2OYZA

Crystal structure of unknown function protein vpa0057 from vibrio parahaemolyticus (targeted domain 2-94)
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
94
structure length
94
Chain Sequence
ASIKENSYFAGGVKSLGFNQHGQDVSVGVMLPGEYTFGTQAPERMTVVKGALVVKRVGEADWTTYSSGESFDVEGNSSFELQVKDATAYLCEYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords UPF0345 protein VPA0057
publication title Crystal structure of unknown function protein VPA0057 from Vibrio parahaemolyticus
rcsb
source organism Vibrio parahaemolyticus
total genus 17
structure length 94
sequence length 94
ec nomenclature ec 2.4.2.15: Guanosine phosphorylase.
pdb deposition date 2007-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06865 Ppnp Pyrimidine/purine nucleoside phosphorylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2oyzA00
3FHIB 4MV2A 4LA2A 3KGZA 3S7IA 5F1RA 4HSJA 1O7FA 4X6QB 3S7EA 3OCPA 2CV6A 5BUVA 3NSTA 1X7NA 4LA3A 5JSPA 4HN1A 5C6CA 4D7SA 1J59A 3ES1A 2PFWA 4ONUA 2VQAA 3MDPA 2PAEA 5K8SA 4UXAA 5LEKA 3U0ZA 2XKPA 1DGWA 1GQHA 4Z07A 1O3RA 2PHLA 5FPXA 4HLTA 3PNAA 3TNQA 1ZRDA 2OA2A 4QGMA 1GQGA 4MX3A 3SMHA 1EPZA 1V70A 1ZREA 3DN7A 3FJSA 3ETQA 5JR7B 3IWZA 5T3NA 3BPZA 4AQ6A 2O8QA 3GBFA 3I59A 3JZVA 5FDBA 4I2OA 5I0RA 3MYXA 2IXJA 1RL3A 3FZ3A 2D40A 4HSLA 3RYKA 4BIFA 3BCWA 4P9GA 1DGRA 3NJZA 2GC3A 1I5ZA 5KHHA 3H9AA 1VJ2A 2ET7A 3LWCA 4HBNA 1CAVB 5J48A 3HIFA 4ZU7A 3WW4A 1UPIA 4Q0PA 3ZDSA 4OFGA 5BV6A 3VHRA 4I09A 4PIYA 3MPBA 3CO2A 4KL1A 1Q5OA 4AVCA 3GYDA 4ZU4A 2PAKA 4IEWA 1FT9A 3KMHA 4KU7A 1OI6A 4L11A 4XFIA 1CGPA 2BGCA 3E5QA 4LLOA 3FE5A 4TLFA 1CX4A 5HI0A 2CGPA 3U11A 1J3PA 3LA3A 4QM8A 2EAAA 2BYVE 1CAXA 4YYOA 3H7JA 2Q0AA 4QGLA 3C3VA 3WW3A 2IXIA 2GAUA 3KGLA 4AQ2A 1G6NA 1YUDA 3IIAA 5I8YA 3H1MA 1CAWA 4JVAA 3D0SA 1EP0A 4X6RB 3NVCA 4IETA 2VPVA 1LRHA 4H7LA 2XL9A 4F7ZA 5FQ0A 1IPJA 3LA7A 4F8AA 3LOIA 4UBHA 3DL3A 2GU9A 1YLLA 4XFCA 3ACLA 1O3QA 3H50A 2XL7A 1O3TA 2OZJA 2PHDA 1NZCA 4EROA 2Z69A 4XF3A 2V09A 2N7GA 1WGPA 4J1WA 2FQPA 4MGKE 4IEPA 1NE6A 1J58A 1Y3TA 5EZWA 3USSA 3EJKA 2B8MA 2P17A 4KWKA 3QACA 1XE7A 4E2SA 3SHRA 1ZVFA 3H1WA 3I59B 2H6BA 4R52A 3E6CC 2IXKA 1VR3A 1VP6A 2CAVA 2D5FA 4KU8A 1PM7A 2BNNA 4PIXA 4FT8A 1XRUA 1RUNA 1YWKA 3ES4A 3FX3A 5CADA 3H7YA 4XF0A 4E2GA 3DV8A 2E9QA 4HVQA 1OMIA 3H8UA 4LTAA 4R8HA 2ZKLA 2IXHA 2XGXA 4LUKA 1OFNA 3S0MA 5JSRA 2B5HA 4I0BA 4A2UA 3CJXA 1CAUA 5J7MA 1JUHA 4EV0A 4KWLA 1X8MA 5LRRA 3RZZA 1O5LA 3R6SA 3BU7A 3RPQA 5FLJA 3WW2A 4Q0SA 5D1IA 4IEYA 4XF9A 2QDRA 4FBFA 1NXMA 2PAMA 4JTOA 2WFPA 4HN0A 3RNSA 1EY2A 3I54A 5FCCA 3SCFA 2PTMA 4QXKA 2C0ZA 3NL1A 1DZTA 5E16A 2XLFA 3QOPA 1ZRCA 5FQ0B 5KHIA 1SFNA 1DZRA 5CVRA 4HZFA 4ORFA 4YRDA 1RGSA 1PMIA 2OPKA 2UY8A 4XFHA 3SCHA 4J1XA 4UBGA 4I0AA 4Q0UA 3M70A 4META 5BPXA 3ELNA 4Q0VA 3UKTA 5BXXA 2K9ZA 2D5HA 2ATFA 4HVRA 4FAHA 5I91A 2H6CA 1L3JA 2UY9A 3E6BA 4D7TA 1HW5A 5I0UA 1YFXA 4WZCA 2ET1A 5JSOA 4XEZA 4EWEA 3I7DA 1Y9QA 1J3RA 4HMZA 1ZZ9A 1UD1A 2GH2A 1QWRA 1ZZ7A 5LRSA 1SEFA 2MHFA 4O9EA 2QVSB 3PLQA 4I01A 3HQXA 3H1YA 2QNKA 5FLHA 4CYDA 3EQEA 1XE8A 5JAXA 4E2QA 1ZZ6A 3RYPA 1YFUA 1LB2A 4QMAA 4XFBA 3BALA 4IEQA 4IEVA 5E1RA 3M3IA 2GZWA 3DKWA 3SXWA 1NE4A 3OF1A 4Q29A 1ZZCA 4PJYA 2XLAA 4YARA 5KBFA 3D0JA 3ROUA 3RYRA 4NVPA 3E97A 2GC2A 4IEOA 1ZX5A 1FXZA 3B02A 3CL1A 4MGYE 3CEWA 4XFAA 4HVOA 5AVPA 1WLTA 4L2NA 2FMYA 3BB6A 2Y0OA 4XF4A 2ZCWA 2DCTA 3SCGA 3H3UA 3FFQA 1YFWA 4N9IA 1WA4A 4YNIA 2Q30A 1X8EA 4IEUA 1O4TA 1J1LA 4BYYA 1YFYA 4LEJA 4MGZE 4AVAA 2B9UA 4BHPA 2QCSB 3E5XA 4B29A 2D93A 4WBBA 5I0SA 3IBMA 4PIZA 1UW8A 3NKTA 1UIJA 1RUOA 4JV4A 2PA7A 2CAUA 4O9GA 3PVBB 1J3QA 5KHJA 3OGJA 3UKVA 3KSCA 4MZUA 3ST7A 2HKXA 2H0VA 2OZ6A 1ZNPA 1CAXB 5J3UA 4OLLA 3IDBB 2F4PA 3WW1A 3UKNA 1ZZ8A 4EWAA 2ETEA 1CAWB 2EVXA 3E6DA 4Q0QA 2BNOA 4QX5A 4XF1A 3IDCB 3TNPB 1O5UA 2Z2SB 1EYBA 5CU1A 2OYZA 2O1QA 5LEJA 4AVBA 1YHFA 4IERA 2GC0A 2HJIA 4MH0E 4Z82A 4DINB 4XFFA 2MPFA 1O3SA 4GULA 3NW4A 2UYAA 2GC1A 4MUVA 4LUMA 4YSFA 1UIKA 3OTFA 5I0TA 1TQ5A 2PQQA 2PYTA 3HT2A 5JCTA 2IXCA 4MGIE 4XETA 1FI2A 2Q4SA 5I8TA 1ZRRA 2MNGA 3EBRA 4N9HA 4LULA 5FLIA 4EWDA 1RTVA 1QXRA 3L2HA 1RC6A 1I6XA 1Q3EA 2XHKA 3LA2A 4KWJA 1IPKA 3EO6A 5BY5A 4BH9A 4RD7A 2K0GA 1UCXA 3HT1A 2IC1A 4FAGA 1ZZBA 1CAVA 1LR5A 5EFUA 3N4MA 2IXLA 3MZHA 4WVZA 1U12A 1H1IA 2WC2A 2VECA 4K8FA 5C8WA 3CLPA 3KCCA 4I3PA 2I45A 4I02A 1ZRFA 2BNMA 5KHKA 5I93A 1Q43A 2BEOA 3O14A 3FWEA 3U10A 1QXJA 3LZZA 3G7DA 5FPZA 4IESA 2XKOA 3CF6E 1LKNA 2XLGA 4XFGA 1QY4A 3RDIA 4ZU5A 4IEXA 1CAUB 2UYBA 2Q1ZB 2EA7A 3LAGA 1X82A 4AXOA 3D82A 5I8SA 2QJVA 1H1MA 3E5UA 1SQ4A 1NYWA 2KXLA 3EHKA 4JTNA 5KHGA 4IEZA 3H3ZA 3OD0A 1OD5A 4QM9A 4QGNA
chains in the Genus database with same CATH superfamily
