2PXJA

The complex structure of jmjd2a and monomethylated h3k36 peptide
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
347
structure length
347
Chain Sequence
b'ASESETLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords JmjC domain-containing histone demethylation protein 3A
molecule tags Oxidoreductase
source organism Homo sapiens
publication title Structural basis of the recognition of a methylated histone tail by JMJD2A
pubmed doi rcsb
total genus 104
structure length 347
sequence length 347
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2007-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 2pxjA01
3PUQA 5F39A 5FJHA 2XXZA 2Q8CA 5FXWA 5FP7A 5FZGA 3PTRB 2W2IA 5FYIA 2GP3A 4HOOA 3ZPOA 4AAPA 4URAA 3K3OA 4CCMA 4CUGA 5A1LA 2WWUA 4LIVA 4GAZA 4Y33A 5FP8A 5FXZA 5A3TA 5LW9A 4Y4RA 2YBSA 5FUPA 4EZHA 5FY9A 5F32A 5FZOA 5IVCA 3PDQA 5FUNA 5F5AA 4IGQA 5FZCA 5F37A 4HONA 5FJKA 5FP9A 3PURA 3U78A 3LDBA 5FZIA 5FZ3A 5A7WA 4XDOA 2PXJA 3KV9A 4LXLA 5FZ9A 5A3NA 5FY4A 5FP4A 5A80A 2XUEA 1VRBA 5FPBA 4CCJA 3N9MA 5IVFA 5E6HA 5FWJA 5F3GA 2OT7A 5FZ1A 4AI9A 5FZEA 3KV5A 5A7NA 2OS2A 5FYCA 5A1FA 4GJYA 3N9QA 3AL6A 2OX0A 3PUSA 3OPWA 5FZMA 5CEHA 3NJYA 4NUBA 3K3NA 2P5BA 4UF0A 3OPTA 5A7SA 5FY5A 3UYJA 4EZ4A 3DXTA 5FPUA 3PU3A 3AL5A 2OQ7A 3AVSA 5IVYA 5FZKA 5K4LA 4QWNA 3DXUA 5FZHA 3KVBA 4D6QA 4XDPA 4UF0B 4CCNA 5FXVA 4GJZA 4EYUA 5A3WA 4ASKA 5FZDA 2Q8DA 4LITA 5F5CA 4DO0A 2YBPA 4QXHA 5FWEA 3K2OA 2GP5A 5FPVA 5FZAA 5FY8A 4E4HA 5FYZA 5F3CA 4DIQA 4QU1A 4D6SA 4QX8A 4D6RA 4Y3OA 5F2WA 4BXFA 5FYMA 5F3IA 4C8DA 5FY0A 5FY7A 5FZLA 4CCLA 4QXCA 5A7QA 5IVJA 5A7OA 2Q8EA 4LIUA 2XMLA 5KR7A 4BU2A 3N9OA 2YPDA 5FZBA 5F3EA 5FZOB 5A3PA 4IGOA 3KVAA 2YU2A 2VD7A 3PU8A 2WWJA 5FYBA 5IVBA 5FYTA 2YBKA 4TN7A 5FYSA 5FP3A 5FYVA 5A7WB 3N9PA 5FY1A 3AVRA 3U4SA 5LWBA 3ZLIA 4CSWA 5IWFA 4BISA 3N9NA 5FBJA 2XDVA 5FZ0A 4IGPA 5A7PA 5FXXA 5ISLA 5FZ6A 3N9LA 5FZ4A 5IW0A 4V2VA 5F2SA 4CCKA 5IVVA 5ANQA 5FZ8A 5FPAA 5FZ7A 4CCOA 5LY2A 5LY1A 2YU1A 5F5IA 4GD4A 5IVEA 3KV6A 4V2WA 5FYYA 4QXBA 3LD8A 5FPLA 3PUAA 3KV4A 5FYHA 5FYUA 4QX7A 5FZFA 2OQ6A 3RVHA 5FV3A
chains in the Genus database with same CATH superfamily
1RB8G 4LBQA 4CCDA 2VCCA 4W65A 3ZXFA 1SPPA 3CKHA 4P9XA 5CIRA 5I0DA 1CJPA 2D6KA 2O0OA 3ZMNA 4HVOA 4Y1YA 1VAKA 3KCCA 1U12A 5H9PA 2ZPXA 4AGRA 5CFCC 4CEYB 4CUGA 2VJXA 2WBKA 2JEMA 3POIA 2WZEA 1WBFA 4AQ6A 1OQ1A 4XEZA 4Y4RA 5LW9A 2BU9A 1O3SA 1RINA 2R042 3M2MA 5F32A 5FZOA 5C33A 2J1VA 3BTZA 4GWIA 4GMP3 2KA3A 3VDCA 1XOYA 2QQNA 2X29A 3ZIXA 4IV3C 3AKRA 3VBOA 3E5UA 3VBFC 1BQPA 5DUUA 1XBFA 3LDKA 1Q8OA 2PAKA 2J42A 3D8CA 1N1YA 2JX9A 1M4WA 1UD1A 2F4PA 4IV1C 1W6PA 1C8M3 5HCFA 3VBRC 1JU3A 4S2HA 2Q1ZB 2QDNA 3IIAA 4OHZA 3H1MA 4HK9A 4ZU4A 5A1FA 2R7EB 4XTMA 1V9U1 4QPWA 3WCRA 4ZZ8A 1AR62 1YI7A 1OOPB 3CDZB 1F5FA 4A3ZA 1PZ9A 1FOD3 1J3PA 5FLHA 3VN4A 1ULGA 3LEMA 4BHPA 2VBPA 3VD3A 4TTGA 4F7ZA 4NWWA 4DNYA 3B02A 4IE6A 1RUG2 3OPTA 1QJFA 5GM0A 5EQUA 5DAVA 1NLQA 1NLSA 5T5OA 2G1MA 2Q0AA 2WDBA 2VO5A 2Q4SA 3IAQA 3ES1A 2ZOEB 4JRLA 4XURA 2LTNA 5FLIA 3MIFA 1PMHX 4O9EA 4EYUA 5IFPA 4UOJA 1Y9QA 1UX6A 5GLUA 1E5HA 2LW8A 2Q8DA 3O1RA 3IM0A 4QXHA 4N53C 3NSTA 2UY8A 3SHRA 2WR9A 1WLDA 3V64A 1GQGA 2HWE1 4XABA 4CDXC 5K0UC 5GKAC 5CFCA 1OPOA 3OGJA 1WCKA 4CDUA 1DGRA 3UNPA 4ARYA 2WSUA 5FK7A 5FREA 5C3RA 1CPNA 4GB33 2AC1A 1W2AX 5BYNA 5JDBA 1IOAA 1SPPB 2B5HA 3HVDA 1JS9A 2Y6KA 5C8CA 4UT5A 2OYZA 3MO4A 4ZPIA 5FP3A 3VD4A 1Q8QA 5GLTA 1GP6A 1LULA 2D40A 4XVHA 5BNOB 1H2KA 4EJRA 2VOVA 1OLME 4N8MA 2DF7A 3UKVA 1RUOA 3KHBA 4M0NA 1MS5A 4QXKA 2HEYF 1C8NA 2BW8A 1KEXA 2AYHA 4YYOA 3GZEA 3CO2A 4P9LA 4QPIC 4CCKA 2B8MA 1POV3 2XBO3 3BOWA 3I8TA 1AR82 5FZ8A 1HJGA 1Y3TA 2WABA 2A6WA 3N7JA 5CKNA 1PMIA 3Q8BA 3OYWA 4PIZA 3N4MA 4ZXKA 1OQEA 4IESA 1BEV3 1BVVA 1UOFA 3POWA 1GZWA 1LHUA 1PZ7A 4IEPA 4WM7C 2GH2A 4HKLA 4Q4V1 3UT0A 4ISRA 1ZVFA 3KD4A 4ZS2A 1HXS3 1LOFC 5FXWA 3AC0A 1PVC2 4H2AA 1FX5A 4R9DA 3WNLA 1GWKA 3WP4A 1KJRA 5LA9A 3RDIA 1QJU1 2J1SA 4K9SA 3ZYFA 5LA0A 3J7HA 3NV3A 4PQ9A 5FAXA 4N53A 1ENQA 2QQKA 1NA1B 1PK6C 2QQPA 2JG8B 5KHHA 5HV4A 1QQP1 2P34A 1EAH3 1B09A 4EWAA 2B45X 2Z42A 1AX1A 1BJQA 1LOEA 1W2UA 4COVA 5JXHA 5FJKA 3FZ3A 3PURA 1DG6A 5DN2A 5DAQA 3N7KA 2LRPA 2D5HA 3POFA 4WZFA 2P4EA 1HB2A 1O4YA 5BXXA 4Z2WA 1U5IA 4NOTA 1CAVB 1RUD1 2MEV1 4BWOA 2JD4A 4QX3A 5F6LB 4AVAA 5IHRA 5CU1A 4CU9A 4RSUA 4XJZA 1JW6A 4RL7A 4XXAA 3VZOA 2YDEA 4Q29A 2YY1A 2OS2A 2HEVF 2PHUA 2BTVC 1OA3A 1WW6A 2A6ZA 1Y4WA 2EA7A 3WNPA 4IDZA 4DUXA 3QH7A 1J83A 1HDKA 1SLAA 5B4XA 4A45A 1GZTA 4BA6A 1O3RA 1SLTA 2CAVA 4Z1VA 1F5JA 4XPVA 3I3MA 1XPWA 5DAPA 2Z4FA 4QAWA 3GHNA 4LQRA 2B7YA 4P9GA 3WP6A 3MFAA 2JENA 2NPIA 5DXDA 5CEHA 2WZR1 4EN8B 4RS5C 3PU3A 1H8TB 3AL5A 1LB2A 3QACA 1OSGA 2ZGQA 4LBMA 2XVLA 5IVJA 4KGQA 5GLZA 5A6ZA 1ZRRA 2IVJA 1IS3A 2WFPA 3BVCA 3VHOA 4AEDC 1DQ0A 4XF0A 4A41A 2X8KA 3DPRB 4UI9L 4DO0A 1YQ8A 4HKOA 5C5TA 1C8M1 3POGA 3KF5A 4H7LA 1UXXX 4AGGA 2VY0A 2EF6A 2PTMA 4X6QB 1K5MA 3JU9A 5BUVA 1V70A 2HYXA 4FPCA 2JG8C 4K6BA 4OUSA 1JI6A 5HCHA 2V4VA 4IV1B 5KHGA 5FZBA 4FPFA 3SH4A 3PU8A 1ZBE3 3ALQA 4Q4X2 5EFUA 1BMV2 3MZHA 5FY1A 4K21A 4XFAA 2PYTA 1PVC1 2XJQA 3I2DA 1AL22 4L2NA 3LEGA 3OBZA 3LWCA 4YZ2A 4IE5A 4EN9B 2XDVA 1PHMA 3UL2A 1V0AA 2D97A 3T2TA 1V9U2 1MEC3 1GNYA 4AEMA 1W04A 1C8M2 3W21A 1X33A 1V6NA 1YXWA 3D82A 3RGBA 3HJRA 3DGTA 4J1WA 4L8QA 2RHPA 3X29B 4JHZA 4A6OA 1NCRB 3EMRA 5LY2A 1C1FA 5JUVA 3FHIB 1DLLA 1W8NA 1YC61 1ASJ2 2A71A 4Y5SA 5TSWA 3LD8A 5FPLA 3KHCA 3H50A 1COV3 1S0EA 3MF6A 5DG1A 3B94A 4RGKA 4RS5B 4XXPA 4UW4A 3AM2A 1WBLA 4B1MA 5FJHA 3KZ4C 1OLQA 3SISA 3ZFGC 5CFCB 1QDCA 3PVOA 1BVP1 4QKNA 1AR91 3O1SA 5FP7A 2Y6FA 5FZGA 3KCYA 3FHQA 3PTRB 4AFCA 3LAGA 2ZGOA 3EYPA 4GMP1 4LHSA 3EB7A 3BODA 4YW5A 3DPRC 3NRUA 4OMDA 1GOFA 5C4WB 5IAXA 2QNKA 3ZYPA 2D6OX 1RXFA 4HBNA 4AGVA 1VRH1 3GCWA 5LK7B 1RMU3 3JQWA 4BJ0A 2DDUA 5A3MA 4WVMB 1OBNA 4ZXEA 4AQ2A 1A6CA 4FXGB 2HWF1 2E63A 1VBD1 2ZBJA 3SEEA 3I54A 5JOXA 3GBGA 3H9AA 3CJIC 2BPA2 1PIV2 2YGLA 4KU7A 1N3PA 1O59A 5HI0A 5IK8A 1QDOA 1VAMA 4MGYE 2W46A 3T2PA 3VBRA 2CHHA 3J7LA 4CPBA 2GSYA 3CJIB 4I0BA 5KHKA 3O1MA 4I0AA 1XNCA 1WMFA 2JDUA 4AAXA 3VBRB 1I9RA 4HSJA 4FFIA 1WWYA 5EJ1B 4I01A 1EV12 4DOUA 3ZN4A 1VBD3 1PNFA 2WRAA 2Q1MA 1R1ZA 4YW4A 3IDAA 4N7UA 2QQMA 4HVRA 3R05A 2ARBA 5FZMA 3I49A 3NJYA 3LIGA 1CJDA 2C24A 3JUUA 1VBD2 4Y20A 1W0OA 2OQ7A 1OFSA 2CYFA 3NV1A 1CD3G 1SACA 4Y26A 3TNQA 2AEYA 1PIV1 1RUJ2 2ILMA 2ZX0A 4R8HA 2PMWB 3HMYA 1AL21 3USUB 1AHSA 5A3WA 4ASKA 1W05A 2XJRA 1MS4A 4P9IA 4Y1VA 3NVCA 3I3EA 1UW8A 2YBPA 2R072 3AKTA 3RWNA 4JKLA 1W8HA 1WMXA 1VRH2 1WZXA 4TSVA 2NLRA 1UYYA 5JIAA 1OURA 3TBDA 2XLGA 3ETPA 1QEXA 3OD4A 2F4LA 4YM2A 1QJX2 1HLCA 2PHXA 4PHZA 4SLIA 3S6PA 4BXFA 3BKZA 3ZDSA 2WQ4A 2VZ3A 4C8DA 5FZLA 3T30A 3Q8EA 3UESA 2PLV2 2YHJA 5IJRA 1DGWA 4A4AA 1GUIA 1LESA 1VLNA 1OC1A 1Z78A 1VBA3 1RUG1 5K8SA 2PHFA 2BFUS 2XJPA 4P08A 3LF7A 3U07A 2BBVA 2WC2A 3LPFA 4QM8A 5FK8A 4XFIA 5FYSA 3WF3A 5FYVA 1KS5A 4CDWB 2GN7A 1O7FA 1NY72 1YHFA 1W8WA 2OXBA 3C7HA 3IDCB 3VKLA 4FPGA 1WCDJ 2EXJA 1UKRA 2XG3A 2WIIB 3RI8A 4M3CA 5FZ6A 3IMMA 3NAPC 4CP0A 1US3A 2ORZA 4MGZE 2XHNA 5J48A 1JOBA 1AXZA 5FPAA 1I5ZA 1XNBA 1LJ7A 3EXUA 3RYPA 1HKDA 3JB4C 4PDWA 2Y6GA 3M3OA 4WM8B 5LY1A 1POV0 3ILRA 4DY3A 1LGBA 3TN92 2JDAA 2WLQA 3I2FA 1MS9A 2VMCA 4H3WA 4CPBD 3WQ7A 1RUG3 2DUPA 4CA9A 3E6BA 1BYHA 4GWJA 3F95A 1Y9GA 5L19A 3JBG3 1UU6A 2VULA 2ZACA 3NQHA 1UZWA 2IWGB 4HPKA 1DGRN 4LIVA 3ELNA 4GAZA 5EPAA 2PHDA 3WQ1A 4NN0A 3KGZA 5LBBA 3HNYM 1HQNA 4OHXA 1O5LA 3DCQA 5ACA3 5CFDC 2RVAA 2ARXA 2ET1A 3AP6A 2RG4A 3FLTA 4UW5A 2XJUA 1SLIA 1LODA 3EO6A 4MXVA 4BQ5A 5BNNB 2Y26A 3VDDC 1JUIA 4MLOA 4XDOA 3TN91 2E7AA 3VV1A 5JSOA 4IQPA 1ULEA 1UX7A 3AMHA 5ACA2 3GM8A 1Q8VA 3SH3A 2X10A 4AVBA 2BOJA 5FFOC 3USSA 1UF2C 4CP1A 2KM2A 2RMU3 1JZ7A 3CL1A 3JD71 5JR7B 1NKGA 1O8SA 2XKOA 3P3PA 4KI5M 4NIGA 2VW2A 3TNPB 1F9KA 1Z0HA 5C3SA 5JAXA 4ZU5A 1LAJA 3ACHA 1RUE2 3IPVA 3NO8A 2W9XA 2IUWA 1D4M1 2DV9A 2EVXA 3ZSLA 1OVSA 3FJSA 4C1WA 4D7YA 4I3GA 1GANA 1HN0A 2XBO2 4Q27A 5FKBA 3C3VA 4M0HA 2QQIA 2OZJA 3DXTA 4WM8C 2VMIA 3B9IA 3T0AA 3AVSA 1Q8PA 3WW4A 1LEDA 5GZDA 2WT2A 3M8LA 2BV4A 1QJY3 4Q0QA 5FMOS 4XHXA 2XKPA 4ITCA 3POSA 3U37A 4CCEA 5A70A 5B2GB 2FD8A 2XB6C 4AEDA 4YGBA 5BNPA 1O3TA 1RL3A 3AMMA 4QT6A 3IPVB 1AJOA 1JBCA 5FZAA 4E4HA 1RXGA 2ZGTA 1REFA 4FQZA 4OULA 3VKMA 4XJWA 2R16A 1EY2A 3CNAA 1S2EA 1W8FA 4YM3A 2QVSB 5LCWL 3URFA 5DAXA 2PN5A 3WF0A 4FOQA 1PX4A 1W6OA 4CCLA 3D4KA 4CDQA 3H8OA 2WINB 2HWF2 1RMU2 5T54A 2XJTA 5SV5A 1NCRA 2WFF2 4YPJA 1G9BA 1HRI2 1HIXA 1LHNA 2HJIA 5J37A 2BNOA 4XETA 3IIIA 1PO22 2DUOA 5EYYA 5JIUA 4M3CE 1UNBA 3F2ZA 3I2OA 1BEV1 2FBEA 2FDFA 3C7FA 4NROA 5A7PA 5LRRA 3BIEA 1R64A 3C7GA 2E33A 3J26N 3ZXLA 3RJRA 1QOSA 1H8VA 3GZTB 1AJKA 4LLFA 2GC2A 1YQCA 4RHV1 5CG8A 1YCIA 5DPNA 2E32A 3L2HA 3RS6A 4LHLA 5F5IA 5AC91 1JZ2A 5I93A 4DXRA 3ZSJA 3ZXGA 3AP4A 4OI0A 1MACA 1G8WA 3WG1A 4Z2AA 3KV4A 3ZFEC 5ACA1 5FZFA 2OQ6A 2WFF1 1MEC1 4QHBA 2GZWA 4LHKA 1OVPA 3MIDA 5C3OA 2JDNA 4CYDA 2W87A 1CAWA 3VBSB 4BMEA 4QGNA 4AEDB 1S0FA 1BK1A 1W3XA 2RS52 2JB4A 4URAA 3DPRA 3PVBB 5EXOA 3PLQA 2O8QA 3R4UA 4OFGA 4EZHA 3B9CA 5HBAA 3WOGA 4B7EA 4BCUA 2PHRA 4UFLA 2LUWA 4AXOA 2R073 4FT8A 4HETA 4NWVA 1Y9MA 5GZGA 3BB6A 3HNMA 2WZR2 1CAUA 1WW5A 5LA2A 4Y5TA 3BPZA 4CDQC 3ZSMA 1J84A 4YZ5A 2PAMA 1W28A 3ZX7A 1TEIA 