3POIA

Crystal structure of masp-1 cub2 domain bound to methylamine
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
113
structure length
113
Chain Sequence
ECSGNLFTQRTGTITSPDYPNPYPKSSECSYTIDLEEGFMVTLQFEDIFDIEDHPEVPCPYDYIKIKAGSKVWGPFCGEKSPEPISTQSHSIQILFRSDNSGENRGWRLSYRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Mannan-binding lectin serine protease 1
publication title Structural Basis of Mannan-Binding Lectin Recognition by Its Associated Serine Protease MASP-1: Implications for Complement Activation.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 21
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 3.4.21.-:
pdb deposition date 2010-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00431 CUB CUB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.290 Mainly Beta Sandwich Jelly Rolls Spermadhesin, CUB domain 3poiA00
5CKQA 3DEMA 4GZ9A 1SPPA 2QQKA 1NZIA 4LOTA 3KQ4B 4LMFA 3POGA 5CKNA 3POEA 2QQLA 1SPPB 2QQMA 4LORA 5CKMA 1NT0A 2WNOA 2QQOA 3POJA 3POFA 3POIA 1SZBA 3POBA 5CISA 1SFPA 4LOSA
chains in the Genus database with same CATH superfamily
3FLPA 2VL4A 3FE5A 4JC1A 4FFGA 3OY8B 2PHXA 1UWWA 3GBFA 4I3GA 4NWWA 5E1RA 3AP5A 1SFYA 1TME2 4LBKA 2CAVA 4Q0VA 5K8SA 3ZXKA 2G4IA 4YFWA 1VBA1 4KWLA 4W65A 1B09A 1AR83 1ZX5A 2PHRA 1XE7A 3MPPG 2X8KA 5JXHA 5FPVA 5FZHA 1W9YA 2QZ3A 1R1A3 3ABZA 1N1SA 2XWBB 4EZ4A 1JH5A 1CAXA 2JENA 4PIXA 1NZCA 4CDQC 1MVEA 3RQ0A 3GZUC 4UOJA 5FMOL 3AJZA 5FTTC 2FMDA 5CBLA 2WN2A 4DXZA 3CDZB 3WOGA 3WDWA 2GH8A 3POSA 3OCPA 2FDKA 1LODA 4QMAA 5FIXA 3LA3A 2DFBA 1FI2A 2CGPA 5LY2A 3OBTA 5B2GB 1TMF1 4K8FA 2X09A 5T5JA 4IV1A 3ZDSA 2G9GA 1AUYA 5CKNA 1OFSA 1VBE2 4GH4A 1CAUB 4M0HA 2E33A 1NCQA 4AEDA 3LZZA 5FY0A 2BV4A 4CUGA 3BTXA 1A78A 3PL0A 1S0BA 1K5MC 3PNAA 4FQ4A 2DTYA 3ME2A 3Q9OA 4UFMA 3ZN6A 4LT5A 1QQP3 1GR3A 2XOMA 2Y6LA 5J96B 2JIGA 3VZLA 1YCIA 4W6XA 3N36A 2WR9A 3TWIA 3AKQA 4XFHA 5FMDA 3IM0A 1OQEA 3LEIA 4M00A 2I07B 1OSGA 4IE5A 4HVRA 2AH2A 4GKXA 4QDQA 2W47A 5FMCA 3M4FA 4CEYC 2Q8DA 1WZXA 4CUCA 4XXAA 1PGW1 1LENA 3AL5A 4QDRA 2PYTA 1G8WA 4AVBA 1DGWA 1OHFA 5DABA 2BQPA 2JE8A 3S30A 4CP2A 5C70A 4YWAA 4DEVA 1HV1A 2W1QA 3ES1A 4XJAA 5A6QA 5CKMA 3JBG1 3P3NA 1ZNPA 3ETPA 1UYYA 4RQPB 5D8AB 1MS3A 1RUI2 5IUQA 2D3SA 5HCAA 4JGYB 1ZA4A 2HWF1 1YWKA 4Y5SA 4A42A 4AI3A 4XUTA 3KS7A 3BOPA 5A33B 4YW6A 1NKGA 1RINA 2DVFA 1UQXA 2XHKA 3LDKA 4OHYA 1JYWA 1OH4A 4LBQB 3C7HA 4IEOA 1JZ3A 1NE4A 2VBBA 3ZSEA 1KGYA 2FMYA 2ZABA 1IS3A 4IUGA 3KB5A 1WLDA 1YIFA 1UU4A 1VBA3 2XL7A 4OZXA 3OUHA 5GZDA 2Z42A 3KM5A 1PIV1 3TYJA 3RZHA 1J83A 2WWJA 2ATFA 5FXWA 4CU7A 4XEZA 1NG0A 3DN7A 2HWE2 4LLOA 1JN2P 2G9ZA 1V9U1 5A6ZA 4IETA 2MHFA 1O7FA 3AP7A 1EPWA 1SFPA 4F3JA 1HKDA 1OH3A 2CDPA 2J42A 2WQ8A 3FBMA 1Y3TA 4N43B 4WM8A 1YJLA 4I30A 2UYBA 1QIQA 3CJIA 1JZ4A 1O5UA 2LS6A 4YW7A 5CG9A 3HQUA 2XH6A 1QMJA 4L0PA 2F4PA 1OUXA 2GNBA 1TMF3 3NV3A 4MGZE 1AX2A 4CZSA 5D1IA 1LOEA 3SH5A 4JHTA 2ZX2A 2Y6KA 4E2GA 2VOTA 4BIFA 4QKFA 4AEJA 1ULDA 1CAWB 1AYN1 3ILRA 4GA9A 4LK6A 3THDA 3LAGA 1EUUA 1JOPA 2ORXA 2VAUA 4NIAA 4JGZC 1S0EA 1BHGA 2H6BA 3ON7A 1XU1A 3WUDA 1DCSA 3VN4A 4MGIE 4BU2A 3OPZA 3USSA 3VKFC 1J3PA 4LBOA 4QPWA 5BNNB 5FY4A 5F5CA 3SNMA 4CE8A 2WA4A 2ZGQA 5DZEA 4YARA 4QX8A 2JDPA 1GP5A 2HWB1 4Q8KA 5JXIA 1H8VA 1AF9A 3K46A 3U37A 5FZDA 4ARXA 2Q8EA 4B4PA 4E2QA 1NY71 4IEXA 3JQWA 4OHZA 1UMZA 5DG2A 3BI3A 5H9RA 5KWRA 2X05A 1PO22 3FC0A 4N53A 2FHRA 1AL21 4E4SA 3ZSJA 2H6CA 2VQAA 3R4UA 4WM7A 5F3EA 3HMYA 4AL9A 1QJY1 3OYWB 1POQA 2WFF1 4GMP0 2HH9A 4PDWC 4QGNA 4OQ8A 2VMEA 5FPXA 4ITCA 3AJYA 4NR1A 1H4GA 4FPYA 3GZEA 2LROA 3LSDA 2PHUA 2W08A 2VO5A 1NOVA 1X9TA 2Z2SB 3J8F1 3LIGA 4OFGA 5KC5A 2JDAA 2W91A 2JD4A 1Q5OA 3DKQA 4XZPA 5FV3A 3MLLA 3H0OA 1OURA 1I3HA 3CF6E 4K1YA 2OXBA 2Q5TA 3OGSA 3WQ0A 5FZBA 5IAXA 3V56A 4AZZA 4DZGA 3U0ZA 3ZXLA 1WWYA 4QPGC 1VBC1 3FUOA 4ASLA 3RWNA 4UYBA 5CFCA 5EJ1B 1PIV3 3ZFEC 2ZGMA 3WG4A 2A6YA 4LHNA 4L99A 4ZZ5A 2JDYA 1V9U3 1NLRA 3IKWA 4MGSA 1MZ5A 1QJFA 3THTA 3LCPA 1OD5A 1PMIA 1AR72 5L19A 1VJ2A 1DQ2A 3KWVA 4OLLA 4LJHA 1BJQA 4JRAA 1UAIA 1G86A 1V70A 5C3PA 3GZAA 3WW1A 1UXXX 1W2NA 4EQVA 3V0AA 3VHOA 4JRLA 4DB5A 5L7OB 1K12A 4NJ4A 5IVEA 2ZGRA 1XU2A 3OB8A 1RITA 4ES9A 1UU6A 3ZN5A 2OUJA 5FXVA 4Q0SA 2ZBJA 5FPBA 4HPKA 5T5LA 3VBFC 1MS9A 2JD9A 1N47A 4CU6A 3PDQA 4UF0A 4RGGA 1YFUA 4QDSA 2ARXA 5A7PA 3WF1A 5IVJA 4Y4RA 4KGGA 1R091 3BTAA 3VGIA 4ATEA 1H1AA 3AMHA 1X8MA 1RUD3 4YLZA 1AYN3 1TQ5A 3GDBA 2VUDA 2QDNA 4CCDA 3JCIA 3L2HA 4M0NA 4PQQA 3SCGA 1C8M1 4XQWA 2DU0A 3WV6A 2ZKLA 1H6YA 1OXCA 4CDWB 4QQOA 1O8PA 2I74A 3FJSA 5I0SA 4HL0A 3OY8A 4QGMA 3UKNA 2TEPA 2HWB3 4GXLA 3BPZA 4CVUA 1VALA 3FBYA 5FYSA 2VNRA 2C24A 3WZ1A 1CAVA 3AVRA 4KBZA 4RGKA 1QJEA 3POYA 5FBJA 1VRH3 2ARBA 3OOXA 5AC92 1WKYA 2C0ZA 1DQ5A 2VOXA 4JQRA 1CIWA 2V4VA 2VVDA 4GJYA 4K21A 3N3HA 4PF1A 3AYAA 1AL23 1IPSA 3JQXA 4XCAA 2R1DA 2RJLA 4GJZA 3S5QA 1OA4A 5JOXA 2P6HA 1HW5A 2FDIA 1HB3A 3POWA 4YG6A 4LE4A 2WFF3 4LULA 3HAGA 1YC61 5L73A 1SPPB 3ZYJB 3WSOA 1IG0A 1W28A 2IFRA 1GZTA 2R062 3CNAA 4W6WA 1RUH1 1VP6A 3KQRA 5CFDB 3VLBB 4A2UA 3J8F3 2E26A 3M1HA 2HLEA 4IE7A 3ZM8A 1ENSA 2AACA 2NZ9A 2HEWF 3M3IA 4WBBA 4Y1UA 3UGFA 2WQZC 2ADDA 3AMPA 4R4ZA 4PDWB 1W6MB 3JXSA 1VBC3 4CDUB 2R071 3WP4A 2LW8A 4QKBA 5DDJ1 1O59A 4FOVA 4YW3A 3NKTA 3H7JA 1UPIA 2AYHA 4Q0PA 3TB0A 2DBNA 3WW3A 5DQ0A 5FK7A 5CNAA 2QDRA 3O1MA 4BQXA 1SLLA 3N9PA 1DGLA 4FTSA 3BU0A 1BYHA 5C6CA 4F8AA 1RGSA 4BQ2A 1ZREA 2AZ5A 2VMCA 3GBGA 5GZCA 5GLVA 1GOGA 3C7OA 4P9JA 1RUOA 2VU9A 1M4WA 1LHNA 3ZYIB 4QPIA 1A3KA 1RMU2 4UBHA 5LCWL 4RGAA 3ZXGA 4BJ0A 3LQCA 2WDBA 5K0UB 3RYPA 1XNCA 4J1WA 2BBAA 3NNJA 4BLJA 4IV3C 2QFEA 4HK9A 3VKOA 5C71A 1C57A 1MACA 1DYOA 4RQPA 1FXZA 5D8AA 2BGPA 1LOFA 1UMIA 3ENRA 2ES3A 1V6NA 3MICA 3P3PA 4JGYA 1W06A 2WWUA 2W95A 2YB7A 1C8M3 4XXPA 5A33A 3AYEA 1WCUA 1T2XA 1RTVA 3ORJA 4BIOA 2FCVA 2WZR1 4LBQA 3SQOA 1JXNA 1TVGA 3NSTA 3KV6A 2OYZA 4RFT0 1JU4A 1DZTA 1AHSA 2R32A 5CU1A 1IKQA 4E8DA 4R4XA 4PJYA 3U07A 4A45A 3WDVA 1SMVA 2BTVC 4QX1A 2ZS6B 2W0XA 2XL9A 1W3VA 4CCMA 1LR5A 2E53A 4Y4YA 2R041 3JUUA 4JKLA 4B1MA 1MZEA 4LUKA 3MW3A 1W04A 2C6SA 2ETEA 2ZGSA 3HNMA 4O7XA 1P8JA 4QX7A 1F2NA 1ZRRA 4KBBA 5E16A 4A44A 4AI8A 2Y60A 2W46A 1ALYA 2EIDA 4C1WA 1DDLA 2VECA 2VUCA 4C0HA 4KWJA 1VMFA 3TNPB 3DV8A 2YY1A 3KV4A 5DUWA 2O8QA 2XQXA 3M3QA 1RUH3 5DAVA 2CGOA 3SLIA 3TN92 1LU1A 4FOWA 1NT0A 4CDXC 5JSPA 4ZHNA 1REEA 5F5QA 4XIKA 4OHXA 3WW2A 3OEAA 5C4WB 1X9PA 4WVMA 5FZIA 1VR3A 2UY9A 2V5YA 3QOPA 5F2WA 3RWKX 4CCLA 4KL1A 1YHFA 5JLVA 3BN6A 1UYXA 1VB4A 1ULOA 2QBXA 2R073 2GMEA 4CCJA 5DDJ3 2ZEZA 1MS4A 2K9ZA 4AK3A 2Q30A 1CAWA 1H1IA 1UF2C 3B00A 5FUIA 4CPBA 4GH4C 1STMA 3PURA 1OF4A 4QXCA 3JZVA 1ONAA 1RUF2 2V73A 4PHZA 5JUVA 4LLFA 1JZ7A 2VMIA 4IL7A 5BNNA 4UXAA 3PVNA 1JYXA 1MVQA 1ZZBA 2WZPP 4QHZA 4BB3A 2EICA 1RUJ1 2O14A 3WDUA 5DUXA 1O5LA 2IXJA 1LOBA 2AREA 4YFZA 1OOPC 4L8QA 4RS5A 4YM0A 5H9PA 3K51A 1EV12 5FLHA 3WP5A 4XJWA 4Q4W2 3LD8A 4K40A 3FWEA 3OYWA 3FHAA 1YQ6A 1K42A 5JXJA 2GH2A 4Q2FA 4XOGA 4OCTA 2B9VA 3ZDVA 1Q3EA 2QUOA 2ID4A 3N9QA 1KXGA 3AX4A 2YBKA 3ZX7A 1DGRN 2P3YA 3EYPA 2ZHLA 1CIYA 3MIDA 1CX4A 4YGCA 2YC0A 1DQ0A 3VDDA 1H8TB 3H42B 1REFA 5KXCA 2J7MA 3KGLA 1ZRCA 3T2TA 4YVWB 4M4RA 4Q29A 3LEGA 2DCYA 3OGJA 4AQ6A 3N9MA 1CGPA 4P9XA 2R043 4QX3A 2A71A 1PVXA 2ZPXA 4K8RB 1IS6A 1C4RA 1W8ZA 1Z78A 1GU3A 3M70A 3BTYA 4FP3A 2FDGA 1MQTB 1KD7A 1DZQA 3T0AA 4NVPA 4HSLA 4HKOA 4LKEA 3SMHA 4AFCA 5JOYA 5ABJC 4BQYA 1RUC2 1X36A 4Q26A 1PX3A 2E6VA 1A8MA 4YGEA 2WT1A 5CYYA 4XBNA 5IHRA 3WF4A 5L7OA 2G9FA 2EAAA 4WVZA 5FOJB 1J84A 2AUYA 3I3MA 1EAH1 1WW5A 3T08A 5KXEA 1PK6A 3POBA 3F2ZA 1CONA 3KT1A 3OGVA 3QLQA 3L2YA 5DPNA 2A7AA 4LHSA 2RV9A 2WNVB 3QCWA 4YGDA 4SLIA 2IVJA 2VW0A 4CRQA 3VBUB 4KNCA 2K46A 4CU8A 2RS51 5C3SA 5FAXA 1KDMA 5FPZA 5FO7B 3W59A 5C9AA 4OI0A 3WQBA 1WCQA 4HFSA 4S2DA 4LO5B 3SHRA 5FR3A 3WDTA 2YYOA 3N7LA 1GZ9A 1QOSA 5J37A 1MS1A 4CYDA 3FFQA 1ZZ7A 4NHYA 4PI2A 4L9BA 1WD4A 2BW8A 3DPRB 4RR3A 1TNFA 5I0TA 5FY5A 4P14A 1QQP2 4IERA 4AHWA 4AG4A 4FAHA 5CG8A 4QXKA 4B4RA 2ZAAA 4MX3A 3AXDA 1JW6A 2XONA 1RUJ3 4YM2A 4WVWA 5FY8A 3RZZA 4UFIA 4E4DX 2YFZA 2VD7A 1LCLA 5C3QA 5F8PA 2K2SA 4RHV1 3ZYBA 4A6SA 2ZGNA 3RZGA 1UZWA 4I0AA 2IXIA 1SQ4A 1F5FA 1D4VB 1OI6A 1RUE1 3AP9A 1GZWB 3BOWA 3VD7A 1SPPA 3O5SA 3I2HA 2D5FA 5E88A 4PCRA 1POV1 2RDNA 4IEYA 1JODA 2W92A 2A6ZA 1Z7S2 2VZVA 1HXS1 2FQPA 4JX0A 4DXRA 2XVKA 4PLNA 3FMGA 3RYRA 2RM21 3I2JA 1FMD3 4YG3A 1V6IA 1W6PB 2R0HA 3IZOA 2WYSA 3HQXA 1Q56A 1SFNA 1WLWA 1MS0A 2VQTA 1PM4A 4YVSC 4D7YA 5AVPA 1AR91 3WNPA 2VM9A 1W6MA 1OF3A 