3QLQA 1WCKA 2GMEA 2X05A 1MZEA 1R64A 1EAH2 2J1RA 2Y8KA 3B9IA 4AI8A 1UOJA 5C4WB 4FOWA 1IPSA 1N1SA 3AFGA 3VDDB 3LDKA 5F5IA 5BUVA 1AJOA 4RHV1 4BCUA 3N9PA 4NPRA 2XB6C 2YZ4A 2BOJA 3WY6A 1J59A 3IT8A 2R043 1QJX1 2Y6KA 5GZGA 3MIEA 3MDPA 2PAEA 5LEKA 4YM0A 2XDVA 3GZEA 1NKGA 1OT5A 1GQHA 2YGLA 2PHLA 3VD3A 3RGBA 3B00A 1S0JA 3VKMA 1RJ7A 4YG3A 1ND3B 4LHSA 1ZRDA 4GZ9A 3J7NA 2OA2A 1VBB2 1Q8VA 5A33A 5FBZA 3KV4A 1P8JA 1SCRA 4JGZB 2BRTA 3KT7A 4ASMB 4GWMA 4PHZA 3IPVA 1I3HA 3U75A 5EPAA 1RJ8A 1RIRA 1ULEA 1ZYBA 3Q8BA 4RS5C 1IS6A 4AK3A 3ZR5A 1FNZA 1HRI2 4OUSA 4P9GA 1PVC1 3UGHA 1YIPA 3NJZA 1SMVA 3WNMA 3LPFA 3PU3A 5T5PA 1H8VA 3UJOA 4W50A 3QCWA 5LK7B 2GALA 4LOTA 5DDJ3 1ENRA 4HBNA 1AR91 2YFZA 1W8TA 2DTWA 3HIFA 5FYIA 4UFHA 4Y5TA 3AKTA 5FYVA 1UPIA 2GSYA 2MEV3 3HEIA 2BFUL 3MFCA 3SH4A 3VDCA 5FY5A 1NQDA 4ITCA 5FRAA 3VZMA 3ZDSA 5IVEA 5IHRA 4Q26A 1C3HA 4PIYA 4XBNA 1XQNA 3M8LA 4KL1A 4AI0A 2XHNA 3HNBM 3WF0A 2OIIA 5IVFA 5A7NA 4Q8KA 1JYNA 1PGL2 2X53S 3LE0A 3KMHA 4KU7A 1OI6A 5FO9B 4L11A 1J83A 4XFIA 1WMEA 4XYXA 5A3PA 1CGPA 2YBPA 4XMIA 1LCLA 2QQNA 3FE5A 2RDSA 2XJQA 2PHTA 4ZZ5A 1T6BX 4AEMA 5BNPB 4BK5A 2Y6GA 3VD5A 3OSDA 5FBJA 2VH9A 4QPIA 3UV9A 4NRQA 3WP3A 4YM3A 4OI0A 2BFUS 3AP7A 3H7JA 2WNVB 3MIHA 4MGSA 5FY4A 5FZ9A 3VBOB 3VKFC 3W58A 3WW3A 5C71A 3JQWA 1KJRA 1MACA 3O7OA 1YUDA 4CXXA 3SH3A 1CAWA 1TMF1 4JVAA 5CFCC 3VBRB 2RHPA 3ZLIA 3WT3A 1UYPA 3ZXAC 5BNOB 3ZYPA 1F2NA 5FPUA 3NNGA 2CTVA 4X6RB 3NVCA 3EYPA 4IV1B 5JZGB 1RXGA 2VPVA 5FZLA 1AXKA 4ES9A 1DYKA 4COYA 4E4ZA 1W04A 3PJYA 4Q4V1 4H7LA 4UFLA 4XQWA 5T54A 4AZZA 2ZGNA 2VOWA 2NYYA 1C1FA 5FQ0A 4MGTA 1CVNA 1T6GC 4IGOA 1HB1A 4E8DA 2GU9A 1N1VA 3NV1A 1BEV2 1UZZA 4WM7B 1YLLA 3KB5A 3T3YA 5HCFA 3H50A 5C33A 2BWAA 2ZMKA 4Y1ZA 3UL2A 1RITA 3N7MA 1ENSA 2PHDA 4CP9A 4Y20A 1GANA 3VN4A 4EROA 4HETA 2JDMA 5EXOA 3VD7A 1DCSA 3AVRA 3I2DA 1QMJA 3NNLA 4IE6A 3DYMA 4PQ9A 1ND2A 5ERLA 4XCBA 5FZOA 5H9QA 1UQXA 1ND2C 1B35A 3T08A 1BMV1 3AK0A 1CQ9A 4LE4A 3POJA 1B35C 4C90A 3GJAA 4YZ2A 4DRRA 3EJKA 3MHZA 3J26N 1QJY1 1VB4A 1OVPA 1VPHA 2YC2A 1JYCA 4YVSB 3KF5A 3ZFEC 4EZHA 2KD7A 3VBSC 5IATA 2ZHKA 3H1WA 2Y6FA 5HBAA 1H30A 4LBQB 5EJ1B 3JD72 3I59B 2H6BA 2Y26A 4Y22A 3E6CC 5FFOC 1SG3A 3T4HB 3ZYBA 1Q8SA 1VP6A 1Q8QA 4CXYA 2VBDA 3AP6A 1H2NA 1UL9A 1ENXA 3H8XA 4D6RA 2BNNA 4XUOA 4FCAA 1D4M3 1XNAA 4JX0A 2W1WA 3ZKUA 4P9YA 3ZFFA 3HVDA 1VE0A 3DV8A 2VUDA 3ABZA 5CYYA 3H8UA 1NCQA 3VBRC 1W9YA 1GU3A 3OBAA 4BDVB 2P1BA 4Y4RA 1U5IA 2IXHA 2YPJA 4OI4A 2XGXA 4CE8A 2ADEA 2R1BA 2DFBA 2D3PA 1R081 4XXPA 3LFIA 1PIV3 3AVSA 4LUKA 1OFNA 1VBE1 5EYXA 5JSRA 1DQ0A 1D7PM 1VBC2 1JH5A 4WM7C 4I0BA 2Q8DA 2OUJA 4CDQC 4FFHA 4Y3OA 1RUI1 3MI8A 3ASIA 4QWNA 5DAPA 5FYHA 1AXYA 1V9U1 2IWGB 1XU2A 2HWF3 1GNYA 1GP5A 4JKKA 3ZXGA 4EV0A 2XQXA 1X8MA 1GSLA 2ZEWA 2DBNA 3GCXA 1R092 4DY3A 2LUWA 1OHFA 1H0BA 2PLV1 5D1IA 1RUJ1 4IEYA 2P37A 3JUUA 1PGW1 4G9SB 1JZ7A 2PAMA 4GH4A 5J36A 1WLWA 1VBD2 5C8CA 1DG6A 2E53A 3U78A 4GH4C 4FP2A 5BNNA 3ALQA 3I54A 4P5YA 3T2OA 5JOXA 1PZ9A 3NJXA 2C0ZA 4QXKA 4YVSC 5BNNC 1OURA 2DCKA 1W6NB 4Y1VA 2HEVF 5E16A 5FZ8A 2XLFA 2WIIB 3ZSLA 1RVF1 3ZMOA 4DFSA 1OA4A 2G4IA 1QQP1 1W6MA 2BBVA 1D2QA 4TYSA 4GMP0 4XPVA 3VZNA 5FZCA 1PMIA 2A75A 2HYKA 2UY8A 4M3CB 5JZGC 2UWBA 1AX1A 1JYTA 3RMYA 1D0GA 4M0HA 1Z0HA 4Q0UA 5EYYA 1YQ8A 3C7EA 2OKXA 2XMLA 4WVMB 4MHRA 3MW4A 5FP9A 2Z42A 4GALA 1AF9A 3N3HA 4XW3A 5BXXA 3GCWA 1C8M1 2R062 5I91A 4E9KA 2GNDA 1HN1A 3AMMA 4NAOA 2VE1A 3ZN5A 2AR6A 2NZ9A 4IE7A 2F17A 5DUWA 5HCAA 2DUOA 4BU2A 1RUE2 2JXAA 4YFZA 4HMZA 3BUCA 1OPOA 4PLNA 2GH2A 5HV0A 1KS4A 1ZM1A 1QJU1 5FMBA 3UETA 1NOVA 1O59A 1G9FA 4QQPA 4I01A 3TWIA 1FMD1 1CIWA 2E63A 2ZX4A 3H1YA 4NOTA 1HXS2 1GWKA 3R4DB 2QNKA 2W1UA 5FLHA 1POV0 5FKBA 4CYDA 1XE8A 1FOD3 2WNEA 1ZZ6A 1C28A 5FOJB 4QQHA 2EALA 4N53B 3WD5A 5IVCA 1O91A 1ACCA 1NZIA 2XBO2 2HBUA 3RZLA 4N43B 3MPPG 4CPBD 3UYJA 5ANNA 5CB7A 3ZXDA 1ULFA 1VAVA 2CDOA 1NY71 1H4HA 5ABJA 5GLVA 4LORA 4NRMA 1V6JA 4DEVA 2VMGA 3AXEA 3OY8A 5C70A 3HAGA 3PIGA 4ZONA 5ABJC 1N1YA 2FBEA 2W87A 2Z5WA 4XJZA 5LY2A 3D0JA 1RUC1 2AGSA 2JDUA 5A3LA 3WVJA 3THPA 1FYUA 4XTMA 1FXZA 5C3SA 4COZA 3GXUA 1GNHA 4B4PA 5C5TA 2FCTA 2VQTA 3CL1A 1COV3 4W4ZA 2W9XA 1TVGA 2VZ1A 1IGOA 1QJEA 3VKOA 5A3UA 4L2NA 1V6LA 2FMYA 3W59A 5F7UA 1H2MA 4PDWA 4XF4A 1RB8G 4QPGA 3JB4C 4LK6A 2GDFA 3U37A 1SLTA 1ASJ3 1WA4A 2VZQA 4YNIA 4AF9A 2Q30A 4CP1A 2CHHA 3I3QA 2DVAA 4AVVA 2ZGUA 4BYYA 1YFYA 1W9WA 2R041 4BISA 4W6XA 4ARXA 3DUIA 4BE3A 3M3EA 2B9UA 3AMQA 1H6XA 4BHPA 2D3SA 3NQHA 2QCSB 3RG0A 4B29A 4WBBA 5EIYB 1LHWA 4BA6A 2RS52 3NKTA 3POBA 1RUF2 4YM2A 3P5BA 3ORJA 3WQ1A 4H3WA 4XURA 3IIIA 3DGTA 4XILA 3SLIA 5KHJA 3OGJA 5FYSA 2WQ4A 1RHI1 1LODA 1QOTA 2GNBA 2DVBA 4WVVA 5AC92 1X9TA 2NMOA 4CU9A 4Y5Z0 2OZ6A 3LB9A 4UFKA 4P9XA 5J3UA 1UKGA 2A6XA 2VZOA 2NQYA 4AQTA 2F4PA 1AYM2 2HBTA 5B4XA 1ZZ8A 4OI1A 3WSOA 5ACA2 1Z7S2 2EVXA 1HJGA 1LOEA 1MS8A 4CPBA 2DYCA 2W2IA 4XIKA 4QX5A 5FY8A 1X36A 4D6SA 3H8OA 1AR83 3V64A 3U4SA 2RS33 5CG8A 1BK1A 2MEV1 2AH2A 4WM8B 2WLPA 1S2EA 1K42A 4Y33A 1UY4A 4NHYA 4K7JA 1ZBE2 4CDXB 4AI3A 2DCYA 1OQEA 1W8WA 1XNDA 2V5DA 1GOFA 2HWE3 2HWC2 3KT4A 2GC0A 4EQVA 1PO12 4OHZA 4MG2A 2WABA 4K21A 3FMGA 1PNFA 2P3KA 1AR72 1O4YA 5A3TA 4IW3A 3SITA 3DCQA 1LGBA 3VBFC 5KWRA 3LIGA 2RDNA 4Z82A 4XFFA 5FYZA 1V6MA 1YI9A 4NHLA 4GULA 4CCKA 2GNMA 3OJBA 1S55A 5CKNA 2GMPA 1YO8A 2WO7A 2AENA 1YQCA 3WXPA 1M06G 1A3KA 5I0TA 3NNMA 2RR12 2WNOA 3I3EA 2AZ5A 3KM5A 2PQQA 4AVSA 1GUIA 5JCTA 3EXUA 3J7HA 3OPTA 4BOWA 4FPEA 1FI2A 4U2AA 5FZ4A 1SZBA 1DGRN 2X5IB 3DECA 1GMMA 4KH9A 4CCCA 5I8TA 1E5IA 2B45X 4GB33 4Z1VA 4QKBA 4N9HA 4LULA 4RA0A 1W0NA 4UF0A 4XHXA 4EWDA 4XHBA 2WL1A 2YU2A 1RC6A 1I6XA 3K3OA 3H3LA 