3POIA

Crystal structure of masp-1 cub2 domain bound to methylamine
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
113
structure length
113
Chain Sequence
ECSGNLFTQRTGTITSPDYPNPYPKSSECSYTIDLEEGFMVTLQFEDIFDIEDHPEVPCPYDYIKIKAGSKVWGPFCGEKSPEPISTQSHSIQILFRSDNSGENRGWRLSYRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Mannan-binding lectin serine protease 1
publication title Structural Basis of Mannan-Binding Lectin Recognition by Its Associated Serine Protease MASP-1: Implications for Complement Activation.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 21
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 3.4.21.-:
pdb deposition date 2010-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00431 CUB CUB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.290 Mainly Beta Sandwich Jelly Rolls Spermadhesin, CUB domain 3poiA00
4GZ9A 1SPPA 3KQ4B 2WNOA 4LOTA 1SFPA 2QQKA 3POGA 4LMFA 2QQOA 5CISA 3DEMA 3POIA 3POEA 2QQMA 5CKNA 4LOSA 3POFA 1NZIA 1SZBA 3POBA 5CKMA 5CKQA 2QQLA 4LORA 1SPPB 3POJA 1NT0A
chains in the Genus database with same CATH superfamily
1NQJA 1R64A 1ULCA 2PELA 3PL0A 3ZXLA 3BU7A 4NMIA 3TN93 1E5SA 2LM3A 1W03A 5J7MA 5FYSA 3MIDA 5CEHA 4QGMA 3SEPA 3WY6A 4YVSC 4AHWA 3NNLA 3TAYA 1LRHA 4UF0A 3MIHA 1QQP1 1A6CA 2ZHNA 1EYBA 4JKMA 2A1XA 4BLIA 5T50A 4BQWA 4E8CA 4KWJA 3CJIB 4JGZA 4Q4W1 4LBNA 3BCWA 4Q4Y2 2RM23 4CDXC 4IV3B 1RUF1 3OGRA 1O4ZA 1PVC3 1XNBA 2ADDA 4FQZA 1IHMA 2YGLA 2OQ6A 3O0WA 4TLFA 3I2OA 4NRMA 2C1FA 4S2GA 2WO2A 4QPIA 5BNPC 3NVCA 4PIYA 3WD5A 1H6XA 1UX7A 4Z82A 2RG4A 5L9BA 4KMQA 2OUJA 2R32A 2ARXA 2WNVB 3KM5A 4R4XA 1V6JA 2FD8A 1IPKA 3B9IA 4QWNA 5KXDA 4CUAA 2HWE2 4CP0A 1RITA 2K0GA 2HWD1 5A1FA 2X29A 2JX9A 4C1WA 4GWIA 4YW1A 1LEMA 2ZGSA 4YGDA 4AFAA 1R081 2ZHLA 1GQHA 1Q8VA 4XMAA 1R091 1Q8SA 3B5LB 5JIUA 2DUPA 3OEAA 4XBQA 4EV0A 1NYWA 2QQUA 2YBKA 1PGL1 3ILNA 2VCCA 5B2GB 1ODMA 2ET7A 3H1YA 1CVNA 3K3OA 4YVWB 2LTNA 2QDRA 2J1RA 3BIEA 1RUJ2 3CJXA 1COV3 2O1QA 4XCBA 1PK6C 2WO7A 1RUI2 1RUD3 4GD4A 1OF4A 4IGPA 4Y33A 4OQ9A 2WQZC 3AX4A 3FZ3A 3I97A 3OBAA 5BNNC 5J48A 5JZGB 3VBOC 3HVDA 2XPJA 3POWA 2BNMA 3ORJA 3U14A 1ENQA 2DCYA 2CYFA 3N9PA 1GZWA 3FL7A 3A7QA 2ZMNA 4CXXA 2BUKA 3ACFA 3FHIB 1ASJ1 3VLBB 4G9SB 4DUXA 4HL0A 2HEWF 1ZBA2 4AHXA 5AFBA 1CX1A 3KT1A 1UY4A 1W2AX 4RQPC 3AK0A 3WG4A 2WNEA 1Y9GA 1W05A 2JJ6A 3IPVB 3K3NA 3NAPC 4NVPA 3VD4A 1V6OA 2VNVA 4P9YA 4JX0A 3S6PA 1Q8QA 1MS5A 1H30A 3I59A 4R9AA 2JEMA 2AACA 5GLVA 5GJ6A 4CDWB 2Q1MA 5LA1A 5FDBA 3A23A 3O5SA 2WAAA 1CAVB 1W6QA 3FFQA 4IDZA 3PVNA 1HXS2 1CAWA 4GB32 3VUOA 3TBDA 4B7EA 1JI6A 1R1A3 3VBRC 4EN7B 5DAQA 3S57A 1V9U1 3ALQA 3FBMA 2P5BA 2IXIA 1ZBE2 5A33A 2VY0A 5KC6A 4AGVA 1WZXA 4Y5SA 4RS5A 1HB3A 3GBGA 3RZLA 1RUNA 4QGNA 2WZR2 2YC4A 2ETEA 3OB8A 2MEV3 4WM7C 2OPWA 3LGRA 5L9VA 5C9AB 5J1XA 1WBFA 2D5FA 3QACA 1OLMA 4Q0SA 4E4ZA 2FDFA 2ZBJA 5F5AA 5A3LA 5I0DA 3B7MA 4DXRA 4KL1A 2GMPA 2XWJB 4LBKA 4ORFA 4D94A 3KHBA 5FV3A 1GWMA 1YFUA 1QWRA 2Y64A 2VNRA 1C28A 2RS52 5LK7B 3WF1A 2WS93 2AENA 5FMBA 3MF9A 1PVC1 4P9JA 3V65A 5K7PA 4ONUA 2ORZA 1MEC3 1S0CA 4LIVA 2QQNA 2WWUA 2X09A 4D6SA 4AL9A 2VU9A 4XJAA 1CJDA 1BHGA 4LHNA 3WCRA 2VUAA 2CWSA 3RI9A 5BNQA 4BH9A 2RR11 2OYZA 4WVZA 3AMPA 1WUVA 3WP3A 5KXBA 2VJXA 4QPGA 3AMQA 3OY8A 4INDA 2IFRA 3JU9A 1ZZBA 1J3QA 2AGSA 3PJQA 4K7JA 3DYOA 4QXBA 1WCQA 4Y1YA 1SLBA 1W0NA 4LMFA 1GNYA 3RZZA 4N43B 1W2UA 2HWC2 2N7GA 4L2NA 3ZFEA 2BNNA 1MPXA 5FLJA 1PO22 5SV8A 2VOWA 1VMHA 1VB4A 3ZFGA 4BQ3A 5A70A 2HWF1 2IZWA 1NXMA 1V6LA 1UYZA 4IEZA 1AX1A 1DBNA 2WWJA 3CZUA 4DFSA 4GWMA 4ARXA 1UL9A 1TVGA 1W9WA 3E6DA 1UOFA 2JG8A 3D5OA 4NRPA 1G9DA 4R8HA 2ZABA 2PHWA 2RDSA 3MFAA 4L92A 1MZFA 2A6YA 2IFWA 2P4EA 1S1AA 1NUKA 3OEBA 4AFCA 4TTGA 3CF6E 3PU3A 2CDOA 1SQ4A 2IXHA 2Z5WA 3Q8AA 5IYYA 3POGA 4XIKA 3THTA 3E5QA 2D40A 2QTWB 2VVEA 1YFYA 2JXAA 3N7JA 4CCNA 3AZYA 4COUA 4DO0A 2XMLA 4NIHA 3VBFA 1HN1A 1K5MC 3HN3A 1JZ2A 2JIGA 2R7EB 1CR7A 2D6NA 2FCTA 1JHJA 2JB4A 3R4SA 5EZWA 5A7PA 5BNPB 1LOFC 4LO8A 1W8UA 1W6NA 1W8TA 2XBO2 4RR3A 2VNOA 2X5IC 2ZGKA 2HH9A 1XPWA 2GNMA 1U5YA 2RMU3 3AP9A 5JPNB 1GQGA 4LEJA 1UNBA 2JDUA 2NP0A 4AAXA 3NSTA 2GALA 1SMVA 1QKQA 4AEJA 1IS6A 4BHPA 4MXWA 4YGCA 4Y20B 3IB3A 1KFXL 3CIHA 1AR61 1R1A1 1ND3A 4OUMA 1VPHA 1J1TA 1QMJA 2BVBA 4XQ4A 4Q8KA 1YUDA 2JKXA 4GA9A 3ZPYA 3KV5A 4GMP3 1VBC2 1SLLA 4EWEA 4A6OA 2RS11 2YC0A 5F2SA 2IXCA 3LFMA 1E5HA 4FCAA 5AVAA 2XL9A 1D7PM 3CLPA 1RUOA 3NNGA 3I3QA 4Y5Z0 1L7RA 1PK6B 1RUG3 4N53C 1HB2A 1JZ7A 1D4M1 2OS2A 4K21A 2ZZQA 4RGGA 4M3CE 5CFCC 2CGPA 3VKFC 1JXNA 1QJX2 1UF2C 4FO9A 1RL3A 3C3VA 4FP3A 5FP9A 4HETA 1NZCA 1NA1C 2ORXA 3ZSJA 2ARAA 1O91A 5FAXA 4MADA 5EWSA 4PJYA 3GHNA 5KXCA 3JUUA 1YEWA 3OGVA 4YG6A 4ASLA 4P9XA 1UMIA 5CKNA 4XQDA 5LA9A 4JGYC 2W1SA 2VO5A 3LFIA 5A7WA 3WLUA 3OBRA 2XJRA 3NAPB 3MIFA 4E8DA 3T0AA 2R0FA 2VTXA 2QQLA 4GB33 1URXA 1XNKA 1ZA4A 5F32A 3ZYBA 5JOWA 2W2IA 2H6BA 2V4VA 4B1MA 2VOVA 5K0UA 4IUGA 3UGGA 1MR5A 4ZU4A 2UWCA 2WZ8A 1ACCA 4NPRA 3D8CA 3GYDA 2CHHA 3ZDVA 3VBUC 4BWOA 5F7UA 3ZSLA 5A80A 3WDVA 2CAUA 2OXBA 4WV8A 4QDRA 2X53S 3VBRB 1KITA 1PIV2 1LNSA 2D3RA 3GXUA 5BNOA 1MQTC 1JN2P 4Z2WA 1VBD1 2PLV3 2YDEA 3J9SA 4B3NA 1BCXA 3UK9A 4CEWC 1UXZA 3GHMA 5ACA1 4I09A 4LKFA 2QZ2A 1RUE2 1NCRA 1TEIA 2DU0A 2GNTA 1N1TA 2WFPA 2YYOA 2ZACA 3ABZA 4WM7B 5FPBA 4KGGA 1RINA 2RS53 1D2QA 4MGZE 1XRUA 2EAAA 5F5CA 3LCPA 4CXWA 3PJYA 2OVUA 4OI0A 4MGIE 3TNQA 3WP4A 1DQ4A 4MZUA 3HOBA 2X05A 1DCSA 1PNGA 1RMU3 2D7FA 1OKOA 2KA3A 1F4AA 2WFF3 3E97A 3THCA 5GZDA 1YI7A 3WNKA 5CFDB 3I2FA 2A71A 1W6MB 1TQ5A 2XR4A 4XILA 5A6ZA 4YPJA 4FFIA 4FPCA 1DYKA 3WW1A 1JOBA 3RNSA 3AMNA 4BYYA 1O3RA 2HYXA 2VOTA 1FXZA 3N7LA 3PMSA 2ZMLA 2VUCA 3U07A 2DVBA 2ZX1A 1UMHA 5BPXA 3SKVA 5FPVA 4NJ4A 2JG9C 5FZGA 1RUC2 4K9SA 4R9CA 4QB2A 5LEKA 2QQJA 4QMAA 5FZOB 2EIDA 4EYUA 2GC0A 2LALA 1DQ0A 3OSDA 1FOD2 4H7LA 3D6EA 2RS33 4NOTA 3AYCA 5E8AA 4URTA 4ZXEA 1JZ8A 5IK7A 1AR82 3LE0A 1SG3A 1TME1 3D4KA 1VMJA 2E7AA 1PO23 1AJOA 1PO12 4LBQD 4XCAA 5GLWA 3V64A 1TNRA 3UT0A 1AYM3 3ZYPA 3RMYA 3LPGA 5C7GA 4AFMA 3ES4A 3H0OA 1AR93 3VD3A 3ZYFA 5F1RA 1BJQA 1V6NA 4QX0A 3T08A 3ITQA 1JYXA 3B00A 2G9ZA 3RGBA 5HCFA 4M4RA 3IIAA 4LNVA 1YC61 1J1LA 1YQ2A 4FFHA 4JDMA 3I2IA 3LD8A 1RUG1 3CKHA 1NG0A 2Y6GA 4GH4B 3N36A 5JCTA 4LO7A 4XAEA 3KF5A 2DV9A 5FPLA 5E1RA 3HT1A 1FV2A 4E2QA 1SPPA 4HOOA 5EP9A 3LDBA 4IE7A 1QQP2 1VBB3 2XBO3 1X8EA 4UFMA 3ME2A 4Y1ZA 4CZSA 5I91A 3PVOA 4KWKA 1NE6A 1FAYA 4XDPA 2NZ9A 1UYPA 3B94A 2BTVC 3M3IA 4MX3A 4Q4W2 1G7YA 4AG4A 2BERA 4FPYA 3ZSEA 5LEJA 1RUF2 5B4NA 3DKQA 3IIIA 2BGCA 5BXXA 4B1LA 1IG0A 3LDKA 3N9LA 4YG3A 4LIUA 2WZPP 1F4HA 2X5IB 1H0BA 5I0RA 5GLTA 2VZTA 1XU2A 1VBC3 2JDKA 1P8JA 2W9XA 4AW7A 3IAPA 2D3PA 3G7DA 2DURA 2ZOEB 1HIXA 1FYUA 1UY0A 1YO8A 2ZEXA 4P14A 5HCAA 2OA2A 1UU4A 2Q8EA 4XFIA 2PLV1 2ZAHA 4IV1B 3WCSA 1HQNA 2EXHA 4A3XA 3GNEA 2PN5A 4P9IA 1R082 1AZDA 3W59A 4QKFA 3VD5A 3ZR6A 1R092 2CV6A 4FXGB 3TEZA 1QJX3 2FZ1A 2OZ6A 4Q4V1 2GN3A 2GP5A 1NLQA 3HNMA 1CIWA 1H1IA 4UXAA 1JW6A 1PGL2 2ZTNA 4YW5A 3FX3A 1FPN3 3E5XA 1ZZ8A 4HVQA 4N53B 1YFWA 2VBPA 2WFF1 4ISQA 4JTOA 5G04L 3JQWA 2W1QA 3BPSA 1I5ZA 1U5XA 2YG0A 1JZ6A 5FOJB 1US3A 3I3EA 4H3WA 5H9SA 1G9BA 1KDMA 5F39A 4LTAA 3PUIA 5FJHA 3P3NA 4XTMA 3I4IA 5A3WA 2VZVA 2ZHKA 3MHZA 1G86A 4CDUA 1OURA 1CAXA 1YIFA 3POSA 1W8ZA 2GNBA 4YGBA 4JGYB 1Y9MA 2V4AA 1CN1A 1ASJ2 1WMEA 1OVPA 4MUVA 2ZS6B 5JAXA 5HV0A 4DMIA 5FMDA 1EUTA 1RUH1 2RS31 3WDUA 4FOQA 4XFBA 5JMOA 4BB3A 1B35C 4YZ1A 2ZPXA 1AYM1 3AKRA 3J8F1 3EYPA 4ZY9A 1VE0A 3AYAA 4RGKA 3VBUB 4JZRA 4MXVA 1DG6A 4YSFA 2VUJA 1AR91 3JQXA 3ZX7A 1T6BX 3VBSA 4AI1A 4WVWA 1H9WA 4HMZA 4CEWB 2CAVA 4OHYA 4M3CF 1KD7A 1EAH3 4BMEA 1TMF1 3F2ZA 3FJSA 5F3CA 1V9U2 3AYDA 4LJHA 1XU1A 2QQMA 2R062 2XJPA 1OT5A 3ZDSA 1CZVA 1SZBA 4BQ2A 5J09A 5D21A 1HRI3 3ILFA 3T2QA 2OZJA 3TN92 4JDNA 4QPWA 5F5IA 5CVRA 2J1EA 5J96B 1PGW1 4DINB 3POJA 1UU5A 4XIOA 5C4WA 4XJZA 1VBB1 3A22A 5CB7A 4A6SA 2E33A 4XFFA 4AQ2A 2C24A 4Q0VA 4L0PA 4JKKA 4KBZA 5A6QA 1FOD3 4YW7A 3MEPA 4BQYA 4K8FA 5F3GA 3OGJA 5L9RA 5AFEA 5C5UA 1PVC2 3DYPA 2VZPA 1H2MA 2JG9B 3H9AA 1GZCA 1PM7A 1X7NA 4O9GA 2P3YA 4BZ4A 2IC1A 2VTXJ 4A42A 2DCTA 1BK1A 4K1YA 4LXLA 4DS0A 2VCAA 1O59A 1XNTA 3T30A 4LKSA 2RR12 4Q2FA 3WW2A 2Q0AA 2GMMA 3OGSA 2RHPA 4HK9A 5LBFA 5A7SA 1C4RA 1YRZA 3C7OA 4LITA 4UF0B 5FZ6A 4NIIA 4YVWC 3RSJA 1F15A 4IEPA 1TE1B 1U5ZA 4NIGA 1XC6A 2UWBA 1PZ7A 4EN9B 3H3UA 5GKAC 3VL8A 1V70A 2IUWA 4R9BA 5FYTA 5JSRA 5JZGC 4XUTA 3WQ0A 2WIIB 1FPN1 3KHCA 4Q0QA 3RPQA 1QQP3 4QX2A 3N35A 4L99A 2HWF2 5JOXA 2WWSA 5H9QA 4D7SA 4QPIB 5DZFA 