2PXJA

The complex structure of jmjd2a and monomethylated h3k36 peptide
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
347
structure length
347
Chain Sequence
ASESETLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords JmjC domain-containing histone demethylation protein 3A
publication title Structural basis of the recognition of a methylated histone tail by JMJD2A
pubmed doi rcsb
source organism Homo sapiens
total genus 104
structure length 347
sequence length 347
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2007-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 2pxjA01
4NUBA 2Q8EA 5FV3A 3K3OA 3N9NA 5LW9A 2OT7A 4CCNA 3KV5A 5ANQA 5FY9A 4QX8A 4XDOA 4QXBA 5A3NA 5FJKA 5FPVA 5FYZA 5FZ6A 4BISA 5FZBA 4V2VA 3AVSA 3PUQA 2OQ7A 3N9QA 4BU2A 5IVVA 3PUSA 3OPWA 5FPBA 5F2WA 3AL6A 3N9OA 3ZLIA 4HONA 4IGQA 4Y3OA 4LIVA 4D6RA 5F3EA 5FZ0A 5F5IA 5FXVA 4UF0A 2PXJA 5FYTA 4QX7A 5FP3A 2YBKA 3NJYA 3PU3A 5FZAA 4XDPA 3LD8A 5CEHA 4E4HA 5FUPA 4CCOA 2P5BA 3KVAA 4AI9A 2VD7A 2YPDA 5FY4A 4EYUA 3N9MA 5FY7A 5IVFA 2YBSA 5FWEA 4LIUA 3PDQA 5FYMA 2OQ6A 4QXCA 5A1FA 3PU8A 5FZGA 3KV6A 5F32A 5FZ1A 5K4LA 5FZOB 5IVCA 5A1LA 5F3CA 1VRBA 5FY1A 5A7SA 3OPTA 4URAA 2WWJA 4DO0A 2XMLA 3K2OA 4CCKA 4GD4A 4ASKA 2YU1A 3KV4A 2XDVA 5A3WA 2GP5A 5F3GA 3KV9A 5FZCA 5FPLA 5FZ3A 2XUEA 5F3IA 4GAZA 4TN7A 5FZ7A 3DXUA 3LDBA 5A7WA 3RVHA 5F2SA 5FYUA 5FYBA 5IVYA 5FP8A 5A7WB 4DIQA 4QWNA 4Y33A 5A7OA 4D6QA 5FZMA 2Q8CA 5F39A 3PUAA 2GP3A 5FZEA 5IVEA 4Y4RA 5FPUA 5FYCA 5F5AA 5LY2A 5FZOA 5F37A 2XXZA 5FZFA 4HOOA 4AAPA 3KVBA 5F5CA 5FYHA 3K3NA 3PTRB 5FBJA 5FXWA 4EZ4A 3AL5A 5LWBA 4CUGA 4LXLA 4QU1A 2Q8DA 4CSWA 4D6SA 5FYVA 5FZKA 5E6HA 5A80A 5FPAA 3DXTA 5FP7A 5IWFA 5FZDA 2OS2A 5FZ4A 2WWUA 5A7NA 3U78A 3UYJA 4CCMA 5A3TA 5FZLA 2YU2A 5FWJA 5FXZA 4BXFA 2W2IA 2OX0A 5FYSA 5A7QA 4EZHA 3ZPOA 5FZIA 4IGPA 5FZHA 5FP4A 5FYIA 3N9LA 5FZ8A 5IW0A 5LY1A 4CCJA 5FY8A 5FZ9A 5FP9A 4GJYA 4GJZA 4V2WA 4LITA 5IVJA 5FYYA 3PURA 4CCLA 4C8DA 5FY0A 4UF0B 5KR7A 3AVRA 5FJHA 5FY5A 2YBPA 5IVBA 5ISLA 4IGOA 4QXHA 5A7PA 3U4SA 5FXXA 3N9PA 5A3PA 5FUNA
chains in the Genus database with same CATH superfamily
1KS5A 1LENA 1QJX3 3WP5A 1VRH3 2OT7A 1M06G 1WZXA 4KQ7A 3J8F1 4Z92B 1XNTA 1WMEA 2JDYA 4G3YC 3MIDA 2NMNA 4V2VA 1UMIA 4XILA 2JG9A 3AVSA 2QTWB 1AJKA 2K0GA 5EJ1B 1VBC2 1QJY1 1MVQA 1Q3EA 4I30A 4LK6A 5F2WA 4CDWC 2WZR2 4XFAA 3TB0A 2DVGA 4WZFA 5FZ0A 5T5JA 1YQ2A 2PXJA 5C9AC 2WDBA 3ZSEA 4XUNA 5FK7A 3ZYJB 4L8QA 5E1RA 1CJDA 3ZN6A 1QXJA 5AVAA 2HWC1 4GMP0 3IZOA 4ES8A 5L9RA 4WM8B 1KD7A 1DGRN 2ZHMA 4OUMA 4EQVA 4R52A 1B35C 1DQ2A 1LEDA 1W0PA 2PAKA 3ASIA 3HQRA 5J1XA 3ZXAC 5D8AC 3LIHA 2W0XA 4LIUA 2YG0A 2XBO3 3EXUA 1XU1A 2R043 3NRUA 3LSDA 1XNBA 1LRHA 1GZ9A 1UY1A 4PT6A 1LESA 5F6KA 1IG0A 2ZHKA 4QM9A 5K4LA 4YVWC 3AK0A 2I07B 2GH2A 2QNKA 2IVIB 3GCXA 1RUG2 4JDNA 3HBKA 3JZVA 5BNNA 2XJQA 1UMZA 2HWE2 2GC2A 4M3CB 2C6SA 5ABJA 1FV2A 3E5UA 1LOFC 1RHI3 4LO6B 1HQNA 1LHUA 4MHUA 4N90A 4NIGA 3MW2A 5FZCA 4G9SB 3FLPA 3VHRA 5FYBA 1FNYA 1UL9A 4IV1C 4JX0A 4JGYA 4RGKA 3WQ7A 2BJSA 4XJAA 2E26A 2VH9A 2BNMA 2WQZC 2GNDA 1H0BA 1QNYA 2GP3A 2WABA 3EJKA 1AVBA 5FCCA 1MS4A 2XXZA 5FZFA 4DFSA 1UZZA 1C8M3 1H4GA 2EF6A 2PA7A 2XKPA 4LKSA 1O3TA 3FFZA 3K46A 3JU9A 1H8TA 4EZ4A 1VBB2 2ZGTA 4PQQA 4LXLA 1FI2A 3ALQA 1QOOA 2B45X 2WO3A 3N36A 3NMBA 4ZY9A 2Q8DA 2NLRA 3WLUA 1H6YA 3ECQA 3F95A 1WD4A 2VE1A 3OD4A 4NRPA 4TZDA 2HYXA 2ZHLA 3HBZA 5EFUA 4AR2A 2A6XA 3ZVXA 4BXFA 2W2IA 1AYN1 1EAH3 3HR9A 1UX6A 4CCEA 2ZBJA 5FZIA 5FZ8A 1WLWA 3AJZA 2XVLA 3I59B 4FPLA 3CJIA 2W68A 4A6SA 2Z69A 3POGA 4WM8C 4OQ8A 1YXWA 3FUOA 1CAUB 1NE4A 1P8JA 4LORA 2VZUA 4GJYA 2BWCA 4Q0SA 4IEVA 4QDSA 3RWKX 4CCLA 4L2NA 1UOJA 1W9FA 3P3NA 1PMIA 5A6YA 5JI7A 1F2NA 4XF9A 2DF7A 4QAWA 4CXYA 3ZXFA 4N43A 2KR2A 4J6GA 3FN9A 5ANQA 2EXJA 1UPIA 5FPVA 4Q4X2 3SH3A 2UURA 3J8F3 1EP0A 2OQ7A 1BQPA 4QX1A 3T1LA 2O14A 5GLVA 4DS0A 1ZRFA 3WW2A 1W2NA 3ZPYA 1OI6A 4ZXKA 3B01A 2PHXA 4HONA 4S2DA 4AW7A 4IGQA 4Y3OA 4NIAA 1YI9A 5DAQA 2JIGA 5DAVA 4M3CF 4DXRA 5IAXA 1QJY3 4GWMA 5G04L 4YZ1A 2VOXA 1VBC1 3KZ4C 4UW4A 3PU3A 5CEHA 2K46A 1VMFA 5DAXA 2VD7A 2YPDA 3M3EA 1R081 3OBTA 3MIHA 4GQ7A 4QDRA 5FY7A 5JXHA 2HWC3 5JZGB 2EXIA 4CRQA 2MPFA 5LASA 1T6BX 3CZUA 4QX3A 3RYKA 2JDUA 2P3KA 2C0ZA 1CZSA 1XYNA 3SCHA 2VULA 1VRBA 4HPKA 5A7SA 4RN5A 1UOGA 2IXIA 3ZFEA 5CFCB 3WW4A 4MXWA 3WF1A 2AR6A 3SCFA 1AYM1 1CQ9A 4A42A 3LFIA 2Q1MA 2F6BA 3FWEA 4GAZA 4EWAA 1ZX5A 4A3ZA 1LGNA 2HWE1 2RDNA 1XSQA 2GC1A 2CNAA 1FXZA 1SPPA 4JHZA 3OSDA 3DN7A 2D40A 3TNQA 2JE7A 4UFIA 3B7MA 4FTSA 2BP6A 4CUBA 5IYYA 3O1MA 1TE1B 3VKFC 5FPUA 1C8NA 3BIEA 2VZVA 2HLEA 3MW3A 5FFOC 1IPKA 2D5HA 5I0DA 4L11A 1MZFA 3H8RA 3M70A 2Y6KA 1OQ1A 4FVVA 1KITA 4OVEA 1J83A 1APNA 4MGQA 2A6YA 2BVBA 2WLPA 3NL1A 1JS9A 4XEZA 1HV0A 3USSA 3Q9OA 5HCHA 1W6PB 3JBG1 3RI9A 1N3QA 1VBB1 2JE9A 4QPGB 4CP9A 1JYIA 1YIPA 3IT8A 2VR4A 4GIQA 2QJVA 1UY2A 4OHZA 1FPN2 4UXAA 5T55A 5CA6A 4KWJA 1R1ZA 1HRV2 5FP4A 5IW0A 1KEXA 3D3AA 5K9YA 1AYN3 1HX6A 4G4FA 5CFDB 3BALA 4CA9A 2B39A 4N9IA 4ZS2A 3VHPA 1MS3A 4AGRA 2WO1A 1BK1A 1Q5OA 3WXPA 3HWJA 5JZGC 2IUWA 3H3UA 1XRUA 1NLRA 3AKQA 1ZREA 1SBEA 3DPRB 3VBSB 3BUCA 2VMCA 3L2HA 4UF0B 3C7GA 4IV3C 4LBLA 3ZXLA 2JD9A 5A7PA 4MH0E 4LBNA 3PVNA 2W1UA 2XJUA 1G9DA 3M7AA 4OHWA 2CAUA 2VUCA 3GZEA 5E8AA 3X29B 5CU1A 5K8SA 2YV8A 3AJYA 5CFCC 1DYKA 2BGPA 3ITQA 5JXIA 4XDOA 4M4PA 4DB5A 5JPMB 3IDBB 3ON7A 4UFMA 1EY2A 4NROA 4UOJA 1GWKA 5CZKA 4YARA 4Q4Y2 2XWBB 1LU1A 1VP6A 2W52A 3NO8A 3OGRA 1BK0A 2PYTA 4BOWA 1ENRA 3V0BA 1ZZCA 5GALA 4PIXA 1UQXA 2VCMA 1UY3A 3WINE 2WO7A 3NJYA 4BPZA 2JDAA 3LD8A 1RUJ2 4NWWA 5FUPA 1O5LA 5HBAA 1OQEA 1VBC3 1RJ8A 1D0HA 1JOBA 1U5YA 3WD5A 4GULA 1EUUA 1ST8A 2XKOA 3GM8A 5JR2A 4LO8A 4B1LA 2R49A 1HKDA 1R083 1JU4A 3GBGA 4N53B 5T5LA 4CZSA 3EB7A 4E2QA 3LPFA 5D1IA 1GWMA 2DDUA 5HCBA 1PX3A 2WLQA 1IZ3A 4CDXA 4M00A 2VTXJ 1ENSA 1W8ZA 2RR12 3KCYA 3SH5A 3WW3A 4E4SA 3B9CA 4URAA 5DMYA 4ISRA 1CAVA 4EN9B 4P02B 3POFA 1BXHA 1UX7A 1C5HA 4LKEA 4OUEA 2XMLA 2GNMA 3C3VA 4Q5OA 4YW1A 4CEWB 1PMJX 2FZ1A 5CFDC 4LE4A 4ZU4A 1PVC2 3AYDA 1FV3A 4D94A 3PJYA 1AYM3 1FNZA 3KSCA 4CDWA 3ETQA 3DPRC 4LKDA 4XYXA 1LGBA 3WDVA 4WM7B 4QKBA 4XJ9A 5F6LB 5C5TA 1HLCA 1OD5A 2EIBA 1DZQA 2HWE3 2VQTA 1X8MA 1L7RA 1TMF2 2ORZA 4QPWA 5C9AA 3RNSA 2RS32 1O59A 3LEIA 5B4XA 2R6QA 1Q8SA 2IXLA 3LAGA 3JB4C 3PTRB 3AL5A 5IK5A 2BV4A 4QU1A 1DGWA 3AP6A 1B35A 3BCWA 5LATA 2O8QA 1DDLA 5D8AA 2XB6C 3GF6A 4UW6A 3MHZA 4INDA 3LSEA 4MGKE 1V00A 1W6OB 2XJRA 3HNBM 2OS2A 3E97A 4YVWA 4XTPA 