3ACHA 1Y7BA 2ZGLA 5FZDA 3TB0A 5FZGA 3W21A 3JQXA 3LA2A 2BJSA 5BNQA 1W3XA 3O1UA 2J1SA 3POSA 4BQ5A 2Z79A 3THCA 4JRLA 4NIIA 3IDEA 3CU7A 1AYN3 2IC1A 1CAVA 1LR5A 5EFUA 4DXTA 1UNBA 1YIFA 3N4MA 2IXLA 2VUJA 2J1AA 5L7OB 5A6XA 4LHNA 4QX0A 5T5JA 1H1IA 1S0GA 4ES8A 2WYSA 5DUVA 1YXWA 2VVFA 1EV13 1AXZA 4ZY9A 5DUXA 4A3XA 1UY2A 4PF1A 5KHKA 4BK4A 2YUEA 3WHTA 2WT0A 4HKLA 2QE3A 2QQOA 3RS6A 3VKLA 1BJQA 4AAXA 3VLBB 1LOGA 3W9AA 2GN7A 2VZUA 1Q43A 2CL2A 4JQRA 1PK6B 1GWMA 3AYAA 3LZZA 3G7DA 1GNZA 2EXJA 1XNBA 1A8MA 1GKBA 3FLRA 4U36A 3CF6E 4FOVA 1LKNA 4XFGA 1A6CA 4QX2A 5C3OA 4IEXA 4YWAA 2NP0A 5GALA 2EXKA 1ENQA 2IUWA 4AI9A 1W8NA 2GMMA 3LAGA 1ONAA 3DPRA 3VL8A 3UNPA 1W2NA 4LO6B 3FC0A 3DPRC 1F5FA 3IAPA 2QJVA 3ETPA 1SLAA 4RR3B 3W5MA 3Q8FA 3E5UA 4LIVA 4LKDA 4DUWA 2QQMA 3ILRA 1R1A1 4ATEA 1HRV2 1QJY3 3H3ZA 3B93A 3R0RA 3OB8A 4TZDA 1JU4A 3FHIB 2A6VA 4YGEA 1UO9A 1K5MA 3AKRA 4M01A 3WNLA 2QZ2A 3NAPA 1ODNA 2VY0A 5F1RA 3CJIA 3H42B 1K5MC 4NPLA 1MS3A 2D3RA 3S7EA 3NAPC 3O12A 3OCPA 1UY0A 5H9PA 3ACIA 1PIV1 3OGVA 4RFRB 2VU9A 5LB6A 2A71A 3NSTA 3ZYIB 2EIDA 4QDQA 1NX9A 4HN1A 4URAA 2ZJCA 4AEKA 3AZWA 3INAA 1REDA 3HNYM 4GXLA 4LMFA 2CSGA 4TSVA 1UPSA 2XONA 2ZKNA 3TN93 1OLRA 4YZ4A 4L0PA 2F4LA 3ZPYA 4XUQA 5LA2A 1G9CA 1O3RA 2PHFA 1IOAA 3OGGA 3LIHA 1U5YA 3MLKA 4NPMA 1VBE3 4Y26A 1CX1A 3PNAA 1FAYA 1C5HA 1OA3A 1TZOA 2DCZA 1UZWA 1OOPA 4GKXA 1S0FA 3AKPA 2YBSA 4JDOA 1JN2P 1JOPA 4MX3A 1PK6C 1ULPA 3ETQA 1OOPC 3ZN6A 2O8QA 4MO3M 1CPNA 1AR92 3GBGA 3JZVA 5FDBA 2ZHLA 5I0RA 1N47A 3MYXA 4NE9A 1Z78A 2VO5A 2X09A 2VW1A 1LOFA 2WKKA 1NAEA 5KXCA 1MS4A 4XACA 4QQOA 4E4SA 1MZFA 2Y34A 4XVHA 3OGRA 4YG0A 5KHHA 3RZJA 1LOFC 1VJ2A 1LAJA 2WQ8A 3PUAA 5FK7A 4RR3C 5JIUA 4Y4YA 3MIFA 4ZU7A 2YPDA 3B9CA 3BIWE 5CA6A 3FBMA 5BV6A 4OFGA 1LGNA 4Q5OA 2JDPA 3NRUA 1FV3A 1W03A 2QQUA 1PX4A 2JE8A 3TOJA 4FPJA 2BGOA 1MS0A 3C7OA 4N90A 5EWSA 1W06A 4LBKA 1PX3A 5A3OA 1AR62 5EV7A 4ZU4A 2PAKA 3G6JB 4Q4Y2 4QQ2A 3UESA 1KDMA 1UF2C 3FBYA 5IUQA 1C4RA 3E5QA 5EJZB 3GZTB 4CDWA 1SACA 4LLOA 4QU1A 3O1OA 3ZO0B 2VXJA 2EXHA 2G9ZA 3KS7A 1PHMA 4TLFA 3SEPA 3PU8A 4AHZA 2CGPA 5HXVA 4UFIA 3ME2A 2BYVE 4CUCA 4YYOA 1C8M3 2R073 1S0BA 4IV3B 4DB5A 4V1PA 2GAUA 2KR2A 4AQ2A 3MUY1 1W6OA 2J7MA 1FOD1 5CIRA 4CEWA 3D0SA 3V0BA 4AVTA 1UOGA 3KD4A 2UURA 2WS91 1G9DA 1NA1A 3OD4A 4CEWC 5C9AB 1LRHA 2JJ6A 2G19A 5KXEA 2XL9A 3B01A 4MLOA 4UBHA 3DL3A 1S2KA 4LBJA 2YMZA 4FPYA 1YI7A 2YROA 2A1XA 5JXHA 1POQA 2VMCA 2CU5A 3PL0A 4NHMA 2JIJA 5DN2A 1O3TA 5JXJA 3VDBA 4EZ4A 4LKSA 3WDYA 2YB7A 4NIDA 1RUH1 1W8OA 4XF3A 2V09A 4M4PA 2G9FA 3MW3A 3RMXA 4QAWA 3SISA 2J1VA 2JG9C 5FZHA 1OQ1A 1MS9A 1I9RA 2C6SA 2WAOA 5CFDC 4AGVA 4COUA 1J58A 2JG8A 3AXDA 3AP9A 1DYOA 5EZWA 1RUC3 1C1LA 2XJUA 4LJHA 5K4LA 1ASJ1 4FO9A 1HN0A 4LOSA 2XR4A 4AI2A 4QT6A 3AZVA 5CKMA 1BBT2 1FPN3 4LHLA 4C0BA 2ENRA 2ZGOA 2GNTA 3MV11 3QACA 5A33B 4E2SA 1ZA4A 3SHRA 1ZVFA 4BQ2A 3O1MA 2V73A 1UZVA 1KQRA 2NM1A 4BMEA 3IPVB 2XQRA 4HG6B 5K0UA 5E8AA 2LM3A 4LPLA 2CAVA 2R0FA 5FZIA 5K0UC 1W2OA 2YG0A 1RUNA 2JE9A 2QQWA 2FDKA 4IV3C 1NLRA 2E51A 2WJSA 4YW7A 4L8QA 3TEWA 3H7YA 1R082 2XJVA 3VHNA 4BQXA 5FO7B 4E2GA 3BTZA 2VL4A 2E32A 4LTAA 2QUOA 4OZXA 4A41A 2CYFA 4AYUA 2TBVA 4MYEA 4HKOA 2OPWA 5FR3A 5CKQA 5AFBA 2WLQA 1V9U2 3HD8B 1XYPA 2PHWA 4KG0A 1GQPA 2VUAA 1GOGA 1W0PA 1AUYA 4F3JA 1HQLA 1DU3D 4RGAA 4INDA 3GNEA 4DUXA 2XXZA 3TBDA 2WUHA 2D6LX 3BOPA 3JBG2 1PNGA 5FY9A 2LROA 1UZ0A 3PMSA 1UYYA 1CAUA 2ZTNA 4JHTA 4LO7A 3TEZA 1RHI3 1AR81 2VMDA 4RS5A 1GFF2 2RS31 1JUHA 3HWJA 4KWLA 1AL22 1O5LA 1YYNA 1JUIA 4HXCA 1IQAA 2AUYA 2C24A 2RM22 5FLJA 4EN7B 1QNYA 1QOSA 1MEC3 2HWE1 3PVNA 1ULCA 4FXGB 1Y9GA 2HYXA 1NXMA 2JDHA 5IWFA 2IFRA 3MBWA 1REFA 2W47A 4KGQA 1UX7A 1YQ2A 5D2AA 5DXDA 1MVEA 4P5HA 5DZGA 2A3XA 5FZMA 2JX9A 3RNSA 2XWBB 4IUGA 1Y43B 3SCFA 3D3AA 1XNKA 4ZPIA 3ZYFA 4AOCA 4IE0A 1HKDA 5D21A 3NL1A 1DZTA 5C4WA 3ZIXA 5FQ0B 2HH9A 3EB7A 2C5DA 3AP5A 4YG6A 5CEHA 2DU0A 5C3PA 2OXBA 5C4WC 1NXD1 5FPLA 2D7FA 1AX0A 4HZFA 3OUHA 4ORFA 1RGSA 2OPKA 4XZPA 4GB31 5CVRA 4BXSV 2O0OA 3VDDC 4KWUA 4DMIA 1EUTA 2FD8A 2OX0A 3AFKA 3ZXJA 3AYEA 4CTEA 4CP9B 1R093 1GOHA 2CGNA 3ELNA 4Q0VA 2ZPXA 4XJAA 1UY1A 3UKTA 3C7HA 3N7KA 2YY1A 3WNOA 5LY1A 1VBD3 2D5HA 5C7GA 2ATFA 1D0HA 4HVRA 5CFCA 4AFBA 4KG8A 1AYN1 2H6CA 2UY9A 3T1LA 5DZEA 4TN7A 1ND3C 1DYPA 1YFXA 2UWAA 4WZCA 1G86A 3UJQA 1LU1A 2R49A 5JSOA 2ZHNA 1ZZ9A 1OQDA 2JDYA 3MIGA 3I2HA 5F2WA 4JGZC 3WP5A 2JEMA 1JXNA 3PUSA 1EV11 3O1SA 1MR5A 1ZZ7A 2ARXA 1DP0A 1SEFA 2VGDA 3HMYA 4DEQA 5LRSA 3F95A 1PZ7A 2QQPA 4AL9A 1DFQA 4WZFA 5APAA 1K3IA 3WQ0A 2XVLA 3FFZA 2YU1A 3ZYGA 4P9LA 2ZEYA 3QH6A 1HIXA 4E2QA 2DTYA 4FQZA 1YFUA 2Y38A 4QD2A 4DXZA 3H8RA 2XVKA 1SLLA 3ZX7A 3I97A 4IEVA 1S0EA 3DKWA 1JTZX 3GALA 2XOMA 3JCIA 1STMA 4XMAA 5DQ0A 2R063 3OF1A 2C4XA 2W5FA 5AVAA 3CKHA 4LBQD 1ZZCA 2Y64A 5F3CA 4CCOA 4OUMA 1CIYA 4YZ1A 4B1LA 2DUPA 2VZTA 3ENRA 2LTNA 1OF3A 2RV9A 1CJDA 1RUE3 2RDQA 2PN5A 3ROUA 3ZFEA 5KBFA 3ZXKA 4B1MA 3VBSA 3T2PA 5FZ1A 2OS2A 3J8F2 3ZVXA 1LOBA 1QDCA 5BNPA 1LESA 4MGYE 3CEWA 5FUNA 5FZBA 1HXS3 4BXFA 5BNPC 1YEWA 3RRDA 2PQSA 2WNVA 5DAWA 5GZCA 4CVUA 5FPVA 1W8HA 1OFSA 2ZA9A 4FSJA 3THDA 4P9WA 1OKOA 2WNVC 2ZABA 5GLZA 3DYOA 4XBLA 1R1A3 2V4AA 2XBO3 4N9IA 