4CDUA 3MEPA 4XJZA 1E5RA 2J1EA 4HLTA 2JWPA 5H9SA 1S0GA 4IE0A 1DYKA 1CZSA 1RVF1 1NCRB 5LBCA 1D4M1 3Q8FA 3RG0A 2D5HA 1KITA 5F32A 3WP6A 2ILMA 5T3NA 1W2UA 5A7QA 4V1PA 5IT6A 2D3RA 2LRPA 1W2TA 2XBO1 3KV9A 3PUQA 3NRUA 4FVVA 4M01A 1QHDA 4DFSA 2DU1A 2WLQA 2RDRA 2IC1A 1GANA 2J1RA 1EAH3 2ZAHA 4LORA 4XMIA 1DYPA 3A22A 4XVHA 1Y9GA 1UIJA 2ZEYA 1B35A 1VPHA 3BYWA 4JDMA 5K0UA 4H7MA 4HONA 4NHXA 3MFAA 1YFXA 3W20A 4QQLA 3C8XA 1OPOA 2RS53 1TMF2 3WF0A 5FY1A 4AVAA 2PHLA 1G9AA 3NAPC 3AP6A 2D43A 2V09A 1HLCA 1EYBA 2WC2A 3GHNA 3VBSB 3ZFGB 4A6OA 1H6XA 5BYNA 3FN9A 5J98B 5A7OA 3BVCA 3EB7A 5B4XA 1OA3A 1BBT1 4AQ2A 2OPKA 1A8DA 3BCWA 2WSVA 1ZZ9A 2YPJA 1QWRA 1LHOA 4KGQA 3SEPA 2D44A 4QX0A 4XURA 4J25A 3ZYFA 5F1RA 1W6NB 3HJRA 1SLIA 3EXUA 4Z07A 2RMU1 3VB9A 1PGL1 1GOHA 2YC4A 4P08A 1AXYA 5FZ4A 2BNNA 3B93A 4BQWA 5FRAA 4XC9A 4AAXA 2ZACA 3K4DA 1WCKA 2P4EA 1IOAA 5FZFA 4TLGA 4TZDA 1AYM1 2A3YA 2QQPA 3NNMA 5FYYA 1RUE3 5BNPC 3QD6A 3ZO0B 4NIHA 1R083 1OMIA 3I2FA 1POV3 5K7PA 2BGCA 5FPAA 1OT5A 1X8EA 4BQ1A 1HXS3 2ZEWA 2Y6JA 2RM23 4RN5A 1ND2B 2ZCWA 1GQHA 3GCXA 2W87A 2W9XA 3NJZA 4FPEA 4FFFA 5HXVA 5C4WA 1GSLA 4BLIA 4GULA 1MR5A 1W8WA 4Q4Y1 1ZBE2 3USUB 4HVQA 5A6XA 4NHLA 2X53S 3BPSA 2W1SA 4KG0A 4OMCA 2HBUA 4JTNA 1S4CA 2LTNA 1X82A 4HKWA 5LATA 4YZ3A 3ACIA 1RVF3 4MO3M 1D4M3 4CCEA 1DP0A 4UW4A 1S0CA 3CL1A 4YVSB 5J1XA 1JYVA 2ZA9A 5FYUA 2O0OA 5I93A 2VE1A 2XBO3 2WSUA 3VBOA 5BNOC 2OS2A 1EY2A 4DY5A 1W8TA 2ZX4A 4AI1A 4MV2A 4O61A 5E89A 5KXDA 1GNYA 3FFZA 1US3A 2BFUL 3GHMA 1ZA7A 1QY4A 4NHKA 2CU5A 4M4PA 3WINE 5E8AA 4AI2A 1SLTA 2H0BA 4BXFA 4JKMA 3VKLA 3AKRA 3RI8A 2VZRA 4QPIC 3KF5A 4LA2A 1XC6A 5D2AA 5G05L 4CCNA 1LJ7A 2QE3A 1MEC1 3B01A 3BB6A 4LUMA 1C1LA 1L7LA 4J6GA 4BPZA 2B42B 1VE0A 4I0BA 2YROA 5CKQA 2B45X 1BBT3 5FZ0A 1AR62 1RUD2 2LM3A 2Y64A 3HPNA 5LBBA 1C5IA 4IE4A 4FCAA 2BUKA 1H8TA 1VBB2 5IFTA 1HQLA 4AFAA 1LGBA 1OC1A 1NQJA 1NZIA 2RMU3 2B8MA 2WS92 4EN0A 2XDVA 3IN9A 1RUG3 2VH9A 5FZMA 3H7YA 2DUPA 4EJRA 2XR4A 3NAPB 4GKYA 5EYYA 2HWB2 2XJQA 3JB8A 4GWJA 1F4AA 1KQRA 4Y20B 1FOD1 1FV3A 1OQ1A 1AYM3 2NQYA 4FAGA 4JAAA 2W1WA 1VRH2 2HEYF 1MQTA 2Z69A 2WL1A 3BTZA 3KSCA 1ZBA2 1C8NA 2WNUB 1N3OA 4AQTA 4N8MA 2VBDA 2DUOA 2DV9A 4W8JA 1Y7BA 1AX0A 2VCAA 1D2QA 5FQ0B 4HSJA 1F35A 3TNQA 4CUBA 2DFCA 5FKCA 4P00B 4LE3A 3WNNA 2GC0A 3FZ3A 3WHTA 4S2FA 4EWAA 1H2NA 4P5YA 1QNYA 3AZYA 5A32B 3IB3A 4Q4Y3 3U4SA 5BNPB 3KHCA 2WNVA 4FPLA 3SCHA 1V6OA 2PHDA 3M7AA 3VBUA 4YSFA 5FXXA 5JMOA 1CZTA 2VR4A 1XSQA 2IXHA 4FFHA 3BALA 1O8SA 1VBC2 1L3JA 2R30A 4CEWB 3M3OA 1MS8A 3DPRA 2KA3A 2L9LA 3HBKA 4N7IA 1BMV2 4Q4X2 2HWD1 4XF0A 3KMHA 2FCUA 1UU5A 3I8TA 2XMLA 5HXMA 3BKZA 4RD7A 3FHQA 1SBEA 3VL9A 3KCCA 4G4FA 4E27A 4LTAA 2E31A 1C1FA 1EPZA 1TG7A 5LWBA 2Z79A 2PAKA 3S7IA 2Q4SA 3I59B 4K1ZA 2A73B 2TUNA 4DUXA 4RS5C 1LGNA 1SEFA 2JG8A 1GZWA 4HG6B 1K3IA 1HB1A 2R0FA 4JQTA 4NE9A 5EXOA 2WJSA 1MEC3 1O4YA 3B02A 3EO6A 4LHKA 4XJ9A 4AEMA 1GV9A 5KC6A 2UWBA 4XBLA 3WX5A 5JZGC 5IWFA 1DBNA 1GKBA 2E7AA 1TNRA 3U78A 3J7MA 4BMEA 1W6PA 3AFGA 4TSVA 1I6XA 1YEWA 2JE7A 4XILA 2HYKA 4FTEA 2ARAA 4BK4A 5FP4A 3ZFFC 1O3SA 4KU7A 2VNGA 3VBOC 5CA6A 5LA9A 2AEYA 3VDDC 5ACA2 1FAYA 2EXJA 2ZZQA 3MLKA 4KU8A 1OD3A 3HD8B 4C8DA 4H55A 3KZ4C 4FOYA 5C3RA 3R4DB 3ECQA 1NCRA 2R7EB 4E8CA 4YM3A 4Q5OA 3WXPA 3I49A 1GQGA 1WUVA 3N9NA 1SCSA 1ZRIA 2ZGLA 1V6JA 2P3KA 3WD5A 4FPOB 4QGLA 4GWNA 3ZPOA 3V0BA 1LNSA 3VUOA 1W03A 3A4UA 2OPWA 3O14A 1NYWA 1RUH2 1O3QA 2VW1A 4BQ4A 4NIDA 1PZ7A 3AVSA 3B9CA 3MUZ1 4E4HA 2GMMA 4XUPA 2VNOA 4N9HA 4COWA 2BGOA 3KQ4B 2JE9A 1PK6C 4OHWA 3FL7A 3LB9A 5I8TA 3O1UA 4CDQB 1U12A 4LK7A 1M06G 4FFIA 5FOBB 4IXLA 2PLV1 4NRMA 5EV7A 4GIQA 3DL3A 1KFXL 2R072 2VCBA 3A0NA 3POJA 5DDJ2 5T52A 3ZKYA 1PO12 4ASKA 5C9AC 2ZZJA 2MPFA 1IQDC 1PMHX 4AVTA 2JB4A 4QT6A 1S2KA 2VUJA 4BQ3A 1ZRDA 2HWD3 4ZXKA 4G9SB 3O1OA 4XUOA 1W6NA 3LWCA 3DEMA 4RR3C 5A3TA 4B4QA 1K5MB 3ZLIA 3C7FA 2X5IC 1W9WA 1R1ZA 3CMGA 3RS6A 3LFIA 1WMDA 2BU9A 3NJYA 4V2WA 1XXNA 1NA1C 4MXVA 3WG3A 5LY1A 2D6OX 1E5HA 3JBG3 4X6RB 1H2KA 3IDBB 4IW3A 3U1XA 5FBZA 2XJPA 4HMZA 4XE9A 3WUCA 2HWF3 4MGYE 1TME1 4BCUA 2Y33A 4D0QA 4CEYB 4QHOA 1I9RA 2RR11 1JYIA 4P02B 2W68A 3DECA 1ND2A 1IZ3A 3O1VA 3OF1A 2NP0A 4PBOA 2GZWA 4YZ4A 5GLZA 4XDOA 1CZVA 1BXHA 1T6GC 1ZM1A 2QQIA 3E6BA 4KWUA 5K9YA 3MZHA 3A7QA 3WNLA 3I2DA 1FYUA 3TBDA 3VKNA 2H0VA 3IBMA 2QQLA 5HI0A 3I2OA 4OUMA 2R042 4YNIA 3T1MA 4MHUA 4QQHA 3KT4A 1QU0A 2UWAA 5J3UA 3ILFA 2ZHMA 2IVIB 4XABA 2CDOA 5GKAC 2ZKNA 3B5LB 4CCOA 4B8EA 5A3UA 1F15A 5LBFA 4UAPA 5A1AA 5HCFA 2WN3A 1HN0A 1LEDA 2O8OA 4UI9L 5GJ6A 3ACLA 4LO8A 1NUKA 2BZDA 4FO9A 4IEQA 5APAA 4XQ4A 3N4MA 4ZU5A 1PVC2 1Q8VA 2LUWA 1FT9A 2XHNA 1YQ2A 2JECA 3WG1A 3TEYA 2BFUS 3IDAA 4DUVA 2IFWA 4UT5A 2E51A 3Q8EA 1DQ6A 1JHJA 5F2SA 3O0VA 1UKRA 3C7EA 3PUIA 4P9IA 2B7YA 1XNBA 2ZGPA 2EXHA 4Y26A 3P6BA 1BEV2 4DIQA 4HXCA 1Q8SA 4GB31 4JZRA 3IMMA 1N3QA 3IPVB 3AM2A 1GNHA 1RUI1 1UD1A 2C5DA 5I0RA 1ULFA 1S0FA 3LPGA 2EAKA 3CU7A 3VZOA 1TZOA 2RDQA 4Y20A 3K3OA 4JGZB 3Q8BA 1QDOA 4XW3A 4C91A 2Y6GA 5A3MA 1D0HA 2RS31 2YGLA 5FO8B 1D7PM 1QJY3 2J1UA 2WNUA 4MLOA 1LHVA 2IWGB 1TME3 3K48A 2MEV2 1CQ9A 3MIHA 4C1XA 1BQPA 2PQQA 5FQ0A 2RR13 2JX9A 3POIA 5FO9B 3PMSA 1OKQA 1W6OB 3D0SA 3MV01 3VBHC 2EALA 4D6SA 3S57A 3ZOIA 2P6CA 1WMXA 2PHFA 1F4HA 4O9EA 4LOSA 3H50A 4DXSA 4DY3A 5B4NA 4NIGA 2BNMA 5FMOS 2HWE1 4Y1ZA 3TEXA 1SACA 1FMD2 1XYNA 4AAPA 2WO2A 5DG1A 3UESA 4COYA 4BWOA 5AVAA 2Q1MA 1CAUA 1DU3D 2ZMNA 4Y22B 1ND3C 4XYXA 5GZFA 1S1AA 3S6PA 4ISRA 5C8CC 2PFWA 2PA7A 2KXLA 2RE9A 4OI2A 1QOTA 4FPKA 3DYMA 2GNTA 1S2BA 5J36A 3ACFA 2IXKA 4CEWA 1UXZA 4BOWA 5EJZB 4NPMA 5FZLA 1KS5A 2VY0A 2JDHA 4LQRA 3J4UH 3NKGA 4OMDA 4IEWA 3VBRC 4I01A 1HRV2 4H3WA 3O0XA 2HBTA 4QPGB 4EWEA 2JG9C 1UY3A 3BIWE 3NO8A 3ZFEB 4XJ8A 3GZTB 2B46X 4LR4A 3I59A 5DAWA 1R093 4A7ZA 2YG0A 4QX5A 4XF4A 5C3OA 4FPGA 1YQ5A 1CR7A 4GMP1 2FDJA 2Z4FA 1RHI2 1FV2A 1S55A 1FPN2 4Q1RA 1SG3A 3ZPYA 3M8LA 4LKDA 3MUY1 1CX1A 3QACA 3VBFB 4QQ2A 3ZXAC 5JI9A 2E7QA 4WV8A 3H8RA 4GB33 1B35C 4G3YC 5CISA 1PO21 1YQCA 5BPXA 2WUHA 5JI7A 2WBKA 1XE0A 1H9PA 3RNSA 2W52A 5A70A 5IK4A 5IJRA 3WEZA 3KHBA 2GU9A 3H3LA 5T5OA 5KXBA 2FDHA 2RS33 5ISLA 1AJOA 1N1TA 4B7EA 2OVUA 2WKKA 3H8UA 2KD7A 3EHKA 4D7TA 1HDKA 2GP5A 2C26A 4NPRA 3POEA 3T0DA 1DGWX 3OUIA 1UYZA 1RUE2 4MUVA 2BRTA 5FYMA 4FI9A 1R082 4MXWB 5JAXA 4ARYA 2QQJA 4RFRB 3PVBB 2XKPA 4N43A 3KVBA 4R52A 1NQDA 5IK5A 1YI7A 4QXBA 4AFMA 3OGGA 3V64A 1T6BX 2HWE3 3PJYA 2BERA 2ET1A 2IXCA 4W50A 1LHUA 1AR71 5A6YA 1VIWB 5EP9A 4CDQA 4OI4A 3O1RA 2QQWA 4RYDA 2Q1ZB 4QB6A 2OIIA 4IV1C 1S2EA 4YM1A 1YLLA 1QJZA 3HWJA 5C7GA 2BVVA 1NCQC 3PTYA 4AEDC 5IVCA 3WNMA 5HCHA 2R6QA 1HIXA 5JPNB 2JICA 3LPFA 2HWC2 4YRDA 3C2UA 1SLAA 1WW6A 1RVF2 2ZJCA 3IIIA 1D4M2 2QTWB 4V2VA 2ENRA 3FLRA 5FP3A 5FZKA 3UJQA 4AFBA 4Q4V1 1UZVA 1K5MA 3NV1A 4DRVA 5C8CB 4AW7A 2P5BA 1WW4A 3GM8A 2BPA2 5LA0A 2DVDA 3WY6A 2C1FA 3LSEA 1JBCA 4Y1XA 1CJPA 1OLRA 1JI6A 4A3ZA 4XTPA 2XJSA 3LF7A 2OX0A 1H30A 2RG4A 4GMP3 4F7ZA 1IS5A 1GZCA 4I09A 2PXJA 1FX5A 3WNKA 3VBRB 5FP7A 1VLNA 4C0BA 2XJRA 3MPBA 2JG8C 1LOCA 3AXEA 3OBZA 2HYXA 4CEYA 1OLME 1UPSA 5FYBA 4BHPA 3NNLA 3I97A 1GNZA 1WLCA 5FUPA 2WZR3 5ANQA 1O3RA 1QJU2 1PO23 5I0UA 3SKVA 3U75A 1PNGA 1SZBA 4HN0A 3KV5A 4IV3B 4AHYA 3SKJE 2FD8A 1Q8OA 3UKVA 4YW4A 1A6CA 1QKQA 4QD2A 1W90A 3FX3A 5I91A 1PGL2 4QAWA 4D7SA 1J1LA 1RUG2 4EE2A 4HT1T 4AI0A 2ZEXA 4XTMA 3HEIA 5A3OA 3T4HB 3HBZA 1MZ6A 1GBGA 3CJXA 1VMJA 1AR82 1WLTA 3DCQA 5IVBA 1AYM2 2QZ2A 1UN1A 2VGDA 1UOBA 2NMNA 4XIOA 3UKTA 4CSWA 2FZ1A 1IGOA 1VBD1 2RVAA 1R1A2 5CAZA 2XG3A 4PIZA 3GGLA 4OVEA 4XFFA 3DYPA 1QXRA 1PHMA 4WM8C 1Q8PA 2O1QA 2PAMA 3CJIC 1XNDA 1JOJA 4XJUA 3H8OA 4MZUA 2CNAA 1JZ8A 3BU7A 2JDMA 3RZJA 4CP0A 2IUWA 3URFA 2DCZA 1XB9A 2JDUA 1CJDA 4LNVA 1BLZA 2SBAA 4XF3A 4DPNA 3A23A 4LIVA 4CDXB 1OKOA 5FYHA 2LALA 4D8MA 1JMUB 1ACCA 2IXLA 3AMMA 4CDWA 1W05A 3WNXA 2XXZA 4TTGA 4AHXA 4XZUG 2F6BA 1UOGA 4AFDA 4N90A 1V00A 4XUQA 1ULPA 1N1VA 4ISQA 4OUEA 4CTEA 2WA3A 2NLRA 5JCTA 4Q4V3 3B69A 3RJ2X 3SH4A 2D98A 5F3CA 1RXFA 4Z82A 3CBNA 2D97A 4I3PA 4GH4B 3VV1A 4JGZA 3EBRA 3VHRA 5FCCA 3PIGA 4CP9B 5L9BA 5IVVA 1HRI1 1W3XA 1ASJ1 4MHRA 3VHPA 2VMGA 4N53C 4QHBA 3WNOA 5LA2A 4CXWA 1EUTA 1BZWA 4EN9B 4N9IA 5FUNA 4YZ1A 1OPMA 3U10A 4WM7C 4B7KA 3H1YA 1DGRA 3UL2A 5CFDA 3UV9A 1OLQA 1CESA 3K77A 1OOPB 3POGA 4MOAA 1W6OA 1AJKA 3RFRA 5FZAA 3PVOA 3U14A 3ZSMA 3RPQA 4ASMB 1AL0G 1DQ4A 5DZFA 3CIHA 4ET7A 1XRUA 4XCBA 3RYKA 5JXGA 1CN1A 3D3AA 2GSYA 4XFGA 4PDWA 1OVPA 5F6KA 4LO4B 4Y22A 5FWJA 2QVSB 3AZWA 3TN91 1GWKA 4FXGB 3JB4C 1VBA2 1ZZCA 2XKOA 5CFCC 4N7UA 2J1VA 2ZXQA 3MIGA 