2RJLA 4FPFA 4K1ZA 1LOBA 3L2YA 1AF9A 4OI2A 1Z7S3 2Y0OA 1RUF3 2I45A 3LPFA 3C2UA 3U0ZA 3VZNA 4KG0A 1OUSA 1MZEA 1S2EA 5I8TA 5JIAA 1FV3A 3VZKA 1F8VA 2ZGOA 2WRAA 3UL2A 1HN0A 3W5NA 2D6MA 4CDWC 2GC1A 1J83A 2GZWA 2P6HA 2VCBA 2WT2A 5FY0A 3VHOA 1O4YA 3W9AA 2BOJA 5JI9A 5F37A 2HWD3 1S2KA 2XKOA 1LULA 2VZSA 2LS6A 1GNHA 1NQDA 5GZCA 1IQAA 3LB9A 3HJRA 1AX0A 2WQ8A 4KU7A 1R093 3BIWE 2WL1A 1SBFA 5IFTA 3UKTA 4K40A 2I74A 4OUEA 5IATA 1O3QA 5F5QA 5LATA 1FNZA 2K2SA 5A7NA 1LR5A 4K20A 5FZ0A 4GALA 1EAH1 5D8AA 1R1A2 1OSGA 2I07B 2WNUA 4RA0A 3C7EA 5FYIA 1AR62 4MGTA 4D69A 4CCKA 1I3HA 2A6ZA 1GZWB 1OH3A 3HD8B 3HR9A 3IDAA 3ZXAC 1REEA 2PTMA 2B9UA 1C8NA 5JXIA 2XXZA 3ZN5A 3GBFA 2RS12 2CNAA 1SFYA 1OHFA 1L7QA 1AL23 5JOYA 1OKQA 3KVAA 1FMD1 5IVBA 3A4UA 3OG2A 3WP6A 1ODNA 4EN8B 4YZ4A 4NPLA 3E6BA 2FDHA 3AL6A 5FPZA 1CQ9A 3JCIA 1AVBA 4Y22B 4QM8A 5FO7B 1YJKA 4BM8A 5ABJA 3I59B 2BZDA 3IKWA 3LA3A 4LBLA 1W04A 2DYCA 3WSOA 1NCQA 4UFJA 1Y43B 1M4WA 3I3MA 2QDNA 2A6WA 2ZEWA 3WF0A 1W6QB 2XLAA 1CAWB 2VC9A 4P5HA 3X29B 4MH0E 1ZZ9A 3T4VA 2L9LA 4DXSA 3CBNA 1O8PA 1ST8A 3K48A 2EA7A 4FFGA 1JYNA 1J3PA 4RS5B 1H8TA 3JZVA 1C57A 3RG0A 1AJKA 3SCGA 4FTEA 4A7KA 5FCCA 4WBBA 4N43C 1ENRA 5K4LA 4UW4A 3ZIWA 3MV01 5KHKA 1O8SA 3AMMA 4AF9A 4MG2A 5L19A 2JE7A 4PDWA 2MHFA 1BQPA 4NHLA 4CCOA 2WN2A 3QD6A 4IEYA 4YFZA 4Q5OA 3V0AA 2ZA9A 3HT2A 5E16A 2DU1A 5CNAA 1J58A 3DPRA 1JYVA 3OD4A 4ASMB 1MS8A 4JQRA 4CCJA 3N9NA 1J84A 5HV4A 5IUQA 2EIBA 3RYRA 1STMA 1TG7A 4HSJA 4PI0A 4GKXA 1N3QA 4HKWA 1W0OA 2QVSB 3WINE 5I0UA 4AR2A 1JU3A 1Z7S1 1BZWA 4S2HA 2ZGTA 3OJBA 5KR7A 3VBHA 1LESA 2JECA 1F2NA 2BEOA 4ATEA 4GWNA 5KXEA 2J1UA 2GN7A 3CEWA 4Z92B 3AFGA 4XF3A 1JUIA 1REFA 1UZVA 2G1MA 3QH6A 4GQ7A 4CYDA 1DIWA 3KT4A 3S5QA 1ZZ7A 4HN1A 4I3GA 4OLLA 2RDNA 3A21A 1ZRRA 2RR13 2CGOA 3LZZA 2Q1FA 3C7HA 3ASIA 3NQHA 1ULPA 5LA0A 1WCKA 3KCXA 4JC1A 3SMHA 3ZFGB 4M3CA 3HWJA 3BOWA 1GU3A 5T3NA 2DVGA 2QCSB 1VBE3 1NXD1 2RMU2 5EJ3A 3LDRA 1ZA7A 3ZN6A 1LGNA 2GH8A 1OPOA 4RYDA 1TME2 4D0QA 1JYTA 1WMFA 3NJXA 2JG8B 3ZM8A 2AEZA 1WKYA 2O14A 1WCSA 2HWF3 4YGEA 4EZ4A 1UWWA 2Y6LA 4P9WA 4C90A 3AM2A 3ACLA 4JCKA 1XYPA 1MS1A 2DFBA 2ZZJA 2XLGA 1D4VB 4JKLA 2LROA 4RFT0 1RVF3 3B93A 1AL21 3NV3A 4ZS2A 5A3PA 3I8TA 3OGGA 3BGAA 4MLOA 5FZBA 1I6XA 4Y1UA 2E63A 4Q1RA 3AZXA 2Q5TA 1W9SA 1V00A 2WJSA 1RUG2 1W6NB 2D98A 2VZUA 5FYUA 4LO4B 3DF0A 3LA7A 4FPHA 4CCMA 3DXTA 5FREA 1MS4A 2XWBB 5FUPA 5JWPA 4QX7A 4DXZA 1WD4A 2QFEA 5LBBA 1Z78A 2QQVA 4UT5A 3WF2A 2W46A 4CDQC 3WUCA 1WLDA 4ATFA 1LKNA 5IW0A 1J59A 1CPMA 4RFRB 1W8WA 1Y3TA 3ILRA 2VVDA 5JXJA 4A3ZA 1F31A 4AI2A 4WZCA 1UY2A 2XQRA 1RGSA 1CWPA 3MBWA 1ONAA 1OQDA 2D3SA 2BQPA 4CEYC 1GP4A 3SCHA 4JHTA 1H2KA 1AR63 2VXRA 1YJLA 2D5HA 3OUIA 3ZN4A 4S2DA 2IVJA 1A3KA 1LCLA 1I9RA 1S4CA 4CRQA 3KD4A 5JDBA 1ULOA 2JDAA 2RS13 2CTVA 3R05A 4NPMA 1UKRA 2D6LX 3O1VA 3FC0A 4XW3A 1ZRFA 4FTBA 4FOWA 2XVGA 3J7LA 1IS3A 1WWYA 4MYEA 3WUDA 2PLV2 3NL1A 4JRAA 3B9CA 4XQWA 1XNAA 1D4M3 1RB8G 2PQSA 4V2VA 4IEQA 5FBZA 2SLIA 3VD9A 5FZLA 3OYWB 2WO3A 5FK8A 5CFDC 5A7WB 5FTTC 1BEV3 3WNLA 4H2AA 1TNFA 2R0HA 5C8CA 2Q30A 1GFF2 4HANA 3WHUA 2CU5A 1MS0A 1PX3A 4TXWA 3T2TA 2O0OA 4BIFA 2VVFA 3W20A 2FBEA 1RMU2 2WFF2 3NWKA 5K0UB 3FLPA 4OHVA 4FSJA 2HJIA 4GJYA 2UWAA 1UYYA 2W1WA 2PXJA 3H50A 1ZRIA 4MGYE 2Y0IA 4NN0A 4TLGA 5C33A 4UW3A 3VDDA 2AC1A 1KQRA 5EV7A 3AJYA 5FYZA 3PNAA 2YPJA 1K45A 4AFDA 4LA3A 1UOGA 1GZ9A 1H1AA 5BNOB 1BVVA 4PF5A 1Q56A 1YQ5A 2H0BA 5FP3A 1UY3A 2VULA 3VDCA 3FUQA 4IESA 5KC5A 3OBZA 1VBE1 3VV1A 1QH6A 1RUH2 2RS32 3ZMNA 2ID4A 2WLQA 3NW4A 1EUUA 4NIDA 2W0XA 2O8OA 5ISLA 3OPZA 1XYOA 1D2SA 3CJIA 4RN5A 1VBD3 3V56A 1AYM2 4FAGA 5ACA3 4IV3A 3VKNA 2VH9A 3C7GA 4P08A 1NOVA 4RHV1 2BVVA 2ES3A 4C8DA 1AR92 4GH4C 4P9GA 2OPKA 1RVF1 2XVKA 2JIJA 3WF4A 3KCCA 3WZ1A 4ZONA 4AE2A 1BKZA 2WNVA 4YYOA 4V2WA 4FAHA 2R073 1TMF2 3CMGA 3MF6A 5FY7A 1QDOA 1Y4WA 5FXVA 4UFIA 1IZ3A 1SFPA 2E6VA 4PLOA 4QXKA 5CYYA 5I8SA 3UJQA 4AEMA 4LT5A 4FTSA 4WVMA 4YFWA 4V1PA 4AEDC 4CE8A 1S55A 4XPVA 4N8MA 3DN7A 1QJFA 4L11A 4NHXA 5EJ1B 2OT7A 4LOSA 5DAVA 3SC7X 2Y6FA 5EYYA 2XL7A 5FZHA 3ZFFA 3DKWA 3RQ0A 4CUGA 1DHKB 2VBDA 1PGW2 1POV0 4YLZA 1HJFA 2PFWA 1VAVA 1DGLA 2A6VA 2DBIA 2BGOA 2Z4FA 1VBB2 4DB5A 3BTZA 1KRIA 3VHRA 5J37A 2GH2A 1RHI3 4NR1A 1DZQA 3KB5A 3P3PA 3N7KA 3RZHA 1TME3 4NIAA 1WLCA 1FATA 3SH5A 4I02A 4BLJA 5F6LB 1Z0HA 1UZZA 4L9BA 4CA9A 4QT6A 2XJVA 3AVRA 3DCQA 2PHRA 4GWJA 5LRSA 4IV1C 2EICA 5FOBB 4O7XA 1RJ8A 5FJKA 1E57A 2W1UA 3D3AA 1UPIA 1W8OA 3K46A 4HONA 4D7YA 4B4PA 3GGLA 1OOPC 2OX0A 1Y9QA 4XF4A 3THDA 3GZUC 1NY71 1SPPB 3W58A 2BGPA 1BLZA 3ZYRA 3IPVA 4FQ4A 1GOFA 4YW6A 2W47A 3S30A 4BXFA 5ERLA 1DLLA 4FPLA 4XDQA 2QJVA 3K51A 3ECQA 3RI8A 1NX9A 2YFZA 4YG0A 4I30A 1PM4A 5FQ0A 1BEV1 1W3VA 4KG8A 5DXDA 1FPN2 1CAVA 4A44A 5DZEA 1ND2C 3KGZA 4ASKA 3O12A 1C1FA 2VQTA 4I3PA 3RJ2X 3VKMA 1KEXA 1NE4A 4IW3A 3ZSKA 4IE4A 4XFHA 1X82A 4Z07A 4CDQB 3K2OA 4DEVA 2W94A 2BBVA 5C9AA 5M0TA 1GICA 1ZYBA 3EQEA 4IEOA 3WR0A 1JU4A 1LHOA 1S0EA 1GUIA 5T52A 4CVUA 3O1OA 4K3UA 4BU2A 4KI5M 3AP6A 1QJY1 5L7OA 1TZOA 2ZEYA 4DQAA 4CEYB 3BOPA 5C3PA 4LE3A 3U10A 5I8YA 1WW4A 2BNOA 5CISA 3IZOA 2VE1A 2YHJA 4W6WA 1YIPA 5FUNA 4UYBA 3P1IA 1YXWA 2Z69A 3WG3A 2VUDA 2VQUA 3B01A 1X8MA 4AQ6A 1Y7BA 1N1YA 3ATGA 2W5FA 2QQPA 1YFXA 2VQ0A 3CO2A 2K46A 4Q4V3 1XSQA 1BMV1 4WM8A 2DVAA 4AEKA 5FBJA 5JSOA 3O1SA 2HWB1 1SFNA 1OLQA 1N47A 1KGYA 1EAH2 2R071 5F3IA 2Y6HA 1L7LA 5IJRA 1LU1A 1JYCA 2VG9A 1H9PA 2V73A 1UN1A 3BB6A 1VJ2A 1OMIA 2ZKLA 5E89A 2VZQA 3MW2A 1XJAA 1H6YA 5FPAA 1HRI2 2GDFA 2ZKNA 5JUVA 2DVFA 1SEFA 2JE8A 1FMD2 2B39A 4O9EA 3ZXGA 2LUWA 1SBEA 3I7DA 2MNGA 2BP6A 4Q4Y1 2JWPA 4PLNA 3T0DA 1MVQA 1WCUA 3FBYA 4N7IA 4GIQA 1MS3A 1MVEA 1RHI1 2G9FA 3IMNA 3POYA 1RUH3 1ZZCA 4COWA 3WQ1A 3WX5A 4CPBD 4A7YA 1DYPA 5JI7A 2G4IA 4UFKA 2HYKA 5A32A 2OW4A 1YCIA 4EN6B 3J8F3 1QU0A 3SXWA 2YC2A 4YVSA 1OA4A 4H14A 1F35A 2XOMA 5LBCA 2Y6KA 4B7KA 1ZM1A 3PVBB 1OLME 3AP4A 4NWWA 2F6BA 5FMCA 1GOGA 1SDWA 5FWJA 2GMEA 1GR3A 4JRLA 4FFFA 4E4SA 4CSWA 5JPMB 2VMHA 4JGZC 4KWLA 4CDXA 1TMF3 2VR4A 4UBHA 4DUWA 3ZR5A 5LA2A 1X9PA 1GNZA 2JDHA 5C4WB 3RFRA 4FOVA 5FZ4A 3U1XA 1LODA 3WF3A 5BNPA 4K8RB 2I2SA 4QPIC 5AC93 1VRH1 4YZ5A 2WA3A 4BE3A 1PHMA 4HBNA 3O1TA 5EJZB 4LHLA 2HKXA 2XJUA 4FPEA 1IPSA 3BI3A 4PI2A 3CDZB 3SQOA 4AEDB 3FHQA 2ZGMA 4QKBA 3I2DA 4BISA 4F8AA 4W65A 5IVFA 3AVSA 3CHXA 4XAAA 3ON7A 1Z7S2 1JTZX 2JDMA 5FYYA 4BDVB 1C8M1 5IWFA 4BOWA 2QBXA 5EFUA 1HV1A 3GM8A 2CDPA 4KWUA 2WYFA 3L2HA 1H4GA 1W9FA 4PBOA 1EY2A 4QPYA 1C5HA 5D1IA 2AR6A 2DBNA 4URAA 1PK6A 5TSWA 2A75A 1DZRA 5HXVA 3AMHA 5BNNA 2HWD2 2P34A 4KBBA 3VBOA 3ETQA 4DNYA 4PLMA 1NAEA 5FFOC 4NRQA 1KXGA 3N7MA 1HXS1 2CWMA 2QQOA 3MDPA 3ZPOA 2VECA 5LW9A 2CL2A 4BMBA 1XXNA 4J25A 5EQUA 1OOPB 4M01A 2PYTA 1I5PA 3POBA 2DCJA 4RQPA 5F6KA 4BPZA 3NAPA 3GF6A 3KS7A 4EZHA 3OUJA 3JD73 2ARCA 5C3RA 3VKLA 4CP1A 2R043 2BRTA 4PQ9A 1T2XA 3KZ4C 1VR3A 3FUOA 4ZU5A 1EP0A 2FHRA 2QQIA 1G9FA 2XJSA 1HRV3 1ZX5A 1AL22 3NMBA 2Y33A 5IAVA 1AYN3 1CZSA 3WHTA 3PU8A 1F5JA 1LHNA 2P1BA 1AXKA 1ND2B 4CXYA 3NV4A 3VBRA 3PUSA 4Q4X1 3AJZA 3Q8EA 4NWVA 4X6QB 3T2PA 2ADEA 1D0GA 5FZ3A 4ZZ5A 2FDKA 1XB9A 4RS5C 5FK7A 2BWAA 4WM7A 1QDCA 4H7MA 3IN9A 5IT6A 4XJ8A 4Q0UA 2GSYA 2D43A 3TB0A 3RS6A 2YBSA 1JH5A 1QIQA 4UBGA 4A7ZA 5A1LA 1CAUA 5FZEA 1PZ8A 2P37A 4M00A 3GDBA 4MO3M 2ERFA 2WNOA 3R4DB 3TWIA 4CP9B 1ZNPA 3IAQA 1YYNA 4COZA 3QLQA 4FPGA 3H8RA 1OD3A 3MIBA 4IEUA 4EJRA 3OPTA 4N9IA 4XABA 4QQHA 3HBKA 4OI1A 3T09A 1UOBA 5GLUA 4CU7A 4OULA 4Q1PA 3UGFA 3O1UA 2O8QA 5D2AA 2V72A 2RJ2A 1GWLA 1T6GC 5T5LA 2C26A 5JOZA 4DUVA 4C1XA 1VBA1 3U4XA 5LZ6A 1DGRN 1O5LA 1PMIA 3JB8A 4Q0PA 4DXTA 5AC91 3ZKUA 3BTXA 1IGOA 1NCQB 3LEMA 3OUHA 4R9DA 1FMD3 3VKOA 3BUCA 3HQUA 2XGXA 1Q3EA 3PVEA 3NNFA 5DAPA 3ZXEA 2JICA 1BK0A 4CCDA 2QNKA 3FE5A 4HXCA 4QPGC 3VZLA 1EV11 3L9JT 4FP2A 4YM0A 1DDLA 1H8TB 1MZ6A 3A0NA 3KV9A 3O1PA 4G4FA 2JD9A 4PIXA 5EHDA 1CZTA 1Q8PA 4XF9A 3H8UA 3HAGA 4P00B 3EBRA 1WW5A 1UYXA 1IG3A 3GJAA 4QX1A 3ZFEC 1W8FA 3ZFGC 1W6OA 1K12A 3O1RA 2AEYA 4B4QA 3PUHA 4PDWB 3ZIXA 4QU1A 5F3EA 1OFNA 4BCUA 4BQXA 3V0AB 1WA6X 3HBZA 4YARA 1AL0G 4GH4A 5DG2A 2ZGRA 1VP6A 3LEIA 3LIHA 5FY1A 1F5FA 3RMXA 3SEEA 1SCSA 1B09A 5C8WA 4AQSA 1DZTA 1JODA 2JG8C 4U2AA 2UU8A 4XZUG 2YROA 1VBE2 3IBMA 1UXXX 2F4PA 4OUSA 4F7ZA 4JGZB 1VRBA 3PLQA 3PIJA 4QXCA 1RXGA 1K5MA 3VBFC 3LF7A 3H3ZA 3AC0A 4RHV2 3JD71 2AYHA 1LOFA 1W28A 2R041 5FYBA 3T0BA 4GMP0 2VMGA 1N3PA 2X5IA 2EF6A 2JDZA 2PHDA 4RR3C 1HRV1 1HJGA 1RVF2 1RJ7A 5CZKA 3IT8A 1OQ1A 1AYN1 3KT7A 1CX4A 1UZ0A 1XNDA 2BBAA 3FWEA 3I2GA 4IXLA 1QHDA 5L36A 1JZ3A 1Q5OA 5CU1A 