3SCGA 3B3QE 4N7UA 5FPAA 3VBOC 3VBRA 1W6QA 3VDAA 4E4HA 5BNOA 2JDAA 3SNMA 1JZ3A 4IV1A 4OYUA 5C8CB 2ARBA 4HANA 4KQ7A 4S2DA 1J1LA 5BNOC 2FDIA 3M4FA 3TN91 4IV1C 3I3BA 4LEJA 2Q8EA 1GZTA 1QH6A 2WZR2 3RI8A 2ARAA 4MGZE 1OLMA 3Q8AA 4Q4W1 2JDKA 3RJRA 1XSRA 3VBUB 4E4DX 1O8SA 2QBXA 4UW6A 3ZM8A 4WM7A 4CDQA 3P6BA 1KS5A 2ZGKA 4PIZA 4OVEA 3S57A 1W6MB 1YJLA 2P3IA 2WO1A 1F9KA 1IG3A 4O9GA 4PLOA 1PO23 3ZFGB 1J3QA 3POFA 1XNCA 1EAH1 2WSVA 5DDJ2 5LCWL 1RUG2 1S1AA 3ST7A 2ZMLA 1GZCA 4OHXA 1CD3G 2WNUB 2XJTA 4I30A 4TLGA 5G04L 3IB3A 1ZNPA 4B7EA 1CAXB 1IKQA 4A44A 4FPLA 2X29A 4EWAA 2R0HA 2ETEA 5HV4A 3ZSEA 3MIBA 3S5AA 3E6DA 3N9LA 3R4SA 3T2TA 3CHXA 4YVSA 3VGIA 1VLNA 4GMP3 5E88A 3CIHA 1QHDA 4PBOA 1TG7A 1XU1A 2R7EB 1VRH3 3ATGA 5LBEA 1PZ8A 1OA2A 4LBQA 4ZXKA 2HWD3 3E1F1 4TWTA 4EE2A 5L36A 2W39A 3NKGA 1LU2A 1US2A 4AFAA 1RUF3 2WZPP 2TEPA 1W9TA 2ZX1A 4IERA 3A23A 1VBB1 4YGDA 4AVBA 5JZGA 4BLJA 1WCQA 4JDNA 5FZAA 5GLTA 1V6NA 3VZKA 4B7KA 5ISLA 3N36A 2BZDA 4HOOA 4RYDA 4YVWB 3WDWA 4CCEA 3R05A 4I3GA 4CCLA 3O5SA 4DINB 1H8TB 1HB4A 4ZS2A 3QD6A 1H1AA 1OF4A 5CZKA 5KXDA 1HRI1 4MUVA 1ZBA3 4GJYA 1AYM3 1I5PA 1MQTB 1OLME 5CISA 1F31A 3HT2A 1I1EA 4DOUA 4FPHA 2R071 3GM8A 4A6OA 2Q4SA 3OY8B 5J37A 3Q8CA 4BQWA 2P6CA 2BTVC 2RMU3 5KXBA 5LA0A 1X50A 2MNGA 4D8MA 3MGUA 1ZBE3 4Q1PA 4Y1XA 4LXLA 4ATFA 5B4NA 5HCHA 1POV3 1U0AA 3OGSA 4RGKA 1JYVA 4H7MA 1XPWA 2FZ1A 2XPJA 2HWC3 4XAAA 2VC9A 4CP2A 1OBNA 5LZ6A 1AR73 1LNSA 4LO8A 1UU4A 3KV6A 5BY5A 3BGAA 4YGCA 1KXGA 2WNUC 1QF3A 3HT1A 3T0AA 1W2UA 3BTAA 4NROA 4JC1A 5JIAA 4D7YA 3MZHA 4WVZA 4L97A 2IVJA 4J6GA 4MXWB 5LA1A 2FDFA 2WS93 4LHKA 5IVBA 3WUDA 3NV4A 4QX1A 1H9PA 2I45A 4I02A 1JHNA 4UW5A 1ZA7A 1BHGA 2BNMA 4M4RA 5LASA 5EHDA 4R9DA 1VIWB 4RGGA 3PJQA 2CY6A 1QGLA 1N1TA 4R4XA 2QTWB 3O14A 2FMDA 3USUB 3NNJA 2ZOEB 4AFDA 4M3CA 1QXJA 3LDBA 2E33A 3W20A 3X29B 4XTPA 3RSJA 1RUH3 4QQLA 1FPN1 5C3QA 4RN5A 5FZ6A 1D4M2 2YGMA 3GHMA 2VUCA 2UYBA 5FJKA 5IAVA 4WVMA 1BEV1 2A70A 1OXCA 1TME2 2B39A 1V6KA 2EA7A 3OBTA 4HPKA 1X82A 4JKLA 5FMCA 3WF1A 4DZGA 1W99A 3FN9A 4AFMA 1W2AX 2V4VA 2D98A 1IS3A 5A32A 2YC4A 1H2LA 1SQ4A 4M3CF 2QQIA 2KXLA 3EHKA 4Q1RA 4J25A 4IEZA 3FLTA 4TXWA 5F9TA 1PIV2 3MICA 4CA9A 1HQNA 3GZUC 3QBQA 5IK8A 3HQUA 4LA2A 4NAMA 2BVVA 5LBFA 2NLRA 2A6WA 3BKZA 2HWF2 3F2ZA 1F4AA 2FCUA 1O7FA 4HSJA 1BLZA 4ISQA 4X6QB 1UX6A 2ADDA 1CONA 4OHYA 1LHOA 4COWA 1VRBA 1X7NA 2D43A 4LA3A 4Q4X3 2VJXA 4N53A 5FK8A 2XJRA 3GZAA 5JSPA 2P6HA 2VCBA 1MPXA 3DXTA 3OUJA 4LBNA 5C6CA 4N53C 4D7SA 4N43A 4RQPB 3ES1A 4ONUA 4H14A 3O1VA 3KT1A 2DBIA 2VW0A 4UXAA 3IMMA 2PXJA 2WFF2 4LR4A 4N43C 4AGRA 3AZZA 3RZMA 1XNTA 2OVUA 3BODA 5F6LB 1EUUA 1T2XA 3VZLA 1DGWA 1LECA 1PM4A 3VZOA 2JWPA 1VBA2 1HRV3 5FPXA 1SHWB 1F35A 1MEC1 1BKZA 2V5YA 3AYDA 4HLTA 4P9IA 4DUVA 4LT5A 1JS9A 4QGMA 2LALA 2O8OA 4QX8A 1EPZA 4M3CE 1V70A 5FZEA 1IHMA 3SMHA 3AJYA 3DN7A 5SV8A 1ZREA 3GDBA 1LTEA 3IWZA 5A7SA 5T3NA 3BPZA 2ZBJA 3HPNA 1W28A 3WHUA 2WDBA 2BWCA 4YZ3A 4I2OA 1JU3A 2J42A 2IXJA 2WYFA 1RUD2 1RL3A 3FZ3A 4QB6A 3P3PA 2D40A 3LD8A 2P3JA 3LPGA 3RYKA 3WOGA 4BIFA 5I0DA 1DGRA 2LRPA 1RMU2 3S30A 3PDQA 3VBFA 1FATA 1I5ZA 3H9AA 4GIQA 4QPWA 1FX5A 3I2GA 1K45A 2VG9A 3VV1A 4CDUB 3LWCA 3APBA 1IS4A 1CAVB 1YJKA 1CN1A 4QKFA 4XDQA 4D3WA 2EXIA 4Q0PA 1BXHA 3U1XA 1R091 3ZSMA 3VHRA 3VL9A 3RZKA 3KHBA 3MPBA 3CO2A 5J1XA 5DPNA 1Q5OA 1YQ6A 3C2UA 4QXCA 3OYWB 4AVCA 1VBD1 2JKBA 2PELA 1A78A 3GYDA 3OG2A 4LLFA 4YFWA 5C5UA 4IEWA 1FT9A 2UU8A 4CZSA 1LGCA 3I2KA 1W0OA 2JD4A 1Q8OA 1UWWA 4ZHNA 3BOWA 3HJRA 3MO4A 1CX4A 5HI0A 4BMBA 1IS5A 1V6IA 2J1UA 3U11A 3VBHB 2RS13 1BQPA 2EAAA 1UU5A 1WWYA 2E7AA 1WMXA 2Q0AA 3WEZA 4QGLA 1TNRA 3C3VA 4N7IA 4Z8BA 2IXIA 3I2JA 3TRSB 2DCJA 1G6NA 3IIAA 1G8WA 4IL7A 5I8YA 3WF4A 2ZGTA 3ZYRA 3ZMNA 3K77A 4YPJA 1EP0A 5FP8A 4FTSA 4RSUA 4IETA 2ZEXA 4WM8A 1VALA 2J22A 1YC61 4LKEA 5FAXA 1HQWA 1EPWA 3HR9A 4PCRA 4AWDA 1AR63 2BVBA 2RJLA 3U07A 1CR7A 5CAZA 4WM8C 5A7PA 5TSWA 4H2AA 4F7ZA 3RFRA 2R061 3FL7A 3LA7A 2WRAA 4AQSA 4CDXC 4Q4Y3 1UU6A 3N9OA 3LSEA 3CJIB 1OH4A 2JDNA 3A4UA 4CEYB 1COV2 4NUBA 4R9CA 4XFCA 3ACLA 5FWEA 1O3QA 1GZWA 1NCRB 1RUE1 1IQDC 2VZ3A 2WWSA 4CDUC 4S2GA 2C26A 3IM0A 3ZIWA 2OW4A 1KRIA 3WQBA 4PLMA 2DURA 2Q8CA 1S0DA 2KM2A 2Z69A 4L99A 4UT5A 5IK5A 2IVIB 2N7GA 3NV2A 1WGPA 4W6WA 4AI1A 2Q5TA 2HWB2 4OUEA 2PMWB 1HXS1 2XUEA 2KA3A 5A7WB 1U5XA 2BPA2 1W90A 2JE7A 1NE6A 1NLQA 1Y3TA 2VQUA 2X5IA 3KQ4B 5T52A 1HJFA 4AG4A 2QQJA 2W1QA 5FXWA 4IE4A 2J1TA 2X5IC 1AX2A 2XBO1 2B8MA 5ANQA 3WNXA 4K6BA 2JDZA 4KWKA 3K4AA 2JIGA 5LEJA 2JB4A 4RHV2 3TYJA 5JMCA 2CGOA 3MLJA 3SKJE 2D97A 4R52A 4MOAA 3DYPA 2IXKA 1JODA 3O0VA 4PI2A 1VR3A 3SC7X 1QJX2 2WA3A 4F83A 1NUKA 1GYKA 2D5FA 2YV8A 2WO2A 1DQ4A 1LENA 4PIXA 4FXKB 5DAVA 1MVQA 1XRUA 2CWSA 3N9MA 1YWKA 2ORZA 1D4VB 1KEXA 3ES4A 3FX3A 4KBBA 4UAPA 3IMNA 4KBZA 4XF0A 5CADA 5L7OA 3J7LA 2WWJA 3WLUA 1PO21 4HVQA 1OMIA 4R8HA 5L7OC 1AJKA 5L73A 2TNFA 2ZKLA 1GR3A 3AL5A 3AMHA 4OI2A 4Q4W3 3PUIA 3VB9A 1SFPA 2RS32 5FMDA 5EP9A 1PK6A 1BBT3 3S0MA 4DRVA 1SPPB 4W8JA 1PVC2 2ZEZA 3N35A 4XC9A 5SV5A 4A2UA 3J9SA 1EAH3 2HWE2 1QIQA 3OEBA 4N8MA 3POEA 3KZ4C 2WZ8A 3CDZB 3I4IA 4GMP1 4LE3A 4P9JA 4PQQA 4CDWB 5A70A 5J7MA 1CZVA 1VRH1 4EJRA 3B69A 4XJ9A 2HWD1 4HL0A 