2J22A 1DIWA 5BPXA 3OOXA 1AXKA 1A8DA 1BBT1 3I3QA 4YARA 1OXCA 1PMJX 2D6PA 4LTAA 2A7AA 4XFGA 3QLQA 4LKSA 3SNMA 3J7NA 2JWPA 4XF4A 3J4UH 3NNLA 4CU8A 3VBFA 1XJAA 3DEMA 4AHYA 3IKWA 2CGOA 2UY9A 2RJ2A 4XMIA 4YLZA 1PM4A 2HEWF 1LNSA 1R093 3MIGA 1WLWA 3BIWE 3GZAA 1NOVA 5E88A 3NKTA 1FOD1 3BN6A 3HEIA 3RRDA 2VBDA 2PAEA 2ZABA 1UWWA 5DDJ1 5A7SA 1QF3A 4P5HA 2AREA 1YNAA 5FPUA 2HWC2 4A7ZA 3HT2A 3TEXA 4G4FA 5A33A 3AYEA 5L9VA 3DXUA 1AR71 1J3RA 1E5IA 2DCKA 2W91A 3K51A 3MUY1 1NZIA 4LK7A 1KFUL 4NHKA 1ODNA 2XUMA 1T6BX 5KHIA 2BNNA 4QX1A 2JD9A 4XDQA 1MQTB 2ZKLA 2A6YA 4NIHA 1TME1 2VMGA 5FPVA 1IS4A 3JZVA 5J1XA 2NN8A 3D0SA 4Q0VA 1UU4A 1Y7BA 1HX6A 2XL7A 5FQ0B 2R0FA 2R6QA 2JECA 3WW3A 3W9AA 1VR3A 4UW3A 1H2MA 2IC1A 1ZNPA 3PUHA 1QQP3 2JIJA 3AMPA 3OYWB 4GH4B 5AVPA 5GZCA 5K0UB 2D6MA 5A3PA 3L2YA 1Q3EA 4YG6A 1GNHA 4GB32 3RNSA 5J09A 3ZR5A 4AHXA 4QX5A 3AVRA 5LWBA 1CN1A 5K0UA 1ENXA 3WCSA 3ZN5A 4E2GA 4JGYA 4CSWA 1LU1A 4X6RB 5J96B 3MPBA 2JDYA 3VL9A 3UV9A 2B39A 4CU6A 5DABA 5BNOA 1T2XA 2WS93 3C2UA 5A3UA 4BQXA 3K48A 1VBE1 3UETA 4BK5A 3LB9A 1LOBA 4CXWA 5C8CC 3ES4A 2ZGUA 3LZZA 4COWA 1WW7A 1ZRDA 3P3NA 4GD4A 5C3QA 3LOBA 4V2WA 1RC6A 1BKZA 5FYYA 1POV1 2XBO1 4PDWC 4EE2A 5IT6A 1D0HA 1WA4A 4F3JA 2FCUA 1WA6X 2UWAA 1NQDA 2VNRA 3LFMA 4TZDA 4LT5A 4LBLA 5F39A 4CP9B 3O1VA 3QH6A 1H8TA 1JOPA 5BV6A 5HCBA 1UN1A 2EXHA 4UYBA 3OB8A 3N7MA 1GYKA 1QNYA 2WO2A 3CHXA 3H3ZA 3J7MA 1ZA4A 1UOGA 4K20A 2JG9A 3NV2A 1R091 2BRTA 1K5JA 2UURA 2YROA 3K4DA 4JRAA 3ZPOA 4AAPA 2P3YA 3SKVA 2E9QA 3MPPG 1YI9A 3WV6A 5FXZA 4DRVA 1SZBA 4ZKTB 3UK9A 2QZ2A 1DYKA 3S30A 1FMD2 1X9PA 3R4DB 3AZYA 3PDQA 4LNVA 1IKQA 1PO12 2B9UA 4QD2A 3IWZA 1OHFA 3AP5A 4E4ZA 2BDRA 4KBZA 4RN5A 1HRV1 3B00A 2W68A 5LBCA 2RS31 1RUJ1 2V5DA 1CAVA 1VRBA 1J1TA 2EALA 2R063 1X8MA 5L36A 4J25A 4COYA 2OT7A 1WUVA 4NPLA 4AI9A 4PI0A 4CDWC 2P2KA 1CX4A 3HQXA 2DTYA 3LOIA 2WFF3 4LA3A 3DYPA 2JE8A 4LBKA 1YQ6A 1MVEA 5F1RA 2YFZA 4D69A 2DURA 1KD7A 2IXIA 2C5DA 5JI9A 2Q30A 4Q4Y3 4MHUA 1PO11 4PJYA 3NL1A 1ACCA 2QQOA 1W3VA 4M3CF 4NHLA 3K3NA 2YC0A 3KWVA 1GICA 3B3QE 2Q1FA 5IVYA 2YG0A 1TQ5A 3AKSA 4QMAA 1EUUA 3CLPA 4O9GA 2XQRA 2VZUA 2FCVA 2RS11 1RUH2 4I09A 3RZKA 1H8TC 4A3XA 2IXCA 4OQ9A 5I8SA 3U10A 3ZOIA 1ALYA 1MS1A 2R0HA 1BZWA 2Z69A 2LM3A 2WZPP 1EAH1 3THDA 3WZ1A 1TNRA 1YIPA 4RQPB 3JCIA 4D6SA 1ENRA 4QKFA 4IEVA 3ACGA 4RS5A 1FAYA 5F2WA 1UY2A 3ACFA 3H1WA 4M4PA 4YG3A 4LKEA 5IK7A 1CZTA 1PK6B 4ORFA 4B3NA 2CAUA 4MGTA 2NP0A 2VNGA 1H2LA 3HIFA 4LE4A 4LIUA 3CQOA 3MLLA 4G3YC 1DDLA 1CWPA 4NRMA 3RI9A 1J3QA 1W6NA 3WF2A 1DZRA 2ZGLA 4YWAA 4QDRA 2P17A 4NJ4A 3MYXA 1HJFA 1L7LA 3ZIWA 2VUCA 3AXDA 1QXPA 4JHTA 2VM9A 4HLTA 2ARAA 3CZUA 1JMUB 1C1LA 4M4RA 5EHDA 4JV4A 2AH2A 2JG8A 3ZFFC 1ND2C 5LEKA 1X82A 5ISLA 4DQAA 1EAH2 5KC6A 1OA4A 2V72A 5LATA 3PUIA 1VJ2A 3IT8A 2JDHA 5IVVA 3HN1A 3MDPA 2JDZA 3PHMA 2AZ5A 4IV1A 2WS91 3POEA 1H1IA 4HMZA 2BOIA 1UIJA 1XU2A 4MXWB 1UMHA 3OJBA 4YNIA 1QJY1 2NYYA 4FPOB 3DL3A 1EUTA 2VTXJ 2QQUA 2JDPA 1XXNA 2A3WA 2IFRA 4LO6B 1ZYBA 3E1F1 1GOHA 1ASJ3 4IEXA 4M00A 1AR72 1SBFA 3AZZA 5I91A 1B35B 1WD4A 1UYPA 5C7GA 3WW2A 3N3HA 2CGPA 1UIKA 3VKOA 4QGMA 2HWC3 3E6CC 2AR6A 3OSDA 4L97A 1JTZX 2RM21 3AP7A 3KQ4B 4AG4A 5L7OC 2XJSA 2BGPA 2XVGA 3K3OA 2WN3A 1AR73 1L7RA 1CAXA 1MZEA 2VOTA 3WNMA 4HVQA 1Y43B 2VOXA 2HYKA 4N7IA 3WNOA 2DWRA 4Y1ZA 4A42A 4PBOA 2YXSA 4YZ3A 3PMEA 3VL8A 3O0WA 3GYDA 4IEQA 3INAA 3T09A 1W9WA 4A7KA 3V0AA 3AJYA 1L3JA 1UKGA 2XUEA 3GBFA 1ND3B 3N9MA 1URXA 3NNFA 1RUH1 2PHLA 2TNFA 2VW1A 3PVEA 1N1TA 4Q4X1 5A6YA 5CKMA 5FZ1A 4CDQB 4AK3A 2JE9A 1VMHA 4CDUC 2P6HA 2L9LA 2VE1A 3NNJA 4YM1A 5LZ6A 4ZONA 1Z7S1 2GAUA 1MS0A 5FPXA 1LENA 1AYN1 1ND2A 3H7YA 3TEWA 2ATFA 5T3NA 4EN7B 2MHFA 1JZ3A 2W95A 1BXHA 4CP9A 4MV2A 2AUYA 3ACIA 4H7MA 4XYXA 4PLMA 2OUHA 4NUBA 2WAOA 1J58A 3MHZA 4WBBA 1ZBE2 5FY5A 3T0BA 4IUGA 1OI6A 4Q4Y1 1N1VA 1NCQB 3ENRA 4AI8A 2VBBA 4OZXA 5KHJA 1PGW2 1CPMA 1DP0A 1RUF1 2RDNA 3C7OA 1JHJA 3NW4A 4N53B 3W20A 1PO21 3ACLA 3B69A 4UW6A 3M3EA 4YM0A 5L9RA 3GF6A 4GJZA 3ZPYA 4P9YA 2P3JA 4L92A 4LORA 3IBMA 5D21A 1M06G 1B35C 2RM22 5JSRA 1AZDA 5FWEA 4BB3A 2PELA 5LA1A 5F3CA 1XRUA 2VXJA 4S2DA 1RUI3 4GKXA 4WV8A 1FATA 1YQ5A 4PI2A 3ZSKA 3UJOA 4GH4C 5G05L 1ZRCA 5FYMA 1MZ6A 2FDHA 5BNNC 1UZYA 5FOBB 4FSJA 1KFXL 1QJX3 4XFFA 1HQWA 3W5NA 1X9TA 1LOFA 2YYOA 4CVUA 3N9OA 1D2SA 3OEAA 4HANA 1W9YA 2I74A 3ZKYA 1JZ8A 4IL7A 4A44A 4LE3A 1LTEA 5CB7A 4TN7A 1ZBA3 4X8NA 4IW3A 1F15A 4I30A 5FTTC 1AVBA 1CZSA 3ZLIA 3S5AA 2W94A 3J8F2 2O8OA 2J1AA 2JG9B 4BISA 3N9NA 4JQTA 5FBJA 5DMYA 4IGPA 2FZ2A 4JGYC 5C5UA 4DEVA 1W2OA 1NLRA 2D5FA 4Y24A 3RZGA 1EV11 1ZRFA 5BNOC 2XH6A 2ZGRA 1OOPC 2ZEYA 1KJLA 4YGCA 3SQOA 1PX3A 2OKXA 2P3KA 4DUVA 3BOPA 3S7EA 4XILA 1UCXA 2YU1A 1UY1A 3KV6A 1NAEA 5A6QA 3IZOA 2FDJA 2R1DA 2TEPA 2ET7A 1QH7A 2Y8KA 3PJYA 2ZZQA 3USUA 1S0CA 3ZM8A 2VZ1A 2C9AA 1JUHA 2VZTA 4CP2A 2WKKA 1OKOA 3J9SA 1W2NA 1VMJA 3NNGA 3LSEA 5CZKA 4Q8LA 3EHKA 3O14A 3PUQA 4HSLA 1QNWA 2EIGA 2WNVA 2ZX1A 5JZGA 1CESA 1NYWA 2ZKNA 4Y20B 2R49A 4PDWB 1JYVA 4PBPA 3HD8B 1T6GC 1VBC2 3C7EA 3LA3A 1ZRIA 4HOOA 4KMQA 2QKDA 2HWD3 3CZJA 3JBG2 1H9PA 3MUZ1 2FCTA 1SBEA 2HWE2 2WWUA 5HCAA 3GZUC 5HV0A 4WVVA 1VBB1 1WMEA 3H8UA 1WLTA 3ZMOA 1AL0G 4AHWA 1VBE3 4GH4A 2VGDA 3OY8B 1JZ5A 2XR4A 3DYOA 3SCGA 3VDAA 4XJAA 3WP5A 3SMHA 4KU8A 4N90A 1PM7A 4EN6B 1OH3A 2X05A 4AF9A 5F9TA 2WQ8A 2V5YA 1DYOA 3OY8A 4XW3A 3ZXJA 4CTEA 1Q5OA 5IVFA 1JOJA 2FQPA 4MGIE 1R1A2 5FWJA 2A1XA 1OF3A 3RFRA 1H1AA 3KV5A 1K5MC 2C9KA 5JXJA 3WNKA 2DCZA 3AX4A 1SEFA 3FBMA 4FTSA 3N9QA 4FP2A 5E1RA 4CCCA 4L99A 1A78A 1ULDA 3ILNA 1ZZ6A 1S4CA 2BGCA 3AKPA 2JXAA 1YFXA 2A6VA 1G86A 4JCKA 3VDDA 4B4QA 1QGLA 1VBB2 3KF3A 4QU2A 4RGAA 1I5PA 2WS92 5EYXA 1RIRA 4E2QA 3LKJA 4MH0E 1VBA2 3PUSA 3Q8FA 3TWIA 1AR81 1JU4A 2RS13 4QPIB 1EPZA 4CXYA 1W8OA 1ZREA 2P5BA 3AYAA 3VBUC 1MZ5A 4E8CA 2QQLA 5JXGA 1UYXA 3H3LA 1DYPA 2DCYA 2ENRA 3MFCA 3NKGA 4BQWA 5C3PA 2WSVA 1A34A 2NM1A 1YYNA 4XZUG 2WNVC 1QOOA 5JZGC 1OFNA 2SLIA 2WUHA 3DYMA 5LASA 1Q56A 1ZZ8A 2ZMNA 4Q0PA 2KD7A 4LKFA 1H9WA 1AX2A 3FL7A 4QKBA 3U11A 4LEJA 2XONA 4PLOA 5EIYB 2E7TA 3FE5A 2ARCA 2D3PA 4LKDA 2VQUA 3ZFGA 3B5LB 4W6YA 4A7YA 2XMLA 3MIEA 5KR7A 1DQ1A 5BNPC 1W6OB 5AC93 5ABJC 3NWKA 2KXLA 2OVUA 1XYNA 3KVAA 4QQHA 5LBFA 4AQTA 4BOWA 2AGSA 4IEUA 1YFUA 2MEV2 1OLRA 4Q1PA 4AYUA 3TEZA 3ZR6A 1POQA 4JGZC 1HRI3 1ZZCA 4FPHA 2R062 2GMPA 4R9BA 3U4XA 3ZYRA 4XC9A 1ZZ9A 3VBSA 2W39A 3OGSA 2ZS6B 1K5MB 1EP0A 2GALA 5I0UA 3ZYBA 1U5ZA 4KL1A 3PMSA 1X7NA 2GH8A 2VZQA 3KCXA 4RA0A 3M4FA 5FZ4A 2VTFA 3ZFFA 4E4SA 2P37A 1GSLA 4F83A 5JVVA 1G7YA 4LPLA 2VCBA 4AI0A 1V6IA 1SLCA 1GMMA 4B29A 1RJ7A 3WF1A 4AVTA 2E6VA 2J1UA 3TEYA 2WNOA 4LO8A 1UOJA 5JOZA 1R081 1DQ6A 3OUIA 2BVBA 4XQDA 3MW4A 1W6NB 1YRZA 4Q4W2 4W4ZA 2Q8CA 3TRSB 3WHUA 3ZKUA 1QHDA 2KR2A 5APAA 1VALA 2LROA 3MIHA 3PJQA 3ZYJB 2DUQA 2ES3A 3ATGA 2WO3A 1OH4A 3SH5A 2VZSA 5L7OA 4IV3B 1V00A 3OTFA 4BQ4A 2Z2SB 2OW4A 3ZFEA 5FKCA 3UKTA 1WCSA 4FO9A 2YUEA 2G19A 1MR5A 3V56A 3TB0A 2W92A 5FMDA 4C0BA 1W6MA 5FZIA 1JODA 5DUXA 2IXKA 1QJY2 5IAVA 1WD3A 5A80A 2WZR3 5HXVA 1O91A 1AR83 4R4XA 3OG2A 3FLRA 4RFT0 4XF1A 3WY6A 5ABJB 2MNGA 1SQ4A 1W9TA 3O0VA 5CADA 4NPMA 1GLHA 1JHNA 2HWB3 2Y0IA 3GBWA 5FYCA 1BEV2 2FHRA 2BWCA 1RVF1 1XNAA 4XUPA 1SCRA 1ZBA2 2FZ1A 2N7GA 2X5IB 2YFUA 5A6XA 1JZ6A 1JYTA 1IPJA 2GU9A 4YRDA 1NCQA 1SFNA 2DCJA 4XQWA 1GFF2 2HWF3 5L9BA 2CDOA 4EV0A 2X53S 1FPN3 1LGNA 2IXLA 2JB8A 3GGLA 4D94A 2RJKA 4FPEA 3ST7A 2VMHA 4ISQA 2CSGA 3ZO0B 5I0TA 3QD6A 3THPA 1WMDA 4BQ3A 3FBYA 1A8MA 2OIIA 4NE9A 5DDJ3 1HB1A 3A0NA 4Q4V2 4EROA 1FPN1 2A75A 1F2NA 5K7PA 2RR11 3O12A 1AR92 4D7TA 4LITA 1UPSA 4LO7A 3WDTA 4UFIA 1VMFA 3GHMA 2ERFA 2G9FA 1YJKA 5FY8A 3ETQA 5FYZA 2YZ4A 4DIQA 5LEJA 3JBG1 1W9FA 5CFDB 3PVNA 4D6RA 3S57A 2ZCWA 5I8YA 1XE0A 4QHZA 1IPSA 1UXZA 3ZDVA 1U5XA 2VECA 4HXCA 1S0JA 1UOBA 4NRQA 3T3YA 3WSOA 5BNNA 4AI1A 3NJXA 5C9AA 2G9GA 1YWKA 1SLLA 2VAUA 3HR9A 4IGOA 4OHVA 5FYBA 1RGSA 1FT9A 1W0NA 3JD73 4BLJA 5CISA 5FYTA 2WNEA 5A7WB 3GALA 2DBNA 2ZGKA 5T5JA 3U4SA 1J59A 4AEJA 5CVRA 5DQ0A 4A6SA 3A23A 1O6UA 5C70A 3VZLA 4N9IA 3M3CA 5DZGA 1R1A3 4PF5A 4JTOA 4FPYA 1K42A 4L9BA 1C28A 2XWJB 2B9VA 3A22A 1NZCA 4QQPA 3GJAA 3FX3A 2ETEA 3I2GA 3QCWA 1RUC2 1UQXA 4IERA 2QQJA 2ZX2A 3UGFA 1S0IA 2BYVE 1V9U3 3AZVA 3PNAA 3SEPA 1HRI1 4AI2A 3BUCA 2RS12 4IEYA 1BMV1 4M3CB 4XOGA 4CU7A 3M3QA 4DXTA 4JX0A 3GNEA 2FDGA 3RZLA 1RUI1 5FIXA 3WF4A 4FPKA 1Z7S2 4Q8KA 5FMOL 3K77A 1MQTC 4QDQA 3VBHB 1ENSA 2PHTA 4UBHA 2YBSA 4JDNA 1AL23 4RYDA 3DN7A 4IEWA 2ZAAA 1XB9A 4MSVA 1Z7S3 1DBNA 1F31A 2Z79A 4QKDA 3IDEA 4CEWB 3U78A 1OF4A 2P1BA 5C6CA 2K46A 2H0VA 2PXJA 3KV9A 3IDBB 4M01A 5FP4A 1F4HA 4YVWA 1QMJA 4DS0A 3OGVA 3K75B 4ZHNA 4NIDA 1C57A 2H0BA 2VPVA 1KS4A 1NE4A 4FPLA 4L0PA 3UJQA 3BALA 1DZQA 1ST8A 4JZRA 5E16A 3DKWA 5A7NA 1K45A 4FBFA 2D7FA 2YB7A 3DF0A 4K7JA 4TLGA 5JOYA 4KNCA 1LOAA 3RZHA 2VQTA 1OUSA 1QXRA 2MEV3 4UFMA 3O1OA 4XF9A 3AL6A 4QQOA 1NCRC 5J36A 1PIV3 2QDRA 2W1UA 1FNZA 1H4HA 1QQP2 4N9HA 4XMAA 2FMDA 1OD3A 1QU0A 2ID4A 4CEWA 1WW4A 4XFCA 1N3QA 2A3YA 4EWEA 4R4ZA 4YVWB 5KXEA 1P8JA 2C6SA 4D6QA 2ZMKA 2YC4A 4PF1A 4QQ2A 4CCNA 4P14A 3UGHA 1DQ4A 1V6MA 4AEKA 5F5CA 1YFYA 1CAXB 3WX5A 4ATEA 2WJSA 1FI2A 3ROUA 4GZ9A 2ZEZA 1HV0A 3A21A 3MBWA 2DVAA 3E97A 1JYCA 1DZTA 4C0HA 5FMBA 4MO3M 3OF1A 2W1QA 3AMQA 4QXCA 3FUQA 2A6XA 4Y22A 2RJLA 1EV13 3ZXEA 4JGZB 4CE8A 4TLFA 3BGAA 2J1TA 2JDKA 