5A3NA 5C6CA 3M3QA 3WDTA 2C9AA 2X8KA 5IVJA 4BK4A 3H8XA 4M3CB 1ND3C 2HBUA 3EB7A 4OHXA 3U37A 1NKGA 3SKJE 1X50A 1DQ5A 3T4HB 5DUVA 3KV4A 5T55A 3ZN6B 4PT6A 4BQ5A 2VL4A 3WDXA 5FP8A 2JENA 4OHZA 3H1WA 5JXHA 5FKBA 5T5PA 4XUNA 3OTFA 1O5UA 1YI9A 3GZTB 4YW4A 4LBMA 1VMFA 4N53A 4MHUA 4QM9A 1OA3A 4JAAA 2R1DA 5ANQA 2FZ2A 3PUAA 5CFCA 1ULEA 3J7HA 2E7TA 3WOGA 4JV4A 5IK5A 1MACA 2Z79A 1REDA 4WZFA 2DCZA 5FKCA 3WNNA 5CA6A 3LQCA 1NA1A 1G9CA 4OMCA 4MSVA 2XONA 2ZGQA 4AI3A 1J3RA 2VQAA 1PIV1 5KWRA 1DLCA 1LOGA 4RL7A 2EALA 2ZX0A 4KU8A 3POEA 2DDUA 4JGYA 1GOHA 4S2FA 5DDJ1 3WG2A 1CONA 1RUE1 1LHUA 1W06A 4ZS3A 3I2JA 2V5DA 2B8MA 3Q8BA 3MIEA 1NY72 2Y34A 2C6SA 3MW3A 5A3TA 5F2WA 1GP5A 2ZEZA 2ZXQA 2R49A 4QGLA 1UOJA 4XEZA 1D4M2 5IVVA 5K0UC 1IS5A 3UKVA 1XE7A 5HBAA 2R1BA 4GZ9A 2PAMA 4GULA 1K42A 1JZ4A 5FY5A 2YU1A 4W6XA 1BEV2 1EPWA 1QNYA 4IE6A 3PUQA 3VBUA 1LOEA 2Y8KA 3CNAA 1MQTA 1HQWA 2XVLA 5BNOC 4OVEA 3P5BA 4CEWA 3WQ7A 3H8OA 4LBOA 5A33B 2Y38A 3AP7A 1HX6A 1GV9A 1NCRC 3SH3A 5L73A 2GC3A 2YBPA 3HPNA 2PQQA 4OYUA 5CKMA 4FT8A 2QUOA 4QDQA 1IQDC 2WO1A 3B02A 4UFLA 4XUPA 3FHAA 4ZXKA 4AI0A 2WUHA 1RIRA 1S2BA 2Q1ZB 3E6CC 2C5DA 1S0JA 3TEWA 1QOOA 3RVHA 4NHMA 1QJY2 3SH4A 5FZMA 1XYNA 3LEGA 1XQNA 1PO11 3MIGA 3A0KA 4AZZA 4TZDA 3QCWA 4QHBA 3N9MA 5IVYA 5LY2A 5DQ0A 1GQPA 1NLSA 3CL1A 3JB4C 4Z1VA 3R0RA 1HLCA 3USUA 4DIQA 4LUKA 1RTVA 1VBD2 1QOSA 1QJU1 2YY1A 3JBG3 5FZDA 5ANNA 1DU3D 3DEMA 5ACA2 4XJWA 1OQEA 4CUBA 2RVAA 3PURA 1OPMA 2JG9A 4GAZA 2DUOA 1H4HA 2UY9A 1AR73 2ZJCA 1BMV2 1FI2A 2YGMA 2B45X 1SLCA 2WZEA 1UKGA 4CPBA 4ARYA 1UW8A 3H7JA 4D8MA 2PHTA 1CPNA 2WT0A 1BBT3 4LBQA 1JZ5A 2H6CA 2R072 4QPGB 1LJ7A 3OY8B 1DP0A 4YM2A 2QZ3A 1DYOA 3MPBA 1X36A 3I2KA 3WP5A 1XNCA 1WBLA 2DTWA 5FLHA 5FZIA 1POV1 3V0BA 1SLIA 3QH7A 5I93A 3LWCA 3O1MA 2EIEA 1DQ2A 1H2LA 2RJKA 3QBQA 4A4AA 3ZFEB 1AX2A 1KS5A 2SBAA 2WBKA 1VAKA 4HN0A 5C71A 3TNPB 4JTNA 2DTYA 1S0IA 4OCTA 1ZZ6A 3RWNA 3U4SA 2P3IA 1RHI2 2VZOA 4I0BA 4BJ0A 3RZGA 1VIWB 1W6PA 2J1AA 2P6CA 5HCHA 1A34A 1AXYA 4LLOA 2ATFA 5I0TA 1E5RA 4MGSA 4DOUA 5FR3A 4Y1VA 4LHKA 4RHV3 4LULA 5FIXA 5FWEA 3K77A 3TEYA 2ILMA 4W8JA 1GBGA 1JYWA 4WVMB 2VMDA 4YWAA 1OVSA 4MVTA 4FOYA 4J1XA 1HW5A 1YLLA 2J7MA 5A7QA 4TSVA 3VBFB 2EIGA 2TUNA 3ZFFB 1SLTA 4HPKA 1V6IA 4BA6A 3EJKA 4QHOA 1LTEA 3FMGA 3OBTA 3EO6A 4B8EA 3NRUA 2P17A 1XSRA 2D6PA 4RR3B 3FLRA 2VBBA 3M7AA 3ZYIB 2VM9A 1VRH2 4SLIA 2NYYA 4XYXA 2GC2A 3ACIA 3VGIA 4MXWB 4EROA 4HFSA 3MUY1 5JXGA 4TN7A 4FPOB 2ZGNA 3M1HA 1ND3B 3MICA 5C5TA 2W39A 3WNXA 3ELNA 4OZOA 3AB0A 2QKDA 5IK8A 4GJZA 3WVJA 2NN8A 1V6MA 1DF0A 1OUXA 2HBTA 4P02B 2VAUA 3VDAA 1QJEA 4ES9A 1C8M2 3APBA 5FZAA 4CUCA 3AKQA 5BY5A 1WMXA 4XFAA 5LB6A 1FT9A 1QF3A 5FYCA 1LOAA 2NMOA 2XHKA 3BODA 4LE4A 1YQ8A 4XXAA 4XZPA 4RD7A 4Y22A 3NV2A 5FQ0B 2VOKA 2BV4A 4QKDA 4QHZA 1ULFA 1W2TA 2E9QA 1WMDA 3GJBA 3JBG1 4TWTA 3P6BA 5DZGA 3UV9A 2Q8DA 4CDUC 4XJUA 1OH4A 4XHBA 1AR71 2ARBA 4Q4V2 2P3JA 5LCWL 4NAOA 3DYMA 2KXLA 4JVAA 1AUYA 3J4UH 4ZZ8A 2R061 1BBT1 4J1WA 4B29A 4AVTA 5FP7A 1B35A 3RYPA 3TN91 1DGRA 2XB6C 1W9YA 1JOJA 1UPSA 4M0NA 4Y5TA 4YW2A 4A2UA 5L7OB 3T1LA 5FZCA 1WLTA 5FO9B 3UYJA 2WKKA 4MOAA 1BYHA 3ZLIA 5HI0A 2FMDA 2W52A 4GXLA 4XF0A 4D3WA 1W90A 1W2OA 3VDBA 2Q4SA 4K6BA 4KNCA 3VBSC 5C70A 1ULGA 5IK4A 4XC9A 4Q4X2 1YHFA 2YZ4A 2RM21 3KV6A 1QJY3 2HEYF 4XURA 1NCRB 1V0AA 3C7FA 3POIA 3IDCB 2MPFA 3WNOA 5EIYB 5K8SA 2ZCWA 3M3EA 1G8WA 4WM8B 2FDIA 4BIOA 2XHNA 2R30A 1ULDA 5DUXA 4DRVA 1UIJA 1HDKA 2EXKA 2YV8A 2ZGPA 3J8F2 4LK6A 2VMIA 1HQLA 4Q26A 3KLSA 4YM1A 5HCBA 1KFUL 5LY1A 1NT0A 5F8PA 3ZXDA 5C4WC 3LSDA 4W6YA 3ZMOA 5J36A 3WW3A 3K75B 4ZPIA 3RZKA 3LA2A 4NUBA 4AVSA 2HWB3 4NAMA 4QX8A 4HZFA 1OD5A 3LIGA 4E27A 1FNYA 3BALA 3IM0A 3I2HA 1HV0A 4UW5A 1XOYA 4Q29A 5FLIA 4EWAA 3BYWA 5JR7B 5F9TA 3WT3A 1V6KA 1VBA2 3MFCA 3WNPA 3PDQA 2YUEA 5BV6A 3AZVA 4PCRA 2J1SA 1IKPA 4AFBA 2KR2A 1WW6A 5AC92 3S7EA 4PF1A 5JMCA 4AVAA 1COV1 3IWZA 4UW6A 1RUD1 3T1MA 3DGTA 5DG1A 5A32B 1LAJA 2VOXA 2BWCA 4Q4Y3 4A45A 3HNBM 4YVSB 1EV12 2XUMA 3ZXKA 4FVVA 4AI8A 4YVWA 1F9KA 1OC1A 2VMEA 3EHKA 3LKJA 3RYKA 3J7NA 3SHRA 1LGCA 3HQXA 2IVIB 3AZZA 3INAA 4D6QA 1SLAA 2RE9A 3HQRA 2YB7A 5IAXA 2JB8A 4CDXB 4I01A 4ET7A 3E5UA 5JZGA 3HMYA 3TOJA 5JVVA 2B46X 1JHNA 1RC6A 2HWE3 5FYVA 2Z2SB 1W3XA 1NZIA 2VCMA 3BU0A 3CZJA 2ENRA 2EXIA 4OFGA 3RDIA 3UESA 4HLTA 5LASA 1UY1A 3ETPA 4XXPA 1XE8A 2VTFA 3PTYA 2NQYA 2RDRA 5BUVA 1DGWX 2ZGUA 4QB6A 2OIIA 2OQ7A 2WR9A 3KQ4B 3M3CA 3URFA 1L3JA 4EWDA 5DMYA 1CESA 1QH7A 1N1SA 1C5IA 4XJ9A 1PVXA 2NM1A 3AZWA 2YXSA 1PZ9A 1VRH3 1DFQA 4QD2A 4XBNA 4CCEA 4CDWA 1RUJ3 1YWKA 5CBLA 4I2OA 4QB1A 1RUI3 1S0BA 3OD0A 2A6XA 5H9PA 4LO6B 5GZGA 2XH6A 5K9YA 4LKEA 2MEV1 2VD7A 1UQXA 2JDPA 1UZWA 3JD72 2R042 5FZFA 3O14A 2DVDA 4XACA 2YFUA 5FY4A 1WLWA 4J6GA 4QU2A 1ENSA 4KH9A 3T3YA 1APNA 1HRV2 4Y24A 4QQLA 4YW3A 4LR4A 2VNGA 4IQPA 3ZYGA 5FZ8A 1AYN2 1C8M3 5GZFA 4AAPA 1M06G 4HG6B 2W68A 1ZBA3 3WDYA 5BNNB 1D0HA 1EPZA 2JE9A 3FFZA 3VBOB 1S0DA 1LHVA 2V09A 5AVPA 4B4RA 2WYSA 5D8AC 2WNUC 2WS91 2XQXA 2TEPA 1CJPA 2UURA 3IMMA 4LBJA 4UWDA 1MEC1 4IE5A 2ZMKA 3CQOA 2PHUA 3DUIA 3OYWA 4XF1A 1DGWA 2VMCA 4RQPB 2GNDA 3ZKYA 4OHWA 1UU6A 3ENRA 1HXS3 4E4HA 3G6JB 3WV6A 3DECA 2G19A 1PGSA 4OZXA 1LOCA 4BXSV 1UD1A 5A3MA 2DCKA 5ABJC 1ZBE3 3WEZA 1SBDA 2XKPA 1R1ZA 4AWDA 1NCQC 2EAKA 2WZR3 3AL5A 5J98B 5IVCA 2R6QA 1PMJX 5DPNA 2CSGA 3HN1A 4CDUB 1QJZA 1WD3A 1CAXB 4HT1T 2QQWA 1PMHX 3B3QE 2FDGA 2Q8CA 4AHYA 3BTYA 3KQRA 3MYXA 1C3HA 2J42A 4ITCA 1X9TA 1JYIA 2VW2A 3I3DA 1SACA 3B69A 3IDEA 3GZAA 3OF1A 5DDJ2 4N90A 1H8TC 4AI9A 5FUIA 3UGHA 2AZ5A 4N43A 1IS4A 2A5ZA 2UYAA 3ACGA 4Q4X3 5LBEA 4AVVA 4DPNA 3BKZA 1U0AA 3H7YA 4ZU7A 4YZ2A 1CAUB 2PA7A 3RZJA 3SITA 1LU2A 5CG9A 2CY6A 1GWKA 1LEDA 2BDRA 3K4ZA 3TYJA 2WSUA 5C3QA 4PDWC 4E2GA 3AP5A 3ZVXA 3VBSB 3S0MA 2PAEA 4NHYA 2XG3A 4LOTA 5CG8A 2WDBA 3DPRC 3MV11 2XUEA 1XE0A 1JBCA 3KVBA 2HWE1 3W21A 1O6UA 3TRSB 2H0VA 2IXLA 5FZKA 1JUHA 2JKBA 2VGDA 1GSLA 4W50A 3GCWA 3DXUA 4LQRA 3RWKX 2VMFA 2RMU1 2JDYA 3AXDA 2Y6JA 3K4AA 3JXSA 4EE2A 4IE0A 3HIFA 2HWC3 3VBHC 4E2SA 2B5HA 5LK5A 1VBA3 4ES8A 3U75A 5IFPA 3VZMA 2PHXA 2NLRA 4N7UA 2OKXA 2EXJA 4XHXA 4LHSA 4AHZA 3AKPA 3DL3A 2W87A 1KS4A 1UO9A 2W95A 1RUJ1 3MW4A 3WW4A 1UX6A 1G9AA 4GMP1 1RUI1 5E6HA 2XLFA 1QJU2 2ZHMA 3NJVA 2G9GA 2GP3A 4JHZA 3T2OA 4Y20A 1EV13 4BQ1A 5GALA 1ZVFA 4U36A 4YRDA 4PIZA 4UAPA 1W6OB 5FY8A 2ZX4A 1QY4A 2A3XA 3D82A 4D7TA 1WA4A 3KCYA 3NO8A 2D93A 2E31A 2PAKA 4CU8A 4X6RB 1POQA 4AXOA 3HEIA 3MUZ1 1CD3G 1ZBA1 1OF3A 1S0GA 1O3TA 2A70A 1VAMA 3CU7A 2BFUS 2IWGB 1YQCA 4HKOA 4BK5A 2B4KA 4C0BA 3S5AA 3PIGA 4XTPA 5KHGA 5BYNA 4BQ4A 2ET1A 3GALA 1OLRA 1S0FA 3M8LA 4IEVA 5DUWA 5FP4A 1GLHA 4AK3A 5FZ7A 3VL9A 4XBLA 3D0SA 2A73B 3TEXA 5A1AA 4YM3A 1QNWA 3UKNA 4COYA 4C0HA 4UOJA 1K5MB 5SV5A 2DUQA 3EXUA 4QX5A 1DQ6A 3WQBA 5B4XA 3F95A 4GB31 4QX3A 5IHRA 2LW8A 4LO5B 2B9VA 1VB2A 1AXZA 4Y1XA 2E32A 3PMEA 2YPDA 1QGLA 4SBVA 4O61A 3WXPA 4DZGA 1VALA 1ZBE1 2AH2A 1ZRCA 3MI8A 4LORA 2WABA 2WZR1 4OMDA 2TBVA 1U12A 4XUOA 5FYHA 3M4FA 1AHSA 1KJRA 2YMZA 3N9OA 3WDWA 2BOIA 4CDQA 4NROA 4FPKA 2FQPA 5HPOA 3I49A 4LK7A 4AQTA 2ZAAA 3BVCA 4RGAA 5I0SA 4XMIA 4PHZA 2Y26A 1GMMA 4ZHNA 4AVBA 4MGQA 2EVXA 3QOPA 3KGLA 5A6YA 2NMNA 1IKQA 1WCDJ 3KWVA 3BPZA 5H9RA 4CEYA 5KBFA 1OXCA 3OCPA 3EMRA 2RS51 2XDVA 4AOCA 1ZRDA 2PHFA 1GYKA 4XETA 1CGPA 3J26N 1HB4A 2B42B 1JMUB 2D44A 1LECA 5CIRA 4YZ3A 2P2KA 4LLFA 2WINB 1UAIA 3I54A 4JDOA 4MHRA 5FZ1A 3BTAA 1RMU1 1QXPA 3I3BA 4F3JA 2BFUL 4E4DX 3UNPA 2AREA 5CFCB 2W3JA 2GAUA 3AKSA 3Q8CA 4G3YC 3W5MA 3MZHA 2D6KA 2KM2A 1RXFA 1OFSA 1UIKA 2WNUB 1NA1B 5D8AB 5FMOS 4KQ7A 3H42B 4R52A 2W92A 3AFKA 4WVVA 4Y4YA 4QQPA 1LHWA 2C4XA 1ENXA 1H8VA 1WGPA 2DF7A 2QE3A 5CFDA 1W6MA 2RDQA 2Q8OA 2B7YA 4DY3A 5C3SA 2X10A 1Q8OA 2Z42A 5CADA 3FLTA 4M4PA 5GLZA 5C8CC 2XJTA 4GKYA 2JDNA 2F4LA 3O0XA 5KHJA 1PIV3 2HWC1 2BU9A 5ABJB 3NJZA 4DRRA 1PO21 1A8MA 2CGNA 4Q8LA 4D6RA 5JSPA 1BXHA 3BN6A 5DDJ3 1RUE3 2UY8A 2VZ3A 4MGKE 5FZOA 3U78A 3VDDC 4OQ8A 1K3IA 2P3KA 2VZ1A 4CU6A 3JBG2 3D0JA 3ZXFA 4AVCA 3H1MA 1MQTB 5HXMA 2PMWB 4L8QA 3MLKA 5KHIA 5LWBA 2BW8A 3KF3A 1AR72 4EN0A 1DQ1A 4OI4A 1KJLA 2Y60A 1IPJA 3MPPG 2RV9A 5A6XA 1QOTA 4C91A 2WAOA 1BBT2 3UETA 5FXXA 5GM0A 2IXJA 3WG1A 2VZRA 3UJOA 2DWRA 3NNJA 1LB2A 3CJIC 2WQ4A 3N4MA 1HB1A 2DFCA 4I0AA 1RYYA 4IV3C 2PHLA 4AGGA 3RJRA 3ZOIA 4YNIA 5FMOL 4NE9A 1RUC3 2XBO1 5DUUA 3U11A 3LOIA 3IDBB 3DPRB 2BJSA 1Q43A 3NKGA 3PTRB 4IL7A 4LUMA 5EXOA 3VZOA 3USUB 2J1TA 3MGUA 4META 4N9HA 2WNVC 4XUQA 1AR83 2RM22 4F83A 1GZTA 5JR2A 1A78A 3H3LA 1PO13 4FXKB 4Y3OA 5GZEA 3SNMA 3VHPA 4AYUA 1GP6A 3R4UA 4QQOA 