2PXJA

The complex structure of jmjd2a and monomethylated h3k36 peptide
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
347
structure length
347
Chain Sequence
ASESETLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords JmjC domain-containing histone demethylation protein 3A
publication title Structural basis of the recognition of a methylated histone tail by JMJD2A
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 104
structure length 347
sequence length 347
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2007-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 2pxjA01
4XDPA 5FYTA 5IVBA 5FZ1A 4IGQA 4D6QA 2YBKA 5A7OA 3KV6A 3KVBA 5LY1A 4GD4A 4V2WA 5A3WA 4BXFA 3PUAA 5ISLA 5F3IA 3AVSA 4QWNA 5FYSA 5FZGA 5IVYA 4GAZA 3LDBA 5FV3A 5FY5A 3PU3A 2Q8EA 3N9OA 3KV5A 5FPAA 4UF0B 4C8DA 5A7WB 5FP4A 3KVAA 2PXJA 4BISA 4DIQA 5F2SA 4E4HA 5LY2A 5F37A 4CCJA 3AL5A 5FWEA 3U4SA 5FUPA 4QU1A 4LITA 4AAPA 5FZHA 4XDOA 3K3NA 5FZ4A 5FXZA 4EZ4A 3N9QA 3PURA 5FY8A 5FUNA 5FJHA 4Y4RA 5FZBA 2Q8CA 3K3OA 5FY4A 5LW9A 3LD8A 5KR7A 5FYIA 5FXWA 3KV9A 3OPWA 2YU1A 5FZMA 3DXTA 5F5IA 5FY0A 3NJYA 5F5AA 5A7NA 5FY9A 5IVVA 4QX8A 5E6HA 4AI9A 4GJZA 2Q8DA 5F3CA 3DXUA 5F3GA 5FZKA 5FBJA 4UF0A 5A7WA 5IVJA 5A7QA 5FYYA 3N9LA 5FYCA 5FYBA 5FP7A 5FZCA 5IVEA 5IWFA 3AL6A 5FZ3A 5A3PA 4CCKA 4BU2A 4HOOA 5FP9A 3N9NA 5FY1A 5FZLA 4CCOA 5FPUA 4NUBA 5F5CA 5FPBA 5FYMA 4LIUA 5A7PA 2XMLA 5FZEA 3ZPOA 2OS2A 4LXLA 4Y3OA 5FZ0A 3UYJA 5A3TA 5FZOA 2YBPA 4QXBA 5FP3A 5FZOB 3K2OA 4QXCA 5FXVA 5FZDA 2OX0A 2YPDA 2OQ7A 3AVRA 4GJYA 5FZFA 2YBSA 5LWBA 4Y33A 4CSWA 1VRBA 5FZIA 2P5BA 4V2VA 5FJKA 5FZAA 4EZHA 5A1LA 5IVFA 5A7SA 4TN7A 4D6SA 5FWJA 5IVCA 5FZ8A 5A1FA 2OQ6A 4LIVA 3U78A 2GP5A 3PDQA 5FYHA 5A3NA 5F2WA 4CCNA 5A80A 5IW0A 3PU8A 4QXHA 2XXZA 4CCMA 5F3EA 3N9MA 5FYUA 5FP8A 5K4LA 4CCLA 4EYUA 5FYZA 5ANQA 3KV4A 4QX7A 4D6RA 4IGOA 3OPTA 5FZ9A 3N9PA 3PUQA 5FXXA 4DO0A 2W2IA 4ASKA 2WWJA 2XDVA 4IGPA 5FY7A 3PTRB 5F32A 3RVHA 5FPLA 5CEHA 5FYVA 5F39A 2WWUA 2GP3A 2OT7A 2VD7A 2XUEA 5FPVA 5FZ6A 3ZLIA 3PUSA 4CUGA 2YU2A 4HONA 5FZ7A 4URAA
chains in the Genus database with same CATH superfamily
1NA1B 5H9SA 5JSPA 4QKDA 1O59A 2W0XA 4XXAA 4JGZB 5DZEA 3VKNA 1G7YA 1L3JA 1S0CA 5I0RA 1NCQB 4AEDC 2VMDA 1S0JA 4CUCA 2D3SA 2WLPA 2Q4SA 1BBT2 4TZDA 5CFDC 5LY1A 2WT0A 3RQ0A 2YY1A 2A6ZA 2VZ1A 1VRH1 1Z0HA 4CDQA 2RM23 4IV3C 4I3GA 1PGW1 4IXLA 4CDUC 3KV5A 1BK1A 5FPAA 1FT9A 4AI1A 2H6BA 4LORA 5GALA 2VMEA 3QH6A 5F37A 3ZKUA 2DBNA 1HRV3 4XIKA 4J1WA 1DYOA 3K48A 2P37A 1SHWB 1K5MC 3R0RA 5DDJ2 1YC61 5H9PA 2R1BA 2XWBB 2ZX4A 4XYXA 1RUJ1 1CR7A 2VTFA 2QQKA 1RUD2 2PN5A 1OKQA 3L2YA 5LW9A 1JYCA 2ZPXA 1W9FA 4KG8A 4PDWC 4DMIA 5DAVA 4B7EA 1JZ2A 2PLV2 2YGMA 5EHDA 5IVVA 2ZJCA 1AF9A 1C5HA 1EV11 4K8FA 2Q8DA 1WW7A 4LLOA 1R1A2 5A6YA 2XBO2 4FP2A 3I2GA 3ZR6A 4Q4V1 1ZYBA 1MACA 2A73B 5FYYA 4GB31 5F5QA 1NQDA 2VECA 3F95A 3DN7A 5BYNA 1NCRC 2QZ3A 1GP6A 3FWEA 4CCKA 5A3PA 5FP9A 2HYKA 1G86A 4CP9B 4FTBA 1E5HA 4FAGA 1AHSA 3C8XA 3G6JB 3MF6A 4A41A 2ET7A 2RS12 1Z78A 5C8CC 2CGOA 3ES1A 4M01A 3VHPA 2OS2A 1GP4A 2UWCA 3AYDA 3KM5A 4Z1VA 4MSVA 1MQTB 1FMD2 3GBGA 4GH4B 4QXBA 5FP3A 1CAUA 4I09A 2OUHA 1U5ZA 2IFRA 2LRPA 4QDSA 1MZFA 2H0BA 1BZWA 4I0AA 3MIGA 5BXXA 5GZCA 4PLNA 2E7AA 3AKSA 3JD71 2FHRA 1OLQA 3B93A 1O4ZA 3GHMA 1YUDA 2IVJA 2NQYA 4XW3A 1UZVA 4N43B 1KDKA 4EWEA 1WMDA 2GC2A 3BU0A 2EICA 5IVCA 4F7ZA 4E9KA 2VTXJ 3O0VA 4HL0A 2C5DA 2WO7A 4FPGA 3PJYA 2XJRA 5A3NA 1UYPA 4H14A 5CAZA 4XFGA 1FYUA 1PVC2 3PU8A 3R4UA 4CCMA 3GF6A 4INDA 4IV1B 1KD7A 1VBE3 4QGMA 4BZ4A 5C3PA 2Q1FA 2XLGA 4YGDA 1SLBA 5L9RA 3ZXDA 5F8PA 5L7OC 2A5ZA 4NIIA 5A33A 4DINB 4GKYA 1JZ7A 1PVXA 4MZUA 1OVSA 1XU2A 5CNAA 2FD8A 2V4VA 3M7AA 1C1LA 3D5OA 3LEIA 4A7YA 1F9KA 2PFWA 2RR11 1LOEA 1G8WA 2Y60A 2OT7A 1KS5A 3IT8A 3NJXA 4DQAA 4QD2A 3ZLIA 4BQWA 2VQAA 4CDXB 5DN2A 1BKZA 4FOYA 3USSA 2MEV3 2CV6A 3CIHA 1QJZA 1GMMA 3OOXA 3VZKA 4YGCA 2NN8A 1AR73 4CP1A 4AL9A 1LGNA 4XUNA 4CUBA 1JZ3A 1NLRA 4FQ4A 2WT1A 1SLIA 2MNGA 1BK0A 1HRI1 3THPA 1WLDA 1N1VA 2WS92 5FZGA 5GLZA 2E6VA 1V70A 3BTAA 2HLEA 3U0ZA 3KF3A 4IEVA 4LJHA 4L8QA 4YSFA 4OVEA 4FAHA 1NT0A 1MS8A 1WCKA 5J37A 1GLHA 1W6OB 4XIOA 1D0GA 1Q8OA 2CDOA 2D7FA 2GSYA 2Y34A 3TEXA 4AFDA 4AVTA 3E5XA 3VZOA 1SQ4A 4DNYA 1FPN3 5BNNB 1O3RA 3OG2A 3S30A 3VD9A 3M3EA 2XJPA 1V0AA 4XPVA 1ND2C 1XNTA 1KQRA 3OSDA 4XDQA 4CDWA 5IK5A 1VAKA 2Y6HA 4Y20B 2BPA2 3D0JA 5LEJA 1U5IA 5BNPB 5EYYA 1JBCA 3WQ7A 5BNOB 3U75A 1V6KA 3HWJA 3MHZA 5JMOA 3CBNA 5C3SA 3O1MA 1CGPA 4A3XA 4FT8A 4NRPA 1VBC2 4KWKA 4K8RB 2JG8A 4N7IA 1ND3A 1E5IA 2FZ1A 2F6BA 3AFGA 3VZNA 1HJFA 2D5FA 4OFGA 3ZXKA 5IATA 1VBB3 4JCKA 2SBAA 2BERA 1OHFA 4GWNA 4GKXA 4L97A 3H1MA 3KB5A 5F5CA 2DUQA 3UETA 1YQ8A 1G9AA 1QJFA 4KG0A 5CFDB 1LR5A 1QJU1 4JRAA 5KHJA 4A44A 4IV3B 4KBBA 4D7SA 5FZDA 3MW4A 4JV4A 4XBNA 3TAYA 4BMEA 2VU9A 3D3AA 4QKBA 4XZPA 4CDUB 3OBAA 2XQRA 4S2HA 2ATFA 2VBDA 3U1XA 2DCTA 5JXIA 5FZIA 1XE8A 1DZTA 3BIEA 3UV9A 3SITA 1QJX3 5FJKA 4MGIE 5C3RA 1RUG3 1W0NA 5GLTA 1ULOA 4CCEA 1XNBA 4IEPA 4Q4X3 3SKJE 2K9ZA 1WMXA 4CDQC 1UD1A 1DHKB 1H8TC 3KMHA 5L19A 3MI8A 3NNMA 1K5MB 1QDOA 1ZRFA 5AVPA 2VO5A 3DEMA 5FLIA 3BCWA 2VW2A 2J1RA 1J1LA 2OKXA 3RI8A 3U78A 2CSGA 4C91A 2B42B 1R093 2ZGKA 4HMZA 2C9AA 2B8MA 5LA2A 1BYHA 4PDWB 2WNEA 4XUQA 1I9RA 3WX5A 5T5OA 2BP6A 4KI5M 1ASJ1 4AAXA 2DWRA 5FYZA 1J3RA 3LA7A 4W4ZA 4LR4A 1SBFA 1SCRA 4NROA 5FO9B 3HJRA 5LASA 3ZFGB 3E5UA 5LEKA 3CLPA 1HB4A 1NCRB 3ON7A 2WRAA 3WF0A 4AFBA 1LEDA 2WT2A 3OCPA 4Q1RA 3RZLA 5F39A 4B8EA 3O1PA 2RHPA 4NRQA 2X5IA 4DRRA 1MEC3 5C8CB 4D0QA 1CVNA 4NIDA 3F2ZA 3WNNA 1E57A 3NL1A 2UY9A 4MG2A 2HWC2 1DIWA 3JBG3 4IETA 1BVP1 4ZU5A 1IPSA 1XSQA 2XHKA 3I59A 4PF5A 4UOJA 4HK8A 3GJAA 3ZXLA 5LRRA 3GXUA 3KQ4B 3H9AA 4HN1A 1ZRDA 4LBMA 4MXWB 1M06G 5ISLA 1UMZA 4AZZA 2GAUA 5F3IA 3WUDA 3N7JA 3ETQA 4XUPA 2Q8EA 3W5NA 3A21A 2DVGA 2ZX0A 3MIFA 1RUE1 5T3NA 1H9PA 1YYNA 1NY72 3BIWE 1NLQA 2Z42A 3FE5A 1CIYA 4I2OA 3BUCA 2WN2A 1VLNA 5L7OB 2QUOA 4QHBA 5AFEA 4YW4A 4RHV2 5FXZA 4L2NA 1S0DA 3OYWB 3J7HA 3THCA 2OXBA 4JKLA 1YCIA 1BCXA 2PTMA 4YW2A 5GLVA 3ZXAC 2R0FA 2WA4A 5FZMA 1GV9A 1AR91 1COV3 1V9U1 1W6QA 3VD4A 1NE4A 1MS5A 3VD7A 2V5DA 1O3TA 4XTPA 5CKQA 1IQAA 4MVTA 3AMNA 4TSVA 4FTEA 4DOUA 3UJQA 4A3ZA 2N7GA 2A6WA 3M4FA 1H6YA 5JCTA 3ZIXA 4K20A 4XUOA 4PLMA 4NIHA 1W3VA 1DDLA 1VRH2 1QXJA 4GZ9A 2W3JA 4ZS2A 4JHZA 1W6MA 3VBFA 3I3BA 4AI8A 2JDPA 2FDGA 1RYYA 2BNMA 1D2QA 5FMOL 5JSRA 5LWBA 2P3JA 1OMIA 1F15A 1FX5A 3GALA 3MICA 1QMJA 4M3CE 3OUHA 4LUMA 4Y1ZA 3VDAA 2D40A 3NKTA 4CP9A 3WDVA 4QT6A 3AP6A 5CG9A 1RUH1 1VIWB 3T2TA 1ND2B 4XURA 5K7PA 1ZBE3 1ZZ6A 1EPZA 2D6NA 1QWRA 4JKMA 4FFHA 1PO13 2QQOA 3I2FA 3VBUC 4ONUA 1EV12 4H2AA 2B39A 3ZYIB 3KT1A 1JZ6A 3HQRA 4TXWA 2X10A 4Q4V2 3MO4A 2YMZA 4GB32 2ORXA 1AUYA 2JIJA 4XFIA 4XQWA 3DECA 1HV0A 1RITA 4ASKA 4MLOA 4CDWC 1VMFA 1ZBA3 5T50A 3IAQA 1UCXA 3PVNA 1N3OA 1FOD2 1BBT1 2PQQA 5G04L 3H7YA 3EHKA 4RGGA 1C8M2 4B4QA 1OFSA 4PT6A 4HN0A 2JG8C 2CU5A 4XCBA 5KHIA 1ND3C 3UESA 4HPKB 4EROA 2JJ6A 5FYTA 1HIXA 1RC6A 3O0XA 3N7KA 3LF7A 4I30A 3VD5A 2DDUA 4AI0A 1R083 3JD72 3LSEA 3AX4A 1B35A 2VOVA 3BTYA 5JXGA 5EJZB 1UOBA 3WDYA 1BEV1 4QPGC 4FCAA 5KC6A 4KGGA 2JXAA 2EA7A 2WABA 2JE9A 4CDQB 2ILMA 3GYDA 2WFPA 1MPXA 4LKEA 3HIFA 4JGYC 4UF0B 4ISQA 1S0BA 2BW8A 3OGVA 1DYKA 4NPMA 5CISA 5F2SA 1H4GA 1W2NA 1RJ8A 1ULFA 5FOBB 4FPOB 3RZZA 4XFCA 4FQZA 3PMSA 1CWPA 1R1A1 3POBA 4GWJA 5A6QA 1CN1A 2ADEA 2RDSA 2VNGA 3VBHC 2RE9A 1U5XA 1Q8SA 1LESA 1XNKA 5FJHA 4Y4RA 2Q8CA 2NP0A 1RTVA 5DAQA 5FY4A 3NNGA 4L92A 1H8VA 3NV2A 5F5IA 1U0AA 1HDKA 1UZZA 1WMFA 4C1XA 3I4IA 4JZRA 5DUUA 5FBJA 1FMD1 4JQRA 4R9AA 4XE9A 3VV1A 5IWFA 4IEQA 4RA0A 4YW7A 3WQ0A 3RZJA 4FFIA 5SV8A 5DUVA 5FZLA 4OHZA 4OI2A 1RUC1 4NUBA 4FOQA 4N53A 2E9QA 1HRI2 4N90A 5KBFA 1UY2A 4CA9A 2XMLA 1JHNA 2QVSB 3WT3A 3GZEA 1WA4A 4Y20A 2WBKA 3JQWA 4XABA 3TEZA 1CAUB 1PVC1 3HVDA 1I6XA 1SDWA 3ZSLA 3W20A 1OH3A 4E2GA 5HXMA 1WLTA 2ZEXA 1GNZA 3EO6A 2P5BA 4LO8A 1V6JA 4HFSA 3I3MA 1MVQA 1NE6A 4IL7A 3V0AA 3FBYA 5A7SA 4CCDA 4RSUA 1W0PA 4QPIA 1POQA 1VAMA 2R063 3GBFA 3J7NA 3IDBB 3EJKA 2QJVA 4HK9A 5CZKA 1DGWA 2ZZQA 3L2HA 2C9KA 4Q29A 4AEDA 4AOCA 4TLGA 2E26A 4XOGA 1GQGA 1DLCA 5A3LA 1I5PA 5FYUA 2EALA 3JXSA 2WZPP 4AVBA 4EWDA 2BNOA 3CDZB 1PZ8A 1LGCA 2VW1A 5C70A 3T2PA 5HBAA 5KXBA 1CX4A 4CDUA 2QNKA 3MW3A 3LSDA 3N9PA 5FXXA 1COV1 4P9LA 4R4XA 5IT6A 1JUIA 3C7GA 1OUXA 1SPPA 2VC9A 1KFUL 4XAAA 1PZ9A 1W28A 4Q4W3 1YJLA 4HKOA 3NMBA 1OUSA 4XFFA 4Y5TA 1ULEA 3NSTA 4CEYA 3P1IA 4UFIA 3ES4A 3I3QA 1V6NA 2WS91 1JODA 2ARBA 2WQ4A 2GALA 4HETA 2BTVC 1WD4A 1S2EA 1K5JA 1ZX5A 5JXJA 2JG9C 5J48A 4J1XA 5BUVA 3K46A 2AREA 4GIQA 1Q5OA 5A7OA 4QQHA 3O1VA 5JLVA 2J22A 5A3WA 1HKDA 4P9WA 1W8OA 1XRUA 1ZNPA 4E8CA 2VQTA 4PCRA 2P6CA 4OYUA 3VDDA 4IE0A 4LA3A 4WV8A 2EXJA 4XJZA 3LDBA 3B7MA 3VBFC 3IPVA 3I2KA 4KH9A 4WBBA 5I91A 5I0UA 2HJIA 5H9QA 3ZOIA 3AYCA 4AVCA 4LEJA 2Y26A 3KSCA 5C8CA 1JTZX 2VQ0A 1LHOA 2C1FA 4LHLA 5K8SA 1Y3TA 2HBTA 1YFWA 4LITA 3QACA 1C3HA 4DS0A 2AEYA 1RINA 1TQ5A 1WCUA 2B4KA 3ATGA 1NYWA 3GCXA 3K3NA 3ME2A 4EZ4A 4HSJA 1JU4A 4NPRA 4CDWB 1DGWX 2JE7A 1S2BA 4AQSA 2AYHA 3SXWA 1PIV3 4K3UA 1UQXA 2D44A 2A3WA 1UOFA 1OQ1A 2B7YA 5KWRA 5FZCA 2JG8B 5KHKA 1ND3B 4COVA 3ELNA 3LAGA 3IMNA 3WINE 3ZYRA 5I0SA 1W8UA 2WR9A 4B4PA 5A7PA 5FZEA 4L0PA 3VKOA 1QKQA 4E4SA 4AVAA 4MUVA 2VGDA 3OYWA 2JICA 2FQPA 