1MS8A 5GZEA 4HVRA 4TXWA 5HXMA 2PAMA 3JBG3 3M2MA 3PL0A 1VBB3 3KQ4B 4GA9A 5HXVA 3VD9A 1K42A 1GP5A 2WNVC 2WUHA 4OQ9A 1ND2B 1LOFA 4MXVA 4CCJA 4LHNA 4PQ9A 2C9KA 1Y9QA 1OLMA 3KCCA 1NCRA 1W8WA 2H0VA 3CBNA 4GXLA 1Z0HA 4W65A 3LPGA 4IV1A 1SZBA 2CYFA 2QQNA 2Y6JA 4BJ0A 1LB2A 4N53C 3T3YA 5FY0A 3EMRA 3AZWA 4RL7A 1IKQA 1RUOA 4XPVA 5I8YA 1WLDA 4Y1UA 3USUB 3H42B 5BNOB 4WVWA 2WA4A 1W2TA 2XOMA 3C7OA 3GALA 2X29A 5FY9A 4CEWC 4LBMA 1TME2 5FAXA 1RUE1 3BTZA 2JDMA 1NOVA 4U2AA 4HK8A 4XBQA 1AHSA 2ZKLA 3EO6A 3N9QA 4AF9A 2ZPXA 2VZ3A 4FPJA 5IK8A 1ULCA 2DV9A 1QJX2 3AZXA 4XMIA 4AQ2A 5T50A 3DGTA 4MYEA 3DL3A 4PIZA 2BW8A 1WBFA 4LO5B 4Z8BA 5C8WA 1ODNA 1OC1A 1S0CA 1S2EA 2CHHA 3J7HA 4LOSA 5EYYA 2YGLA 2WZPP 5FP3A 4Q4Y1 2ZX3A 3P6BA 2W1WA 4E4HA 4CCOA 4RA0A 2Y6LA 4WM8A 2FCTA 2VOTA 1WCSA 2VY0A 3VD5A 4URTA 1K5JA 1OURA 1RUJ1 3AMHA 3MEPA 3EQEA 3PDQA 3UGFA 4DUVA 2A71A 4SLIA 2HWB2 4Y1XA 1X36A 3B94A 4AOCA 3I3BA 5AVPA 2Y38A 1WBLA 2A70A 2PLV2 2YXSA 3U11A 4DMIA 3OPTA 2D43A 1UU4A 4GB31 5KC5A 3DCQA 1WCQA 1ND2C 3OYWA 5J37A 1UY0A 2PMWB 4GD4A 4DRVA 3ENRA 1DQ5A 1NA1B 2P2KA 2YU1A 2R042 2O8OA 3Q8EA 3I3QA 5JI9A 3MLLA 4HFSA 1PO11 3JQWA 2XONA 4DIQA 4DPNA 3G7DA 5DG1A 3WOGA 3FHQA 2Q8OA 3CMGA 3WEZA 1ALYA 3I2FA 2ZHNA 4QHOA 5F39A 2ZZJA 3HD8B 1RHI2 1LR5A 1HIXA 2A3WA 4FTBA 2CGOA 4FXGB 4XE9A 1YQ8A 1W39A 4Y1ZA 1OD3A 5EIYB 5CG9A 1BMV1 4XIKA 3KVBA 4JZRA 5FYHA 1LTEA 2R062 3VBOB 2XQRA 3M1HA 3W59A 3K75B 5LEKA 3GNEA 2C1FA 1OBNA 4BK5A 4KGGA 2LUWA 3E5XA 4CSWA 3IB3A 3RZJA 4NHLA 5L7OB 1DCSA 3HN1A 5A32B 2WWUA 5A7NA 1XE0A 1SDWA 1C8M2 1HB3A 2RS12 4HZFA 1YC61 2B9UA 4BQ5A 5JOYA 2ZGLA 1QY4A 4BQ2A 1HJFA 2AENA 3VDDC 3QCWA 4AL9A 1QJEA 5IATA 1OLME 5FY8A 1O3QA 2ZABA 2YHJA 4OHXA 2P34A 1SBFA 2ZKNA 3T0AA 4CDUA 4CUCA 5C4WB 2JWPA 2BFUS 4A4AA 3UKNA 3AFGA 3VDCA 3ZMOA 1XE8A 4C91A 2WJSA 3AVRA 2GMEA 3N9PA 1LOAA 5ISLA 1UXXX 5DPNA 2ADEA 2D3SA 1G7YA 2IWGB 1H2NA 1XYPA 3PNAA 3LGRA 5FV3A 5KC6A 2WWSA 3AM2A 3LA3A 5KXCA 2ZMKA 2CAVA 5DDJ2 2EIEA 1NA1C 4YYOA 2R0HA 2C9AA 1TQ5A 1CAXB 1WUVA 2E7AA 1N3OA 3EYPA 1RUE3 1J3RA 2WAAA 3G6JB 2CSGA 3HNYM 3PUSA 4R9BA 4AXOA 5FDBA 4NIIA 4LA2A 1JW6A 1OKOA 3GBWA 3VBFB 2ZACA 1WCKA 3LFMA 2WFF2 1M4WA 3ORJA 3A0KA 1ODMA 4K8RB 5F3EA 5EHDA 5F8PA 5GKAC 3WDWA 4K6BA 1F35A 1PGSA 4CDQC 5FYTA 4BLIA 4UW5A 1MS5A 2ZGSA 1Z7S1 3J8F2 3MF6A 4ONUA 5J98B 3VBOC 2WINB 3JQXA 1U12A 4Q4Y3 5LA2A 4D0QA 5IVFA 3AZVA 1QJY2 4OI1A 5BY5A 1YRZA 2Q1ZB 4AI8A 2PQSA 4Q27A 2E9QA 3J7LA 3B9IA 1WLCA 4IV3A 1NQJA 4A7KA 5FREA 5A1FA 2BBVA 4D7TA 2FD8A 1GZWB 4KBZA 2RMU1 4SBVA 4C0BA 2DUPA 1RUJ3 3SKVA 5JLVA 5GZDA 4M3CE 1L7LA 4LE3A 4YGDA 1MACA 4PLNA 5FY1A 3I3MA 2PHTA 3RZLA 1VAKA 2A6WA 4LOTA 2HWB1 4LT5A 4DINB 4GB33 5T52A 2PLV1 5CVRA 5F3IA 2YC2A 5C4WC 3AYCA 1ZRDA 2VMGA 4LHSA 5FTTC 5J7MA 4QGNA 3OEBA 4Y24A 3VN4A 1PO13 4D8MA 4JAAA 1C1FA 4IW3A 3MI8A 4R4XA 4QX5A 3BKZA 3IMNA 1ULEA 4AQTA 1W0OA 1PK6C 2ES3A 4AEJA 1IOAA 2W91A 1WMFA 5LY2A 5KHJA 2A6ZA 3AMPA 4YW2A 1SBDA 1KQRA 4IE5A 3LDRA 1QNWA 1J1LA 4FPCA 2OZ6A 3S6PA 3WG2A 1A3KA 2XR4A 2BRTA 1ZNPA 2Z79A 3AZZA 5BNPA 3R05A 2WNUA 1LHNA 3ZXDA 2R061 3VBFC 4OCTA 3VBRB 1X50A 3RZGA 2JDHA 1OH4A 5FXZA 1L7QA 3VBHB 4CEYB 2R16A 5FMBA 1W0NA 3FE5A 1DGWX 5CKMA 3CU7A 3T08A 2OUJA 4P9IA 1CPMA 4H7LA 2RS11 4HANA 1DYPA 4JHTA 4N7IA 1BVVA 2HBTA 1O8SA 5JVVA 4XF3A 4KNCA 3KLSA 3DPRA 4EV0A 2YZ4A 4YZ4A 1I5ZA 2QZ2A 2ADDA 1KDMA 4JC1A 4C8DA 1JYWA 2CV6A 2WKKA 2JDZA 1RVF1 1AYN2 5D2AA 3SCGA 5LEJA 1I5PA 3MPPG 2Q8EA 3V0AA 1D2SA 5A33A 4YM3A 1HN1A 2JE8A 4I09A 2BNNA 2HEYF 4CCNA 2D6PA 3KV5A 3KWVA 3WUCA 1PM7A 5K0UC 4PJYA 3ZFFA 4UWDA 1Y3TA 4AI1A 5FYZA 5FZ6A 2VL4A 1CX4A 4QT6A 3NJZA 3FHAA 2VUDA 3QLQA 4XF4A 5FZBA 1Q43A 1W99A 4Y22A 4XUOA 2ET1A 1UMHA 4ZZ5A 3FZ3A 3ZLIA 2J1VA 5DDJ1 3R0RA 4NHXA 3KS7A 1N3PA 2QQWA 2WQ4A 1RUF1 2AGSA 2LS6A 3ILRA 4O9EA 4BA6A 1L3JA 2YYOA 3NAPA 2Y6FA 1XOYA 3BB6A 4COUA 5CG8A 4HETA 5FK8A 2XJSA 2WNVA 3VLBB 5EZWA 2XVGA 3AMNA 2E32A 4XDPA 3OY8A 3GZAA 5KHIA 3INAA 2WFF1 3R4UA 2G4IA 1HN0A 4CYDA 1Z7S3 3ACLA 3IAPA 4KWUA 3SLIA 2QBXA 4RGAA 3B69A 1S2KA 4N53A 2OKXA 1SLTA 2FMYA 1AUYA 2Y33A 4Q8KA 3DECA 5JUVA 1UIJA 2BZDA 1GOGA 4IQPA 2DUOA 2HWD1 4R9CA 1STMA 4GWIA 3VBRC 3OOXA 5L9BA 3UESA 5C3SA 2VCAA 3VBHC 4CEYC 2RMU3 3IKWA 4DO0A 1O4TA 4CCKA 4MGZE 4MZUA 1R082 2XDVA 3RFRA 1W8NA 1YFUA 2ZEZA 4J25A 5DXDA 3P3PA 2XUEA 4COVA 3KF3A 1E5HA 4HKWA 3RVHA 2HWB3 4XQ4A 1YFXA 5EJZB 3S7EA 1Y7BA 1Y4WA 2PLV3 1BCXA 4RS5B 4RD7A 1H1MA 4LBQB 4L0PA 1GFF2 2VOWA 3ZFGA 2V5DA 5FLIA 3QH7A 2ZX0A 5FZOA 2UY9A 1AYM2 4FPYA 4HOOA 1JOPA 1ZA4A 3HOBA 5FLHA 3B93A 5DUUA 2JDPA 3HQUA 1VAVA 3U1XA 3MICA 4ZZ8A 4S2GA 1S0BA 4QU2A 3WQBA 1YQ6A 4GH4A 5FZKA 2HH9A 1JYVA 5EV7A 5JSRA 1OSGA 4OI4A 1W6OA 2BU9A 3I2IA 3KD4A 4AI2A 4EE2A 2OUHA 5FWJA 1NCQA 4FP3A 4ARYA 5C8CA 2R063 4W6XA 3M4FA 1ND2A 3M3OA 4LTAA 1V70A 4P9JA 3UJQA 3WF0A 1O91A 4FBFA 3POBA 4AWDA 4E2SA 4CUAA 1I3HA 2RS53 1FX5A 4UBGA 2B8MA 4B7KA 2RS13 2FCVA 2DVFA 3JBG2 3H8XA 1Q8PA 3D0JA 4KU7A 1AR91 4IEYA 1KJRA 2V73A 3GGLA 3LA7A 3TNPB 3U75A 2DFBA 2OPKA 3MIEA 3DKWA 3ZXKA 2BWAA 4META 4QXHA 3U4SA 3USUA 5A6QA 1UKRA 2FCUA 3HMYA 3UKTA 1EUTA 4X8NA 4XABA 4XBNA 2ZX1A 2VVEA 2FDFA 1RVF3 2RJLA 3GJBA 1REEA 1D4VB 4ARXA 4I3GA 5TSWA 1O4YA 4LR4A 4BE3A 1GR3A 3I49A 4QM8A 3U0ZA 1IG3A 3PUQA 4CU8A 4AAXA 1NQDA 5FQ0A 4COWA 5FMOS 5M0TA 4YSFA 5CB7A 2QDNA 1JU3A 2D93A 3VL9A 4RS5C 4BQ1A 4P08A 2QKDA 2AYHA 3DYOA 4ATEA 2GNTA 1MZEA 4Y20A 2DCKA 3OD0A 1ZZ8A 5DDJ3 3VDDA 1W6NA 2Q5TA 1RUF3 1YQCA 4F7ZA 4ATFA 2DTYA 3NJVA 1R1A2 3MIBA 2ZX4A 4XJZA 2V5YA 2W39A 3WNNA 3ZXGA 4AI9A 3O1RA 1V6KA 1WW5A 3FHIB 3KMHA 2ERFA 2UYBA 1DZRA 2Y6GA 4FFFA 2WFF3 3VB9A 1UOBA 5LBBA 2LM3A 5H9QA 4XHBA 4A7ZA 1LULA 1NT0A 4NMIA 5HCFA 1HXS1 4Q1RA 5FR3A 5A1LA 2G9GA 1CJPA 1GUIA 1SMVA 3B3QE 1S1AA 2HWD3 5F3CA 5F7UA 4BDVB 3H3ZA 2BVVA 4QQ2A 3FX3A 2X5IB 4R9DA 1POQA 2VCBA 2FQPA 3WF3A 3I97A 2VU9A 3O1PA 2D3RA 1DG6A 5JPNB 4JGZA 5F3GA 1NXD1 2GSYA 3A23A 2BYVE 3MUZ1 4GMP1 1YUDA 3GJAA 2YDEA 4FOWA 2NM1A 4LULA 5FZ3A 2O0OA 5LB6A 3VBUB 1OLQA 2ETEA 3A22A 5FP8A 4QWNA 5FRAA 5GM0A 2EICA 5GZFA 1CGPA 4HL0A 3RG0A 5EQUA 1QJZA 1YEWA 2EIDA 2KA3A 4FPKA 4PDWB 1WA4A 3LB9A 2RG4A 4A3XA 4CDQA 3KGLA 2CDOA 1UZ0A 3GZUC 1UY4A 4OZOA 4YLZA 1MPXA 5JIAA 5I8SA 3AKSA 4QQLA 4Y5SA 5T5PA 4BYYA 4AAPA 1LJ7A 2Z5WA 5F5CA 3B02A 1Y9GA 4XJUA 4XQWA 1TEIA 3ZDVA 1JZ5A 4QB6A 4MLOA 4RR3B 1XPWA 2Y64A 3JUUA 1WW6A 5E6HA 4OHYA 3VHOA 2VJXA 1UZVA 2W08A 3GHNA 4CCMA 1V6OA 3BPZA 4K40A 1HDKA 1AX2A 4B1MA 5I0RA 2ZS6B 1DIWA 4AVCA 1JYXA 1PZ8A 2UWBA 4IETA 1UF2C 5I91A 3C7EA 