4AEDA 3LAGA 1W8NA 5JLVA 4XVHA 2XJQA 3ROUA 4CP2A 2D6OX 1VBC1 4PQQA 4IEXA 1QJU3 2WN3A 4LBQB 4QQ2A 5DAWA 5DN2A 3SISA 2OUHA 4IETA 3VBHB 1MS9A 3DV8A 3ZFFC 1OBNA 1QEXA 1H2NA 3GZEA 4FPJA 3ES1A 3MLJA 2FDJA 2BPA2 5CAZA 2WLPA 1W0PA 3RZMA 2A3YA 4CCCA 4XE9A 1SDDB 3AXEA 1FX5A 4QAWA 3V0BB 1KDKA 3AYEA 2FCUA 2J1VA 3M2MA 4MV2A 4PBPA 1ZREA 5A3UA 2WA4A 4IEWA 1NLRA 3ZXJA 1W9TA 2C9KA 2E51A 1QJX1 3NNMA 3Q8FA 3J7MA 1JOPA 2ZGLA 3VZJA 1W39A 1WW7A 5EYXA 2FMYA 3M70A 4IV1A 1IOAA 1POV3 1UCXA 2VW0A 2VXJA 2ZX2A 2R16A 5T5JA 1YQ6A 1K5JA 1W6PB 1PNFA 4LKDA 4Q27A 3NJYA 5FPUA 1COV2 1OOPA 4LPLA 1CIYA 1OI6A 1RUD2 4Q4W3 4XFCA 5FXWA 4QXHA 3LEKA 3R6SA 5FY9A 3GBWA 2LRPA 4I0WB 4X8NA 2UYBA 4L97A 5APAA 3VN4A 3ZYHA 1N1VA 4M0HA 1GANA 3C8XA 3PHMA 2A7AA 1W99A 2GU9A 2HLEA 5DAXA 1N3OA 3SLIA 4XDOA 1H1MA 3VB9A 1O3SA 4H55A 2WT1A 1MZ5A 4HKLA 1A8DA 1O7FA 3THPA 2HEVF 4HPKB 5FZ9A 5T54A 4KGQA 2WC2A 3LOBA 3LSEA 4IGOA 3M3OA 4CU9A 1ALYA 2E7QA 1ND2A 2E26A 4XOGA 1GKBA 2NPIA 1W2NA 3N3HA 1O4TA 2F17A 3NV1A 3Q9OA 5E88A 4COVA 5EPAA 5IVEA 4X8PA 3O7OA 5CKQA 1QXJA 1R083 5J3UA 4FBFA 3VD7A 1E5IA 5G05L 2IXKA 2K9ZA 3RRDA 4CCLA 5A3OA 4XFGA 2VPVA 1W8HA 1VLNA 4ISRA 3ZYJB 4DY5A 5C9AC 3GCXA 3O0VA 5KHHA 4AGRA 2ZX3A 4LA2A 2W08A 4R4ZA 4HK8A 4EQVA 2VW1A 2WSVA 4DEQA 4P5YA 5L7OC 2W91A 1SCRA 1U5IA 4CP9A 3E1F1 4CTEA 3NKTA 1SHWB 1UMZA 2V5YA 2MEV2 2TNFA 4QDSA 1HRI1 3OOXA 3ZO0B 4HSLA 5FYMA 3SCFA 5A7OA 2C0ZA 2JD4A 4O65A 5FRAA 1US2A 4HVRA 5FXZA 5LRRA 3POFA 5C3OA 3WNMA 3OPWA 4TYSA 3N9QA 4QKNA 4P9LA 4RSUA 1LENA 1RUC1 2A3WA 4Y4RA 1ASJ3 4ZKTB 1LGBA 3KSCA 4WM8C 2AUYA 2BYVE 4HVOA 4NO4A 1FOD1 2D97A 3ST7A 3S7IA 1AR81 4W4ZA 4A41A 5DABA 2WS92 1HKDA 2E53A 2KD7A 3KMHA 3MLLA 5FO8B 4IERA 4Y26A 1QXRA 3MO4A 4NHKA 4JQTA 1MEC2 2J22A 1C1LA 2QQKA 3ACHA 4IGQA 5C8CB 4FI9A 1G6NA 1UZYA 2YU2A 5T5OA 3VHNA 4Z8BA 1B35B 1JS9A 1OA2A 3HNYM 4E9KA 4Z2AA 3K4DA 3FN9A 4UI9L 3ZSMA 3USSA 1V9U3 5FPXA 3AKTA 4UFHA 3VDDB 2HWB2 1PX4A 1XBFA 1YNAA 1I1EA 1X33A 2R063 2FCVA 1BVP1
chains in the Genus database with same CATH topology
4GZ9A 1SPPA 3KQ4B 2WNOA 4LOTA 1SFPA 2QQKA 3POGA 4LMFA 2QQOA 5CISA 3DEMA 3POIA 3POEA 2QQMA 5CKNA 4LOSA 3POFA 1NZIA 1SZBA 3POBA 5CKMA 5CKQA 2QQLA 4LORA 1SPPB 3POJA 1NT0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GZ9 A;  1SPP A;  3KQ4 B;  2WNO A;  4LOT A;  1SFP A;  2QQK A;  3POG A;  4LMF A;  2QQO A;  5CIS A;  3DEM A;  3POI A;  3POE A;  2QQM A;  5CKN A;  4LOS A;  3POF A;  1NZI A;  1SZB A;  3POB A;  5CKM A;  5CKQ A;  2QQL A;  4LOR A;  1SPP B;  3POJ A;  1NT0 A; 
#chains in the Genus database with same CATH topology
 1NQJ A;  1R64 A;  1ULC A;  2PEL A;  3PL0 A;  3ZXL A;  3BU7 A;  4NMI A;  3TN9 3;  1E5S A;  2LM3 A;  1W03 A;  5J7M A;  5FYS A;  3MID A;  5CEH A;  4QGM A;  3SEP A;  3WY6 A;  4YVS C;  4AHW A;  3NNL A;  3TAY A;  1LRH A;  4UF0 A;  3MIH A;  1QQP 1;  1A6C A;  2ZHN A;  1EYB A;  4JKM A;  2A1X A;  4BLI A;  5T50 A;  4BQW A;  4E8C A;  4KWJ A;  3CJI B;  4JGZ A;  4Q4W 1;  4LBN A;  3BCW A;  4Q4Y 2;  2RM2 3;  4CDX C;  4IV3 B;  1RUF 1;  3OGR A;  1O4Z A;  1PVC 3;  1XNB A;  2ADD A;  4FQZ A;  1IHM A;  2YGL A;  2OQ6 A;  3O0W A;  4TLF A;  3I2O A;  4NRM A;  2C1F A;  4S2G A;  2WO2 A;  4QPI A;  5BNP C;  3NVC A;  4PIY A;  3WD5 A;  1H6X A;  1UX7 A;  4Z82 A;  2RG4 A;  5L9B A;  4KMQ A;  2OUJ A;  2R32 A;  2ARX A;  2WNV B;  3KM5 A;  4R4X A;  1V6J A;  2FD8 A;  1IPK A;  3B9I A;  4QWN A;  5KXD A;  4CUA A;  2HWE 2;  4CP0 A;  1RIT A;  2K0G A;  2HWD 1;  5A1F A;  2X29 A;  2JX9 A;  4C1W A;  4GWI A;  4YW1 A;  1LEM A;  2ZGS A;  4YGD A;  4AFA A;  1R08 1;  2ZHL A;  1GQH A;  1Q8V A;  4XMA A;  1R09 1;  1Q8S A;  3B5L B;  5JIU A;  2DUP A;  3OEA A;  4XBQ A;  4EV0 A;  1NYW A;  2QQU A;  2YBK A;  1PGL 1;  3ILN A;  2VCC A;  5B2G B;  1ODM A;  2ET7 A;  3H1Y A;  1CVN A;  3K3O A;  4YVW B;  2LTN A;  2QDR A;  2J1R A;  3BIE A;  1RUJ 2;  3CJX A;  1COV 3;  2O1Q A;  4XCB A;  1PK6 C;  2WO7 A;  1RUI 2;  1RUD 3;  4GD4 A;  1OF4 A;  4IGP A;  4Y33 A;  4OQ9 A;  2WQZ C;  3AX4 A;  3FZ3 A;  3I97 A;  3OBA A;  5BNN C;  5J48 A;  5JZG B;  3VBO C;  3HVD A;  2XPJ A;  3POW A;  2BNM A;  3ORJ A;  3U14 A;  1ENQ A;  2DCY A;  2CYF A;  3N9P A;  1GZW A;  3FL7 A;  3A7Q A;  2ZMN A;  4CXX A;  2BUK A;  3ACF A;  3FHI B;  1ASJ 1;  3VLB B;  4G9S B;  4DUX A;  4HL0 A;  2HEW F;  1ZBA 2;  4AHX A;  5AFB A;  1CX1 A;  3KT1 A;  1UY4 A;  1W2A X;  4RQP C;  3AK0 A;  3WG4 A;  2WNE A;  1Y9G A;  1W05 A;  2JJ6 A;  3IPV B;  3K3N A;  3NAP C;  4NVP A;  3VD4 A;  1V6O A;  2VNV A;  4P9Y A;  4JX0 A;  3S6P A;  1Q8Q A;  1MS5 A;  1H30 A;  3I59 A;  4R9A A;  2JEM A;  2AAC A;  5GLV A;  5GJ6 A;  4CDW B;  2Q1M A;  5LA1 A;  5FDB A;  3A23 A;  3O5S A;  2WAA A;  1CAV B;  1W6Q A;  3FFQ A;  4IDZ A;  3PVN A;  1HXS 2;  1CAW A;  4GB3 2;  3VUO A;  3TBD A;  4B7E A;  1JI6 A;  1R1A 3;  3VBR C;  4EN7 B;  5DAQ A;  3S57 A;  1V9U 1;  3ALQ A;  3FBM A;  2P5B A;  2IXI A;  1ZBE 2;  5A33 A;  2VY0 A;  5KC6 A;  4AGV A;  1WZX A;  4Y5S A;  4RS5 A;  1HB3 A;  3GBG A;  3RZL A;  1RUN A;  4QGN A;  2WZR 2;  2YC4 A;  2ETE A;  3OB8 A;  2MEV 3;  4WM7 C;  2OPW A;  3LGR A;  5L9V A;  5C9A B;  5J1X A;  1WBF A;  2D5F A;  3QAC A;  1OLM A;  4Q0S A;  4E4Z A;  2FDF A;  2ZBJ A;  5F5A A;  5A3L A;  5I0D A;  3B7M A;  4DXR A;  4KL1 A;  2GMP A;  2XWJ B;  4LBK A;  4ORF A;  4D94 A;  3KHB A;  5FV3 A;  1GWM A;  1YFU A;  1QWR A;  2Y64 A;  2VNR A;  1C28 A;  2RS5 2;  5LK7 B;  3WF1 A;  2WS9 3;  2AEN A;  5FMB A;  3MF9 A;  1PVC 1;  4P9J A;  3V65 A;  5K7P A;  4ONU A;  2ORZ A;  1MEC 3;  1S0C A;  4LIV A;  2QQN A;  2WWU A;  2X09 A;  4D6S A;  4AL9 A;  2VU9 A;  4XJA A;  1CJD A;  1BHG A;  4LHN A;  3WCR A;  2VUA A;  2CWS A;  3RI9 A;  5BNQ A;  4BH9 A;  2RR1 1;  2OYZ A;  4WVZ A;  3AMP A;  1WUV A;  3WP3 A;  5KXB A;  2VJX A;  4QPG A;  3AMQ A;  3OY8 A;  4IND A;  2IFR A;  3JU9 A;  1ZZB A;  1J3Q A;  2AGS A;  3PJQ A;  4K7J A;  3DYO A;  4QXB A;  1WCQ A;  4Y1Y A;  1SLB A;  1W0N A;  4LMF A;  1GNY A;  3RZZ A;  4N43 B;  1W2U A;  2HWC 2;  2N7G A;  4L2N A;  3ZFE A;  2BNN A;  1MPX A;  5FLJ A;  1PO2 2;  5SV8 A;  2VOW A;  1VMH A;  1VB4 A;  3ZFG A;  4BQ3 A;  5A70 A;  2HWF 1;  2IZW A;  1NXM A;  1V6L A;  1UYZ A;  4IEZ A;  1AX1 A;  1DBN A;  2WWJ A;  3CZU A;  4DFS A;  4GWM A;  4ARX A;  1UL9 A;  1TVG A;  1W9W A;  3E6D A;  1UOF A;  2JG8 A;  3D5O A;  4NRP A;  1G9D A;  4R8H A;  2ZAB A;  2PHW A;  2RDS A;  3MFA A;  4L92 A;  1MZF A;  2A6Y A;  2IFW A;  2P4E A;  1S1A A;  1NUK A;  3OEB A;  4AFC A;  4TTG A;  3CF6 E;  3PU3 A;  2CDO A;  1SQ4 A;  2IXH A;  2Z5W A;  3Q8A A;  5IYY A;  3POG A;  4XIK A;  3THT A;  3E5Q A;  2D40 A;  2QTW B;  2VVE A;  1YFY A;  2JXA A;  3N7J A;  4CCN A;  3AZY A;  4COU A;  4DO0 A;  2XML A;  4NIH A;  3VBF A;  1HN1 A;  1K5M C;  3HN3 A;  1JZ2 A;  2JIG A;  2R7E B;  1CR7 A;  2D6N A;  2FCT A;  1JHJ A;  2JB4 A;  3R4S A;  5EZW A;  5A7P A;  5BNP B;  1LOF C;  4LO8 A;  1W8U A;  1W6N A;  1W8T A;  2XBO 2;  4RR3 A;  2VNO A;  2X5I C;  2ZGK A;  2HH9 A;  1XPW A;  2GNM A;  1U5Y A;  2RMU 3;  3AP9 A;  5JPN B;  1GQG A;  4LEJ A;  1UNB A;  2JDU A;  2NP0 A;  4AAX A;  3NST A;  2GAL A;  1SMV A;  1QKQ A;  4AEJ A;  1IS6 A;  4BHP A;  4MXW A;  4YGC A;  4Y20 B;  3IB3 A;  1KFX L;  3CIH A;  1AR6 1;  1R1A 1;  1ND3 A;  4OUM A;  1VPH A;  1J1T A;  1QMJ A;  2BVB A;  4XQ4 A;  4Q8K A;  1YUD A;  2JKX A;  4GA9 A;  3ZPY A;  3KV5 A;  4GMP 3;  1VBC 2;  1SLL A;  4EWE A;  4A6O A;  2RS1 1;  2YC0 A;  5F2S A;  2IXC A;  3LFM A;  1E5H A;  4FCA A;  5AVA A;  2XL9 A;  1D7P M;  3CLP A;  1RUO A;  3NNG A;  3I3Q A;  4Y5Z 0;  1L7R A;  1PK6 B;  1RUG 3;  4N53 C;  1HB2 A;  1JZ7 A;  1D4M 1;  2OS2 A;  4K21 A;  2ZZQ A;  4RGG A;  4M3C E;  5CFC C;  2CGP A;  3VKF C;  1JXN A;  1QJX 2;  1UF2 C;  4FO9 A;  1RL3 A;  3C3V A;  4FP3 A;  5FP9 A;  4HET A;  1NZC A;  1NA1 C;  2ORX A;  3ZSJ A;  2ARA A;  1O91 A;  5FAX A;  4MAD A;  5EWS A;  4PJY A;  3GHN A;  5KXC A;  3JUU A;  1YEW A;  3OGV A;  4YG6 A;  4ASL A;  4P9X A;  1UMI A;  5CKN A;  4XQD A;  5LA9 A;  4JGY C;  2W1S A;  2VO5 A;  3LFI A;  5A7W A;  3WLU A;  3OBR A;  2XJR A;  3NAP B;  3MIF A;  4E8D A;  3T0A A;  2R0F A;  2VTX A;  2QQL A;  4GB3 3;  1URX A;  1XNK A;  1ZA4 A;  5F32 A;  3ZYB A;  5JOW A;  2W2I A;  2H6B A;  2V4V A;  4B1M A;  2VOV A;  5K0U A;  4IUG A;  3UGG A;  1MR5 A;  4ZU4 A;  2UWC A;  2WZ8 A;  1ACC A;  4NPR A;  3D8C A;  3GYD A;  2CHH A;  3ZDV A;  3VBU C;  4BWO A;  5F7U A;  3ZSL A;  5A80 A;  3WDV A;  2CAU A;  2OXB A;  4WV8 A;  4QDR A;  2X53 S;  3VBR B;  1KIT A;  1PIV 2;  