1SDDB 4NMIA 4MHUA 4OCTA 4JGYB 4M00A 3V0AB 4JKMA 3RPQA 1RUF1 3WW2A 1QJZA 3U4XA 4RR3A 4XF9A 2AACA 3BIEA 2QDRA 1VMJA 3A0NA 1XSQA 4R9BA 1KFXL 1V6OA 4JTOA 3M7AA 4K1YA 2RVAA 4NN0A 2PHRA 1JHJA 4HN0A 5AC91 2GP5A 1NLSA 1EY2A 3AMNA 4IXLA 4Y24A 5FCCA 2W94A 5FP4A 5LBCA 2W91A 1HX6A 1NQJA 4RFT0 5GM0A 1NA1B 4A7KA 4NR1A 1ZBA1 1F15A 4W65A 1AYM1 3QOPA 1ZRCA 1VBB3 1M4WA 1ALYA 3A7QA 3RQ0A 5F37A 4SLIA 5KHIA 3JBG3 4AEDB 4MADA 4R4ZA 1SLIA 1L7RA 3NJYA 1DZRA 4K9SA 2H0BA 5L9RA 2RMU1 4XFHA 1XBFA 3SCHA 1W6PB 2TUNA 2YYOA 2QQKA 1AL23 1WCUA 1ZBE1 4I0AA 1LHNA 1AYN2 3D5OA 4LO4B 1WW5A 4OZOA 1E5SA 1HRI3 1TMF2 2G1MA 1POV1 3ITQA 4OHVA 5FP7A 3M70A 3T2QA 2VNRA 5BPXA 2YBKA 2HWC1 4AEJA 4A4AA 2VCCA 4HT1T 2VVEA 2VULA 5FY7A 1AR71 5FZ3A 3M3QA 2GN3A 3BPSA 4Q4V2 4OHWA 3IZOA 5T5OA 5D8AB 1DIWA 2JG8B 4FAHA 3E6BA 1L3JA 5DAXA 4C91A 1HW5A 2WN2A 3CZJA 2VW2A 5IAXA 4NIHA 1JBCA 1LEDA 2ET1A 5F3GA 4XEZA 1CJPA 3I7DA 5FXXA 1J3RA 2JICA 1UD1A 1WW6A 2RR11 2VMHA 4ASKA 1DDLA 2DU1A 1HV1A 5FIXA 2VZVA 4LITA 3PHMA 4O9EA 2ZGSA 4YW1A 4EN6B 1G9AA 4JGYC 3HQXA 2IFWA 1ULOA 3EQEA 4SBVA 5JAXA 3ILNA 2O14A 4QDRA 5JWPA 5IK7A 3CNAA 1CESA 3HQRA 4QMAA 1BMV2 4XFBA 3T09A 1MS1A 2DFCA 1ODMA 4HFSA 2JG9A 2Y6HA 1HB3A 3DKQA 3M3IA 4D69A 5CFDA 2BW8A 3RI9A 3BN6A 1SBFA 1QJY2 1SBEA 3LCPA 3CQOA 2RDRA 4MXVA 1OSGA 4Q29A 1OH3A 2GP3A 4LBOA 4DQAA 2XLAA 4ET7A 4YARA 3OPZA 4LIUA 5LA9A 3ACGA 4WVWA 2C1FA 5FP3A 2WA4A 3ZN4A 3AZXA 3RYRA 4P02B 2BGPA 3K48A 4FFFA 5T55A 4O65A 4CUBA 2P4EA 3B02A 1BEV3 1N3OA 3MF9A 2VOKA 5FYBA 2A73B 4G4FA 4XFAA 5AVPA 4HVOA 2X8KA 4MSVA 4MGQA 4HK8A 5FXVA 3BU0A 3NNFA 1RXFA 3BB6A 1Q56A 4IV3A 3M3OA 3TN92 4GD4A 4HK9A 4O61A 3N7JA 1S0IA 4AHYA 2ZX2A 2DCTA 4CUGA 1VMFA 4LO5B 1UOBA 5D8AC 4Q4X1 2WO3A 2XH6A 2Z4FA 3LEKA 1X8EA 4XDOA 1VMHA 5FXZA 3O1TA 1J84A 1VBE2 1W3VA 3PMEA 1O4TA 3AM2A 4LK7A 5IT6A 5C9AA 1IZ3A 1KITA 1OLQA 3K46A 2VZPA 2AEYA 3PVOA 4XXAA 4KI5M 5F5QA 1RUI2 5FWJA 3K4ZA 3SEEA 5C9AC 1GBGA 4AVAA 1GP4A 3WNKA 4B4RA 3I2IA 1Q8PA 1V0AA 3VD9A 3E5XA 5I0SA 1HRV1 3IBMA 1YQ5A 3J8F3 4QHBA 5A7OA 3LOBA 2PLV2 1RUJ2 4JV4A 1JYWA 2F6BA 1XYNA 2RG4A 3JD73 4MVTA 3L2YA 3CBNA 1PGW2 2VR4A 1SDWA 4QXHA 5LK5A 2IZWA 2Y60A 1KFUL 3WP6A 3WUCA 2ZZJA 4CU6A 2RE9A 3MEPA 4E27A 2ERFA 3VZJA 2Y33A 2Q8OA 2HKXA 1MZ5A 5GJ6A 2H0VA 4BQ4A 4BM8A 4QPIB 3NMBA 3W5NA 1DF0A 3WW1A 4O7XA 4OULA 2RJ2A 5CFCB 1RVF2 1QOOA 1BK0A 5F5CA 2LS6A 1QQP2 1CAWB 5DUUA 2WZR3 4Q0QA 1YNAA 2ZAAA 1O5UA 4UWDA 1W8UA 3VD4A 2EIEA 4IGQA 2D6KA 3KVAA 3RWKX 1CZSA 5CU1A 3LQCA 1QH7A 5IVVA 1WCDJ 3R4UA 1VBC3 4XUTA 5A3WA 1XOYA 2QQVA 5A80A 3WG1A 4YW6A 5T5LA 3VDDA 2FDGA 1JYXA 1UMHA 4BIOA 2SBAA 3K2OA 2J1EA 3PTYA 4Y5SA 1GV9A 1E5RA 5IYYA 1C8M2 4FFIA 2R072 1RUG3 2EAKA 2VTFA 4A45A 2MPFA 2C9AA 4Y20B 4HKWA 1O3SA 1LOAA 5LW9A 1DQ2A 4FI9A 4DS0A 1S0CA 2BBAA 4IGPA 4RL7A 3SKVA 2DDUA 5GLWA 4CEWB 2RS11 3OTFA 1ND2B 1UOFA 5CG9A 2PYTA 3V56A 2IXCA 1ND3A 4MGIE 1QJU2 4XETA 3KCXA 5FZOB 5CBLA 1B35B 4K3UA 3J7MA 5JXIA 4C1XA 1DLLA 1FMD2 1PVXA 2AC1A 2XJSA 2BQPA 4CUAA 1MS5A 3ZFEB 5FYCA 2AREA 2ZZQA 4JGZA 3I3MA 1RTVA 2D6NA 5FYTA 4I0WB 3VBSB 1GP6A 4B4QA 4R9AA 3M3CA 1JYIA 3A21A 2QFEA 2G9GA 2VNOA 1AR61 2XHKA 2UWCA 1QJFA 4CRQA 2VMFA 4KWJA 5DG2A 4Q27A 4Y22B 5FZKA 3UK9A 1IPKA 5JI7A 3RZGA 4Q4Y1 4OQ9A 4BH9A 2K0GA 3KHCA 1NY72 4QPIC 4FAGA 3K51A 1LOCA 3ZYHA 2DWRA 4ZXEA 1XC6A 4QB2A 5JMOA 3AKQA 4IE5A 1OKQA 4A42A 3ZFFB 3KV9A 1W6QB 3ZSKA 1U12A 3OEAA 2Q1MA 1RUC2 4LBMA 3WNPA 3URFA 2VECA 1NCQB 4K8FA 3MF6A 3KCCA 3K3NA 3BI3A 3NO8A 5E89A 3A0KA 1FPN2 1H6YA 3WDVA 1E57A 5FREA 5H9SA 4XAEA 3LKJA 3THTA 1REEA 1WD3A 5FZ0A 2XJPA 4CDQB 3U10A 1SBDA 2QQLA 3ZPOA 4DO0A 5LBBA 5DMYA 3OBZA 4Z2AA 5FPZA 2VTXJ 2WT1A 4ZZ8A 3PUQA 3RJ2X 5JOYA 1QNWA 4UW3A 2BV4A 1UMIA 2B9VA 5L9BA 1HV0A 4C8DA 4D0QA 4AXOA 3BYWA 3I2FA 3VBOA 2R042 2XWJB 4QHZA 1L7LA 4URTA 1UYZA 5IK4A 1WCSA 1H1MA 3P1IA 3RZHA 1OUSA 2R32A 4GH4B 4JTNA 5IFPA 1WMFA 3OD0A 4GA9A 4XZUG 1WW4A 3WF2A 4AR2A 1OD5A 4QM9A 5BNNB 2DVFA 4K1ZA 4QGNA 1QDOA 4MV2A 3WQ7A 2CWMA 4CCNA 2A6YA 2FCVA 4X8PA 3KGZA 3S7IA 3BTYA 3IN9A 1RHI2 2DUQA 1ST8A 4XUPA 4AE2A 4G3YC 2CV6A 2FDJA 2W92A 4CU7A 4NJ4A 1BBT1 1WZXA 3ILFA 1WD4A 1YCIA 2R30A 3KWVA 3PUHA 5FO8B 1NG0A 3GGLA 2P2KA 1VB2A 4BWOA 2W08A 4B8EA 1TME3 2VXRA 2WR9A 5GZEA 4XABA 1GICA 1MEC2 5F39A 5A6QA 1DQ5A 3ZFFC 2PFWA 3A22A 2VQAA 3UGGA 1DGLA 3WF3A 5JUVA 1SFYA 2DV9A 5K8SA 3U0ZA 1NCQC 2XKPA 3POYA 4PT6A 5GLUA 2MEV2 4Z07A 1NT0A 4LNVA 4AFCA 1R1ZA 2WZEA 4HONA 5A1LA 2JD9A 1F8VA 2ZACA 2R1DA 2W1SA 3TNQA 3B94A 1GQGA 2E7TA 3LEMA 5FZFA 3FJSA 3FHAA 4EN8B 5JR7B 2CDPA 3IDAA 4AQ6A 4NIGA 4YM1A 2OT7A 4K20A 2VOTA 3GBFA 3I59A 5F5AA 3BTXA 2RS53 3WDTA 3PURA 4GWJA 2GH8A 4HSLA 2BOIA 1QKQA 3BCWA 4JDMA 3PTRB 3TAYA 2GC3A 3JBG1 2A5ZA 3GHNA 4YGBA 2ET7A 2HLEA 5EJ3A 2JENA 4CXWA 2B7YA 5F6KA 5AC93 5J48A 4LQRA 4QPYA 2WFF3 1AL21 3WW4A 1UKRA 1N3PA 5C8CC 2RM21 1VBA3 3PIJA 3WX5A 1OUXA 1W9FA 3LEIA 4NO4A 4UFJA 4I09A 1OD3A 2JKXA 3VBUA 1WUVA 4CCDA 4XJWA 3ZKYA 4DNYA 1RINA 5ABJB 1AL0G 1Z7S3 3D6EA 5ACA3 5K7PA 3VBUC 5DZFA 2P5BA 1UXXX 3FHQA 1GWLA 5J09A 3ZXFA 2ZAHA 2ZMNA 3WG3A 3ZFGA 2BGCA 1QXPA 1W8ZA 5HCBA 2VCMA 1RUD3 3ZFGC 2BU9A 3NV3A 4ARYA 4D6QA 4A7YA 1PO13 1RMU3 3OUIA 2HEYF 5L19A 1BYHA 5FY0A 