3VDBA 2DCTA 2E63A 4META 3QBQA 1COV1 1VBD3 2GN7A 3JD71 4OZOA 1K45A 2P1BA 2PTMA 5EHDA 4IEVA 1AXKA 4DQAA 3OSDA 4QPGA 5FZ9A 1S0IA 3A0KA 3HOBA 1PNFA 2OQ6A 3NVCA 4UW3A 4XUNA 2VJXA 1RXGA 3PMEA 2ZMKA 3T4VA 3ZFEA 3VHNA 2HEVF 3I2IA 1QXPA 4INDA 3M3CA 1RUF1 3NJXA 2CV6A 2WNEA 3LIHA 5FP8A 2G19A 3N7MA 4ES8A 4ZS3A 5CADA 5ABJB 3CLPA 4Q27A 1YFWA 2GC3A 4SBVA 2VXRA 1G6NA 1VMHA 2VTXJ 2PMWB 2WRAA 3T0BA 3T2QA 3INAA 3B7MA 3ZXJA 4R8HA 1X50A 4XFAA 5EQUA 3AMNA 2C9AA 1KDKA 1UKGA 1PGSA 3X29B 3VBFA 2D6KA 4O65A 1S0JA 4AVSA 2D7FA 4Y24A 4PLOA 5L36A 4MGTA 2HJIA 4ZKTB 2BYVE 2ZGTA 2GNDA 3NWKA 1EV11 1AX1A 5F37A 4K3UA 3R0RA 2YBSA 1XNKA 3PUSA 3T09A 1O4ZA 1E57A 5FLJA 2ZOEB 1DLCA 2NMOA 4K7JA 1QEXA 4RHV3 5KHIA 1DHKB 3IAPA 2WABA 1N3PA 4HN1A 1W99A 1DG6A 3H1MA 1HRI3 2QKDA 2Q0AA 4QB2A 1ASJ3 2KR2A 5FP9A 1PGW2 1G9DA 5F9TA 1CWPA 4ZONA 1W9TA 3RGBA 4QKDA 3PUAA 1X33A 1I5PA 2VCMA 1ST8A 3ASIA 2VZ3A 1GOFA 3JBG2 5GZEA 2N7GA 3C7GA 4AQSA 5C8WA 3PJQA 1MZFA 4JVAA 4AR2A 5BY5A 2HWF2 5FZ7A 2DVGA 4X8PA 4BZ4A 3AK0A 3ACHA 4WZCA 1CVNA 4IEPA 2WFPA 4ONUA 3OPWA 4QKNA 4UFLA 3IAQA 4YW5A 1ODMA 4LKFA 4NMIA 5DUUA 1AR93 1YXWA 1JYCA 2EF6A 1H0BA 1HX6A 5GLWA 4NWVA 3K75B 2XJUA 3AKSA 2AGSA 3ES4A 1RUC1 2A5ZA 2B39A 2UURA 3CZUA 3VDCA 3E1F1 1Y9MA 2ET7A 3K2OA 1KS4A 1UX7A 2WT0A 3HNBM 5IK8A 1VRBA 2J1TA 1LOGA 3VD4A 4JTOA 1WW7A 3CZJA 4DEQA 1PIV2 2VG9A 2WO7A 4CPBD 5TSWA 3BUCA 3N35A 2YBPA 1COV3 3GBWA 2R49A 1GFF2 1V9U2 3JD73 1X7NA 1NLSA 4YZ5A 3E6DA 3SISA 4ATFA 4EN6B 3HN3A 4AVCA 3MF9A 3R4SA 3GYDA 4IDZA 2JDZA 2QQMA 5LB6A 3WF3A 3DXUA 1RUF3 2WO3A 4L92A 4L97A 4GQ7A 1PMJX 1SDWA 3A21A 4Y3OA 4XDPA 4P9GA 1BK1A 3MW2A 4MVTA 4AGRA 1YNAA 3TEWA 5LRSA 3KGZA 3QH6A 2VMDA 3PTRB 3FHIB 2B9UA 3N7KA 2Y0OA 4RQPC 5D8AC 1I1EA 1H9WA 2QJVA 1LOFC 2WAOA 3AYDA 1AYN2 2QQUA 3DUIA 4JGYC 4HKLA 1EV13 4IV3A 4NRQA 2W2IA 4QQPA 4YVWA 1HB2A 1J3QA 2PN5A 2UWCA 1BVVA 3ATGA 3MO4A 3QH7A 4UW5A 3WLUA 1NAEA 2OW4A 4XAAA 1Z7S1 4FPHA 3WG2A 3ZXEA 3T2OA 4COUA 1VAMA 3ELNA 2QQVA 1NY72 4QU1A 5FWEA 3C3VA 1HQWA 1F31A 3WHUA 1AL22 1F9KA 4HVOA 4BDVB 4ZPIA 1W6QB 4LITA 5FYCA 5JOWA 3O1TA 3KCXA 3ZYHA 3I7DA 1LULA 4LBNA 1QJY2 1MPXA 2WFF2 1OA2A 3E5XA 3J9SA 3BIEA 4A3XA 4FOQA 1UIKA 2XJTA 4PI0A 1QGLA 3GCWA 5FZ6A 4YW2A 3ZYGA 1CAVB 3U4XA 2RR12 3K4ZA 3K4AA 3KD4A 5T54A 4LMFA 4N43C 3J8F2 2JDKA 5T55A 2P34A 3CO2A 4AGVA 4DUWA 2J1SA 4M3CF 1J58A 1RUC3 2OA2A 4AF9A 4JDOA 1GWLA 3LFMA 5EJ3A 3MDPA 1JZ6A 5FKBA 1LOAA 2FZ2A 4CDXA 3DGTA 2CGNA 4TN7A 4XBQA 4BM8A 2P3IA 3ZMOA 5SV5A 4MG2A 1W2OA 3CQOA 1ENXA 3MYXA 4MSVA 5IVYA 3VD3A 2XUMA 3AC0A 2B4KA 1Y4WA 3WCRA 3WW4A 5BNNC 1RC6A 5C5UA 4R9CA 5HV4A 1UL9A 1ZZ6A 2XPJA 4Y5TA 5A7NA 2XLAA 2RS11 3P5BA 1LESA 4MGQA 5J7MA 3RVHA 1WBFA 4H2AA 4CP9A 3UJOA 3HN1A 1OVSA 3DF0A 3SEEA 2W94A 5F3IA 3AZVA 1OUSA 4D3WA 1Q8QA 2C9KA 5BNOB 2JKXA 3PU3A 2VQUA 2WYFA 4UFHA 5L9RA 4PIYA 4TXWA 1R092 3WT3A 3KVAA 1W0OA 1XBFA 3LA7A 2A70A 1CPMA 1D2SA 1XJAA 2WINB 2R16A 3BGAA 3Q8CA 4U36A 3IIAA 1OOPA 3I2GA 5A3PA 2Y34A 3MGUA 3MBWA 2JXAA 3TAYA 2AEZA 1C8M2 5LEKA 5EYXA 5FZGA 4DS0A 3H3ZA 2ZX1A 3I3QA 4L2NA 4QPIB 4XHBA 4I02A 4PF5A 3NQHA 4PLMA 4GB32 5E6HA 4AE2A 2BOIA 4ZU7A 1W8FA 2CY6A 2UU8A 4F83A 1Z7S3 5T5PA 5JIUA 4W4ZA 1FOD3 2VOWA 4B3NA 3V65A 2BWAA 4EN7B 3KF3A 5JDBA 4TYSA 4CCKA 1QJX1 4XQDA 4K20A 1JZ5A 1J3RA 5L9VA 4D69A 1SLCA 2WLPA 2RS32 1U5XA 3W21A 3W5NA 3CKHA 4BXSV 1ZBE1 1HQNA 3D4KA 2DDUA 3AZZA 1KJRA 2VBPA 2YV8A 4H14A 5IW0A 2IZWA 2E9QA 3MIFA 2A1XA 4I0WB 3OEBA 3THPA 5L7OC 1WMFA 5I0DA 1UOFA 1KEXA 4D6RA 2ERFA 1LECA 2TNFA 1UY1A 5ABJA 4OHVA 1HJFA 4UBGA 4YZ2A 2EXKA 1H1MA 3T1LA 1RJ7A 2Y38A 2QQOA 1U5IA 4CA9A 3ZFGA 3VBSA 1TEIA 2P2KA 3AB0A 4HANA 4QB1A 1QXJA 2GMPA 3LE0A 4AXOA 2W5FA 2VTXA 5FREA 3E6CC 1SDDB 5T50A 3HR9A 2VCCA 4CDWC 3UNPA 3ZN4A 1KFUL 3AZXA 4JHZA 2VZOA 1DZRA 4WVMB 2Q8CA 1LHWA 2RS13 2NM1A 2D93A 2JDNA 3O12A 4QM9A 3LOBA 1UYPA 5DMYA 1AR61 1RUD1 4GWIA 5AFEA 4EZHA 4D94A 2WZ8A 3RDIA 3ZMNA 1V6KA 3T3YA 4ZS2A 2YHJA 5FZEA 1WA6X 1VBB1 5LW9A 3ZYRA 1BK0A 2WS91 3I2KA 4TLFA 2SLIA 3TEZA 4AHZA 2FCTA 3B94A 2EA7A 3OD0A 2KM2A 1YO8A 4FXKB 2ZX3A 1J1TA 5CFDC 1GP6A 3MLJA 3OBRA 1VRH1 4RS5B 4IESA 2WZR2 3M3EA 1SBDA 1CD3G 1ZBA1 1S0DA 2VZ1A 3EJKA 1RIRA 5EFUA 3USUA 1FATA 1WGPA 4DNYA 2Y6FA 1BKZA 4LXLA 2P37A 4LBMA 5H9QA 1TE1B 1O6UA 5FK8A 4DXTA 4NPLA 4FPJA 2VW2A 3HIFA 4Y5Z0 5F5IA 2ZHNA 5JZGB 1PM7A 4HZFA 4OUSA 1NXD1 4CDUC 2PQSA 5DAQA 5FMBA 1QJX3 1HV0A 2W1UA 1APNA 4LA3A 1AZDA 1Z0HA 3EQEA 1DIWA 1QF3A 4YVSA 5HPOA 1QH6A 3ZFFB 2TBVA 2YPDA 3VBOB 1ZBE3 4Y1YA 3G6JB 1URXA 3VDDB 4D6QA 1VBE1 4YG0A 4XACA 4OQ9A 3F95A 2RHPA 3ZKUA 2JKBA 5DAPA 4AI9A 2OQ7A 4PQ9A 4NRPA 3I3DA 4ZXEA 4RSUA 4A7YA 2QQNA 1GWMA 3SXWA 1ENQA 1ODNA 1GUIA 4KG8A 4HOOA 2CL2A 2A75A 2YU2A 2GN3A 2VOVA 3GALA 1BMV1 2BDRA 4Q4X1 5K0UC 2PELA 3RI9A 2PLV3 3T2PA 1LGCA 3ZSKA 1IG3A 2BVBA 3AFKA 4YW1A 4FT8A 4OULA 3ACGA 4S2GA 3GF6A 1YI9A 3WCSA 5GZGA 1F5JA 1LU2A 3RZMA 4JCKA 4A41A 2QCSB 1H2MA 1PK6B 3CEWA 1H2LA 5FJHA 2PHTA 1AXZA 4GAZA 2VTFA 2VMFA 2YGMA 3NAPA 1PX4A 3OUJA 5FPUA 1SCRA 3R05A 4BE3A 2NN8A 1RUJ2 3FUQA 4Q4V2 3S7EA 4W6YA 1AR63 2JIJA 1REDA 5C9AB 1O91A 3H3UA 5F6LB 2D6PA 5A7WB 3B9IA 3J26N 1VBB3 4XFIA 4ZU4A 1UY2A 2WS93 4CXXA 1W6QA 4RR3B 4NHMA 2DF7A 5CZKA 5LK5A 5ACA1 4IGPA 3H9AA 1YYNA 1J59A 1JOBA 2X5IB 2Y8KA 2DBIA 3WR0A 4URAA 3ALQA 2XQRA 1NA1B 1O4TA 2BOJA 1OFNA 5BNPA 1HB4A 5A32A 3VZJA 5IVFA 1ZBA3 4ORFA 2JEMA 3RZLA 3OPTA 1ULEA 4CCCA 5C4WC 4M3CB 1UY4A 1YUDA 3APBA 3D8CA 5ANNA 5FY9A 2RJ2A 3HT2A 1QDCA 5FYIA 5M0TA 4XF1A 3UT0A 3ETQA 3RJRA 2CHHA 3I54A 3DKWA 2VXJA 3GJAA 5LRRA 2XGXA 2OUHA 1XNTA 1BCXA 3OG2A 2DWRA 1F8VA 1IKPA 1RYYA 1UNBA 1UO9A 1VBE3 3E5QA 4LIUA 4LO6B 4S2HA 3ILNA 1VBD2 2Y26A 4QM8A 2A6WA 4XAEA 3ZXDA 4CXYA 4GZ9A 1QOOA 2Y6HA 1R64A 2R1BA 1PO11 4EWDA 2AENA 5KHKA 1EAH2 1Q43A 5GALA 3AMQA 2RDSA 2VNVA 4Q4X3 5BNOA 3GXUA 2P3JA 3IDCB 5GLTA 2V72A 2CWMA 5JR7B 4QPYA 1XPWA 2CAUA 4P9LA 3B3QE 2RS52 2GDFA 4IQPA 4MYEA 1RJ8A 3J7LA 3MW4A 1UCXA 4FPCA 4EROA 1W9FA 2ZGOA 3Q8AA 4FBFA 1GP4A 3AP4A 3KCYA 4BISA 5KR7A 3RMYA 4FPFA 4ZY9A 2ZMLA 4AEKA 1ZVFA 5JSOA 1O3TA 2A3XA 2YFUA 2VQ0A 5A80A 5A1FA 2ARCA 4XFBA 1RUI3 1ZYBA 1H8TC 1YJKA 4LPLA 4Z8BA 4Z2WA 4BA6A 3KLSA 4C90A 2CSGA 4YVWC 2VUAA 3BODA 3ITQA 3UK9A 5A3NA 1H4HA 1KRIA 5K4LA 4RHV2 3VL8A 4NAOA 5JIAA 3SCFA 3UGGA 2YDEA 1L7QA 2DUQA 4QXHA 1WD3A 1HRI2 1ASJ2 1MQTC 2VC9A 2OKXA 2C4XA 5ACA3 2E7TA 2VMHA 5DZGA 2YMZA 3UGHA 3MV11 4AGGA 4XPVA 1CPNA 1IQAA 3HNYM 1HXS2 3IWZA 1N1YA 4U2AA 2BP6A 1NLQA 4XETA 2Z5WA 4NIIA 2RM22 4KI5M 1DFQA 1US2A 2BEOA 5FY7A 4XDQA 1NXMA 2PAEA 2YC2A 1NX9A 4P9WA 1RB8G 4I2OA 2VZTA 3DXTA 3WDYA 2V4AA 4B1LA 1DF0A 2Q1FA 1SHWB 2BWCA 1HN1A 5AFBA 1AR92 3GNEA 5GLUA 2WNVC 1YIPA 4K6BA 3THCA 1MS5A 2D6LX 1XOYA 3T30A 2Y0IA 2ZX0A 3VBUC 3VBHB 3WVJA 1POV0 4KQ7A 1LRHA 4NOTA 1VB2A 4NUBA 3VZKA 1PZ9A 3JU9A 1E5SA 4XFCA 1G9CA 2DVBA 1PVC1 4IGOA 1W8UA 3VZNA 3HQRA 2BBVA 1OQDA 2G1MA 1ND3B 3DPRC 2XBO2 1COV2 4DMIA 3JD72 3VD5A 5FZOB 3KT7A 5IATA 2P17A 3RZKA 1U0AA 2X29A 4UFKA 1D0GA 2YU1A 5A3LA 1PO13 4M3CE 4MH0E 1RUNA 1XQNA 4R9DA 4AOCA 1BEV1 5FYTA 3NL1A 4FTBA 4MADA 3HVDA 1YQ8A 1G7YA 2VZSA 1GLHA 3IDEA 2DCJA 4LEJA 1V6LA 3AYCA 4MGKE 5A7SA 5FDBA 1ZRFA 2JG9B 4UWDA 1UZ0A 3NV4A 5AC91 4LBLA 5SV8A 4RA0A 3ZXFA 4Y1VA 1G9FA 3H1WA 3M2MA 3LOIA 4DO0A 1XYOA 1BBT2 4FP2A 5CB7A 5F39A 1ENRA 1LTEA 1W9SA 2DCKA 2RMU2 2MEV1 3AKPA 2R061 3SITA 1C3HA 4URTA 2GP3A 1W8NA 3VDAA 5JZGA 1XSRA 1EP0A 3MFCA 3IT8A 1W39A 2J22A 4DRRA 1PZ8A 1B35B 1JYNA 2I2SA 5G04L 2WQ4A 3J7HA 3ZFFA 1ZZ8A 3RMXA 4YYOA 1FMD1 1JUIA 1NCRC 2XLGA 1ULCA 3TRSB 1UW8A 2XVGA 3PU8A 4CUAA 3NW4A 3G7DA 3HT1A 1V0AA 1LKNA 3PLQA 3POFA 3LEKA 5FJKA 3J7NA 3WQ7A 1LAJA 3OTFA 5FZ3A 1C28A 4Z92B 4XHXA 1OBNA 3NV2A 2OZJA 1IPKA 1AR73 3NMBA 1SLBA 2MNGA 1JZ2A 4X6QB 5EWSA 1UMHA 2X10A 4Q4Y2 3U11A 2XVLA 4Y33A 5A3WA 4DOUA 1HRV1 4Q8LA 5HBAA 5IFPA 1CAXB 1GYKA 2CWSA 3LEMA 4Z2AA 2K0GA 2XWJB 4LOTA 4PBPA 3O1SA 2F4LA 3UETA 4B29A 2BNOA 1FNYA 2EIBA 2DTWA 1RMU1 3VBSC 1KJLA 3ZFGC 4COZA 1PVC3 3IPVA 3ZIWA 5LASA 4Q1PA 2VZQA 1W8OA 5LA1A 1RHI1 5J48A 1FPN1 1ULGA 1YFYA 3D5OA 5CVRA 3R6SA 5C5TA 1UX6A 4IV1B 1U5YA 2A6XA 4GD4A 5GM0A 3RSJA 1NCQB 4AEDB 1G9BA 4TWTA 4NROA 2XJVA 5JPMB 3OBAA 2DVAA 5I8SA 5JOZA 2GAUA 3N9OA 4UW6A 4EN8B 3VD9A 5IK7A 3LDBA 1BEV3 2ORZA 5A7WA 2Q8OA 5KBFA 2EXIA 5F3GA 3ZN6B 3MF6A 5BV6A 4EYUA 1IHMA 5HCBA 2FDFA 2GC2A 4E9KA 3LA2A 1GICA 1XNAA 3NNGA 1BVP1 3W5MA 3S5AA 2BJSA 4FQZA 5AC93 2UY8A 2J1AA 3OD4A 4IEUA 1MEC2 4A7KA 1V6MA 2X5IA 5IYYA 5FYVA 1JTZX 4WZFA 4BH9A 5J09A 4PT6A 4LKSA 4QU2A 1NA1A 2D6MA 3ROUA 4JV4A 5JMCA 1ND2C 3MIEA 2HKXA 5FXZA 3W58A 