1LNS A;  2D3R A;  3GXU A;  5BNO A;  1MQT C;  1JN2 P;  4Z2W A;  1VBD 1;  2PLV 3;  2YDE A;  3J9S A;  4B3N A;  1BCX A;  3UK9 A;  4CEW C;  1UXZ A;  3GHM A;  5ACA 1;  4I09 A;  4LKF A;  2QZ2 A;  1RUE 2;  1NCR A;  1TEI A;  2DU0 A;  2GNT A;  1N1T A;  2WFP A;  2YYO A;  2ZAC A;  3ABZ A;  4WM7 B;  5FPB A;  4KGG A;  1RIN A;  2RS5 3;  1D2Q A;  4MGZ E;  1XRU A;  2EAA A;  5F5C A;  3LCP A;  4CXW A;  3PJY A;  2OVU A;  4OI0 A;  4MGI E;  3TNQ A;  3WP4 A;  1DQ4 A;  4MZU A;  3HOB A;  2X05 A;  1DCS A;  1PNG A;  1RMU 3;  2D7F A;  1OKO A;  2KA3 A;  1F4A A;  2WFF 3;  3E97 A;  3THC A;  5GZD A;  1YI7 A;  3WNK A;  5CFD B;  3I2F A;  2A71 A;  1W6M B;  1TQ5 A;  2XR4 A;  4XIL A;  5A6Z A;  4YPJ A;  4FFI A;  4FPC A;  1DYK A;  3WW1 A;  1JOB A;  3RNS A;  3AMN A;  4BYY A;  1O3R A;  2HYX A;  2VOT A;  1FXZ A;  3N7L A;  3PMS A;  2ZML A;  2VUC A;  3U07 A;  2DVB A;  2ZX1 A;  1UMH A;  5BPX A;  3SKV A;  5FPV A;  4NJ4 A;  2JG9 C;  5FZG A;  1RUC 2;  4K9S A;  4R9C A;  4QB2 A;  5LEK A;  2QQJ A;  4QMA A;  5FZO B;  2EID A;  4EYU A;  2GC0 A;  2LAL A;  1DQ0 A;  3OSD A;  1FOD 2;  4H7L A;  3D6E A;  2RS3 3;  4NOT A;  3AYC A;  5E8A A;  4URT A;  4ZXE A;  1JZ8 A;  5IK7 A;  1AR8 2;  3LE0 A;  1SG3 A;  1TME 1;  3D4K A;  1VMJ A;  2E7A A;  1PO2 3;  1AJO A;  1PO1 2;  4LBQ D;  4XCA A;  5GLW A;  3V64 A;  1TNR A;  3UT0 A;  1AYM 3;  3ZYP A;  3RMY A;  3LPG A;  5C7G A;  4AFM A;  3ES4 A;  3H0O A;  1AR9 3;  3VD3 A;  3ZYF A;  5F1R A;  1BJQ A;  1V6N A;  4QX0 A;  3T08 A;  3ITQ A;  1JYX A;  3B00 A;  2G9Z A;  3RGB A;  5HCF A;  4M4R A;  3IIA A;  4LNV A;  1YC6 1;  1J1L A;  1YQ2 A;  4FFH A;  4JDM A;  3I2I A;  3LD8 A;  1RUG 1;  3CKH A;  1NG0 A;  2Y6G A;  4GH4 B;  3N36 A;  5JCT A;  4LO7 A;  4XAE A;  3KF5 A;  2DV9 A;  5FPL A;  5E1R A;  3HT1 A;  1FV2 A;  4E2Q A;  1SPP A;  4HOO A;  5EP9 A;  3LDB A;  4IE7 A;  1QQP 2;  1VBB 3;  2XBO 3;  1X8E A;  4UFM A;  3ME2 A;  4Y1Z A;  4CZS A;  5I91 A;  3PVO A;  4KWK A;  1NE6 A;  1FAY A;  4XDP A;  2NZ9 A;  1UYP A;  3B94 A;  2BTV C;  3M3I A;  4MX3 A;  4Q4W 2;  1G7Y A;  4AG4 A;  2BER A;  4FPY A;  3ZSE A;  5LEJ A;  1RUF 2;  5B4N A;  3DKQ A;  3III A;  2BGC A;  5BXX A;  4B1L A;  1IG0 A;  3LDK A;  3N9L A;  4YG3 A;  4LIU A;  2WZP P;  1F4H A;  2X5I B;  1H0B A;  5I0R A;  5GLT A;  2VZT A;  1XU2 A;  1VBC 3;  2JDK A;  1P8J A;  2W9X A;  4AW7 A;  3IAP A;  2D3P A;  3G7D A;  2DUR A;  2ZOE B;  1HIX A;  1FYU A;  1UY0 A;  1YO8 A;  2ZEX A;  4P14 A;  5HCA A;  2OA2 A;  1UU4 A;  2Q8E A;  4XFI A;  2PLV 1;  2ZAH A;  4IV1 B;  3WCS A;  1HQN A;  2EXH A;  4A3X A;  3GNE A;  2PN5 A;  4P9I A;  1R08 2;  1AZD A;  3W59 A;  4QKF A;  3VD5 A;  3ZR6 A;  1R09 2;  2CV6 A;  4FXG B;  3TEZ A;  1QJX 3;  2FZ1 A;  2OZ6 A;  4Q4V 1;  2GN3 A;  2GP5 A;  1NLQ A;  3HNM A;  1CIW A;  1H1I A;  4UXA A;  1JW6 A;  1PGL 2;  2ZTN A;  4YW5 A;  3FX3 A;  1FPN 3;  3E5X A;  1ZZ8 A;  4HVQ A;  4N53 B;  1YFW A;  2VBP A;  2WFF 1;  4ISQ A;  4JTO A;  5G04 L;  3JQW A;  2W1Q A;  3BPS A;  1I5Z A;  1U5X A;  2YG0 A;  1JZ6 A;  5FOJ B;  1US3 A;  3I3E A;  4H3W A;  5H9S A;  1G9B A;  1KDM A;  5F39 A;  4LTA A;  3PUI A;  5FJH A;  3P3N A;  4XTM A;  3I4I A;  5A3W A;  2VZV A;  2ZHK A;  3MHZ A;  1G86 A;  4CDU A;  1OUR A;  1CAX A;  1YIF A;  3POS A;  1W8Z A;  2GNB A;  4YGB A;  4JGY B;  1Y9M A;  2V4A A;  1CN1 A;  1ASJ 2;  1WME A;  1OVP A;  4MUV A;  2ZS6 B;  5JAX A;  5HV0 A;  4DMI A;  5FMD A;  1EUT A;  1RUH 1;  2RS3 1;  3WDU A;  4FOQ A;  4XFB A;  5JMO A;  4BB3 A;  1B35 C;  4YZ1 A;  2ZPX A;  1AYM 1;  3AKR A;  3J8F 1;  3EYP A;  4ZY9 A;  1VE0 A;  3AYA A;  4RGK A;  3VBU B;  4JZR A;  4MXV A;  1DG6 A;  4YSF A;  2VUJ A;  1AR9 1;  3JQX A;  3ZX7 A;  1T6B X;  3VBS A;  4AI1 A;  4WVW A;  1H9W A;  4HMZ A;  4CEW B;  2CAV A;  4OHY A;  4M3C F;  1KD7 A;  1EAH 3;  4BME A;  1TMF 1;  3F2Z A;  3FJS A;  5F3C A;  1V9U 2;  3AYD A;  4LJH A;  1XU1 A;  2QQM A;  2R06 2;  2XJP A;  1OT5 A;  3ZDS A;  1CZV A;  1SZB A;  4BQ2 A;  5J09 A;  5D21 A;  1HRI 3;  3ILF A;  3T2Q A;  2OZJ A;  3TN9 2;  4JDN A;  4QPW A;  5F5I A;  5CVR A;  2J1E A;  5J96 B;  1PGW 1;  4DIN B;  3POJ A;  1UU5 A;  4XIO A;  5C4W A;  4XJZ A;  1VBB 1;  3A22 A;  5CB7 A;  4A6S A;  2E33 A;  4XFF A;  4AQ2 A;  2C24 A;  4Q0V A;  4L0P A;  4JKK A;  4KBZ A;  5A6Q A;  1FOD 3;  4YW7 A;  3MEP A;  4BQY A;  4K8F A;  5F3G A;  3OGJ A;  5L9R A;  5AFE A;  5C5U A;  1PVC 2;  3DYP A;  2VZP A;  1H2M A;  2JG9 B;  3H9A A;  1GZC A;  1PM7 A;  1X7N A;  4O9G A;  2P3Y A;  4BZ4 A;  2IC1 A;  2VTX J;  4A42 A;  2DCT A;  1BK1 A;  4K1Y A;  4LXL A;  4DS0 A;  2VCA A;  1O59 A;  1XNT A;  3T30 A;  4LKS A;  2RR1 2;  4Q2F A;  3WW2 A;  2Q0A A;  2GMM A;  3OGS A;  2RHP A;  4HK9 A;  5LBF A;  5A7S A;  1C4R A;  1YRZ A;  3C7O A;  4LIT A;  4UF0 B;  5FZ6 A;  4NII A;  4YVW C;  3RSJ A;  1F15 A;  4IEP A;  1TE1 B;  1U5Z A;  4NIG A;  1XC6 A;  2UWB A;  1PZ7 A;  4EN9 B;  3H3U A;  5GKA C;  3VL8 A;  1V70 A;  2IUW A;  4R9B A;  5FYT A;  5JSR A;  5JZG C;  4XUT A;  3WQ0 A;  2WII B;  1FPN 1;  3KHC A;  4Q0Q A;  3RPQ A;  1QQP 3;  4QX2 A;  3N35 A;  4L99 A;  2HWF 2;  5JOX A;  2WWS A;  5H9Q A;  4D7S A;  4QPI B;  5DZF A;  2RJL A;  4FPF A;  4K1Z A;  1LOB A;  3L2Y A;  1AF9 A;  4OI2 A;  1Z7S 3;  2Y0O A;  1RUF 3;  2I45 A;  3LPF A;  3C2U A;  3U0Z A;  3VZN A;  4KG0 A;  1OUS A;  1MZE A;  1S2E A;  5I8T A;  5JIA A;  1FV3 A;  3VZK A;  1F8V A;  2ZGO A;  2WRA A;  3UL2 A;  1HN0 A;  3W5N A;  2D6M A;  4CDW C;  2GC1 A;  1J83 A;  2GZW A;  2P6H A;  2VCB A;  2WT2 A;  5FY0 A;  3VHO A;  1O4Y A;  3W9A A;  2BOJ A;  5JI9 A;  5F37 A;  2HWD 3;  1S2K A;  2XKO A;  1LUL A;  2VZS A;  2LS6 A;  1GNH A;  1NQD A;  5GZC A;  1IQA A;  3LB9 A;  3HJR A;  1AX0 A;  2WQ8 A;  4KU7 A;  1R09 3;  3BIW E;  2WL1 A;  1SBF A;  5IFT A;  3UKT A;  4K40 A;  2I74 A;  4OUE A;  5IAT A;  1O3Q A;  5F5Q A;  5LAT A;  1FNZ A;  2K2S A;  5A7N A;  1LR5 A;  4K20 A;  5FZ0 A;  4GAL A;  1EAH 1;  5D8A A;  1R1A 2;  1OSG A;  2I07 B;  2WNU A;  4RA0 A;  3C7E A;  5FYI A;  1AR6 2;  4MGT A;  4D69 A;  4CCK A;  1I3H A;  2A6Z A;  1GZW B;  1OH3 A;  3HD8 B;  3HR9 A;  3IDA A;  3ZXA C;  1REE A;  2PTM A;  2B9U A;  1C8N A;  5JXI A;  2XXZ A;  3ZN5 A;  3GBF A;  2RS1 2;  2CNA A;  1SFY A;  1OHF A;  1L7Q A;  1AL2 3;  5JOY A;  1OKQ A;  3KVA A;  1FMD 1;  5IVB A;  3A4U A;  3OG2 A;  3WP6 A;  1ODN A;  4EN8 B;  4YZ4 A;  4NPL A;  3E6B A;  2FDH A;  3AL6 A;  5FPZ A;  1CQ9 A;  3JCI A;  1AVB A;  4Y22 B;  4QM8 A;  5FO7 B;  1YJK A;  4BM8 A;  5ABJ A;  3I59 B;  2BZD A;  3IKW A;  3LA3 A;  4LBL A;  1W04 A;  2DYC A;  3WSO A;  1NCQ A;  4UFJ A;  1Y43 B;  1M4W A;  3I3M A;  2QDN A;  2A6W A;  2ZEW A;  3WF0 A;  1W6Q B;  2XLA A;  1CAW B;  2VC9 A;  4P5H A;  3X29 B;  4MH0 E;  1ZZ9 A;  3T4V A;  2L9L A;  4DXS A;  3CBN A;  1O8P A;  1ST8 A;  3K48 A;  2EA7 A;  4FFG A;  1JYN A;  1J3P A;  4RS5 B;  1H8T A;  3JZV A;  1C57 A;  3RG0 A;  1AJK A;  3SCG A;  4FTE A;  4A7K A;  5FCC A;  4WBB A;  4N43 C;  1ENR A;  5K4L A;  4UW4 A;  3ZIW A;  3MV0 1;  5KHK A;  1O8S A;  3AMM A;  4AF9 A;  4MG2 A;  5L19 A;  2JE7 A;  4PDW A;  2MHF A;  1BQP A;  4NHL A;  4CCO A;  2WN2 A;  3QD6 A;  4IEY A;  4YFZ A;  4Q5O A;  3V0A A;  2ZA9 A;  3HT2 A;  5E16 A;  2DU1 A;  5CNA A;  1J58 A;  3DPR A;  1JYV A;  3OD4 A;  4ASM B;  1MS8 A;  4JQR A;  4CCJ A;  3N9N A;  1J84 A;  5HV4 A;  5IUQ A;  2EIB A;  3RYR A;  1STM A;  1TG7 A;  4HSJ A;  4PI0 A;  4GKX A;  1N3Q A;  4HKW A;  1W0O A;  2QVS B;  3WIN E;  5I0U A;  4AR2 A;  1JU3 A;  1Z7S 1;  1BZW A;  4S2H A;  2ZGT A;  3OJB A;  5KR7 A;  3VBH A;  1LES A;  2JEC A;  1F2N A;  2BEO A;  4ATE A;  4GWN A;  5KXE A;  2J1U A;  2GN7 A;  3CEW A;  4Z92 B;  3AFG A;  4XF3 A;  1JUI A;  1REF A;  1UZV A;  2G1M A;  3QH6 A;  4GQ7 A;  4CYD A;  1DIW A;  3KT4 A;  3S5Q A;  1ZZ7 A;  4HN1 A;  4I3G A;  4OLL A;  2RDN A;  3A21 A;  1ZRR A;  2RR1 3;  2CGO A;  3LZZ A;  2Q1F A;  3C7H A;  3ASI A;  3NQH A;  1ULP A;  5LA0 A;  1WCK A;  3KCX A;  4JC1 A;  3SMH A;  3ZFG B;  4M3C A;  3HWJ A;  3BOW A;  1GU3 A;  5T3N A;  2DVG A;  2QCS B;  1VBE 3;  1NXD 1;  2RMU 2;  5EJ3 A;  3LDR A;  1ZA7 A;  3ZN6 A;  1LGN A;  2GH8 A;  1OPO A;  4RYD A;  1TME 2;  4D0Q A;  1JYT A;  1WMF A;  3NJX A;  2JG8 B;  3ZM8 A;  2AEZ A;  1WKY A;  2O14 A;  1WCS A;  2HWF 3;  4YGE A;  4EZ4 A;  1UWW A;  2Y6L A;  4P9W A;  4C90 A;  3AM2 A;  3ACL A;  4JCK A;  1XYP A;  1MS1 A;  2DFB A;  2ZZJ A;  2XLG A;  1D4V B;  4JKL A;  2LRO A;  4RFT 0;  1RVF 3;  3B93 A;  1AL2 1;  3NV3 A;  4ZS2 A;  5A3P A;  3I8T A;  3OGG A;  3BGA A;  4MLO A;  5FZB A;  1I6X