1PGL1 2WNUA 4DIQA 1J3PA 3LA3A 2E31A 4QM8A 1CAXA 4HPKB 2EIBA 4BQYA 5J96B 3WZ1A 3AJZA 3OOXA 5CNAA 2I07B 3ZXEA 2PHXA 4PDWB 3KGLA 4NHKA 4QPGB 2ZGRA 2RJKA 3H1MA 1UN1A 4EYUA 4QX7A 5A32B 2I74A 4PF5A 4TTGA 2NMNA 4ASLA 3J4UH 2RR13 4COVA 2EF6A 5DG1A 5A3MA 3AC0A 2A3WA 1S4CA 1W6NA 2VAUA 4D94A 1SLBA 1JOJA 1HLCA 1IPJA 4F8AA 3LOIA 1W05A 3GBWA 3NWKA 3N9QA 4EN0A 2QZ3A 3AMPA 4QHOA 4JAAA 4YVWA 4CCMA 5A3NA 2WINB 4E8CA 1FNYA 1APNA 2XL7A 3OBRA 1BVVA 4LBLA 3WG4A 2OZJA 5G05L 1H8TA 4YVWC 2VZRA 1NZCA 5F8PA 4V2WA 1LEMA 1WBFA 2A6ZA 1GLHA 1R1A2 1H8TC 4XOGA 1WMDA 4S2FA 4BQ3A 2FHRA 5A6ZA 1US3A 1UZYA 4GJZA 3T0DA 2L9LA 1MQTA 4J1WA 3KV5A 1E5HA 2VZSA 2D6PA 2FQPA 4MGKE 4A7ZA 4IEPA 3LEGA 4JZRA 3ZOIA 4CP0A 1MQTC 5E6HA 1JZ6A 1H2KA 1O6UA 2B46X 2BUKA 4KNCA 2W0XA 4JCKA 3USSA 1HB2A 4K40A 1ULDA 4V2VA 1Y9MA 1D2SA 2Y6JA 3ACFA 5JLVA 2P17A 1DLCA 1XE7A 2E26A 2FDHA 2B42B 2WN3A 4FP3A 4H55A 3GJBA 5FPBA 3ON7A 2XG3A 4OQ8A 1PO22 3S6PA 2W95A 2Y0IA 2VNGA 2AYHA 4BQ1A 2VD7A 2OUHA 4NWVA 4KU8A 5FYUA 1PM7A 3T30A 2C9KA 3L9JT 4FT8A 1UYXA 3J8F1 3VBFB 1WW7A 2E6VA 4P14A 1IG0A 2SLIA 4MXWA 4PDWC 1JZ8A 2EICA 4QPGC 2WWUA 3U14A 2E9QA 4BPZA 3JD71 2HWB3 3AKSA 4IDZA 5IJRA 5JI9A 5J98B 5IFTA 5IVYA 3VKNA 3POGA 2A7AA 3NJVA 3LSDA 3I49A 4UI9L 3Q8EA 5A7QA 2NN8A 3FUOA 2Y6LA 1XYOA 2BDRA 1VRH2 2HWD2 3AL6A 3B5LB 3USUA 3BVCA 4FTEA 2VCAA 2VBBA 1XJAA 4FOQA 4RHV3 2B5HA 2DF7A 3AZYA 5AFEA 4YZ5A 2VNVA 2WZR1 3CJXA 1SCSA 4DY5A 4UF0B 5KR7A 2W68A 4FPOB 1K5JA 1QJX3 2BERA 4XQ4A 5KC5A 4PI0A 3M2MA 3MFAA 4AAPA 5LRRA 5IVJA 3RZZA 1FV2A 2EIGA 3R6SA 1DGWX 5JOZA 1VBC1 3BU7A 5KC6A 5DABA 4Q0SA 4NHXA 3I2OA 2VMIA 1X9PA 1ZBA2 2ILMA 4FBFA 2WT2A 3POIA 1VAMA 3KLSA 1VAKA 4FPKA 3DXUA 5DDJ1 3UT0A 2WFPA 2VOXA 1RUG1 4QU2A 3T1MA 4ZKTB 1CWPA 3AB0A 1N3QA 5H9RA 3WCSA 1IKPA 5T50A 2RMU2 4QDSA 4DPNA 2PTMA 4UFMA 4X8NA 2P3YA 3WP4A 3D4KA 5HXMA 1F5JA 1JOBA 3HOBA 1PVC3 4OMDA 4FPGA 2ZXQA 2VOVA 2ZGMA 4JRAA 5LWBA 3T4VA 1SFNA 4XE9A 1QU0A 4B3NA 1WBLA 3CZUA 1WA6X 4KMQA 4QKDA 4YRDA 4C0HA 1AR93 3PVEA 4QXBA 1GZWB 1JI6A 3AX4A 3AP4A 5M0TA 3KQRA 3DF0A 1OPMA 4J1XA 4UBGA 4YW5A 4RQPA 1FOD2 1ZRIA 4META 5FY1A 4RQPC 4FFGA 4GQ7A 3V65A 2ORXA 4FQ4A 1OC1A 2WS92 3K75B 2V72A 5FZ7A 5FYMA 3DPRB 4FVVA 5JOWA 5FTTC 2K9ZA 4XJUA 1G9BA 5FV3A 2BP6A 5C3RA 2WBKA 4NRPA 1JZ2A 4D7TA 4FPCA 5I0UA 1A34A 2VBPA 1BCXA 1A8DA 4EWEA 1UY3A 1Y9QA 4GAZA 4NIAA 3WV6A 4GKYA 4CDXA 2YC0A 1SLCA 2X10A 1PGSA 2ID4A 1K5MB 1QWRA 2OQ7A 1RUH2 3HBZA 2MHFA 1W9SA 3NAPB 1C8NA 2QVSB 3PLQA 3ZSJA 1DQ1A 2NPIA 3JB8A 3Q9OA 3MW2A 2ZX0A 4CDUA 3D8CA 4FTBA 4CU8A 1TMF3 3RYPA 5FUIA 1LB2A 1AHSA 1L7QA 2YDEA 2D6OX 3BALA 4IEQA 3WG2A 4LKFA 5E1RA 1ASJ2 2WQZC 2GZWA 3C8XA 3SXWA 4Q4V3 2B4KA 3WNNA 3IKWA 1NE4A 2QDNA 5IW0A 1TNFA 3VHPA 3OYWA 3FUQA 3LGRA 4PJYA 1KJLA 1TE1B 1J1TA 1XE0A 1H4GA 2ZGQA 3POWA 3IAQA 5EQUA 1OOPB 4K8RB 4NVPA 2YHJA 4DXSA 3E97A 2GC2A 4IEOA 1ZX5A 1CPMA 5F2SA 3C7FA 4JHZA 5F3EA 1DQ6A 3ZN6B 2W52A 2XUMA 4Q4X2 1DHKB 2ZGPA 3VBHA 5A6YA 1KDKA 1W2TA 1WLTA 4AW7A 2VVDA 1DBNA 3HBKA 4UW4A 3VBHC 3ZDVA 2Y0OA 1K12A 2ZCWA 4UOJA 4BZ4A 3H3UA 1WLDA 1YFWA 3FFQA 4XBQA 2YXSA 4Y1YA 5GZFA 1D4M1 2VQ0A 4XJ8A 2ARCA 1TME1 4IEUA 3HN1A 3HN3A 1YRZA 2Q1FA 1PMHX 4GWIA 1GZ9A 5FUPA 1AR82 3I8TA 5JDBA 4CEYA 1MZ6A 2D93A 2ZHMA 4ZS3A 1OVSA 1UW8A 3WCRA 4Y1UA 3CJIC 1NCRA 2VMEA 4CEYC 3KVBA 1UIJA 1AVBA 4XIOA 3ZYJB 4CCJA 1RUOA 2PA7A 1X33A 1NCRC 3JXSA 2CAUA 3PVBB 4FOYA 4CSWA 3MV01 3UKVA 2HWF1 3KSCA 3O0WA 1PMJX 3H0OA 1UAIA 2AEZA 4MZUA 4DXRA 5JR2A 5A7WA 2RS51 2P34A 5LATA 5JXGA 4XUNA 5FKCA 5DAQA 4OMCA 1R083 3SH5A 4OLLA 1WKYA 3IDBB 5BYNA 3UGFA 4FPFA 3UKNA 3CMGA 2DVDA 4AHWA 4P00B 1C57A 1W6OB 2ZS6B 1RUI3 4BLIA 5GKAC 5L9VA 5FJHA 4BB3A 1V9U3 2BNOA 1Y4WA 1ULGA 1W39A 2WFF1 3EMRA 3IDCB 4XF1A 3TNPB 4ISRA 1XB9A 4GB32 2Z2SB 1KD7A 3C7GA 3V0BB 1EYBA 1VBA1 2JECA 3M1HA 3O0XA 1TEIA 1JW6A 2OYZA 2LW8A 4QB1A 2PLV3 2O1QA 4L92A 1JZ5A 1RUJ3 3KF3A 1YHFA 1Z7S1 2WAAA 5ACA1 3LDRA 2VM9A 2XVGA 4A6SA 2ZX3A 3AYCA 1W8FA 2RS12 2W46A 3HNMA 3B7MA 2WSUA 2HJIA 4MH0E 1BZWA 1O4ZA 5HPOA 5GZDA 5JPMB 2FZ2A 4GWNA 4KGGA 1WLCA 4XDPA 2RM23 2D6MA 1RUD1 3ZR6A 4Z92B 1DZQA 3NW4A 4YLZA 2UYAA 2GC1A 2JG9B 3LF7A 2E7QA 3P3NA 1PO11 1RMU1 4LUMA 1UIKA 4YSFA 5CFDB 1AZDA 1RVF3 1TQ5A 3JU9A 4Q8LA 1QQP3 1EV12 1U5ZA 1SPPA 1CZTA 4L9BA 1JZ4A 1ZRRA 4WV8A 3TEXA 2K2SA 1O8PA 3QH7A 2HEWF 2ES3A 3EBRA 3K4DA 3WDUA 2R6QA 5FLIA 3N7LA 2K46A 1KGYA 3SQOA 1QXRA 3I3DA 1XXNA 3MLLA 5JPNB 3L2HA 2A3YA 1F4HA 1Q3EA 2QKDA 4XQDA 4CDWC 3O1PA 3VUOA 5FOBB 4JGYA 3V0AA 1B09A 3O1RA 3KCYA 2JB8A 5FMOL 4YW2A 2D44A 4P08A 4UYBA 5K0UB 3EO6A 3FLPA 5JVVA 4RD7A 5F3IA 2I2SA 1UCXA 2R16A 3RWNA 5A1FA 1ZZBA 4JQTA 1LJ7A 1URXA 3TEYA 2W3JA 1G7YA 4AGGA 5A1AA 3MIDA 3LFMA 3WDXA 4QKNA 1C5IA 1QEXA 2WC2A 5C8WA 3CLPA 4I3PA 1QJU3 4IQPA 4BJ0A 1ZRFA 3VHOA 2CNAA 4YW3A 5F32A 1NA1C 4PBPA 1JMUB 1UMZA 1FMD3 4M0NA 3WINE 4AEDA 4A3ZA 5I93A 5FYYA 4EN9B 2BEOA 3N9NA 3FWEA 2PHUA 2DVGA 4AHXA 4AEDC 1W6PA 5FMOS 4IESA 3RVHA 2XKOA 2XLGA 4YW4A 3ECQA 1QY4A 3RDIA 4XCAA 4ZU5A 1CAUB 1UXZA 2YFUA 5B2GB 1LULA 2OQ6A 3DEMA 3OPWA 4RS5B 1BVP1 2Q1ZB 3S5QA 1COV1 1V00A 2VTXA 4C1WA 3GF6A 3D82A 1RYYA 4QX3A 5D8AA 5K9YA 5I8SA 1LHUA 1S2BA 4Q4W2 1HDKA 4S2HA 2JG8C 4NWWA 3T0BA 1NYWA 3ZXLA 4W6YA 5KHGA 1H9WA 4Q2FA 4Z2WA 3MUZ1 2HWB1 3WR0A 1LHVA