2AACA 4IEZA 3E6DA 3K2OA 5JWPA 3KT7A 2ZGQA 1GYKA 4NWVA 3FLPA 1S55A 1RUE2 4JGYB 2VPVA 5L36A 2YBSA 2OA2A 2B9UA 2QQWA 1UXZA 5TSWA 3ZXJA 1KRIA 1B35C 2OZ6A 3MIEA 5GZFA 3URFA 3NQHA 4H7MA 2CL2A 4CZSA 3NW4A 3D82A 5FZ8A 4META 5KXCA 4Y1XA 2Q1ZB 2QQMA 2WQZC 3IN9A 3USUA 1F4HA 1ZREA 3QD6A 4I3PA 4OHVA 2IWGB 1PZ7A 1UY3A 2P17A 2PHWA 2ZKNA 4HVOA 4AQ2A 3NV4A 2IXLA 5L73A 1Z7S3 2LUWA 1PMHX 3OY8A 1AR92 2VOKA 3FL7A 5CADA 3I7DA 2HWF1 2NLRA 3GCWA 5APAA 4YW3A 2LTNA 2VBBA 4QX7A 2DVAA 4J25A 1OQDA 4M4PA 3VBSA 4AFMA 1N1YA 2ET1A 3RMXA 3HT1A 3ZX7A 2A6XA 4IEXA 2QCSB 1OD3A 4ASMB 4K6BA 3ST7A 2QQUA 3P3PA 3WHTA 1D7PM 1WCDJ 2CWMA 4YM0A 1ULCA 5B2GB 2BWAA 3ZR5A 4FPYA 3WD5A 2XB6C 4LHKA 2IC1A 4OMDA 2YU2A 1MS4A 1REDA 1B09A 3WDWA 4BXSV 1W8TA 3DL3A 2JECA 5IVBA 1KJRA 1GBGA 2XH6A 2X05A 4N53C 1PNGA 1UOGA 3I59B 4AF9A 3KVBA 3IWZA 5SV5A 3HBKA 2Z79A 3POEA 4V2WA 1DYPA 3ZSJA 1IS6A 2DCKA 2XQXA 1RUF3 3IZOA 3BKZA 3VDCA 4HBNA 1ENXA 1GNYA 4LLFA 3EBRA 4Y1UA 3WNXA 3SLIA 1AYN3 3GZAA 3KS7A 5DXDA 2YDEA 2BVVA 1KXGA 2FCTA 3JUUA 3ZSMA 4IEUA 5CBLA 1UU4A 1D2SA 5JOWA 1JUHA 3T1LA 3WW4A 4Z92B 1K42A 2XGXA 1DU3D 2JDMA 2W08A 3ZYGA 4AQ6A 1A8MA 1RHI1 3H1WA 4HPKA 1ZZ7A 3S7EA 3FMGA 4MX3A 4QPIC 2XOMA 1OPMA 1CJPA 1VE0A 2JDUA 4QM9A 5JOYA 1C4RA 1EY2A 2ZBJA 4LBQB 3KQRA 3LD8A 3AP4A 4NVPA 5IAXA 3WG3A 2CHHA 3IIIA 4FP3A 2W87A 3DYPA 2QQIA 4BHPA 3WEZA 4HVQA 4AI9A 1CAVB 1H8TA 1W6QB 2VCMA 3BN6A 2Y0IA 2HWB3 2AH2A 3FUOA 4UF0A 4XFHA 5FMDA 1DZQA 1ONAA 1JYVA 3RZMA 1SBDA 2YC4A 5FZ3A 2P3KA 5L9BA 1VBA1 4FPKA 2BQPA 3D8CA 3MW2A 4P9GA 2XL7A 3IMMA 5FPUA 4CEYC 1J3QA 2OZJA 3W9AA 4ZU7A 1NX9A 4GWIA 1MS9A 4RD7A 2RS53 1BEV2 5C9AA 3FZ3A 1TG7A 1NXMA 1SLLA 2EF6A 5FR3A 1XYPA 4LO7A 5JVVA 1QNYA 3WG1A 2D6KA 3RDIA 5C4WA 1H6XA 3UGHA 2TEPA 1W6MB 3VGIA 3VBFB 1UPSA 1UL9A 3AVRA 1AX1A 4GJYA 4LHSA 4V1PA 1CJDA 1OPOA 2HWE3 4ZZ8A 2J1SA 2WFF3 2Y6GA 1UU6A 4PIXA 1YXWA 1CX1A 1UPIA 1R092 3J8F3 4KGQA 1LRHA 3VDDC 4PQ9A 3OEAA 2BEOA 3WP4A 2E7TA 3A0NA 3PDQA 3RZGA 1FOD1 5JOXA 2WC2A 2W5FA 1ODNA 1FNZA 1WA6X 3AMQA 3KGZA 3PVEA 2OYZA 5J3UA 1JYNA 1C8M1 4RS5A 3LDKA 1AYM1 4ISRA 5ACA3 4RFT0 1GNHA 4YZ3A 1VPHA 5I8TA 1F8VA 4W6YA 5E88A 4CP0A 4D6RA 3QLQA 1V6LA 2UURA 3M1HA 3T1MA 2E53A 2K46A 2WL1A 5HCFA 5FQ0B 5A32A 2YROA 2PAEA 3CJIA 2VZVA 3AKRA 1MEC2 1N3PA 1GQPA 1XB9A 1RUC2 1HJGA 3ACIA 4ZXEA 4BOWA 3ETPA 5CEHA 3NJVA 1X33A 3LEMA 3MGUA 5DG1A 3FX3A 4DY5A 3JBG2 1OOPC 2VD7A 2YC0A 5FRAA 1AR63 5FZ6A 3T09A 2GH8A 5FZ7A 4O9EA 4AVVA 2RMU3 2VULA 1IOAA 1OA4A 5BNQA 1ENRA 1UKGA 2VH9A 3KCYA 3MIBA 4JQTA 1QNWA 4NN0A 1LEMA 1IG3A 2IFWA 4QDRA 3WOGA 4D6QA 3OD4A 1RIRA 3KV6A 1H1MA 1B35B 1JYIA 4YYOA 4E4ZA 3UNPA 2G9ZA 2HWD3 1RMU1 4YARA 3Q8CA 4GMP3 1FI2A 2PHFA 4NAMA 1TNFA 4NO4A 1REFA 1Q8QA 2DVDA 1ODMA 4OULA 4CCJA 4G3YC 1QY4A 2ZABA 3AMMA 3RJRA 1YI9A 2JDAA 4YRDA 4PLOA 5I8SA 2E32A 1VP6A 3HNMA 5FZHA 1OA2A 1S4CA 1Z7S1 2BOJA 2PYTA 1COV2 2RS33 2RVAA 3DCQA 4WVMA 1HW5A 2DVFA 5EJ1B 1TME3 3N9QA 3I2JA 1RUI3 4UW5A 1HV1A 3ACGA 2BDRA 3KV9A 5C7GA 5FY0A 2VMFA 2WZR3 3NJYA 5FDBA 4QX8A 2AEZA 2ZTNA 4W50A 2VNVA 2Z2SB 4JTNA 3RYPA 2BU9A 1CZTA 2OVUA 1SLCA 4M0HA 1QXRA 4QB2A 2OW4A 1G6NA 4HANA 5FP7A 3VBSC 3VBRA 2JENA 3VN4A 2J1VA 4MO3M 2XVKA 2ZX2A 4Q4Y1 5FY1A 5E16A 1O3QA 1QOSA 1X82A 4C0BA 3VBUA 5FPBA 4R9CA 3OD0A 4C90A 3OEBA 4N53B 3ZN4A 3ZYPA 3TRSB 2W1WA 2R043 1S0IA 4OHWA 1LNSA 5FZ0A 2W91A 4ZPIA 1JOPA 3RSJA 1H2LA 1IKPA 5AVAA 2Q1MA 3ZPYA 3LA3A 1UY1A 5EQUA 1RUF1 2IVIB 4LBJA 1NZIA 3K4AA 3C2UA 3ROUA 1AL23 5A1AA 4K40A 2RV9A 3A23A 3H42B 1YFYA 3POSA 1ZBE2 1GOFA 4QMAA 1OXCA 1BQPA 2A75A 2GN3A 3VKMA 5FPZA 4EN6B 3V0AB 5DUWA 1XQNA 3CMGA 4M0NA 5JUVA 2O8QA 1OKOA 3PUHA 4D94A 4QPIB 1ZVFA 2D6LX 3EYPA 4CVUA 1QF3A 4KWLA 4CCNA 4KWUA 2R32A 1UKRA 2XJQA 2ZAAA 1LHNA 4AEDB 5LBCA 5AC93 1AX2A 2KXLA 2QZ2A 3N9MA 4QPGA 1ZBA2 3SMHA 4CCLA 1LENA 2TUNA 3GDBA 4GALA 5ANQA 3WSOA 4JGYA 3UKTA 3PUQA 3IDEA 3VL9A 2YUEA 1W8NA 2RM21 1FAYA 4EJRA 1GUIA 1SPPB 1DQ1A 1VMHA 2VVDA 3QH7A 4E27A 4JC1A 4QXKA 3LKJA 4CEYB 5HXVA 3PMEA 3WCSA 4NOTA 3HT2A 4BLJA 1ULPA 3TN93 1SEFA 1SFYA 1XNAA 2YZ4A 1HRV1 2WNOA 3J26N 3BOPA 5IJRA 3SH4A 3VBHA 1JXNA 3IB3A 1RXFA 3LEKA 2ZGNA 5A3UA 2LW8A 1W9WA 4H55A 2DCYA 2VMGA 1GOHA 5GLUA 5KHHA 5JPNB 2C6SA 1TNRA 1HXS3 1X8EA 2XVLA 3L9JT 3PTYA 1LU1A 3SH5A 3FC0A 4F3JA 3V64A 1UZ0A 1MZ6A 2EIEA 3FBMA 4GD4A 5GZEA 2ZMNA 4YGBA 4BQ1A 5C9AC 2PELA 5A3OA 4B4RA 4P14A 3WDXA 3I8TA 3SC7X 1RUD3 4DXRA 2HWE1 2D5HA 2A3XA 1UMHA 3VDDB 5C4WC 3H8RA 2PAMA 2EXIA 3PIJA 4UBHA 4WVZA 5CVRA 2W92A 2ZKLA 1ENQA 4ATFA 3IPVB 4ET7A 3H0OA 4AEKA 2XBO3 3NV3A 4KNCA 4LBKA 5FWEA 2HWF2 5IFTA 4WM8A 1H30A 4YLZA 2IZWA 4N9HA 3FJSA 1YQ5A 1J84A 5IK7A 3MEPA 2DU1A 3WR0A 3WXPA 1K12A 5IUQA 3RYKA 2XKPA 3MPPG 4MGSA 5LCWL 5FKCA 3N7MA 5EXOA 3RNSA 4DUVA 1JZ4A 5LA1A 3DXTA 5JR7B 3SISA 4RS5C 1POV3 5JZGC 2RDQA 4X6RB 4XJUA 4P9IA 3S0MA 1DQ5A 4BLIA 4MHUA 3T3YA 3CL1A 1WCQA 3CJIC 3ZO0B 1AR61 3WHUA 4BU2A 5E1RA 2CYFA 5FK7A 3WZ1A 5HCAA 4XJ9A 3OUIA 5FAXA 3W58A 1KEXA 2YV8A 4QQPA 2BJSA 3ZN6A 3WW2A 4DRVA 1GANA 3VD3A 3HR9A 3BALA 2R30A 1VBE1 2RG4A 3AXEA 5GKAC 3A22A 1DGRN 3N35A 2F4PA 2GMEA 4LBQA 1L7QA 3ENRA 4LBQD 4WM7A 1G9BA 3VKLA 2XR4A 5C6CA 3WF2A 4GQ7A 2BGCA 3AMHA 2XLAA 1F5FA 1CAVA 4QKNA 2G4IA 2ZGRA 3I97A 3OBRA 4N8MA 5DG2A 4BQ2A 5JI9A 2AENA 2R062 3MFAA 2QQJA 3AC0A 1LB2A 1RHI2 4D6SA 1W8ZA 2VNRA 5A1FA 2IXKA 2J1UA 1O8SA 2JG9A 2JE8A 3GGLA 1NLSA 4IEYA 3ZSEA 2Y6LA 1WD3A 1LU2A 5F2WA 3USUB 2MEV1 4SLIA 5A80A 4MH0E 4XF1A 2PHUA 2XXZA 2FMYA 2C0ZA 4M3CF 1RJ7A 4QGLA 2RS31 1GWLA 1AR71 3OY8B 3E5QA 5FFOC 4EYUA 5GZGA 2XUMA 4XETA 4KU7A 4JDMA 3BYWA 2VW0A 5KHGA 1VB2A 2PQSA 1LJ7A 2OUJA 3C7HA 4UW6A 3TBDA 4A45A 4DEQA 2WWJA 1CZSA 1VBA2 4M00A 3D6EA 3LE0A 3MYXA 1GQHA 3VBSB 5DQ0A 4XACA 1RVF3 5HCBA 2BGOA 2VZ3A 3WP6A 1F5JA 1MR5A 2VXRA 1IS3A 2P2KA 3IDCB 4CUAA 3H7JA 4AFAA 1JOJA 1J3PA 2QFEA 3DKQA 1YQ2A 3PUIA 1J59A 2ID4A 3JU9A 2ZHMA 4D7YA 4OI0A 1AR83 3VBRC 1GZWA 4Y1VA 5FK8A 3MLJA 1FPN1 5LB6A 1REEA 4AR2A 2RJKA 3CQOA 4LK7A 2P3IA 1LOFA 1W39A 3KCXA 2Y6KA 5BY5A 3I3EA 4QX0A 4R4ZA 4Z2AA 5FQ0A 2NZ9A 1AL0G 4M3CA 2JWPA 4H7LA 1O4TA 5CG8A 5FO8B 1AJKA 5FV3A 2IXCA 3PU3A 4D7TA 3SEPA 1NXD1 1I3HA 2I74A 4ORFA 1SDDB 3DUIA 1S1AA 5FP4A 1BLZA 4Q1PA 4YNIA 1PGSA 2CAVA 3LWCA 2EAAA 4FFFA 3MLKA 3AL5A 3AMPA 5LBFA 5IFPA 1VBC3 1AYM2 1VBB1 1WZXA 1H4HA 4I01A 4NHKA 1XPWA 2BWCA 2DUOA 1UN1A 2G19A 3O0WA 1QXPA 4ZONA 1PIV2 5AC91 4NJ4A 1DQ2A 4GA9A 3ZYJB 1SFNA 5J09A 4UFJA 3MF9A 3RI9A 2NMOA 5FMCA 2P34A 4Q2FA 2A70A 5A7NA 3WVJA 1YHFA 4HLTA 4P00B 5FY9A 4BIFA 4Z2WA 3RPQA 2EXHA 2WN3A 1RUNA 5F3GA 4IQPA 2GNBA 1H8TB 1QJX1 5IVJA 4LMFA 1BXHA 1RUG1 2ZEWA 5FYCA 1HN0A 4CEWA 2ADDA 4Q4X1 4W8JA 1X8MA 2GMMA 4CXWA 1FV3A 1AXYA 2R7EB 3WV6A 5GJ6A 1DFQA 1SLTA 4XBLA 4AEJA 3NNLA 5FPXA 1GP5A 3ZYFA 1UW8A 1WW4A 4A2UA 4CTEA 1SG3A 1SMVA 4XMAA 1R091 4LIUA 4NHXA 1STMA 2QTWB 2HEWF 4UW3A 4O9GA 2R1DA 1HXS1 5C9AB 4Q0PA 1RMU2 4HKLA 2B9VA 2Y38A 1DQ4A 4W6XA 2UY8A 2C26A 3A7QA 4QX5A 5C4WB 1O91A 4YZ5A 1YLLA 1QH6A 1W0OA 2CTVA 1XOYA 2FCUA 2MPFA 3AKTA 3H8OA 1HB2A 4BWOA 1BHGA 3AYAA 2VQUA 3AZXA 3ZMNA 3POYA 5C3QA 1SBEA 3KD4A 3LZZA 3ZKYA 3POGA 5FWJA 4ES9A 2VUJA 1Z7S2 2JDHA 3AP9A 4AFCA 4AGRA 2BNNA 3UKVA 4AHYA 4XUTA 3KHCA 1MEC1 3BB6A 1QGLA 1QQP3 1S0FA 1QU0A 4AGVA 5JXHA 4UI9L 2J1AA 1IPKA 1GICA 3JBG1 4FI9A 5F3EA 3LQCA 3O1RA 1PM4A 2QQLA 2VTXA 2R16A 4WM8C 1W9SA 4RS5B 2FDKA 1ZA4A 4MGZE 1W05A 3GM8A 4CPBA 1LOCA 4RR3A 4CPBD 4P5YA 2JDNA 3NVCA 3IDAA 1OC1A 2VY0A 3T0DA 1A34A 2DTWA 2SLIA 5J98B 4C0HA 1PMIA 4Q4Y2 5A32B 5C5UA 3AXDA 1VBD3 3CJIB 3PTRB 3RVHA 4G9SB 3J7LA 3RZKA 4RQPC 2WWUA 2O1QA 3IM0A 3I2DA 1OURA 4YW5A 2IXJA 1LOGA 2DV9A 3THTA 2Q0AA 3S5QA 5IK8A 1C57A 4B1LA 4UWDA 2EVXA 1X7NA 2BVBA 4Q0QA 4RFRB 1XE7A 1C5IA 2Q30A 4ZS3A 3TOJA 1RUF2 3O1UA 4IDZA 2MHFA 3GBWA 3OTFA 2HEVF 4Q0VA 4BYYA 2Z4FA 4NE9A 4BXFA 1WW6A 3MFCA 2D6OX 4MYEA 4QAWA 3AKPA 5FYSA 5IVYA 4WM7C 4E2SA 3ILNA 4XFBA 1OVPA 1IKQA 1F35A 1LECA 1IGOA 2BUKA 4Q0SA 3ZM8A 2C4XA 2E31A 2YXSA 1UNBA 1W06A 3ABZA 2BYVE 4A6OA 1H1IA 1JZ5A 2VMIA 1YFUA 3W5MA 1ZZCA 1OQEA 1UY4A 4DB5A 1VALA 1EAH3 3BTZA 4OUMA 5FZ4A 1RUOA 4R8HA 4WVMB 2RM22 2Y6JA 1KFXL 1MS0A 3MPBA 4GWMA 3BODA 3FFQA 4Z07A 2HWB2 5FUNA 5FZBA 1ACCA 2QE3A 3WP3A 5BV6A 1CAWA 1JOBA 2GMPA 3CEWA 1OF3A 4EN9B 1ZA7A 2XJTA 3P6BA 1UXXX 3DXUA 1RVF1 4P9YA 1O6UA 2GC0A 1HRV2 1W6NA 3CJXA 2JB8A 5FCCA 2Q8OA 2Y0OA 2Z69A 4YM3A 5JOZA 3N9LA 4OLLA 2HEYF 3VDBA 4JX0A 1V6OA 2RS52 2OIIA 3WY6A 5CFCA 4JTOA 3VBRB 2KR2A 5GM0A 4CCOA 1A3KA 2RJLA 4GMP0 3VBUB 1CIWA 5EIYB 3V65A 1ZBE1 2W94A 3B69A 4KBZA 4PIZA 4XZUG 5B4NA 2ZGLA 1RUJ3 1PO11 5K0UC 3JZVA 4X8NA 4ZKTB 2YBPA 2HWE2 3IBMA 4DXTA 2WFF2 3MLLA 4QXCA 4E4DX 1EPWA 3J8F2 2OQ7A 4EE2A 2WO1A 5FZFA 3WNPA 1EV13 3B01A 5J96B 1OOPA 1OSGA 3KWVA 2ARXA 1ZBA1 1E5RA 4Q4V3 1IS4A 4Q26A 1LOFC 3T4HB 4GB33 4XVHA 1HLCA 4WVWA 4PJYA 2X09A 3ACLA 3ZYBA 3ZDVA 4MGKE 1SZBA 3R05A 5ACA2 2GP5A 3S5AA 2LROA 2WKKA 3K75B 2ZX1A 5FIXA 5LA0A 1H2KA 2I45A 3NKGA 3KZ4C 4LK6A 3MV01 1UZYA 2CWSA 4DEVA 5DAWA 5HI0A 3VZJA 1DQ6A 5D1IA 1R081 4QPGB 4XQ4A 2A3YA 3U4XA 4Q5OA 5J36A 1WCSA 4BM8A 1XYOA 1H0BA 4GH4C 1UX7A 2ZHNA 4XJWA 1DBNA 1C8NA 2XDVA 1AR62 3B00A 2W1SA 4N9IA 5JIAA 2VMCA 3AM2A 3ASIA 4CU7A 3UL2A 5LA9A 4OCTA 1GU3A 4K9SA 1D4M3 1H9WA 2VOXA 2XJVA 3JB4C 3NV1A 3RWKX 2K2SA 3NNFA 1O5LA 4N43C 4X6QB 1AXKA 5FPVA 3C7EA 3PUSA 4CUGA 2CAUA 1VBE2 3M70A 4I0WB 5ERLA 1NUKA 3PVBB 1I1EA 3ZFEA 3TNPB 3VBHB 2OPWA 4CEWC 5DMYA 4UW4A 1PX4A 4P08A 4XDPA 2JDZA 2WNUA 1U12A 4DPNA 4Q8KA 3GZTB 3N4MA 4FPEA 2QQPA 1TZOA 3Q8AA 3VL8A 4IV1C 2UYBA 5EP9A 2HH9A 4EN7B 3AZYA 3CNAA 3AFKA 3BGAA 3Q9OA 1UF2C 1S0GA 4QWNA 4LBNA 1FV2A 3APBA 5FLJA 1UMIA 5A7WB 2MEV2 2RR13 3HOBA 3Q8FA 3LOBA 1KGYA 2F4LA 4XF0A 2R6QA 2VBPA 3FHAA 2VCAA 2RS32 3U11A 1AR72 3K51A 3H50A 1JYXA 1EYBA 1XBFA 2XKOA 4LTAA 4IE5A 4LKDA 4UT5A 5CYYA 3UJOA 4F8AA 2GDFA 2PHLA 1VJ2A 4FSJA 4WM8B 1WMEA 2WQ8A 1OBNA 4MHRA 4YVWC 4OMCA 4QQOA 5I8YA 2FDHA 4JVAA 1CZVA 2VZSA 3K3OA 1CQ9A 2YB7A 1LOBA 2ZX3A 5FXWA 4NIAA 4LNVA 2IUWA 4YW1A 4UFHA 2VL4A 1UU5A 4BQXA 2YYOA 1P8JA 4LPLA 4GJZA 4M4RA 4RQPB 3MDPA 2DCJA 1VBD1 3B02A 4LO4B 4YVSA 2XONA 2VG9A 4I0BA 4RR3C 4Y1YA 3WDUA 2J1EA 1FPN2 1F31A 3HEIA 4CU8A 2R042 4DZGA 2G1MA 1VR3A 1NAEA 2R0HA 4YG0A 4RYDA 5T5PA 2R061 2D3RA 4JRLA 2XJUA 3ZMOA 3M3QA 3ZPOA 4BDVB 3UT0A 4D3WA 3ZN6B 3UYJA 4IEWA 3P3NA 5FXVA 4WM7B 1DGLA 5T55A 2VZUA 2YPDA 4BQ3A 1QEXA 5C5TA 1APNA 3VKFC 1WBFA 3ZSKA 4XAEA 4LKSA 1AJOA 5BNOC 3HNBM 3RWNA 1VBB2 4V2VA 1D4VB 5BPXA 4Q4W1 5A1LA 1W6PA 5IVFA 1MS3A 5D8AA 4ARXA 3OBTA 5I93A 2B45X 2QQVA 3PJQA 4LOSA 1UIJA 4BJ0A 2FCVA 5AC92 4DY3A 4IE7A 1POV0 1A78A 2JG9B 5FYHA 1YIFA 3KCCA 1Q43A 4OQ8A 4X8PA 1QJY3 4XBQA 3VB9A 4OUSA 3OGSA 2Y33A 1X9TA 1EAH1 1QJU3 1ZRRA 3B3QE 4FBFA 1SACA 5JI7A 2W1QA 4AK3A 5CKMA 3ACFA 1QJX2 3CF6E 3WF4A 1RUG2 1SCSA 2YPJA 4XHBA 2ORZA 1LGBA 4Q4X2 3SQOA 2GC3A 1N3QA 2BFUS 3TN92 4NHLA 4DXZA 5FY7A 4XFAA 5JAXA 3PVOA 1LCLA 2PHXA 2PHTA 2ZHKA 3A4UA 5FYVA 2DYCA 4EQVA 1HQWA 2O14A 1XE0A 1HQLA 1HXS2 3EQEA 5A6XA 5K0UB 2LALA 1NG0A 4UFKA 2PHRA 2JEMA 2XWJB 4COZA 5K9YA 1PGL2 3WLUA 5CFCC 3FN9A 3LFIA 1GZWB 4JDNA 5F1RA 1ASJ3 2VAUA 1O5UA 4RN5A 4OQ9A 4ASLA 5JZGA 5KXDA 3MZHA 4UFLA 2RDRA 1G9DA 4ITCA 4QGNA 1YRZA 3IKWA 3J7MA 5EV7A 1PIV1 4GAZA 4XQDA 3DYOA 4M3CB 3N9OA 3O12A 2PA7A 4MOAA 4C8DA 3ZFGC 1BMV1 1Q3EA 2ZS6B 1PK6C 4CU9A 1WLWA 1XU1A 1W9YA 3ILFA 5GLWA 2FBEA 2AC1A 2WZEA 4QX2A 3R4SA 4NR1A 2ZGSA 1H1AA 1JW6A 4AAPA 1GZCA 1W03A 2UYAA 3LGRA 3POFA 1PNFA 4MGQA 3VHRA 5DZGA 4DUXA 3I2IA 3FUQA 1LHVA 4A7KA 2PHDA 2WSVA 3Q8BA 3QCWA 4LE3A 3I2HA 4YG3A 3T30A 1X36A 3WF3A 3WNOA 2VOWA 3BOWA 3UGFA 4A7ZA 4FPLA 4BE3A 4OHYA 2E63A 3DYMA 3OPWA 3FFZA 2WWSA 3V0BA 5F5AA 4PI2A 3D4KA 3O7OA 4NHMA 1UYXA 1VB4A 2GNDA 3IAPA 4P02B 3T0AA 4AVSA 1GSLA 1JHJA 1O4YA 3ZFFA 1LODA 1YEWA 3WDTA 1D4M1 1RUE3 2D6PA 4YZ2A 2PMWB 4TYSA 4J6GA 2GH2A 5IVEA 4A42A 4O61A 1YWKA 4L9BA 5B4XA 4XTMA 4ZU4A 2V09A 2KD7A 2AGSA 4CEWB 1CONA 1RGSA 2A6VA 1HX6A 3ORJA 2AR6A 4Y5Z0 3T2QA 3ZDSA 1T2XA 4BK4A 4EN0A 1V6IA 4TLFA 1TMF3 3LDRA 5A3TA 2XHNA 5FZOA 3WF1A 5F6KA 3ZFEC 2O0OA 2R49A 2B46X 1W8HA 3LA2A 3LPGA 1J58A 1ZZ8A 1AR93 2J1TA 2WNUC 4PIYA 3WW3A 1V9U3 4YFZA 3VZMA 4K7JA 5LATA 1VRBA 2P1BA 3KGLA 2FDJA 3ECQA 4E8DA 5FZAA 3RRDA 1W2AX 3C7FA 1D0HA 1UX6A 3HMYA 4S2GA 2XVGA 3RS6A 4AW7A 4YFWA 5JDBA 1LULA 2D3PA 2NM1A 3VBOC 3S57A 2OQ6A 4Y24A 3ZXFA 2WDBA 3AZWA 1T6BX 4YVWB 5EWSA 2X29A 2A7AA 1L7LA 1PMJX 3R6SA 1W90A 1A6CA 5IW0A 3SCHA 1HN1A 5C33A 3VLBB 2EIBA 3NAPA 1NZCA 4QQLA 1RVF2 2HYXA 2CY6A 1PO23 4QHOA 3DKWA 1G9FA 3OPTA 3U07A 2W2IA 4JKKA 4UAPA 1WGPA 4RR3B 1AX0A 1WUVA 5FUIA 5ABJA 1JZ8A 1QHDA 3TB0A 1AR82 1AYN1 1YIPA 3HN3A 4XJAA 2VXJA 5H9RA 2ZGTA 1PO12 1RUH3 2ARCA 4YVSC 3HN1A 3D0SA 3Q8EA 5ANNA 4URAA 3TYJA 3U10A 1M4WA 3DF0A 2VOTA 3UK9A 2R073 5IAVA 4NPLA 4NHYA 4P9JA 4U36A 5FZ1A 3WQ1A 4FTSA 4IGQA 1RXGA 4O7XA 3SEEA 2YBKA 1Y9MA 4RGAA 5T54A 3GNEA 2YG0A 4LUKA 2EXKA 1OFNA 3MIDA 3U37A 2VUAA 2HKXA 1TE1B 3MV11 3U14A 3ZN5A 2UWBA 3DPRA 4L11A 4AE2A 4PBOA 4A6SA 2NMNA 4LE4A 1YI7A 2CNAA 1BBT3 4Y22A 3RG0A 2HWB1 2YFZA 3T08A 4PI0A 1UYZA 2DVBA 2VUCA 4LKFA 3WCRA 4DIQA 2WUHA 3OF1A 5LY2A 4JHTA 4OZOA 2YC2A 1R64A 3NRUA 4COWA 3LFMA 3PNAA 4MV2A 1R082 5D8AC 5FUPA 3OJBA 3MIHA 2BRTA 1QJY1 2ETEA 4BB3A 4BQ5A 3HQUA 2RS51 1XXNA 4Q8LA 4FPHA 4QX3A 1DGRA 2ZHLA 3E6BA 1G9CA 1JU3A 1L7RA 5FKBA 2WYSA 5DDJ3 1BEV3 5FYIA 3RZHA 2WIIB 5JSOA 1CAWB 3I54A 4HG6B 5E6HA 1US3A 5EJ3A 5CU1A 3RFRA 4I02A 3W59A 2WFF1 2QKDA 2VVEA 2WNVA 5A7WA 5LBEA 4BH9A 3TEYA 1W6NB 2PLV3 1DZRA 4NMIA 1T6GC 3J8F1 4BPZA 1TEIA 3CZUA 4PHZA 3B5LB 5CFCB 3WNKA 1R1A3 2ZZJA 2JD4A 1V00A 4S2FA 2ZCWA 3T0BA 5DAXA 1VAVA 1WWYA 3RYRA 3SHRA 4HSLA 4LXLA 1SLAA 2Y64A 5ACA1 4AHWA 4TWTA 4QQ2A 1JH5A 1W8WA 3MBWA 4B3NA 4B1MA 2RS13 2GC1A 2Z5WA 5E89A 3H3ZA 3KLSA 4PQQA 4C1WA 4RQPA 4BA6A 1PK6B 1Q8VA 1FMD3 1UYYA 2ZGPA 5FBZA 1OOPB 4EZHA 4N7UA 1UAIA 3ACHA 3J4UH 4Q27A 1QQP2 1BVVA 1CAXA 4QB1A 4Y26A 2D97A 3LPFA 1YNAA 3K77A 1ST8A 1JMUB 2W39A 1RUC3 4BCUA 2RDNA 5G05L 4YPJA 1YQ6A 3X29B 2RMU1 4QXHA 3WUCA 4HT1T 3J9SA 2ZACA 3AP7A 4K1YA 3H3UA 1VBD2 2ZMLA 2WAOA 3EXUA 1W8FA 1YFXA 4R9BA 1PVC3 1W2UA 3TEWA 2E33A 2WINB 1LTEA 2G9FA 3N7LA 4FOVA 4WZFA 1HQNA 2HWD1 5FREA 1DP0A 1VMJA 5F32A 1HB3A 3E1F1 4GMP1 4A4AA 2JX9A 1SFPA 2VZPA 2I07B 2CGNA 3WW1A 1QJEA 1X9PA 4EV0A 4YW6A 4LULA 4ATEA 1ENSA 1GKBA 3ZFFC 1UIKA 2LM3A 3K4DA 1NA1A 2B5HA 3A0KA 4QPYA 1IQDC 4HZFA 4YZ1A 3ZFEB 4QHZA 4XXPA 4KQ7A 4JGZA 2VM9A 1OD5A 3R4DB 4XF9A 1TMF1 3THDA 1NCQA 2WNUB 1CD3G 4NIGA 2ZMKA 3WG2A 1JYTA 1NOVA 1TME1 3POWA 1RUI1 1Q8PA 4Q4W2 3EB7A 5EYXA 3ZYHA 2ZA9A 4K21A 2WZR1 2CGPA 5FOJB 4YG6A 3VBOB 4DUWA 2QDNA 3ITQA 3RGBA 5HCHA 3LCPA 4XF4A 3OGJA 1GWMA 1IS5A 3LIGA 2ZAHA 3UKNA 1N1TA 4OUEA 1URXA 2WS93 4E4HA 3O1OA 3FHIB 1EAH2 3H8UA 1GWKA 3B9CA 1KITA 5K0UA 2AZ5A 2AUYA 2W68A 1IHMA 4QU1A 3KHBA 5F9TA 4UXAA 3O1TA 3BI3A 4W65A 4P5HA 3KF5A 3H3LA 4XDOA 3M2MA 4QB6A 4AG4A 3SCFA 1PGW2 2EIDA 3ZVXA 2R041 2ZGOA 5CIRA 4YZ4A 3PURA 5FY8A 2K0GA 3UGGA 3JB8A 4NAOA 1OF4A 1PO21 2WO2A 2V5YA 1X50A 1EUUA 3N36A 4YM2A 3NAPC 3AJYA 5F3CA 4DFSA 3HBZA 5T5LA 5KC5A 2XG3A 1AL21 4FFGA 3T4VA 1GOGA 1LOAA 3E97A 4YVSB 4P9XA 4AYUA 1GZTA 5F6LB 2NYYA 3AL6A 4AEMA 1DF0A 3AJZA 1W2OA 1RUJ2 1E5SA 4FXKB 4TTGA 5ABJC 2JKBA 1CPMA 3SKVA 2Q5TA 2WLQA 3TWIA 2GNTA 2V4AA 2FDIA 3LB9A 1FNYA 2JDKA 3WNLA 2R071 1JN2P 2ENRA 2V72A 5JPMB 5IYYA 1MQTA 3TNQA 4GH4A 2QBXA 5I0TA 2G9GA 1KS4A 3WG4A 5CKNA 4YGEA 1BMV2 2ZEZA 4XILA 2OX0A 2GZWA 1ZRIA 1C28A 3HNYM 2WSUA 3HQXA 2H0VA 1ZZ9A 3NO8A 4N43A 1W04A 4CE8A 1MZ5A 2TBVA 4D8MA 5KXEA 4S2DA 4JAAA 4CRQA 1W6PB 2BFUL 1LHUA 1KJLA 4QKFA 5D8AB 1PHMA 4HVRA 3GJBA 1A8DA 3DPRC 3OGGA 4XEZA 4CXXA 4K1ZA 3LOIA 3TN91 1YQCA 2DTYA 4DXSA 3SNMA 4RGKA 4OZXA 4ZY9A 4BIOA 1O7FA 4IV1A 5DZFA 2VJXA 1EUTA 1H2MA 5K4LA 4URTA 4Y4YA 5FP8A 5F7UA 4QM8A 5DPNA 2DBIA 4EN8B 2GNMA 2A1XA 3BPSA 3M8LA 3PHMA 5DDJ1 2DUPA 1FATA 1D4M2 5FZ9A 1PGL1 3OBZA 5FMBA 4DO0A 2NPIA 4W6WA 5LK7B 4UBGA 4R9DA 1RUD1 1I5ZA 2BV4A 5JMCA 2F17A 2I2SA 4IE6A 1JI6A 5JIUA 3C3VA 2PLV1 1WLCA 3K4ZA 4PBPA 4UYBA 3PL0A 5GZDA 4CDXA 1XSRA 2VZQA 3DV8A 4FO9A 2VZRA 1PX3A 4Z82A 4YVWA 4HONA 2XBO1 2WNVC 4KU8A 1UOJA 5J1XA 5FO7B 1RB8G 3B94A 1ZZBA 3JQXA 1JS9A 2W47A 4MGTA 5D21A 2WZ8A 4LBLA 4QU2A 1WKYA 2P6HA 3LEGA 2HWF3 2YHJA 3CO2A 1QIQA 1NQJA 3JCIA 4IERA 1DCSA 4D69A 2HWC3 2KA3A 3ZXEA 5JZGB 4RL7A 2RS11 2RR12 4E2QA 4G4FA 4MGYE 4AHXA 5C71A 5C3OA 2Y8KA 4NWWA 5A70A 5JR2A 1OA3A 1POV1 2E7QA 5M0TA 2BBAA 2TNFA 2ZXQA 3KVAA 4AHZA 1O8PA 1W6OA 5CA6A 5L9VA 2DCZA 1XJAA 5HV4A 4OHXA 5BNNA 5T52A 3U4SA 2GN7A 4IESA 2X5IC 1LHWA 1AVBA 3BPZA 1C1FA 3H1YA 3O5SA 3AK0A 4MXVA 4QDQA 1U5YA 5IK4A 5BNPA 5BNOA 5KR7A 4OI1A 1ZRCA 2YU1A 1OLRA 1AYN2 2JIGA 4XC9A 3AKQA 4RHV3 4CP2A 3KT4A 5E8AA 5FTTC 1XNDA 5HPOA 5DAPA 3V0BB 1QH7A 1K3IA 2DU0A 3M3CA 2D98A 1IZ3A 1Y9QA 2OPKA 2XLFA 4AWDA 3AZVA 5A7QA 3I3DA 3SH3A 2BGPA 3ZFFB 4QX1A 4IW3A 1DLLA 1CPNA 4CU6A 1US2A 1ULDA 3OUJA 3EMRA 2WYFA 4BMBA 2VE1A 2W9XA 1RHI3 3VUOA 2XL9A 5CFDA 1UWWA 2VCCA 2VVFA 4NRMA 2H6CA 4Y3OA 4IV3A 1ULGA 3E6CC 4H3WA 4R52A 4F83A 2VZOA 1NA1C 1IPJA 3CZJA 1Y7BA 5FZOB 4FVVA 3S7IA 4ARYA 1GZ9A 1QOOA 4JGZC 5A33B 5A3MA 3DGTA 1VRH3 1NCQC 4AQTA 2Y6FA 2JD9A 4XF3A 3POJA 4LHNA 4Y33A 3T2OA 4CSWA 4MADA 5LZ6A 3AZZA 3FLTA 2D6MA 1K5MA 1QJY2 4TN7A 3S6PA 5HV0A 1VBA3 2X8KA 2C24A 2E51A 4ZZ5A 3VZLA 1QJU2 2W95A 2FZ2A 1HB1A 5EPAA 1R1ZA 2DF7A 2ES3A 2ERFA 2L9LA 3GHNA 1AR81 3MUZ1 3VHNA 4AGGA 4PDWA 2BBVA 4Q0UA 2W46A 2XPJA 3CHXA 2VCBA 4LO5B 2JDYA 4FPCA 2EAKA 4B29A 4IE4A 3ZIWA 2FDFA 3NAPB 3W21A 2O8OA 5J7MA 3O14A 4BQYA 3I49A 3KV4A 2A6YA 2XJSA 3INAA 2LS6A 4IGOA 4KMQA 3ZFGA 4GULA 2IXIA 1OLME 1NCRA 1PM7A 4XCAA 1MZEA 5LBBA 1PK6A 1NKGA 1N47A 3NNJA 2V73A 5EZWA 5FPLA 4LT5A 2J7MA 5ABJB 2PAKA 4BK5A 2XUEA 4WZCA 1FXZA 1ASJ2 1TVGA 1VBC1 1FOD3 2ZEYA 3CKHA 1Y43B 1WBLA 2FMDA 2GU9A 2VUDA 1F4AA 3OGRA 1C8M3 1GR3A 4Z8BA 1O3SA 4BQ4A 3FHQA 1AYM3 1YJKA 1JYWA 2ZGMA 4FPJA 2WA3A 1XYNA 3POIA 1OLMA 4MXWA 4KL1A 4L99A 1J1TA 3GZUC 4PF1A 3PUAA 3BVCA 3ZXGA 1QOTA 1UY0A 1ALYA 1MQTC 1OH4A 3AVSA 1LAJA 2YGLA 1W2TA 3JD73 2ARAA 5FY5A 3DPRB 1UZWA 4Y22B 3V56A 3N3HA 4COYA 3ALQA 2PXJA 2BZDA 2RMU2 3C7OA 3PLQA 3OB8A 4BISA 4EWAA 3I2OA 4IUGA 2JKXA 2BOIA 2VR4A 1W99A 3M3IA 4AI3A 5L7OA 3NWKA 2D93A 2UWAA 2WO3A 1UO9A 4FPFA 4ZHNA 3FLRA 1V6MA 1OI6A 3HAGA 4XJ8A 3WP5A 3O1SA 2QDRA 2HWD2 1Y9GA 2RJ2A 3AB0A 4COUA 1GFF2 4UFMA 5LRSA 4OI4A 1XNCA 4U2AA 1MS1A 1MVEA 1RMU3 3G7DA 1ZM1A 4XHXA 3RJ2X 1XC6A 3VBOA 5FZKA 4ES8A 3QOPA 2WJSA 1WW5A 5IHRA 1DQ0A 1YO8A 2WNVB 4Y5SA 5FYBA 3H8XA 3AP5A 4LO6B 5FLHA 1TMF2 4HOOA 2VZTA 3N9NA 1KDMA 1TME2 3P5BA 5CB7A 1RUI2 4YM1A 5FYMA 1QDCA 1QQP1 2ZGUA 4KWJA 5C8WA 2KM2A 4CDXC 1V9U2 5T5JA 3B9IA 3NJZA 2WZR2 3RMYA 4LOTA 1AXZA 3OPZA 2P4EA 2D43A 4FOWA 2HWC1 1HRI3 1W9TA 5EFUA 2UU8A 2J42A 2VNOA 4HXCA 5I0DA 2IXHA 3ILRA 1F2NA 2W52A 2ZOEB 1H2NA 1W3XA 3WNMA 4CXYA 1EP0A 1K45A 2W1UA 4B7KA 2HBUA 3M3OA 5D2AA 2DFBA 4AI2A 1BJQA 2P3YA 3VHOA 1CAXB 3AYEA 2JB4A 4Q4Y3 2X5IB 4HKWA 4LA2A 1AZDA 1DG6A 1ND2A 2YFUA 4LIVA 5DUXA 3BTXA 3PIGA 3HD8B 5LK5A 3BU7A 1PO22 1OT5A 2WAAA 1NY71 1RL3A 1S2KA 3IIAA 5DABA 2DFCA 1LKNA 1J83A 5BNNC 4AXOA 5FMOS 1AL22 4JDOA 4SBVA 3SCGA 3LIHA 3CU7A 2DURA 1IG0A 4RHV1 2QQNA 4LQRA 1CESA 3HPNA 3QBQA 4O65A 4LBOA 4IGPA 5BNPC 1RUH2 2CDPA 4FXGB 2EIGA 4YWAA 1S0EA 1Q56A 1Y4WA 2A71A 2X53S 4XMIA 5AFBA 4CYDA 2VMHA 4GXLA 2GP3A 2R072 1N1SA 4QPWA 3MUY1 3WQBA 4CCCA 5A6ZA 4WVVA 4IEOA 4ZXKA