4IGPA 2TBVA 2QQOA 2VZTA 1FMD1 1QGLA 1RUI1 1SLLA 2B7YA 3H8OA 1AR62 3AC0A 3T4HB 1QQP1 3CKHA 5C4WA 4B7EA 2MEV2 3DF0A 2LTNA 1RMU2 1JI6A 4FPHA 4HKLA 1F9KA 5SV8A 5A1AA 2XWJB 4IEUA 4IGOA 4AQ6A 1JYNA 5FXXA 1UYYA 1PK6A 1AR93 3IWZA 1GWLA 3WP3A 3ZMNA 4XBLA 2VC9A 4KU8A 5LW9A 1REFA 3BTAA 2X5IC 4Y1VA 1IQDC 3N7KA 1A8DA 4GZ9A 1F5JA 2G19A 1GNHA 1HJGA 3OG2A 1XSRA 5G05L 2K9ZA 3ZO0B 3NNMA 1O3SA 1FAYA 4YVSB 4OYUA 1QMJA 1CAXA 1F5FA 4ASLA 4S2FA 2YFUA 1TNFA 4YM1A 1YFWA 4FAHA 3VBUC 3RGBA 4W50A 4XCBA 4W6YA 2IXHA 1QU0A 2Q0AA 1O7FA 3OPWA 3ETPA 1JZ3A 3WG1A 1ASJ1 5IAVA 3VBFA 3D0SA 4LBJA 4FO9A 2YY1A 1C5IA 4PDWC 2XLFA 4JKLA 3D4KA 2NMOA 2JXAA 3J26N 1ZBA3 3BN6A 3RZMA 1SLCA 1OA4A 1AF9A 1K3IA 1RUE2 1WMXA 3GYDA 3POSA 4W4ZA 1JHNA 1GQHA 1ND3A 2P5BA 1DGRA 3AP9A 1K5MA 3KT7A 1UCXA 3NNLA 4B4QA 1W6QA 4YGCA 3OGVA 2V4AA 1XC6A 4RR3C 1GSLA 2UWAA 3AKRA 3T4VA 4MSVA 5T5OA 1R1A1 2VZ1A 2VZSA 3CNAA 5DG2A 2VBBA 2XL9A 1R092 3WF2A 5FPZA 4D7SA 4XHXA 1GZWA 4LHLA 3BGAA 5F32A 3K4DA 2VNGA 1J59A 1POV0 1T6GC 3SEPA 3AXEA 4XURA 5JMOA 2IFWA 2CGNA 2VZRA 3RRDA 1S0GA 1H2MA 2ZEWA 5FOJB 1YWKA 2EXKA 1D4M1 1S2BA 3CLPA 1HXS3 2WWJA 3PHMA 5K0UA 4ASKA 3K51A 1CAWA 5A3WA 2ZZQA 2GAUA 5LRRA 2JDNA 3IMMA 3UK9A 2EAAA 3H1MA 1EPZA 3IBMA 3NKGA 2XGXA 3MUY1 4FOVA 4MHRA 4C1WA 4DQAA 2A6VA 3O0VA 4GMP3 4HBNA 3AMMA 1KGYA 2RDSA 4IERA 1N1SA 2Y6HA 2Q8CA 5KWRA 4WVMB 2P37A 5J09A 4GB32 4Q0QA 4QPGC 1XB9A 1VBD2 2VBDA 2VQAA 3O1TA 4XF0A 5I0UA 2VGDA 5HV0A 4AHXA 4ISQA 4YM0A 4AZZA 3D6EA 5DAPA 2TNFA 2WYSA 3ZN4A 1PO12 5LWBA 3VUOA 4K9SA 3HT2A 1E5SA 2QQKA 3SXWA 3P1IA 1PZ7A 5FBZA 4YZ5A 1ULOA 3RZZA 5LZ6A 2Y8KA 1GMMA 4KMQA 1DLCA 3IDEA 3VBRA 5FZ4A 1N1YA 4ZKTB 1S0EA 2WRAA 4LLFA 4MX3A 1BMV2 4CEYA 3A0NA 3VBSC 5J36A 1GP6A 1QXRA 4B29A 1COV2 2Y26A 5L36A 1G9AA 1WKYA 1MQTB 1E57A 3KB5A 3QH6A 1PGL2 4M4RA 1JTZX 2ZAHA 4BIOA 1FMD3 1W9YA 2JEMA 4FPOB 4LITA 5L73A 1RUI3 1RIRA 1KS4A 3MF9A 5FYYA 1H9PA 1QJFA 1QQP3 2X53S 3A21A 4H2AA 3AKPA 4QB1A 3RJRA 2E33A 3WSOA 4FOQA 4L97A 3VKOA 1REDA 4QB2A 1AR61 1CIWA 2YBPA 3OBRA 5FJHA 4A6OA 4DRRA 3RJ2X 3T0DA 4I0AA 2MEV1 3ZN6B 1YHFA 4CE8A 4NUBA 4BXSV 1RMU1 1RTVA 2HKXA 2ZGNA 3C2UA 3QD6A 1SG3A 1X82A 3J7MA 1UN1A 4XJWA 3QOPA 2DURA 1NXMA 4JKKA 5FIXA 2W87A 4RFRB 5FUIA 4FXKB 1WWYA 4XFBA 5A3LA 4RGGA 4BM8A 1JZ8A 4BISA 2BGOA 3LZZA 4C90A 1AX1A 2IFRA 2VW1A 1S55A 2P17A 1E5RA 2ARBA 1W2OA 3AL6A 1WLTA 4HXCA 3AYAA 3APBA 1CWPA 1W05A 2WN2A 5BNNB 1MR5A 2FMDA 2DU1A 3MW4A 3NV2A 3WNXA 1QWRA 1ASJ3 1PNGA 3VHNA 1E5IA 5ABJB 1I9RA 2XUMA 1EV11 1UW8A 2LRPA 3AB0A 4YW4A 4LKFA 2H6CA 1HW5A 1VE0A 4ZHNA 4LQRA 4CTEA 1US2A 2IXJA 2DFCA 5H9RA 2YC0A 2WO2A 4PF1A 2C5DA 3WP4A 2J7MA 3VL8A 2RJ2A 3CHXA 4H7MA 3BPSA 4LUMA 1XU2A 1RL3A 2A73B 2VG9A 4P5HA 3I8TA 4K7JA 2X10A 1YIFA 1WCUA 1R1A3 4FPFA 4K20A 1CD3G 4P9LA 5DZEA 3WP6A 1LEMA 1Z7S2 2R0FA 3CEWA 5EPAA 1J84A 4IE0A 2P6CA 4WM7C 1H8TB 4NR1A 4EN6B 1R091 3SEEA 3K2OA 1C57A 2JG8B 2DCJA 2WSUA 1MQTC 2ZEYA 4M01A 4CCDA 3ACGA 1BZWA 4IE6A 1D4M3 2GP5A 4AGGA 1CR7A 1T2XA 1PX4A 2JB8A 1PNFA 4NPLA 5LBFA 4X6RB 4PI0A 1BHGA 4FQ4A 5A7WB 3SISA 1VR3A 2DCZA 2ZGMA 4NAMA 4RS5A 4AYUA 5C3RA 4QHZA 1OOPB 2RMU2 3H7JA 1ENXA 3TN91 4LBQA 5KXEA 3LF7A 4JGZC 1DF0A 5FMCA 5FOBB 3CJIB 3PUHA 4BQWA 1RUNA 1OPMA 1W9WA 1LOEA 2XLGA 3E6CC 5F5QA 4NE9A 5DUVA 3SH4A 2WAOA 4XXPA 3K3NA 1D0GA 2VZQA 3I3DA 3MBWA 4NWVA 4D69A 4M3CA 1ZZ7A 4RFT0 1VBD1 1HB2A 1ONAA 1QJU1 5FPAA 3U4XA 5F9TA 2B4KA 1XNKA 4XDQA 2DBIA 2X8KA 5BNNC 1NUKA 3PIJA 3HEIA 4CP0A 3ZDSA 3FLRA 1LGCA 1JH5A 2WT2A 3FBMA 4I0BA 5J48A 1H2KA 2DBNA 1W06A 3KT1A 4FTEA 2EVXA 2ARCA 3UGGA 1H6XA 2KD7A 4ZPIA 3WQ1A 3AP5A 3PTYA 5FZ9A 3WQ0A 4YZ2A 4ZU7A 3MIGA 5BNOC 1JMUB 2QZ3A 4ZS3A 4BQXA 2Z2SB 4FI9A 2CL2A 4O7XA 2OYZA 2VUJA 5IVJA 1COV1 1QHDA 3IDCB 4N9HA 4BMEA 4XFGA 3K48A 5JAXA 2C26A 4AVBA 1UAIA 2PELA 2WR9A 3CIHA 3O1SA 3PVBB 1PO22 5IVBA 2KXLA 1PGL1 1GQGA 3I3EA 5KHGA 4OHVA 1QF3A 1RUD2 2BTVC 1AR63 1IS5A 2RS52 3N9NA 4OZXA 1D2QA 4Z07A 4YW5A 2RM21 5JMCA 2GDFA 3KHCA 1XNAA 2D6LX 2MEV3 4TLGA 2J1UA 3DYMA 2JG8C 5CISA 1RMU3 1OUXA 1AR71 3I59A 1SQ4A 4YZ3A 3WX5A 1CAUA 3Q8CA 4OULA 4DUWA 2YUEA 2OXBA 1OOPC 1RVF2 2DVAA 5IHRA 2CY6A 1EYBA 3ZFEB 2DCYA 1OF3A 4D7YA 2JD4A 4MXWB 1KFUL 3MFCA 3CJIC 3ZN5A 5CAZA 3AX4A 2QUOA 2WNEA 1BEV2 1EV13 3KVAA 5AC91 2IXKA 5EYXA 4COYA 1CN1A 4E4DX 2GC0A 2ZGQA 4PI2A 4Y4YA 1B09A 1XYOA 5CYYA 4FPEA 5FWEA 3I2JA 1RUF2 4BMBA 3F2ZA 5FZGA 1TVGA 3PMEA 1JZ2A 2FDIA 4YNIA 5GJ6A 2HWF2 3OEAA 5A3UA 2R1DA 4FP2A 2ID4A 3ZYFA 2RVAA 5L9VA 1UNBA 2VTFA 4MUVA 4ZONA 3THPA 4JKMA 4H55A 1G86A 4LJHA 1V6NA 3VZNA 3WW1A 2VBPA 4TYSA 1W8UA 2ZAAA 1R093 1JZ6A 2P3JA 3H50A 2EAKA 3UJOA 1LECA 2E7QA 4HN0A 3UL2A 1BBT3 2AACA 3EBRA 3WHUA 1XE7A 4YW7A 2HWD2 2V09A 2WZ8A 3E6BA 3UKVA 2NP0A 4P9YA 1PZ9A 5JZGA 3S5AA 5D21A 1W04A 4GALA 3FUQA 1NLSA 1OQDA 5L7OC 3TWIA 3FJSA 3I2HA 3T2TA 3TN93 3ZIWA 4BK4A 3VZKA 2ZOEB 1PIV2 4WZCA 5AFEA 5IJRA 3V56A 1FOD1 1LHOA 2WL1A 4ORFA 5CFCA 1J3PA 1FATA 1Q8QA 1MS9A 1U5XA 5IFTA 4XJ8A 1VB4A 1VAMA 3ZYBA 3HN3A 4W6WA 3UYJA 1VBD3 1QJU3 1AR81 5FZLA 2AEYA 4UFJA 2C24A 3ZFEC 3AP7A 1GLHA 2CWMA 2PHUA 2A5ZA 2DCTA 1C1LA 3OCPA 4Q0VA 5APAA 2R32A 1NAEA 5FZHA 4OI0A 5A3OA 3N9LA 1F15A 4E8CA 4YM2A 2YMZA 3MPBA 4XAEA 2OA2A 5KHHA 2PHLA 3M3QA 5BNQA 4Q4W2 2D6OX 1OKQA 4J1XA 3FBYA 1RUC1 1W2AX 1LNSA 3NNFA 1BLZA 3W5MA 4XFIA 2R30A 2FZ2A 1GU3A 1Y43B 4CP2A 1GV9A 1COV3 5LBEA 3GZTB 3WNLA 4GWNA 1DP0A 5ERLA 1ZBE2 1W6PA 1UZWA 2QFEA 2WSVA 4AFBA 4AI3A 5KXDA 4QPGA 5FLJA 3IAQA 1TG7A 1A8MA 3WCRA 5JCTA 2GC3A 4LK7A 2VUAA 3IIIA 1LOGA 1PO21 1VMJA 5FJKA 4Y5Z0 3TBDA 3I2GA 2XL7A 2GU9A 2RM23 2TUNA 3OUJA 3Q8FA 1GANA 3Q8AA 1RUD1 2RS51 4NVPA 5C7GA 4Q0UA 1AR73 1OH3A 1SHWB 1AR92 2WC2A 5CFDA 2UYAA 3CZJA 3LEGA 4C0HA 3H1WA 4CDXB 4L92A 2GH8A 3VV1A 4AFCA 1CAVB 4WVVA 5C3QA 2Y60A 1G8WA 1LODA 2MHFA 3NV4A 3VBSA 4UF0A 2FDGA 3LOBA 1SLIA 4AG4A 2D7FA 2YBKA 4QQOA 2CDPA 1W9SA 1VJ2A 1JOJA 1ULGA 1MZ6A 5IK4A 4CDWB 5ANNA 2GN7A 1ZZ6A 4P14A 1IQAA 2R072 3HT1A 5HPOA 2DVBA 2OIIA 5AC93 1ZBA2 1MVEA 1NZIA 3I7DA 3A4UA 3LDKA 4BQYA 1BEV1 2VAUA 4B3NA 2J1EA 2JB4A 2XJVA 2PHDA 4TLFA 1W6MB 1OA3A 3Q8BA 1NX9A 4A41A 2E6VA 2VNVA 3GXUA 3L2YA 4E2GA 1D7PM 3ROUA 1UYXA 1ZM1A 1URXA 4E27A 1UZYA 2J1AA 2W1SA 1BJQA 4P9WA 4KH9A 4UFHA 3JXSA 3OGGA 4LBOA 4PF5A 5D8AB 3RMYA 3ZIXA 4D3WA 2HWF1 2BNOA 4L9BA 2DU0A 4B8EA 3LDBA 3C7HA 4AK3A 1DGLA 5IVYA 2YROA 3UGHA 3OTFA 1OXCA 5EJ3A 5A3MA 1UYZA 1W8HA 4JTOA 1HXS2 3VKLA 1UXZA 3AZYA 2RDQA 3UETA 4WVMA 5HV4A 4W8JA 3PVEA 2CWSA 2VM9A 1RB8G 2NN8A 1LHVA 1OFNA 2ZCWA 2ZGRA 2W94A 3JD71 3RWNA 1GQPA 