4LHLA 5EZWA 1XE8A 2MEV3 3LKJA 2R063 4M3CA 2YZ4A 4XF9A 2ZGKA 2JG8B 1R081 1WMEA 5F7UA 1UOJA 3PIJA 4Q0QA 4QWNA 2D3PA 3OJBA 5DAXA 1JUHA 3K3NA 4OYUA 2A6VA 2QQKA 1FOD2 2EIGA 5BXXA 1I5ZA 2V5DA 1GMMA 4Q0UA 5CIRA 5EPAA 2DYCA 2NPIA 1OLMA 2ZGUA 2WO1A 3NNFA 4KMQA 3PVEA 1SBFA 2EVXA 5DN2A 5DXDA 4ZZ8A 4BQ5A 5FZ8A 3LDRA 2QNKA 3E97A 3E5UA 1UY0A 4O9GA 5LBEA 5LEJA 5JVVA 5A1LA 5C33A 5JWPA 1DLLA 4HBNA 2HWC1 4IE6A 3D82A 4CU9A 3O1PA 1U5ZA 3P1IA 1IPJA 4IGQA 1L7RA 5FZCA 1HRV3 4GWMA 2VPVA 2PHWA 1W2AX 1Y9QA 1AVBA 2WAAA 3W9AA 3V0BB 3UYJA 1JHNA 1RMU3 1WCSA 4KWKA 4WM8B 3I3BA 4JKKA 3ZIXA 3CJIB 5BUVA 1LEMA 3VZMA 4Q4W1 3TOJA 2OT7A 2VULA 4LBQD 3ZVXA 3AL6A 1RHI3 1FPN3 4XMAA 2HWD2 3ST7A 5KHHA 1A34A 2VZUA 3GJBA 5FPLA 5FFOC 3WDXA 4BYYA 2VVFA 4FSJA 4OI1A 2ZTNA 5KHJA 2JB8A 5BNQA 2RJKA 4P5HA 1QNWA 1NE6A 2RS12 5JR2A 1QJU1 1QH7A 4A4AA 1UZZA 2A3WA 4NO4A 5IAVA 1GQPA 3CHXA 4K9SA 3PHMA 4MXWA 3ZR6A 4JDNA 2WNUC 1WBLA 4QX2A 1VAKA 1WA4A 4IEZA 5FYZA 3H8XA 2AC1A 1XYPA 2D40A 1JS9A 4AWDA 1RUG1 4GALA 3ZSLA 2ZHKA 1VAVA 4H7LA 1W8HA 5F5AA 4E4ZA 1AR81 2B5HA 2I45A 2W3JA 3MI8A 2NYYA 3I4IA 2JJ6A 4J1XA 1UZYA 4N53B 5FLIA 5HV0A 4WM7B 1R1A1 4HK8A 3IMNA 3TN93 1WCDJ 3SC7X 5I8YA 2CYFA 2WWSA 2XB6C 3N7JA 1IS4A 3WQ1A 3VBHA 5LK7B 4YGBA 3VKMA 4AYUA 3NJVA 4LBJA 1E5IA 3S0MA 2D6NA 4DINB 3L9JT 5LZ6A 1QJX2 2GALA 5EIYB 2GNMA 4CEWC 4R9AA 1K5JA 4R9BA 1JYTA 2VZPA 4L11A 1DQ1A 5CEHA 4X8NA 1ND3A 4CP1A 1Y43B 3EMRA 1YRZA 4P9YA 3AKTA 3MIBA 5FZOA 5C8CA 3PUHA 1FNZA 2F17A 2WNOA 4RL7A 4WVVA 5ERLA 5CFCB 3MHZA 5KHGA 3ZR5A 4COVA 2YXSA 4EV0A 4YPJA 2WIIB 3FLTA 2HWC3 2UYAA 4BMBA 3O0WA 3WF2A 1QQP1 2VOKA 3LGRA 2WZEA 3ZYPA 2W39A 4NN0A 3VBRA 4BK5A 4Z1VA 3DYOA 1JU3A 3OGRA 4KH9A 2JG9A 1HJGA 3D0JA 5D21A 3V0AB 2PLV2 2VVEA 2XLFA 2ADEA 2FBEA 2DURA 4HPKB 4E2SA 4Q4W3 2CTVA 2EIEA 4LO7A 2AR6A 1RL3A 4UF0B 2YUEA 2XUEA 5JSRA 2GC1A 3O7OA 4AVVA 3SH3A 5DUVA 3WP3A 2WT2A 3N9LA 5FZ1A 3D6EA 3RRDA 2E32A 1W0PA 4NAMA 4UFJA 3I3EA 1QJU3 1LB2A 2OZ6A 1W0NA 1C5HA 4HETA
chains in the Genus database with same CATH topology
5CKQA 3DEMA 4GZ9A 1SPPA 2QQKA 1NZIA 4LOTA 3KQ4B 4LMFA 3POGA 5CKNA 3POEA 2QQLA 1SPPB 2QQMA 4LORA 5CKMA 1NT0A 2WNOA 2QQOA 3POJA 3POFA 3POIA 1SZBA 3POBA 5CISA 1SFPA 4LOSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CKQ A;  3DEM A;  4GZ9 A;  1SPP A;  2QQK A;  1NZI A;  4LOT A;  3KQ4 B;  4LMF A;  3POG A;  5CKN A;  3POE A;  2QQL A;  1SPP B;  2QQM A;  4LOR A;  5CKM A;  1NT0 A;  2WNO A;  2QQO A;  3POJ A;  3POF A;  3POI A;  1SZB A;  3POB A;  5CIS A;  1SFP A;  4LOS A; 
#chains in the Genus database with same CATH topology
 3FLP A;  2VL4 A;  3FE5 A;  4JC1 A;  4FFG A;  3OY8 B;  2PHX A;  1UWW A;  3GBF A;  4I3G A;  4NWW A;  5E1R A;  3AP5 A;  1SFY A;  1TME 2;  4LBK A;  2CAV A;  4Q0V A;  5K8S A;  3ZXK A;  2G4I A;  4YFW A;  1VBA 1;  4KWL A;  4W65 A;  1B09 A;  1AR8 3;  1ZX5 A;  2PHR A;  1XE7 A;  3MPP G;  2X8K A;  5JXH A;  5FPV A;  5FZH A;  1W9Y A;  2QZ3 A;  1R1A 3;  3ABZ A;  1N1S A;  2XWB B;  4EZ4 A;  1JH5 A;  1CAX A;  2JEN A;  4PIX A;  1NZC A;  4CDQ C;  1MVE A;  3RQ0 A;  3GZU C;  4UOJ A;  5FMO L;  3AJZ A;  5FTT C;  2FMD A;  5CBL A;  2WN2 A;  4DXZ A;  3CDZ B;  3WOG A;  3WDW A;  2GH8 A;  3POS A;  3OCP A;  2FDK A;  1LOD A;  4QMA A;  5FIX A;  3LA3 A;  2DFB A;  1FI2 A;  2CGP A;  5LY2 A;  3OBT A;  5B2G B;  1TMF 1;  4K8F A;  2X09 A;  5T5J A;  4IV1 A;  3ZDS A;  2G9G A;  1AUY A;  5CKN A;  1OFS A;  1VBE 2;  4GH4 A;  1CAU B;  4M0H A;  2E33 A;  1NCQ A;  4AED A;  3LZZ A;  5FY0 A;  2BV4 A;  4CUG A;  3BTX A;  1A78 A;  3PL0 A;  1S0B A;  1K5M C;  3PNA A;  4FQ4 A;  2DTY A;  3ME2 A;  3Q9O A;  4UFM A;  3ZN6 A;  4LT5 A;  1QQP 3;  1GR3 A;  2XOM A;  2Y6L A;  5J96 B;  2JIG A;  3VZL A;  1YCI A;  4W6X A;  3N36 A;  2WR9 A;  3TWI A;  3AKQ A;  4XFH A;  5FMD A;  3IM0 A;  1OQE A;  3LEI A;  4M00 A;  2I07 B;  1OSG A;  4IE5 A;  4HVR A;  2AH2 A;  4GKX A;  4QDQ A;  2W47 A;  5FMC A;  3M4F A;  4CEY C;  2Q8D A;  1WZX A;  4CUC A;  4XXA A;  1PGW 1;  1LEN A;  3AL5 A;  4QDR A;  2PYT A;  1G8W A;  4AVB A;  1DGW A;  1OHF A;  5DAB A;  2BQP A;  2JE8 A;  3S30 A;  4CP2 A;  5C70 A;  4YWA A;  4DEV A;  1HV1 A;  2W1Q A;  3ES1 A;  4XJA A;  5A6Q A;  5CKM A;  3JBG 1;  3P3N A;  1ZNP A;  3ETP A;  1UYY A;  4RQP B;  5D8A B;  1MS3 A;  1RUI 2;  5IUQ A;  2D3S A;  5HCA A;  4JGY B;  1ZA4 A;  2HWF 1;  1YWK A;  4Y5S A;  4A42 A;  4AI3 A;  4XUT A;  3KS7 A;  3BOP A;  5A33 B;  4YW6 A;  1NKG A;  1RIN A;  2DVF A;  1UQX A;  2XHK A;  3LDK A;  4OHY A;  1JYW A;  1OH4 A;  4LBQ B;  3C7H A;  4IEO A;  1JZ3 A;  1NE4 A;  2VBB A;  3ZSE A;  1KGY A;  2FMY A;  2ZAB A;  1IS3 A;  4IUG A;  3KB5 A;  1WLD A;  1YIF A;  1UU4 A;  1VBA 3;  2XL7 A;  4OZX A;  3OUH A;  5GZD A;  2Z42 A;  3KM5 A;  1PIV 1;  3TYJ A;  3RZH A;  1J83 A;  2WWJ A;  2ATF A;  5FXW A;  4CU7 A;  4XEZ A;  1NG0 A;  3DN7 A;  2HWE 2;  4LLO A;  1JN2 P;  2G9Z A;  1V9U 1;  5A6Z A;  4IET A;  2MHF A;  1O7F A;  3AP7 A;  1EPW A;  1SFP A;  4F3J A;  1HKD A;  1OH3 A;  2CDP A;  2J42 A;  2WQ8 A;  3FBM A;  1Y3T A;  4N43 B;  4WM8 A;  1YJL A;  4I30 A;  2UYB A;  1QIQ A;  3CJI A;  1JZ4 A;  1O5U A;  2LS6 A;  4YW7 A;  5CG9 A;  3HQU A;  2XH6 A;  1QMJ A;  4L0P A;  2F4P A;  1OUX A;  2GNB A;  1TMF 3;  3NV3 A;  4MGZ E;  1AX2 A;  4CZS A;  5D1I A;  1LOE A;  3SH5 A;  4JHT A;  2ZX2 A;  2Y6K A;  4E2G A;  2VOT A;  4BIF A;  4QKF A;  4AEJ A;  1ULD A;  1CAW B;  1AYN 1;  3ILR A;  4GA9 A;  4LK6 A;  3THD A;  3LAG A;  1EUU A;  1JOP A;  2ORX A;  2VAU A;  4NIA A;  4JGZ C;  1S0E A;  1BHG A;  2H6B A;  3ON7 A;  1XU1 A;  3WUD A;  1DCS A;  3VN4 A;  4MGI E;  4BU2 A;  3OPZ A;  3USS A;  3VKF C;  1J3P A;  4LBO A;  4QPW A;  5BNN B;  5FY4 A;  5F5C A;  3SNM A;  4CE8 A;  2WA4 A;  2ZGQ A;  5DZE A;  4YAR A;  4QX8 A;  2JDP A;  1GP5 A;  2HWB 1;  4Q8K A;  5JXI A;  1H8V A;  1AF9 A;  3K46 A;  3U37 A;  5FZD A;  4ARX A;  2Q8E A;  4B4P A;  4E2Q A;  1NY7 1;  4IEX A;  3JQW A;  4OHZ A;  1UMZ A;  5DG2 A;  3BI3 A;  5H9R A;  5KWR A;  2X05 A;  1PO2 2;  3FC0 A;  4N53 A;  2FHR A;  1AL2 1;  4E4S A;  3ZSJ A;  2H6C A;  2VQA A;  3R4U A;  4WM7 A;  5F3E A;  3HMY A;  4AL9 A;  1QJY 1;  3OYW B;  1POQ A;  2WFF 1;  4GMP 0;  2HH9 A;  4PDW C;  4QGN A;  4OQ8 A;  2VME A;  5FPX A;  4ITC A;  3AJY A;  4NR1 A;  1H4G A;  4FPY A;  3GZE A;  2LRO A;  3LSD A;  2PHU A;  2W08 A;  2VO5 A;  1NOV A;  1X9T A;  2Z2S B;  3J8F 1;  3LIG A;  4OFG A;  5KC5 A;  2JDA A;  2W91 A;  2JD4 A;  1Q5O A;  3DKQ A;  4XZP A;  5FV3 A;  3MLL A;  3H0O A;  1OUR A;  1I3H A;  3CF6 E;  4K1Y A;  2OXB A;  2Q5T A;  3OGS A;  3WQ0 A;  5FZB A;  5IAX A;  3V56 A;  4AZZ A;  4DZG A;  3U0Z A;  3ZXL A;  1WWY A;  4QPG C;  1VBC 1;  3FUO A;  4ASL A;  3RWN A;  4UYB A;  5CFC A;  5EJ1 B;  1PIV 3;  3ZFE C;  2ZGM A;  3WG4 A;  2A6Y A;  4LHN A;  4L99 A;  4ZZ5 A;  2JDY A;  1V9U 3;  1NLR A;  3IKW A;  4MGS A;  1MZ5 A;  1QJF A;  3THT A;  3LCP A;  1OD5 A;  1PMI A;  1AR7 2;  5L19 A;  1VJ2 A;  1DQ2 A;  3KWV A;  4OLL A;  4LJH A;  1BJQ A;  4JRA A;  1UAI A;  1G86 A;  1V70 A;  5C3P A;  3GZA A;  3WW1 A;  1UXX X;  1W2N A;  4EQV A;  3V0A A;  3VHO A;  4JRL A;  4DB5 A;  5L7O B;  1K12 A;  4NJ4 A;  5IVE A;  2ZGR A;  1XU2 A;  3OB8 A;  1RIT A;  4ES9 A;  1UU6 A;  3ZN5 A;  2OUJ A;  5FXV A;  4Q0S A;  2ZBJ A;  5FPB A;  4HPK A;  5T5L A;  3VBF C;  1MS9 A;  2JD9 A;  1N47 A;  4CU6 A;  3PDQ A;  4UF0 A;  4RGG A;  1YFU A;  4QDS A;  2ARX A;  5A7P A;  3WF1 A;  5IVJ A;  4Y4R A;  4KGG A;  1R09 1;  3BTA A;  3VGI A;  4ATE A;  1H1A A;  3AMH A;  1X8M A;  1RUD 3;  4YLZ A;  1AYN 3;  1TQ5 A;  3GDB A;  2VUD A;  2QDN A;  4CCD A;  3JCI A;  3L2H A;  4M0N A;  4PQQ A;  3SCG A;  1C8M 1;  4XQW A;  2DU0 A;  3WV6 A;  2ZKL A;  1H6Y A;  1OXC A;  4CDW B;  4QQO A;  1O8P A;  2I74 A;  3FJS A;  5I0S A;  4HL0 A;  3OY8 A;  4QGM A;  3UKN A;  2TEP A;  2HWB 3;  4GXL A;  3BPZ A;  4CVU A;  1VAL A;  3FBY A;  5FYS A;  2VNR A;  2C24 A;  3WZ1 A;  1CAV A;  3AVR A;  4KBZ A;  4RGK A;  1QJE A;  3POY A;  5FBJ A;  1VRH 3;  2ARB A;  3OOX A;  5AC9 2;  1WKY A;  2C0Z A;  1DQ5 A;  2VOX A;  4JQR A;  1CIW A;  2V4V A;  2VVD A;  4GJY A;  4K21 A;  3N3H A;  4PF1 A;  3AYA A;  1AL2 3;  1IPS A;  3JQX A;  4XCA A;  2R1D A;  2RJL A;  4GJZ A;  3S5Q A;  1OA4 A;  5JOX A;  2P6H A;  1HW5 A;  2FDI A;  1HB3 A;  3POW A;  4YG6 A;  4LE4 A;  2WFF 3;  4LUL A;  3HAG A;  1YC6 1;  5L73 A;  1SPP B;  3ZYJ B;  3WSO A;  1IG0 A;  1W28 A;  2IFR A;  1GZT A;  2R06 2;  3CNA A;  4W6W A;  1RUH 1;  1VP6 A;  3KQR A;  5CFD B;  3VLB B;  4A2U A;  3J8F 3;  2E26 A;  3M1H A;  