chains in the Genus database with same CATH topology
4XDPA 5FYTA 5IVBA 5FZ1A 4IGQA 4D6QA 2YBKA 5A7OA 3KV6A 3KVBA 5LY1A 4GD4A 4V2WA 5A3WA 4BXFA 3PUAA 5ISLA 5F3IA 3AVSA 4QWNA 5FYSA 5FZGA 5IVYA 4GAZA 3LDBA 5FV3A 5FY5A 3PU3A 2Q8EA 3N9OA 3KV5A 5FPAA 4UF0B 4C8DA 5A7WB 5FP4A 3KVAA 2PXJA 4BISA 4DIQA 5F2SA 4E4HA 5LY2A 5F37A 4CCJA 3AL5A 5FWEA 3U4SA 5FUPA 4QU1A 4LITA 4AAPA 5FZHA 4XDOA 3K3NA 5FZ4A 5FXZA 4EZ4A 3N9QA 3PURA 5FY8A 5FUNA 5FJHA 4Y4RA 5FZBA 2Q8CA 3K3OA 5FY4A 5LW9A 3LD8A 5KR7A 5FYIA 5FXWA 3KV9A 3OPWA 2YU1A 5FZMA 3DXTA 5F5IA 5FY0A 3NJYA 5F5AA 5A7NA 5FY9A 5IVVA 4QX8A 5E6HA 4AI9A 4GJZA 2Q8DA 5F3CA 3DXUA 5F3GA 5FZKA 5FBJA 4UF0A 5A7WA 5IVJA 5A7QA 5FYYA 3N9LA 5FYCA 5FYBA 5FP7A 5FZCA 5IVEA 5IWFA 3AL6A 5FZ3A 5A3PA 4CCKA 4BU2A 4HOOA 5FP9A 3N9NA 5FY1A 5FZLA 4CCOA 5FPUA 4NUBA 5F5CA 5FPBA 5FYMA 4LIUA 5A7PA 2XMLA 5FZEA 3ZPOA 2OS2A 4LXLA 4Y3OA 5FZ0A 3UYJA 5A3TA 5FZOA 2YBPA 4QXBA 5FP3A 5FZOB 3K2OA 4QXCA 5FXVA 5FZDA 2OX0A 2YPDA 2OQ7A 3AVRA 4GJYA 5FZFA 2YBSA 5LWBA 4Y33A 4CSWA 1VRBA 5FZIA 2P5BA 4V2VA 5FJKA 5FZAA 4EZHA 5A1LA 5IVFA 5A7SA 4TN7A 4D6SA 5FWJA 5IVCA 5FZ8A 5A1FA 2OQ6A 4LIVA 3U78A 2GP5A 3PDQA 5FYHA 5A3NA 5F2WA 4CCNA 5A80A 5IW0A 3PU8A 4QXHA 2XXZA 4CCMA 5F3EA 3N9MA 5FYUA 5FP8A 5K4LA 4CCLA 4EYUA 5FYZA 5ANQA 3KV4A 4QX7A 4D6RA 4IGOA 3OPTA 5FZ9A 3N9PA 3PUQA 5FXXA 4DO0A 2W2IA 4ASKA 2WWJA 2XDVA 4IGPA 5FY7A 3PTRB 5F32A 3RVHA 5FPLA 5CEHA 5FYVA 5F39A 2WWUA 2GP3A 2OT7A 2VD7A 2XUEA 5FPVA 5FZ6A 3ZLIA 3PUSA 4CUGA 2YU2A 4HONA 5FZ7A 4URAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XDP A;  5FYT A;  5IVB A;  5FZ1 A;  4IGQ A;  4D6Q A;  2YBK A;  5A7O A;  3KV6 A;  3KVB A;  5LY1 A;  4GD4 A;  4V2W A;  5A3W A;  4BXF A;  3PUA A;  5ISL A;  5F3I A;  3AVS A;  4QWN A;  5FYS A;  5FZG A;  5IVY A;  4GAZ A;  3LDB A;  5FV3 A;  5FY5 A;  3PU3 A;  2Q8E A;  3N9O A;  3KV5 A;  5FPA A;  4UF0 B;  4C8D A;  5A7W B;  5FP4 A;  3KVA A;  2PXJ A;  4BIS A;  4DIQ A;  5F2S A;  4E4H A;  5LY2 A;  5F37 A;  4CCJ A;  3AL5 A;  5FWE A;  3U4S A;  5FUP A;  4QU1 A;  4LIT A;  4AAP A;  5FZH A;  4XDO A;  3K3N A;  5FZ4 A;  5FXZ A;  4EZ4 A;  3N9Q A;  3PUR A;  5FY8 A;  5FUN A;  5FJH A;  4Y4R A;  5FZB A;  2Q8C A;  3K3O A;  5FY4 A;  5LW9 A;  3LD8 A;  5KR7 A;  5FYI A;  5FXW A;  3KV9 A;  3OPW A;  2YU1 A;  5FZM A;  3DXT A;  5F5I A;  5FY0 A;  3NJY A;  5F5A A;  5A7N A;  5FY9 A;  5IVV A;  4QX8 A;  5E6H A;  4AI9 A;  4GJZ A;  2Q8D A;  5F3C A;  3DXU A;  5F3G A;  5FZK A;  5FBJ A;  4UF0 A;  5A7W A;  5IVJ A;  5A7Q A;  5FYY A;  3N9L A;  5FYC A;  5FYB A;  5FP7 A;  5FZC A;  5IVE A;  5IWF A;  3AL6 A;  5FZ3 A;  5A3P A;  4CCK A;  4BU2 A;  4HOO A;  5FP9 A;  3N9N A;  5FY1 A;  5FZL A;  4CCO A;  5FPU A;  4NUB A;  5F5C A;  5FPB A;  5FYM A;  4LIU A;  5A7P A;  2XML A;  5FZE A;  3ZPO A;  2OS2 A;  4LXL A;  4Y3O A;  5FZ0 A;  3UYJ A;  5A3T A;  5FZO A;  2YBP A;  4QXB A;  5FP3 A;  5FZO B;  3K2O A;  4QXC A;  5FXV A;  5FZD A;  2OX0 A;  2YPD A;  2OQ7 A;  3AVR A;  4GJY A;  5FZF A;  2YBS A;  5LWB A;  4Y33 A;  4CSW A;  1VRB A;  5FZI A;  2P5B A;  4V2V A;  5FJK A;  5FZA A;  4EZH A;  5A1L A;  5IVF A;  5A7S A;  4TN7 A;  4D6S A;  5FWJ A;  5IVC A;  5FZ8 A;  5A1F A;  2OQ6 A;  4LIV A;  3U78 A;  2GP5 A;  3PDQ A;  5FYH A;  5A3N A;  5F2W A;  4CCN A;  5A80 A;  5IW0 A;  3PU8 A;  4QXH A;  2XXZ A;  4CCM A;  5F3E A;  3N9M A;  5FYU A;  5FP8 A;  5K4L A;  4CCL A;  4EYU A;  5FYZ A;  5ANQ A;  3KV4 A;  4QX7 A;  4D6R A;  4IGO A;  3OPT A;  5FZ9 A;  3N9P A;  3PUQ A;  5FXX A;  4DO0 A;  2W2I A;  4ASK A;  2WWJ A;  2XDV A;  4IGP A;  5FY7 A;  3PTR B;  5F32 A;  3RVH A;  5FPL A;  5CEH A;  5FYV A;  5F39 A;  2WWU A;  2GP3 A;  2OT7 A;  2VD7 A;  2XUE A;  5FPV A;  5FZ6 A;  3ZLI A;  3PUS A;  4CUG A;  2YU2 A;  4HON A;  5FZ7 A;  4URA A; 
#chains in the Genus database with same CATH topology
 1NA1 B;  5H9S A;  5JSP A;  4QKD A;  1O59 A;  2W0X A;  4XXA A;  4JGZ B;  5DZE A;  3VKN A;  1G7Y A;  1L3J A;  1S0C A;  5I0R A;  1NCQ B;  4AED C;  2VMD A;  1S0J A;  4CUC A;  2D3S A;  2WLP A;  2Q4S A;  1BBT 2;  4TZD A;  5CFD C;  5LY1 A;  2WT0 A;  3RQ0 A;  2YY1 A;  2A6Z A;  2VZ1 A;  1VRH 1;  1Z0H A;  4CDQ A;  2RM2 3;  4IV3 C;  4I3G A;  1PGW 1;  4IXL A;  4CDU C;  3KV5 A;  1BK1 A;  5FPA A;  1FT9 A;  4AI1 A;  2H6B A;  4LOR A;  5GAL A;  2VME A;  3QH6 A;  5F37 A;  3ZKU A;  2DBN A;  1HRV 3;  4XIK A;  4J1W A;  1DYO A;  3K48 A;  2P37 A;  1SHW B;  1K5M C;  3R0R A;  5DDJ 2;  1YC6 1;  5H9P A;  2R1B A;  2XWB B;  2ZX4 A;  4XYX A;  1RUJ 1;  1CR7 A;  2VTF A;  2QQK A;  1RUD 2;  2PN5 A;  1OKQ A;  3L2Y A;  5LW9 A;  1JYC A;  2ZPX A;  1W9F A;  4KG8 A;  4PDW C;  4DMI A;  5DAV A;  4B7E A;  1JZ2 A;  2PLV 2;  2YGM A;  5EHD A;  5IVV A;  2ZJC A;  1AF9 A;  1C5H A;  1EV1 1;  4K8F A;  2Q8D A;  1WW7 A;  4LLO A;  1R1A 2;  5A6Y A;  2XBO 2;  4FP2 A;  3I2G A;  3ZR6 A;  4Q4V 1;  1ZYB A;  1MAC A;  2A73 B;  5FYY A;  4GB3 1;  5F5Q A;  1NQD A;  2VEC A;  3F95 A;  3DN7 A;  5BYN A;  1NCR C;  2QZ3 A;  1GP6 A;  3FWE A;  4CCK A;  5A3P A;  5FP9 A;  2HYK A;  1G86 A;  4CP9 B;  4FTB A;  1E5H A;  4FAG A;  1AHS A;  3C8X A;  3G6J B;  3MF6 A;  4A41 A;  2ET7 A;  2RS1 2;  1Z78 A;  5C8C C;  2CGO A;  3ES1 A;  4M01 A;  3VHP A;  2OS2 A;  1GP4 A;  2UWC A;  3AYD A;  3KM5 A;  4Z1V A;  4MSV A;  1MQT B;  1FMD 2;  3GBG A;  4GH4 B;  4QXB A;  5FP3 A;  1CAU A;  4I09 A;  2OUH A;  1U5Z A;  2IFR A;  2LRP A;  4QDS A;  1MZF A;  2H0B A;  1BZW A;  4I0A A;  3MIG A;  5BXX A;  5GZC A;  4PLN A;  2E7A A;  3AKS A;  3JD7 1;  2FHR A;  1OLQ A;  3B93 A;  1O4Z A;  3GHM A;  1YUD A;  2IVJ A;  2NQY A;  4XW3 A;  1UZV A;  4N43 B;  1KDK A;  4EWE A;  1WMD A;  2GC2 A;  3BU0 A;  2EIC A;  5IVC A;  4F7Z A;  4E9K A;  2VTX J;  3O0V A;  4HL0 A;  2C5D A;  2WO7 A;  4FPG A;  3PJY A;  2XJR A;  5A3N A;  1UYP A;  4H14 A;  5CAZ A;  4XFG A;  1FYU A;  1PVC 2;  3PU8 A;  3R4U A;  4CCM A;  3GF6 A;  4IND A;  4IV1 B;  1KD7 A;  1VBE 3;  4QGM A;  4BZ4 A;  5C3P A;  2Q1F A;  2XLG A;  4YGD A;  1SLB A;  5L9R A;  3ZXD A;  5F8P A;  5L7O C;  2A5Z A;  4NII A;  5A33 A;  4DIN B;  4GKY A;  1JZ7 A;  1PVX A;  4MZU A;  1OVS A;  1XU2 A;  5CNA A;  2FD8 A;  2V4V A;  3M7A A;  1C1L A;  3D5O A;  3LEI A;  4A7Y A;  1F9K A;  2PFW A;  2RR1 1;  1LOE A;  1G8W A;  2Y60 A;  2OT7 A;  1KS5 A;  3IT8 A;  3NJX A;  4DQA A;  4QD2 A;  3ZLI A;  4BQW A;  2VQA A;  4CDX B;  5DN2 A;  1BKZ A;  4FOY A;  3USS A;  2MEV 3;  2CV6 A;  3CIH A;  1QJZ A;  1GMM A;  3OOX A;  3VZK A;  4YGC A;  2NN8 A;  1AR7 3;  4CP1 A;  4AL9 A;  1LGN A;  4XUN A;  4CUB A;  1JZ3 A;  1NLR A;  4FQ4 A;  2WT1 A;  1SLI A;  2MNG A;  1BK0 A;  1HRI 1;  3THP A;  1WLD A;  1N1V A;  2WS9 2;  5FZG A;  5GLZ A;  2E6V A;  1V70 A;  3BTA A;  2HLE A;  3U0Z A;  3KF3 A;  4IEV A;  4LJH A;  4L8Q A;  4YSF A;  4OVE A;  4FAH A;  1NT0 A;  1MS8 A;  1WCK A;  5J37 A;  1GLH A;  1W6O B;  4XIO A;  1D0G A;  1Q8O A;  2CDO A;  2D7F A;  2GSY A;  2Y34 A;  3TEX A;  4AFD A;  4AVT A;  3E5X A;  3VZO A;  1SQ4 A;  4DNY A;  1FPN 3;  5BNN B;  1O3R A;  3OG2 A;  3S30 A;  3VD9 A;  3M3E A;  2XJP A;  1V0A A;  4XPV A;  1ND2 C;  1XNT A;  1KQR A;  3OSD A;  4XDQ A;  4CDW A;  5IK5 A;  1VAK A;  2Y6H A;  4Y20 B;  2BPA 2;  3D0J A;  5LEJ A;  1U5I A;  5BNP B;  5EYY A;  1JBC A;  3WQ7 A;  5BNO B;  3U75 A;  1V6K A;  3HWJ A;  3MHZ A;  5JMO A;  3CBN A;  5C3S A;  3O1M A;  1CGP A;  4A3X A;  4FT8 A;  4NRP A;  1VBC 2;  4KWK A;  4K8R B;  2JG8 A;  4N7I A;  1ND3 A;  1E5I A;  2FZ1 A;  2F6B A;  3AFG A;  3VZN A;  1HJF A;  2D5F A;  4OFG A;  3ZXK A;  5IAT A;  1VBB 3;  4JCK A;  2SBA A;  2BER A;  1OHF A;  4GWN A;  4GKX A;  4L97 A;  3H1M A;  3KB5 A;  5F5C A;  2DUQ A;  3UET A;  1YQ8 A;  1G9A A;  1QJF A;  4KG0 A;  5CFD B;  1LR5 A;  1QJU 1;  4JRA A;  5KHJ A;  4A44 A;  4IV3 B;  4KBB A;  4D7S A;  5FZD A;  3MW4 A;  4JV4 A;  4XBN A;  3TAY A;  4BME A;  2VU9 A;  3D3A A;  4QKB A;  4XZP A;  4CDU B;  3OBA A;  2XQR A;  4S2H A;  2ATF A;  2VBD A;  3U1X A;  2DCT A;  5JXI A;  5FZI A;  1XE8 A;  1DZT A;  3BIE A;  3UV9 A;  3SIT A;  1QJX 3;  5FJK A;  4MGI E;  5C3R A;  1RUG 3;  1W0N A;  5GLT A;  1ULO A;  4CCE A;  1XNB A;  4IEP A;  4Q4X 3;  3SKJ E;  2K9Z A;  1WMX A;  4CDQ C;  1UD1 A;  1DHK B;  1H8T C;  3KMH A;  5L19 A;  3MI8 A;  3NNM A;  1K5M B;  1QDO A;  1ZRF A;  5AVP A;  2VO5 A;  3DEM A;  5FLI A;  3BCW A;  2VW2 A;  2J1R A;  1J1L A;  2OKX A;  3RI8 A;  3U78 A;  2CSG A;  4C91 A;  2B42 B;  1R09 3;  2ZGK A;  4HMZ A;  2C9A A;  2B8M A;  5LA2 A;  1BYH A;  4PDW B;  2WNE A;  4XUQ A;  1I9R A;  3WX5 A;  5T5O A;  2BP6 A;  4KI5 M;  1ASJ 1;  4AAX A;  2DWR A;  5FYZ A;  1J3R A;  3LA7 A;  4W4Z