3IPVB 3MV01 1NCRB 2ZJCA 4KWLA 1HRI1 5FXWA 2UY8A 3KF5A 5L19A 4CUGA 3MV11 1OT5A 4CEWA 1DQ6A 2GZWA 1FOD3 4PCRA 5GLWA 3VGIA 3WF4A 2IXCA 2ZTNA 5A80A 3WV6A 4E4ZA 1PIV1 4FOYA 1HQLA 4CDXC 4FFIA 1LU2A 4Q4V2 4AEKA 3DYPA 1OUSA 3B00A 4KG0A 3V64A 1ULDA 3GBFA 3WZ1A 4WM7A 4AEDB 2VZPA 4AFAA 4FQZA 4QDQA 2J22A 1AL21 1Y9MA 5A7QA 1JUHA 2CU5A 1AR83 2PAEA 2ZMNA 5FYIA 1W03A 3ZPOA 4EZHA 1IKPA 1MQTA 1QH7A 1YQ5A 3D5OA 2ILMA 3J9SA 5LA1A 1MZ5A 3TEZA 3POEA 4RHV2 2PHWA 1G6NA 4JRAA 4CP1A 1TNRA 4P00B 4UAPA 2J1RA 4GJZA 2W46A 3N35A 4V2WA 4XUTA 3VZJA 4MGTA 5C6CA 2E7TA 5J96B 3WDYA 4WBBA 4GKXA 3H0OA 1GYKA 1RUC3 3I2OA 2IC1A 3WDTA 4Q4W1 3ZOIA 5GLZA 3CJXA 2RE9A 4QGLA 2ARAA 5CIRA 4OUSA 4EN8B 3IM0A 4LBKA 1FMD2 3PUIA 1DLLA 3J7NA 1RUI2 2ZGPA 3I54A 3LA2A 1YNAA 3O0XA 3EHKA 4HVOA 4XOGA 3ST7A 5CKQA 1QQP2 3WT3A 3S57A 1UU6A 3SHRA 2E53A 5FO8B 1ZBE1 3V65A 2XH6A 1PO23 3H1YA 1DZTA 5FPBA 3VDBA 1NY72 5HCAA 1RUD3 4BZ4A 5JIUA 3RDIA 5I0SA 1MEC2 5EXOA 2ZGKA 3OYWB 1AXYA 1SCRA 2SBAA 2Y0OA 2ZMLA 4BWOA 2VO5A 2VCCA 3OPZA 1NCRC 2Q30A 3RQ0A 1XBFA 4YG0A 5BNOA 4B4RA 5JSPA 3WDUA 1VBE2 3HAGA 1AX0A 5FY4A 4NRMA 4MGYE 3MGUA 2YBSA 1H1AA 2RV9A 3LEMA 1ASJ2 4IE7A 5FKCA 3RYPA 3U37A 3T2QA 1Z78A 2VMIA 4KWKA 3VD4A 2P6HA 2OQ6A 4QXCA 1IS3A 4IEPA 3PU8A 4N7UA 1XXNA 3U07A 3BI3A 3LOIA 1F31A 4MG2A 2R071 3W20A 1DFQA 4NPMA 2AREA 3W58A 1O6UA 3BVCA 1BEV3 3THCA 4KBBA 4AEDC 4LO7A 4BCUA 1ZBA1 4CXWA 2ARXA 2PQQA 2PFWA 2LROA 2VXRA 1S4CA 2AC1A 4LEJA 4MGSA 2JG8A 3SNMA 3LKJA 4XF1A 2AZ5A 3THTA 2RJKA 3K77A 4R9AA 4X8PA 3ZYPA 1XNCA 2ZA9A 5A7WA 2BFUL 1QDCA 1QOTA 3POWA 4PHZA 4QKFA 1OA2A 5F2SA 2HWF3 3T0BA 1NE6A 4JCKA 5IK7A 1OOPA 2HEWF 2YPJA 2ENRA 1V9U2 3O7OA 2R1BA 4A44A 2QDRA 3ACFA 3O12A 1SLBA 4E9KA 1D4M2 5FZEA 5I0TA 3ZXJA 4XQDA 2A75A 4AVSA 3FMGA 2EXHA 3OUIA 2X05A 4CDUB 5I93A 3ZYHA 2FDKA 1F4AA 3JD73 4XMAA 4P5YA 3RZKA 4D6SA 2W92A 5FYVA 1NA1A 4XAAA 1HRI3 3M3CA 2P4EA 4OLLA 4XZPA 3S5QA 3RI8A 1A6CA 3JCIA 2ZEXA 3ZSMA 4HLTA 1O8PA 2P3IA 4R8HA 3VKMA 1G9BA 2JECA 4YGEA 2WS91 1DU3D 1PIV3 2BEOA 1OFSA 4MV2A 2W5FA 3TRSB 1ZRCA 1LOCA 2QCSB 3MLKA 4Z2WA 5GZCA 1S0DA 4Q4V1 2R7EB 4XFHA 1OLRA 1YI7A 2D3PA 3OBAA 4AHWA 2YC4A 2JKXA 2J1SA 1AL23 1NKGA 4DXTA 3BTYA 2E51A 1QOSA 4OMCA 2VW2A 2XG3A 3VBOA 3N7LA 3TOJA 4NIDA 1CVNA 1UD1A 3KGZA 1LHWA 4NRQA 4MVTA 4RHV1 2LW8A 1SACA 2PHFA 2WZR1 4HK9A 1G9FA 1ULFA 3GDBA 3MIFA 5L7OA 2D44A 1F4HA 5CKNA 4UW3A 1KRIA 1W3XA 4Y1YA 3K3OA 1IPSA 2BOIA 4Q4W3 5A32A 2ZXQA 3WDXA 4JV4A 1C28A 5B2GB 1ACCA 3NSTA 4QXBA 5A3NA 2WYFA 2YGMA 3B5LB 4K8FA 1R64A 4IV3B 3CO2A 5DZGA 3ACIA 1KXGA 5IVVA 4IEQA 2XHKA 3LIGA 5J3UA 1ZBE3 4P9GA 3DEMA 2YB7A 4OFGA 2OW4A 3OB8A 4LIVA 3QACA 4ZU5A 4D6RA 2RDRA 2NQYA 1H1IA 3ZR6A 5F5IA 5KXBA 4DOUA 3ZX7A 1BVP1 2I2SA 2K2SA 4LUKA 1FT9A 1NY71 2NYYA 1RUG1 3R6SA 4CDUC 2Y0IA 4QPYA 2XHNA 4AVVA 4YW6A 1MEC1 1RJ7A 1W8OA 5C3PA 1V6LA 1DQ1A 1H30A 2VMEA 3JB8A 5H9SA 1CIYA 2XVKA 4NO4A 4HN1A 1A34A 4HMZA 3P5BA 2WA3A 3WVJA 4KI5M 2W47A 1VMHA 2V4VA 2DTWA 3ZSKA 2GMPA 1ULPA 4NJ4A 2QQPA 5JWPA 1VBE1 1YYNA 4PLOA 1RUH2 1EV12 2QQVA 4BQ3A 3URFA 3AYEA 4TWTA 2VZOA 2R073 4DXSA 4AEMA 1PMHX 5ACA2 1RGSA 2HJIA 4QX2A 4X6QB 3OJBA 1H9WA 1NG0A 1XJAA 2JICA 1OVSA 1N47A 4IL7A 3MYXA 4QD2A 5T54A 5BNPB 1J1TA 4Y5TA 2WNUB 3NWKA 5AFBA 5FYUA 4XVHA 1ZZ9A 2Q4SA 3VZLA 3J4UH 2XJTA 3LQCA 3M8LA 4JVAA 4CU6A 4EN7B 2WT0A 4Y33A 1JHJA 1JN2P 5C71A 2VOKA 4CXXA 4FSJA 2PTMA 5H9PA 4OI2A 1PHMA 1WW4A 4RYDA 3TYJA 4XW3A 4Y4RA 4IDZA 1V6IA 3FFQA 3ZXEA 1K12A 1OF4A 1BBT2 1SLAA 1QH6A 1V9U1 1N1TA 4QPIB 5FO7B 5EWSA 1UOFA 1W2UA 4H3WA 3VD7A 3ACHA 4UFKA 2I74A 2D6MA 1UU5A 2WT1A 3H3LA 4A45A 3O5SA 3TN92 1OVPA 1QEXA 2VMFA 5A33B 1UO9A 3V0AB 1K45A 5IT6A 3I2KA 3GCWA 3S0MA 2W95A 2XQXA 5FYSA 3ZFFB 1G9CA 2WS93 2E31A 1LKNA 4K3UA 4LBQD 4LLOA 5LBCA 5JXGA 3TEWA 1YCIA 4Y22B 1PVXA 3LWCA 2DYCA 5KHKA 4CPBA 3MLJA 1S0IA 2WQ8A 4Q4V3 4QQHA 2B9VA 4Q4X1 1QJU2 1VBA2 4XXAA 3SC7X 3DUIA 5CBLA 4RQPB 3NVCA 3WY6A 3NAPB 4LPLA 3BODA 4YVSC 3ZYRA 4AVAA 4IEZA 4YG6A 1J58A 2WNVB 4IXLA 5A70A 1VALA 1YO8A 5GZGA 4HKOA 5EP9A 3OY8B 4AE2A 5FUNA 3DKQA 4FFGA 4PIYA 4RHV3 2VPVA 1GKBA 4NIHA 1GNZA 2WZR3 4YFZA 3E5QA 4HT1T 5LA9A 4F83A 3KCXA 3RS6A 4I0WB 3RPQA 3T1MA 1QDOA 3VBHA 2AEZA 3SQOA 3NJXA 3TEXA 5BNPC 2WNUC 1QXPA 3S7IA 1PM4A 2JG9B 2VOVA 3NKTA 4EWEA 2Q1FA 1JXNA 3I4IA 4UT5A 1F8VA 3ZKUA 4Z1VA 1JODA 2B42B 2GMMA 1YLLA 1C4RA 5JDBA 2AH2A 5C3OA 4A7YA 3ABZA 4BH9A 2LALA 4MADA 2RM22 3HNMA 3H7YA 1US3A 4MO3M 2C4XA 4TTGA 2EA7A 2RHPA 4QPIC 1AR72 4XUPA 1RC6A 1N1VA 1KJLA 1KFXL 3PVOA 1IS4A 2L9LA 4NHMA 4YW3A 1WD3A 1X7NA 3TEYA 3PIGA 2QQMA 3NV1A 1RUG3 4I2OA 2ZGOA 1MEC3 2HYKA 4Y26A 4IEOA 3U10A 3N7MA 3ZSJA 4E8DA 4AVTA 1GZCA 4EROA 1LAJA 5FYMA 5LK5A 2H6BA 3ZFGB 1GP4A 1YFYA 3ATGA 4IUGA 3UNPA 2CGPA 4FCAA 2OVUA 1W6MA 4Z82A 5FZOB 4XETA 1X9PA 1DBNA 2TEPA 3QBQA 1OHFA 1VBE3 2D5FA 3ZFFC 3W5NA 4FPGA 1SFYA 5DUWA 5FMDA 2PN5A 4XTMA 5AC92 2JKBA 5DZFA 4GH4B 1RUH1 3KV4A 3ZYGA 1ZZBA 3FLTA 1O4ZA 3W9AA 3T2PA 4Z2AA 5BYNA 4I01A 5IVCA 4Q8LA 3DXUA 5E89A 4YG3A 3UT0A 4COZA 5K7PA 4RQPC 1VPHA 1SCSA 5ACA1 1NCQB 3NAPC 5GLUA 2BBAA 1DYOA 1TZOA 4JGYB 4BHPA 1LCLA 1UWWA 2UU8A 4K1ZA 5C8CB 2Z42A 4D6QA 3LEKA 5FZMA 2VTXA 3PUAA 3HJRA 4EJRA 2JDKA 2WZEA 3D8CA 1JYCA 1POV1 3IPVA 1FPN1 1V0AA 2DVDA 4ET7A 1RXGA 1HRV1 3RMXA 3WNKA 1SFPA 5FBJA 2DWRA 4NHYA 1V9U3 5C33A 5JOXA 1RITA 4Q26A 2JG9C 3WNMA 1YJLA 5FMOL 4C1XA 1BBT1 1GICA 2IZWA 3DXTA 5FZDA 5JXJA 2IVJA 5LA0A 3BTXA 1XNDA 2WN3A 5A6ZA 3SMHA 4AEDA 1CESA 1UKGA 3VKNA 1PGW2 4PLMA 1HV1A 3WG3A 1WMDA 4LO4B 2NPIA 4DEVA 1FOD2 4BQ4A 5LY1A 4NN0A 4ASMB 5JR7B 1JUIA 2VVDA 5FQ0B 3POIA 4WV8A 4AI0A 2XPJA 1VRH2 4AGVA 3CL1A 1CPNA 5B4NA 3AFKA 4HSJA 4GWJA 4Y20B 3PURA 1H4HA 3H8UA 4TSVA 3W21A 5LK7B 2BGCA 1AZDA 2A3YA 3RYRA 4Q4X3 3VDDB 1AR82 1W6NB 3K4ZA 4QMAA 3ZFGC 1NZCA 5FY5A 3WHTA 2AUYA 2W3JA 2GALA 1KDKA 1VBA1 3VDAA 3D82A 1WA6X 5A3PA 4UYBA 2F17A 4N43B 3OGJA 4HG6B 1CZVA 3ZSLA 1NYWA 4HSLA 4P9XA 4LHKA 1DHKB 2Y34A 2ZGUA 1A78A 4QX8A 3C8XA 3NV3A 2BOJA 2Z4FA 4GH4C 1RYYA 4EN0A 5ABJC 5C70A 2QQJA 1GZTA 3MZHA 1RUC2 1W90A 2QVSB 2YFZA 3ZKYA 3NQHA 4ZXEA 1GOHA 4XUQA 1QKQA 3FL7A 5DAWA 1NCQC 3N9OA 4LNVA 3ZR5A 4IE4A 4JGYC 5C8CC 1AXKA 3MFAA 2B46X 5FXVA 1OMIA 2XBO2 2D97A 4JDMA 1UPSA 4U36A 1HQWA 4N8MA 4QX7A 4XIOA 2RR11 2F4PA 4M0NA 3BU7A 4JGZB 5FZAA 3THDA 1JZ7A 2JIJA 1H8VA 4UFLA 3CF6E 1WGPA 2B5HA 4QKNA 3WG4A 4CPBD 2VVFA 5DUXA 1I6XA 1DQ0A 3AMQA 4FT8A 1H8TC 1IS6A 3U14A 4EYUA 3N9MA 1ZRRA 4QKDA 1PVC1 2V72A 3I2DA 3CDZB 4CDQB 3T09A 4UBHA 5JOWA 3KQRA 1GNYA 4MOAA 4IEXA 4PBOA 3O1VA 