2HLE A;  4IE7 A;  3ZM8 A;  1ENS A;  2AAC A;  2NZ9 A;  2HEW F;  3M3I A;  4WBB A;  4Y1U A;  3UGF A;  2WQZ C;  2ADD A;  3AMP A;  4R4Z A;  4PDW B;  1W6M B;  3JXS A;  1VBC 3;  4CDU B;  2R07 1;  3WP4 A;  2LW8 A;  4QKB A;  5DDJ 1;  1O59 A;  4FOV A;  4YW3 A;  3NKT A;  3H7J A;  1UPI A;  2AYH A;  4Q0P A;  3TB0 A;  2DBN A;  3WW3 A;  5DQ0 A;  5FK7 A;  5CNA A;  2QDR A;  3O1M A;  4BQX A;  1SLL A;  3N9P A;  1DGL A;  4FTS A;  3BU0 A;  1BYH A;  5C6C A;  4F8A A;  1RGS A;  4BQ2 A;  1ZRE A;  2AZ5 A;  2VMC A;  3GBG A;  5GZC A;  5GLV A;  1GOG A;  3C7O A;  4P9J A;  1RUO A;  2VU9 A;  1M4W A;  1LHN A;  3ZYI B;  4QPI A;  1A3K A;  1RMU 2;  4UBH A;  5LCW L;  4RGA A;  3ZXG A;  4BJ0 A;  3LQC A;  2WDB A;  5K0U B;  3RYP A;  1XNC A;  4J1W A;  2BBA A;  3NNJ A;  4BLJ A;  4IV3 C;  2QFE A;  4HK9 A;  3VKO A;  5C71 A;  1C57 A;  1MAC A;  1DYO A;  4RQP A;  1FXZ A;  5D8A A;  2BGP A;  1LOF A;  1UMI A;  3ENR A;  2ES3 A;  1V6N A;  3MIC A;  3P3P A;  4JGY A;  1W06 A;  2WWU A;  2W95 A;  2YB7 A;  1C8M 3;  4XXP A;  5A33 A;  3AYE A;  1WCU A;  1T2X A;  1RTV A;  3ORJ A;  4BIO A;  2FCV A;  2WZR 1;  4LBQ A;  3SQO A;  1JXN A;  1TVG A;  3NST A;  3KV6 A;  2OYZ A;  4RFT 0;  1JU4 A;  1DZT A;  1AHS A;  2R32 A;  5CU1 A;  1IKQ A;  4E8D A;  4R4X A;  4PJY A;  3U07 A;  4A45 A;  3WDV A;  1SMV A;  2BTV C;  4QX1 A;  2ZS6 B;  2W0X A;  2XL9 A;  1W3V A;  4CCM A;  1LR5 A;  2E53 A;  4Y4Y A;  2R04 1;  3JUU A;  4JKL A;  4B1M A;  1MZE A;  4LUK A;  3MW3 A;  1W04 A;  2C6S A;  2ETE A;  2ZGS A;  3HNM A;  4O7X A;  1P8J A;  4QX7 A;  1F2N A;  1ZRR A;  4KBB A;  5E16 A;  4A44 A;  4AI8 A;  2Y60 A;  2W46 A;  1ALY A;  2EID A;  4C1W A;  1DDL A;  2VEC A;  2VUC A;  4C0H A;  4KWJ A;  1VMF A;  3TNP B;  3DV8 A;  2YY1 A;  3KV4 A;  5DUW A;  2O8Q A;  2XQX A;  3M3Q A;  1RUH 3;  5DAV A;  2CGO A;  3SLI A;  3TN9 2;  1LU1 A;  4FOW A;  1NT0 A;  4CDX C;  5JSP A;  4ZHN A;  1REE A;  5F5Q A;  4XIK A;  4OHX A;  3WW2 A;  3OEA A;  5C4W B;  1X9P A;  4WVM A;  5FZI A;  1VR3 A;  2UY9 A;  2V5Y A;  3QOP A;  5F2W A;  3RWK X;  4CCL A;  4KL1 A;  1YHF A;  5JLV A;  3BN6 A;  1UYX A;  1VB4 A;  1ULO A;  2QBX A;  2R07 3;  2GME A;  4CCJ A;  5DDJ 3;  2ZEZ A;  1MS4 A;  2K9Z A;  4AK3 A;  2Q30 A;  1CAW A;  1H1I A;  1UF2 C;  3B00 A;  5FUI A;  4CPB A;  4GH4 C;  1STM A;  3PUR A;  1OF4 A;  4QXC A;  3JZV A;  1ONA A;  1RUF 2;  2V73 A;  4PHZ A;  5JUV A;  4LLF A;  1JZ7 A;  2VMI A;  4IL7 A;  5BNN A;  4UXA A;  3PVN A;  1JYX A;  1MVQ A;  1ZZB A;  2WZP P;  4QHZ A;  4BB3 A;  2EIC A;  1RUJ 1;  2O14 A;  3WDU A;  5DUX A;  1O5L A;  2IXJ A;  1LOB A;  2ARE A;  4YFZ A;  1OOP C;  4L8Q A;  4RS5 A;  4YM0 A;  5H9P A;  3K51 A;  1EV1 2;  5FLH A;  3WP5 A;  4XJW A;  4Q4W 2;  3LD8 A;  4K40 A;  3FWE A;  3OYW A;  3FHA A;  1YQ6 A;  1K42 A;  5JXJ A;  2GH2 A;  4Q2F A;  4XOG A;  4OCT A;  2B9V A;  3ZDV A;  1Q3E A;  2QUO A;  2ID4 A;  3N9Q A;  1KXG A;  3AX4 A;  2YBK A;  3ZX7 A;  1DGR N;  2P3Y A;  3EYP A;  2ZHL A;  1CIY A;  3MID A;  1CX4 A;  4YGC A;  2YC0 A;  1DQ0 A;  3VDD A;  1H8T B;  3H42 B;  1REF A;  5KXC A;  2J7M A;  3KGL A;  1ZRC A;  3T2T A;  4YVW B;  4M4R A;  4Q29 A;  3LEG A;  2DCY A;  3OGJ A;  4AQ6 A;  3N9M A;  1CGP A;  4P9X A;  2R04 3;  4QX3 A;  2A71 A;  1PVX A;  2ZPX A;  4K8R B;  1IS6 A;  1C4R A;  1W8Z A;  1Z78 A;  1GU3 A;  3M70 A;  3BTY A;  4FP3 A;  2FDG A;  1MQT B;  1KD7 A;  1DZQ A;  3T0A A;  4NVP A;  4HSL A;  4HKO A;  4LKE A;  3SMH A;  4AFC A;  5JOY A;  5ABJ C;  4BQY A;  1RUC 2;  1X36 A;  4Q26 A;  1PX3 A;  2E6V A;  1A8M A;  4YGE A;  2WT1 A;  5CYY A;  4XBN A;  5IHR A;  3WF4 A;  5L7O A;  2G9F A;  2EAA A;  4WVZ A;  5FOJ B;  1J84 A;  2AUY A;  3I3M A;  1EAH 1;  1WW5 A;  3T08 A;  5KXE A;  1PK6 A;  3POB A;  3F2Z A;  1CON A;  3KT1 A;  3OGV A;  3QLQ A;  3L2Y A;  5DPN A;  2A7A A;  4LHS A;  2RV9 A;  2WNV B;  3QCW A;  4YGD A;  4SLI A;  2IVJ A;  2VW0 A;  4CRQ A;  3VBU B;  4KNC A;  2K46 A;  4CU8 A;  2RS5 1;  5C3S A;  5FAX A;  1KDM A;  5FPZ A;  5FO7 B;  3W59 A;  5C9A A;  4OI0 A;  3WQB A;  1WCQ A;  4HFS A;  4S2D A;  4LO5 B;  3SHR A;  5FR3 A;  3WDT A;  2YYO A;  3N7L A;  1GZ9 A;  1QOS A;  5J37 A;  1MS1 A;  4CYD A;  3FFQ A;  1ZZ7 A;  4NHY A;  4PI2 A;  4L9B A;  1WD4 A;  2BW8 A;  3DPR B;  4RR3 A;  1TNF A;  5I0T A;  5FY5 A;  4P14 A;  1QQP 2;  4IER A;  4AHW A;  4AG4 A;  4FAH A;  5CG8 A;  4QXK A;  4B4R A;  2ZAA A;  4MX3 A;  3AXD A;  1JW6 A;  2XON A;  1RUJ 3;  4YM2 A;  4WVW A;  5FY8 A;  3RZZ A;  4UFI A;  4E4D X;  2YFZ A;  2VD7 A;  1LCL A;  5C3Q A;  5F8P A;  2K2S A;  4RHV 1;  3ZYB A;  4A6S A;  2ZGN A;  3RZG A;  1UZW A;  4I0A A;  2IXI A;  1SQ4 A;  1F5F A;  1D4V B;  1OI6 A;  1RUE 1;  3AP9 A;  1GZW B;  3BOW A;  3VD7 A;  1SPP A;  3O5S A;  3I2H A;  2D5F A;  5E88 A;  4PCR A;  1POV 1;  2RDN A;  4IEY A;  1JOD A;  2W92 A;  2A6Z A;  1Z7S 2;  2VZV A;  1HXS 1;  2FQP A;  4JX0 A;  4DXR A;  2XVK A;  4PLN A;  3FMG A;  3RYR A;  2RM2 1;  3I2J A;  1FMD 3;  4YG3 A;  1V6I A;  1W6P B;  2R0H A;  3IZO A;  2WYS A;  3HQX A;  1Q56 A;  1SFN A;  1WLW A;  1MS0 A;  2VQT A;  1PM4 A;  4YVS C;  4D7Y A;  5AVP A;  1AR9 1;  3WNP A;  2VM9 A;  1W6M A;  1OF3 A;  4CDU A;  3MEP A;  4XJZ A;  1E5R A;  2J1E A;  4HLT A;  2JWP A;  5H9S A;  1S0G A;  4IE0 A;  1DYK A;  1CZS A;  1RVF 1;  1NCR B;  5LBC A;  1D4M 1;  3Q8F A;  3RG0 A;  2D5H A;  1KIT A;  5F32 A;  3WP6 A;  2ILM A;  5T3N A;  1W2U A;  5A7Q A;  4V1P A;  5IT6 A;  2D3R A;  2LRP A;  1W2T A;  2XBO 1;  3KV9 A;  3PUQ A;  3NRU A;  4FVV A;  4M01 A;  1QHD A;  4DFS A;  2DU1 A;  2WLQ A;  2RDR A;  2IC1 A;  1GAN A;  2J1R A;  1EAH 3;  2ZAH A;  4LOR A;  4XMI A;  1DYP A;  3A22 A;  4XVH A;  1Y9G A;  1UIJ A;  2ZEY A;  1B35 A;  1VPH A;  3BYW A;  4JDM A;  5K0U A;  4H7M A;  4HON A;  4NHX A;  3MFA A;  1YFX A;  3W20 A;  4QQL A;  3C8X A;  1OPO A;  2RS5 3;  1TMF 2;  3WF0 A;  5FY1 A;  4AVA A;  2PHL A;  1G9A A;  3NAP C;  3AP6 A;  2D43 A;  2V09 A;  1HLC A;  1EYB A;  2WC2 A;  3GHN A;  3VBS B;  3ZFG B;  4A6O A;  1H6X A;  5BYN A;  3FN9 A;  5J98 B;  5A7O A;  3BVC A;  3EB7 A;  5B4X A;  1OA3 A;  1BBT 1;  4AQ2 A;  2OPK A;  1A8D A;  3BCW A;  2WSV A;  1ZZ9 A;  2YPJ A;  1QWR A;  1LHO A;  4KGQ A;  3SEP A;  2D44 A;  4QX0 A;  4XUR A;  4J25 A;  3ZYF A;  5F1R A;  1W6N B;  3HJR A;  1SLI A;  3EXU A;  4Z07 A;  2RMU 1;  3VB9 A;  1PGL 1;  1GOH A;  2YC4 A;  4P08 A;  1AXY A;  5FZ4 A;  2BNN A;  3B93 A;  4BQW A;  5FRA A;  4XC9 A;  4AAX A;  2ZAC A;  3K4D A;  1WCK A;  2P4E A;  1IOA A;  5FZF A;  4TLG A;  4TZD A;  1AYM 1;  2A3Y A;  2QQP A;  3NNM A;  5FYY A;  1RUE 3;  5BNP C;  3QD6 A;  3ZO0 B;  4NIH A;  1R08 3;  1OMI A;  3I2F A;  1POV 3;  5K7P A;  2BGC A;  5FPA A;  1OT5 A;  1X8E A;  4BQ1 A;  1HXS 3;  2ZEW A;  2Y6J A;  2RM2 3;  4RN5 A;  1ND2 B;  2ZCW A;  1GQH A;  3GCX A;  2W87 A;  2W9X A;  3NJZ A;  4FPE A;  4FFF A;  5HXV A;  5C4W A;  1GSL A;  4BLI A;  4GUL A;  1MR5 A;  1W8W A;  4Q4Y 1;  1ZBE 2;  3USU B;  4HVQ A;  5A6X A;  4NHL A;  2X53 S;  3BPS A;  2W1S A;  4KG0 A;  4OMC A;  2HBU A;  4JTN A;  1S4C A;  2LTN A;  1X82 A;  4HKW A;  5LAT A;  4YZ3 A;  3ACI A;  1RVF 3;  4MO3 M;  1D4M 3;  4CCE A;  1DP0 A;  4UW4 A;  1S0C A;  3CL1 A;  4YVS B;  5J1X A;  1JYV A;  2ZA9 A;  5FYU A;  2O0O A;  5I93 A;  2VE1 A;  2XBO 3;  2WSU A;  3VBO A;  5BNO C;  2OS2 A;  1EY2 A;  4DY5 A;  1W8T A;  2ZX4 A;  4AI1 A;  4MV2 A;  4O61 A;  5E89 A;  5KXD A;  1GNY A;  3FFZ A;  1US3 A;  2BFU L;  3GHM A;  1ZA7 A;  1QY4 A;  4NHK A;  2CU5 A;  4M4P A;  3WIN E;  5E8A A;  4AI2 A;  1SLT A;  2H0B A;  4BXF A;  4JKM A;  3VKL A;  3AKR A;  3RI8 A;  2VZR A;  4QPI C;  3KF5 A;  4LA2 A;  1XC6 A;  5D2A A;  5G05 L;  4CCN A;  1LJ7 A;  2QE3 A;  1MEC 1;  3B01 A;  3BB6 A;  4LUM A;  1C1L A;  1L7L A;  4J6G A;  4BPZ A;  2B42 B;  1VE0 A;  4I0B A;  2YRO A;  5CKQ A;  2B45 X;  1BBT 3;  5FZ0 A;  1AR6 2;  1RUD 2;  2LM3 A;  2Y64 A;  3HPN A;  5LBB A;  1C5I A;  4IE4 A;  4FCA A;  2BUK A;  1H8T A;  1VBB 2;  5IFT A;  1HQL A;  4AFA A;  1LGB A;  1OC1 A;  1NQJ A;  1NZI A;  2RMU 3;  2B8M A;  2WS9 2;  4EN0 A;  2XDV A;  3IN9 A;  1RUG 3;  2VH9 A;  5FZM A;  3H7Y A;  2DUP A;  4EJR A;  2XR4 A;  3NAP B;  4GKY A;  5EYY A;  2HWB 2;  2XJQ A;  3JB8 A;  4GWJ A;  1F4A A;  1KQR A;  4Y20 B;  1FOD 1;  1FV3 A;  1OQ1 A;  1AYM 3;  2NQY A;  4FAG A;  4JAA A;  2W1W A;  1VRH 2;  2HEY F;  1MQT A;  2Z69 A;  2WL1 A;  3BTZ A;  3KSC A;  1ZBA 2;  1C8N A;  2WNU B;  1N3O A;  4AQT A;  4N8M A;  2VBD A;  2DUO A;  2DV9 A;  4W8J A;  1Y7B A;  1AX0 A;  2VCA A;  1D2Q A;  5FQ0 B;  4HSJ A;  1F35 A;  3TNQ A;  4CUB A;  2DFC A;  5FKC A;  4P00 B;  4LE3 A;  3WNN A;  2GC0 A;  3FZ3 A;  3WHT A;  4S2F A;  4EWA A;  1H2N A;  4P5Y A;  1QNY A;  3AZY A;  5A32 B;  3IB3 A;  4Q4Y 3;  3U4S A;  5BNP B;  3KHC A;  2WNV A;  4FPL A;  3SCH A;  1V6O A;  2PHD A;  3M7A A;  3VBU A;  4YSF A;  5FXX A;  5JMO A;  1CZT A;  2VR4 A;  1XSQ A;  2IXH A;  4FFH A;  3BAL A;  1O8S A;  1VBC 2;  1L3J A;  2R30 A;  4CEW B;  3M3O A;  1MS8 A;  3DPR A;  2KA3 A;  2L9L A;  3HBK A;  4N7I A;  1BMV 2;  4Q4X 2;  2HWD 1;  4XF0 A;  3KMH A;  2FCU A;  1UU5 A;  3I8T A;  2XML A;  5HXM A;  3BKZ A;  4RD7 A;  3FHQ A;  1SBE A;  3VL9 A;  3KCC A;  4G4F A;  4E27 A;  4LTA A;  2E31 A;  1C1F A;  1EPZ A;  1TG7 A;  5LWB A;  2Z79 A;  2PAK A;  3S7I A;  2Q4S A;  3I59 B;  4K1Z A;  2A73 B;  2TUN A;  4DUX A;  4RS5 C;  1LGN A;  1SEF A;  2JG8 A;  1GZW A;  4HG6 B;  1K3I A;  1HB1 A;  2R0F A;  4JQT A;  4NE9 A;  5EXO A;  2WJS A;  1MEC 3;  1O4Y A;  3B02 A;  3EO6 A;  4LHK A;  4XJ9 A;  4AEM A;  1GV9 A;  5KC6 A;  2UWB A;  4XBL A;  3WX5 A;  5JZG C;  5IWF A;  1DBN A;  1GKB A;  2E7A A;  1TNR A;  3U78 A;  3J7M A;  4BME A;  1W6P A;  3AFG A;  4TSV A;  1I6X A;  1YEW A;  2JE7 A;  4XIL A;  2HYK A;  4FTE A;  2ARA A;  4BK4 A;  5FP4 A;  3ZFF C;  1O3S A;  4KU7 A;  2VNG A;  3VBO C;  5CA6 A;  5LA9 A;  2AEY A;  3VDD C;  5ACA 2;  1FAY A;  2EXJ A;  2ZZQ A;  3MLK A;  4KU8 A;  1OD3 A;  3HD8 B;  4C8D A;  4H55 A;  3KZ4 C;  4FOY A;  5C3R A;  3R4D B;  3ECQ A;  1NCR A;  2R7E B;  4E8C A;  4YM3 A;  4Q5O A;  3WXP A;  3I49 A;  1GQG A;  1WUV A;  3N9N A;  1SCS A;  1ZRI A;  2ZGL A;  1V6J A;  2P3K A;  3WD5 A;  4FPO B;  4QGL A;  4GWN A;  3ZPO A;  3V0B A;  1LNS A;  3VUO A;  1W03 A;  3A4U A;  2OPW A;  3O14 A;  1NYW A;  1RUH 2;  1O3Q A;  2VW1 A;  4BQ4 A;  4NID A;  1PZ7 A;  3AVS A;  3B9C A;  3MUZ 1;  4E4H A;  2GMM A;  4XUP A;  2VNO A;  4N9H A;  4COW A;  2BGO A;  3KQ4 B;  2JE9 A;  1PK6 C;  4OHW A;  3FL7 A;  3LB9 A;  5I8T A;  3O1U A;  4CDQ B;  1U12 A;  4LK7 A;  1M06 G;  4FFI A;  5FOB B;  4IXL A;  2PLV 1;  4NRM A;  5EV7 A;  4GIQ A;  3DL3 A;  1KFX L;  2R07 2;  2VCB A;  3A0N A;  3POJ A;  5DDJ 2;  5T52 A;  3ZKY A;  1PO1 2;  4ASK A;  5C9A C;  2ZZJ A;  2MPF A;  1IQD C;  1PMH X;  4AVT A;  2JB4 A;  4QT6 A;  1S2K A;  2VUJ A;  4BQ3 A;  1ZRD A;  2HWD 3;  4ZXK A;  4G9S B;  3O1O A;  4XUO A;  1W6N A;  3LWC A;  3DEM A;  4RR3 C;  5A3T A;  4B4Q A;  1K5M B;  3ZLI A;  3C7F A;  2X5I C;  1W9W A;  1R1Z A;  3CMG A;  3RS6 A;  3LFI A;  1WMD A;  2BU9 A;  3NJY A;  4V2W A;  1XXN A;  1NA1 C;  4MXV A;  3WG3 A;  5LY1 A;  2D6O X;  1E5H A;  3JBG 3;  4X6R B;  1H2K A;  3IDB B;  4IW3 A;  3U1X A;  5FBZ A;  2XJP A;  4HMZ A;  4XE9 A;  3WUC A;  2HWF 3;  4MGY E;  1TME 1;  4BCU A;  2Y33 A;  4D0Q A;  4CEY B;  4QHO A;  1I9R A;  2RR1 1;  1JYI A;  4P02 B;  2W68 A;  3DEC A;  1ND2 A;  1IZ3 A;  3O1V A;  3OF1 A;  2NP0 A;  4PBO A;  2GZW A;  4YZ4 A;  5GLZ A;  4XDO A;  1CZV A;  1BXH A;  1T6G C;  1ZM1 A;  2QQI A;  3E6B A;  4KWU A;  5K9Y A;  3MZH A;  3A7Q A;  3WNL A;  3I2D A;  1FYU A;  3TBD A;  3VKN A;  2H0V A;  3IBM A;  2QQL A;  5HI0 A;  3I2O A;  4OUM A;  2R04 2;  4YNI A;  3T1M A;  4MHU A;  4QQH A;  3KT4 A;  1QU0 A;  2UWA A;  5J3U A;  3ILF A;  2ZHM A;  2IVI B;  4XAB A;  2CDO A;  5GKA C;  2ZKN A;  3B5L B;  4CCO A;  4B8E A;  5A3U A;  1F15 A;  5LBF A;  4UAP A;  5A1A A;  5HCF A;  2WN3 A;  1HN0 A;  1LED A;  2O8O A;  4UI9 L;  5GJ6 A;  3ACL A;  4LO8 A;  1NUK A;  2BZD A;  4FO9 A;  4IEQ A;  5APA A;  4XQ4 A;  3N4M A;  4ZU5 A;  1PVC 2;  1Q8V A;  2LUW A;  1FT9 A;  2XHN A;  1YQ2 A;  2JEC A;  3WG1 A;  3TEY A;  2BFU S;  3IDA A;  4DUV A;  2IFW A;  4UT5 A;  2E51 A;  3Q8E A;  1DQ6 A;  1JHJ A;  5F2S A;  3O0V A;  1UKR A;  3C7E A;  3PUI A;  4P9I A;  2B7Y A;  1XNB A;  2ZGP A;  2EXH A;  4Y26 A;  3P6B A;  1BEV 2;  4DIQ A;  4HXC A;  1Q8S A;  4GB3 1;  4JZR A;  3IMM A;  1N3Q A;  3IPV B;  3AM2 A;  1GNH A;  1RUI 1;  1UD1 A;  2C5D A;  5I0R A;  1ULF A;  1S0F A;  3LPG A;  2EAK A;  3CU7 A;  3VZO A;  1TZO A;  2RDQ A;  4Y20 A;  3K3O A;  4JGZ B;  3Q8B A;  1QDO A;  4XW3 A;  4C91 A;  2Y6G A;  5A3M A;  1D0H A;  2RS3 1;  2YGL A;  5FO8 B;  1D7P M;  1QJY 3;  2J1U A;  2WNU A;  4MLO A;  1LHV A;  2IWG B;  1TME 3;  3K48 A;  2MEV 2;  1CQ9 A;  3MIH A;  4C1X A;  1BQP A;  2PQQ A;  5FQ0 A;  2RR1 3;  2JX9 A;  3POI A;  5FO9 B;  3PMS A;  1OKQ A;  1W6O B;  3D0S A;  3MV0 1;  3VBH C;  2EAL A;  4D6S A;  3S57 A;  3ZOI A;  2P6C A;  1WMX A;  2PHF A;  1F4H A;  4O9E A;  4LOS A;  3H50 A;  4DXS A;  4DY3 A;  5B4N A;  4NIG A;  2BNM A;  5FMO S;  2HWE 1;  4Y1Z A;  3TEX A;  1SAC A;  1FMD 2;  1XYN A;  4AAP A;  2WO2 A;  5DG1 A;  3UES A;  4COY A;  4BWO A;  5AVA A;  2Q1M A;  1CAU A;  1DU3 D;  2ZMN A;  4Y22 B;  1ND3 C;  4XYX A;  5GZF A;  1S1A A;  3S6P A;  4ISR A;  5C8C C;  2PFW A;  2PA7 A;  2KXL A;  2RE9 A;  4OI2 A;  1QOT A;  4FPK A;  3DYM A;  2GNT A;  1S2B A;  5J36 A;  3ACF A;  2IXK A;  4CEW A;  1UXZ A;  4BOW A;  5EJZ B;  4NPM A;  5FZL A;  1KS5 A;  2VY0 A;  2JDH A;  4LQR A;  3J4U H;  3NKG A;  4OMD A;  4IEW A;  3VBR C;  4I01 A;  1HRV 2;  4H3W A;  3O0X A;  2HBT A;  4QPG B;  4EWE A;  2JG9 C;  1UY3 A;  3BIW E;  3NO8 A;  3ZFE B;  4XJ8 A;  3GZT B;  2B46 X;  4LR4 A;  3I59 A;  5DAW A;  1R09 3;  4A7Z A;  2YG0 A;  4QX5 A;  4XF4 A;  5C3O A;  4FPG A;  1YQ5 A;  1CR7 A;  4GMP 1;  2FDJ A;  2Z4F A;  1RHI 2;  1FV2 A;  1S55 A;  1FPN 2;  4Q1R A;  1SG3 A;  3ZPY A;  3M8L A;  4LKD A;  3MUY 1;  1CX1 A;  3QAC A;  3VBF B;  4QQ2 A;  3ZXA C;  5JI9 A;  2E7Q A;  4WV8 A;  3H8R A;  4GB3 3;  1B35 C;  4G3Y C;  5CIS A;  1PO2 1;  1YQC A;  5BPX A;  2WUH A;  5JI7 A;  2WBK A;  1XE0 A;  1H9P A;  3RNS A;  2W52 A;  5A70 A;  5IK4 A;  5IJR A;  3WEZ A;  3KHB A;  2GU9 A;  3H3L A;  5T5O A;  5KXB A;  2FDH A;  2RS3 3;  5ISL A;  1AJO A;  1N1T A;  4B7E A;  2OVU A;  2WKK A;  3H8U A;  2KD7 A;  3EHK A;  4D7T A;  1HDK A;  2GP5 A;  2C26 A;  4NPR A;  3POE A;  3T0D A;  1DGW X;  3OUI A;  1UYZ A;  1RUE 2;  4MUV A;  2BRT A;  5FYM A;  4FI9 A;  1R08 2;  4MXW B;  5JAX A;  4ARY A;  2QQJ A;  4RFR B;  3PVB B;  2XKP A;  4N43 A;  3KVB A;  4R52 A;  1NQD A;  5IK5 A;  1YI7 A;  4QXB A;  4AFM A;  3OGG A;  3V64 A;  1T6B X;  2HWE 3;  3PJY A;  2BER A;  2ET1 A;  2IXC A;  4W50 A;  1LHU A;  1AR7 1;  5A6Y A;  1VIW B;  5EP9 A;  4CDQ A;  4OI4 A;  3O1R A;  2QQW A;  4RYD A;  2Q1Z B;  4QB6 A;  2OII A;  4IV1 C;  1S2E A;  4YM1 A;  1YLL A;  1QJZ A;  3HWJ A;  5C7G A;  2BVV A;  1NCQ C;  3PTY A;  4AED C;  5IVC A;  3WNM A;  5HCH A;  2R6Q A;  1HIX A;  5JPN B;  2JIC A;  3LPF A;  2HWC 2;  4YRD A;  3C2U A;  1SLA A;  1WW6 A;  1RVF 2;  2ZJC A;  3III A;  1D4M 2;  2QTW B;  4V2V A;  2ENR A;  3FLR A;  5FP3 A;  5FZK A;  3UJQ A;  4AFB A;  4Q4V 1;  1UZV A;  1K5M A;  3NV1 A;  4DRV A;  5C8C B;  4AW7 A;  2P5B A;  1WW4 A;  3GM8 A;  2BPA 2;  5LA0 A;  2DVD A;  3WY6 A;  2C1F A;  3LSE A;  1JBC A;  4Y1X A;  1CJP A;  1OLR A;  1JI6 A;  4A3Z A;  4XTP A;  2XJS A;  3LF7 A;  2OX0 A;  1H30 A;  2RG4 A;  4GMP 3;  4F7Z A;  1IS5 A;  1GZC A;  4I09 A;  2PXJ A;  1FX5 A;  3WNK A;  3VBR B;  5FP7 A;  1VLN A;  4C0B A;  2XJR A;  3MPB A;  2JG8 C;  1LOC A;  3AXE A;  3OBZ A;  2HYX A;  4CEY A;  1OLM E;  1UPS A;  5FYB A;  4BHP A;  3NNL A;  3I97 A;  1GNZ A;  1WLC A;  5FUP A;  2WZR 3;  5ANQ A;  1O3R A;  1QJU 2;  1PO2 3;  5I0U A;  3SKV A;  3U75 A;  1PNG A;  1SZB A;  4HN0 A;  3KV5 A;  4IV3 B;  4AHY A;  3SKJ E;  2FD8 A;  1Q8O A;  3UKV A;  4YW4 A;  1A6C A;  1QKQ A;  4QD2 A;  1W90 A;  3FX3 A;  5I91 A;  1PGL 2;  4QAW A;  4D7S A;  1J1L A;  1RUG 2;  4EE2 A;  4HT1 T;  4AI0 A;  2ZEX A;  4XTM A;  3HEI A;  5A3O A;  3T4H B;  3HBZ A;  1MZ6 A;  1GBG A;  3CJX A;  1VMJ A;  1AR8 2;  1WLT A;  3DCQ A;  5IVB A;  1AYM 2;  2QZ2 A;  1UN1 A;  2VGD A;  1UOB A;  2NMN A;  4XIO A;  3UKT A;  4CSW A;  2FZ1 A;  1IGO A;  1VBD 1;  2RVA A;  1R1A 2;  5CAZ A;  2XG3 A;  4PIZ A;  3GGL A;  4OVE A;  4XFF A;  3DYP A;  1QXR A;  1PHM A;  4WM8 C;  1Q8P A;  2O1Q A;  2PAM A;  3CJI C;  1XND A;  1JOJ A;  4XJU A;  3H8O A;  4MZU A;  2CNA A;  1JZ8 A;  3BU7 A;  2JDM A;  3RZJ A;  4CP0 A;  2IUW A;  3URF A;  2DCZ A;  1XB9 A;  2JDU A;  1CJD A;  4LNV A;  1BLZ A;  2SBA A;  4XF3 A;  4DPN A;  3A23 A;  4LIV A;  4CDX B;  1OKO A;  5FYH A;  2LAL A;  4D8M A;  1JMU B;  1ACC A;  2IXL A;  3AMM A;  4CDW A;  1W05 A;  3WNX A;  2XXZ A;  4TTG A;  4AHX A;  4XZU G;  2F6B A;  1UOG A;  4AFD A;  4N90 A;  1V00 A;  4XUQ A;  1ULP A;  1N1V A;  4ISQ A;  4OUE A;  4CTE A;  2WA3 A;  2NLR A;  5JCT A;  4Q4V 3;  3B69 A;  3RJ2 X;  