU A;  1R1A 1;  2WBK A;  2VZR A;  5D8A C;  5T5O A;  4DEQ A;  1W9F A;  2HEY F;  5D1I A;  4OQ9 A;  3WDY A;  1OF3 A;  1SBE A;  2OXB A;  4AI3 A;  5FZF A;  3RZM A;  4LHN A;  1DFQ A;  4MGK E;  4AHW A;  1WW6 A;  2EIG A;  3ZFG C;  2DWR A;  4D7Y A;  4D0Q A;  4YG0 A;  5CEH A;  3M8L A;  4FP3 A;  1ULO A;  4LE4 A;  3TEW A;  2YPD A;  3NV4 A;  1YRZ A;  1YFW A;  3VKL A;  1Y43 B;  2PHL A;  4CEW C;  2P1B A;  1QNY A;  1W6O A;  2DCT A;  3POE A;  5FIX A;  1HB2 A;  1VAM A;  3IIA A;  4K21 A;  4OHV A;  4R9D A;  3I3D A;  4A45 A;  3SHR A;  5A7S A;  1YWK A;  4DB5 A;  4O61 A;  4OI4 A;  4ES9 A;  5EYX A;  3ZVX A;  4GWN A;  2BVV A;  1GFF 2;  1W6Q A;  1GSL A;  5EXO A;  1QJU 3;  3HQX A;  3RYP A;  1HRI 1;  1BEV 2;  2JD4 A;  1ZBA 2;  4N53 A;  1DYO A;  2XJV A;  2TNF A;  2OT7 A;  1CX4 A;  3NNG A;  1MS9 A;  3MDP A;  1AR7 3;  4JGZ C;  4MH0 E;  3VBO B;  4HG6 B;  4GKX A;  4HFS A;  3POS A;  2HLE A;  4EE2 A;  1L7Q A;  4Q0V A;  1ZRD A;  5A3N A;  1W99 A;  2MPF A;  2JWP A;  3CJI A;  2HWE 1;  3SIS A;  4BXF A;  4FSJ A;  5JOX A;  2VU9 A;  2NLR A;  3HT2 A;  4HK9 A;  4LE3 A;  3H8O A;  1Z78 A;  1ENR A;  4GMP 3;  5FUP A;  4DNY A;  3HWJ A;  4BQ5 A;  3O1P A;  3FUO A;  4YVS B;  4OMD A;  4QQ2 A;  3NKG A;  2VMF A;  1D2Q A;  2Y38 A;  2F17 A;  5KHH A;  3W20 A;  2Y6G A;  2ET7 A;  3T4V A;  1PX4 A;  2TEP A;  2XBO 3;  1LOB A;  2YRO A;  3ZMO A;  5J98 B;  1KGY A;  1MS4 A;  3C8X A;  3Q8E A;  2X29 A;  5C3Q A;  3O1S A;  2ARE A;  1RUJ 3;  1XND A;  3MPB A;  4U36 A;  4U2A A;  3SH3 A;  4J1X A;  3TEX A;  2VXR A;  2GSY A;  3ETQ A;  3FLR A;  4FOV A;  1A8M A;  4QKF A;  2QQI A;  2Y60 A;  1JYT A;  4XUP A;  5FCC A;  5A1A A;  5IK4 A;  1N3O A;  1AXZ A;  3CKH A;  5A3W A;  2ZCW A;  5C8C B;  1I9R A;  2D6K A;  4Q4X 2;  3AX4 A;  3RJ2 X;  2BGP A;  3M3E A;  4COW A;  1U5I A;  1AUY A;  2BOI A;  1SDW A;  3CJI C;  3MYX A;  4QX3 A;  3HOB A;  2XG3 A;  3BCW A;  1AR9 1;  2JKX A;  2W47 A;  4LUK A;  1ALY A;  1DHK B;  2WN3 A;  3MI8 A;  4YW7 A;  4AHX A;  1KIT A;  4CDW A;  2R07 1;  2GMM A;  3RZK A;  4CP9 A;  1ZBA 3;  1VRB A;  1RUE 2;  3OTF A;  3BVC A;  1A3K A;  1DZR A;  4CU9 A;  1C57 A;  2WKK A;  4IEX A;  1YXW A;  3S7E A;  2WT2 A;  4A3X A;  5ACA 2;  2YGL A;  3VZJ A;  5J1X A;  5JR2 A;  3VBR A;  4LJH A;  5FR3 A;  1GAN A;  4LIU A;  3H1W A;  2ENR A;  4XJ8 A;  1MZ5 A;  4UFI A;  3Q8A A;  5HV0 A;  1EV1 3;  1H8T C;  1UF2 C;  1YLL A;  1HN0 A;  4QPG A;  2WO7 A;  4NR1 A;  1PK6 C;  1ASJ 2;  2JDZ A;  2QNK A;  4NVP A;  4AHY A;  4A7Z A;  2FBE A;  1QMJ A;  2RS3 1;  2FDH A;  3MIC A;  3AZY A;  5CKM A;  4GWI A;  3ATG A;  3AMQ A;  1J84 A;  4BU2 A;  4YFW A;  4GJZ A;  1QJU 2;  1R08 2;  1IGO A;  3EYP A;  3LEI A;  1KEX A;  2EXH A;  5AFB A;  5JXG A;  4XUQ A;  2VW0 A;  4ET7 A;  3MGU A;  1IHM A;  3GZA A;  1BBT 1;  3N7J A;  4FTS A;  3ITQ A;  2PXJ A;  3U10 A; 
#chains in the Genus database with same CATH homology
 1SPP A;  5CKN A;  1SZB A;  3POE A;  3POF A;  3POB A;  4LOR A;  3KQ4 B;  5CKM A;  4LOS A;  1NT0 A;  4LOT A;  2QQK A;  2QQL A;  3DEM A;  4LMF A;  1SPP B;  1NZI A;  3POJ A;  2QQM A;  3POI A;  5CIS A;  1SFP A;  2QQO A;  4GZ9 A;  3POG A;  5CKQ A;  2WNO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...