3WUDA 2BPA2 1JBCA 3KV6A 1GBGA 3BYWA 4S2HA 5KBFA 5BUVA 2FBEA 3RZHA 5A6XA 4DZGA 1TMF1 1QIQA 4HPKB 1VIWB 4UI9L 4DXZA 4FAGA 5I8TA 4J1WA 2RS31 4FFHA 2OPWA 4F3JA 5JSOA 2KM2A 3ILFA 4JQRA 2GN3A 3N4MA 4NOTA 4QHBA 5FPLA 2FDHA 2MNGA 3LE0A 2E63A 4O61A 5FZ7A 3VD3A 1RUH3 3KM5A 4BIFA 2VXJA 2QE3A 4LA3A 2D6NA 3HIFA 4XFFA 4QXKA 1SPPB 2BUKA 3DV8A 3IIAA 4I3PA 5ACA3 4XC9A 2UWCA 2A3XA 3O14A 1VB2A 2JJ6A 4N43C 3S30A 5FYCA 4K21A 1OPOA 1CONA 3OUHA 5F5AA 4YRDA 4YWAA 5IUQA 5F37A 3R4SA 2X09A 1Q56A 1CZTA 1EAH2 1POV3 1RINA 1FPN3 4I02A 2X5IA 4JRLA 4XFCA 3T30A 4HVQA 2I45A 3T2OA 1HRV3 3NNGA 1X8EA 4M0HA 4YFWA 2BQPA 3N7JA 4Q1PA 1Q8VA 1XQNA 4QGMA 3WR0A 5FO9B 2FDJA 1PK6B 3GHMA 4XZUG 4RSUA 4KL1A 3U78A 3VBUA 2CTVA 3HPNA 3KT4A 3L9JT 2ATFA 4AFMA 4CP9B 4CVUA 2P1BA 3AP4A 1MS1A 1IGOA 1AXZA 3JD72 1HB4A 1SDDB 3H9AA 4PDWA 1W28A 3MDPA 3MO4A 1HRI2 4OMDA 1ZYBA 4QX0A 4B4PA 1FYUA 2G9FA 1BYHA 2JX9A 3O1UA 1TME1 1S0JA 1HB1A 1PGW1 3BOWA 2D6KA 2A1XA 3C7FA 4QQPA 3RSJA 1I1EA 4Q2FA 2VQUA 4O65A 4AHYA 5KR7A 1JZ4A 4RR3A 3NNJA 1QJX1 3NW4A 1SFNA 3HVDA 4A2UA 1VRH1 1ZRIA 4YPJA 1AL22 4KGQA 1ND3B 3WNOA 1NLQA 3ME2A 3OGSA 4Q0PA 1K5MB 3WCSA 3OF1A 5DN2A 1AJOA 4AQSA 1W6QB 4DNYA 4DY5A 1VBA3 3AKTA 4CCCA 1O3RA 4BLJA 4YGBA 3ZYIB 4O9GA 1UYPA 2VQ0A 1GOFA 5HI0A 4AHZA 4BU2A 1W8FA 2H0BA 1W3VA 1W8TA 2QQUA 2J1TA 3IDAA 3ZM8A 3ILNA 1C3HA 5LRSA 2SLIA 2HWC2 3M3IA 1DQ4A 2WIIB 4NHKA 4CU7A 5LCWL 5K0UB 5BV6A 1YJKA 5SV5A 2VMHA 1CAWB 3O1OA 3V0BB 3FC0A 1UIKA 3N3HA 1Q8OA 2DUQA 4IESA 3ELNA 3BOPA 1RXFA 3LCPA 1J3QA 4AFDA 4JQTA 2ZX2A 4V1PA 2RR13 2EALA 2XBO1 2ORXA 2R041 5DABA 4WVZA 3BU0A 4MGIE 2GNBA 4YVSA 3CQOA 1X33A 4K1YA 3TAYA 1PVC3 2NZ9A 3AXDA 5FZ1A 3K4AA 1AL0G 5T3NA 2XLAA 1V6JA 1CX1A 1WW7A 2WFPA 1RHI1 4ES9A 2FHRA 5E88A 3WNPA 1TMF3 2N7GA 2PHRA 2RS33 2VNOA 3KV9A 5GLTA 5IFPA 4TN7A 4PBPA 1S0FA 1IPJA 2F4LA 1O5UA 3ES4A 3SITA 1U5ZA 4DY3A 4JDOA 5A7OA 4EWDA 5JOZA 3E1F1 2HBUA 1U0AA 2EIGA 3PLQA 2JENA 2W1QA 2VW0A 3PJQA 2VNRA 4GKYA 1C8M1 5IVEA 1ND3C 5C9AB 1W9TA 2G9ZA 1U5IA 1K5MC 3A7QA 2A7AA 2HEVF 4QPIA 4R4ZA 1LOBA 2G1MA 3IN9A 2WNOA 4L99A 4NPRA 3UV9A 3R4DB 1JYTA 1SEFA 2QQLA 4NAOA 1X9TA 4XACA 3OBZA 4KG8A 3PMSA 5F1RA 2VECA 1B35B 2D98A 2J42A 3ES1A 5E16A 3VZOA 1V6MA 3KHBA 2XJPA 4LMFA 1ZA7A 2P3YA 5FP7A 5IWFA 1EAH1 5CADA 5A3TA 1WCDJ 5BXXA 2OZJA 2YU2A 4YVWB 5C5UA 2BDRA 4BB3A 1IHMA 1MS0A 2OX0A 3HQXA 3BIWE 3SKJE 1H2LA 2ET7A 2VMDA 4XCAA 1EPWA 1VLNA 3VZMA 3O0WA 5FP9A 3POJA 1ENQA 1ZVFA 2WBKA 4Q29A 5BPXA 3POYA 4RQPA 2BERA 2O1QA 4H14A 4ITCA 1TME3 4IV1B 4DEQA 4F8AA 5FKBA 4CU9A 5DQ0A 2WS92 2W9XA 4JTNA 1BKZA 4DUXA 4IEWA 5FPXA 5CNAA 3E6DA 2QQIA
chains in the Genus database with same CATH topology
4NUBA 2Q8EA 5FV3A 3K3OA 3N9NA 5LW9A 2OT7A 4CCNA 3KV5A 5ANQA 5FY9A 4QX8A 4XDOA 4QXBA 5A3NA 5FJKA 5FPVA 5FYZA 5FZ6A 4BISA 5FZBA 4V2VA 3AVSA 3PUQA 2OQ7A 3N9QA 4BU2A 5IVVA 3PUSA 3OPWA 5FPBA 5F2WA 3AL6A 3N9OA 3ZLIA 4HONA 4IGQA 4Y3OA 4LIVA 4D6RA 5F3EA 5FZ0A 5F5IA 5FXVA 4UF0A 2PXJA 5FYTA 4QX7A 5FP3A 2YBKA 3NJYA 3PU3A 5FZAA 4XDPA 3LD8A 5CEHA 4E4HA 5FUPA 4CCOA 2P5BA 3KVAA 4AI9A 2VD7A 2YPDA 5FY4A 4EYUA 3N9MA 5FY7A 5IVFA 2YBSA 5FWEA 4LIUA 3PDQA 5FYMA 2OQ6A 4QXCA 5A1FA 3PU8A 5FZGA 3KV6A 5F32A 5FZ1A 5K4LA 5FZOB 5IVCA 5A1LA 5F3CA 1VRBA 5FY1A 5A7SA 3OPTA 4URAA 2WWJA 4DO0A 2XMLA 3K2OA 4CCKA 4GD4A 4ASKA 2YU1A 3KV4A 2XDVA 5A3WA 2GP5A 5F3GA 3KV9A 5FZCA 5FPLA 5FZ3A 2XUEA 5F3IA 4GAZA 4TN7A 5FZ7A 3DXUA 3LDBA 5A7WA 3RVHA 5F2SA 5FYUA 5FYBA 5IVYA 5FP8A 5A7WB 4DIQA 4QWNA 4Y33A 5A7OA 4D6QA 5FZMA 2Q8CA 5F39A 3PUAA 2GP3A 5FZEA 5IVEA 4Y4RA 5FPUA 5FYCA 5F5AA 5LY2A 5FZOA 5F37A 2XXZA 5FZFA 4HOOA 4AAPA 3KVBA 5F5CA 5FYHA 3K3NA 3PTRB 5FBJA 5FXWA 4EZ4A 3AL5A 5LWBA 4CUGA 4LXLA 4QU1A 2Q8DA 4CSWA 4D6SA 5FYVA 5FZKA 5E6HA 5A80A 5FPAA 3DXTA 5FP7A 5IWFA 5FZDA 2OS2A 5FZ4A 2WWUA 5A7NA 3U78A 3UYJA 4CCMA 5A3TA 5FZLA 2YU2A 5FWJA 5FXZA 4BXFA 2W2IA 2OX0A 5FYSA 5A7QA 4EZHA 3ZPOA 5FZIA 4IGPA 5FZHA 5FP4A 5FYIA 3N9LA 5FZ8A 5IW0A 5LY1A 4CCJA 5FY8A 5FZ9A 5FP9A 4GJYA 4GJZA 4V2WA 4LITA 5IVJA 5FYYA 3PURA 4CCLA 4C8DA 5FY0A 4UF0B 5KR7A 3AVRA 5FJHA 5FY5A 2YBPA 5IVBA 5ISLA 4IGOA 4QXHA 5A7PA 3U4SA 5FXXA 3N9PA 5A3PA 5FUNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NUB A;  2Q8E A;  5FV3 A;  3K3O A;  3N9N A;  5LW9 A;  2OT7 A;  4CCN A;  3KV5 A;  5ANQ A;  5FY9 A;  4QX8 A;  4XDO A;  4QXB A;  5A3N A;  5FJK A;  5FPV A;  5FYZ A;  5FZ6 A;  4BIS A;  5FZB A;  4V2V A;  3AVS A;  3PUQ A;  2OQ7 A;  3N9Q A;  4BU2 A;  5IVV A;  3PUS A;  3OPW A;  5FPB A;  5F2W A;  3AL6 A;  3N9O A;  3ZLI A;  4HON A;  4IGQ A;  4Y3O A;  4LIV A;  4D6R A;  5F3E A;  5FZ0 A;  5F5I A;  5FXV A;  4UF0 A;  2PXJ A;  5FYT A;  4QX7 A;  5FP3 A;  2YBK A;  3NJY A;  3PU3 A;  5FZA A;  4XDP A;  3LD8 A;  5CEH A;  4E4H A;  5FUP A;  4CCO A;  2P5B A;  3KVA A;  4AI9 A;  2VD7 A;  2YPD A;  5FY4 A;  4EYU A;  3N9M A;  5FY7 A;  5IVF A;  2YBS A;  5FWE A;  4LIU A;  3PDQ A;  5FYM A;  2OQ6 A;  4QXC A;  5A1F A;  3PU8 A;  5FZG A;  3KV6 A;  5F32 A;  5FZ1 A;  5K4L A;  5FZO B;  5IVC A;  5A1L A;  5F3C A;  1VRB A;  5FY1 A;  5A7S A;  3OPT A;  4URA A;  2WWJ A;  4DO0 A;  2XML A;  3K2O A;  4CCK A;  4GD4 A;  4ASK A;  2YU1 A;  3KV4 A;  2XDV A;  5A3W A;  2GP5 A;  5F3G A;  3KV9 A;  5FZC A;  5FPL A;  5FZ3 A;  2XUE A;  5F3I A;  4GAZ A;  4TN7 A;  5FZ7 A;  3DXU A;  3LDB A;  5A7W A;  3RVH A;  5F2S A;  5FYU A;  5FYB A;  5IVY A;  5FP8 A;  5A7W B;  4DIQ A;  4QWN A;  4Y33 A;  5A7O A;  4D6Q A;  5FZM A;  2Q8C A;  5F39 A;  3PUA A;  2GP3 A;  5FZE A;  5IVE A;  4Y4R A;  5FPU A;  5FYC A;  5F5A A;  5LY2 A;  5FZO A;  5F37 A;  2XXZ A;  5FZF A;  4HOO A;  4AAP A;  3KVB A;  5F5C A;  5FYH A;  3K3N A;  3PTR B;  5FBJ A;  5FXW A;  4EZ4 A;  3AL5 A;  5LWB A;  4CUG A;  4LXL A;  4QU1 A;  2Q8D A;  4CSW A;  4D6S A;  5FYV A;  5FZK A;  5E6H A;  5A80 A;  5FPA A;  3DXT A;  5FP7 A;  5IWF A;  5FZD A;  2OS2 A;  5FZ4 A;  2WWU A;  5A7N A;  3U78 A;  3UYJ A;  4CCM A;  5A3T A;  5FZL A;  2YU2 A;  5FWJ A;  5FXZ A;  4BXF A;  2W2I A;  2OX0 A;  5FYS A;  5A7Q A;  4EZH A;  3ZPO A;  5FZI A;  4IGP A;  5FZH A;  5FP4 A;  5FYI A;  3N9L A;  5FZ8 A;  5IW0 A;  5LY1 A;  4CCJ A;  5FY8 A;  5FZ9 A;  5FP9 A;  4GJY A;  4GJZ A;  4V2W A;  4LIT A;  5IVJ A;  5FYY A;  3PUR A;  4CCL A;  4C8D A;  5FY0 A;  4UF0 B;  5KR7 A;  3AVR A;  5FJH A;  5FY5 A;  2YBP A;  5IVB A;  5ISL A;  4IGO A;  4QXH A;  5A7P A;  3U4S A;  5FXX A;  3N9P A;  5A3P A;  5FUN A; 
#chains in the Genus database with same CATH topology