A;  4Y1U A;  2E63 A;  4Q1R A;  3AZX A;  2Q5T A;  1W9S A;  1V00 A;  2WJS A;  1RUG 2;  1W6N B;  2D98 A;  2VZU A;  5FYU A;  4LO4 B;  3DF0 A;  3LA7 A;  4FPH A;  4CCM A;  3DXT A;  5FRE A;  1MS4 A;  2XWB B;  5FUP A;  5JWP A;  4QX7 A;  4DXZ A;  1WD4 A;  2QFE A;  5LBB A;  1Z78 A;  2QQV A;  4UT5 A;  3WF2 A;  2W46 A;  4CDQ C;  3WUC A;  1WLD A;  4ATF A;  1LKN A;  5IW0 A;  1J59 A;  1CPM A;  4RFR B;  1W8W A;  1Y3T A;  3ILR A;  2VVD A;  5JXJ A;  4A3Z A;  1F31 A;  4AI2 A;  4WZC A;  1UY2 A;  2XQR A;  1RGS A;  1CWP A;  3MBW A;  1ONA A;  1OQD A;  2D3S A;  2BQP A;  4CEY C;  1GP4 A;  3SCH A;  4JHT A;  1H2K A;  1AR6 3;  2VXR A;  1YJL A;  2D5H A;  3OUI A;  3ZN4 A;  4S2D A;  2IVJ A;  1A3K A;  1LCL A;  1I9R A;  1S4C A;  4CRQ A;  3KD4 A;  5JDB A;  1ULO A;  2JDA A;  2RS1 3;  2CTV A;  3R05 A;  4NPM A;  1UKR A;  2D6L X;  3O1V A;  3FC0 A;  4XW3 A;  1ZRF A;  4FTB A;  4FOW A;  2XVG A;  3J7L A;  1IS3 A;  1WWY A;  4MYE A;  3WUD A;  2PLV 2;  3NL1 A;  4JRA A;  3B9C A;  4XQW A;  1XNA A;  1D4M 3;  1RB8 G;  2PQS A;  4V2V A;  4IEQ A;  5FBZ A;  2SLI A;  3VD9 A;  5FZL A;  3OYW B;  2WO3 A;  5FK8 A;  5CFD C;  5A7W B;  5FTT C;  1BEV 3;  3WNL A;  4H2A A;  1TNF A;  2R0H A;  5C8C A;  2Q30 A;  1GFF 2;  4HAN A;  3WHU A;  2CU5 A;  1MS0 A;  1PX3 A;  4TXW A;  3T2T A;  2O0O A;  4BIF A;  2VVF A;  3W20 A;  2FBE A;  1RMU 2;  2WFF 2;  3NWK A;  5K0U B;  3FLP A;  4OHV A;  4FSJ A;  2HJI A;  4GJY A;  2UWA A;  1UYY A;  2W1W A;  2PXJ A;  3H50 A;  1ZRI A;  4MGY E;  2Y0I A;  4NN0 A;  4TLG A;  5C33 A;  4UW3 A;  3VDD A;  2AC1 A;  1KQR A;  5EV7 A;  3AJY A;  5FYZ A;  3PNA A;  2YPJ A;  1K45 A;  4AFD A;  4LA3 A;  1UOG A;  1GZ9 A;  1H1A A;  5BNO B;  1BVV A;  4PF5 A;  1Q56 A;  1YQ5 A;  2H0B A;  5FP3 A;  1UY3 A;  2VUL A;  3VDC A;  3FUQ A;  4IES A;  5KC5 A;  3OBZ A;  1VBE 1;  3VV1 A;  1QH6 A;  1RUH 2;  2RS3 2;  3ZMN A;  2ID4 A;  2WLQ A;  3NW4 A;  1EUU A;  4NID A;  2W0X A;  2O8O A;  5ISL A;  3OPZ A;  1XYO A;  1D2S A;  3CJI A;  4RN5 A;  1VBD 3;  3V56 A;  1AYM 2;  4FAG A;  5ACA 3;  4IV3 A;  3VKN A;  2VH9 A;  3C7G A;  4P08 A;  1NOV A;  4RHV 1;  2BVV A;  2ES3 A;  4C8D A;  1AR9 2;  4GH4 C;  4P9G A;  2OPK A;  1RVF 1;  2XVK A;  2JIJ A;  3WF4 A;  3KCC A;  3WZ1 A;  4ZON A;  4AE2 A;  1BKZ A;  2WNV A;  4YYO A;  4V2W A;  4FAH A;  2R07 3;  1TMF 2;  3CMG A;  3MF6 A;  5FY7 A;  1QDO A;  1Y4W A;  5FXV A;  4UFI A;  1IZ3 A;  1SFP A;  2E6V A;  4PLO A;  4QXK A;  5CYY A;  5I8S A;  3UJQ A;  4AEM A;  4LT5 A;  4FTS A;  4WVM A;  4YFW A;  4V1P A;  4AED C;  4CE8 A;  1S55 A;  4XPV A;  4N8M A;  3DN7 A;  1QJF A;  4L11 A;  4NHX A;  5EJ1 B;  2OT7 A;  4LOS A;  5DAV A;  3SC7 X;  2Y6F A;  5EYY A;  2XL7 A;  5FZH A;  3ZFF A;  3DKW A;  3RQ0 A;  4CUG A;  1DHK B;  2VBD A;  1PGW 2;  1POV 0;  4YLZ A;  1HJF A;  2PFW A;  1VAV A;  1DGL A;  2A6V A;  2DBI A;  2BGO A;  2Z4F A;  1VBB 2;  4DB5 A;  3BTZ A;  1KRI A;  3VHR A;  5J37 A;  2GH2 A;  1RHI 3;  4NR1 A;  1DZQ A;  3KB5 A;  3P3P A;  3N7K A;  3RZH A;  1TME 3;  4NIA A;  1WLC A;  1FAT A;  3SH5 A;  4I02 A;  4BLJ A;  5F6L B;  1Z0H A;  1UZZ A;  4L9B A;  4CA9 A;  4QT6 A;  2XJV A;  3AVR A;  3DCQ A;  2PHR A;  4GWJ A;  5LRS A;  4IV1 C;  2EIC A;  5FOB B;  4O7X A;  1RJ8 A;  5FJK A;  1E57 A;  2W1U A;  3D3A A;  1UPI A;  1W8O A;  3K46 A;  4HON A;  4D7Y A;  4B4P A;  3GGL A;  1OOP C;  2OX0 A;  1Y9Q A;  4XF4 A;  3THD A;  3GZU C;  1NY7 1;  1SPP B;  3W58 A;  2BGP A;  1BLZ A;  3ZYR A;  3IPV A;  4FQ4 A;  1GOF A;  4YW6 A;  2W47 A;  3S30 A;  4BXF A;  5ERL A;  1DLL A;  4FPL A;  4XDQ A;  2QJV A;  3K51 A;  3ECQ A;  3RI8 A;  1NX9 A;  2YFZ A;  4YG0 A;  4I30 A;  1PM4 A;  5FQ0 A;  1BEV 1;  1W3V A;  4KG8 A;  5DXD A;  1FPN 2;  1CAV A;  4A44 A;  5DZE A;  1ND2 C;  3KGZ A;  4ASK A;  3O12 A;  1C1F A;  2VQT A;  4I3P A;  3RJ2 X;  3VKM A;  1KEX A;  1NE4 A;  4IW3 A;  3ZSK A;  4IE4 A;  4XFH A;  1X82 A;  4Z07 A;  4CDQ B;  3K2O A;  4DEV A;  2W94 A;  2BBV A;  5C9A A;  5M0T A;  1GIC A;  1ZYB A;  3EQE A;  4IEO A;  3WR0 A;  1JU4 A;  1LHO A;  1S0E A;  1GUI A;  5T52 A;  4CVU A;  3O1O A;  4K3U A;  4BU2 A;  4KI5 M;  3AP6 A;  1QJY 1;  5L7O A;  1TZO A;  2ZEY A;  4DQA A;  4CEY B;  3BOP A;  5C3P A;  4LE3 A;  3U10 A;  5I8Y A;  1WW4 A;  2BNO A;  5CIS A;  3IZO A;  2VE1 A;  2YHJ A;  4W6W A;  1YIP A;  5FUN A;  4UYB A;  3P1I A;  1YXW A;  2Z69 A;  3WG3 A;  2VUD A;  2VQU A;  3B01 A;  1X8M A;  4AQ6 A;  1Y7B A;  1N1Y A;  3ATG A;  2W5F A;  2QQP A;  1YFX A;  2VQ0 A;  3CO2 A;  2K46 A;  4Q4V 3;  1XSQ A;  1BMV 1;  4WM8 A;  2DVA A;  4AEK A;  5FBJ A;  5JSO A;  3O1S A;  2HWB 1;  1SFN A;  1OLQ A;  1N47 A;  1KGY A;  1EAH 2;  2R07 1;  5F3I A;  2Y6H A;  1L7L A;  5IJR A;  1LU1 A;  1JYC A;  2VG9 A;  1H9P A;  2V73 A;  1UN1 A;  3BB6 A;  1VJ2 A;  1OMI A;  2ZKL A;  5E89 A;  2VZQ A;  3MW2 A;  1XJA A;  1H6Y A;  5FPA A;  1HRI 2;  2GDF A;  2ZKN A;  5JUV A;  2DVF A;  1SEF A;  2JE8 A;  1FMD 2;  2B39 A;  4O9E A;  3ZXG A;  2LUW A;  1SBE A;  3I7D A;  2MNG A;  2BP6 A;  4Q4Y 1;  2JWP A;  4PLN A;  3T0D A;  1MVQ A;  1WCU A;  3FBY A;  4N7I A;  4GIQ A;  1MS3 A;  1MVE A;  1RHI 1;  2G9F A;  3IMN A;  3POY A;  1RUH 3;  1ZZC A;  4COW A;  3WQ1 A;  3WX5 A;  4CPB D;  4A7Y A;  1DYP A;  5JI7 A;  2G4I A;  4UFK A;  2HYK A;  5A32 A;  2OW4 A;  1YCI A;  4EN6 B;  3J8F 3;  1QU0 A;  3SXW A;  2YC2 A;  4YVS A;  1OA4 A;  4H14 A;  1F35 A;  2XOM A;  5LBC A;  2Y6K A;  4B7K A;  1ZM1 A;  3PVB B;  1OLM E;  3AP4 A;  4NWW A;  2F6B A;  5FMC A;  1GOG A;  1SDW A;  5FWJ A;  2GME A;  1GR3 A;  4JRL A;  4FFF A;  4E4S A;  4CSW A;  5JPM B;  2VMH A;  4JGZ C;  4KWL A;  4CDX A;  1TMF 3;  2VR4 A;  4UBH A;  4DUW A;  3ZR5 A;  5LA2 A;  1X9P A;  1GNZ A;  2JDH A;  5C4W B;  3RFR A;  4FOV A;  5FZ4 A;  3U1X A;  1LOD A;  3WF3 A;  5BNP A;  4K8R B;  2I2S A;  4QPI C;  5AC9 3;  1VRH 1;  4YZ5 A;  2WA3 A;  4BE3 A;  1PHM A;  4HBN A;  3O1T A;  5EJZ B;  4LHL A;  2HKX A;  2XJU A;  4FPE A;  1IPS A;  3BI3 A;  4PI2 A;  3CDZ B;  3SQO A;  4AED B;  3FHQ A;  2ZGM A;  4QKB A;  3I2D A;  4BIS A;  4F8A A;  4W65 A;  5IVF A;  3AVS A;  3CHX A;  4XAA A;  3ON7 A;  1Z7S 2;  1JTZ X;  2JDM A;  5FYY A;  4BDV B;  1C8M 1;  5IWF A;  4BOW A;  2QBX A;  5EFU A;  1HV1 A;  3GM8 A;  2CDP A;  4KWU A;  2WYF A;  3L2H A;  1H4G A;  1W9F A;  4PBO A;  1EY2 A;  4QPY A;  1C5H A;  5D1I A;  2AR6 A;  2DBN A;  4URA A;  1PK6 A;  5TSW A;  2A75 A;  1DZR A;  5HXV A;  3AMH A;  5BNN A;  2HWD 2;  2P34 A;  4KBB A;  3VBO A;  3ETQ A;  4DNY A;  4PLM A;  1NAE A;  5FFO C;  4NRQ A;  1KXG A;  3N7M A;  1HXS 1;  2CWM A;  2QQO A;  3MDP A;  3ZPO A;  2VEC A;  5LW9 A;  2CL2 A;  4BMB A;  1XXN A;  4J25 A;  5EQU A;  1OOP B;  4M01 A;  2PYT A;  1I5P A;  3POB A;  2DCJ A;  4RQP A;  5F6K A;  4BPZ A;  3NAP A;  3GF6 A;  3KS7 A;  4EZH A;  3OUJ A;  3JD7 3;  2ARC A;  5C3R A;  3VKL A;  4CP1 A;  2R04 3;  2BRT A;  4PQ9 A;  1T2X A;  3KZ4 C;  1VR3 A;  3FUO A;  4ZU5 A;  1EP0 A;  2FHR A;  2QQI A;  1G9F A;  2XJS A;  1HRV 3;  1ZX5 A;  1AL2 2;  3NMB A;  2Y33 A;  5IAV A;  1AYN 3;  1CZS A;  3WHT A;  3PU8 A;  1F5J A;  1LHN A;  2P1B A;  1AXK A;  1ND2 B;  4CXY A;  3NV4 A;  3VBR A;  3PUS A;  4Q4X 1;  3AJZ A;  3Q8E A;  4NWV A;  4X6Q B;  3T2P A;  2ADE A;  1D0G A;  5FZ3 A;  4ZZ5 A;  2FDK A;  1XB9 A;  4RS5 C;  5FK7 A;  2BWA A;  4WM7 A;  1QDC A;  4H7M A;  3IN9 A;  5IT6 A;  4XJ8 A;  4Q0U A;  2GSY A;  2D43 A;  3TB0 A;  3RS6 A;  2YBS A;  1JH5 A;  1QIQ A;  4UBG A;  4A7Z A;  5A1L A;  1CAU A;  5FZE A;  1PZ8 A;  2P37 A;  4M00 A;  3GDB A;  4MO3 M;  2ERF A;  2WNO A;  3R4D B;  3TWI A;  4CP9 B;  1ZNP A;  3IAQ A;  1YYN A;  4COZ A;  3QLQ A;  4FPG A;  3H8R A;  1OD3 A;  3MIB A;  4IEU A;  4EJR A;  3OPT A;  4N9I A;  4XAB A;  4QQH A;  3HBK A;  4OI1 A;  3T09 A;  1UOB A;  5GLU A;  4CU7 A;  4OUL A;  4Q1P A;  3UGF A;  3O1U A;  2O8Q A;  5D2A A;  2V72 A;  2RJ2 A;  1GWL A;  1T6G C;  5T5L A;  2C26 A;  5JOZ A;  4DUV A;  4C1X A;  1VBA 1;  3U4X A;  5LZ6 A;  1DGR N;  1O5L A;  1PMI A;  3JB8 A;  4Q0P A;  4DXT A;  5AC9 1;  3ZKU A;  3BTX A;  1IGO A;  1NCQ B;  3LEM A;  3OUH A;  4R9D A;  1FMD 3;  3VKO A;  3BUC A;  3HQU A;  2XGX A;  1Q3E A;  3PVE A;  3NNF A;  5DAP A;  3ZXE A;  2JIC A;  1BK0 A;  4CCD A;  2QNK A;  3FE5 A;  4HXC A;  4QPG C;  3VZL A;  1EV1 1;  3L9J T;  4FP2 A;  4YM0 A;  1DDL A;  1H8T B;  1MZ6 A;  3A0N A;  3KV9 A;  3O1P A;  4G4F A;  2JD9 A;  4PIX A;  5EHD A;  1CZT A;  1Q8P A;  4XF9 A;  3H8U A;  3HAG A;  4P00 B;  3EBR A;  1WW5 A;  1UYX A;  1IG3 A;  3GJA A;  4QX1 A;  3ZFE C;  1W8F A;  3ZFG C;  1W6O A;  