3SH4 A;  2D98 A;  5F3C A;  1RXF A;  4Z82 A;  3CBN A;  2D97 A;  4I3P A;  4GH4 B;  3VV1 A;  4JGZ A;  3EBR A;  3VHR A;  5FCC A;  3PIG A;  4CP9 B;  5L9B A;  5IVV A;  1HRI 1;  1W3X A;  1ASJ 1;  4MHR A;  3VHP A;  2VMG A;  4N53 C;  4QHB A;  3WNO A;  5LA2 A;  4CXW A;  1EUT A;  1BZW A;  4EN9 B;  4N9I A;  5FUN A;  4YZ1 A;  1OPM A;  3U10 A;  4WM7 C;  4B7K A;  3H1Y A;  1DGR A;  3UL2 A;  5CFD A;  3UV9 A;  1OLQ A;  1CES A;  3K77 A;  1OOP B;  3POG A;  4MOA A;  1W6O A;  1AJK A;  3RFR A;  5FZA A;  3PVO A;  3U14 A;  3ZSM A;  3RPQ A;  4ASM B;  1AL0 G;  1DQ4 A;  5DZF A;  3CIH A;  4ET7 A;  1XRU A;  4XCB A;  3RYK A;  5JXG A;  1CN1 A;  3D3A A;  2GSY A;  4XFG A;  4PDW A;  1OVP A;  5F6K A;  4LO4 B;  4Y22 A;  5FWJ A;  2QVS B;  3AZW A;  3TN9 1;  1GWK A;  4FXG B;  3JB4 C;  1VBA 2;  1ZZC A;  2XKO A;  5CFC C;  4N7U A;  2J1V A;  2ZXQ A;  3MIG A;  3VDB A;  2DCT A;  2E63 A;  4MET A;  3QBQ A;  1COV 1;  1VBD 3;  2GN7 A;  3JD7 1;  4OZO A;  1K45 A;  2P1B A;  2PTM A;  5EHD A;  4IEV A;  1AXK A;  4DQA A;  3OSD A;  4QPG A;  5FZ9 A;  1S0I A;  3A0K A;  3HOB A;  1PNF A;  2OQ6 A;  3NVC A;  4UW3 A;  4XUN A;  2VJX A;  1RXG A;  3PME A;  2ZMK A;  3T4V A;  3ZFE A;  3VHN A;  2HEV F;  3I2I A;  1QXP A;  4IND A;  3M3C A;  1RUF 1;  3NJX A;  2CV6 A;  2WNE A;  3LIH A;  5FP8 A;  2G19 A;  3N7M A;  4ES8 A;  4ZS3 A;  5CAD A;  5ABJ B;  3CLP A;  4Q27 A;  1YFW A;  2GC3 A;  4SBV A;  2VXR A;  1G6N A;  1VMH A;  2VTX J;  2PMW B;  2WRA A;  3T0B A;  3T2Q A;  3INA A;  3B7M A;  3ZXJ A;  4R8H A;  1X50 A;  4XFA A;  5EQU A;  3AMN A;  2C9A A;  1KDK A;  1UKG A;  1PGS A;  3X29 B;  3VBF A;  2D6K A;  4O65 A;  1S0J A;  4AVS A;  2D7F A;  4Y24 A;  4PLO A;  5L36 A;  4MGT A;  2HJI A;  4ZKT B;  2BYV E;  2ZGT A;  2GND A;  3NWK A;  1EV1 1;  1AX1 A;  5F37 A;  4K3U A;  3R0R A;  2YBS A;  1XNK A;  3PUS A;  3T09 A;  1O4Z A;  1E57 A;  5FLJ A;  2ZOE B;  1DLC A;  2NMO A;  4K7J A;  1QEX A;  4RHV 3;  5KHI A;  1DHK B;  3IAP A;  2WAB A;  1N3P A;  4HN1 A;  1W99 A;  1DG6 A;  3H1M A;  1HRI 3;  2QKD A;  2Q0A A;  4QB2 A;  1ASJ 3;  2KR2 A;  5FP9 A;  1PGW 2;  1G9D A;  5F9T A;  1CWP A;  4ZON A;  1W9T A;  3RGB A;  4QKD A;  3PUA A;  1X33 A;  1I5P A;  2VCM A;  1ST8 A;  3ASI A;  2VZ3 A;  1GOF A;  3JBG 2;  5GZE A;  2N7G A;  3C7G A;  4AQS A;  5C8W A;  3PJQ A;  1MZF A;  4JVA A;  4AR2 A;  5BY5 A;  2HWF 2;  5FZ7 A;  2DVG A;  4X8P A;  4BZ4 A;  3AK0 A;  3ACH A;  4WZC A;  1CVN A;  4IEP A;  2WFP A;  4ONU A;  3OPW A;  4QKN A;  4UFL A;  3IAQ A;  4YW5 A;  1ODM A;  4LKF A;  4NMI A;  5DUU A;  1AR9 3;  1YXW A;  1JYC A;  2EF6 A;  1H0B A;  1HX6 A;  5GLW A;  4NWV A;  3K75 B;  2XJU A;  3AKS A;  2AGS A;  3ES4 A;  1RUC 1;  2A5Z A;  2B39 A;  2UUR A;  3CZU A;  3VDC A;  3E1F 1;  1Y9M A;  2ET7 A;  3K2O A;  1KS4 A;  1UX7 A;  2WT0 A;  3HNB M;  5IK8 A;  1VRB A;  2J1T A;  1LOG A;  3VD4 A;  4JTO A;  1WW7 A;  3CZJ A;  4DEQ A;  1PIV 2;  2VG9 A;  2WO7 A;  4CPB D;  5TSW A;  3BUC A;  3N35 A;  2YBP A;  1COV 3;  3GBW A;  2R49 A;  1GFF 2;  1V9U 2;  3JD7 3;  1X7N A;  1NLS A;  4YZ5 A;  3E6D A;  3SIS A;  4ATF A;  4EN6 B;  3HN3 A;  4AVC A;  3MF9 A;  3R4S A;  3GYD A;  4IDZ A;  2JDZ A;  2QQM A;  5LB6 A;  3WF3 A;  3DXU A;  1RUF 3;  2WO3 A;  4L92 A;  4L97 A;  4GQ7 A;  1PMJ X;  1SDW A;  3A21 A;  4Y3O A;  4XDP A;  4P9G A;  1BK1 A;  3MW2 A;  4MVT A;  4AGR A;  1YNA A;  3TEW A;  5LRS A;  3KGZ A;  3QH6 A;  2VMD A;  3PTR B;  3FHI B;  2B9U A;  3N7K A;  2Y0O A;  4RQP C;  5D8A C;  1I1E A;  1H9W A;  2QJV A;  1LOF C;  2WAO A;  3AYD A;  1AYN 2;  2QQU A;  3DUI A;  4JGY C;  4HKL A;  1EV1 3;  4IV3 A;  4NRQ A;  2W2I A;  4QQP A;  4YVW A;  1HB2 A;  1J3Q A;  2PN5 A;  2UWC A;  1BVV A;  3ATG A;  3MO4 A;  3QH7 A;  4UW5 A;  3WLU A;  1NAE A;  2OW4 A;  4XAA A;  1Z7S 1;  4FPH A;  3WG2 A;  3ZXE A;  3T2O A;  4COU A;  1VAM A;  3ELN A;  2QQV A;  1NY7 2;  4QU1 A;  5FWE A;  3C3V A;  1HQW A;  1F31 A;  3WHU A;  1AL2 2;  1F9K A;  4HVO A;  4BDV B;  4ZPI A;  1W6Q B;  4LIT A;  5FYC A;  5JOW A;  3O1T A;  3KCX A;  3ZYH A;  3I7D A;  1LUL A;  4LBN A;  1QJY 2;  1MPX A;  2WFF 2;  1OA2 A;  3E5X A;  3J9S A;  3BIE A;  4A3X A;  4FOQ A;  1UIK A;  2XJT A;  4PI0 A;  1QGL A;  3GCW A;  5FZ6 A;  4YW2 A;  3ZYG A;  1CAV B;  3U4X A;  2RR1 2;  3K4Z A;  3K4A A;  3KD4 A;  5T54 A;  4LMF A;  4N43 C;  3J8F 2;  2JDK A;  5T55 A;  2P34 A;  3CO2 A;  4AGV A;  4DUW A;  2J1S A;  4M3C F;  1J58 A;  1RUC 3;  2OA2 A;  4AF9 A;  4JDO A;  1GWL A;  3LFM A;  5EJ3 A;  3MDP A;  1JZ6 A;  5FKB A;  1LOA A;  2FZ2 A;  4CDX A;  3DGT A;  2CGN A;  4TN7 A;  4XBQ A;  4BM8 A;  2P3I A;  3ZMO A;  5SV5 A;  4MG2 A;  1W2O A;  3CQO A;  1ENX A;  3MYX A;  4MSV A;  5IVY A;  3VD3 A;  2XUM A;  3AC0 A;  2B4K A;  1Y4W A;  3WCR A;  3WW4 A;  5BNN C;  1RC6 A;  5C5U A;  4R9C A;  5HV4 A;  1UL9 A;  1ZZ6 A;  2XPJ A;  4Y5T A;  5A7N A;  2XLA A;  2RS1 1;  3P5B A;  1LES A;  4MGQ A;  5J7M A;  3RVH A;  1WBF A;  4H2A A;  4CP9 A;  3UJO A;  3HN1 A;  1OVS A;  3DF0 A;  3SEE A;  2W94 A;  5F3I A;  3AZV A;  1OUS A;  4D3W A;  1Q8Q A;  2C9K A;  5BNO B;  2JKX A;  3PU3 A;  2VQU A;  2WYF A;  4UFH A;  5L9R A;  4PIY A;  4TXW A;  1R09 2;  3WT3 A;  3KVA A;  1W0O A;  1XBF A;  3LA7 A;  2A70 A;  1CPM A;  1D2S A;  1XJA A;  2WIN B;  2R16 A;  3BGA A;  3Q8C A;  4U36 A;  3IIA A;  1OOP A;  3I2G A;  5A3P A;  2Y34 A;  3MGU A;  3MBW A;  2JXA A;  3TAY A;  2AEZ A;  1C8M 2;  5LEK A;  5EYX A;  5FZG A;  4DS0 A;  3H3Z A;  2ZX1 A;  3I3Q A;  4L2N A;  4QPI B;  4XHB A;  4I02 A;  4PF5 A;  3NQH A;  4PLM A;  4GB3 2;  5E6H A;  4AE2 A;  2BOI A;  4ZU7 A;  1W8F A;  2CY6 A;  2UU8 A;  4F83 A;  1Z7S 3;  5T5P A;  5JIU A;  4W4Z A;  1FOD 3;  2VOW A;  4B3N A;  3V65 A;  2BWA A;  4EN7 B;  3KF3 A;  5JDB A;  4TYS A;  4CCK A;  1QJX 1;  4XQD A;  4K20 A;  1JZ5 A;  1J3R A;  5L9V A;  4D69 A;  1SLC A;  2WLP A;  2RS3 2;  1U5X A;  3W21 A;  3W5N A;  3CKH A;  4BXS V;  1ZBE 1;  1HQN A;  3D4K A;  2DDU A;  3AZZ A;  1KJR A;  2VBP A;  2YV8 A;  4H14 A;  5IW0 A;  2IZW A;  2E9Q A;  3MIF A;  2A1X A;  4I0W B;  3OEB A;  3THP A;  5L7O C;  1WMF A;  5I0D A;  1UOF A;  1KEX A;  4D6R A;  2ERF A;  1LEC A;  2TNF A;  1UY1 A;  5ABJ A;  4OHV A;  1HJF A;  4UBG A;  4YZ2 A;  2EXK A;  1H1M A;  3T1L A;  1RJ7 A;  2Y38 A;  2QQO A;  1U5I A;  4CA9 A;  3ZFG A;  3VBS A;  1TEI A;  2P2K A;  3AB0 A;  4HAN A;  4QB1 A;  1QXJ A;  2GMP A;  3LE0 A;  4AXO A;  2W5F A;  2VTX A;  5FRE A;  3E6C C;  1SDD B;  5T50 A;  3HR9 A;  2VCC A;  4CDW C;  3UNP A;  3ZN4 A;  1KFU L;  3AZX A;  4JHZ A;  2VZO A;  1DZR A;  4WVM B;  2Q8C A;  1LHW A;  2RS1 3;  2NM1 A;  2D93 A;  2JDN A;  3O12 A;  4QM9 A;  3LOB A;  1UYP A;  5DMY A;  1AR6 1;  1RUD 1;  4GWI A;  5AFE A;  4EZH A;  4D94 A;  2WZ8 A;  3RDI A;  3ZMN A;  1V6K A;  3T3Y A;  4ZS2 A;  2YHJ A;  5FZE A;  1WA6 X;  1VBB 1;  5LW9 A;  3ZYR A;  1BK0 A;  2WS9 1;  3I2K A;  4TLF A;  2SLI A;  3TEZ A;  4AHZ A;  2FCT A;  3B94 A;  2EA7 A;  3OD0 A;  2KM2 A;  1YO8 A;  4FXK B;  2ZX3 A;  1J1T A;  5CFD C;  1GP6 A;  3MLJ A;  3OBR A;  1VRH 1;  4RS5 B;  4IES A;  2WZR 2;  3M3E A;  1SBD A;  1CD3 G;  1ZBA 1;  1S0D A;  2VZ1 A;  3EJK A;  1RIR A;  5EFU A;  3USU A;  1FAT A;  1WGP A;  4DNY A;  2Y6F A;  1BKZ A;  4LXL A;  2P37 A;  4LBM A;  5H9Q A;  1TE1 B;  1O6U A;  5FK8 A;  4DXT A;  4NPL A;  4FPJ A;  2VW2 A;  3HIF A;  4Y5Z 0;  5F5I A;  2ZHN A;  5JZG B;  1PM7 A;  4HZF A;  4OUS A;  1NXD 1;  4CDU C;  2PQS A;  5DAQ A;  5FMB A;  1QJX 3;  1HV0 A;  2W1U A;  1APN A;  4LA3 A;  1AZD A;  1Z0H A;  3EQE A;  1DIW A;  1QF3 A;  4YVS A;  5HPO A;  1QH6 A;  3ZFF B;  2TBV A;  2YPD A;  3VBO B;  1ZBE 3;  4Y1Y A;  3G6J B;  1URX A;  3VDD B;  4D6Q A;  1VBE 1;  4YG0 A;  4XAC A;  4OQ9 A;  3F95 A;  2RHP A;  3ZKU A;  2JKB A;  5DAP A;  4AI9 A;  2OQ7 A;  4PQ9 A;  4NRP A;  3I3D A;  4ZXE A;  4RSU A;  4A7Y A;  2QQN A;  1GWM A;  3SXW A;  1ENQ A;  1ODN A;  1GUI A;  4KG8 A;  4HOO A;  2CL2 A;  2A75 A;  2YU2 A;  2GN3 A;  2VOV A;  3GAL A;  1BMV 1;  2BDR A;  4Q4X 1;  5K0U C;  2PEL A;  3RI9 A;  2PLV 3;  3T2P A;  1LGC A;  3ZSK A;  1IG3 A;  2BVB A;  3AFK A;  4YW1 A;  4FT8 A;  4OUL A;  3ACG A;  4S2G A;  3GF6 A;  1YI9 A;  3WCS A;  5GZG A;  1F5J A;  1LU2 A;  3RZM A;  4JCK A;  4A41 A;  2QCS B;  1H2M A;  1PK6 B;  3CEW A;  1H2L A;  5FJH A;  2PHT A;  1AXZ A;  4GAZ A;  2VTF A;  2VMF A;  2YGM A;  3NAP A;  1PX4 A;  3OUJ A;  5FPU A;  1SCR A;  3R05 A;  4BE3 A;  2NN8 A;  1RUJ 2;  3FUQ A;  4Q4V 2;  3S7E A;  4W6Y A;  1AR6 3;  2JIJ A;  1RED A;  5C9A B;  1O91 A;  3H3U A;  5F6L B;  2D6P A;  5A7W