A;  4LR4 A;  1SBF A;  1SCR A;  4NRO A;  5FO9 B;  3HJR A;  5LAS A;  3ZFG B;  3E5U A;  5LEK A;  3CLP A;  1HB4 A;  1NCR B;  3ON7 A;  2WRA A;  3WF0 A;  4AFB A;  1LED A;  2WT2 A;  3OCP A;  4Q1R A;  3RZL A;  5F39 A;  4B8E A;  3O1P A;  2RHP A;  4NRQ A;  2X5I A;  4DRR A;  1MEC 3;  5C8C B;  4D0Q A;  1CVN A;  4NID A;  3F2Z A;  3WNN A;  1E57 A;  3NL1 A;  2UY9 A;  4MG2 A;  2HWC 2;  1DIW A;  3JBG 3;  4IET A;  1BVP 1;  4ZU5 A;  1IPS A;  1XSQ A;  2XHK A;  3I59 A;  4PF5 A;  4UOJ A;  4HK8 A;  3GJA A;  3ZXL A;  5LRR A;  3GXU A;  3KQ4 B;  3H9A A;  4HN1 A;  1ZRD A;  4LBM A;  4MXW B;  1M06 G;  5ISL A;  1UMZ A;  4AZZ A;  2GAU A;  5F3I A;  3WUD A;  3N7J A;  3ETQ A;  4XUP A;  2Q8E A;  3W5N A;  3A21 A;  2DVG A;  2ZX0 A;  3MIF A;  1RUE 1;  5T3N A;  1H9P A;  1YYN A;  1NY7 2;  3BIW E;  1NLQ A;  2Z42 A;  3FE5 A;  1CIY A;  4I2O A;  3BUC A;  2WN2 A;  1VLN A;  5L7O B;  2QUO A;  4QHB A;  5AFE A;  4YW4 A;  4RHV 2;  5FXZ A;  4L2N A;  1S0D A;  3OYW B;  3J7H A;  3THC A;  2OXB A;  4JKL A;  1YCI A;  1BCX A;  2PTM A;  4YW2 A;  5GLV A;  3ZXA C;  2R0F A;  2WA4 A;  5FZM A;  1GV9 A;  1AR9 1;  1COV 3;  1V9U 1;  1W6Q A;  3VD4 A;  1NE4 A;  1MS5 A;  3VD7 A;  2V5D A;  1O3T A;  4XTP A;  5CKQ A;  1IQA A;  4MVT A;  3AMN A;  4TSV A;  4FTE A;  4DOU A;  3UJQ A;  4A3Z A;  2N7G A;  2A6W A;  3M4F A;  1H6Y A;  5JCT A;  3ZIX A;  4K20 A;  4XUO A;  4PLM A;  4NIH A;  1W3V A;  1DDL A;  1VRH 2;  1QXJ A;  4GZ9 A;  2W3J A;  4ZS2 A;  4JHZ A;  1W6M A;  3VBF A;  3I3B A;  4AI8 A;  2JDP A;  2FDG A;  1RYY A;  2BNM A;  1D2Q A;  5FMO L;  5JSR A;  5LWB A;  2P3J A;  1OMI A;  1F15 A;  1FX5 A;  3GAL A;  3MIC A;  1QMJ A;  4M3C E;  3OUH A;  4LUM A;  4Y1Z A;  3VDA A;  2D40 A;  3NKT A;  4CP9 A;  3WDV A;  4QT6 A;  3AP6 A;  5CG9 A;  1RUH 1;  1VIW B;  3T2T A;  1ND2 B;  4XUR A;  5K7P A;  1ZBE 3;  1ZZ6 A;  1EPZ A;  2D6N A;  1QWR A;  4JKM A;  4FFH A;  1PO1 3;  2QQO A;  3I2F A;  3VBU C;  4ONU A;  1EV1 2;  4H2A A;  2B39 A;  3ZYI B;  3KT1 A;  1JZ6 A;  3HQR A;  4TXW A;  2X10 A;  4Q4V 2;  3MO4 A;  2YMZ A;  4GB3 2;  2ORX A;  1AUY A;  2JIJ A;  4XFI A;  4XQW A;  3DEC A;  1HV0 A;  1RIT A;  4ASK A;  4MLO A;  4CDW C;  1VMF A;  1ZBA 3;  5T50 A;  3IAQ A;  1UCX A;  3PVN A;  1N3O A;  1FOD 2;  1BBT 1;  2PQQ A;  5G04 L;  3H7Y A;  3EHK A;  4RGG A;  1C8M 2;  4B4Q A;  1OFS A;  4PT6 A;  4HN0 A;  2JG8 C;  2CU5 A;  4XCB A;  5KHI A;  1ND3 C;  3UES A;  4HPK B;  4ERO A;  2JJ6 A;  5FYT A;  1HIX A;  1RC6 A;  3O0X A;  3N7K A;  3LF7 A;  4I30 A;  3VD5 A;  2DDU A;  4AI0 A;  1R08 3;  3JD7 2;  3LSE A;  3AX4 A;  1B35 A;  2VOV A;  3BTY A;  5JXG A;  5EJZ B;  1UOB A;  3WDY A;  1BEV 1;  4QPG C;  4FCA A;  5KC6 A;  4KGG A;  2JXA A;  2EA7 A;  2WAB A;  2JE9 A;  4CDQ B;  2ILM A;  3GYD A;  2WFP A;  1MPX A;  4LKE A;  3HIF A;  4JGY C;  4UF0 B;  4ISQ A;  1S0B A;  2BW8 A;  3OGV A;  1DYK A;  4NPM A;  5CIS A;  5F2S A;  1H4G A;  1W2N A;  1RJ8 A;  1ULF A;  5FOB B;  4FPO B;  3RZZ A;  4XFC A;  4FQZ A;  3PMS A;  1CWP A;  1R1A 1;  3POB A;  4GWJ A;  5A6Q A;  1CN1 A;  2ADE A;  2RDS A;  2VNG A;  3VBH C;  2RE9 A;  1U5X A;  1Q8S A;  1LES A;  1XNK A;  5FJH A;  4Y4R A;  2Q8C A;  2NP0 A;  1RTV A;  5DAQ A;  5FY4 A;  3NNG A;  4L92 A;  1H8V A;  3NV2 A;  5F5I A;  1U0A A;  1HDK A;  1UZZ A;  1WMF A;  4C1X A;  3I4I A;  4JZR A;  5DUU A;  5FBJ A;  1FMD 1;  4JQR A;  4R9A A;  4XE9 A;  3VV1 A;  5IWF A;  4IEQ A;  4RA0 A;  4YW7 A;  3WQ0 A;  3RZJ A;  4FFI A;  5SV8 A;  5DUV A;  5FZL A;  4OHZ A;  4OI2 A;  1RUC 1;  4NUB A;  4FOQ A;  4N53 A;  2E9Q A;  1HRI 2;  4N90 A;  5KBF A;  1UY2 A;  4CA9 A;  2XML A;  1JHN A;  2QVS B;  3WT3 A;  3GZE A;  1WA4 A;  4Y20 A;  2WBK A;  3JQW A;  4XAB A;  3TEZ A;  1CAU B;  1PVC 1;  3HVD A;  1I6X A;  1SDW A;  3ZSL A;  3W20 A;  1OH3 A;  4E2G A;  5HXM A;  1WLT A;  2ZEX A;  1GNZ A;  3EO6 A;  2P5B A;  4LO8 A;  1V6J A;  4HFS A;  3I3M A;  1MVQ A;  1NE6 A;  4IL7 A;  3V0A A;  3FBY A;  5A7S A;  4CCD A;  4RSU A;  1W0P A;  4QPI A;  1POQ A;  1VAM A;  2R06 3;  3GBF A;  3J7N A;  3IDB B;  3EJK A;  2QJV A;  4HK9 A;  5CZK A;  1DGW A;  2ZZQ A;  3L2H A;  2C9K A;  4Q29 A;  4AED A;  4AOC A;  4TLG A;  2E26 A;  4XOG A;  1GQG A;  1DLC A;  5A3L A;  1I5P A;  5FYU A;  2EAL A;  3JXS A;  2WZP P;  4AVB A;  4EWD A;  2BNO A;  3CDZ B;  1PZ8 A;  1LGC A;  2VW1 A;  5C70 A;  3T2P A;  5HBA A;  5KXB A;  1CX4 A;  4CDU A;  2QNK A;  3MW3 A;  3LSD A;  3N9P A;  5FXX A;  1COV 1;  4P9L A;  4R4X A;  5IT6 A;  1JUI A;  3C7G A;  1OUX A;  1SPP A;  2VC9 A;  1KFU L;  4XAA A;  1PZ9 A;  1W28 A;  4Q4W 3;  1YJL A;  4HKO A;  3NMB A;  1OUS A;  4XFF A;  4Y5T A;  1ULE A;  3NST A;  4CEY A;  3P1I A;  4UFI A;  3ES4 A;  3I3Q A;  1V6N A;  2WS9 1;  1JOD A;  2ARB A;  2WQ4 A;  2GAL A;  4HET A;  2BTV C;  1WD4 A;  1S2E A;  1K5J A;  1ZX5 A;  5JXJ A;  2JG9 C;  5J48 A;  4J1X A;  5BUV A;  3K46 A;  2ARE A;  4GIQ A;  1Q5O A;  5A7O A;  4QQH A;  3O1V A;  5JLV A;  2J22 A;  5A3W A;  1HKD A;  4P9W A;  1W8O A;  1XRU A;  1ZNP A;  4E8C A;  2VQT A;  4PCR A;  2P6C A;  4OYU A;  3VDD A;  4IE0 A;  4LA3 A;  4WV8 A;  2EXJ A;  4XJZ A;  3LDB A;  3B7M A;  3VBF C;  3IPV A;  3I2K A;  4KH9 A;  4WBB A;  5I91 A;  5I0U A;  2HJI A;  5H9Q A;  3ZOI A;  3AYC A;  4AVC A;  4LEJ A;  2Y26 A;  3KSC A;  5C8C A;  1JTZ X;  2VQ0 A;  1LHO A;  2C1F A;  4LHL A;  5K8S A;  1Y3T A;  2HBT A;  1YFW A;  4LIT A;  3QAC A;  1C3H A;  4DS0 A;  2AEY A;  1RIN A;  1TQ5 A;  1WCU A;  2B4K A;  3ATG A;  1NYW A;  3GCX A;  3K3N A;  3ME2 A;  4EZ4 A;  4HSJ A;  1JU4 A;  4NPR A;  4CDW B;  1DGW X;  2JE7 A;  1S2B A;  4AQS A;  2AYH A;  3SXW A;  1PIV 3;  4K3U A;  1UQX A;  2D44 A;  2A3W A;  1UOF A;  1OQ1 A;  2B7Y A;  5KWR A;  5FZC A;  2JG8 B;  5KHK A;  1ND3 B;  4COV A;  3ELN A;  3LAG A;  3IMN A;  3WIN E;  3ZYR A;  5I0S A;  1W8U A;  2WR9 A;  4B4P A;  5A7P A;  5FZE A;  4L0P A;  3VKO A;  1QKQ A;  4E4S A;  4AVA A;  4MUV A;  2VGD A;  3OYW A;  2JIC A;  2FQP A;  2AAC A;  4IEZ A;  3E6D A;  3K2O A;  5JWP A;  3KT7 A;  2ZGQ A;  1GYK A;  4NWV A;  3FLP A;  1S55 A;  1RUE 2;  4JGY B;  2VPV A;  5L36 A;  2YBS A;  2OA2 A;  2B9U A;  2QQW A;  1UXZ A;  5TSW A;  3ZXJ A;  1KRI A;  1B35 C;  2OZ6 A;  3MIE A;  5GZF A;  3URF A;  3NQH A;  4H7M A;  2CL2 A;  4CZS A;  3NW4 A;  3D82 A;  5FZ8 A;  4MET A;  5KXC A;  4Y1X A;  2Q1Z B;  2QQM A;  2WQZ C;  3IN9 A;  3USU A;  1F4H A;  1ZRE A;  3QD6 A;  4I3P A;  4OHV A;  2IWG B;  1PZ7 A;  1UY3 A;  2P17 A;  2PHW A;  2ZKN A;  4HVO A;  4AQ2 A;  3NV4 A;  2IXL A;  5L73 A;  1Z7S 3;  2LUW A;  1PMH X;  3OY8 A;  1AR9 2;  2VOK A;  3FL7 A;  5CAD A;  3I7D A;  2HWF 1;  2NLR A;  3GCW A;  5APA A;  4YW3 A;  2LTN A;  2VBB A;  4QX7 A;  2DVA A;  4J25 A;  1OQD A;  4M4P A;  3VBS A;  4AFM A;  1N1Y A;  2ET1 A;  3RMX A;  3HT1 A;  3ZX7 A;  2A6X A;  4IEX A;  2QCS B;  1OD3 A;  4ASM B;  4K6B A;  3ST7 A;  2QQU A;  3P3P A;  3WHT A;  1D7P M;  1WCD J;  2CWM A;  4YM0 A;  1ULC A;  5B2G B;  2BWA A;  3ZR5 A;  4FPY A;  3WD5 A;  2XB6 C;  4LHK A;  2IC1 A;  4OMD A;  2YU2 A;  1MS4 A;  1RED A;  1B09 A;  3WDW A;  4BXS V;  1W8T A;  3DL3 A;  2JEC A;  5IVB A;  1KJR A;  1GBG A;  2XH6 A;  2X05 A;  4N53 C;  1PNG A;  1UOG A;  3I59 B;  4AF9 A;  3KVB A;  3IWZ A;  5SV5 A;  3HBK A;  2Z79 A;  3POE A;  4V2W A;  1DYP A;  3ZSJ A;  1IS6 A;  2DCK A;  2XQX A;  1RUF 3;  3IZO A;  3BKZ A;  3VDC A;  4HBN A;  1ENX A;  1GNY A;  4LLF A;  3EBR A;  4Y1U A;  3WNX A;  3SLI A;  1AYN 3;  3GZA A;  3KS7 A;  5DXD A;  2YDE A;  2BVV A;  1KXG A;  2FCT A;  3JUU A;  3ZSM A;  4IEU A;  5CBL A;  1UU4 A;  1D2S A;  5JOW A;  1JUH A;  3T1L A;  3WW4 A;  4Z92 B;  1K42 A;  2XGX A;  1DU3 D;  2JDM A;  2W08 A;  3ZYG A;  4AQ6 A;  1A8M A;  1RHI 1;  3H1W A;  4HPK A;  1ZZ7 A;  3S7E A;  3FMG A;  4MX3 A;  4QPI C;  2XOM A;  1OPM A;  1CJP A;  1VE0 A;  2JDU A;  4QM9 A;  5JOY A;  1C4R A;  1EY2 A;  2ZBJ A;  4LBQ B;  3KQR A;  3LD8 A;  3AP4 A;  4NVP A;  5IAX A;  3WG3 A;  2CHH A;  3III A;  4FP3 A;  2W87 A;  3DYP A;  2QQI A;  4BHP A;  3WEZ A;  4HVQ A;  4AI9 A;  1CAV B;  1H8T A;  1W6Q B;  2VCM A;  3BN6 A;  2Y0I A;  2HWB 3;  2AH2 A;  3FUO A;  4UF0 A;  4XFH A;  5FMD A;  1DZQ A;  1ONA A;  1JYV A;  3RZM A;  1SBD A;  2YC4 A;  5FZ3 A;  2P3K A;  5L9B A;  1VBA 1;  4FPK A;  2BQP A;  3D8C A;  3MW2 A;  4P9G A;  2XL7 A;  3IMM A;  5FPU A;  4CEY C;  1J3Q A;  2OZJ A;  3W9A A;  4ZU7 A;  1NX9 A;  4GWI A;  1MS9 A;  4RD7 A;  2RS5 3;  1BEV 2;  5C9A A;  3FZ3 A;  1TG7 A;  1NXM A;  1SLL A;  2EF6 A;  5FR3 A;  1XYP A;  4LO7 A;  5JVV A;  1QNY A;  3WG1 A;  2D6K A;  3RDI A;  5C4W A;  1H6X A;  3UGH A;  2TEP A;  1W6M B;  3VGI A;  3VBF B;  1UPS A;  1UL9 A;  3AVR A;  1AX1 A;  4GJY A;  4LHS A;  4V1P A;  1CJD A;  1OPO A;  2HWE 3;  4ZZ8 A;  2J1S A;  2WFF 3;  2Y6G A;  1UU6 A;  4PIX A;  1YXW A;  1CX1 A;  1UPI A;  1R09 2;  3J8F 3;  4KGQ A;  1LRH A;  3VDD C;  4PQ9 A;  3OEA A;  2BEO A;  3WP4 A;  2E7T A;  3A0N A;  3PDQ A;  3RZG A;  1FOD 1;  5JOX A;  2WC2 A;  2W5F A;  1ODN A;  1FNZ A;  1WA6 X;  3AMQ A;  3KGZ A;  3PVE A;  2OYZ A;  5J3U A;  1JYN A;  1C8M 1;  4RS5 A;  3LDK A;  1AYM 1;  4ISR A;  5ACA 3;  4RFT 0;  1GNH A;  4YZ3 A;  1VPH A;  5I8T A;  1F8V A;  4W6Y A;  5E88 A;  4CP0 A;  4D6R A;  3QLQ A;  1V6L A;  2UUR A;  3M1H A;  3T1M A;  2E53 A;  2K46 A;  2WL1 A;  5HCF A;  5FQ0 B;  5A32 A;  2YRO