 1KS5 A;  1LEN A;  1QJX 3;  3WP5 A;  1VRH 3;  2OT7 A;  1M06 G;  1WZX A;  4KQ7 A;  3J8F 1;  4Z92 B;  1XNT A;  1WME A;  2JDY A;  4G3Y C;  3MID A;  2NMN A;  4V2V A;  1UMI A;  4XIL A;  2JG9 A;  3AVS A;  2QTW B;  1AJK A;  2K0G A;  5EJ1 B;  1VBC 2;  1QJY 1;  1MVQ A;  1Q3E A;  4I30 A;  4LK6 A;  5F2W A;  4CDW C;  2WZR 2;  4XFA A;  3TB0 A;  2DVG A;  4WZF A;  5FZ0 A;  5T5J A;  1YQ2 A;  2PXJ A;  5C9A C;  2WDB A;  3ZSE A;  4XUN A;  5FK7 A;  3ZYJ B;  4L8Q A;  5E1R A;  1CJD A;  3ZN6 A;  1QXJ A;  5AVA A;  2HWC 1;  4GMP 0;  3IZO A;  4ES8 A;  5L9R A;  4WM8 B;  1KD7 A;  1DGR N;  2ZHM A;  4OUM A;  4EQV A;  4R52 A;  1B35 C;  1DQ2 A;  1LED A;  1W0P A;  2PAK A;  3ASI A;  3HQR A;  5J1X A;  3ZXA C;  5D8A C;  3LIH A;  2W0X A;  4LIU A;  2YG0 A;  2XBO 3;  3EXU A;  1XU1 A;  2R04 3;  3NRU A;  3LSD A;  1XNB A;  1LRH A;  1GZ9 A;  1UY1 A;  4PT6 A;  1LES A;  5F6K A;  1IG0 A;  2ZHK A;  4QM9 A;  5K4L A;  4YVW C;  3AK0 A;  2I07 B;  2GH2 A;  2QNK A;  2IVI B;  3GCX A;  1RUG 2;  4JDN A;  3HBK A;  3JZV A;  5BNN A;  2XJQ A;  1UMZ A;  2HWE 2;  2GC2 A;  4M3C B;  2C6S A;  5ABJ A;  1FV2 A;  3E5U A;  1LOF C;  1RHI 3;  4LO6 B;  1HQN A;  1LHU A;  4MHU A;  4N90 A;  4NIG A;  3MW2 A;  5FZC A;  4G9S B;  3FLP A;  3VHR A;  5FYB A;  1FNY A;  1UL9 A;  4IV1 C;  4JX0 A;  4JGY A;  4RGK A;  3WQ7 A;  2BJS A;  4XJA A;  2E26 A;  2VH9 A;  2BNM A;  2WQZ C;  2GND A;  1H0B A;  1QNY A;  2GP3 A;  2WAB A;  3EJK A;  1AVB A;  5FCC A;  1MS4 A;  2XXZ A;  5FZF A;  4DFS A;  1UZZ A;  1C8M 3;  1H4G A;  2EF6 A;  2PA7 A;  2XKP A;  4LKS A;  1O3T A;  3FFZ A;  3K46 A;  3JU9 A;  1H8T A;  4EZ4 A;  1VBB 2;  2ZGT A;  4PQQ A;  4LXL A;  1FI2 A;  3ALQ A;  1QOO A;  2B45 X;  2WO3 A;  3N36 A;  3NMB A;  4ZY9 A;  2Q8D A;  2NLR A;  3WLU A;  1H6Y A;  3ECQ A;  3F95 A;  1WD4 A;  2VE1 A;  3OD4 A;  4NRP A;  4TZD A;  2HYX A;  2ZHL A;  3HBZ A;  5EFU A;  4AR2 A;  2A6X A;  3ZVX A;  4BXF A;  2W2I A;  1AYN 1;  1EAH 3;  3HR9 A;  1UX6 A;  4CCE A;  2ZBJ A;  5FZI A;  5FZ8 A;  1WLW A;  3AJZ A;  2XVL A;  3I59 B;  4FPL A;  3CJI A;  2W68 A;  4A6S A;  2Z69 A;  3POG A;  4WM8 C;  4OQ8 A;  1YXW A;  3FUO A;  1CAU B;  1NE4 A;  1P8J A;  4LOR A;  2VZU A;  4GJY A;  2BWC A;  4Q0S A;  4IEV A;  4QDS A;  3RWK X;  4CCL A;  4L2N A;  1UOJ A;  1W9F A;  3P3N A;  1PMI A;  5A6Y A;  5JI7 A;  1F2N A;  4XF9 A;  2DF7 A;  4QAW A;  4CXY A;  3ZXF A;  4N43 A;  2KR2 A;  4J6G A;  3FN9 A;  5ANQ A;  2EXJ A;  1UPI A;  5FPV A;  4Q4X 2;  3SH3 A;  2UUR A;  3J8F 3;  1EP0 A;  2OQ7 A;  1BQP A;  4QX1 A;  3T1L A;  2O14 A;  5GLV A;  4DS0 A;  1ZRF A;  3WW2 A;  1W2N A;  3ZPY A;  1OI6 A;  4ZXK A;  3B01 A;  2PHX A;  4HON A;  4S2D A;  4AW7 A;  4IGQ A;  4Y3O A;  4NIA A;  1YI9 A;  5DAQ A;  2JIG A;  5DAV A;  4M3C F;  4DXR A;  5IAX A;  1QJY 3;  4GWM A;  5G04 L;  4YZ1 A;  2VOX A;  1VBC 1;  3KZ4 C;  4UW4 A;  3PU3 A;  5CEH A;  2K46 A;  1VMF A;  5DAX A;  2VD7 A;  2YPD A;  3M3E A;  1R08 1;  3OBT A;  3MIH A;  4GQ7 A;  4QDR A;  5FY7 A;  5JXH A;  2HWC 3;  5JZG B;  2EXI A;  4CRQ A;  2MPF A;  5LAS A;  1T6B X;  3CZU A;  4QX3 A;  3RYK A;  2JDU A;  2P3K A;  2C0Z A;  1CZS A;  1XYN A;  3SCH A;  2VUL A;  1VRB A;  4HPK A;  5A7S A;  4RN5 A;  1UOG A;  2IXI A;  3ZFE A;  5CFC B;  3WW4 A;  4MXW A;  3WF1 A;  2AR6 A;  3SCF A;  1AYM 1;  1CQ9 A;  4A42 A;  3LFI A;  2Q1M A;  2F6B A;  3FWE A;  4GAZ A;  4EWA A;  1ZX5 A;  4A3Z A;  1LGN A;  2HWE 1;  2RDN A;  1XSQ A;  2GC1 A;  2CNA A;  1FXZ A;  1SPP A;  4JHZ A;  3OSD A;  3DN7 A;  2D40 A;  3TNQ A;  2JE7 A;  4UFI A;  3B7M A;  4FTS A;  2BP6 A;  4CUB A;  5IYY A;  3O1M A;  1TE1 B;  3VKF C;  5FPU A;  1C8N A;  3BIE A;  2VZV A;  2HLE A;  3MW3 A;  5FFO C;  1IPK A;  2D5H A;  5I0D A;  4L11 A;  1MZF A;  3H8R A;  3M70 A;  2Y6K A;  1OQ1 A;  4FVV A;  1KIT A;  4OVE A;  1J83 A;  1APN A;  4MGQ A;  2A6Y A;  2BVB A;  2WLP A;  3NL1 A;  1JS9 A;  4XEZ A;  1HV0 A;  3USS A;  3Q9O A;  5HCH A;  1W6P B;  3JBG 1;  3RI9 A;  1N3Q A;  1VBB 1;  2JE9 A;  4QPG B;  4CP9 A;  1JYI A;  1YIP A;  3IT8 A;  2VR4 A;  4GIQ A;  2QJV A;  1UY2 A;  4OHZ A;  1FPN 2;  4UXA A;  5T55 A;  5CA6 A;  4KWJ A;  1R1Z A;  1HRV 2;  5FP4 A;  5IW0 A;  1KEX A;  3D3A A;  5K9Y A;  1AYN 3;  1HX6 A;  4G4F A;  5CFD B;  3BAL A;  4CA9 A;  2B39 A;  4N9I A;  4ZS2 A;  3VHP A;  1MS3 A;  4AGR A;  2WO1 A;  1BK1 A;  1Q5O A;  3WXP A;  3HWJ A;  5JZG C;  2IUW A;  3H3U A;  1XRU A;  1NLR A;  3AKQ A;  1ZRE A;  1SBE A;  3DPR B;  3VBS B;  3BUC A;  2VMC A;  3L2H A;  4UF0 B;  3C7G A;  4IV3 C;  4LBL A;  3ZXL A;  2JD9 A;  5A7P A;  4MH0 E;  4LBN A;  3PVN A;  2W1U A;  2XJU A;  1G9D A;  3M7A A;  4OHW A;  2CAU A;  2VUC A;  3GZE A;  5E8A A;  3X29 B;  5CU1 A;  5K8S A;  2YV8 A;  3AJY A;  5CFC C;  1DYK A;  2BGP A;  3ITQ A;  5JXI A;  4XDO A;  4M4P A;  4DB5 A;  5JPM B;  3IDB B;  3ON7 A;  4UFM A;  1EY2 A;  4NRO A;  4UOJ A;  1GWK A;  5CZK A;  4YAR A;  4Q4Y 2;  2XWB B;  1LU1 A;  1VP6 A;  2W52 A;  3NO8 A;  3OGR A;  1BK0 A;  2PYT A;  4BOW A;  1ENR A;  3V0B A;  1ZZC A;  5GAL A;  4PIX A;  1UQX A;  2VCM A;  1UY3 A;  3WIN E;  2WO7 A;  3NJY A;  4BPZ A;  2JDA A;  3LD8 A;  1RUJ 2;  4NWW A;  5FUP A;  1O5L A;  5HBA A;  1OQE A;  1VBC 3;  1RJ8 A;  1D0H A;  1JOB A;  1U5Y A;  3WD5 A;  4GUL A;  1EUU A;  1ST8 A;  2XKO A;  3GM8 A;  5JR2 A;  4LO8 A;  4B1L A;  2R49 A;  1HKD A;  1R08 3;  1JU4 A;  3GBG A;  4N53 B;  5T5L A;  4CZS A;  3EB7 A;  4E2Q A;  3LPF A;  5D1I A;  1GWM A;  2DDU A;  5HCB A;  1PX3 A;  2WLQ A;  1IZ3 A;  4CDX A;  4M00 A;  2VTX J;  1ENS A;  1W8Z A;  2RR1 2;  3KCY A;  3SH5 A;  3WW3 A;  4E4S A;  3B9C A;  4URA A;  5DMY A;  4ISR A;  1CAV A;  4EN9 B;  4P02 B;  3POF A;  1BXH A;  1UX7 A;  1C5H A;  4LKE A;  4OUE A;  2XML A;  2GNM A;  3C3V A;  4Q5O A;  4YW1 A;  4CEW B;  1PMJ X;  2FZ1 A;  5CFD C;  4LE4 A;  4ZU4 A;  1PVC 2;  3AYD A;  1FV3 A;  4D94 A;  3PJY A;  1AYM 3;  1FNZ A;  3KSC A;  4CDW A;  3ETQ A;  3DPR C;  4LKD A;  4XYX A;  1LGB A;  3WDV A;  4WM7 B;  4QKB A;  4XJ9 A;  5F6L B;  5C5T A;  1HLC A;  1OD5 A;  2EIB A;  1DZQ A;  2HWE 3;  2VQT A;  1X8M A;  1L7R A;  1TMF 2;  2ORZ A;  4QPW A;  5C9A A;  3RNS A;  2RS3 2;  1O59 A;  3LEI A;  5B4X A;  2R6Q A;  1Q8S A;  2IXL A;  3LAG A;  3JB4 C;  3PTR B;  3AL5 A;  5IK5 A;  2BV4 A;  4QU1 A;  1DGW A;  3AP6 A;  1B35 A;  3BCW A;  5LAT A;  2O8Q A;  1DDL A;  5D8A A;  2XB6 C;  3GF6 A;  4UW6 A;  3MHZ A;  4IND A;  3LSE A;  4MGK E;  1V00 A;  1W6O B;  2XJR A;  3HNB M;  2OS2 A;  3E97 A;  4YVW A;  4XTP A;  1MS8 A;  5GZE A;  4HVR A;  4TXW A;  5HXM