3MEPA 5F3EA 1IG0A 4ZZ5A 2DBIA 2XOMA 2WWJA 4XF3A 1OMIA 1DLCA 1XE7A 4AQSA 4ASLA 2NQYA 4YZ4A 1AYM3 2RS51 4FFFA 4KWKA 2E31A 2PLV3 1AR61 1K3IA 1ZZ7A 2R32A 1NT0A 2PFWA 3I59A 3OPZA 4NAOA 4CEYA 1RUE1 4OI4A 5F5QA 3VKNA 2WYSA 1PVC3 1ZA7A 4XUTA 1AYM2 2GNTA 1D4M2 3A7QA 1VRH3 1H0BA 4JKMA 3IB3A 1LR5A 1JYWA 2ZGPA 4LBQB 1RTVA 1A3KA 3FN9A 1D0GA 1HQLA 2YGMA 4XUOA 2VUAA 3RVHA 1TG7A 3WT3A 4COZA 1AF9A 4AOCA 5A1AA 1FPN2 1V6JA 1IHMA 5BY5A 3ZVXA 1IQAA 5T50A 4NMIA 2W1WA 1VIWB 3R4SA 4D8MA 3OBAA 4W50A 4LBQD 3WG4A 4UFJA 1PZ8A 1YO8A 2Y60A 2XWBB 4JKKA 3KSCA 3ZSEA 4RQPA 3TN93 4DPNA 5A1LA 2ZAHA 5T52A 1TZOA 4LA2A 2HLEA 1F8VA 2CDPA 5J7MA 5FY9A 2VVDA 3AZXA 2TBVA 3MW2A 2ADDA 3POBA 1FOD2 5F8PA 5FUNA 5FZCA 5F37A 2EIBA 1ULCA 2H6CA 1CAUB 5KXDA 1QWRA 1WGPA 3A4UA 4XUNA 4H14A 1SHWB 4P00B 2VQ0A 2IXHA 2EAKA 2YPJA 2VZPA 3W59A 3V65A 1BLZA 2X5IA 4YW6A 2ZEXA 5T5LA 2VVEA 5FZEA 4H55A 3WUDA 4OHYA 1TNFA 1JYXA 1WCQA 1N1SA 3AYCA 3JB8A 1GNZA 1XSRA 3QOPA 1GKBA 2VOKA 5JCTA 1ND2B 3MI8A 1I6XA 1S0GA 2WT0A 5LK5A 3CF6E 2BFUL 3FFQA 3RYKA 4RHV2 3EBRA 4B4RA 4KWUA 4FCAA 4N43A 3MF9A 2WN2A 2VNVA 1RUF3 1OKQA 2JKBA 2ZXQA 5A3LA 3ZYGA 3OCPA 1C5IA 3I2KA 4JC1A 5JR2A 4ASMB 5IFTA 1LECA 3SKJE 4QWNA 4MX3A 1MEC2 4J6GA 3T08A 2HKXA 3ZFEB 1NY71 5CKQA 3VLBB 4IV3A 4YG0A 5FDBA 1RUE3 2BUKA 5FZDA 4Z92B 1LGCA 1S0DA 1XNTA 2YV8A 4TWTA 3K2OA 1AYN3 2Q8OA 3DV8A 4R52A 1QJU2 5L7OB 3WQBA 3VZMA 3OBTA 4HK8A 3NV4A 2WAAA 1NE6A 1AX0A 1LOCA 1UZ0A 4U36A 5F3IA 3WDVA 3I3DA 3FFZA 1YEWA 4KBBA 4SBVA 5D1IA 5G04L 4XAAA 3VGIA 1B35A 3FHAA 4AHZA 2JG9C 1HB3A 5KXBA 2JE7A 5IYYA 4TYSA 4FAHA 3N9PA 3NAPB 5LBEA 3IMNA 4UXAA 1W6QA 2EXKA 5DZEA 4QB6A 2WYFA 5FXXA 2CY6A 2V09A 4COUA 3LSDA 4FQ4A 3WP3A 3WR0A 2HH9A 2VMDA 1YLLA 2VH9A 4JAAA 4GXLA 2O1QA 3PIJA 4FFHA 4GQ7A 4IEOA 4HN1A 4J1XA 4JGYB 3OD0A 3RWKX 4V1PA 5IVEA 1QIQA 3I2HA 3OEBA 2PLV1 2W52A 4Q2FA 1I1EA 1DU3D 1XSQA 4XAEA 3AMNA 3K46A 4I02A 4CDWA 4IXLA 5FUIA 3KT7A 4UBGA 4LK6A 3IAPA 4ONUA 1ZZBA 2XXZA 4GKYA 1XU1A 2XLFA 5ANNA 1GQHA 2W1SA 3WINE 1OOPA 5JSPA 1C4RA 2QFEA 1NG0A 4WVWA 5FYIA 2GMEA 1QH6A 1RVF2 2BNMA 2GP3A 1ZBA1 2YC2A 1N47A 4QPGB 1CX1A 1Q8SA 4ARXA 2C26A 4Y33A 5A3TA 2VXRA 3LE0A 2XVKA 1W6PB 1MQTA 5IVCA 2XQXA 1Q43A 4MGSA 4FOVA 4XQ4A 4B8EA 1RVF3 1JZ4A 4UFKA 4OI1A 3RZZA 3WG3A 5JPMB 4NHMA 3LDBA 1ZX5A 4A2UA 3RZMA 4Q26A 2W08A 4QPIA 2XHKA 5FBZA 5A3NA 1KQRA 1JH5A 2QZ3A 3T1MA 3AXEA 4CCJA 1E5SA 1S0BA 5KXCA 3O1TA 4Z8BA 3VDDB 3KMHA 4JQRA 1U5YA 1V6LA 2WA3A 4BQ1A 4BQ2A 1RUI2 3HPNA 4BPZA 3EQEA 1RUJ3 3WLUA 1H6YA 3H8RA 4FTBA 1GZCA 1PO13 2VCMA 5I0SA 1QJEA 4XUQA 2OX0A 2HBUA 1X36A 5IK4A 5JLVA 2K9ZA 1G9AA 3AK0A 4LBOA 3O5SA 1EYBA 2QE3A 4KG8A 1UZZA 2WT1A 2WQZC 1I3HA 4UF0A 3UYJA 2Q5TA 1HN1A 5SV8A 3ORJA 1GOGA 3WQ0A 4E9KA 3WNNA 3A0KA 1QJZA 5FZHA 4CRQA 2UWBA 5JMOA 5DZFA 4AFAA 2VTXA 5M0TA 3BU7A 5CAZA 4K1YA 3BPSA 5CNAA 1RHI1 3VB9A 3OUHA 5AFBA 1R092 3RQ0A 2W5FA 4DY5A 5DAWA 2XLAA 2E7QA 4RFRB 4BXSV 4DUWA 3VHPA 4FP3A 1NXMA 2C1FA 2ADEA 2OA2A 4HKWA 4TXWA 2QJVA 4XIKA 3VBUA 2WNVB 1AR63 5JPNB 4WZCA 1UPIA 3AJZA 4W6WA 1VAVA 2A3XA 2GN3A 5L73A 4AVSA 1G9CA 3KLSA 2Q8EA 4L11A 2X09A 4BQYA 4BU2A 4X8PA 1DHKB 5EP9A 3L9JT 5FZOB 2NMNA 2V73A 2YU2A 1GP5A 2EICA 4ES8A 1VBC3 2Y33A 3POJA 2RV9A 3I59B 4YGDA 2LS6A 1YFWA 5D2AA 5EV7A 1E5RA 2ZZJA 2BP6A 1J1LA 3CEWA 3TOJA 1ODMA 1LKNA 4Y4YA 3LDRA 3HOBA 1YIFA 2ZMLA 5F2SA 3RG0A 1CIWA 5CBLA 1IG3A 3M70A 4META 2UYAA 3AFKA 1NX9A 1H6XA 2XL9A 4YSFA 2BGOA 2HBTA 4Q1RA 4QB1A 4QGLA 4RGGA 5FCCA 4AWDA 4MOAA 2JDMA 4JGZA 4PCRA 4ZU7A 2DVBA 2MPFA 1W90A 5E89A 1H4GA 2BWAA 3PUAA 3KB5A 2PQSA 2Y64A 3VBSC 1RUD2 2WO7A 2XGXA 5LB6A 2VZOA 1GP4A 3I7DA 1CZVA 4RHV3 5FV3A 3VBUB 2DFBA 3DECA 2BBAA 4OYUA 4PQQA 3SC7X 4K3UA 3ZN6A 3BU0A 3ZYIB 3MIBA 2EXIA 4Q4W3 1G9DA 2H6BA 3CMGA 4LOTA 4MUVA 1RUD3 5FPZA 3WG2A 4XHBA 3O1UA 5CG9A 4LO5B 2XJVA 4CCMA 2R043 3BCWA 2I2SA 2K2SA 1QOTA 4LLOA 3KT1A 3VD5A 5FMCA 2RMU2 3W58A 3D3AA 3LGRA 4RQPC 3RSJA 1XC6A 1JYNA 4Q0SA 3E6DA 3K4ZA 3MGUA 4CUAA 3AZWA 4IGQA 5D8AB 4MHRA 5HPOA 3G7DA 3H8XA 2PHWA 3HQUA 2IVIB 4HL0A 1REDA 1N3OA 5AVAA 2Y6JA 1GZ9A 5GZEA 1ASJ1 4QHOA 5DUVA 5FY4A 2AACA 4DINB 5FPBA 3WW1A 1TE1B 4GB31 5A33B 1PNGA 2NMOA 1TMF2 2B4KA 1XE8A 2OUJA 5T5PA 1FMD3 4XE9A 3VD7A 2QUOA 3ZXDA 3PTYA 1IGOA 3E5XA 1ND3C 3M3IA 3MICA 4DEQA 1QKQA 3VKFC 4MG2A 2VMEA 4JTNA 3OBRA 3ON7A 1S2KA 2D93A 2C0ZA 4XZPA 4IE4A 5AC92 2IFWA 4ZS3A 4NO4A 3WNXA 4WM7B 4YVSC 2UYBA 4N43C 3N36A 1D4M3 3HAGA 3V0AB 1RHI3 4ES9A 2V4AA 3HN3A 2VR4A 1HV1A 3KVBA 3P6BA 3NJZA 4XBQA 1G6NA 2ZGNA 2F17A 4QPGA 4N43B 5JWPA 1NCQC 1LEMA 4C91A 3CJIA 1KITA 2VUDA 1AUYA 1UAIA 4FFGA 1DGLA 1OUXA 2RMU1 4URTA 1BHGA 1PO23 5GLVA 4XIOA 1CIYA 4HPKB 5I8TA 1CONA 4BYYA 2J7MA 4PIXA 2VZVA 4PIYA 3HBKA 1BBT3 4O61A 4XJUA 5A3OA 5HXMA 1H2NA 1CR7A 1UMZA 2FDIA 4QB2A 1NXD1 4CZSA 3EJKA 4WVMA 1ULOA 2VD7A 1RJ8A 1TMF1 1GZWB 2RDQA 2YBKA 4GWMA 4UFHA 3U0ZA 1BBT2 2I45A 4QQLA 4QDSA 1CVNA 2IZWA 2BVVA 1QY4A 3CJXA 1UO9A 2DYCA 2VQAA 3JD72 3LFIA 3NMBA 3Q9OA 5DUWA 1OD5A 2RDSA 1UY4A 1W6QB 4DRRA 5CYYA 5FZ0A 5A32B 1APNA 4LUMA 2VW0A 5B4NA 2IXJA 3I2IA 3N9LA 1RUH3 1PGSA 3E5QA 5ANQA 4YW1A 3HQRA 4MZUA 4E27A 5E8AA 2RS53 3G6JB 3LCPA 1HRV2 5GLWA 3RZJA 1W9SA 4Y1XA 3WDXA 4BLIA 3AYDA 3I4IA 4FVVA 3S7IA 1PK6A 5FR3A 4YVSA 4YVSB 1HXS2 1RUF2 2SBAA 3ZXAC 3H1YA 3I97A 2HWB2 1V6KA 4OMCA 1HRV3 2J1RA 1UU5A 3Q8CA 2I07B 3B7MA 1MVQA 4R9AA 2ZJCA 1S1AA 5FO7B 1JYIA 1MPXA 4LHNA 3O0XA 3MV11 3UKNA 5EJZB 3I2JA 4XJ8A 2XPJA 3FC0A 5FP8A 4LULA 4XTPA 4YZ1A 1REEA 3ZYHA 1QJU3 2FMYA 1MS3A 4Z82A 4HONA 1STMA 2W3JA 5BNPB 5FP9A 3FWEA 3K4AA 1NA1C 4K8FA 4NAMA 1IS6A 1UY0A 1WKYA 4LXLA 4Q4V3 1KRIA 4FAGA 4OHWA 1W99A 4Y5Z0 4O65A 1TME3 3JXSA 4OUMA 4Q4W1 1COV2 5E6HA 2D3SA 2J1EA 5F3GA 1W06A 3WD5A 1FNYA 4GIQA 2ZEWA 3J8F1 4AFMA 1ULFA 2ZHLA 4YFZA 4GJYA 3H3UA 1VP6A 1RYYA 2R30A 2WWSA 4LBJA 4DB5A 3LQCA 2FDKA 5C8WA 3MV01 3GDBA 4FI9A 4KG0A 1VBE2 4UWDA 4D3WA 1O5UA 5F6KA 3U14A 5ABJA 2O14A 2WA4A 5JI7A 3AB0A 3CIHA 4OI2A 1FMD1 1E57A 4YVWC 5JXIA 4NHXA 1UL9A 4MGQA 3VZNA 1LU2A 5KC5A 2Y38A 4KGGA 3AFGA 4ZY9A 3VZJA 4AL9A 3QBQA 2EAAA 3BTAA 4OLLA 4FXKB 1FV2A 2UU8A 3FMGA 5EJ3A 1IQDC 1W0PA 3BYWA 4NVPA 2GDFA 4P02B 2D3RA 2ZX3A 1COV1 5AFEA 1BK0A 1PGL2 1VBC1 2A73B 3WXPA 2ZA9A 1IZ3A 2VG9A 1O4TA 2DVFA 2GC0A 4XFHA 4P9JA 4LJHA 2VU9A 4XBLA 1RUNA 1VPHA 3I3BA 3HNBM 4FPJA 3KS7A 5A7OA 2HWD1 2RE9A 3ME2A 2Z5WA 4HG6B 5LRSA 2DU0A 3DKQA 5IVBA 3S5QA 1NA1A 4Y1UA 3FLPA 2CNAA 4QPYA 4I2OA 2CTVA 1W8TA 3HBZA 1DF0A 4XFBA 3WVJA 1VB4A 4C1XA 3MLKA 1X8EA 2WO1A 1F4AA 2QQWA 4WM8A 2JJ6A 3HT1A 1LHOA 5EWSA 1LHWA 3THCA 1OA2A 4NRPA 3T0DA 1TMF3 4GWNA 4Q0UA 5IW0A 3UGGA 2CL2A 3LPGA 3Q8AA 1DFQA 4U2AA 3POYA 4K8RB 4YW3A 4KWLA 1UMIA 2GMMA 3ITQA 5FZ7A 4CCOA 4C90A 4Y22B 3SITA 3W5MA 3CU7A 2B42B 4BMBA 2A5ZA 2A70A 4YW2A 2RS32 2ZHMA 5FYUA 3R6SA 4QX7A 2Y34A 2W0XA 4JDMA 4R9CA 1CGPA 3OUJA 1O3QA 1YJLA 5C71A 4CEYC 1V6OA 3R0RA 1OQDA 1C5HA 1U0AA 3SCHA 2DCTA 1XQNA 4INDA 1C3HA 3MW3A 3VHRA 2QBXA 2R071 2GC1A 3LA7A 1MS8A 2G4IA 1KDMA 2C4XA 1K12A 1W2TA 1O8PA 2B46X 4OZOA 1QJX1 3N7LA 5FUPA 1SMVA 4EN0A 5C4WC 2OPWA 4XACA 2CWMA 3B01A 2F6BA 3U75A 3VBOB 5A7WA 4FTEA 3WUCA 4K1ZA 3RJ2X 2BJSA 2RR13 3T2OA 1WLCA 4P5YA 4CDUB 1PGW1 1LCLA 1FXZA 4QX0A 4NR1A 4D0QA 1EPWA 3U1XA 4CXXA 1FYUA 1MZFA 3VBFB 4XCBA 1PGL1 3FUOA 1PVXA 4AE2A 1DQ2A 1CQ9A 2ZX4A 1S2BA 2WNUB 4RR3C 4HN0A 1ULPA 2CV6A 4AFDA 1H1MA 1ND3A 5C9AC 2E51A 4HT1T 2OPKA 4AI3A 5J3UA 1GV9A 2DU1A 2VMFA 2WLPA 2HWD2 3WDUA 2X5IC 1RMU1 2VZRA 4XJ9A 3WHTA 1ZM1A 5F7UA 4MVTA 3WDYA 2E53A 1HXS1 4ATFA 4LUKA 1DCSA 2UWCA 3H7JA 1WCUA 2LALA 1LHVA 4IE7A 5KBFA 1SBDA 3VBHA 4LR4A 3ZXKA 2BQPA 4UF0B 2DVDA 2ZHNA 1HB4A 2VVFA 2Y6LA 4XBNA 4QPGC 4W6XA 4BIFA 4GMP0 2GP5A 2QQVA 4CDXA 3NNMA 2OZ6A 4BDVB 4O7XA 4QU1A 2GC3A 2RDRA 3M1HA 4QX8A 4E8DA 1AYN2 4Y3OA 2K0GA 2ORXA 4GA9A 4XCAA 3T4HB 1SDWA 2R041 4BZ4A 1CAWB 3KT4A 5FY7A 4I3PA 5C4WA 4GALA 3H42B 4RD7A 5IUQA 5I0RA 1YUDA 5D8AC 1NUKA 4BM8A 3NAPA 5DDJ2 5JMCA 1H30A 1VBB3 2HWC1 3WDWA 2YMZA 3IN9A 1AR93 3H0OA 4AVVA 1GBGA 1W6MB 1GQPA 5KWRA 2PA7A 3P5BA 4BE3A 4Q5OA 1W8UA 2GNBA 3V0BA 3O1PA 2ZHKA 3DUIA 3P1IA 4EQVA 4EWDA 4BIOA 1TME2 4BH9A 4DZGA 4RR3A 1DQ5A 2WNUC 4RR3B 1US2A 4V2VA 4DXZA 4CUBA 1GR3A 1XYPA 4B4PA 5C9AB 1OT5A 3MLJA 4PLNA 3GCXA 3RPQA 4F8AA 3V0BB 4IEZA 3D5OA 2DVGA 4UAPA 5ERLA 3O7OA 1W39A 4WM7A 3KM5A 3SCFA 5C8CB 5FYHA 1D2QA 3WEZA 2CU5A 2EIDA 5CFDA 1XYOA 1D7PM 5J98B 5H9QA 2G9ZA 5FO8B 3CBNA 3D6EA 1RHI2 2VOWA 3VBHC 3TYJA 3BTXA 3AKQA 5A32A 1W8ZA 2D43A 2DFCA 2W2IA 3PL0A 4OQ8A 1AXYA 4YW7A 3B93A 1L7QA 2D6NA 3KQRA 2JKXA 4Z07A 4CEWC 4I0WB 1XNKA 3T4VA 4P9WA 2ZGMA 1VBA1 3N35A 2EIEA 1JN2P 1R083 2D44A 1KDKA 1RUC3 1UZVA 4GULA 5F5AA 4CDXB 1X50A 5IK5A 1GWMA 4MYEA 2AENA 4AFBA 1IS5A 1ZBE1 4LBNA 5FZ3A 4Q4Y2 4Q4X3 3BTYA 4WVZA 2P6CA 3RMYA 5GALA 4HFSA 5FOJB 3BI3A 5D8AA 3M7AA 5FZ9A 4YFWA 4ET7A 1R082 3OGGA 1RITA 2P3IA 3OGRA 5GZFA 2BZDA 4NPRA 1IKPA 4IE0A 3LA2A 5FRAA 4HZFA 4LOSA 2R061 4AVCA 2BERA 5CA6A 4CUCA 1GWLA 3S0MA 3ZN6B 3D0JA 1SFYA 3TAYA 1SCSA 2VL4A 4NIAA 3GJBA 3GXUA 3ILFA 5BNQA 2WNUA 2RM23 4FOYA 1LOGA 1DGWX 1LRHA 2NZ9A 3VDBA 3OPWA 1SDDB 1XNDA 1RUC1 1VE0A 4MADA 4LMFA 2PQQA 4EZ4A 5K9YA 1SFPA 4OVEA 2QTWB 1IPKA 1ONAA 5JZGB 1SLBA 1HW5A 1KGYA 4K40A 2D98A 5FZKA 5K4LA 4XDPA 4YGEA 2WZ8A 5GJ6A 5T55A 4DXSA 5FXVA 2QCSB 1R1A1 2VC9A 3LEIA 4S2GA 4W8JA 4DFSA 1D4VB 2RS33 3NJVA 1W03A 3VUOA 4E2SA 1OLMA 4LO4B 5EZWA 5FLJA 1F35A 3THTA 3RYRA 1JXNA 2E26A 4KQ7A 4FOWA 1TVGA 2WL1A 5H9SA 3SXWA 3J8F3 1SG3A 4S2FA 1AYM1 4E4DX 1O4ZA 2JICA 1QXJA 3ECQA 5FY0A 3VBOC 5A7QA 2GNMA 2D6LX 4MXWA 3ABZA 2DTWA 2YPDA 5DG2A 1KXGA 2VNOA 2VUJA 5FO9B 4KH9A 2HWB1 3VD9A 3ZFFB 3SLIA 2BEOA 1UY3A 3C8XA 3ASIA 2VCAA 3T1LA 4AZZA 1UYZA 2RR12 2TUNA 2Y0OA 4KWJA 5IWFA 3VHNA 4B1LA 1NQJA 1VB2A 4OCTA 3PIGA 2GNDA 4OUEA 4G9SB 4JDOA 2ZTNA 1OPMA 3APBA 4PT6A 4DMIA 1S55A 4NIIA 4D7SA 1YQ2A 3HWJA 1GU3A 3AP9A 4B7KA 3RMXA 4QX2A 5H9RA 4BK4A 2JIGA 3KGLA 2Y6HA 4IETA 4AW7A 5JOWA 3VZKA 3JQXA 5IATA 3ZFGB 4QM9A 4NHYA 2HWE3 2R1BA 2CWSA 4JVAA 3LEKA 4MGKE 4QXBA 5FQ0A 2ZGSA 1FV3A 2W47A 2AEZA 2CGNA 3T2QA 4AR2A 1BCXA 3LIHA 1G9FA