A;  2PAE A;  3CJI A;  2VZV A;  3AKR A;  1MEC 2;  1N3P A;  1GQP A;  1XB9 A;  1RUC 2;  1HJG A;  3ACI A;  4ZXE A;  4BOW A;  3ETP A;  5CEH A;  3NJV A;  1X33 A;  3LEM A;  3MGU A;  5DG1 A;  3FX3 A;  4DY5 A;  3JBG 2;  1OOP C;  2VD7 A;  2YC0 A;  5FRA A;  1AR6 3;  5FZ6 A;  3T09 A;  2GH8 A;  5FZ7 A;  4O9E A;  4AVV A;  2RMU 3;  2VUL A;  1IOA A;  1OA4 A;  5BNQ A;  1ENR A;  1UKG A;  2VH9 A;  3KCY A;  3MIB A;  4JQT A;  1QNW A;  4NN0 A;  1LEM A;  1IG3 A;  2IFW A;  4QDR A;  3WOG A;  4D6Q A;  3OD4 A;  1RIR A;  3KV6 A;  1H1M A;  1B35 B;  1JYI A;  4YYO A;  4E4Z A;  3UNP A;  2G9Z A;  2HWD 3;  1RMU 1;  4YAR A;  3Q8C A;  4GMP 3;  1FI2 A;  2PHF A;  4NAM A;  1TNF A;  4NO4 A;  1REF A;  1Q8Q A;  2DVD A;  1ODM A;  4OUL A;  4CCJ A;  4G3Y C;  1QY4 A;  2ZAB A;  3AMM A;  3RJR A;  1YI9 A;  2JDA A;  4YRD A;  4PLO A;  5I8S A;  2E32 A;  1VP6 A;  3HNM A;  5FZH A;  1OA2 A;  1S4C A;  1Z7S 1;  2BOJ A;  2PYT A;  1COV 2;  2RS3 3;  2RVA A;  3DCQ A;  4WVM A;  1HW5 A;  2DVF A;  5EJ1 B;  1TME 3;  3N9Q A;  3I2J A;  1RUI 3;  4UW5 A;  1HV1 A;  3ACG A;  2BDR A;  3KV9 A;  5C7G A;  5FY0 A;  2VMF A;  2WZR 3;  3NJY A;  5FDB A;  4QX8 A;  2AEZ A;  2ZTN A;  4W50 A;  2VNV A;  2Z2S B;  4JTN A;  3RYP A;  2BU9 A;  1CZT A;  2OVU A;  1SLC A;  4M0H A;  1QXR A;  4QB2 A;  2OW4 A;  1G6N A;  4HAN A;  5FP7 A;  3VBS C;  3VBR A;  2JEN A;  3VN4 A;  2J1V A;  4MO3 M;  2XVK A;  2ZX2 A;  4Q4Y 1;  5FY1 A;  5E16 A;  1O3Q A;  1QOS A;  1X82 A;  4C0B A;  3VBU A;  5FPB A;  4R9C A;  3OD0 A;  4C90 A;  3OEB A;  4N53 B;  3ZN4 A;  3ZYP A;  3TRS B;  2W1W A;  2R04 3;  1S0I A;  4OHW A;  1LNS A;  5FZ0 A;  2W91 A;  4ZPI A;  1JOP A;  3RSJ A;  1H2L A;  1IKP A;  5AVA A;  2Q1M A;  3ZPY A;  3LA3 A;  1UY1 A;  5EQU A;  1RUF 1;  2IVI B;  4LBJ A;  1NZI A;  3K4A A;  3C2U A;  3ROU A;  1AL2 3;  5A1A A;  4K40 A;  2RV9 A;  3A23 A;  3H42 B;  1YFY A;  3POS A;  1ZBE 2;  1GOF A;  4QMA A;  1OXC A;  1BQP A;  2A75 A;  2GN3 A;  3VKM A;  5FPZ A;  4EN6 B;  3V0A B;  5DUW A;  1XQN A;  3CMG A;  4M0N A;  5JUV A;  2O8Q A;  1OKO A;  3PUH A;  4D94 A;  4QPI B;  1ZVF A;  2D6L X;  3EYP A;  4CVU A;  1QF3 A;  4KWL A;  4CCN A;  4KWU A;  2R32 A;  1UKR A;  2XJQ A;  2ZAA A;  1LHN A;  4AED B;  5LBC A;  5AC9 3;  1AX2 A;  2KXL A;  2QZ2 A;  3N9M A;  4QPG A;  1ZBA 2;  3SMH A;  4CCL A;  1LEN A;  2TUN A;  3GDB A;  4GAL A;  5ANQ A;  3WSO A;  4JGY A;  3UKT A;  3PUQ A;  3IDE A;  3VL9 A;  2YUE A;  1W8N A;  2RM2 1;  1FAY A;  4EJR A;  1GUI A;  1SPP B;  1DQ1 A;  1VMH A;  2VVD A;  3QH7 A;  4E27 A;  4JC1 A;  4QXK A;  3LKJ A;  4CEY B;  5HXV A;  3PME A;  3WCS A;  4NOT A;  3HT2 A;  4BLJ A;  1ULP A;  3TN9 3;  1SEF A;  1SFY A;  1XNA A;  2YZ4 A;  1HRV 1;  2WNO A;  3J26 N;  3BOP A;  5IJR A;  3SH4 A;  3VBH A;  1JXN A;  3IB3 A;  1RXF A;  3LEK A;  2ZGN A;  5A3U A;  2LW8 A;  1W9W A;  4H55 A;  2DCY A;  2VMG A;  1GOH A;  5GLU A;  5KHH A;  5JPN B;  2C6S A;  1TNR A;  1HXS 3;  1X8E A;  2XVL A;  3L9J T;  3PTY A;  1LU1 A;  3SH5 A;  3FC0 A;  4F3J A;  3V64 A;  1UZ0 A;  1MZ6 A;  2EIE A;  3FBM A;  4GD4 A;  5GZE A;  2ZMN A;  4YGB A;  4BQ1 A;  5C9A C;  2PEL A;  5A3O A;  4B4R A;  4P14 A;  3WDX A;  3I8T A;  3SC7 X;  1RUD 3;  4DXR A;  2HWE 1;  2D5H A;  2A3X A;  1UMH A;  3VDD B;  5C4W C;  3H8R A;  2PAM A;  2EXI A;  3PIJ A;  4UBH A;  4WVZ A;  5CVR A;  2W92 A;  2ZKL A;  1ENQ A;  4ATF A;  3IPV B;  4ET7 A;  3H0O A;  4AEK A;  2XBO 3;  3NV3 A;  4KNC A;  4LBK A;  5FWE A;  2HWF 2;  5IFT A;  4WM8 A;  1H30 A;  4YLZ A;  2IZW A;  4N9H A;  3FJS A;  1YQ5 A;  1J84 A;  5IK7 A;  3MEP A;  2DU1 A;  3WR0 A;  3WXP A;  1K12 A;  5IUQ A;  3RYK A;  2XKP A;  3MPP G;  4MGS A;  5LCW L;  5FKC A;  3N7M A;  5EXO A;  3RNS A;  4DUV A;  1JZ4 A;  5LA1 A;  3DXT A;  5JR7 B;  3SIS A;  4RS5 C;  1POV 3;  5JZG C;  2RDQ A;  4X6R B;  4XJU A;  4P9I A;  3S0M A;  1DQ5 A;  4BLI A;  4MHU A;  3T3Y A;  3CL1 A;  1WCQ A;  3CJI C;  3ZO0 B;  1AR6 1;  3WHU A;  4BU2 A;  5E1R A;  2CYF A;  5FK7 A;  3WZ1 A;  5HCA A;  4XJ9 A;  3OUI A;  5FAX A;  3W58 A;  1KEX A;  2YV8 A;  4QQP A;  2BJS A;  3ZN6 A;  3WW2 A;  4DRV A;  1GAN A;  3VD3 A;  3HR9 A;  3BAL A;  2R30 A;  1VBE 1;  2RG4 A;  3AXE A;  5GKA C;  3A22 A;  1DGR N;  3N35 A;  2F4P A;  2GME A;  4LBQ A;  1L7Q A;  3ENR A;  4LBQ D;  4WM7 A;  1G9B A;  3VKL A;  2XR4 A;  5C6C A;  3WF2 A;  4GQ7 A;  2BGC A;  3AMH A;  2XLA A;  1F5F A;  1CAV A;  4QKN A;  2G4I A;  2ZGR A;  3I97 A;  3OBR A;  4N8M A;  5DG2 A;  4BQ2 A;  5JI9 A;  2AEN A;  2R06 2;  3MFA A;  2QQJ A;  3AC0 A;  1LB2 A;  1RHI 2;  4D6S A;  1W8Z A;  2VNR A;  5A1F A;  2IXK A;  2J1U A;  1O8S A;  2JG9 A;  2JE8 A;  3GGL A;  1NLS A;  4IEY A;  3ZSE A;  2Y6L A;  1WD3 A;  1LU2 A;  5F2W A;  3USU B;  2MEV 1;  4SLI A;  5A80 A;  4MH0 E;  4XF1 A;  2PHU A;  2XXZ A;  2FMY A;  2C0Z A;  4M3C F;  1RJ7 A;  4QGL A;  2RS3 1;  1GWL A;  1AR7 1;  3OY8 B;  3E5Q A;  5FFO C;  4EYU A;  5GZG A;  2XUM A;  4XET A;  4KU7 A;  4JDM A;  3BYW A;  2VW0 A;  5KHG A;  1VB2 A;  2PQS A;  1LJ7 A;  2OUJ A;  3C7H A;  4UW6 A;  3TBD A;  4A45 A;  4DEQ A;  2WWJ A;  1CZS A;  1VBA 2;  4M00 A;  3D6E A;  3LE0 A;  3MYX A;  1GQH A;  3VBS B;  5DQ0 A;  4XAC A;  1RVF 3;  5HCB A;  2BGO A;  2VZ3 A;  3WP6 A;  1F5J A;  1MR5 A;  2VXR A;  1IS3 A;  2P2K A;  3IDC B;  4CUA A;  3H7J A;  4AFA A;  1JOJ A;  1J3P A;  2QFE A;  3DKQ A;  1YQ2 A;  3PUI A;  1J59 A;  2ID4 A;  3JU9 A;  2ZHM A;  4D7Y A;  4OI0 A;  1AR8 3;  3VBR C;  1GZW A;  4Y1V A;  5FK8 A;  3MLJ A;  1FPN 1;  5LB6 A;  1REE A;  4AR2 A;  2RJK A;  3CQO A;  4LK7 A;  2P3I A;  1LOF A;  1W39 A;  3KCX A;  2Y6K A;  5BY5 A;  3I3E A;  4QX0 A;  4R4Z A;  4Z2A A;  5FQ0 A;  2NZ9 A;  1AL0 G;  4M3C A;  2JWP A;  4H7L A;  1O4T A;  5CG8 A;  5FO8 B;  1AJK A;  5FV3 A;  2IXC A;  3PU3 A;  4D7T A;  3SEP A;  1NXD 1;  1I3H A;  2I74 A;  4ORF A;  1SDD B;  3DUI A;  1S1A A;  5FP4 A;  1BLZ A;  4Q1P A;  4YNI A;  1PGS A;  2CAV A;  3LWC A;  2EAA A;  4FFF A;  3MLK A;  3AL5 A;  3AMP A;  5LBF A;  5IFP A;  1VBC 3;  1AYM 2;  1VBB 1;  1WZX A;  1H4H A;  4I01 A;  4NHK A;  1XPW A;  2BWC A;  2DUO A;  1UN1 A;  2G19 A;  3O0W A;  1QXP A;  4ZON A;  1PIV 2;  5AC9 1;  4NJ4 A;  1DQ2 A;  4GA9 A;  3ZYJ B;  1SFN A;  5J09 A;  4UFJ A;  3MF9 A;  3RI9 A;  2NMO A;  5FMC A;  2P34 A;  4Q2F A;  2A70 A;  5A7N A;  3WVJ A;  1YHF A;  4HLT A;  4P00 B;  5FY9 A;  4BIF A;  4Z2W A;  3RPQ A;  2EXH A;  2WN3 A;  1RUN A;  5F3G A;  4IQP A;  2GNB A;  1H8T B;  1QJX 1;  5IVJ A;  4LMF A;  1BXH A;  1RUG 1;  2ZEW A;  5FYC A;  1HN0 A;  4CEW A;  2ADD A;  4Q4X 1;  4W8J A;  1X8M A;  2GMM A;  4CXW A;  1FV3 A;  1AXY A;  2R7E B;  3WV6 A;  5GJ6 A;  1DFQ A;  1SLT A;  4XBL A;  4AEJ A;  3NNL A;  5FPX A;  1GP5 A;  3ZYF A;  1UW8 A;  1WW4 A;  4A2U A;  4CTE A;  1SG3 A;  1SMV A;  4XMA A;  1R09 1;  4LIU A;  4NHX A;  1STM A;  2QTW B;  2HEW F;  4UW3 A;  4O9G A;  2R1D A;  1HXS 1;  5C9A B;  4Q0P A;  1RMU 2;  4HKL A;  2B9V A;  2Y38 A;  1DQ4 A;  4W6X A;  2UY8 A;  2C26 A;  3A7Q A;  4QX5 A;  5C4W B;  1O91 A;  4YZ5 A;  1YLL A;  1QH6 A;  1W0O A;  2CTV A;  1XOY A;  2FCU A;  2MPF A;  3AKT A;  3H8O A;  1HB2 A;  4BWO A;  1BHG A;  3AYA A;  2VQU A;  3AZX A;  3ZMN A;  3POY A;  5C3Q A;  1SBE A;  3KD4 A;  3LZZ A;  3ZKY A;  3POG A;  5FWJ A;  4ES9 A;  2VUJ A;  1Z7S 2;  2JDH A;  3AP9 A;  4AFC A;  4AGR A;  2BNN A;  3UKV A;  4AHY A;  4XUT A;  3KHC A;  1MEC 1;  3BB6 A;  1QGL A;  1QQP 3;  1S0F A;  1QU0 A;  4AGV A;  5JXH A;  4UI9 L;  2J1A A;  1IPK A;  1GIC A;  3JBG 1;  4FI9 A;  5F3E A;  3LQC A;  3O1R A;  1PM4 A;  2QQL A;  2VTX A;  2R16 A;  4WM8 C;  1W9S A;  4RS5 B;  2FDK A;  1ZA4 A;  4MGZ E;  1W05 A;  3GM8 A;  4CPB A;  1LOC A;  4RR3 A;  4CPB D;  4P5Y A;  2JDN A;  3NVC A;  3IDA A;  1OC1 A;  2VY0 A;  3T0D A;  1A34 A;  2DTW A;  2SLI A;  5J98 B;  4C0H A;  1PMI A;  4Q4Y 2;  5A32 B;  5C5U A;  3AXD A;  1VBD 3;  3CJI B;  3PTR B;  3RVH A;  4G9S B;  3J7L A;  3RZK A;  4RQP C;  2WWU A;  2O1Q A;  3IM0 A;  3I2D A;  1OUR A;  4YW5 A;  2IXJ A;  1LOG A;  2DV9 A;  3THT A;  2Q0A A;  3S5Q A;  5IK8 A;  1C57 A;  4B1L A;  4UWD A;  2EVX A;  1X7N A;  2BVB A;  4Q0Q A;  4RFR B;  1XE7 A;  1C5I A;  2Q30 A;  4ZS3 A;  3TOJ A;  1RUF 2;  3O1U A;  4IDZ A;  2MHF A;  3GBW A;  3OTF A;  2HEV F;  4Q0V A;  4BYY A;  2Z4F A;  4NE9 A;  4BXF A;  1WW6 A;  3MFC A;  2D6O X;  4MYE A;  4QAW A;  3AKP A;  5FYS A;  5IVY A;  4WM7 C;  4E2S A;  3ILN A;  4XFB A;  1OVP A;  1IKQ A;  1F35 A;  1LEC A;  1IGO A;  2BUK A;  4Q0S A;  3ZM8 A;  2C4X A;  2E31 A;  2YXS A;  1UNB A;  1W06 A;  3ABZ A;  2BYV E;  4A6O A;  1H1I A;  1JZ5 A;  2VMI A;  1YFU A;  3W5M A;  1ZZC A;  1OQE A;  1UY4 A;  4DB5 A;  1VAL A;  1EAH 3;  3BTZ A;  4OUM A;  5FZ4 A;  1RUO A;  4R8H A;  4WVM B;  2RM2 2;  2Y6J A;  1KFX L;  1MS0 A;  3MPB A;  4GWM A;  3BOD A;  3FFQ A;  4Z07 A;  2HWB 2;  5FUN A;  5FZB A;  1ACC A;  2QE3 A;  3WP3 A;  5BV6 A;  1CAW A;  1JOB A;  2GMP A;  3CEW A;  1OF3 A;  4EN9 B;  1ZA7 A;  2XJT A;  3P6B A;  1UXX X;  3DXU A;  1RVF 1;  4P9Y A;  1O6U A;  2GC0 A;  1HRV 2;  1W6N A;  3CJX A;  2JB8 A;  5FCC A;  2Q8O A;  2Y0O A;  2Z69 A;  4YM3 A;  5JOZ A;  3N9L A;  4OLL A;  2HEY F;  3VDB A;  4JX0 A;  1V6O A;  2RS5 2;  2OII A;  3WY6 A;  5CFC A;  4JTO A;  3VBR B;  2KR2 A;  5GM0 A;  4CCO A;  1A3K A;  2RJL A;  4GMP 0;  3VBU B;  1CIW A;  5EIY B;  3V65 A;  1ZBE 1;  2W94 A;  3B69 A;  4KBZ A;  4PIZ A;  4XZU G;  5B4N A;  2ZGL A;  1RUJ 3;  1PO1 1;  5K0U C;  3JZV A;  4X8N A;  4ZKT B;  2YBP A;  2HWE 2;  3IBM A;  4DXT A;  2WFF 2;  3MLL A;  4QXC A;  4E4D X;  1EPW A;  3J8F 2;  2OQ7 A;  4EE2 A;  2WO1 A;  5FZF A;  3WNP A;  1EV1 3;  3B01 A;  5J96 B;  1OOP A;  1OSG A;  3KWV A;  2ARX A;  1ZBA 1;  1E5R A;  4Q4V 3;  1IS4 A;  4Q26 A;  1LOF C;  3T4H B;  4GB3 3;  4XVH A;  1HLC A;  4WVW A;  4PJY A;  2X09 A;  3ACL A;  3ZYB A;  3ZDV A;  4MGK E;  1SZB A;  3R05 A;  5ACA 2;  2GP5 A;  3S5A A;  2LRO A;  2WKK A;  3K75 B;  2ZX1 A;  5FIX A;  5LA0 A;  1H2K A;  2I45 A;  3NKG A;  3KZ4 C;  4LK6 A;  3MV0 1;  1UZY A;  2CWS A;  4DEV A;  5DAW A;  5HI0 A;  3VZJ A;  1DQ6 A;  5D1I A;  1R08 1;  4QPG B;  4XQ4 A;  2A3Y A;  3U4X A;  4Q5O A;  5J36 A;  1WCS A;  4BM8 A;  1XYO A;  1H0B A;  4GH4 C;  1UX7 A;  2ZHN A;  4XJW A;  1DBN A;  1C8N A;  2XDV A;  1AR6 2;  3B00 A;  2W1S A;  4N9I A;  5JIA A;  2VMC A;  3AM2 A;  3ASI A;  4CU7 A;  3UL2 A;  5LA9 A;  4OCT A;  1GU3 A;  4K9S A;  1D4M 3;  1H9W A;  2VOX A;  2XJV A;  3JB4 C;  3NV1 A;  3RWK X;  2K2S A;  3NNF A;  1O5L A;  4N43 C;  4X6Q B;  1AXK A;  5FPV A;  3C7E A;  3PUS A;  4CUG A;  2CAU A;  1VBE 2;  3M70 A;  4I0W B;  5ERL A;  1NUK A;  3PVB B;  1I1E A;  3ZFE A;  3TNP B;  3VBH B;  2OPW A;  4CEW C;  5DMY A;  4UW4 A;  1PX4 A;  4P08 A;  4XDP A;  2JDZ A;  2WNU A;  1U12 A;  4DPN A;  4Q8K A;  3GZT B;  3N4M A;  4FPE A;  2QQP A;  1TZO A;  3Q8A A;  3VL8 A;  4IV1 C;  2UYB A;  5EP9 A;  2HH9 A;  4EN7 B;  3AZY A;  3CNA A;  3AFK A;  3BGA A;  3Q9O A;  1UF2 C;  1S0G A;  4QWN A;  4LBN A;  1FV2 A;  3APB A;  5FLJ A;  1UMI A;  5A7W B;  2MEV 2;  2RR1 3;  3HOB A;  3Q8F A;  3LOB A;  1KGY A;  2F4L A;  4XF0 A;  2R6Q A;  2VBP A;  3FHA A;  2VCA A;  2RS3 2;  3U11 A;  1AR7 2;  3K51 A;  3H50 A;  1JYX A;  1EYB A;  1XBF A;  2XKO A;  4LTA A;  4IE5 A;  4LKD A;  4UT5 A;  5CYY A;  3UJO A;  4F8A A;  2GDF A;  2PHL A;  1VJ2 A;  4FSJ A;  4WM8 B;  1WME A;  2WQ8 A;  1OBN A;  4MHR A;  4YVW C;  4OMC A;  4QQO A;  5I8Y A;  2FDH A;  4JVA A;  1CZV A;  2VZS A;  3K3O A;  1CQ9 A;  2YB7 A;  1LOB A;  2ZX3 A;  5FXW A;  4NIA A;  4LNV A;  2IUW A;  4YW1 A;  4UFH A;  2VL4 A;  1UU5 A;  4BQX A;  2YYO A;  1P8J A;  4LPL A;  4GJZ A;  4M4R A;  4RQP B;  3MDP A;  2DCJ A;  1VBD 1;  3B02 A;  4LO4 B;  4YVS A;  2XON A;  2VG9 A;  4I0B A;  4RR3 C;  4Y1Y A;  3WDU A;  2J1E A;  1FPN 2;  1F31 A;  3HEI A;  4CU8 A;  2R04 2;  4DZG A;  2G1M A;  1VR3 A;  1NAE A;  2R0H A;  4YG0 A;  4RYD A;  5T5P A;  2R06 1;  2D3R A;  4JRL A;  2XJU A;  3ZMO A;  3M3Q A;  3ZPO A;  4BDV B;  3UT0 A;  4D3W A;  3ZN6 B;  3UYJ A;  4IEW A;  3P3N A;  5FXV A;  4WM7 B;  1DGL A;  5T55 A;  2VZU A;  2YPD A;  4BQ3 A;  1QEX A;  5C5T A;  1APN A;  3VKF C;  1WBF A;  3ZSK A;  4XAE A;  4LKS A;  1AJO A;  5BNO C;  3HNB M;  3RWN A;  1VBB 2;  4V2V A;  1D4V B;  5BPX A;  4Q4W 1;  5A1L A;  1W6P A;  5IVF A;  1MS3 A;  5D8A A;  4ARX A;  3OBT A;  5I93 A;  2B45 X;  2QQV A;  3PJQ A;  4LOS A;  1UIJ A;  4BJ0 A;  2FCV A;  5AC9 2;  4DY3 A;  4IE7 A;  1POV 0;  1A78 A;  2JG9 B;  5FYH A;  1YIF A;  3KCC A;  1Q43 A;  4OQ8 A;  4X8P A;  1QJY 3;  4XBQ A;  3VB9 A;  4OUS A;  3OGS A;  2Y33 A;  1X9T A;  1EAH 1;  1QJU 3;  1ZRR A;  3B3Q E;  4FBF A;  1SAC A;  5JI7 A;  2W1Q A;  4AK3 A;  5CKM A;  3ACF A;  1QJX 2;  3CF6 E;  3WF4 A;  1RUG 2;  1SCS A;  2YPJ A;  4XHB A;  2ORZ A;  1LGB A;  4Q4X 2;  3SQO A;  2GC3 A;  1N3Q A;  2BFU S;  3TN9 2;  4NHL A;  4DXZ A;  5FY7 A;  4XFA A;  5JAX A;  3PVO A;  1LCL A;  2PHX A;  2PHT A;  2ZHK A;  3A4U A;  5FYV A;  2DYC A;  4EQV A;  1HQW A;  2O14 A;  1XE0 A;  1HQL A;  1HXS 2;  3EQE A;  5A6X A;  5K0U B;  2LAL A;  1NG0 A;  4UFK A;  2PHR A;  2JEM A;  2XWJ B;  4COZ A;  5K9Y A;  1PGL 2;  3WLU A;  5CFC C;  3FN9 A;  3LFI A;  1GZW B;  4JDN A;  5F1R A;  1ASJ 3;  2VAU A;  1O5U A;  4RN5 A;  4OQ9 A;  4ASL A;  5JZG A;  5KXD A;  3MZH A;  4UFL A;  2RDR A;  1G9D A;  4ITC A;  4QGN A;  1YRZ A;  3IKW A;  3J7M A;  5EV7 A;  1PIV 1;  4GAZ A;  4XQD A;  3DYO A;  4M3C B;  3N9O A;  3O12 A;  2PA7 A;  4MOA A;  4C8D A;  3ZFG C;  1BMV 1;  1Q3E A;  2ZS6 B;  1PK6 C;  4CU9 A;  1WLW A;  1XU1 A;  1W9Y A;  3ILF A;  5GLW A;  2FBE A;  2AC1 A;  2WZE A;  4QX2 A;  3R4S A;  4NR1 A;  2ZGS A;  1H1A A;  1JW6 A;  4AAP A;  1GZC A;  1W03 A;  2UYA A;  3LGR A;  3POF A;  1PNF A;  4MGQ A;  3VHR A;  5DZG A;  4DUX A;  3I2I A;  3FUQ A;  1LHV A;  4A7K A;  2PHD A;  2WSV A;  3Q8B A;  3QCW A;  4LE3 A;  3I2H A;  4YG3 A;  3T30 A;  1X36 A;  3WF3 A;  3WNO A;  2VOW A;  3BOW A;  3UGF A;  4A7Z A;  4FPL A;  4BE3 A;  4OHY A;  2E63 A;  3DYM A;  3OPW A;  3FFZ A;  2WWS A;  3V0B A;  5F5A A;  4PI2 A;  3D4K A;  3O7O A;  4NHM A;  1UYX A;  1VB4 A;  2GND A;  3IAP A;  4P02 B;  3T0A A;  4AVS A;  1GSL A;  1JHJ A;  1O4Y A;  3ZFF A;  1LOD A;  1YEW A;  3WDT A;  1D4M 1;  1RUE 3;  2D6P A;  4YZ2 A;  2PMW B;  4TYS A;  4J6G A;  2GH2 A;  5IVE A;  4A42 A;  4O61 A;  1YWK A;  4L9B A;  5B4X A;  4XTM A;  4ZU4 A;  2V09 A;  2KD7 A;  2AGS A;  4CEW B;  1CON A;  1RGS A;  2A6V A;  1HX6 A;  3ORJ A;  2AR6 A;  4Y5Z 0;  3T2Q A;  3ZDS A;  1T2X A;  4BK4 A;  4EN0 A;  1V6I A;  4TLF A;  1TMF 3;  3LDR A;  5A3T A;  2XHN A;  5FZO A;  3WF1 A;  5F6K A;  3ZFE C;  2O0O A;  2R49 A;  2B46 X;  1W8H A;  3LA2 A;  3LPG A;  1J58 A;  1ZZ8 A;  1AR9 3;  2J1T A;  2WNU C;  4PIY A;  3WW3 A;  1V9U 3;  4YFZ A;  3VZM A;  4K7J A;  5LAT A;  1VRB A;  2P1B A;  3KGL A;  2FDJ A;  3ECQ A;  4E8D A;  5FZA A;  3RRD A;  1W2A X;  3C7F A;  1D0H A;  1UX6 A;  3HMY A;  4S2G A;  2XVG A;  3RS6 A;  4AW7 A;  4YFW A;  5JDB A;  1LUL A;  2D3P A;  2NM1 A;  3VBO C;  3S57 A;  2OQ6 A;  4Y24 A;  3ZXF A;  2WDB A;  3AZW A;  1T6B X;  4YVW B;  5EWS A;  2X29 A;  2A7A A;  1L7L A;  1PMJ X;  3R6S A;  1W90 A;  1A6C A;  5IW0 A;  3SCH A;  1HN1 A;  5C33 A;  3VLB B;  2EIB A;  3NAP A;  1NZC A;  4QQL A;  1RVF 2;  2HYX A;  2CY6 A;  1PO2 3;  4QHO A;  3DKW A;  1G9F A;  3OPT A;  3U07 A;  2W2I A;  4JKK A;  4UAP A;  1WGP A;  4RR3 B;  1AX0 A;  1WUV A;  5FUI A;  5ABJ A;  1JZ8 A;  1QHD A;  3TB0 A;  1AR8 2;  1AYN 1;  1YIP A;  3HN3 A;  4XJA A;  2VXJ A;  5H9R A;  2ZGT A;  1PO1 2;  1RUH 3;  2ARC A;  4YVS C;  3HN1 A;  3D0S A;  3Q8E A;  5ANN A;  4URA A;  3TYJ A;  3U10 A;  1M4W A;  3DF0 A;  2VOT A;  3UK9 A;  2R07 3;  5IAV A;  4NPL A;  4NHY A;  4P9J A;  4U36 A;  5FZ1 A;  3WQ1 A;  4FTS A;  4IGQ A;  1RXG A;  4O7X A;  3SEE A;  2YBK A;  1Y9M A;  4RGA A;  5T54 A;  3GNE A;  2YG0 A;  4LUK A;  2EXK A;  1OFN A;  3MID A;  3U37 A;  2VUA A;  2HKX A;  1TE1 B;  3MV1 1;  3U14 A;  3ZN5 A;  2UWB A;  3DPR A;  4L11 A;  4AE2 A;  4PBO A;  4A6S A;  2NMN A;  4LE4 A;  1YI7 A;  2CNA A;  1BBT 3;  4Y22 A;  3RG0 A;  2HWB 1;  2YFZ A;  3T08 A;  4PI0 A;  1UYZ A;  2DVB A;  2VUC A;  4LKF A;  3WCR A;  4DIQ A;  2WUH A;  3OF1 A;  5LY2 A;  4JHT A;  4OZO A;  2YC2 A;  1R64 A;  3NRU A;  4COW A;  3LFM A;  3PNA A;  4MV2 A;  1R08 2;  5D8A C;  5FUP A;  3OJB A;  3MIH A;  2BRT A;  1QJY 1;  2ETE A;  4BB3 A;  4BQ5 A;  3HQU A;  2RS5 1;  1XXN A;  4Q8L A;  4FPH A;  4QX3 A;  1DGR A;  2ZHL A;  3E6B A;  1G9C A;  1JU3 A;  1L7R A;  5FKB A;  2WYS A;  5DDJ 3;  1BEV 3;  5FYI A;  3RZH A;  2WII B;  5JSO A;  1CAW B;  3I54 A;  4HG6 B;  5E6H A;  1US3 A;  5EJ3 A;  5CU1 A;  3RFR A;  4I02 A;  3W59 A;  2WFF 1;  2QKD A;  2VVE A;  2WNV A;  5A7W A;  5LBE A;  4BH9 A;  3TEY A;  1W6N B;  2PLV 3;  1DZR A;  4NMI A;  1T6G C;  3J8F 1;  4BPZ A;  1TEI A;  3CZU A;  4PHZ A;  3B5L B;  5CFC B;  3WNK A;  1R1A 3;  2ZZJ A;  2JD4 A;  1V00 A;  4S2F A;  2ZCW A;  3T0B A;  5DAX A;  1VAV A;  1WWY A;  3RYR A;  3SHR A;  4HSL A;  4LXL A;  1SLA A;  2Y64 A;  5ACA 1;  4AHW A;  4TWT A;  4QQ2 A;  1JH5 A;  1W8W A;  3MBW A;  4B3N A;  4B1M A;  2RS1 3;  2GC1 A;  2Z5W A;  5E89 A;  3H3Z A;  3KLS A;  4PQQ A;  4C1W A;  4RQP A;  4BA6 A;  1PK6 B;  1Q8V A;  1FMD 3;  1UYY A;  2ZGP A;  5FBZ A;  1OOP B;  4EZH A;  4N7U A;  1UAI A;  3ACH A;  3J4U H;  4Q27 A;  1QQP 2;  1BVV A;  1CAX A;  4QB1 A;  4Y26 A;  2D97 A;  3LPF A;  1YNA A;  3K77 A;  1ST8 A;  1JMU B;  2W39 A;  1RUC 3;  4BCU A;  2RDN A;  5G05 L;  4YPJ A;  1YQ6 A;  3X29 B;  2RMU 1;  4QXH A;  3WUC A;  4HT1 T;  3J9S A;  2ZAC A;  3AP7 A;  4K1Y A;  3H3U A;  1VBD 2;  2ZML A;  2WAO A;  3EXU A;  1W8F A;  1YFX A;  4R9B A;  1PVC 3;  1W2U A;  3TEW A;  2E33 A;  2WIN B;  1LTE A;  2G9F A;  3N7L A;  4FOV A;  4WZF A;  1HQN A;  2HWD 1;  5FRE A;  1DP0 A;  1VMJ A;  5F32 A;  1HB3 A;  3E1F 1;  4GMP 1;  4A4A A;  2JX9 A;  1SFP A;  2VZP A;  2I07 B;  2CGN A;  3WW1 A;  1QJE A;  1X9P A;  4EV0 A;  4YW6 A;  4LUL A;  4ATE A;  1ENS A;  1GKB A;  3ZFF C;  1UIK A;  2LM3 A;  3K4D A;  1NA1 A;  2B5H A;  3A0K A;  4QPY A;  1IQD C;  4HZF A;  4YZ1 A;  3ZFE B;  4QHZ A;  4XXP A;  4KQ7 A;  4JGZ A;  2VM9 A;  1OD5 A;  3R4D B;  4XF9 A;  1TMF 1;  3THD A;  1NCQ A;  2WNU B;  1CD3 G;  4NIG A;  2ZMK A;  3WG2 A;  1JYT A;  1NOV A;  1TME 1;  3POW A;  1RUI 1;  1Q8P A;  4Q4W 2;  3EB7 A;  5EYX A;  3ZYH A;  2ZA9 A;  4K21 A;  2WZR 1;  2CGP A;  5FOJ B;  4YG6 A;  3VBO B;  4DUW A;  2QDN A;  3ITQ A;  3RGB A;  5HCH A;  3LCP A;  4XF4 A;  3OGJ A;  1GWM A;  1IS5 A;  3LIG A;  2ZAH A;  3UKN A;  1N1T A;  4OUE A;  1URX A;  2WS9 3;  4E4H A;  3O1O A;  3FHI