B;  3B9I A;  3J26 N;  1VBB 3;  4XFI A;  4ZU4 A;  1UY2 A;  2WS9 3;  4CXX A;  1W6Q A;  4RR3 B;  4NHM A;  2DF7 A;  5CZK A;  5LK5 A;  5ACA 1;  4IGP A;  3H9A A;  1YYN A;  1J59 A;  1JOB A;  2X5I B;  2Y8K A;  2DBI A;  3WR0 A;  4URA A;  3ALQ A;  2XQR A;  1NA1 B;  1O4T A;  2BOJ A;  1OFN A;  5BNP A;  1HB4 A;  5A32 A;  3VZJ A;  5IVF A;  1ZBA 3;  4ORF A;  2JEM A;  3RZL A;  3OPT A;  1ULE A;  4CCC A;  5C4W C;  4M3C B;  1UY4 A;  1YUD A;  3APB A;  3D8C A;  5ANN A;  5FY9 A;  2RJ2 A;  3HT2 A;  1QDC A;  5FYI A;  5M0T A;  4XF1 A;  3UT0 A;  3ETQ A;  3RJR A;  2CHH A;  3I54 A;  3DKW A;  2VXJ A;  3GJA A;  5LRR A;  2XGX A;  2OUH A;  1XNT A;  1BCX A;  3OG2 A;  2DWR A;  1F8V A;  1IKP A;  1RYY A;  1UNB A;  1UO9 A;  1VBE 3;  3E5Q A;  4LIU A;  4LO6 B;  4S2H A;  3ILN A;  1VBD 2;  2Y26 A;  4QM8 A;  2A6W A;  4XAE A;  3ZXD A;  4CXY A;  4GZ9 A;  1QOO A;  2Y6H A;  1R64 A;  2R1B A;  1PO1 1;  4EWD A;  2AEN A;  5KHK A;  1EAH 2;  1Q43 A;  5GAL A;  3AMQ A;  2RDS A;  2VNV A;  4Q4X 3;  5BNO A;  3GXU A;  2P3J A;  3IDC B;  5GLT A;  2V72 A;  2CWM A;  5JR7 B;  4QPY A;  1XPW A;  2CAU A;  4P9L A;  3B3Q E;  2RS5 2;  2GDF A;  4IQP A;  4MYE A;  1RJ8 A;  3J7L A;  3MW4 A;  1UCX A;  4FPC A;  4ERO A;  1W9F A;  2ZGO A;  3Q8A A;  4FBF A;  1GP4 A;  3AP4 A;  3KCY A;  4BIS A;  5KR7 A;  3RMY A;  4FPF A;  4ZY9 A;  2ZML A;  4AEK A;  1ZVF A;  5JSO A;  1O3T A;  2A3X A;  2YFU A;  2VQ0 A;  5A80 A;  5A1F A;  2ARC A;  4XFB A;  1RUI 3;  1ZYB A;  1H8T C;  1YJK A;  4LPL A;  4Z8B A;  4Z2W A;  4BA6 A;  3KLS A;  4C90 A;  2CSG A;  4YVW C;  2VUA A;  3BOD A;  3ITQ A;  3UK9 A;  5A3N A;  1H4H A;  1KRI A;  5K4L A;  4RHV 2;  3VL8 A;  4NAO A;  5JIA A;  3SCF A;  3UGG A;  2YDE A;  1L7Q A;  2DUQ A;  4QXH A;  1WD3 A;  1HRI 2;  1ASJ 2;  1MQT C;  2VC9 A;  2OKX A;  2C4X A;  5ACA 3;  2E7T A;  2VMH A;  5DZG A;  2YMZ A;  3UGH A;  3MV1 1;  4AGG A;  4XPV A;  1CPN A;  1IQA A;  3HNY M;  1HXS 2;  3IWZ A;  1N1Y A;  4U2A A;  2BP6 A;  1NLQ A;  4XET A;  2Z5W A;  4NII A;  2RM2 2;  4KI5 M;  1DFQ A;  1US2 A;  2BEO A;  5FY7 A;  4XDQ A;  1NXM A;  2PAE A;  2YC2 A;  1NX9 A;  4P9W A;  1RB8 G;  4I2O A;  2VZT A;  3DXT A;  3WDY A;  2V4A A;  4B1L A;  1DF0 A;  2Q1F A;  1SHW B;  2BWC A;  1HN1 A;  5AFB A;  1AR9 2;  3GNE A;  5GLU A;  2WNV C;  1YIP A;  4K6B A;  3THC A;  1MS5 A;  2D6L X;  1XOY A;  3T30 A;  2Y0I A;  2ZX0 A;  3VBU C;  3VBH B;  3WVJ A;  1POV 0;  4KQ7 A;  1LRH A;  4NOT A;  1VB2 A;  4NUB A;  3VZK A;  1PZ9 A;  3JU9 A;  1E5S A;  4XFC A;  1G9C A;  2DVB A;  1PVC 1;  4IGO A;  1W8U A;  3VZN A;  3HQR A;  2BBV A;  1OQD A;  2G1M A;  1ND3 B;  3DPR C;  2XBO 2;  1COV 2;  4DMI A;  3JD7 2;  3VD5 A;  5FZO B;  3KT7 A;  5IAT A;  2P17 A;  3RZK A;  1U0A A;  2X29 A;  4UFK A;  1D0G A;  2YU1 A;  5A3L A;  1PO1 3;  4M3C E;  4MH0 E;  1RUN A;  1XQN A;  4R9D A;  4AOC A;  1BEV 1;  5FYT A;  3NL1 A;  4FTB A;  4MAD A;  3HVD A;  1YQ8 A;  1G7Y A;  2VZS A;  1GLH A;  3IDE A;  2DCJ A;  4LEJ A;  1V6L A;  3AYC A;  4MGK E;  5A7S A;  5FDB A;  1ZRF A;  2JG9 B;  4UWD A;  1UZ0 A;  3NV4 A;  5AC9 1;  4LBL A;  5SV8 A;  4RA0 A;  3ZXF A;  4Y1V A;  1G9F A;  3H1W A;  3M2M A;  3LOI A;  4DO0 A;  1XYO A;  1BBT 2;  4FP2 A;  5CB7 A;  5F39 A;  1ENR A;  1LTE A;  1W9S A;  2DCK A;  2RMU 2;  2MEV 1;  3AKP A;  2R06 1;  3SIT A;  1C3H A;  4URT A;  2GP3 A;  1W8N A;  3VDA A;  5JZG A;  1XSR A;  1EP0 A;  3MFC A;  3IT8 A;  1W39 A;  2J22 A;  4DRR A;  1PZ8 A;  1B35 B;  1JYN A;  2I2S A;  5G04 L;  2WQ4 A;  3J7H A;  3ZFF A;  1ZZ8 A;  3RMX A;  4YYO A;  1FMD 1;  1JUI A;  1NCR C;  2XLG A;  1ULC A;  3TRS B;  1UW8 A;  2XVG A;  3PU8 A;  4CUA A;  3NW4 A;  3G7D A;  3HT1 A;  1V0A A;  1LKN A;  3PLQ A;  3POF A;  3LEK A;  5FJK A;  3J7N A;  3WQ7 A;  1LAJ A;  3OTF A;  5FZ3 A;  1C28 A;  4Z92 B;  4XHX A;  1OBN A;  3NV2 A;  2OZJ A;  1IPK A;  1AR7 3;  3NMB A;  1SLB A;  2MNG A;  1JZ2 A;  4X6Q B;  5EWS A;  1UMH A;  2X10 A;  4Q4Y 2;  3U11 A;  2XVL A;  4Y33 A;  5A3W A;  4DOU A;  1HRV 1;  4Q8L A;  5HBA A;  5IFP A;  1CAX B;  1GYK A;  2CWS A;  3LEM A;  4Z2A A;  2K0G A;  2XWJ B;  4LOT A;  4PBP A;  3O1S A;  2F4L A;  3UET A;  4B29 A;  2BNO A;  1FNY A;  2EIB A;  2DTW A;  1RMU 1;  3VBS C;  1KJL A;  3ZFG C;  4COZ A;  1PVC 3;  3IPV A;  3ZIW A;  5LAS A;  4Q1P A;  2VZQ A;  1W8O A;  5LA1 A;  1RHI 1;  5J48 A;  1FPN 1;  1ULG A;  1YFY A;  3D5O A;  5CVR A;  3R6S A;  5C5T A;  1UX6 A;  4IV1 B;  1U5Y A;  2A6X A;  4GD4 A;  5GM0 A;  3RSJ A;  1NCQ B;  4AED B;  1G9B A;  4TWT A;  4NRO A;  2XJV A;  5JPM B;  3OBA A;  2DVA A;  5I8S A;  5JOZ A;  2GAU A;  3N9O A;  4UW6 A;  4EN8 B;  3VD9 A;  5IK7 A;  3LDB A;  1BEV 3;  2ORZ A;  5A7W A;  2Q8O A;  5KBF A;  2EXI A;  5F3G A;  3ZN6 B;  3MF6 A;  5BV6 A;  4EYU A;  1IHM A;  5HCB A;  2FDF A;  2GC2 A;  4E9K A;  3LA2 A;  1GIC A;  1XNA A;  3NNG A;  1BVP 1;  3W5M A;  3S5A A;  2BJS A;  4FQZ A;  5AC9 3;  2UY8 A;  2J1A A;  3OD4 A;  4IEU A;  1MEC 2;  4A7K A;  1V6M A;  2X5I A;  5IYY A;  5FYV A;  1JTZ X;  4WZF A;  4BH9 A;  5J09 A;  4PT6 A;  4LKS A;  4QU2 A;  1NA1 A;  2D6M A;  3ROU A;  4JV4 A;  5JMC A;  1ND2 C;  3MIE A;  2HKX A;  5FXZ A;  3W58 A;  4LHL A;  5EZW A;  1XE8 A;  2MEV 3;  3LKJ A;  2R06 3;  4M3C A;  2YZ4 A;  4XF9 A;  2ZGK A;  2JG8 B;  1R08 1;  1WME A;  5F7U A;  1UOJ A;  3PIJ A;  4Q0Q A;  4QWN A;  2D3P A;  3OJB A;  5DAX A;  1JUH A;  3K3N A;  4OYU A;  2A6V A;  2QQK A;  1FOD 2;  2EIG A;  5BXX A;  1I5Z A;  2V5D A;  1GMM A;  4Q0U A;  5CIR A;  5EPA A;  2DYC A;  2NPI A;  1OLM A;  2ZGU A;  2WO1 A;  3NNF A;  4KMQ A;  3PVE A;  1SBF A;  2EVX A;  5DN2 A;  5DXD A;  4ZZ8 A;  4BQ5 A;  5FZ8 A;  3LDR A;  2QNK A;  3E97 A;  3E5U A;  1UY0 A;  4O9G A;  5LBE A;  5LEJ A;  5JVV A;  5A1L A;  5C33 A;  5JWP A;  1DLL A;  4HBN A;  2HWC 1;  4IE6 A;  3D82 A;  4CU9 A;  3O1P A;  1U5Z A;  3P1I A;  1IPJ A;  4IGQ A;  1L7R A;  5FZC A;  1HRV 3;  4GWM A;  2VPV A;  2PHW A;  1W2A X;  1Y9Q A;  1AVB A;  2WAA A;  3W9A A;  3V0B B;  3UYJ A;  1JHN A;  1RMU 3;  1WCS A;  4KWK A;  4WM8 B;  3I3B A;  4JKK A;  3ZIX A;  3CJI B;  5BUV A;  1LEM A;  3VZM A;  4Q4W 1;  3TOJ A;  2OT7 A;  2VUL A;  4LBQ D;  3ZVX A;  3AL6 A;  1RHI 3;  1FPN 3;  4XMA A;  2HWD 2;  3ST7 A;  5KHH A;  1A34 A;  2VZU A;  3GJB A;  5FPL A;  5FFO C;  3WDX A;  4BYY A;  2VVF A;  4FSJ A;  4OI1 A;  2ZTN A;  5KHJ A;  2JB8 A;  5BNQ A;  2RJK A;  4P5H A;  1QNW A;  1NE6 A;  2RS1 2;  5JR2 A;  1QJU 1;  1QH7 A;  4A4A A;  1UZZ A;  2A3W A;  4NO4 A;  5IAV A;  1GQP A;  3CHX A;  4K9S A;  3PHM A;  4MXW A;  3ZR6 A;  4JDN A;  2WNU C;  1WBL A;  4QX2 A;  1VAK A;  1WA4 A;  4IEZ A;  5FYZ A;  3H8X A;  2AC1 A;  1XYP A;  2D40 A;  1JS9 A;  4AWD A;  1RUG 1;  4GAL A;  3ZSL A;  2ZHK A;  1VAV A;  4H7L A;  1W8H A;  5F5A A;  4E4Z A;  1AR8 1;  2B5H A;  2I45 A;  2W3J A;  3MI8 A;  2NYY A;  3I4I A;  2JJ6 A;  4J1X A;  1UZY A;  4N53 B;  5FLI A;  5HV0 A;  4WM7 B;  1R1A 1;  4HK8 A;  3IMN A;  3TN9 3;  1WCD J;  3SC7 X;  5I8Y A;  2CYF A;  2WWS A;  2XB6 C;  3N7J A;  1IS4 A;  3WQ1 A;  3VBH A;  5LK7 B;  4YGB A;  3VKM A;  4AYU A;  3NJV A;  4LBJ A;  1E5I A;  3S0M A;  2D6N A;  4DIN B;  3L9J T;  5LZ6 A;  1QJX 2;  2GAL A;  5EIY B;  2GNM A;  4CEW C;  4R9A A;  1K5J A;  4R9B A;  1JYT A;  2VZP A;  4L11 A;  1DQ1 A;  5CEH A;  4X8N A;  1ND3 A;  4CP1 A;  1Y43 B;  3EMR A;  1YRZ A;  4P9Y A;  3AKT A;  3MIB A;  5FZO A;  5C8C A;  3PUH A;  1FNZ A;  2F17 A;  2WNO A;  4RL7 A;  4WVV A;  5ERL A;  5CFC B;  3MHZ A;  5KHG A;  3ZR5 A;  4COV A;  2YXS A;  4EV0 A;  4YPJ A;  2WII B;  3FLT A;  2HWC 3;  2UYA A;  4BMB A;  3O0W A;  3WF2 A;  1QQP 1;  2VOK A;  3LGR A;  2WZE A;  3ZYP A;  2W39 A;  4NN0 A;  3VBR A;  4BK5 A;  4Z1V A;  3DYO A;  1JU3 A;  3OGR A;  4KH9 A;  2JG9 A;  1HJG A;  3D0J A;  5D21 A;  3V0A B;  2PLV 2;  2VVE A;  2XLF A;  2ADE A;  2FBE A;  2DUR A;  4HPK B;  4E2S A;  4Q4W 3;  2CTV A;  2EIE A;  4LO7 A;  2AR6 A;  1RL3 A;  4UF0 B;  2YUE A;  2XUE A;  5JSR A;  2GC1 A;  3O7O A;  4AVV A;  3SH3 A;  5DUV A;  3WP3 A;  2WT2 A;  3N9L A;  5FZ1 A;  3D6E A;  3RRD A;  2E32 A;  1W0P A;  4NAM A;  4UFJ A;  3I3E A;  1QJU 3;  1LB2 A;  2OZ6 A;  1W0N A;  1C5H A;  4HET A; 
#chains in the Genus database with same CATH homology
 5CKQ A;  3DEM A;  4GZ9 A;  1SPP A;  2QQK A;  1NZI A;  4LOT A;  3KQ4 B;  4LMF A;  3POG A;  5CKN A;  3POE A;  2QQL A;  1SPP B;  2QQM A;  4LOR A;  5CKM A;  1NT0 A;  2WNO A;  2QQO A;  3POJ A;  3POF A;  3POI A;  1SZB A;  3POB A;  5CIS A;  1SFP A;  4LOS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...