chains in the Genus database with same CATH topology
3QLQA 1WCKA 2GMEA 1MZEA 1EAH2 3B9IA 4AI8A 5C4WB 4FOWA 1N1SA 3AFGA 3VDDB 5BUVA 1AJOA 4RHV1 4BCUA 4NPRA 2XB6C 2YZ4A 3WY6A 1J59A 3IT8A 2R043 1QJX1 5GZGA 3MIEA 3MDPA 2PAEA 5LEKA 4YM0A 2YGLA 1GQHA 2PHLA 3B00A 1S0JA 3VKMA 1RJ7A 4YG3A 1ND3B 1ZRDA 2OA2A 1VBB2 1Q8VA 5A33A 5FBZA 1SCRA 4JGZB 3KT7A 4ASMB 4GWMA 3IPVA 1I3HA 1RJ8A 1RIRA 1ULEA 1ZYBA 4RS5C 1IS6A 4AK3A 1FNZA 1HRI2 4OUSA 4P9GA 1PVC1 1YIPA 3NJZA 1SMVA 5T5PA 1H8VA 3UJOA 3QCWA 5LK7B 2GALA 5DDJ3 1ENRA 4HBNA 1AR91 2DTWA 3HIFA 3AKTA 1UPIA 2GSYA 2MEV3 3MFCA 2BFUL 3SH4A 3ZDSA 1NQDA 4ITCA 5FRAA 3VZMA 4Q26A 1C3HA 4PIYA 4XBNA 1XQNA 3M8LA 4KL1A 4AI0A 2OIIA 4Q8KA 1PGL2 2X53S 3KMHA 4KU7A 1OI6A 5FO9B 4L11A 4XFIA 1WMEA 4XYXA 1CGPA 4XMIA 1LCLA 3FE5A 2XJQA 2PHTA 4AEMA 5BNPB 3WP3A 3UV9A 4YM3A 2VH9A 4QPIA 4OI0A 2BFUS 3AP7A 3H7JA 2WNVB 3MIHA 3VBOB 3VKFC 3W58A 3WW3A 3JQWA 1KJRA 1MACA 3O7OA 1YUDA 3SH3A 1CAWA 1TMF1 4JVAA 5CFCC 3VBRB 2RHPA 3WT3A 3ZXAC 5BNOB 3ZYPA 1F2NA 2CTVA 4X6RB 3NVCA 4IV1B 2VPVA 1AXKA 4ES9A 1DYKA 4COYA 4E4ZA 4Q4V1 3PJYA 4H7LA 4XQWA 5T54A 2ZGNA 2VOWA 2NYYA 1C1FA 5FQ0A 1CVNA 1T6GC 2GU9A 1N1VA 3NV1A 1BEV2 1UZZA 4WM7B 1YLLA 3KB5A 5HCFA 3H50A 5C33A 2BWAA 2ZMKA 4Y1ZA 3UL2A 1RITA 3N7MA 1ENSA 2PHDA 4Y20A 1GANA 3VN4A 4EROA 4HETA 5EXOA 3I2DA 1QMJA 4PQ9A 1ND2A 5H9QA 1ND2C 1B35A 1BMV1 3AK0A 1CQ9A 4LE4A 1B35C 4C90A 4YZ2A 4DRRA 3EJKA 3J26N 1QJY1 1VB4A 3ZFEC 1JYCA 4YVSB 3VBSC 2ZHKA 3H1WA 5HBAA 1H30A 4LBQB 3JD72 3I59B 2H6BA 2Y26A 4Y22A 3E6CC 5FFOC 1Q8SA 1VP6A 1Q8QA 3AP6A 1H2NA 1UL9A 1ENXA 2BNNA 4FCAA 1D4M3 4P9YA 3ZFFA 3DV8A 3H8UA 1NCQA 3VBRC 1U5IA 2IXHA 2YPJA 4OI4A 2XGXA 2R1BA 2DFBA 2D3PA 1R081 4XXPA 1PIV3 4LUKA 1OFNA 1VBE1 5EYXA 5JSRA 1DQ0A 1VBC2 1JH5A 4WM7C 4I0BA 4CDQC 2OUJA 1RUI1 3MI8A 3ASIA 1AXYA 1V9U1 2IWGB 1XU2A 2HWF3 3ZXGA 4EV0A 1X8MA 1GSLA 4DY3A 1R092 2LUWA 1OHFA 1H0BA 2PLV1 5D1IA 1RUJ1 4IEYA 2P37A 3JUUA 1PGW1 4G9SB 2PAMA 4GH4A 5J36A 1WLWA 1VBD2 5C8CA 1DG6A 2E53A 4GH4C 4FP2A 5BNNA 3ALQA 3I54A 5JOXA 1PZ9A 4QXKA 2C0ZA 4YVSC 5BNNC 2DCKA 1W6NB 4Y1VA 2HEVF 5E16A 3ZSLA 2XLFA 2WIIB 1RVF1 3ZMOA 4DFSA 1OA4A 2G4IA 1QQP1 1W6MA 2BBVA 1D2QA 4TYSA 4GMP0 4XPVA 3VZNA 1PMIA 2A75A 2HYKA 2UY8A 4M3CB 5JZGC 2UWBA 1AX1A 3RMYA 1D0GA 4M0HA 1Z0HA 4Q0UA 5EYYA 4WVMB 3MW4A 2Z42A 4GALA 1AF9A 3N3HA 4XW3A 5BXXA 1C8M1 2R062 5I91A 4E9KA 2GNDA 3AMMA 3ZN5A 2AR6A 2NZ9A 5DUWA 5HCAA 2DUOA 4YFZA 1RUE2 2JXAA 4HMZA 1OPOA 4PLNA 2GH2A 1KS4A 1ZM1A 1QJU1 1NOVA 1G9FA 4QQPA 4I01A 3TWIA 1FMD1 1CIWA 2E63A 2ZX4A 3H1YA 4NOTA 1HXS2 3R4DB 2QNKA 5FLHA 4CYDA 1POV0 1XE8A 1FOD3 2WNEA 1ZZ6A 1C28A 5FOJB 4QQHA 2EALA 4N53B 3WD5A 1O91A 2XBO2 4N43B 3MPPG 5CB7A 3ZXDA 1ULFA 1VAVA 1NY71 1H4HA 5ABJA 5GLVA 1V6JA 2VMGA 3AXEA 3OY8A 3HAGA 5ABJC 1N1YA 2FBEA 2Z5WA 4XJZA 3D0JA 1RUC1 2AGSA 5A3LA 3WVJA 3THPA 1FYUA 4XTMA 1FXZA 4COZA 1GNHA 4B4PA 3CL1A 1COV3 1IGOA 3VKOA 4L2NA 1V6LA 2FMYA 3W59A 1H2MA 4PDWA 4XF4A 1RB8G 4QPGA 3JB4C 2GDFA 1SLTA 1ASJ3 1WA4A 4YNIA 4AF9A 4CP1A 2Q30A 2DVAA 4AVVA 2ZGUA 4BYYA 1YFYA 2R041 4W6XA 3DUIA 4BE3A 3M3EA 2B9UA 3AMQA 4BHPA 2D3SA 2QCSB 3RG0A 4B29A 4WBBA 1LHWA 4BA6A 2RS52 3NKTA 1RUF2 4YM2A 3WQ1A 4H3WA 3DGTA 4XILA 3SLIA 5KHJA 3OGJA 2WQ4A 1RHI1 1LODA 1QOTA 2GNBA 2DVBA 4WVVA 5AC92 2NMOA 4Y5Z0 2OZ6A 3LB9A 4P9XA 5J3UA 1UKGA 2A6XA 2NQYA 4AQTA 2F4PA 1AYM2 1ZZ8A 4OI1A 5ACA2 1Z7S2 2EVXA 1LOEA 1MS8A 2DYCA 4XIKA 4QX5A 1X36A 1AR83 3V64A 5CG8A 2RS33 1BK1A 2MEV1 2AH2A 4WM8B 2WLPA 4K7JA 1ZBE2 4CDXB 4AI3A 2DCYA 1OQEA 1XNDA 2HWE3 2HWC2 3KT4A 2GC0A 1PO12 4OHZA 4K21A 3FMGA 1PNFA 2P3KA 1AR72 1O4YA 3SITA 1LGBA 3VBFC 5KWRA 4Z82A 4XFFA 1V6MA 1YI9A 4NHLA 4GULA 2GNMA 3OJBA 1S55A 2GMPA 1YO8A 2AENA 3WXPA 1M06G 1A3KA 5I0TA 2RR12 3KM5A 2AZ5A 4AVSA 2PQQA 5JCTA 3EXUA 4BOWA 4FPEA 1FI2A 4U2AA 2X5IB 1DGRN 4KH9A 5I8TA 2B45X 4GB33 4Z1VA 4N9HA 4LULA 4RA0A 4XHXA 4EWDA 4XHBA 2WL1A 1RC6A 1I6XA 1Y7BA 2ZGLA 3TB0A 5BNQA 3JQXA 3LA2A 3POSA 2Z79A 4JRLA 3IDEA 3CU7A 1AYN3 2IC1A 1CAVA 1LR5A 5EFUA 3N4MA 1YIFA 2IXLA 2VUJA 5L7OB 4LHNA 5T5JA 1H1IA 1S0GA 4ES8A 5DUVA 1YXWA 2VVFA 1EV13 1AXZA 5DUXA 5KHKA 2YUEA 3WHTA 2WT0A 4HKLA 2QE3A 3RS6A 3VKLA 1BJQA 3VLBB 1LOGA 3W9AA 2GN7A 1Q43A 2CL2A 4JQRA 1PK6B 3AYAA 3LZZA 3G7DA 1GNZA 2EXJA 1XNBA 1A8MA 1GKBA 3FLRA 4U36A 3CF6E 4FOVA 1LKNA 4XFGA 1A6CA 4IEXA 2NP0A 5GALA 2EXKA 1ENQA 2GMMA 3LAGA 1ONAA 3DPRA 3VL8A 4LO6B 3FC0A 3DPRC 1F5FA 2QJVA 1SLAA 4RR3B 3E5UA 3ILRA 1R1A1 4ATEA 1HRV2 1QJY3 3H3ZA 3B93A 3R0RA 4TZDA 3FHIB 2A6VA 4YGEA 1K5MA 3AKRA 4M01A 2QZ2A 3NAPA 2VY0A 5F1RA 3CJIA 1K5MC 1MS3A 2D3RA 3S7EA 3NAPC 3O12A 3OCPA 5H9PA 1PIV1 2VU9A 2A71A 3NSTA 3ZYIB 4HN1A 2ZJCA 4AEKA 3AZWA 3INAA 1REDA 4GXLA 4TSVA 1UPSA 2ZKNA 3TN93 1OLRA 4YZ4A 3ZPYA 1G9CA 1O3RA 2PHFA 1IOAA 3OGGA 3MLKA 1U5YA 4Y26A 1VBE3 3PNAA 1FAYA 1C5HA 1OA3A 2DCZA 1OOPA 4GKXA 1S0FA 3AKPA 4JDOA 1JN2P 4MX3A 1PK6C 3ETQA 1OOPC 3ZN6A 2O8QA 1CPNA 1AR92 3GBGA 3JZVA 5FDBA 2ZHLA 5I0RA 1N47A 3MYXA 1Z78A 2VW1A 1LOFA 2WKKA 5KXCA 1MS4A 4QQOA 4E4SA 1MZFA 4YG0A 5KHHA 1LOFC 1VJ2A 4RR3C 5JIUA 4Y4YA 3MIFA 4ZU7A 3B9CA 3BIWE 5CA6A 3FBMA 5BV6A 4OFGA 1LGNA 1FV3A 