A;  2PAM A;  3JBG 3;  3M2M A;  3PL0 A;  1VBB 3;  3KQ4 B;  4GA9 A;  5HXV A;  3VD9 A;  1K42 A;  1GP5 A;  2WNV C;  2WUH A;  4OQ9 A;  1ND2 B;  1LOF A;  4MXV A;  4CCJ A;  4LHN A;  4PQ9 A;  2C9K A;  1Y9Q A;  1OLM A;  3KCC A;  1NCR A;  1W8W A;  2H0V A;  3CBN A;  4GXL A;  1Z0H A;  4W65 A;  3LPG A;  4IV1 A;  1SZB A;  2CYF A;  2QQN A;  2Y6J A;  4BJ0 A;  1LB2 A;  4N53 C;  3T3Y A;  5FY0 A;  3EMR A;  3AZW A;  4RL7 A;  1IKQ A;  1RUO A;  4XPV A;  5I8Y A;  1WLD A;  4Y1U A;  3USU B;  3H42 B;  5BNO B;  4WVW A;  2WA4 A;  1W2T A;  2XOM A;  3C7O A;  3GAL A;  2X29 A;  5FY9 A;  4CEW C;  4LBM A;  1TME 2;  5FAX A;  1RUE 1;  3BTZ A;  2JDM A;  1NOV A;  4U2A A;  4HK8 A;  4XBQ A;  1AHS A;  2ZKL A;  3EO6 A;  3N9Q A;  4AF9 A;  2ZPX A;  2VZ3 A;  4FPJ A;  5IK8 A;  1ULC A;  2DV9 A;  1QJX 2;  3AZX A;  4XMI A;  4AQ2 A;  5T50 A;  3DGT A;  4MYE A;  3DL3 A;  4PIZ A;  2BW8 A;  1WBF A;  4LO5 B;  4Z8B A;  5C8W A;  1ODN A;  1OC1 A;  1S0C A;  1S2E A;  2CHH A;  3J7H A;  4LOS A;  5EYY A;  2YGL A;  2WZP P;  5FP3 A;  4Q4Y 1;  2ZX3 A;  3P6B A;  2W1W A;  4E4H A;  4CCO A;  4RA0 A;  2Y6L A;  4WM8 A;  2FCT A;  2VOT A;  1WCS A;  2VY0 A;  3VD5 A;  4URT A;  1K5J A;  1OUR A;  1RUJ 1;  3AMH A;  3MEP A;  3EQE A;  3PDQ A;  3UGF A;  4DUV A;  2A71 A;  4SLI A;  2HWB 2;  4Y1X A;  1X36 A;  3B94 A;  4AOC A;  3I3B A;  5AVP A;  2Y38 A;  1WBL A;  2A70 A;  2PLV 2;  2YXS A;  3U11 A;  4DMI A;  3OPT A;  2D43 A;  1UU4 A;  4GB3 1;  5KC5 A;  3DCQ A;  1WCQ A;  1ND2 C;  3OYW A;  5J37 A;  1UY0 A;  2PMW B;  4GD4 A;  4DRV A;  3ENR A;  1DQ5 A;  1NA1 B;  2P2K A;  2YU1 A;  2R04 2;  2O8O A;  3Q8E A;  3I3Q A;  5JI9 A;  3MLL A;  4HFS A;  1PO1 1;  3JQW A;  2XON A;  4DIQ A;  4DPN A;  3G7D A;  5DG1 A;  3WOG A;  3FHQ A;  2Q8O A;  3CMG A;  3WEZ A;  1ALY A;  3I2F A;  2ZHN A;  4QHO A;  5F39 A;  2ZZJ A;  3HD8 B;  1RHI 2;  1LR5 A;  1HIX A;  2A3W A;  4FTB A;  2CGO A;  4FXG B;  4XE9 A;  1YQ8 A;  1W39 A;  4Y1Z A;  1OD3 A;  5EIY B;  5CG9 A;  1BMV 1;  4XIK A;  3KVB A;  4JZR A;  5FYH A;  1LTE A;  2R06 2;  3VBO B;  2XQR A;  3M1H A;  3W59 A;  3K75 B;  5LEK A;  3GNE A;  2C1F A;  1OBN A;  4BK5 A;  4KGG A;  2LUW A;  3E5X A;  4CSW A;  3IB3 A;  3RZJ A;  4NHL A;  5L7O B;  1DCS A;  3HN1 A;  5A32 B;  2WWU A;  5A7N A;  1XE0 A;  1SDW A;  1C8M 2;  1HB3 A;  2RS1 2;  4HZF A;  1YC6 1;  2B9U A;  4BQ5 A;  5JOY A;  2ZGL A;  1QY4 A;  4BQ2 A;  1HJF A;  2AEN A;  3VDD C;  3QCW A;  4AL9 A;  1QJE A;  5IAT A;  1OLM E;  5FY8 A;  1O3Q A;  2ZAB A;  2YHJ A;  4OHX A;  2P34 A;  1SBF A;  2ZKN A;  3T0A A;  4CDU A;  4CUC A;  5C4W B;  2JWP A;  2BFU S;  4A4A A;  3UKN A;  3AFG A;  3VDC A;  3ZMO A;  1XE8 A;  4C91 A;  2WJS A;  3AVR A;  2GME A;  3N9P A;  1LOA A;  5ISL A;  1UXX X;  5DPN A;  2ADE A;  2D3S A;  1G7Y A;  2IWG B;  1H2N A;  1XYP A;  3PNA A;  3LGR A;  5FV3 A;  5KC6 A;  2WWS A;  3AM2 A;  3LA3 A;  5KXC A;  2ZMK A;  2CAV A;  5DDJ 2;  2EIE A;  1NA1 C;  4YYO A;  2R0H A;  2C9A A;  1TQ5 A;  1CAX B;  1WUV A;  2E7A A;  1N3O A;  3EYP A;  1RUE 3;  1J3R A;  2WAA A;  3G6J B;  2CSG A;  3HNY M;  3PUS A;  4R9B A;  4AXO A;  5FDB A;  4NII A;  4LA2 A;  1JW6 A;  1OKO A;  3GBW A;  3VBF B;  2ZAC A;  1WCK A;  3LFM A;  2WFF 2;  1M4W A;  3ORJ A;  3A0K A;  1ODM A;  4K8R B;  5F3E A;  5EHD A;  5F8P A;  5GKA C;  3WDW A;  4K6B A;  1F35 A;  1PGS A;  4CDQ C;  5FYT A;  4BLI A;  4UW5 A;  1MS5 A;  2ZGS A;  1Z7S 1;  3J8F 2;  3MF6 A;  4ONU A;  5J98 B;  3VBO C;  2WIN B;  3JQX A;  1U12 A;  4Q4Y 3;  5LA2 A;  4D0Q A;  5IVF A;  3AZV A;  1QJY 2;  4OI1 A;  5BY5 A;  1YRZ A;  2Q1Z B;  4AI8 A;  2PQS A;  4Q27 A;  2E9Q A;  3J7L A;  3B9I A;  1WLC A;  4IV3 A;  1NQJ A;  4A7K A;  5FRE A;  5A1F A;  2BBV A;  4D7T A;  2FD8 A;  1GZW B;  4KBZ A;  2RMU 1;  4SBV A;  4C0B A;  2DUP A;  1RUJ 3;  3SKV A;  5JLV A;  5GZD A;  4M3C E;  1L7L A;  4LE3 A;  4YGD A;  1MAC A;  4PLN A;  5FY1 A;  3I3M A;  2PHT A;  3RZL A;  1VAK A;  2A6W A;  4LOT A;  2HWB 1;  4LT5 A;  4DIN B;  4GB3 3;  5T52 A;  2PLV 1;  5CVR A;  5F3I A;  2YC2 A;  5C4W C;  3AYC A;  1ZRD A;  2VMG A;  4LHS A;  5FTT C;  5J7M A;  4QGN A;  3OEB A;  4Y24 A;  3VN4 A;  1PO1 3;  4D8M A;  4JAA A;  1C1F A;  4IW3 A;  3MI8 A;  4R4X A;  4QX5 A;  3BKZ A;  3IMN A;  1ULE A;  4AQT A;  1W0O A;  1PK6 C;  2ES3 A;  4AEJ A;  1IOA A;  2W91 A;  1WMF A;  5LY2 A;  5KHJ A;  2A6Z A;  3AMP A;  4YW2 A;  1SBD A;  1KQR A;  4IE5 A;  3LDR A;  1QNW A;  1J1L A;  4FPC A;  2OZ6 A;  3S6P A;  3WG2 A;  1A3K A;  2XR4 A;  2BRT A;  1ZNP A;  2Z79 A;  3AZZ A;  5BNP A;  3R05 A;  2WNU A;  1LHN A;  3ZXD A;  2R06 1;  3VBF C;  4OCT A;  3VBR B;  1X50 A;  3RZG A;  2JDH A;  1OH4 A;  5FXZ A;  1L7Q A;  3VBH B;  4CEY B;  2R16 A;  5FMB A;  1W0N A;  3FE5 A;  1DGW X;  5CKM A;  3CU7 A;  3T08 A;  2OUJ A;  4P9I A;  1CPM A;  4H7L A;  2RS1 1;  4HAN A;  1DYP A;  4JHT A;  4N7I A;  1BVV A;  2HBT A;  1O8S A;  5JVV A;  4XF3 A;  4KNC A;  3KLS A;  3DPR A;  4EV0 A;  2YZ4 A;  4YZ4 A;  1I5Z A;  2QZ2 A;  2ADD A;  1KDM A;  4JC1 A;  4C8D A;  1JYW A;  2CV6 A;  2WKK A;  2JDZ A;  1RVF 1;  1AYN 2;  5D2A A;  3SCG A;  5LEJ A;  1I5P A;  3MPP G;  2Q8E A;  3V0A A;  1D2S A;  5A33 A;  4YM3 A;  1HN1 A;  2JE8 A;  4I09 A;  2BNN A;  2HEY F;  4CCN A;  2D6P A;  3KV5 A;  3KWV A;  3WUC A;  1PM7 A;  5K0U C;  4PJY A;  3ZFF A;  4UWD A;  1Y3T A;  4AI1 A;  5FYZ A;  5FZ6 A;  2VL4 A;  1CX4 A;  4QT6 A;  3NJZ A;  3FHA A;  2VUD A;  3QLQ A;  4XF4 A;  5FZB A;  1Q43 A;  1W99 A;  4Y22 A;  4XUO A;  2ET1 A;  1UMH A;  4ZZ5 A;  3FZ3 A;  3ZLI A;  2J1V A;  5DDJ 1;  3R0R A;  4NHX A;  3KS7 A;  1N3P A;  2QQW A;  2WQ4 A;  1RUF 1;  2AGS A;  2LS6 A;  3ILR A;  4O9E A;  4BA6 A;  1L3J A;  2YYO A;  3NAP A;  2Y6F A;  1XOY A;  3BB6 A;  4COU A;  5CG8 A;  4HET A;  5FK8 A;  2XJS A;  2WNV A;  3VLB B;  5EZW A;  2XVG A;  3AMN A;  2E32 A;  4XDP A;  3OY8 A;  3GZA A;  5KHI A;  3INA A;  2WFF 1;  3R4U A;  2G4I A;  1HN0 A;  4CYD A;  1Z7S 3;  3ACL A;  3IAP A;  4KWU A;  3SLI A;  2QBX A;  4RGA A;  3B69 A;  1S2K A;  4N53 A;  2OKX A;  1SLT A;  2FMY A;  1AUY A;  2Y33 A;  4Q8K A;  3DEC A;  5JUV A;  1UIJ A;  2BZD A;  1GOG A;  4IQP A;  2DUO A;  2HWD 1;  4R9C A;  1STM A;  4GWI A;  3VBR C;  3OOX A;  5L9B A;  3UES A;  5C3S A;  2VCA A;  3VBH C;  4CEY C;  2RMU 3;  3IKW A;  4DO0 A;  1O4T A;  4CCK A;  4MGZ E;  4MZU A;  1R08 2;  2XDV A;  3RFR A;  1W8N A;  1YFU A;  2ZEZ A;  4J25 A;  5DXD A;  3P3P A;  2XUE A;  4COV A;  3KF3 A;  1E5H A;  4HKW A;  3RVH A;  2HWB 3;  4XQ4 A;  1YFX