chains in the Genus database with same CATH topology
3PUQA 5F39A 5FJHA 2XXZA 2Q8CA 5FXWA 5FP7A 5FZGA 3PTRB 2W2IA 5FYIA 2GP3A 4HOOA 3ZPOA 4AAPA 4URAA 3K3OA 4CCMA 4CUGA 5A1LA 2WWUA 4LIVA 4GAZA 4Y33A 5FP8A 5FXZA 5A3TA 5LW9A 4Y4RA 2YBSA 5FUPA 4EZHA 5FY9A 5F32A 5FZOA 5IVCA 3PDQA 5FUNA 5F5AA 4IGQA 5FZCA 5F37A 4HONA 5FJKA 5FP9A 3PURA 3U78A 3LDBA 5FZIA 5FZ3A 5A7WA 4XDOA 2PXJA 3KV9A 4LXLA 5FZ9A 5A3NA 5FY4A 5FP4A 5A80A 2XUEA 1VRBA 5FPBA 4CCJA 3N9MA 5IVFA 5E6HA 5FWJA 5F3GA 2OT7A 5FZ1A 4AI9A 5FZEA 3KV5A 5A7NA 2OS2A 5FYCA 5A1FA 4GJYA 3N9QA 3AL6A 2OX0A 3PUSA 3OPWA 5FZMA 5CEHA 3NJYA 4NUBA 3K3NA 2P5BA 4UF0A 3OPTA 5A7SA 5FY5A 3UYJA 4EZ4A 3DXTA 5FPUA 3PU3A 3AL5A 2OQ7A 3AVSA 5IVYA 5FZKA 5K4LA 4QWNA 3DXUA 5FZHA 3KVBA 4D6QA 4XDPA 4UF0B 4CCNA 5FXVA 4GJZA 4EYUA 5A3WA 4ASKA 5FZDA 2Q8DA 4LITA 5F5CA 4DO0A 2YBPA 4QXHA 5FWEA 3K2OA 2GP5A 5FPVA 5FZAA 5FY8A 4E4HA 5FYZA 5F3CA 4DIQA 4QU1A 4D6SA 4QX8A 4D6RA 4Y3OA 5F2WA 4BXFA 5FYMA 5F3IA 4C8DA 5FY0A 5FY7A 5FZLA 4CCLA 4QXCA 5A7QA 5IVJA 5A7OA 2Q8EA 4LIUA 2XMLA 5KR7A 4BU2A 3N9OA 2YPDA 5FZBA 5F3EA 5FZOB 5A3PA 4IGOA 3KVAA 2YU2A 2VD7A 3PU8A 2WWJA 5FYBA 5IVBA 5FYTA 2YBKA 4TN7A 5FYSA 5FP3A 5FYVA 5A7WB 3N9PA 5FY1A 3AVRA 3U4SA 5LWBA 3ZLIA 4CSWA 5IWFA 4BISA 3N9NA 5FBJA 2XDVA 5FZ0A 4IGPA 5A7PA 5FXXA 5ISLA 5FZ6A 3N9LA 5FZ4A 5IW0A 4V2VA 5F2SA 4CCKA 5IVVA 5ANQA 5FZ8A 5FPAA 5FZ7A 4CCOA 5LY2A 5LY1A 2YU1A 5F5IA 4GD4A 5IVEA 3KV6A 4V2WA 5FYYA 4QXBA 3LD8A 5FPLA 3PUAA 3KV4A 5FYHA 5FYUA 4QX7A 5FZFA 2OQ6A 3RVHA 5FV3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PUQ A;  5F39 A;  5FJH A;  2XXZ A;  2Q8C A;  5FXW A;  5FP7 A;  5FZG A;  3PTR B;  2W2I A;  5FYI A;  2GP3 A;  4HOO A;  3ZPO A;  4AAP A;  4URA A;  3K3O A;  4CCM A;  4CUG A;  5A1L A;  2WWU A;  4LIV A;  4GAZ A;  4Y33 A;  5FP8 A;  5FXZ A;  5A3T A;  5LW9 A;  4Y4R A;  2YBS A;  5FUP A;  4EZH A;  5FY9 A;  5F32 A;  5FZO A;  5IVC A;  3PDQ A;  5FUN A;  5F5A A;  4IGQ A;  5FZC A;  5F37 A;  4HON A;  5FJK A;  5FP9 A;  3PUR A;  3U78 A;  3LDB A;  5FZI A;  5FZ3 A;  5A7W A;  4XDO A;  2PXJ A;  3KV9 A;  4LXL A;  5FZ9 A;  5A3N A;  5FY4 A;  5FP4 A;  5A80 A;  2XUE A;  1VRB A;  5FPB A;  4CCJ A;  3N9M A;  5IVF A;  5E6H A;  5FWJ A;  5F3G A;  2OT7 A;  5FZ1 A;  4AI9 A;  5FZE A;  3KV5 A;  5A7N A;  2OS2 A;  5FYC A;  5A1F A;  4GJY A;  3N9Q A;  3AL6 A;  2OX0 A;  3PUS A;  3OPW A;  5FZM A;  5CEH A;  3NJY A;  4NUB A;  3K3N A;  2P5B A;  4UF0 A;  3OPT A;  5A7S A;  5FY5 A;  3UYJ A;  4EZ4 A;  3DXT A;  5FPU A;  3PU3 A;  3AL5 A;  2OQ7 A;  3AVS A;  5IVY A;  5FZK A;  5K4L A;  4QWN A;  3DXU A;  5FZH A;  3KVB A;  4D6Q A;  4XDP A;  4UF0 B;  4CCN A;  5FXV A;  4GJZ A;  4EYU A;  5A3W A;  4ASK A;  5FZD A;  2Q8D A;  4LIT A;  5F5C A;  4DO0 A;  2YBP A;  4QXH A;  5FWE A;  3K2O A;  2GP5 A;  5FPV A;  5FZA A;  5FY8 A;  4E4H A;  5FYZ A;  5F3C A;  4DIQ A;  4QU1 A;  4D6S A;  4QX8 A;  4D6R A;  4Y3O A;  5F2W A;  4BXF A;  5FYM A;  5F3I A;  4C8D A;  5FY0 A;  5FY7 A;  5FZL A;  4CCL A;  4QXC A;  5A7Q A;  5IVJ A;  5A7O A;  2Q8E A;  4LIU A;  2XML A;  5KR7 A;  4BU2 A;  3N9O A;  2YPD A;  5FZB A;  5F3E A;  5FZO B;  5A3P A;  4IGO A;  3KVA A;  2YU2 A;  2VD7 A;  3PU8 A;  2WWJ A;  5FYB A;  5IVB A;  5FYT A;  2YBK A;  4TN7 A;  5FYS A;  5FP3 A;  5FYV A;  5A7W B;  3N9P A;  5FY1 A;  3AVR A;  3U4S A;  5LWB A;  3ZLI A;  4CSW A;  5IWF A;  4BIS A;  3N9N A;  5FBJ A;  2XDV A;  5FZ0 A;  4IGP A;  5A7P A;  5FXX A;  5ISL A;  5FZ6 A;  3N9L A;  5FZ4 A;  5IW0 A;  4V2V A;  5F2S A;  4CCK A;  5IVV A;  5ANQ A;  5FZ8 A;  5FPA A;  5FZ7 A;  4CCO A;  5LY2 A;  5LY1 A;  2YU1 A;  5F5I A;  4GD4 A;  5IVE A;  3KV6 A;  4V2W A;  5FYY A;  4QXB A;  3LD8 A;  5FPL A;  3PUA A;  3KV4 A;  5FYH A;  5FYU A;  4QX7 A;  5FZF A;  2OQ6 A;  3RVH A;  5FV3 A; 
#chains in the Genus database with same CATH topology
 1RB8 G;  4LBQ A;  4CCD A;  2VCC A;  4W65 A;  3ZXF A;  1SPP A;  3CKH A;  4P9X A;  5CIR A;  5I0D A;  1CJP A;  2D6K A;  2O0O A;  3ZMN A;  4HVO A;  4Y1Y A;  1VAK A;  3KCC A;  1U12 A;  5H9P A;  2ZPX A;  4AGR A;  5CFC C;  4CEY B;  4CUG A;  2VJX A;  2WBK A;  2JEM A;  3POI A;  2WZE A;  1WBF A;  4AQ6 A;  1OQ1 A;  4XEZ A;  4Y4R A;  5LW9 A;  2BU9 A;  1O3S A;  1RIN A;  2R04 2;  3M2M A;  5F32 A;  5FZO A;  5C33 A;  2J1V A;  3BTZ A;  4GWI A;  4GMP 3;  2KA3 A;  3VDC A;  1XOY A;  2QQN A;  2X29 A;  3ZIX A;  4IV3 C;  3AKR A;  3VBO A;  3E5U A;  3VBF C;  1BQP A;  5DUU A;  1XBF A;  3LDK A;  1Q8O A;  2PAK A;  2J42 A;  3D8C A;  1N1Y A;  2JX9 A;  1M4W A;  1UD1 A;  2F4P A;  4IV1 C;  1W6P A;  1C8M 3;  5HCF A;  3VBR C;  1JU3 A;  4S2H A;  2Q1Z B;  2QDN A;  3IIA A;  4OHZ A;  3H1M A;  4HK9 A;  4ZU4 A;  5A1F A;  2R7E B;  4XTM A;  1V9U 1;  4QPW A;  3WCR A;  4ZZ8 A;  1AR6 2;  1YI7 A;  1OOP B;  3CDZ B;  1F5F A;  4A3Z A;  1PZ9 A;  1FOD 3;  1J3P A;  5FLH A;  3VN4 A;  1ULG A;  3LEM A;  4BHP A;  2VBP A;  3VD3 A;  4TTG A;  4F7Z A;  4NWW A;  4DNY A;  3B02 A;  4IE6 A;  1RUG 2;  3OPT A;  1QJF A;  5GM0 A;  5EQU A;  5DAV A;  1NLQ A;  1NLS A;  5T5O A;  2G1M A;  2Q0A A;  2WDB A;  2VO5 A;  2Q4S A;  3IAQ A;  3ES1 A;  2ZOE B;  4JRL A;  4XUR A;  2LTN A;  5FLI A;  3MIF A;  1PMH X;  4O9E A;  4EYU A;  5IFP A;  4UOJ A;  1Y9Q A;  1UX6 A;  5GLU A;  1E5H A;  2LW8 A;  2Q8D A;  3O1R A;  3IM0 A;  4QXH A;  4N53 C;  3NST A;  2UY8 A;  3SHR A;  2WR9 A;  1WLD A;  3V64 A;  1GQG A;  2HWE 1;  4XAB A;  4CDX C;  5K0U C;  5GKA C;  5CFC A;  1OPO A;  3OGJ A;  1WCK A;  4CDU A;  1DGR A;  3UNP A;  4ARY A;  2WSU A;  5FK7 A;  5FRE A;  5C3R A;  1CPN A;  4GB3 3;  2AC1 A;  1W2A X;  5BYN A;  5JDB A;  1IOA A;  1SPP B;  2B5H A;  3HVD A;  1JS9 A;  2Y6K A;  5C8C A;  4UT5 A;  2OYZ A;  3MO4 A;  4ZPI A;  5FP3 A;  3VD4 A;  1Q8Q A;  5GLT A;  1GP6 A;  1LUL A;  2D40 A;  4XVH A;  5BNO B;  1H2K A;  4EJR A;  2VOV A;  1OLM E;  4N8M A;  2DF7 A;  3UKV A;  1RUO A;  3KHB A;  4M0N A;  1MS5 A;  4QXK A;  2HEY F;  1C8N A;  2BW8 A;  1KEX A;  2AYH A;  4YYO A;  3GZE A;  3CO2 A;  4P9L A;  4QPI C;  4CCK A;  2B8M A;  1POV 3;  2XBO 3;  3BOW A;  3I8T A;  1AR8 2;  5FZ8 A;  1HJG A;  1Y3T A;  2WAB A;  2A6W A;  3N7J A;  5CKN A;  1PMI A;  3Q8B A;  3OYW A;  4PIZ A;  3N4M A;  4ZXK A;  1OQE A;  4IES A;  1BEV 3;  1BVV A;  1UOF A;  3POW A;  1GZW A;  1LHU A;  1PZ7 A;  4IEP A;  4WM7 C;  2GH2 A;  4HKL A;  4Q4V 1;  3UT0 A;  4ISR A;  1ZVF A;  3KD4 A;  4ZS2 A;  1HXS 3;  1LOF C;  5FXW A;  3AC0 A;  1PVC 2;  4H2A A;  1FX5 A;  4R9D A;  3WNL A;  1GWK A;  3WP4 A;  1KJR A;  5LA9 A;  3RDI A;  1QJU 1;  2J1S A;  4K9S A;  3ZYF A;  5LA0 A;  3J7H A;  3NV3 A;  4PQ9 A;  5FAX A;  4N53 A;  1ENQ A;  2QQK A;  1NA1 B;  1PK6 C;  2QQP A;  2JG8 B;  5KHH A;  5HV4 A;  1QQP 1;  2P34 A;  1EAH 3;  1B09 A;  4EWA A;  2B45 X;  2Z42 A;  1AX1 A;  1BJQ A;  1LOE A;  1W2U A;  4COV A;  5JXH A;  5FJK A;  3FZ3 A;  3PUR A;  1DG6 A;  5DN2 A;  5DAQ A;  3N7K A;  2LRP A;  2D5H A;  3POF A;  4WZF A;  2P4E A;  1HB2 A;  1O4Y A;  5BXX A;  4Z2W A;  1U5I A;  4NOT A;  1CAV B;  1RUD 1;  2MEV 1;  4BWO A;  2JD4 A;  4QX3 A;  5F6L B;  4AVA A;  5IHR A;  5CU1 A;  4CU9 A;  4RSU A;  4XJZ A;  1JW6 A;  4RL7 A;  4XXA A;  3VZO A;  2YDE A;  4Q29 A;  2YY1 A;  2OS2 A;  2HEV F;  2PHU A;  2BTV C;  1OA3 A;  1WW6 A;  2A6Z A;  1Y4W A;  2EA7 A;  3WNP A;  4IDZ A;  4DUX A;  3QH7 A;  1J83 A;  1HDK A;  1SLA A;  5B4X A;  4A45 A;  1GZT A;  4BA6 A;  1O3R A;  1SLT A;  2CAV A;  4Z1V A;  1F5J A;  4XPV A;  3I3M A;  1XPW A;  5DAP A;  2Z4F A;  4QAW A;  3GHN A;  4LQR A;  2B7Y A;  4P9G A;  3WP6 A;  3MFA A;  2JEN A;  2NPI A;  5DXD A;  5CEH A;  2WZR 1;  4EN8 B;  4RS5 C;  3PU3 A;  1H8T B;  3AL5 A;  1LB2 A;  3QAC A;  1OSG A;  2ZGQ A;  4LBM A;  2XVL A;  5IVJ A;  4KGQ A;  5GLZ A;  5A6Z A;  1ZRR A;  2IVJ A;  1IS3 A;  2WFP A;  3BVC A;  3VHO A;  4AED C;  1DQ0 A;  4XF0 A;  4A41 A;  2X8K A;  3DPR B;  4UI9 L;  4DO0 A;  1YQ8 A;  4HKO A;  5C5T A;  1C8M 1;  3POG A;  3KF5 A;  4H7L A;  1UXX X;  4AGG A;  2VY0 A;  2EF6 A;  2PTM A;  4X6Q B;  1K5M A;  3JU9 A;  5BUV A;  1V70 A;  2HYX A;  4FPC A;  2JG8 C;  4K6B A;  4OUS A;  1JI6 A;  5HCH A;  2V4V A;  4IV1 B;  5KHG A;  5FZB A;  4FPF A;  3SH4 A;  3PU8 A;  1ZBE 3;  3ALQ A;  4Q4X 2;  5EFU A;  1BMV 2;  3MZH A;  5FY1 A;  4K21 A;  4XFA A;  2PYT A;  1PVC 1;  2XJQ A;  3I2D A;  1AL2 2;  4L2N A;  3LEG A;  3OBZ A;  3LWC A;  4YZ2 A;  4IE5 A;  4EN9 B;  2XDV A;  1PHM A;  3UL2 A;  1V0A A;  2D97 A;  3T2T A;  1V9U 2;  1MEC 3;  1GNY A;  4AEM A;  1W04 A;  1C8M 2;  3W21 A;  1X33 A;  1V6N A;  1YXW A;  3D82 A;  3RGB A;  3HJR A;  3DGT A;  4J1W A;  4L8Q A;  2RHP A;  3X29 B;  4JHZ A;  4A6O A;  1NCR B;  3EMR A;  5LY2 A;  1C1F A;  5JUV A;  3FHI B;  1DLL A;  1W8N A;  1YC6 1;  1ASJ 2;  2A71 A;  4Y5S A;  5TSW A;  3LD8 A;  5FPL A;  3KHC A;  3H50 A;  1COV 3;  1S0E A;  3MF6 A;  5DG1 A;  3B94 A;  4RGK A;  4RS5 B;  4XXP A;  4UW4 A;  3AM2 A;  1WBL A;  4B1M A;  5FJH A;  3KZ4 C;  1OLQ A;  3SIS A;  3ZFG C;  5CFC B;  1QDC A;  3PVO A;  1BVP 1;  4QKN A;  1AR9 1;  3O1S A;  5FP7 A;  2Y6F A;  5FZG A;  3KCY A;  3FHQ A;  3PTR B;  4AFC A;  3LAG A;  2ZGO A;  3EYP A;  4GMP 1;  4LHS A;  3EB7 A;  3BOD A;  4YW5 A;  3DPR C;  3NRU A;  4OMD A;  1GOF A;  5C4W B;  5IAX A;  2QNK A;  3ZYP A;  2D6O X;  1RXF A;  4HBN A;  4AGV A;  1VRH 1;  3GCW A;  5LK7 B;  1RMU 3;  3JQW A;  4BJ0 A;  2DDU A;  5A3M A;  4WVM B;  1OBN A;  4ZXE A;  4AQ2 A;  1A6C A;  4FXG B;  2HWF 1;  2E63 A;  1VBD 1;  2ZBJ A;  3SEE A;  3I54 A;  5JOX A;  3GBG A;  3H9A A;  3CJI C;  2BPA 2;  1PIV 2;  2YGL A;  4KU7 A;  1N3P A;  1O59 A;  5HI0 A;  5IK8 A;  1QDO A;  1VAM A;  4MGY E;  2W46 A;  3T2P A;  3VBR A;  2CHH A;  3J7L A;  4CPB A;  2GSY A;  3CJI B;  4I0B A;  5KHK A;  3O1M A;  4I0A A;  1XNC A;  1WMF A;  2JDU A;  4AAX A;  3VBR B;  1I9R A;  4HSJ A;  4FFI A;  1WWY A;  5EJ1 B;  4I01 A;  1EV1 2;  4DOU A;  3ZN4 A;  1VBD 3;  1PNF A;  2WRA A;  2Q1M A;  1R1Z A;  4YW4 A;  3IDA A;  4N7U A;  2QQM A;  4HVR A;  3R05 A;  2ARB A;  5FZM A;  3I49 A;  3NJY A;  3LIG A;  1CJD A;  2C24 A;  3JUU A;  1VBD 2;  4Y20 A;  1W0O A;  2OQ7 A;  1OFS A;  2CYF A;  3NV1 A;  1CD3 G;  1SAC A;  4Y26 A;  3TNQ A;  2AEY A;  1PIV 1;  1RUJ 2;  2ILM A;  2ZX0 A;  4R8H A;  2PMW B;  3HMY A;  1AL2 1;  3USU B;  1AHS A;  5A3W A;  4ASK A;  1W05 A;  2XJR A;  1MS4 A;  4P9I A;  4Y1V A;  3NVC A;  3I3E A;  1UW8 A;  2YBP A;  2R07 2;  3AKT A;  3RWN A;  4JKL A;  1W8H A;  1WMX A;  1VRH 2;  1WZX A;  4TSV A;  2NLR A;  1UYY A;  5JIA A;  1OUR A;  3TBD A;  2XLG A;  3ETP A;  1QEX A;  3OD4 A;  2F4L A;  4YM2 A;  1QJX 2;  1HLC A;  2PHX A;  4PHZ A;  4SLI A;  3S6P A;  4BXF A;  3BKZ A;  3ZDS A;  2WQ4 A;  2VZ3 A;  4C8D A;  5FZL A;  3T30 A;  3Q8E A;  3UES A;  2PLV 2;  2YHJ A;  5IJR A;  1DGW A;  4A4A A;  1GUI A;  1LES A;  1VLN A;  1OC1 A;  1Z78 A;  1VBA 3;  1RUG 1;  5K8S A;  2PHF A;  2BFU S;  2XJP A;  4P08 A;  3LF7 A;  3U07 A;  2BBV A;  2WC2 A;  3LPF A;  4QM8 A;  5FK8 A;  4XFI A;  5FYS A;  3WF3 A;  5FYV A;  1KS5 A;  4CDW B;  2GN7 A;  1O7F A;  1NY7 2;  1YHF A;  1W8W A;  2OXB A;  3C7H A;  3IDC B;  3VKL A;  4FPG A;  1WCD J;  2EXJ A;  1UKR A;  2XG3 A;  2WII B;  3RI8 A;  4M3C A;  5FZ6 A;  3IMM A;  3NAP C;  4CP0 A;  1US3 A;  2ORZ A;  4MGZ E;  2XHN A;  5J48 A;  1JOB A;  1AXZ A;  5FPA A;  1I5Z A;  1XNB A;  1LJ7 A;  3EXU A;  3RYP A;  1HKD A;  3JB4 C;  4PDW A;  2Y6G A;  3M3O A;  4WM8 B;  5LY1 A;  1POV 0;  3ILR A;  4DY3 A;  1LGB A;  3TN9 2;  2JDA A;  2WLQ A;  3I2F A;  1MS9 A;  2VMC A;  4H3W A;  4CPB D;  3WQ7 A;  1RUG 3;  2DUP A;  4CA9 A;  3E6B A;  1BYH A;  4GWJ A;  3F95 A;  1Y9G A;  5L19 A;  3JBG 3;  1UU6 A;  2VUL A;  2ZAC A;  3NQH A;  1UZW A;  2IWG B;  4HPK A;  1DGR N;  4LIV A;  3ELN A;  4GAZ A;  5EPA A;  2PHD A;  3WQ1 A;  4NN0 A;  3KGZ A;  5LBB A;  3HNY M;  1HQN A;  4OHX A;  1O5L A;  3DCQ A;  5ACA 3;  5CFD C;  2RVA A;  2ARX A;  2ET1 A;  3AP6 A;  2RG4 A;  3FLT A;  4UW5 A;  2XJU A;  1SLI A;  1LOD A;  3EO6 A;  4MXV A;  4BQ5 A;  5BNN B;  2Y26 A;  3VDD C;  1JUI A;  4MLO A;  4XDO A;  3TN9 1;  2E7A A;  3VV1 A;  5JSO A;  4IQP A;  1ULE A;  1UX7 A;  3AMH A;  5ACA 2;  3GM8 A;  1Q8V A;  3SH3 A;  2X10 A;  4AVB A;  2BOJ A;  5FFO C;  3USS A;  1UF2 C;  4CP1 A;  2KM2 A;  2RMU 3;  1JZ7 A;  3CL1 A;  3JD7 1;  5JR7 B;  1NKG A;  1O8S A;  2XKO A;  3P3P A;  4KI5 M;  4NIG A;  2VW2 A;  3TNP B;  1F9K A;  1Z0H A;  5C3S A;  5JAX A;  4ZU5 A;  1LAJ A;  3ACH A;  1RUE 2;  3IPV A;  3NO8 A;  2W9X A;  2IUW A;  1D4M 1;  2DV9 A;  2EVX A;  3ZSL A;  1OVS A;  3FJS A;  4C1W A;  4D7Y A;  4I3G A;  1GAN A;  1HN0 A;  2XBO 2;  4Q27 A;  5FKB A;  3C3V A;  4M0H A;  2QQI A;  2OZJ A;  3DXT A;  4WM8 C;  2VMI A;  3B9I A;  3T0A A;  3AVS A;  1Q8P A;  3WW4 A;  1LED A;  5GZD A;  2WT2 A;  3M8L A;  2BV4 A;  1QJY 3;  4Q0Q A;  5FMO S;  4XHX A;  2XKP A;  4ITC A;  3POS A;  3U37 A;  4CCE A;  5A70 A;  5B2G B;  2FD8 A;  2XB6 C;  4AED A;  4YGB A;  5BNP A;  1O3T A;  1RL3 A;  3AMM A;  4QT6 A;  3IPV B;  1AJO A;  1JBC A;  5FZA A;  4E4H A;  1RXG A;  2ZGT A;  1REF A;  4FQZ A;  4OUL A;  3VKM A;  4XJW A;  2R16 A;  1EY2 A;  3CNA A;  1S2E A;  1W8F A;  4YM3 A;  2QVS B;  5LCW L;  3URF A;  5DAX A;  2PN5 A;  3WF0 A;  4FOQ A;  1PX4 A;  1W6O A;  4CCL A;  3D4K A;  4CDQ A;  3H8O A;  2WIN B;  2HWF 2;  1RMU 2;  5T54 A;  2XJT A;  5SV5 A;  1NCR A;  2WFF 2;  4YPJ A;  1G9B A;  1HRI 2;  1HIX A;  1LHN A;  2HJI A;  5J37 A;  2BNO A;  4XET A;  3III A;  1PO2 2;  2DUO A;  5EYY A;  5JIU A;  4M3C E;  1UNB A;  3F2Z A;  3I2O A;  1BEV 1;  2FBE A;  2FDF A;  3C7F A;  4NRO A;  5A7P A;  5LRR A;  3BIE A;  1R64 A;  3C7G A;  2E33 A;  3J26 N;  3ZXL A;  3RJR A;  1QOS A;  1H8V A;  3GZT B;  1AJK A;  4LLF A;  2GC2 A;  1YQC A;  4RHV 1;  5CG8 A;  1YCI A;  5DPN A;  2E32 A;  3L2H A;  3RS6 A;  4LHL A;  5F5I A;  5AC9 1;  1JZ2 A;  5I93 A;  4DXR A;  3ZSJ A;  3ZXG A;  3AP4 A;  4OI0 A;  1MAC A;  1G8W A;  3WG1 A;  4Z2A A;  3KV4 A;  3ZFE C;  5ACA 1;  5FZF A;  2OQ6 A;  2WFF 1;  1MEC 1;  4QHB A;  2GZW A;  4LHK A;  1OVP A;  3MID A;  5C3O A;  2JDN A;  4CYD A;  2W87 A;  1CAW A;  3VBS B;  4BME A;  4QGN A;  4AED B;  1S0F A;  1BK1 A;  1W3X A;  2RS5 2;  2JB4 A;  4URA A;  3DPR A;  3PVB B;  5EXO A;  3PLQ A;  2O8Q A;  3R4U A;  4OFG A;  4EZH A;  3B9C A;  5HBA A;  3WOG A;  4B7E A;  4BCU A;  2PHR A;  4UFL A;  2LUW A;  4AXO A;  2R07 3;  4FT8 A;  4HET A;  4NWV A;  1Y9M A;  5GZG A;  3BB6 A;  3HNM A;  2WZR 2;  1CAU A;  1WW5 A;  5LA2 A;  4Y5T A;  3BPZ A;  4CDQ C;  3ZSM A;  1J84 A;  4YZ5 A;  2PAM A;  1W28 A;  3ZX7 A;  1TEI A;  2J22 A;  1DIW A;  5BPX A;  3OOX A;  1AXK A;  1A8D A;  1BBT 1;  3I3Q A;  4YAR A;  1OXC A;  1PMJ X;  2D6P A;  4LTA A;  2A7A A;  4XFG A;  3QLQ A;  4LKS A;  3SNM A;  3J7N A;  2JWP A;  4XF4 A;  3J4U H;  3NNL A;  4CU8 A;  3VBF A;  1XJA A;  3DEM A;  4AHY A;  3IKW A;  2CGO A;  2UY9 A;  2RJ2 A;  4XMI A;  4YLZ A;  1PM4 A;  2HEW F;  1LNS A;  1R09 3;  3MIG A;  1WLW A;  3BIW E;  3GZA A;  1NOV A;  5E88 A;  3NKT A;  1FOD 1;  3BN6 A;  3HEI A;  3RRD A;  2VBD A;  2PAE A;  2ZAB A;  1UWW A;  5DDJ 1;  5A7S A;  1QF3 A;  4P5H A;  2ARE A;  1YNA A;  5FPU A;  2HWC 2;  4A7Z A;  3HT2 A;  3TEX A;  4G4F A;  5A33 A;  3AYE A;  5L9V A;  3DXU A;  1AR7 1;  1J3R A;  1E5I A;  2DCK A;  2W91 A;  3K51 A;  3MUY 1;  1NZI A;  4LK7 A;  1KFU L;  4NHK A;  1ODN A;  2XUM A;  1T6B X;  5KHI A;  2BNN A;  4QX1 A;  2JD9 A;  4XDQ A;  1MQT B;  2ZKL A;  2A6Y A;  4NIH A;  1TME 1;  2VMG A;  5FPV A;  1IS4 A;  3JZV A;  5J1X A;  2NN8 A;  3D0S A;  4Q0V A;  1UU4 A;  1Y7B A;  1HX6 A;  2XL7 A;  5FQ0 B;  2R0F A;  2R6Q A;  2JEC A;  3WW3 A;  3W9A A;  1VR3 A;  4UW3 A;  1H2M A;  2IC1 A;  1ZNP A;  3PUH A;  1QQP 3;  2JIJ A;  3AMP A;  3OYW B;  4GH4 B;  5AVP A;  5GZC A;  5K0U B;  2D6M A;  5A3P A;  3L2Y A;  1Q3E A;  4YG6 A;  1GNH A;  4GB3 2;  3RNS A;  5J09 A;  3ZR5 A;  4AHX A;  4QX5 A;  3AVR A;  5LWB A;  1CN1 A;  5K0U A;  1ENX A;  3WCS A;  3ZN5 A;  4E2G A;  4JGY A;  4CSW A;  1LU1 A;  4X6R B;  5J96 B;  3MPB A;  2JDY A;  3VL9 A;  3UV9 A;  2B39 A;  4CU6 A;  5DAB A;  5BNO A;  1T2X A;  2WS9 3;  3C2U A;  5A3U A;  4BQX A;  3K48 A;  1VBE 1;  3UET A;  4BK5 A;  3LB9 A;  1LOB A;  4CXW A;  5C8C C;  3ES4 A;  2ZGU A;  3LZZ A;  4COW A;  1WW7 A;  1ZRD A;  3P3N A;  4GD4 A;  5C3Q A;  3LOB A;  4V2W A;  1RC6 A;  1BKZ A;  5FYY A;  1POV 1;  2XBO 1;  4PDW C;  4EE2 A;  5IT6 A;  1D0H A;  1WA4 A;  4F3J A;  2FCU A;  1WA6 X;  2UWA A;  1NQD A;  2VNR A;  3LFM A;  4TZD A;  4LT5 A;  4LBL A;  5F39 A;  4CP9 B;  3O1V A;  3QH6 A;  1H8T A;  1JOP A;  5BV6 A;  5HCB A;  1UN1 A;  2EXH A;  4UYB A;  3OB8 A;  3N7M A;  1GYK A;  1QNY A;  2WO2 A;  3CHX A;  3H3Z A;  3J7M A;  1ZA4 A;  1UOG A;  4K20 A;  2JG9 A;  3NV2 A;  1R09 1;  2BRT A;  1K5J A;  2UUR A;  2YRO A;  3K4D A;  4JRA A;  3ZPO A;  4AAP A;  2P3Y A;  3SKV A;  2E9Q A;  3MPP G;  1YI9 A;  3WV6 A;  5FXZ A;  4DRV A;  1SZB A;  4ZKT B;  3UK9 A;  2QZ2 A;  1DYK A;  3S30 A;  1FMD 2;  1X9P A;  3R4D B;  3AZY A;  3PDQ A;  4LNV A;  1IKQ A;  1PO1 2;  2B9U A;  4QD2 A;  3IWZ A;  1OHF A;  3AP5 A;  4E4Z A;  2BDR A;  4KBZ A;  4RN5 A;  1HRV 1;  3B00 A;  2W68 A;  5LBC A;  2RS3 1;  1RUJ 1;  2V5D A;  1CAV A;  1VRB A;  1J1T A;  2EAL A;  2R06 3;  1X8M A;  5L36 A;  4J25 A;  4COY A;  2OT7 A;  1WUV A;  4NPL A;  4AI9 A;  4PI0 A;  4CDW C;  2P2K A;  1CX4 A;  3HQX A;  2DTY A;  3LOI A;  2WFF 3;  4LA3 A;  3DYP A;  2JE8 A;  4LBK A;  1YQ6 A;  1MVE A;  5F1R A;  2YFZ A;  4D69 A;  2DUR A;  1KD7 A;  2IXI A;  2C5D A;  5JI9 A;  2Q30 A;  4Q4Y 3;  4MHU A;  1PO1 1;  4PJY A;  3NL1 A;  1ACC A;  2QQO A;  1W3V A;  4M3C F;  4NHL A;  3K3N A;  2YC0 A;  3KWV A;  1GIC A;  3B3Q E;  2Q1F A;  5IVY A;  2YG0 A;  1TQ5 A;  3AKS A;  4QMA A;  1EUU A;  3CLP A;  4O9G A;  2XQR A;  2VZU A;  2FCV A;  2RS1 1;  1RUH 2;  4I09 A;  3RZK A;  1H8T C;  4A3X A;  2IXC A;  4OQ9 A;  5I8S A;  3U10 A;  3ZOI A;  1ALY A;  1MS1 A;  2R0H A;  1BZW A;  2Z69 A;  2LM3 A;  2WZP P;  