3TOJA 4FPJA 1MS0A 4N90A 5EWSA 4LBKA 1AR62 5EV7A 4ZU4A 2PAKA 3G6JB 4Q4Y2 4QQ2A 1KDMA 1UF2C 3FBYA 5IUQA 1C4RA 3E5QA 3GZTB 4CDWA 1SACA 4LLOA 3ZO0B 4TLFA 2EXHA 3KS7A 1PHMA 4AHZA 2CGPA 5HXVA 3ME2A 2BYVE 4YYOA 1C8M3 2R073 1S0BA 4IV3B 4DB5A 4V1PA 2GAUA 4AQ2A 1W6OA 1FOD1 5CIRA 4CEWA 3D0SA 3V0BA 4AVTA 3KD4A 2UURA 2WS91 1G9DA 1NA1A 3OD4A 4CEWC 5C9AB 1LRHA 2JJ6A 5KXEA 2XL9A 3B01A 4MLOA 4UBHA 3DL3A 1S2KA 4LBJA 2YMZA 4FPYA 1YI7A 2YROA 4NHMA 1O3TA 3WDYA 1RUH1 4XF3A 2V09A 2G9FA 3MW3A 3RMXA 3SISA 2JG9C 1OQ1A 1MS9A 1I9RA 5CFDC 4AGVA 4COUA 1J58A 2JG8A 3AXDA 3AP9A 5EZWA 1RUC3 1C1LA 2XJUA 1ASJ1 4FO9A 4AI2A 4QT6A 3AZVA 1BBT2 1FPN3 4LHLA 4C0BA 2ENRA 2ZGOA 2GNTA 3QACA 5A33B 4E2SA 1ZA4A 3SHRA 1ZVFA 2V73A 1KQRA 2NM1A 3IPVB 5K0UA 5E8AA 2LM3A 2CAVA 2R0FA 5K0UC 1RUNA 2JE9A 4IV3C 1NLRA 2E51A 2WJSA 4L8QA 3H7YA 1R082 2XJVA 3VHNA 4E2GA 5FO7B 4OZXA 4LTAA 2QUOA 2CYFA 4AYUA 2TBVA 4MYEA 4HKOA 5AFBA 2WLQA 1V9U2 3HD8B 1XYPA 2PHWA 4KG0A 2VUAA 1W0PA 1AUYA 4F3JA 1HQLA 1DU3D 4RGAA 4INDA 3GNEA 3TBDA 2D6LX 3BOPA 3JBG2 1PNGA 3PMSA 1CAUA 2ZTNA 4LO7A 1RHI3 1AR81 4RS5A 1GFF2 2RS31 1JUHA 3HWJA 4KWLA 1AL22 1O5LA 1YYNA 1JUIA 1IQAA 2AUYA 2RM22 4EN7B 5FLJA 1QNYA 1QOSA 1MEC3 2HWE1 3PVNA 1ULCA 4FXGB 1NXMA 2IFRA 1REFA 4KGQA 5DXDA 1MVEA 4P5HA 5DZGA 2A3XA 2JX9A 3RNSA 2XWBB 1Y43B 3SCFA 1XNKA 1HKDA 3NL1A 1DZTA 5C4WA 3ZIXA 5FQ0B 2C5DA 3AP5A 4YG6A 2DU0A 5C4WC 1NXD1 2D7FA 1AX0A 4HZFA 4ORFA 5CVRA 1RGSA 2OPKA 4XZPA 4GB31 4DMIA 2O0OA 3VDDC 3AFKA 3ZXJA 3AYEA 4CTEA 1R093 2CGNA 3ELNA 4Q0VA 2ZPXA 4XJAA 3UKTA 3N7KA 2YY1A 1VBD3 2D5HA 2ATFA 1D0HA 4HVRA 5CFCA 4AFBA 4KG8A 1AYN1 2H6CA 2UY9A 3T1LA 5DZEA 1ND3C 1DYPA 1YFXA 2UWAA 4WZCA 1G86A 3UJQA 1LU1A 2R49A 5JSOA 2ZHNA 1ZZ9A 1OQDA 3MIGA 3WP5A 4JGZC 2JEMA 1JXNA 1EV11 1MR5A 1ZZ7A 2ARXA 5LRSA 1SEFA 2VGDA 3HMYA 1PZ7A 2QQPA 1DFQA 4WZFA 3WQ0A 2XVLA 3FFZA 3ZYGA 4P9LA 3QH6A 1HIXA 4E2QA 2DTYA 4FQZA 1YFUA 2Y38A 4QD2A 4DXZA 2XVKA 1SLLA 3ZX7A 4IEVA 1S0EA 3DKWA 1JTZX 3GALA 3JCIA 4XMAA 2R063 3OF1A 5AVAA 4LBQD 1ZZCA 4OUMA 4YZ1A 2DUPA 3ENRA 2LTNA 1CJDA 1RUE3 2PN5A 3ROUA 3ZFEA 5KBFA 3ZXKA 3VBSA 3J8F2 3ZVXA 1LOBA 1QDCA 5BNPA 1LESA 4MGYE 3CEWA 1HXS3 5BNPC 3RRDA 2WNVA 5GZCA 1OFSA 2ZA9A 4FSJA 4P9WA 2WNVC 3SCGA 2ZABA 5GLZA 4XBLA 3VBOC 1R1A3 4N9IA 2XBO3 5J09A 3B3QE 4N7UA 3VBRA 5BNOA 1W6QA 3SNMA 4IV1A 5C8CB 2ARBA 4HANA 4KQ7A 4S2DA 1J1LA 5BNOC 3M4FA 3TN91 4IV1C 4LEJA 3RI8A 1QH6A 2WZR2 4MGZE 4Q4W1 3RJRA 3VBUB 4E4DX 4UW6A 4WM7A 4CDQA 1KS5A 2ZGKA 4PIZA 4OVEA 1W6MB 1YJLA 2P3IA 1F9KA 4O9GA 4PLOA 3ZFGB 1PO23 1J3QA 1XNCA 1EAH1 2WSVA 5DDJ2 1RUG2 1S1AA 3ST7A 2ZMLA 1GZCA 4OHXA 1CD3G 2WNUB 2XJTA 4I30A 4B7EA 1ZNPA 1CAXB 1IKQA 4FPLA 2X29A 4EWAA 2R0HA 2ETEA 3ZSEA 3MIBA 3E6DA 3R4SA 3T2TA 4YVSA 3VGIA 1VLNA 4GMP3 5E88A 1QHDA 4PBOA 1XU1A 1VRH3 3ATGA 1PZ8A 1OA2A 4LBQA 4ZXKA 2HWD3 5L36A 4TWTA 2W39A 3NKGA 1LU2A 4AFAA 1RUF3 2WZPP 2TEPA 2ZX1A 4IERA 4YGDA 1VBB1 4AVBA 5JZGA 4BLJA 5GLTA 4JDNA 1V6NA 3VZKA 4B7KA 3N36A 4YVWB 3WDWA 3R05A 4I3GA 3O5SA 4DINB 1H8TB 3QD6A 1H1AA 5KXDA 1HRI1 4MUVA 1ZBA3 1AYM3 1MQTB 1F31A 3HT2A 1I1EA 4FPHA 2R071 2Q4SA 3OY8B 5J37A 2RMU3 2BTVC 5KXBA 1X50A 2MNGA 3MGUA 1ZBE3 4Q1PA 4Y1XA 4ATFA 1POV3 1U0AA 4H7MA 2FZ1A 2HWC3 4CP2A 1AR73 4LO8A 1UU4A 5BY5A 4YGCA 1KXGA 2WNUC 1QF3A 3HT1A 1W2UA 3BTAA 4D7YA 4JC1A 5JIAA 3MZHA 4WVZA 4L97A 4J6GA 4MXWB 2WS93 4LHKA 3WUDA 3NV4A 1H9PA 2I45A 4I02A 1JHNA 4UW5A 2BNMA 4R9DA 1VIWB 4RGGA 3PJQA 2CY6A 1QGLA 1N1TA 4R4XA 3O14A 2FMDA 3USUB 4AFDA 2ZOEB 4M3CA 1QXJA 3X29B 4XTPA 3RSJA 1RUH3 4QQLA 1FPN1 1D4M2 2YGMA 3GHMA 2UYBA 4WVMA 1BEV1 2A70A 1TME2 2B39A 1V6KA 2EA7A 3OBTA 4HPKA 1X82A 4DZGA 4AFMA 2D98A 1IS3A 5A32A 1H2LA 1SQ4A 4M3CF 2KXLA 3EHKA 4Q1RA 4IEZA 3FLTA 5F9TA 1PIV2 3MICA 1HQNA 3GZUC 3QBQA 5IK8A 4LA2A 2BVVA 2NLRA 2A6WA 2HWF2 4HSJA 1O7FA 4X6QB 4ISQA 1UX6A 1CONA 4OHYA 1LHOA 4COWA 1X7NA 2D43A 4LA3A 4Q4X3 4N53A 5JSPA 2XJRA 3GZAA 4LBNA 5C6CA 4N53C 4D7SA 4N43A 4RQPB 3ES1A 4ONUA 4H14A 3KT1A 2VW0A 4UXAA 2WFF2 4LR4A 4N43C 3AZZA 2OVUA 5F6LB 3BODA 3VZLA 1DGWA 1LECA 3VZOA 1VBA2 1HRV3 5FPXA 2V5YA 3AYDA 1MEC1 1BKZA 4HLTA 4P9IA 4LT5A 4QGMA 2LALA 2O8OA 3SMHA 1EPZA 4M3CE 1V70A 1IHMA 1ZREA 3AJYA 3DN7A 5SV8A 1LTEA 3IWZA 5T3NA 3BPZA 2ZBJA 3WHUA 2BWCA 4YZ3A 4I2OA 2IXJA 1RUD2 1RL3A 3FZ3A 3WOGA 3P3PA 2D40A 2P3JA 3RYKA 4BIFA 1DGRA 1RMU2 3S30A 3VBFA 1FATA 1I5ZA 3H9AA 4GIQA 1FX5A 4CDUB 2VG9A 3VV1A 3LWCA 3APBA 1IS4A 1CAVB 1YJKA 1CN1A 4XDQA 4D3WA 2EXIA 4Q0PA 1BXHA 1R091 3ZSMA 3VHRA 3VL9A 3MPBA 3CO2A 1Q5OA 3C2UA 3OYWB 4AVCA 1VBD1 2JKBA 2PELA 1A78A 3GYDA 4LLFA 4YFWA 4IEWA 1FT9A 2UU8A 4CZSA 1LGCA 1W0OA 2JD4A 1Q8OA 3BOWA 1CX4A 5HI0A 4BMBA 1IS5A 1V6IA 3U11A 3VBHB 2RS13 1BQPA 2EAAA 1UU5A 2E7AA 2Q0AA 4QGLA 1TNRA 3C3VA 4N7IA 4Z8BA 2IXIA 3TRSB 2DCJA 1G6NA 3IIAA 1G8WA 4IL7A 5I8YA 2ZGTA 3ZYRA 3ZMNA 1EP0A 4FTSA 4RSUA 4IETA 4WM8A 1VALA 5FAXA 1HQWA 1EPWA 3HR9A 4PCRA 4AWDA 1AR63 2BVBA 2RJLA 3U07A 1CR7A 5CAZA 4WM8C 5TSWA 4F7ZA 2R061 3LA7A 4AQSA 4CDXC 4Q4Y3 1UU6A 3LSEA 3CJIB 4CEYB 3A4UA 1COV2 4R9CA 4XFCA 3ACLA 1O3QA 1GZWA 1NCRB 1RUE1 2WWSA 4CDUC 4S2GA 3IM0A 3ZIWA 2OW4A 1KRIA 4PLMA 2DURA 1S0DA 2KM2A 2Z69A 4L99A 5IK5A 2N7GA 3NV2A 1WGPA 4W6WA 4AI1A