1K12 A;  3O1R A;  2AEY A;  4B4Q A;  3PUH A;  4PDW B;  3ZIX A;  4QU1 A;  5F3E A;  1OFN A;  4BCU A;  4BQX A;  3V0A B;  1WA6 X;  3HBZ A;  4YAR A;  1AL0 G;  4GH4 A;  5DG2 A;  2ZGR A;  1VP6 A;  3LEI A;  3LIH A;  5FY1 A;  1F5F A;  3RMX A;  3SEE A;  1SCS A;  1B09 A;  5C8W A;  4AQS A;  1DZT A;  1JOD A;  2JG8 C;  4U2A A;  2UU8 A;  4XZU G;  2YRO A;  1VBE 2;  3IBM A;  1UXX X;  2F4P A;  4OUS A;  4F7Z A;  4JGZ B;  1VRB A;  3PLQ A;  3PIJ A;  4QXC A;  1RXG A;  1K5M A;  3VBF C;  3LF7 A;  3H3Z A;  3AC0 A;  4RHV 2;  3JD7 1;  2AYH A;  1LOF A;  1W28 A;  2R04 1;  5FYB A;  3T0B A;  4GMP 0;  2VMG A;  1N3P A;  2X5I A;  2EF6 A;  2JDZ A;  2PHD A;  4RR3 C;  1HRV 1;  1HJG A;  1RVF 2;  1RJ7 A;  5CZK A;  3IT8 A;  1OQ1 A;  1AYN 1;  3KT7 A;  1CX4 A;  1UZ0 A;  1XND A;  2BBA A;  3FWE A;  3I2G A;  4IXL A;  1QHD A;  5L36 A;  1JZ3 A;  1Q5O A;  5CU1 A;  5A3N A;  5C6C A;  3M3Q A;  3WDT A;  2C9A A;  2X8K A;  5IVJ A;  4BK4 A;  3H8X A;  4M3C B;  1ND3 C;  2HBU A;  3EB7 A;  4OHX A;  3U37 A;  1NKG A;  3SKJ E;  1X50 A;  1DQ5 A;  3T4H B;  5DUV A;  3KV4 A;  5T55 A;  3ZN6 B;  4PT6 A;  4BQ5 A;  2VL4 A;  3WDX A;  5FP8 A;  2JEN A;  4OHZ A;  3H1W A;  5JXH A;  5FKB A;  5T5P A;  4XUN A;  3OTF A;  1O5U A;  1YI9 A;  3GZT B;  4YW4 A;  4LBM A;  1VMF A;  4N53 A;  4MHU A;  4QM9 A;  1OA3 A;  4JAA A;  2R1D A;  5ANQ A;  2FZ2 A;  3PUA A;  5CFC A;  1ULE A;  3J7H A;  2E7T A;  3WOG A;  4JV4 A;  5IK5 A;  1MAC A;  2Z79 A;  1RED A;  4WZF A;  2DCZ A;  5FKC A;  3WNN A;  5CA6 A;  3LQC A;  1NA1 A;  1G9C A;  4OMC A;  4MSV A;  2XON A;  2ZGQ A;  4AI3 A;  1J3R A;  2VQA A;  1PIV 1;  5KWR A;  1DLC A;  1LOG A;  4RL7 A;  2EAL A;  2ZX0 A;  4KU8 A;  3POE A;  2DDU A;  4JGY A;  1GOH A;  4S2F A;  5DDJ 1;  3WG2 A;  1CON A;  1RUE 1;  1LHU A;  1W06 A;  4ZS3 A;  3I2J A;  2V5D A;  2B8M A;  3Q8B A;  3MIE A;  1NY7 2;  2Y34 A;  2C6S A;  3MW3 A;  5A3T A;  5F2W A;  1GP5 A;  2ZEZ A;  2ZXQ A;  2R49 A;  4QGL A;  1UOJ A;  4XEZ A;  1D4M 2;  5IVV A;  5K0U C;  1IS5 A;  3UKV A;  1XE7 A;  5HBA A;  2R1B A;  4GZ9 A;  2PAM A;  4GUL A;  1K42 A;  1JZ4 A;  5FY5 A;  2YU1 A;  4W6X A;  1BEV 2;  1EPW A;  1QNY A;  4IE6 A;  3PUQ A;  3VBU A;  1LOE A;  2Y8K A;  3CNA A;  1MQT A;  1HQW A;  2XVL A;  5BNO C;  4OVE A;  3P5B A;  4CEW A;  3WQ7 A;  3H8O A;  4LBO A;  5A33 B;  2Y38 A;  3AP7 A;  1HX6 A;  1GV9 A;  1NCR C;  3SH3 A;  5L73 A;  2GC3 A;  2YBP A;  3HPN A;  2PQQ A;  4OYU A;  5CKM A;  4FT8 A;  2QUO A;  4QDQ A;  1IQD C;  2WO1 A;  3B02 A;  4UFL A;  4XUP A;  3FHA A;  4ZXK A;  4AI0 A;  2WUH A;  1RIR A;  1S2B A;  2Q1Z B;  3E6C C;  2C5D A;  1S0J A;  3TEW A;  1QOO A;  3RVH A;  4NHM A;  1QJY 2;  3SH4 A;  5FZM A;  1XYN A;  3LEG A;  1XQN A;  1PO1 1;  3MIG A;  3A0K A;  4AZZ A;  4TZD A;  3QCW A;  4QHB A;  3N9M A;  5IVY A;  5LY2 A;  5DQ0 A;  1GQP A;  1NLS A;  3CL1 A;  3JB4 C;  4Z1V A;  3R0R A;  1HLC A;  3USU A;  4DIQ A;  4LUK A;  1RTV A;  1VBD 2;  1QOS A;  1QJU 1;  2YY1 A;  3JBG 3;  5FZD A;  5ANN A;  1DU3 D;  3DEM A;  5ACA 2;  4XJW A;  1OQE A;  4CUB A;  2RVA A;  3PUR A;  1OPM A;  2JG9 A;  4GAZ A;  2DUO A;  1H4H A;  2UY9 A;  1AR7 3;  2ZJC A;  1BMV 2;  1FI2 A;  2YGM A;  2B45 X;  1SLC A;  2WZE A;  1UKG A;  4CPB A;  4ARY A;  1UW8 A;  3H7J A;  4D8M A;  2PHT A;  1CPN A;  2WT0 A;  1BBT 3;  4LBQ A;  1JZ5 A;  2H6C A;  2R07 2;  4QPG B;  1LJ7 A;  3OY8 B;  1DP0 A;  4YM2 A;  2QZ3 A;  1DYO A;  3MPB A;  1X36 A;  3I2K A;  3WP5 A;  1XNC A;  1WBL A;  2DTW A;  5FLH A;  5FZI A;  1POV 1;  3V0B A;  1SLI A;  3QH7 A;  5I93 A;  3LWC A;  3O1M A;  2EIE A;  1DQ2 A;  1H2L A;  2RJK A;  3QBQ A;  4A4A A;  3ZFE B;  1AX2 A;  1KS5 A;  2SBA A;  2WBK A;  1VAK A;  4HN0 A;  5C71 A;  3TNP B;  4JTN A;  2DTY A;  1S0I A;  4OCT A;  1ZZ6 A;  3RWN A;  3U4S A;  2P3I A;  1RHI 2;  2VZO A;  4I0B A;  4BJ0 A;  3RZG A;  1VIW B;  1W6P A;  2J1A A;  2P6C A;  5HCH A;  1A34 A;  1AXY A;  4LLO A;  2ATF A;  5I0T A;  1E5R A;  4MGS A;  4DOU A;  5FR3 A;  4Y1V A;  4LHK A;  4RHV 3;  4LUL A;  5FIX A;  5FWE A;  3K77 A;  3TEY A;  2ILM A;  4W8J A;  1GBG A;  1JYW A;  4WVM B;  2VMD A;  4YWA A;  1OVS A;  4MVT A;  4FOY A;  4J1X A;  1HW5 A;  1YLL A;  2J7M A;  5A7Q A;  4TSV A;  3VBF B;  2EIG A;  2TUN A;  3ZFF B;  1SLT A;  4HPK A;  1V6I A;  4BA6 A;  3EJK A;  4QHO A;  1LTE A;  3FMG A;  3OBT A;  3EO6 A;  4B8E A;  3NRU A;  2P17 A;  1XSR A;  2D6P A;  4RR3 B;  3FLR A;  2VBB A;  3M7A A;  3ZYI B;  2VM9 A;  1VRH 2;  4SLI A;  2NYY A;  4XYX A;  2GC2 A;  3ACI A;  3VGI A;  4MXW B;  4ERO A;  4HFS A;  3MUY 1;  5JXG A;  4TN7 A;  4FPO B;  2ZGN A;  3M1H A;  1ND3 B;  3MIC A;  5C5T A;  2W39 A;  3WNX A;  3ELN A;  4OZO A;  3AB0 A;  2QKD A;  5IK8 A;  4GJZ A;  3WVJ A;  2NN8 A;  1V6M A;  1DF0 A;  1OUX A;  2HBT A;  4P02 B;  2VAU A;  3VDA A;  1QJE A;  4ES9 A;  1C8M 2;  3APB A;  5FZA A;  4CUC A;  3AKQ A;  5BY5 A;  1WMX A;  4XFA A;  5LB6 A;  1FT9 A;  1QF3 A;  5FYC A;  1LOA A;  2NMO A;  2XHK A;  3BOD A;  4LE4 A;  1YQ8 A;  4XXA A;  4XZP A;  4RD7 A;  4Y22 A;  3NV2 A;  5FQ0 B;  2VOK A;  2BV4 A;  4QKD A;  4QHZ A;  1ULF A;  1W2T A;  2E9Q A;  1WMD A;  3GJB A;  3JBG 1;  4TWT A;  3P6B A;  5DZG A;  3UV9 A;  2Q8D A;  4CDU C;  4XJU A;  1OH4 A;  4XHB A;  1AR7 1;  2ARB A;  4Q4V 2;  2P3J A;  5LCW L;  4NAO A;  3DYM A;  2KXL A;  4JVA A;  1AUY A;  3J4U H;  4ZZ8 A;  2R06 1;  1BBT 1;  4J1W A;  4B29 A;  4AVT A;  5FP7 A;  1B35 A;  3RYP A;  3TN9 1;  1DGR A;  2XB6 C;  1W9Y A;  1JOJ A;  1UPS A;  4M0N A;  4Y5T A;  4YW2 A;  4A2U A;  5L7O B;  3T1L A;  5FZC A;  1WLT A;  5FO9 B;  3UYJ A;  2WKK A;  4MOA A;  1BYH A;  3ZLI A;  5HI0 A;  2FMD A;  2W52 A;  4GXL A;  4XF0 A;  4D3W A;  1W90 A;  1W2O A;  3VDB A;  2Q4S A;  4K6B A;  4KNC A;  3VBS C;  5C70 A;  1ULG A;  5IK4 A;  4XC9 A;  4Q4X 2;  1YHF A;  2YZ4 A;  2RM2 1;  3KV6 A;  1QJY 3;  2HEY F;  4XUR A;  1NCR B;  1V0A A;  3C7F A;  3POI A;  3IDC B;  2MPF A;  3WNO A;  5EIY B;  5K8S A;  2ZCW A;  3M3E A;  1G8W A;  4WM8 B;  2FDI A;  4BIO A;  2XHN A;  2R30 A;  1ULD A;  5DUX A;  4DRV A;  1UIJ A;  1HDK A;  2EXK A;  2YV8 A;  2ZGP A;  3J8F 2;  4LK6 A;  2VMI A;  1HQL A;  4Q26 A;  3KLS A;  4YM1 A;  5HCB A;  1KFU L;  5LY1 A;  1NT0 A;  5F8P A;  3ZXD A;  5C4W C;  3LSD A;  4W6Y A;  3ZMO A;  5J36 A;  3WW3 A;  3K75 B;  4ZPI A;  3RZK A;  3LA2 A;  4NUB A;  4AVS A;  2HWB 3;  4NAM A;  4QX8 A;  4HZF A;  1OD5 A;  3LIG A;  4E27 A;  1FNY A;  3BAL A;  3IM0 A;  3I2H A;  1HV0 A;  4UW5 A;  1XOY A;  4Q29 A;  5FLI A;  4EWA A;  3BYW A;  5JR7 B;  5F9T A;  3WT3 A;  1V6K A;  1VBA 2;  3MFC A;  3WNP A;  3PDQ A;  2YUE A;  5BV6 A;  3AZV A;  4PCR A;  2J1S A;  1IKP A;  4AFB A;  2KR2 A;  1WW6 A;  5AC9 2;  3S7E A;  4PF1 A;  5JMC A;  4AVA A;  1COV 1;  3IWZ A;  4UW6 A;  1RUD 1;  3T1M A;  3DGT A;  5DG1 A;  5A32 B;  1LAJ A;  2VOX A;  2BWC A;  4Q4Y 3;  4A45 A;  3HNB M;  4YVS B;  1EV1 2;  2XUM A;  3ZXK A;  4FVV A;  4AI8 A;  4YVW A;  1F9K A;  1OC1 A;  2VME A;  3EHK A;  3LKJ A;  3RYK A;  3J7N A;  3SHR A;  1LGC A;  3HQX A;  2IVI B;  3AZZ A;  3INA A;  4D6Q A;  1SLA A;  2RE9 A;  3HQR A;  2YB7 A;  5IAX A;  2JB8 A;  4CDX B;  4I01 A;  4ET7 A;  3E5U A;  5JZG A;  3HMY A;  3TOJ A;  5JVV A;  2B46 X;  1JHN A;  1RC6 A;  2HWE 3;  5FYV A;  2Z2S B;  1W3X A;  1NZI A;  2VCM A;  3BU0 A;  3CZJ A;  2ENR A;  2EXI A;  4OFG A;  3RDI A;  3UES A;  4HLT A;  5LAS A;  1UY1 A;  3ETP A;  4XXP A;  1XE8 A;  2VTF A;  3PTY A;  2NQY A;  2RDR A;  5BUV A;  1DGW X;  2ZGU A;  4QB6 A;  2OII A;  2OQ7 A;  2WR9 A;  3KQ4 B;  3M3C A;  3URF A;  1L3J A;  4EWD A;  5DMY A;  1CES A;  1QH7 A;  1N1S A;  1C5I A;  4XJ9 A;  1PVX A;  2NM1 A;  3AZW A;  2YXS A;  1PZ9 A;  1VRH 3;  1DFQ A;  4QD2 A;  4XBN A;  4CCE A;  4CDW A;  1RUJ 3;  1YWK A;  5CBL A;  4I2O A;  4QB1 A;  1RUI 3;  1S0B A;  3OD0 A;  2A6X A;  5H9P A;  4LO6 B;  5GZG A;  2XH6 A;  5K9Y A;  4LKE A;  2MEV 1;  2VD7 A;  1UQX A;  2JDP A;  1UZW A;  3JD7 2;  2R04 2;  5FZF A;  3O14 A;  2DVD A;  4XAC A;  2YFU A;  5FY4 A;  1WLW A;  4J6G A;  4QU2 A;  1ENS A;  4KH9 A;  3T3Y A;  1APN A;  1HRV 2;  4Y24 A;  4QQL A;  4YW3 A;  4LR4 A;  2VNG A;  4IQP A;  3ZYG A;  5FZ8 A;  1AYN 2;  1C8M 3;  5GZF A;  4AAP A;  1M06 G;  4HG6 B;  2W68 A;  1ZBA 3;  3WDY A;  5BNN B;  1D0H A;  1EPZ A;  2JE9 A;  3FFZ A;  3VBO B;  1S0D A;  1LHV A;  2V09 A;  5AVP A;  4B4R A;  2WYS A;  5D8A C;  2WNU C;  2WS9 1;  2XQX A;  2TEP A;  1CJP A;  2UUR A;  3IMM A;  4LBJ A;  4UWD A;  1MEC 1;  4IE5 A;  2ZMK A;  3CQO A;  2PHU A;  3DUI A;  3OYW A;  4XF1 A;  1DGW A;  2VMC A;  4RQP B;  2GND