1EAH 1;  3THD A;  3WZ1 A;  1TNR A;  1YIP A;  4RQP B;  3JCI A;  4D6S A;  1ENR A;  4QKF A;  4IEV A;  3ACG A;  4RS5 A;  1FAY A;  5F2W A;  1UY2 A;  3ACF A;  3H1W A;  4M4P A;  4YG3 A;  4LKE A;  5IK7 A;  1CZT A;  1PK6 B;  4ORF A;  4B3N A;  2CAU A;  4MGT A;  2NP0 A;  2VNG A;  1H2L A;  3HIF A;  4LE4 A;  4LIU A;  3CQO A;  3MLL A;  4G3Y C;  1DDL A;  1CWP A;  4NRM A;  3RI9 A;  1J3Q A;  1W6N A;  3WF2 A;  1DZR A;  2ZGL A;  4YWA A;  4QDR A;  2P17 A;  4NJ4 A;  3MYX A;  1HJF A;  1L7L A;  3ZIW A;  2VUC A;  3AXD A;  1QXP A;  4JHT A;  2VM9 A;  4HLT A;  2ARA A;  3CZU A;  1JMU B;  1C1L A;  4M4R A;  5EHD A;  4JV4 A;  2AH2 A;  2JG8 A;  3ZFF C;  1ND2 C;  5LEK A;  1X82 A;  5ISL A;  4DQA A;  1EAH 2;  5KC6 A;  1OA4 A;  2V72 A;  5LAT A;  3PUI A;  1VJ2 A;  3IT8 A;  2JDH A;  5IVV A;  3HN1 A;  3MDP A;  2JDZ A;  3PHM A;  2AZ5 A;  4IV1 A;  2WS9 1;  3POE A;  1H1I A;  4HMZ A;  2BOI A;  1UIJ A;  1XU2 A;  4MXW B;  1UMH A;  3OJB A;  4YNI A;  1QJY 1;  2NYY A;  4FPO B;  3DL3 A;  1EUT A;  2VTX J;  2QQU A;  2JDP A;  1XXN A;  2A3W A;  2IFR A;  4LO6 B;  1ZYB A;  3E1F 1;  1GOH A;  1ASJ 3;  4IEX A;  4M00 A;  1AR7 2;  1SBF A;  3AZZ A;  5I91 A;  1B35 B;  1WD4 A;  1UYP A;  5C7G A;  3WW2 A;  3N3H A;  2CGP A;  1UIK A;  3VKO A;  4QGM A;  2HWC 3;  3E6C C;  2AR6 A;  3OSD A;  4L97 A;  1JTZ X;  2RM2 1;  3AP7 A;  3KQ4 B;  4AG4 A;  5L7O C;  2XJS A;  2BGP A;  2XVG A;  3K3O A;  2WN3 A;  1AR7 3;  1L7R A;  1CAX A;  1MZE A;  2VOT A;  3WNM A;  4HVQ A;  1Y43 B;  2VOX A;  2HYK A;  4N7I A;  3WNO A;  2DWR A;  4Y1Z A;  4A42 A;  4PBO A;  2YXS A;  4YZ3 A;  3PME A;  3VL8 A;  3O0W A;  3GYD A;  4IEQ A;  3INA A;  3T09 A;  1W9W A;  4A7K A;  3V0A A;  3AJY A;  1L3J A;  1UKG A;  2XUE A;  3GBF A;  1ND3 B;  3N9M A;  1URX A;  3NNF A;  1RUH 1;  2PHL A;  2TNF A;  2VW1 A;  3PVE A;  1N1T A;  4Q4X 1;  5A6Y A;  5CKM A;  5FZ1 A;  4CDQ B;  4AK3 A;  2JE9 A;  1VMH A;  4CDU C;  2P6H A;  2L9L A;  2VE1 A;  3NNJ A;  4YM1 A;  5LZ6 A;  4ZON A;  1Z7S 1;  2GAU A;  1MS0 A;  5FPX A;  1LEN A;  1AYN 1;  1ND2 A;  3H7Y A;  3TEW A;  2ATF A;  5T3N A;  4EN7 B;  2MHF A;  1JZ3 A;  2W95 A;  1BXH A;  4CP9 A;  4MV2 A;  2AUY A;  3ACI A;  4H7M A;  4XYX A;  4PLM A;  2OUH A;  4NUB A;  2WAO A;  1J58 A;  3MHZ A;  4WBB A;  1ZBE 2;  5FY5 A;  3T0B A;  4IUG A;  1OI6 A;  4Q4Y 1;  1N1V A;  1NCQ B;  3ENR A;  4AI8 A;  2VBB A;  4OZX A;  5KHJ A;  1PGW 2;  1CPM A;  1DP0 A;  1RUF 1;  2RDN A;  3C7O A;  1JHJ A;  3NW4 A;  4N53 B;  3W20 A;  1PO2 1;  3ACL A;  3B69 A;  4UW6 A;  3M3E A;  4YM0 A;  5L9R A;  3GF6 A;  4GJZ A;  3ZPY A;  4P9Y A;  2P3J A;  4L92 A;  4LOR A;  3IBM A;  5D21 A;  1M06 G;  1B35 C;  2RM2 2;  5JSR A;  1AZD A;  5FWE A;  4BB3 A;  2PEL A;  5LA1 A;  5F3C A;  1XRU A;  2VXJ A;  4S2D A;  1RUI 3;  4GKX A;  4WV8 A;  1FAT A;  1YQ5 A;  4PI2 A;  3ZSK A;  3UJO A;  4GH4 C;  5G05 L;  1ZRC A;  5FYM A;  1MZ6 A;  2FDH A;  5BNN C;  1UZY A;  5FOB B;  4FSJ A;  1KFX L;  1QJX 3;  4XFF A;  1HQW A;  3W5N A;  1X9T A;  1LOF A;  2YYO A;  4CVU A;  3N9O A;  1D2S A;  3OEA A;  4HAN A;  1W9Y A;  2I74 A;  3ZKY A;  1JZ8 A;  4IL7 A;  4A44 A;  4LE3 A;  1LTE A;  5CB7 A;  4TN7 A;  1ZBA 3;  4X8N A;  4IW3 A;  1F15 A;  4I30 A;  5FTT C;  1AVB A;  1CZS A;  3ZLI A;  3S5A A;  2W94 A;  3J8F 2;  2O8O A;  2J1A A;  2JG9 B;  4BIS A;  3N9N A;  4JQT A;  5FBJ A;  5DMY A;  4IGP A;  2FZ2 A;  4JGY C;  5C5U A;  4DEV A;  1W2O A;  1NLR A;  2D5F A;  4Y24 A;  3RZG A;  1EV1 1;  1ZRF A;  5BNO C;  2XH6 A;  2ZGR A;  1OOP C;  2ZEY A;  1KJL A;  4YGC A;  3SQO A;  1PX3 A;  2OKX A;  2P3K A;  4DUV A;  3BOP A;  3S7E A;  4XIL A;  1UCX A;  2YU1 A;  1UY1 A;  3KV6 A;  1NAE A;  5A6Q A;  3IZO A;  2FDJ A;  2R1D A;  2TEP A;  2ET7 A;  1QH7 A;  2Y8K A;  3PJY A;  2ZZQ A;  3USU A;  1S0C A;  3ZM8 A;  2VZ1 A;  2C9A A;  1JUH A;  2VZT A;  4CP2 A;  2WKK A;  1OKO A;  3J9S A;  1W2N A;  1VMJ A;  3NNG A;  3LSE A;  5CZK A;  4Q8L A;  3EHK A;  3O14 A;  3PUQ A;  4HSL A;  1QNW A;  2EIG A;  2WNV A;  2ZX1 A;  5JZG A;  1CES A;  1NYW A;  2ZKN A;  4Y20 B;  2R49 A;  4PDW B;  1JYV A;  4PBP A;  3HD8 B;  1T6G C;  1VBC 2;  3C7E A;  3LA3 A;  1ZRI A;  4HOO A;  4KMQ A;  2QKD A;  2HWD 3;  3CZJ A;  3JBG 2;  1H9P A;  3MUZ 1;  2FCT A;  1SBE A;  2HWE 2;  2WWU A;  5HCA A;  3GZU C;  5HV0 A;  4WVV A;  1VBB 1;  1WME A;  3H8U A;  1WLT A;  3ZMO A;  1AL0 G;  4AHW A;  1VBE 3;  4GH4 A;  2VGD A;  3OY8 B;  1JZ5 A;  2XR4 A;  3DYO A;  3SCG A;  3VDA A;  4XJA A;  3WP5 A;  3SMH A;  4KU8 A;  4N90 A;  1PM7 A;  4EN6 B;  1OH3 A;  2X05 A;  4AF9 A;  5F9T A;  2WQ8 A;  2V5Y A;  1DYO A;  3OY8 A;  4XW3 A;  3ZXJ A;  4CTE A;  1Q5O A;  5IVF A;  1JOJ A;  2FQP A;  4MGI E;  1R1A 2;  5FWJ A;  2A1X A;  1OF3 A;  3RFR A;  1H1A A;  3KV5 A;  1K5M C;  2C9K A;  5JXJ A;  3WNK A;  2DCZ A;  3AX4 A;  1SEF A;  3FBM A;  4FTS A;  3N9Q A;  4FP2 A;  5E1R A;  4CCC A;  4L99 A;  1A78 A;  1ULD A;  3ILN A;  1ZZ6 A;  1S4C A;  2BGC A;  3AKP A;  2JXA A;  1YFX A;  2A6V A;  1G86 A;  4JCK A;  3VDD A;  4B4Q A;  1QGL A;  1VBB 2;  3KF3 A;  4QU2 A;  4RGA A;  1I5P A;  2WS9 2;  5EYX A;  1RIR A;  4E2Q A;  3LKJ A;  4MH0 E;  1VBA 2;  3PUS A;  3Q8F A;  3TWI A;  1AR8 1;  1JU4 A;  2RS1 3;  4QPI B;  1EPZ A;  4CXY A;  1W8O A;  1ZRE A;  2P5B A;  3AYA A;  3VBU C;  1MZ5 A;  4E8C A;  2QQL A;  5JXG A;  1UYX A;  3H3L A;  1DYP A;  2DCY A;  2ENR A;  3MFC A;  3NKG A;  4BQW A;  5C3P A;  2WSV A;  1A34 A;  2NM1 A;  1YYN A;  4XZU G;  2WNV C;  1QOO A;  5JZG C;  1OFN A;  2SLI A;  2WUH A;  3DYM A;  5LAS A;  1Q56 A;  1ZZ8 A;  2ZMN A;  4Q0P A;  2KD7 A;  4LKF A;  1H9W A;  1AX2 A;  3FL7 A;  4QKB A;  3U11 A;  4LEJ A;  2XON A;  4PLO A;  5EIY B;  2E7T A;  3FE5 A;  2ARC A;  2D3P A;  4LKD A;  2VQU A;  3ZFG A;  3B5L B;  4W6Y A;  4A7Y A;  2XML A;  3MIE A;  5KR7 A;  1DQ1 A;  5BNP C;  1W6O B;  5AC9 3;  5ABJ C;  3NWK A;  2KXL A;  2OVU A;  1XYN A;  3KVA A;  4QQH A;  5LBF A;  4AQT A;  4BOW A;  2AGS A;  4IEU A;  1YFU A;  2MEV 2;  1OLR A;  4Q1P A;  4AYU A;  3TEZ A;  3ZR6 A;  1POQ A;  4JGZ C;  1HRI 3;  1ZZC A;  4FPH A;  2R06 2;  2GMP A;  4R9B A;  3U4X A;  3ZYR A;  4XC9 A;  1ZZ9 A;  3VBS A;  2W39 A;  3OGS A;  2ZS6 B;  1K5M B;  1EP0 A;  2GAL A;  5I0U A;  3ZYB A;  1U5Z A;  4KL1 A;  3PMS A;  1X7N A;  2GH8 A;  2VZQ A;  3KCX A;  4RA0 A;  3M4F A;  5FZ4 A;  2VTF A;  3ZFF A;  4E4S A;  2P37 A;  1GSL A;  4F83 A;  5JVV A;  1G7Y A;  4LPL A;  2VCB A;  4AI0 A;  1V6I A;  1SLC A;  1GMM A;  4B29 A;  1RJ7 A;  3WF1 A;  4AVT A;  2E6V A;  2J1U A;  3TEY A;  2WNO A;  4LO8 A;  1UOJ A;  5JOZ A;  1R08 1;  1DQ6 A;  3OUI A;  2BVB A;  4XQD A;  3MW4 A;  1W6N B;  1YRZ A;  4Q4W 2;  4W4Z A;  2Q8C A;  3TRS B;  3WHU A;  3ZKU A;  1QHD A;  2KR2 A;  5APA A;  1VAL A;  2LRO A;  3MIH A;  3PJQ A;  3ZYJ B;  2DUQ A;  2ES3 A;  3ATG A;  2WO3 A;  1OH4 A;  3SH5 A;  2VZS A;  5L7O A;  4IV3 B;  1V00 A;  3OTF A;  4BQ4 A;  2Z2S B;  2OW4 A;  3ZFE A;  5FKC A;  3UKT A;  1WCS A;  4FO9 A;  2YUE A;  2G19 A;  1MR5 A;  3V56 A;  3TB0 A;  2W92 A;  5FMD A;  4C0B A;  1W6M A;  5FZI A;  1JOD A;  5DUX A;  2IXK A;  1QJY 2;  5IAV A;  1WD3 A;  5A80 A;  2WZR 3;  5HXV A;  1O91 A;  1AR8 3;  4R4X A;  3OG2 A;  3FLR A;  4RFT 0;  4XF1 A;  3WY6 A;  5ABJ B;  2MNG A;  1SQ4 A;  1W9T A;  3O0V A;  5CAD A;  4NPM A;  1GLH A;  1JHN A;  2HWB 3;  2Y0I A;  3GBW A;  5FYC A;  1BEV 2;  2FHR A;  2BWC A;  1RVF 1;  1XNA A;  4XUP A;  1SCR A;  1ZBA 2;  2FZ1 A;  2N7G A;  2X5I B;  2YFU A;  5A6X A;  1JZ6 A;  1JYT A;  1IPJ A;  2GU9 A;  4YRD A;  1NCQ A;  1SFN A;  2DCJ A;  4XQW A;  1GFF 2;  2HWF 3;  5L9B A;  2CDO A;  4EV0 A;  2X53 S;  1FPN 3;  1LGN A;  2IXL A;  2JB8 A;  3GGL A;  4D94 A;  2RJK A;  4FPE A;  3ST7 A;  2VMH A;  4ISQ A;  2CSG A;  3ZO0 B;  5I0T A;  3QD6 A;  3THP A;  1WMD A;  4BQ3 A;  3FBY A;  1A8M A;  2OII A;  4NE9 A;  5DDJ 3;  1HB1 A;  3A0N A;  4Q4V 2;  4ERO A;  1FPN 1;  2A75 A;  1F2N A;  5K7P A;  2RR1 1;  3O12 A;  1AR9 2;  4D7T A;  4LIT A;  1UPS A;  4LO7 A;  3WDT A;  4UFI A;  1VMF A;  3GHM A;  2ERF A;  2G9F A;  1YJK A;  5FY8 A;  3ETQ A;  5FYZ A;  2YZ4 A;  4DIQ A;  5LEJ A;  3JBG 1;  1W9F A;  5CFD B;  3PVN A;  4D6R A;  3S57 A;  2ZCW A;  5I8Y A;  1XE0 A;  4QHZ A;  1IPS A;  1UXZ A;  3ZDV A;  1U5X A;  2VEC A;  4HXC A;  1S0J A;  1UOB A;  4NRQ A;  3T3Y A;  3WSO A;  5BNN A;  4AI1 A;  3NJX A;  5C9A A;  2G9G A;  1YWK A;  1SLL A;  2VAU A;  3HR9 A;  4IGO A;  4OHV A;  5FYB A;  1RGS A;  1FT9 A;  1W0N A;  3JD7 3;  4BLJ A;  5CIS A;  5FYT A;  2WNE A;  5A7W B;  3GAL A;  2DBN A;  2ZGK A;  5T5J A;  3U4S A;  1J59 A;  4AEJ A;  5CVR A;  5DQ0 A;  4A6S A;  3A23 A;  1O6U A;  5C70 A;  3VZL A;  4N9I A;  3M3C A;  5DZG A;  1R1A 3;  4PF5 A;  4JTO A;  4FPY A;  1K42 A;  4L9B A;  1C28 A;  2XWJ B;  2B9V A;  3A22 A;  1NZC A;  4QQP A;  3GJA A;  3FX3 A;  2ETE A;  3I2G A;  3QCW A;  1RUC 2;  1UQX A;  4IER A;  2QQJ A;  2ZX2 A;  3UGF A;  1S0I A;  2BYV E;  1V9U 3;  3AZV A;  3PNA A;  3SEP A;  1HRI 1;  4AI2 A;  3BUC A;  2RS1 2;  4IEY A;  1BMV 1;  4M3C B;  4XOG A;  4CU7 A;  3M3Q A;  4DXT A;  4JX0 A;  3GNE A;  2FDG A;  3RZL A;  1RUI 1;  5FIX A;  3WF4 A;  4FPK A;  1Z7S 2;  4Q8K A;  5FMO L;  3K77 A;  1MQT C;  4QDQ A;  3VBH B;  1ENS A;  2PHT A;  4UBH A;  2YBS A;  4JDN A;  1AL2 3;  4RYD A;  3DN7 A;  4IEW A;  2ZAA A;  1XB9 A;  4MSV A;  1Z7S 3;  1DBN