B;  1EAH 2;  3H8U A;  1GWK A;  3B9C A;  1KIT A;  5K0U A;  2AZ5 A;  2AUY A;  2W68 A;  1IHM A;  4QU1 A;  3KHB A;  5F9T A;  4UXA A;  3O1T A;  3BI3 A;  4W65 A;  4P5H A;  3KF5 A;  3H3L A;  4XDO A;  3M2M A;  4QB6 A;  4AG4 A;  3SCF A;  1PGW 2;  2EID A;  3ZVX A;  2R04 1;  2ZGO A;  5CIR A;  4YZ4 A;  3PUR A;  5FY8 A;  2K0G A;  3UGG A;  3JB8 A;  4NAO A;  1OF4 A;  1PO2 1;  2WO2 A;  2V5Y A;  1X50 A;  1EUU A;  3N36 A;  4YM2 A;  3NAP C;  3AJY A;  5F3C A;  4DFS A;  3HBZ A;  5T5L A;  5KC5 A;  2XG3 A;  1AL2 1;  4FFG A;  3T4V A;  1GOG A;  1LOA A;  3E97 A;  4YVS B;  4P9X A;  4AYU A;  1GZT A;  5F6L B;  2NYY A;  3AL6 A;  4AEM A;  1DF0 A;  3AJZ A;  1W2O A;  1RUJ 2;  1E5S A;  4FXK B;  4TTG A;  5ABJ C;  2JKB A;  1CPM A;  3SKV A;  2Q5T A;  2WLQ A;  3TWI A;  2GNT A;  2V4A A;  2FDI A;  3LB9 A;  1FNY A;  2JDK A;  3WNL A;  2R07 1;  1JN2 P;  2ENR A;  2V72 A;  5JPM B;  5IYY A;  1MQT A;  3TNQ A;  4GH4 A;  2QBX A;  5I0T A;  2G9G A;  1KS4 A;  3WG4 A;  5CKN A;  4YGE A;  1BMV 2;  2ZEZ A;  4XIL A;  2OX0 A;  2GZW A;  1ZRI A;  1C28 A;  3HNY M;  2WSU A;  3HQX A;  2H0V A;  1ZZ9 A;  3NO8 A;  4N43 A;  1W04 A;  4CE8 A;  1MZ5 A;  2TBV A;  4D8M A;  5KXE A;  4S2D A;  4JAA A;  4CRQ A;  1W6P B;  2BFU L;  1LHU A;  1KJL A;  4QKF A;  5D8A B;  1PHM A;  4HVR A;  3GJB A;  1A8D A;  3DPR C;  3OGG A;  4XEZ A;  4CXX A;  4K1Z A;  3LOI A;  3TN9 1;  1YQC A;  2DTY A;  4DXS A;  3SNM A;  4RGK A;  4OZX A;  4ZY9 A;  4BIO A;  1O7F A;  4IV1 A;  5DZF A;  2VJX A;  1EUT A;  1H2M A;  5K4L A;  4URT A;  4Y4Y A;  5FP8 A;  5F7U A;  4QM8 A;  5DPN A;  2DBI A;  4EN8 B;  2GNM A;  2A1X A;  3BPS A;  3M8L A;  3PHM A;  5DDJ 1;  2DUP A;  1FAT A;  1D4M 2;  5FZ9 A;  1PGL 1;  3OBZ A;  5FMB A;  4DO0 A;  2NPI A;  4W6W A;  5LK7 B;  4UBG A;  4R9D A;  1RUD 1;  1I5Z A;  2BV4 A;  5JMC A;  2F17 A;  2I2S A;  4IE6 A;  1JI6 A;  5JIU A;  3C3V A;  2PLV 1;  1WLC A;  3K4Z A;  4PBP A;  4UYB A;  3PL0 A;  5GZD A;  4CDX A;  1XSR A;  2VZQ A;  3DV8 A;  4FO9 A;  2VZR A;  1PX3 A;  4Z82 A;  4YVW A;  4HON A;  2XBO 1;  2WNV C;  4KU8 A;  1UOJ A;  5J1X A;  5FO7 B;  1RB8 G;  3B94 A;  1ZZB A;  3JQX A;  1JS9 A;  2W47 A;  4MGT A;  5D21 A;  2WZ8 A;  4LBL A;  4QU2 A;  1WKY A;  2P6H A;  3LEG A;  2HWF 3;  2YHJ A;  3CO2 A;  1QIQ A;  1NQJ A;  3JCI A;  4IER A;  1DCS A;  4D69 A;  2HWC 3;  2KA3 A;  3ZXE A;  5JZG B;  4RL7 A;  2RS1 1;  2RR1 2;  4E2Q A;  4G4F A;  4MGY E;  4AHX A;  5C71 A;  5C3O A;  2Y8K A;  4NWW A;  5A70 A;  5JR2 A;  1OA3 A;  1POV 1;  2E7Q A;  5M0T A;  2BBA A;  2TNF A;  2ZXQ A;  3KVA A;  4AHZ A;  1O8P A;  1W6O A;  5CA6 A;  5L9V A;  2DCZ A;  1XJA A;  5HV4 A;  4OHX A;  5BNN A;  5T52 A;  3U4S A;  2GN7 A;  4IES A;  2X5I C;  1LHW A;  1AVB A;  3BPZ A;  1C1F A;  3H1Y A;  3O5S A;  3AK0 A;  4MXV A;  4QDQ A;  1U5Y A;  5IK4 A;  5BNP A;  5BNO A;  5KR7 A;  4OI1 A;  1ZRC A;  2YU1 A;  1OLR A;  1AYN 2;  2JIG A;  4XC9 A;  3AKQ A;  4RHV 3;  4CP2 A;  3KT4 A;  5E8A A;  5FTT C;  1XND A;  5HPO A;  5DAP A;  3V0B B;  1QH7 A;  1K3I A;  2DU0 A;  3M3C A;  2D98 A;  1IZ3 A;  1Y9Q A;  2OPK A;  2XLF A;  4AWD A;  3AZV A;  5A7Q A;  3I3D A;  3SH3 A;  2BGP A;  3ZFF B;  4QX1 A;  4IW3 A;  1DLL A;  1CPN A;  4CU6 A;  1US2 A;  1ULD A;  3OUJ A;  3EMR A;  2WYF A;  4BMB A;  2VE1 A;  2W9X A;  1RHI 3;  3VUO A;  2XL9 A;  5CFD A;  1UWW A;  2VCC A;  2VVF A;  4NRM A;  2H6C A;  4Y3O A;  4IV3 A;  1ULG A;  3E6C C;  4H3W A;  4R52 A;  4F83 A;  2VZO A;  1NA1 C;  1IPJ A;  3CZJ A;  1Y7B A;  5FZO B;  4FVV A;  3S7I A;  4ARY A;  1GZ9 A;  1QOO A;  4JGZ C;  5A33 B;  5A3M A;  3DGT A;  1VRH 3;  1NCQ C;  4AQT A;  2Y6F A;  2JD9 A;  4XF3 A;  3POJ A;  4LHN A;  4Y33 A;  3T2O A;  4CSW A;  4MAD A;  5LZ6 A;  3AZZ A;  3FLT A;  2D6M A;  1K5M A;  1QJY 2;  4TN7 A;  3S6P A;  5HV0 A;  1VBA 3;  2X8K A;  2C24 A;  2E51 A;  4ZZ5 A;  3VZL A;  1QJU 2;  2W95 A;  2FZ2 A;  1HB1 A;  5EPA A;  1R1Z A;  2DF7 A;  2ES3 A;  2ERF A;  2L9L A;  3GHN A;  1AR8 1;  3MUZ 1;  3VHN A;  4AGG A;  4PDW A;  2BBV A;  4Q0U A;  2W46 A;  2XPJ A;  3CHX A;  2VCB A;  4LO5 B;  2JDY A;  4FPC A;  2EAK A;  4B29 A;  4IE4 A;  3ZIW A;  2FDF A;  3NAP B;  3W21 A;  2O8O A;  5J7M A;  3O14 A;  4BQY A;  3I49 A;  3KV4 A;  2A6Y A;  2XJS A;  3INA A;  2LS6 A;  4IGO A;  4KMQ A;  3ZFG A;  4GUL A;  2IXI A;  1OLM E;  1NCR A;  1PM7 A;  4XCA A;  1MZE A;  5LBB A;  1PK6 A;  1NKG A;  1N47 A;  3NNJ A;  2V73 A;  5EZW A;  5FPL A;  4LT5 A;  2J7M A;  5ABJ B;  2PAK A;  4BK5 A;  2XUE A;  4WZC A;  1FXZ A;  1ASJ 2;  1TVG A;  1VBC 1;  1FOD 3;  2ZEY A;  3CKH A;  1Y43 B;  1WBL A;  2FMD A;  2GU9 A;  2VUD A;  1F4A A;  3OGR A;  1C8M 3;  1GR3 A;  4Z8B A;  1O3S A;  4BQ4 A;  3FHQ A;  1AYM 3;  1YJK A;  1JYW A;  2ZGM A;  4FPJ A;  2WA3 A;  1XYN A;  3POI A;  1OLM A;  4MXW A;  4KL1 A;  4L99 A;  1J1T A;  3GZU C;  4PF1 A;  3PUA A;  3BVC A;  3ZXG A;  1QOT A;  1UY0 A;  1ALY A;  1MQT C;  1OH4 A;  3AVS A;  1LAJ A;  2YGL A;  1W2T A;  3JD7 3;  2ARA A;  5FY5 A;  3DPR B;  1UZW A;  4Y22 B;  3V56 A;  3N3H A;  4COY A;  3ALQ A;  2PXJ A;  2BZD A;  2RMU 2;  3C7O A;  3PLQ A;  3OB8 A;  4BIS A;  4EWA A;  3I2O A;  4IUG A;  2JKX A;  2BOI A;  2VR4 A;  1W99 A;  3M3I A;  4AI3 A;  5L7O A;  3NWK A;  2D93 A;  2UWA A;  2WO3 A;  1UO9 A;  4FPF A;  4ZHN A;  3FLR A;  1V6M A;  1OI6 A;  3HAG A;  4XJ8 A;  3WP5 A;  3O1S A;  2QDR A;  2HWD 2;  1Y9G A;  2RJ2 A;  3AB0 A;  4COU A;  1GFF 2;  4UFM A;  5LRS A;  4OI4 A;  1XNC A;  4U2A A;  1MS1 A;  1MVE A;  1RMU 3;  3G7D A;  1ZM1 A;  4XHX A;  3RJ2 X;  1XC6 A;  3VBO A;  5FZK A;  4ES8 A;  3QOP A;  2WJS A;  1WW5 A;  5IHR A;  1DQ0 A;  1YO8 A;  2WNV B;  4Y5S A;  5FYB A;  3H8X A;  3AP5 A;  4LO6 B;  5FLH A;  1TMF 2;  4HOO A;  2VZT A;  3N9N A;  1KDM A;  1TME 2;  3P5B A;  5CB7 A;  1RUI 2;  4YM1 A;  5FYM A;  1QDC A;  1QQP 1;  2ZGU A;  4KWJ A;  5C8W A;  2KM2 A;  4CDX C;  1V9U 2;  5T5J A;  3B9I A;  3NJZ A;  2WZR 2;  3RMY A;  4LOT A;  1AXZ A;  3OPZ A;  2P4E A;  2D43 A;  4FOW A;  2HWC 1;  1HRI 3;  1W9T A;  5EFU A;  2UU8 A;  2J42 A;  2VNO A;  4HXC A;  5I0D A;  2IXH A;  3ILR A;  1F2N A;  2W52 A;  2ZOE B;  1H2N A;  1W3X A;  3WNM A;  4CXY A;  1EP0 A;  1K45 A;  2W1U A;  4B7K A;  2HBU A;  3M3O A;  5D2A A;  2DFB A;  4AI2 A;  1BJQ A;  2P3Y A;  3VHO A;  1CAX B;  3AYE A;  2JB4 A;  4Q4Y 3;  2X5I B;  4HKW A;  4LA2 A;  1AZD A;  1DG6 A;  1ND2 A;  2YFU A;  4LIV A;  5DUX A;  3BTX A;  3PIG A;  3HD8 B;  5LK5 A;  3BU7 A;  1PO2 2;  1OT5 A;  2WAA A;  1NY7 1;  1RL3 A;  1S2K A;  3IIA A;  5DAB A;  2DFC A;  1LKN A;  1J83 A;  5BNN C;  4AXO A;  5FMO S;  1AL2 2;  4JDO A;  4SBV A;  3SCG A;  3LIH A;  3CU7 A;  2DUR A;  1IG0 A;  4RHV 1;  2QQN A;  4LQR A;  1CES A;  3HPN A;  3QBQ A;  4O65 A;  4LBO A;  4IGP A;  5BNP C;  1RUH 2;  2CDP A;  4FXG B;  2EIG A;  4YWA A;  1S0E A;  1Q56 A;  1Y4W A;  2A71 A;  2X53 S;  4XMI A;  5AFB A;  4CYD A;  2VMH A;  4GXL A;  2GP3 A;  2R07 2;  1N1S A;  4QPW A;  3MUY 1;  3WQB A;  4CCC A;  5A6Z A;  4WVV A;  4IEO A;  4ZXK A; 
#chains in the Genus database with same CATH homology
 4XDP A;  5FYT A;  5IVB A;  5FZ1 A;  4IGQ A;  4D6Q A;  2YBK A;  5A7O A;  3KV6 A;  3KVB A;  5LY1 A;  4GD4 A;  4V2W A;  5A3W A;  4BXF A;  3PUA A;  5ISL A;  5F3I A;  3AVS A;  4QWN A;  5FYS A;  5FZG A;  5IVY A;  4GAZ A;  3LDB A;  5FV3 A;  5FY5 A;  3PU3 A;  2Q8E A;  3N9O A;  3KV5 A;  5FPA A;  4UF0 B;  4C8D A;  5A7W B;  5FP4 A;  3KVA A;  2PXJ A;  4BIS A;  4DIQ A;  5F2S A;  4E4H A;  5LY2 A;  5F37 A;  4CCJ A;  3AL5 A;  5FWE A;  3U4S A;  5FUP A;  4QU1 A;  4LIT A;  4AAP A;  5FZH A;  4XDO A;  3K3N A;  5FZ4 A;  5FXZ A;  4EZ4 A;  3N9Q A;  3PUR A;  5FY8 A;  5FUN A;  5FJH A;  4Y4R A;  5FZB A;  2Q8C A;  3K3O A;  5FY4 A;  5LW9 A;  3LD8 A;  5KR7 A;  5FYI A;  5FXW A;  3KV9 A;  3OPW A;  2YU1 A;  5FZM A;  3DXT A;  5F5I A;  5FY0 A;  3NJY A;  5F5A A;  5A7N A;  5FY9 A;  5IVV A;  4QX8 A;  5E6H A;  4AI9 A;  4GJZ A;  2Q8D A;  5F3C A;  3DXU A;  5F3G A;  5FZK A;  5FBJ A;  4UF0 A;  5A7W A;  5IVJ A;  5A7Q A;  5FYY A;  3N9L A;  5FYC A;  5FYB A;  5FP7 A;  5FZC A;  5IVE A;  5IWF A;  3AL6 A;  5FZ3 A;  5A3P A;  4CCK A;  4BU2 A;  4HOO A;  5FP9 A;  3N9N A;  5FY1 A;  5FZL A;  4CCO A;  5FPU A;  4NUB A;  5F5C A;  5FPB A;  5FYM A;  4LIU A;  5A7P A;  2XML A;  5FZE A;  3ZPO A;  2OS2 A;  4LXL A;  4Y3O A;  5FZ0 A;  3UYJ A;  5A3T A;  5FZO A;  2YBP A;  4QXB A;  5FP3 A;  5FZO B;  3K2O A;  4QXC A;  5FXV A;  5FZD A;  2OX0 A;  2YPD A;  2OQ7 A;  3AVR A;  4GJY A;  5FZF A;  2YBS A;  5LWB A;  4Y33 A;  4CSW A;  1VRB A;  5FZI A;  2P5B A;  4V2V A;  5FJK A;  5FZA A;  4EZH A;  5A1L A;  5IVF A;  5A7S A;  4TN7 A;  4D6S A;  5FWJ A;  5IVC A;  5FZ8 A;  5A1F A;  2OQ6 A;  4LIV A;  3U78 A;  2GP5 A;  3PDQ A;  5FYH A;  5A3N A;  5F2W A;  4CCN A;  5A80 A;  5IW0 A;  3PU8 A;  4QXH A;  2XXZ A;  4CCM A;  5F3E A;  3N9M A;  5FYU A;  5FP8 A;  5K4L A;  4CCL A;  4EYU A;  5FYZ A;  5ANQ A;  3KV4 A;  4QX7 A;  4D6R A;  4IGO A;  3OPT A;  5FZ9 A;  3N9P A;  3PUQ A;  5FXX A;  4DO0 A;  2W2I A;  4ASK A;  2WWJ A;  2XDV A;  4IGP A;  5FY7 A;  3PTR B;  5F32 A;  3RVH A;  5FPL A;  5CEH A;  5FYV A;  5F39 A;  2WWU A;  2GP3 A;  2OT7 A;  2VD7 A;  2XUE A;  5FPV A;  5FZ6 A;  3ZLI A;  3PUS A;  4CUG A;  2YU2 A;  4HON A;  5FZ7 A;  4URA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...