A;  3ZKY A;  4OHW A;  1UU6 A;  3ENR A;  1HXS 3;  4E4H A;  3G6J B;  3WV6 A;  3DEC A;  2G19 A;  1PGS A;  4OZX A;  1LOC A;  4BXS V;  1UD1 A;  5A3M A;  2DCK A;  5ABJ C;  1ZBE 3;  3WEZ A;  1SBD A;  2XKP A;  1R1Z A;  4AWD A;  1NCQ C;  2EAK A;  2WZR 3;  3AL5 A;  5J98 B;  5IVC A;  2R6Q A;  1PMJ X;  5DPN A;  2CSG A;  3HN1 A;  4CDU B;  1QJZ A;  1WD3 A;  1CAX B;  4HT1 T;  2QQW A;  1PMH X;  3B3Q E;  2FDG A;  2Q8C A;  4AHY A;  3BTY A;  3KQR A;  3MYX A;  1C3H A;  2J42 A;  4ITC A;  1X9T A;  1JYI A;  2VW2 A;  3I3D A;  1SAC A;  3B69 A;  3IDE A;  3GZA A;  3OF1 A;  5DDJ 2;  4N90 A;  1H8T C;  4AI9 A;  5FUI A;  3UGH A;  2AZ5 A;  4N43 A;  1IS4 A;  2A5Z A;  2UYA A;  3ACG A;  4Q4X 3;  5LBE A;  4AVV A;  4DPN A;  3BKZ A;  1U0A A;  3H7Y A;  4ZU7 A;  4YZ2 A;  1CAU B;  2PA7 A;  3RZJ A;  3SIT A;  1LU2 A;  5CG9 A;  2CY6 A;  1GWK A;  1LED A;  2BDR A;  3K4Z A;  3TYJ A;  2WSU A;  5C3Q A;  4PDW C;  4E2G A;  3AP5 A;  3ZVX A;  3VBS B;  3S0M A;  2PAE A;  4NHY A;  2XG3 A;  4LOT A;  5CG8 A;  2WDB A;  3DPR C;  3MV1 1;  2XUE A;  1XE0 A;  1JBC A;  3KVB A;  2HWE 1;  3W21 A;  1O6U A;  3TRS B;  2H0V A;  2IXL A;  5FZK A;  1JUH A;  2JKB A;  2VGD A;  1GSL A;  4W50 A;  3GCW A;  3DXU A;  4LQR A;  3RWK X;  2VMF A;  2RMU 1;  2JDY A;  3AXD A;  2Y6J A;  3K4A A;  3JXS A;  4EE2 A;  4IE0 A;  3HIF A;  2HWC 3;  3VBH C;  4E2S A;  2B5H A;  5LK5 A;  1VBA 3;  4ES8 A;  3U75 A;  5IFP A;  3VZM A;  2PHX A;  2NLR A;  4N7U A;  2OKX A;  2EXJ A;  4XHX A;  4LHS A;  4AHZ A;  3AKP A;  3DL3 A;  2W87 A;  1KS4 A;  1UO9 A;  2W95 A;  1RUJ 1;  3MW4 A;  3WW4 A;  1UX6 A;  1G9A A;  4GMP 1;  1RUI 1;  5E6H A;  2XLF A;  1QJU 2;  2ZHM A;  3NJV A;  2G9G A;  2GP3 A;  4JHZ A;  3T2O A;  4Y20 A;  1EV1 3;  4BQ1 A;  5GAL A;  1ZVF A;  4U36 A;  4YRD A;  4PIZ A;  4UAP A;  1W6O B;  5FY8 A;  2ZX4 A;  1QY4 A;  2A3X A;  3D82 A;  4D7T A;  1WA4 A;  3KCY A;  3NO8 A;  2D93 A;  2E31 A;  2PAK A;  4CU8 A;  4X6R B;  1POQ A;  4AXO A;  3HEI A;  3MUZ 1;  1CD3 G;  1ZBA 1;  1OF3 A;  1S0G A;  1O3T A;  2A70 A;  1VAM A;  3CU7 A;  2BFU S;  2IWG B;  1YQC A;  4HKO A;  4BK5 A;  2B4K A;  4C0B A;  3S5A A;  3PIG A;  4XTP A;  5KHG A;  5BYN A;  4BQ4 A;  2ET1 A;  3GAL A;  1OLR A;  1S0F A;  3M8L A;  4IEV A;  5DUW A;  5FP4 A;  1GLH A;  4AK3 A;  5FZ7 A;  3VL9 A;  4XBL A;  3D0S A;  2A73 B;  3TEX A;  5A1A A;  4YM3 A;  1QNW A;  3UKN A;  4COY A;  4C0H A;  4UOJ A;  1K5M B;  5SV5 A;  2DUQ A;  3EXU A;  4QX5 A;  1DQ6 A;  3WQB A;  5B4X A;  3F95 A;  4GB3 1;  4QX3 A;  5IHR A;  2LW8 A;  4LO5 B;  2B9V A;  1VB2 A;  1AXZ A;  4Y1X A;  2E32 A;  3PME A;  2YPD A;  1QGL A;  4SBV A;  4O61 A;  3WXP A;  4DZG A;  1VAL A;  1ZBE 1;  2AH2 A;  1ZRC A;  3MI8 A;  4LOR A;  2WAB A;  2WZR 1;  4OMD A;  2TBV A;  1U12 A;  4XUO A;  5FYH A;  3M4F A;  1AHS A;  1KJR A;  2YMZ A;  3N9O A;  3WDW A;  2BOI A;  4CDQ A;  4NRO A;  4FPK A;  2FQP A;  5HPO A;  3I49 A;  4LK7 A;  4AQT A;  2ZAA A;  3BVC A;  4RGA A;  5I0S A;  4XMI A;  4PHZ A;  2Y26 A;  1GMM A;  4ZHN A;  4AVB A;  4MGQ A;  2EVX A;  3QOP A;  3KGL A;  5A6Y A;  2NMN A;  1IKQ A;  1WCD J;  3KWV A;  3BPZ A;  5H9R A;  4CEY A;  5KBF A;  1OXC A;  3OCP A;  3EMR A;  2RS5 1;  2XDV A;  4AOC A;  1ZRD A;  2PHF A;  1GYK A;  4XET A;  1CGP A;  3J26 N;  1HB4 A;  2B42 B;  1JMU B;  2D44 A;  1LEC A;  5CIR A;  4YZ3 A;  2P2K A;  4LLF A;  2WIN B;  1UAI A;  3I54 A;  4JDO A;  4MHR A;  5FZ1 A;  3BTA A;  1RMU 1;  1QXP A;  3I3B A;  4F3J A;  2BFU L;  4E4D X;  3UNP A;  2ARE A;  5CFC B;  2W3J A;  2GAU A;  3AKS A;  3Q8C A;  4G3Y C;  3W5M A;  3MZH A;  2D6K A;  2KM2 A;  1RXF A;  1OFS A;  1UIK A;  2WNU B;  1NA1 B;  5D8A B;  5FMO S;  4KQ7 A;  3H42 B;  4R52 A;  2W92 A;  3AFK A;  4WVV A;  4Y4Y A;  4QQP A;  1LHW A;  2C4X A;  1ENX A;  1H8V A;  1WGP A;  2DF7 A;  2QE3 A;  5CFD A;  1W6M A;  2RDQ A;  2Q8O A;  2B7Y A;  4DY3 A;  5C3S A;  2X10 A;  1Q8O A;  2Z42 A;  5CAD A;  3FLT A;  4M4P A;  5GLZ A;  5C8C C;  2XJT A;  4GKY A;  2JDN A;  2F4L A;  3O0X A;  5KHJ A;  1PIV 3;  2HWC 1;  2BU9 A;  5ABJ B;  3NJZ A;  4DRR A;  1PO2 1;  1A8M A;  2CGN A;  4Q8L A;  4D6R A;  5JSP A;  1BXH A;  3BN6 A;  5DDJ 3;  1RUE 3;  2UY8 A;  2VZ3 A;  4MGK E;  5FZO A;  3U78 A;  3VDD C;  4OQ8 A;  1K3I A;  2P3K A;  2VZ1 A;  4CU6 A;  3JBG 2;  3D0J A;  3ZXF A;  4AVC A;  3H1M A;  1MQT B;  5HXM A;  2PMW B;  4L8Q A;  3MLK A;  5KHI A;  5LWB A;  2BW8 A;  3KF3 A;  1AR7 2;  4EN0 A;  1DQ1 A;  4OI4 A;  1KJL A;  2Y60 A;  1IPJ A;  3MPP G;  2RV9 A;  5A6X A;  1QOT A;  4C91 A;  2WAO A;  1BBT 2;  3UET A;  5FXX A;  5GM0 A;  2IXJ A;  3WG1 A;  2VZR A;  3UJO A;  2DWR A;  3NNJ A;  1LB2 A;  3CJI C;  2WQ4 A;  3N4M A;  1HB1 A;  2DFC A;  4I0A A;  1RYY A;  4IV3 C;  2PHL A;  4AGG A;  3RJR A;  3ZOI A;  4YNI A;  5FMO L;  4NE9 A;  1RUC 3;  2XBO 1;  5DUU A;  3U11 A;  3LOI A;  3IDB B;  3DPR B;  2BJS A;  1Q43 A;  3NKG A;  3PTR B;  4IL7 A;  4LUM A;  5EXO A;  3VZO A;  3USU B;  2J1T A;  3MGU A;  4MET A;  4N9H A;  2WNV C;  4XUQ A;  1AR8 3;  2RM2 2;  4F83 A;  1GZT A;  5JR2 A;  1A78 A;  3H3L A;  1PO1 3;  4FXK B;  4Y3O A;  5GZE A;  3SNM A;  3VHP A;  4AYU A;  1GP6 A;  3R4U A;  4QQO A;  4AED A;  3LAG A;  1W8N A;  5JLV A;  4XVH A;  2XJQ A;  3ROU A;  4CP2 A;  2D6O X;  1VBC 1;  4PQQ A;  4IEX A;  1QJU 3;  2WN3 A;  4LBQ B;  4QQ2 A;  5DAW A;  5DN2 A;  3SIS A;  2OUH A;  4IET A;  3VBH B;  1MS9 A;  3DV8 A;  3ZFF C;  1OBN A;  1QEX A;  1H2N A;  3GZE A;  4FPJ A;  3ES1 A;  3MLJ A;  2FDJ A;  2BPA 2;  5CAZ A;  2WLP A;  1W0P A;  3RZM A;  2A3Y A;  4CCC A;  4XE9 A;  1SDD B;  3AXE A;  1FX5 A;  4QAW A;  3V0B B;  1KDK A;  3AYE A;  2FCU A;  2J1V A;  3M2M A;  4MV2 A;  4PBP A;  1ZRE A;  5A3U A;  2WA4 A;  4IEW A;  1NLR A;  3ZXJ A;  1W9T A;  2C9K A;  2E51 A;  1QJX 1;  3NNM A;  3Q8F A;  3J7M A;  1JOP A;  2ZGL A;  3VZJ A;  1W39 A;  1WW7 A;  5EYX A;  2FMY A;  3M70 A;  4IV1 A;  1IOA A;  1POV 3;  1UCX A;  2VW0 A;  2VXJ A;  2ZX2 A;  2R16 A;  5T5J A;  1YQ6 A;  1K5J A;  1W6P B;  1PNF A;  4LKD A;  4Q27 A;  3NJY A;  5FPU A;  1COV 2;  1OOP A;  4LPL A;  1CIY A;  1OI6 A;  1RUD 2;  4Q4W 3;  4XFC A;  5FXW A;  4QXH A;  3LEK A;  3R6S A;  5FY9 A;  3GBW A;  2LRP A;  4I0W B;  4X8N A;  2UYB A;  4L97 A;  5APA A;  3VN4 A;  3ZYH A;  1N1V A;  4M0H A;  1GAN A;  3C8X A;  3PHM A;  2A7A A;  1W99 A;  2GU9 A;  2HLE A;  5DAX A;  1N3O A;  3SLI A;  4XDO A;  1H1M A;  3VB9 A;  1O3S A;  4H55 A;  2WT1 A;  1MZ5 A;  4HKL A;  1A8D A;  1O7F A;  3THP A;  2HEV F;  4HPK B;  5FZ9 A;  5T54 A;  4KGQ A;  2WC2 A;  3LOB A;  3LSE A;  4IGO A;  3M3O A;  4CU9 A;  1ALY A;  2E7Q A;  1ND2 A;  2E26 A;  4XOG A;  1GKB A;  2NPI A;  1W2N A;  3N3H A;  1O4T A;  2F17 A;  3NV1 A;  3Q9O A;  5E88 A;  4COV A;  5EPA A;  5IVE A;  4X8P A;  3O7O A;  5CKQ A;  1QXJ A;  1R08 3;  5J3U A;  4FBF A;  3VD7 A;  1E5I A;  5G05 L;  2IXK A;  2K9Z A;  3RRD A;  4CCL A;  5A3O A;  4XFG A;  2VPV A;  1W8H A;  1VLN A;  4ISR A;  3ZYJ B;  4DY5 A;  5C9A C;  3GCX A;  3O0V A;  5KHH A;  4AGR A;  2ZX3 A;  4LA2 A;  2W08 A;  4R4Z A;  4HK8 A;  4EQV A;  2VW1 A;  2WSV A;  4DEQ A;  4P5Y A;  5L7O C;  2W91 A;  1SCR A;  1U5I A;  4CP9 A;  3E1F 1;  4CTE A;  3NKT A;  1SHW B;  1UMZ A;  2V5Y A;  2MEV 2;  2TNF A;  4QDS A;  1HRI 1;  3OOX A;  3ZO0 B;  4HSL A;  5FYM A;  3SCF A;  5A7O A;  2C0Z A;  2JD4 A;  4O65 A;  5FRA A;  1US2 A;  4HVR A;  5FXZ A;  5LRR A;  3POF A;  5C3O A;  3WNM A;  3OPW A;  4TYS A;  3N9Q A;  4QKN A;  4P9L A;  4RSU A;  1LEN A;  1RUC 1;  2A3W A;  4Y4R A;  1ASJ 3;  4ZKT B;  1LGB A;  3KSC A;  4WM8 C;  2AUY A;  2BYV E;  4HVO A;  4NO4 A;  1FOD 1;  2D97 A;  3ST7 A;  3S7I A;  1AR8 1;  4W4Z A;  4A41 A;  5DAB A;  2WS9 2;  1HKD A;  2E53 A;  2KD7 A;  3KMH A;  3MLL A;  5FO8 B;  4IER A;  4Y26 A;  1QXR A;  3MO4 A;  4NHK A;  4JQT A;  1MEC 2;  2J22 A;  1C1L A;  2QQK A;  3ACH A;  4IGQ A;  5C8C B;  4FI9 A;  1G6N A;  1UZY A;  2YU2 A;  5T5O A;  3VHN A;  4Z8B A;  1B35 B;  1JS9 A;  1OA2 A;  3HNY M;  4E9K A;  4Z2A A;  3K4D A;  3FN9 A;  4UI9 L;  3ZSM A;  3USS A;  1V9U 3;  5FPX A;  3AKT A;  4UFH A;  3VDD B;  2HWB 2;  1PX4 A;  1XBF A;  1YNA A;  1I1E A;  1X33 A;  2R06 3;  2FCV A;  1BVP 1; 
#chains in the Genus database with same CATH homology
 4GZ9 A;  1SPP A;  3KQ4 B;  2WNO A;  4LOT A;  1SFP A;  2QQK A;  3POG A;  4LMF A;  2QQO A;  5CIS A;  3DEM A;  3POI A;  3POE A;  2QQM A;  5CKN A;  4LOS A;  3POF A;  1NZI A;  1SZB A;  3POB A;  5CKM A;  5CKQ A;  2QQL A;  4LOR A;  1SPP B;  3POJ A;  1NT0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...