A;  1F31 A;  2Z79 A;  4QKD A;  3IDE A;  4CEW B;  3U78 A;  1OF4 A;  2P1B A;  5C6C A;  2K46 A;  2H0V A;  2PXJ A;  3KV9 A;  3IDB B;  4M01 A;  5FP4 A;  1F4H A;  4YVW A;  1QMJ A;  4DS0 A;  3OGV A;  3K75 B;  4ZHN A;  4NID A;  1C57 A;  2H0B A;  2VPV A;  1KS4 A;  1NE4 A;  4FPL A;  4L0P A;  3UJQ A;  3BAL A;  1DZQ A;  1ST8 A;  4JZR A;  5E16 A;  3DKW A;  5A7N A;  1K45 A;  4FBF A;  2D7F A;  2YB7 A;  3DF0 A;  4K7J A;  4TLG A;  5JOY A;  4KNC A;  1LOA A;  3RZH A;  2VQT A;  1OUS A;  1QXR A;  2MEV 3;  4UFM A;  3O1O A;  4XF9 A;  3AL6 A;  4QQO A;  1NCR C;  5J36 A;  1PIV 3;  2QDR A;  2W1U A;  1FNZ A;  1H4H A;  1QQP 2;  4N9H A;  4XMA A;  2FMD A;  1OD3 A;  1QU0 A;  2ID4 A;  4CEW A;  1WW4 A;  4XFC A;  1N3Q A;  2A3Y A;  4EWE A;  4R4Z A;  4YVW B;  5KXE A;  1P8J A;  2C6S A;  4D6Q A;  2ZMK A;  2YC4 A;  4PF1 A;  4QQ2 A;  4CCN A;  4P14 A;  3UGH A;  1DQ4 A;  1V6M A;  4AEK A;  5F5C A;  1YFY A;  1CAX B;  3WX5 A;  4ATE A;  2WJS A;  1FI2 A;  3ROU A;  4GZ9 A;  2ZEZ A;  1HV0 A;  3A21 A;  3MBW A;  2DVA A;  3E97 A;  1JYC A;  1DZT A;  4C0H A;  5FMB A;  4MO3 M;  3OF1 A;  2W1Q A;  3AMQ A;  4QXC A;  3FUQ A;  2A6X A;  4Y22 A;  2RJL A;  1EV1 3;  3ZXE A;  4JGZ B;  4CE8 A;  4TLF A;  3BGA A;  2J1T A;  2JDK A;  3MEP A;  5F3E A;  1IG0 A;  4ZZ5 A;  2DBI A;  2XOM A;  2WWJ A;  4XF3 A;  1OMI A;  1DLC A;  1XE7 A;  4AQS A;  4ASL A;  2NQY A;  4YZ4 A;  1AYM 3;  2RS5 1;  4FFF A;  4KWK A;  2E31 A;  2PLV 3;  1AR6 1;  1K3I A;  1ZZ7 A;  2R32 A;  1NT0 A;  2PFW A;  3I59 A;  3OPZ A;  4NAO A;  4CEY A;  1RUE 1;  4OI4 A;  5F5Q A;  3VKN A;  2WYS A;  1PVC 3;  1ZA7 A;  4XUT A;  1AYM 2;  2GNT A;  1D4M 2;  3A7Q A;  1VRH 3;  1H0B A;  4JKM A;  3IB3 A;  1LR5 A;  1JYW A;  2ZGP A;  4LBQ B;  1RTV A;  1A3K A;  3FN9 A;  1D0G A;  1HQL A;  2YGM A;  4XUO A;  2VUA A;  3RVH A;  1TG7 A;  3WT3 A;  4COZ A;  1AF9 A;  4AOC A;  5A1A A;  1FPN 2;  1V6J A;  1IHM A;  5BY5 A;  3ZVX A;  1IQA A;  5T50 A;  4NMI A;  2W1W A;  1VIW B;  3R4S A;  4D8M A;  3OBA A;  4W50 A;  4LBQ D;  3WG4 A;  4UFJ A;  1PZ8 A;  1YO8 A;  2Y60 A;  2XWB B;  4JKK A;  3KSC A;  3ZSE A;  4RQP A;  3TN9 3;  4DPN A;  5A1L A;  2ZAH A;  5T52 A;  1TZO A;  4LA2 A;  2HLE A;  1F8V A;  2CDP A;  5J7M A;  5FY9 A;  2VVD A;  3AZX A;  2TBV A;  3MW2 A;  2ADD A;  3POB A;  1FOD 2;  5F8P A;  5FUN A;  5FZC A;  5F37 A;  2EIB A;  1ULC A;  2H6C A;  1CAU B;  5KXD A;  1QWR A;  1WGP A;  3A4U A;  4XUN A;  4H14 A;  1SHW B;  4P00 B;  2VQ0 A;  2IXH A;  2EAK A;  2YPJ A;  2VZP A;  3W59 A;  3V65 A;  1BLZ A;  2X5I A;  4YW6 A;  2ZEX A;  5T5L A;  2VVE A;  5FZE A;  4H55 A;  3WUD A;  4OHY A;  1TNF A;  1JYX A;  1WCQ A;  1N1S A;  3AYC A;  3JB8 A;  1GNZ A;  1XSR A;  3QOP A;  1GKB A;  2VOK A;  5JCT A;  1ND2 B;  3MI8 A;  1I6X A;  1S0G A;  2WT0 A;  5LK5 A;  3CF6 E;  2BFU L;  3FFQ A;  3RYK A;  4RHV 2;  3EBR A;  4B4R A;  4KWU A;  4FCA A;  4N43 A;  3MF9 A;  2WN2 A;  2VNV A;  1RUF 3;  1OKQ A;  2JKB A;  2ZXQ A;  5A3L A;  3ZYG A;  3OCP A;  1C5I A;  3I2K A;  4JC1 A;  5JR2 A;  4ASM B;  5IFT A;  1LEC A;  3SKJ E;  4QWN A;  4MX3 A;  1MEC 2;  4J6G A;  3T08 A;  2HKX A;  3ZFE B;  1NY7 1;  5CKQ A;  3VLB B;  4IV3 A;  4YG0 A;  5FDB A;  1RUE 3;  2BUK A;  5FZD A;  4Z92 B;  1LGC A;  1S0D A;  1XNT A;  2YV8 A;  4TWT A;  3K2O A;  1AYN 3;  2Q8O A;  3DV8 A;  4R52 A;  1QJU 2;  5L7O B;  3WQB A;  3VZM A;  3OBT A;  4HK8 A;  3NV4 A;  2WAA A;  1NE6 A;  1AX0 A;  1LOC A;  1UZ0 A;  4U36 A;  5F3I A;  3WDV A;  3I3D A;  3FFZ A;  1YEW A;  4KBB A;  4SBV A;  5D1I A;  5G04 L;  4XAA A;  3VGI A;  1B35 A;  3FHA A;  4AHZ A;  2JG9 C;  1HB3 A;  5KXB A;  2JE7 A;  5IYY A;  4TYS A;  4FAH A;  3N9P A;  3NAP B;  5LBE A;  3IMN A;  4UXA A;  1W6Q A;  2EXK A;  5DZE A;  4QB6 A;  2WYF A;  5FXX A;  2CY6 A;  2V09 A;  4COU A;  3LSD A;  4FQ4 A;  3WP3 A;  3WR0 A;  2HH9 A;  2VMD A;  1YLL A;  2VH9 A;  4JAA A;  4GXL A;  2O1Q A;  3PIJ A;  4FFH A;  4GQ7 A;  4IEO A;  4HN1 A;  4J1X A;  4JGY B;  3OD0 A;  3RWK X;  4V1P A;  5IVE A;  1QIQ A;  3I2H A;  3OEB A;  2PLV 1;  2W52 A;  4Q2F A;  1I1E A;  1DU3 D;  1XSQ A;  4XAE A;  3AMN A;  3K46 A;  4I02 A;  4CDW A;  4IXL A;  5FUI A;  3KT7 A;  4UBG A;  4LK6 A;  3IAP A;  4ONU A;  1ZZB A;  2XXZ A;  4GKY A;  1XU1 A;  2XLF A;  5ANN A;  1GQH A;  2W1S A;  3WIN E;  1OOP A;  5JSP A;  1C4R A;  2QFE A;  1NG0 A;  4WVW A;  5FYI A;  2GME A;  1QH6 A;  1RVF 2;  2BNM A;  2GP3 A;  1ZBA 1;  2YC2 A;  1N47 A;  4QPG B;  1CX1 A;  1Q8S A;  4ARX A;  2C26 A;  4Y33 A;  5A3T A;  2VXR A;  3LE0 A;  2XVK A;  1W6P B;  1MQT A;  5IVC A;  2XQX A;  1Q43 A;  4MGS A;  4FOV A;  4XQ4 A;  4B8E A;  1RVF 3;  1JZ4 A;  4UFK A;  4OI1 A;  3RZZ A;  3WG3 A;  5JPM B;  4NHM A;  3LDB A;  1ZX5 A;  4A2U A;  3RZM A;  4Q26 A;  2W08 A;  4QPI A;  2XHK A;  5FBZ A;  5A3N A;  1KQR A;  1JH5 A;  2QZ3 A;  3T1M A;  3AXE A;  4CCJ A;  1E5S A;  1S0B A;  5KXC A;  3O1T A;  4Z8B A;  3VDD B;  3KMH A;  4JQR A;  1U5Y A;  1V6L A;  2WA3 A;  4BQ1 A;  4BQ2 A;  1RUI 2;  3HPN A;  4BPZ A;  3EQE A;  1RUJ 3;  3WLU A;  1H6Y A;  3H8R A;  4FTB A;  1GZC A;  1PO1 3;  2VCM A;  5I0S A;  1QJE A;  4XUQ A;  2OX0 A;  2HBU A;  1X36 A;  5IK4 A;  5JLV A;  2K9Z A;  1G9A A;  3AK0 A;  4LBO A;  3O5S A;  1EYB A;  2QE3 A;  4KG8 A;  1UZZ A;  2WT1 A;  2WQZ C;  1I3H A;  4UF0 A;  3UYJ A;  2Q5T A;  1HN1 A;  5SV8 A;  3ORJ A;  1GOG A;  3WQ0 A;  4E9K A;  3WNN A;  3A0K A;  1QJZ A;  5FZH A;  4CRQ A;  2UWB A;  5JMO A;  5DZF A;  4AFA A;  2VTX A;  5M0T A;  3BU7 A;  5CAZ A;  4K1Y A;  3BPS A;  5CNA A;  1RHI 1;  3VB9 A;  3OUH A;  5AFB A;  1R09 2;  3RQ0 A;  2W5F A;  4DY5 A;  5DAW A;  2XLA A;  2E7Q A;  4RFR B;  4BXS V;  4DUW A;  3VHP A;  4FP3 A;  1NXM A;  2C1F A;  2ADE A;  2OA2 A;  4HKW A;  4TXW A;  2QJV A;  4XIK A;  3VBU A;  2WNV B;  1AR6 3;  5JPN B;  4WZC A;  1UPI A;  3AJZ A;  4W6W A;  1VAV A;  2A3X A;  2GN3 A;  5L73 A;  4AVS A;  1G9C A;  3KLS A;  2Q8E A;  4L11 A;  2X09 A;  4BQY A;  4BU2 A;  4X8P A;  1DHK B;  5EP9 A;  3L9J T;  5FZO B;  2NMN A;  2V73 A;  2YU2 A;  1GP5 A;  2EIC A;  4ES8 A;  1VBC 3;  2Y33 A;  3POJ A;  2RV9 A;  3I59 B;  4YGD A;  2LS6 A;  1YFW A;  5D2A A;  5EV7 A;  1E5R A;  2ZZJ A;  2BP6 A;  1J1L A;  3CEW A;  3TOJ A;  1ODM A;  1LKN A;  4Y4Y A;  3LDR A;  3HOB A;  1YIF A;  2ZML A;  5F2S A;  3RG0 A;  1CIW A;  5CBL A;  1IG3 A;  3M70 A;  4MET A;  2UYA A;  3AFK A;  1NX9 A;  1H6X A;  2XL9 A;  4YSF A;  2BGO A;  2HBT A;  4Q1R A;  4QB1 A;  4QGL A;  4RGG A;  5FCC A;  4AWD A;  4MOA A;  2JDM A;  4JGZ A;  4PCR A;  4ZU7 A;  2DVB A;  2MPF A;  1W90 A;  5E89 A;  1H4G A;  2BWA A;  3PUA A;  3KB5 A;  2PQS A;  2Y64 A;  3VBS C;  1RUD 2;  2WO7 A;  2XGX A;  5LB6 A;  2VZO A;  1GP4 A;  3I7D A;  1CZV A;  4RHV 3;  5FV3 A;  3VBU B;  2DFB A;  3DEC A;  2BBA A;  4OYU A;  4PQQ A;  3SC7 X;  4K3U A;  3ZN6 A;  3BU0 A;  3ZYI B;  3MIB A;  2EXI A;  4Q4W 3;  1G9D A;  2H6B A;  3CMG A;  4LOT A;  4MUV A;  1RUD 3;  5FPZ A;  3WG2 A;  4XHB A;  3O1U A;  5CG9 A;  4LO5 B;  2XJV A;  4CCM A;  2R04 3;  3BCW A;  2I2S A;  2K2S A;  1QOT A;  4LLO A;  3KT1 A;  3VD5 A;  5FMC A;  2RMU 2;  3W58 A;  3D3A A;  3LGR A;  4RQP C;  3RSJ A;  1XC6 A;  1JYN A;  4Q0S A;  3E6D A;  3K4Z A;  3MGU A;  4CUA A;  3AZW A;  4IGQ A;  5D8A B;  4MHR A;  5HPO A;  3G7D A;  3H8X A;  2PHW A;  3HQU A;  2IVI B;  4HL0 A;  1RED A;  1N3O A;  5AVA A;  2Y6J A;  1GZ9 A;  5GZE A;  1ASJ 1;  4QHO A;  5DUV A;  5FY4 A;  2AAC A;  4DIN B;  5FPB A;  3WW1 A;  1TE1 B;  4GB3 1;  5A33 B;  1PNG A;  2NMO A;  1TMF 2;  2B4K A;  1XE8 A;  2OUJ A;  5T5P A;  1FMD 3;  4XE9 A;  3VD7 A;  2QUO A;  3ZXD A;  3PTY A;  1IGO A;  3E5X A;  1ND3 C;  3M3I A;  3MIC A;  4DEQ A;  1QKQ A;  3VKF C;  4MG2 A;  2VME A;  4JTN A;  3OBR A;  3ON7 A;  1S2K A;  2D93 A;  2C0Z A;  4XZP A;  4IE4 A;  5AC9 2;  2IFW A;  4ZS3 A;  4NO4 A;  3WNX A;  4WM7 B;  4YVS C;  2UYB A;  4N43 C;  3N36 A;  1D4M 3;  3HAG A;  3V0A B;  1RHI 3;  4ES9 A;  2V4A A;  3HN3 A;  2VR4 A;  1HV1 A;  3KVB A;  3P6B A;  3NJZ A;  4XBQ A;  1G6N A;  2ZGN A;  2F17 A;  4QPG A;  4N43 B;  5JWP A;  1NCQ C;  1LEM A;  4C91 A;  3CJI A;  1KIT A;  2VUD A;  1AUY A;  1UAI A;  4FFG A;  1DGL A;  1OUX A;  2RMU 1;  4URT A;  1BHG A;  1PO2 3;  5GLV A;  4XIO A;  1CIY A;  4HPK B;  5I8T A;  1CON A;  4BYY A;  2J7M A;  4PIX A;  2VZV A;  4PIY A;  3HBK A;  1BBT 3;  4O61 A;  4XJU A;  5A3O A;  5HXM A;  1H2N A;  1CR7 A;  1UMZ A;  2FDI A;  4QB2 A;  1NXD 1;  4CZS A;  3EJK A;  4WVM A;  1ULO A;  2VD7 A;  1RJ8 A;  1TMF 1;  1GZW B;  2RDQ A;  2YBK A;  4GWM A;  4UFH A;  3U0Z A;  1BBT 2;  2I45 A;  4QQL A;  4QDS A;  1CVN A;  2IZW A;  2BVV A;  1QY4 A;  3CJX A;  1UO9 A;  2DYC A;  2VQA A;  3JD7 2;  3LFI A;  3NMB A;  3Q9O A;  5DUW A;  1OD5 A;  2RDS A;  1UY4 A;  1W6Q B;  4DRR A;  5CYY A;  5FZ0 A;  5A32 B;  1APN A;  4LUM A;  2VW0 A;  5B4N A;  2IXJ A;  3I2I A;  3N9L A;  1RUH 3;  1PGS A;  3E5Q A;  5ANQ A;  4YW1 A;  3HQR A;  4MZU A;  4E27 A;  5E8A A;  2RS5 3;  3G6J B;  3LCP A;  1HRV 2;  5GLW A;  3RZJ A;  1W9S A;  4Y1X A;  3WDX A;  4BLI A;  3AYD A;  3I4I A;  4FVV A;  3S7I A;  1PK6 A;  5FR3 A;  4YVS A;  4YVS B;  1HXS 2;  1RUF 2;  2SBA A;  3ZXA C;  3H1Y A;  3I97 A;  2HWB 2;  1V6K A;  4OMC A;  1HRV 3;  2J1R A;  1UU5 A;  3Q8C A;  2I07 B;  3B7M A;  1MVQ A;  4R9A A;  2ZJC A;  1S1A A;  5FO7 B;  1JYI A;  1MPX A;  4LHN A;  3O0X A;  3MV1 1;  3UKN A;  5EJZ B;  3I2J A;  4XJ8 A;  2XPJ A;  3FC0 A;  5FP8 A;  4LUL A;  4XTP A;  4YZ1 A;  1REE A;  3ZYH A;  1QJU 3;  2FMY A;  1MS3 A;  4Z82 A;  4HON A;  1STM A;  2W3J A;  5BNP B;  5FP9 A;  3FWE A;  3K4A A;  1NA1 C;  4K8F A;  4NAM A;  1IS6 A;  1UY0 A;  1WKY A;  4LXL A;  4Q4V 3;  1KRI A;  4FAG A;  4OHW A;  1W99 A;  4Y5Z 0;  4O65 A;  1TME 3;  3JXS A;  4OUM A;  4Q4W 1;  1COV 2;  5E6H A;  2D3S A;  2J1E A;  5F3G A;  1W06 A;  3WD5 A;  1FNY A;  4GIQ A;  2ZEW A;  3J8F 1;  4AFM A;  1ULF A;  2ZHL A;  4YFZ A;  4GJY A;  3H3U A;  1VP6 A;  1RYY A;  2R30 A;  2WWS A;  4LBJ A;  4DB5 A;  3LQC A;  2FDK A;  5C8W A;  3MV0 1;  3GDB A;  4FI9 A;  4KG0 A;  1VBE 2;  4UWD A;  4D3W A;  1O5U A;  5F6K A;  3U14 A;  5ABJ A;  2O14 A;  2WA4 A;  5JI7 A;  3AB0 A;  3CIH A;  4OI2 A;  1FMD 1;  1E57 A;  4YVW C;  5JXI A;  4NHX A;  1UL9 A;  4MGQ A;  3VZN A;  1LU2 A;  5KC5 A;  2Y38 A;  4KGG A;  3AFG A;  4ZY9 A;  3VZJ A;  4AL9 A;  3QBQ A;  2EAA A;  3BTA A;  4OLL A;  4FXK B;  1FV2 A;  2UU8 A;  3FMG A;  5EJ3 A;  1IQD C;  1W0P A;  3BYW A;  4NVP A;  2GDF A;  4P02 B;  2D3R A;  2ZX3 A;  1COV 1;  5AFE A;  1BK0 A;  1PGL 2;  1VBC 1;  2A73 B;  3WXP A;  2ZA9 A;  1IZ3 A;  2VG9 A;  1O4T A;  2DVF A;  2GC0 A;  4XFH A;  4P9J A;  4LJH A;  2VU9 A;  4XBL A;  1RUN A;  1VPH A;  3I3B A;  3HNB M;  4FPJ A;  3KS7 A;  5A7O A;  2HWD 1;  2RE9 A;  3ME2 A;  2Z5W A;  4HG6 B;  5LRS A;  2DU0 A;  3DKQ A;  5IVB A;  3S5Q A;  1NA1 A;  4Y1U A;  3FLP A;  2CNA A;  4QPY A;  4I2O A;  2CTV A;  1W8T A;  3HBZ A;  1DF0 A;  4XFB A;  3WVJ A;  1VB4 A;  4C1X A;  3MLK A;  1X8E A;  2WO1 A;  1F4A A;  2QQW A;  4WM8 A;  2JJ6 A;  3HT1 A;  1LHO A;  5EWS A;  1LHW A;  3THC A;  1OA2 A;  4NRP A;  3T0D A;  1TMF 3;  4GWN A;  4Q0U A;  5IW0 A;  3UGG A;  2CL2 A;  3LPG A;  3Q8A A;  1DFQ A;  4U2A A;  3POY A;  4K8R B;  4YW3 A;  4KWL A;  1UMI A;  2GMM A;  3ITQ A;  5FZ7 A;  4CCO A;  4C90 A;  4Y22 B;  3SIT A;  3W5M A;  3CU7 A;  2B42 B;  4BMB A;  2A5Z A;  2A70 A;  4YW2 A;  2RS3 2;  2ZHM A;  5FYU A;  3R6S A;  4QX7 A;  2Y34 A;  2W0X A;  4JDM A;  4R9C A;  1CGP A;  3OUJ A;  1O3Q A;  1YJL A;  5C71 A;  4CEY C;  1V6O A;  3R0R A;  1OQD A;  1C5H A;  1U0A A;  3SCH A;  2DCT A;  1XQN A;  4IND A;  1C3H A;  3MW3 A;  3VHR A;  2QBX A;  2R07 1;  2GC1 A;  3LA7 A;  1MS8 A;  2G4I A;  1KDM A;  2C4X A;  1K12 A;  1W2T A;  1O8P A;  2B46 X;  4OZO A;  1QJX 1;  3N7L A;  5FUP A;  1SMV A;  4EN0 A;  5C4W C;  2OPW A;  4XAC A;  2CWM A;  3B01 A;  2F6B A;  3U75 A;  3VBO B;  5A7W A;  4FTE A;  3WUC A;  4K1Z A;  3RJ2 X;  2BJS A;  2RR1 3;  3T2O A;  1WLC A;  4P5Y A;  4CDU B;  1PGW 1;  1LCL A;  1FXZ A;  4QX0 A;  4NR1 A;  4D0Q A;  1EPW A;  3U1X A;  4CXX A;  1FYU A;  1MZF A;  3VBF B;  4XCB A;  1PGL 1;  3FUO A;  1PVX A;  4AE2 A;  1DQ2 A;  1CQ9 A;  2ZX4 A;  1S2B A;  2WNU B;  4RR3 C;  4HN0 A;  1ULP A;  2CV6 A;  4AFD A;  1H1M A;  1ND3 A;  5C9A C;  2E51 A;  4HT1 T;  2OPK A;  4AI3 A;  5J3U A;  1GV9 A;  2DU1 A;  2VMF A;  2WLP A;  2HWD 2;  3WDU A;  2X5I C;  1RMU 1;  2VZR A;  4XJ9 A;  3WHT A;  1ZM1 A;  5F7U A;  4MVT A;  3WDY A;  2E53 A;  1HXS 1;  4ATF A;  4LUK A;  1DCS A;  2UWC A;  3H7J A;  1WCU A;  2LAL A;  1LHV A;  4IE7 A;  5KBF A;  1SBD A;  3VBH A;  4LR4 A;  3ZXK A;  2BQP A;  4UF0 B;  2DVD A;  2ZHN A;  1HB4 A;  2VVF A;  2Y6L A;  4XBN A;  4QPG C;  4W6X A;  4BIF A;  4GMP 0;  2GP5 A;  2QQV A;  4CDX A;  3NNM A;  2OZ6 A;  4BDV B;  4O7X A;  4QU1 A;  2GC3 A;  2RDR A;  3M1H A;  4QX8 A;  4E8D A;  1AYN 2;  4Y3O A;  2K0G A;  2ORX A;  4GA9 A;  4XCA A;  3T4H B;  1SDW A;  2R04 1;  4BZ4 A;  1CAW B;  3KT4 A;  5FY7 A;  4I3P A;  5C4W A;  4GAL A;  3H42 B;  4RD7 A;  5IUQ A;  5I0R A;  1YUD A;  5D8A C;  1NUK A;  4BM8 A;  3NAP A;  5DDJ 2;  5JMC A;  1H30 A;  1VBB 3;  2HWC 1;  3WDW A;  2YMZ A;  3IN9 A;  1AR9 3;  3H0O A;  4AVV A;  1GBG A;  1W6M B;  1GQP A;  5KWR A;  2PA7 A;  3P5B A;  4BE3 A;  4Q5O A;  1W8U A;  2GNB A;  3V0B A;  3O1P A;  2ZHK A;  3DUI A;  3P1I A;  4EQV A;  4EWD A;  4BIO A;  1TME 2;  4BH9 A;  4DZG A;  4RR3 A;  1DQ5 A;  2WNU C;  4RR3 B;  1US2 A;  4V2V A;  4DXZ A;  4CUB A;  1GR3 A;  1XYP A;  4B4P A;  5C9A B;  1OT5 A;  3MLJ A;  4PLN A;  3GCX A;  3RPQ A;  4F8A A;  3V0B B;  4IEZ A;  3D5O A;  2DVG A;  4UAP A;  5ERL A;  3O7O A;  1W39 A;  4WM7 A;  3KM5 A;  3SCF A;  5C8C B;  5FYH A;  1D2Q A;  3WEZ A;  2CU5 A;  2EID A;  5CFD A;  1XYO A;  1D7P M;  5J98 B;  5H9Q A;  2G9Z A;  5FO8 B;  3CBN A;  3D6E A;  1RHI 2;  2VOW A;  3VBH C;  3TYJ A;  3BTX A;  3AKQ A;  5A32 A;  1W8Z A;  2D43 A;  2DFC A;  2W2I A;  3PL0 A;  4OQ8 A;  1AXY A;  4YW7 A;  3B93 A;  1L7Q A;  2D6N A;  3KQR A;  2JKX A;  4Z07 A;  4CEW C;  4I0W B;  1XNK A;  3T4V A;  4P9W A;  2ZGM A;  1VBA 1;  3N35 A;  2EIE A;  1JN2 P;  1R08 3;  2D44 A;  1KDK A;  1RUC 3;  1UZV A;  4GUL A;  5F5A A;  4CDX B;  1X50 A;  5IK5 A;  1GWM A;  4MYE A;  2AEN A;  4AFB A;  1IS5 A;  1ZBE 1;  4LBN A;  5FZ3 A;  4Q4Y 2;  4Q4X 3;  3BTY A;  4WVZ A;  2P6C A;  3RMY A;  5GAL A;  4HFS A;  5FOJ B;  3BI3 A;  5D8A A;  3M7A A;  5FZ9 A;  4YFW A;  4ET7 A;  1R08 2;  3OGG A;  1RIT A;  2P3I A;  3OGR A;  5GZF A;  2BZD A;  4NPR A;  1IKP A;  4IE0 A;  3LA2 A;  5FRA A;  4HZF A;  4LOS A;  2R06 1;  4AVC A;  2BER A;  5CA6 A;  4CUC A;  1GWL A;  3S0M A;  3ZN6 B;  3D0J A;  1SFY A;  3TAY A;  1SCS A;  2VL4 A;  4NIA A;  3GJB A;  3GXU A;  3ILF A;  5BNQ A;  2WNU A;  2RM2 3;  4FOY A;  1LOG A;  1DGW X;  1LRH A;  2NZ9 A;  3VDB A;  3OPW A;  1SDD B;  1XND A;  1RUC 1;  1VE0 A;  4MAD A;  4LMF A;  2PQQ A;  4EZ4 A;  5K9Y A;  1SFP A;  4OVE A;  2QTW B;  1IPK A;  1ONA A;  5JZG B;  1SLB A;  1HW5 A;  1KGY A;  4K40 A;  2D98 A;  5FZK A;  5K4L A;  4XDP A;  4YGE A;  2WZ8 A;  5GJ6 A;  5T55 A;  4DXS A;  5FXV A;  2QCS B;  1R1A 1;  2VC9 A;  3LEI A;  4S2G A;  4W8J A;  4DFS A;  1D4V B;  2RS3 3;  3NJV A;  1W03 A;  3VUO A;  4E2S A;  1OLM A;  4LO4 B;  5EZW A;  5FLJ A;  1F35 A;  3THT A;  3RYR A;  1JXN A;  2E26 A;  4KQ7 A;  4FOW A;  1TVG A;  2WL1 A;  5H9S A;  3SXW A;  3J8F 3;  1SG3 A;  4S2F A;  1AYM 1;  4E4D X;  1O4Z A;  2JIC A;  1QXJ A;  3ECQ A;  5FY0 A;  3VBO C;  5A7Q A;  2GNM A;  2D6L X;  4MXW A;  3ABZ A;  2DTW A;  2YPD A;  5DG2 A;  1KXG A;  2VNO A;  2VUJ A;  5FO9 B;  4KH9 A;  2HWB 1;  3VD9 A;  3ZFF B;  3SLI A;  2BEO A;  1UY3 A;  3C8X A;  3ASI A;  2VCA A;  3T1L A;  4AZZ A;  1UYZ A;  2RR1 2;  2TUN A;  2Y0O A;  4KWJ A;  5IWF A;  3VHN A;  4B1L A;  1NQJ A;  1VB2 A;  4OCT A;  3PIG A;  2GND A;  4OUE A;  4G9S B;  4JDO A;  2ZTN A;  1OPM A;  3APB A;  4PT6 A;  4DMI A;  1S55 A;  4NII A;  4D7S A;  1YQ2 A;  3HWJ A;  1GU3 A;  3AP9 A;  4B7K A;  3RMX A;  4QX2 A;  5H9R A;  4BK4 A;  2JIG A;  3KGL A;  2Y6H A;  4IET A;  4AW7 A;  5JOW A;  3VZK A;  3JQX A;  5IAT A;  3ZFG B;  4QM9 A;  4NHY A;  2HWE 3;  2R1B A;  2CWS A;  4JVA A;  3LEK A;  4MGK E;  4QXB A;  5FQ0 A;  2ZGS A;  1FV3 A;  2W47 A;  2AEZ A;  2CGN A;  3T2Q A;  4AR2 A;  1BCX A;  3LIH A;  1G9F A; 
#chains in the Genus database with same CATH homology
 3PUQ A;  5F39 A;  5FJH A;  2XXZ A;  2Q8C A;  5FXW A;  5FP7 A;  5FZG A;  3PTR B;  2W2I A;  5FYI A;  2GP3 A;  4HOO A;  3ZPO A;  4AAP A;  4URA A;  3K3O A;  4CCM A;  4CUG A;  5A1L A;  2WWU A;  4LIV A;  4GAZ A;  4Y33 A;  5FP8 A;  5FXZ A;  5A3T A;  5LW9 A;  4Y4R A;  2YBS A;  5FUP A;  4EZH A;  5FY9 A;  5F32 A;  5FZO A;  5IVC A;  3PDQ A;  5FUN A;  5F5A A;  4IGQ A;  5FZC A;  5F37 A;  4HON A;  5FJK A;  5FP9 A;  3PUR A;  3U78 A;  3LDB A;  5FZI A;  5FZ3 A;  5A7W A;  4XDO A;  2PXJ A;  3KV9 A;  4LXL A;  5FZ9 A;  5A3N A;  5FY4 A;  5FP4 A;  5A80 A;  2XUE A;  1VRB A;  5FPB A;  4CCJ A;  3N9M A;  5IVF A;  5E6H A;  5FWJ A;  5F3G A;  2OT7 A;  5FZ1 A;  4AI9 A;  5FZE A;  3KV5 A;  5A7N A;  2OS2 A;  5FYC A;  5A1F A;  4GJY A;  3N9Q A;  3AL6 A;  2OX0 A;  3PUS A;  3OPW A;  5FZM A;  5CEH A;  3NJY A;  4NUB A;  3K3N A;  2P5B A;  4UF0 A;  3OPT A;  5A7S A;  5FY5 A;  3UYJ A;  4EZ4 A;  3DXT A;  5FPU A;  3PU3 A;  3AL5 A;  2OQ7 A;  3AVS A;  5IVY A;  5FZK A;  5K4L A;  4QWN A;  3DXU A;  5FZH A;  3KVB A;  4D6Q A;  4XDP A;  4UF0 B;  4CCN A;  5FXV A;  4GJZ A;  4EYU A;  5A3W A;  4ASK A;  5FZD A;  2Q8D A;  4LIT A;  5F5C A;  4DO0 A;  2YBP A;  4QXH A;  5FWE A;  3K2O A;  2GP5 A;  5FPV A;  5FZA A;  5FY8 A;  4E4H A;  5FYZ A;  5F3C A;  4DIQ A;  4QU1 A;  4D6S A;  4QX8 A;  4D6R A;  4Y3O A;  5F2W A;  4BXF A;  5FYM A;  5F3I A;  4C8D A;  5FY0 A;  5FY7 A;  5FZL A;  4CCL A;  4QXC A;  5A7Q A;  5IVJ A;  5A7O A;  2Q8E A;  4LIU A;  2XML A;  5KR7 A;  4BU2 A;  3N9O A;  2YPD A;  5FZB A;  5F3E A;  5FZO B;  5A3P A;  4IGO A;  3KVA A;  2YU2 A;  2VD7 A;  3PU8 A;  2WWJ A;  5FYB A;  5IVB A;  5FYT A;  2YBK A;  4TN7 A;  5FYS A;  5FP3 A;  5FYV A;  5A7W B;  3N9P A;  5FY1 A;  3AVR A;  3U4S A;  5LWB A;  3ZLI A;  4CSW A;  5IWF A;  4BIS A;  3N9N A;  5FBJ A;  2XDV A;  5FZ0 A;  4IGP A;  5A7P A;  5FXX A;  5ISL A;  5FZ6 A;  3N9L A;  5FZ4 A;  5IW0 A;  4V2V A;  5F2S A;  4CCK A;  5IVV A;  5ANQ A;  5FZ8 A;  5FPA A;  5FZ7 A;  4CCO A;  5LY2 A;  5LY1 A;  2YU1 A;  5F5I A;  4GD4 A;  5IVE A;  3KV6 A;  4V2W A;  5FYY A;  4QXB A;  3LD8 A;  5FPL A;  3PUA A;  3KV4 A;  5FYH A;  5FYU A;  4QX7 A;  5FZF A;  2OQ6 A;  3RVH A;  5FV3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...