A;  5EJZ B;  3S7E A;  1Y7B A;  1Y4W A;  2PLV 3;  1BCX A;  4RS5 B;  4RD7 A;  1H1M A;  4LBQ B;  4L0P A;  1GFF 2;  2VOW A;  3ZFG A;  2V5D A;  5FLI A;  3QH7 A;  2ZX0 A;  5FZO A;  2UY9 A;  1AYM 2;  4FPY A;  4HOO A;  1JOP A;  1ZA4 A;  3HOB A;  5FLH A;  3B93 A;  5DUU A;  2JDP A;  3HQU A;  1VAV A;  3U1X A;  3MIC A;  4ZZ8 A;  4S2G A;  1S0B A;  4QU2 A;  3WQB A;  1YQ6 A;  4GH4 A;  5FZK A;  2HH9 A;  1JYV A;  5EV7 A;  5JSR A;  1OSG A;  4OI4 A;  1W6O A;  2BU9 A;  3I2I A;  3KD4 A;  4AI2 A;  4EE2 A;  2OUH A;  5FWJ A;  1NCQ A;  4FP3 A;  4ARY A;  5C8C A;  2R06 3;  4W6X A;  3M4F A;  1ND2 A;  3M3O A;  4LTA A;  1V70 A;  4P9J A;  3UJQ A;  3WF0 A;  1O91 A;  4FBF A;  3POB A;  4AWD A;  4E2S A;  4CUA A;  1I3H A;  2RS5 3;  1FX5 A;  4UBG A;  2B8M A;  4B7K A;  2RS1 3;  2FCV A;  2DVF A;  3JBG 2;  3H8X A;  1Q8P A;  3D0J A;  4KU7 A;  1AR9 1;  4IEY A;  1KJR A;  2V73 A;  3GGL A;  3LA7 A;  3TNP B;  3U75 A;  2DFB A;  2OPK A;  3MIE A;  3DKW A;  3ZXK A;  2BWA A;  4MET A;  4QXH A;  3U4S A;  3USU A;  5A6Q A;  1UKR A;  2FCU A;  3HMY A;  3UKT A;  1EUT A;  4X8N A;  4XAB A;  4XBN A;  2ZX1 A;  2VVE A;  2FDF A;  1RVF 3;  2RJL A;  3GJB A;  1REE A;  1D4V B;  4ARX A;  4I3G A;  5TSW A;  1O4Y A;  4LR4 A;  4BE3 A;  1GR3 A;  3I49 A;  4QM8 A;  3U0Z A;  1IG3 A;  3PUQ A;  4CU8 A;  4AAX A;  1NQD A;  5FQ0 A;  4COW A;  5FMO S;  5M0T A;  4YSF A;  5CB7 A;  2QDN A;  1JU3 A;  2D93 A;  3VL9 A;  4RS5 C;  4BQ1 A;  4P08 A;  2QKD A;  2AYH A;  3DYO A;  4ATE A;  2GNT A;  1MZE A;  4Y20 A;  2DCK A;  3OD0 A;  1ZZ8 A;  5DDJ 3;  3VDD A;  1W6N A;  2Q5T A;  1RUF 3;  1YQC A;  4F7Z A;  4ATF A;  2DTY A;  3NJV A;  1R1A 2;  3MIB A;  2ZX4 A;  4XJZ A;  2V5Y A;  2W39 A;  3WNN A;  3ZXG A;  4AI9 A;  3O1R A;  1V6K A;  1WW5 A;  3FHI B;  3KMH A;  2ERF A;  2UYB A;  1DZR A;  2Y6G A;  4FFF A;  2WFF 3;  3VB9 A;  1UOB A;  5LBB A;  2LM3 A;  5H9Q A;  4XHB A;  4A7Z A;  1LUL A;  1NT0 A;  4NMI A;  5HCF A;  1HXS 1;  4Q1R A;  5FR3 A;  5A1L A;  2G9G A;  1CJP A;  1GUI A;  1SMV A;  3B3Q E;  1S1A A;  2HWD 3;  5F3C A;  5F7U A;  4BDV B;  3H3Z A;  2BVV A;  4QQ2 A;  3FX3 A;  2X5I B;  4R9D A;  1POQ A;  2VCB A;  2FQP A;  3WF3 A;  3I97 A;  2VU9 A;  3O1P A;  2D3R A;  1DG6 A;  5JPN B;  4JGZ A;  5F3G A;  1NXD 1;  2GSY A;  3A23 A;  2BYV E;  3MUZ 1;  4GMP 1;  1YUD A;  3GJA A;  2YDE A;  4FOW A;  2NM1 A;  4LUL A;  5FZ3 A;  2O0O A;  5LB6 A;  3VBU B;  1OLQ A;  2ETE A;  3A22 A;  5FP8 A;  4QWN A;  5FRA A;  5GM0 A;  2EIC A;  5GZF A;  1CGP A;  4HL0 A;  3RG0 A;  5EQU A;  1QJZ A;  1YEW A;  2EID A;  2KA3 A;  4FPK A;  4PDW B;  1WA4 A;  3LB9 A;  2RG4 A;  4A3X A;  4CDQ A;  3KGL A;  2CDO A;  1UZ0 A;  3GZU C;  1UY4 A;  4OZO A;  4YLZ A;  1MPX A;  5JIA A;  5I8S A;  3AKS A;  4QQL A;  4Y5S A;  5T5P A;  4BYY A;  4AAP A;  1LJ7 A;  2Z5W A;  5F5C A;  3B02 A;  1Y9G A;  4XJU A;  4XQW A;  1TEI A;  3ZDV A;  1JZ5 A;  4QB6 A;  4MLO A;  4RR3 B;  1XPW A;  2Y64 A;  3JUU A;  1WW6 A;  5E6H A;  4OHY A;  3VHO A;  2VJX A;  1UZV A;  2W08 A;  3GHN A;  4CCM A;  1V6O A;  3BPZ A;  4K40 A;  1HDK A;  1AX2 A;  4B1M A;  5I0R A;  2ZS6 B;  1DIW A;  4AVC A;  1JYX A;  1PZ8 A;  2UWB A;  4IET A;  1UF2 C;  5I91 A;  3C7E A;  4IGP A;  2TBV A;  2QQO A;  2VZT A;  1FMD 1;  1QGL A;  1RUI 1;  1SLL A;  2B7Y A;  3H8O A;  1AR6 2;  3AC0 A;  3T4H B;  1QQP 1;  3CKH A;  5C4W A;  4B7E A;  2MEV 2;  3DF0 A;  2LTN A;  1RMU 2;  1JI6 A;  4FPH A;  4HKL A;  1F9K A;  5SV8 A;  5A1A A;  2XWJ B;  4IEU A;  4IGO A;  4AQ6 A;  1JYN A;  5FXX A;  1UYY A;  1PK6 A;  1AR9 3;  3IWZ A;  1GWL A;  3WP3 A;  3ZMN A;  4XBL A;  2VC9 A;  4KU8 A;  5LW9 A;  1REF A;  3BTA A;  2X5I C;  4Y1V A;  1IQD C;  3N7K A;  1A8D A;  4GZ9 A;  1F5J A;  2G19 A;  1GNH A;  1HJG A;  3OG2 A;  1XSR A;  5G05 L;  2K9Z A;  3ZO0 B;  3NNM A;  1O3S A;  1FAY A;  4YVS B;  4OYU A;  1QMJ A;  1CAX A;  1F5F A;  4ASL A;  4S2F A;  2YFU A;  1TNF A;  4YM1 A;  1YFW A;  4FAH A;  3VBU C;  3RGB A;  4W50 A;  4XCB A;  4W6Y A;  2IXH A;  1QU0 A;  2Q0A A;  1O7F A;  3OPW A;  3ETP A;  1JZ3 A;  3WG1 A;  1ASJ 1;  5IAV A;  3VBF A;  3D0S A;  4LBJ A;  4FO9 A;  2YY1 A;  1C5I A;  4PDW C;  2XLF A;  4JKL A;  3D4K A;  2NMO A;  2JXA A;  3J26 N;  1ZBA 3;  3BN6 A;  3RZM A;  1SLC A;  1OA4 A;  1AF9 A;  1K3I A;  1RUE 2;  1WMX A;  3GYD A;  3POS A;  4W4Z A;  1JHN A;  1GQH A;  1ND3 A;  2P5B A;  1DGR A;  3AP9 A;  1K5M A;  3KT7 A;  1UCX A;  3NNL A;  4B4Q A;  1W6Q A;  4YGC A;  3OGV A;  2V4A A;  1XC6 A;  4RR3 C;  1GSL A;  2UWA A;  3AKR A;  3T4V A;  4MSV A;  5T5O A;  1R1A 1;  2VZ1 A;  2VZS A;  3CNA A;  5DG2 A;  2VBB A;  2XL9 A;  1R09 2;  3WF2 A;  5FPZ A;  4D7S A;  4XHX A;  1GZW A;  4LHL A;  3BGA A;  5F32 A;  3K4D A;  2VNG A;  1J59 A;  1POV 0;  1T6G C;  3SEP A;  3AXE A;  4XUR A;  5JMO A;  2IFW A;  2CGN A;  2VZR A;  3RRD A;  1S0G A;  1H2M A;  2ZEW A;  5FOJ B;  1YWK A;  2EXK A;  1D4M 1;  1S2B A;  3CLP A;  1HXS 3;  2WWJ A;  3PHM A;  5K0U A;  4ASK A;  3K51 A;  1CAW A;  5A3W A;  2ZZQ A;  2GAU A;  5LRR A;  2JDN A;  3IMM A;  3UK9 A;  2EAA A;  3H1M A;  1EPZ A;  3IBM A;  3NKG A;  2XGX A;  3MUY 1;  4FOV A;  4MHR A;  4C1W A;  4DQA A;  2A6V A;  3O0V A;  4GMP 3;  4HBN A;  3AMM A;  1KGY A;  2RDS A;  4IER A;  1N1S A;  2Y6H A;  2Q8C A;  5KWR A;  4WVM B;  2P37 A;  5J09 A;  4GB3 2;  4Q0Q A;  4QPG C;  1XB9 A;  1VBD 2;  2VBD A;  2VQA A;  3O1T A;  4XF0 A;  5I0U A;  2VGD A;  5HV0 A;  4AHX A;  4ISQ A;  4YM0 A;  4AZZ A;  3D6E A;  5DAP A;  2TNF A;  2WYS A;  3ZN4 A;  1PO1 2;  5LWB A;  3VUO A;  4K9S A;  3HT2 A;  1E5S A;  2QQK A;  3SXW A;  3P1I A;  1PZ7 A;  5FBZ A;  4YZ5 A;  1ULO A;  3RZZ A;  5LZ6 A;  2Y8K A;  1GMM A;  4KMQ A;  1DLC A;  3IDE A;  3VBR A;  5FZ4 A;  1N1Y A;  4ZKT B;  1S0E A;  2WRA A;  4LLF A;  4MX3 A;  1BMV 2;  4CEY A;  3A0N A;  3VBS C;  5J36 A;  1GP6 A;  1QXR A;  4B29 A;  1COV 2;  2Y26 A;  5L36 A;  1G9A A;  1WKY A;  1MQT B;  1E57 A;  3KB5 A;  3QH6 A;  1PGL 2;  4M4R A;  1JTZ X;  2ZAH A;  4BIO A;  1FMD 3;  1W9Y A;  2JEM A;  4FPO B;  4LIT A;  5L73 A;  1RUI 3;  1RIR A;  1KS4 A;  3MF9 A;  5FYY A;  1H9P A;  1QJF A;  1QQP 3;  2X53 S;  3A21 A;  4H2A A;  3AKP A;  4QB1 A;  3RJR A;  2E33 A;  3WSO A;  4FOQ A;  4L97 A;  3VKO A;  1RED A;  4QB2 A;  1AR6 1;  1CIW A;  2YBP A;  3OBR A;  5FJH A;  4A6O A;  4DRR A;  3RJ2 X;  3T0D A;  4I0A A;  2MEV 1;  3ZN6 B;  1YHF A;  4CE8 A;  4NUB A;  4BXS V;  1RMU 1;  1RTV A;  2HKX A;  2ZGN A;  3C2U A;  3QD6 A;  1SG3 A;  1X82 A;  3J7M A;  1UN1 A;  4XJW A;  3QOP A;  2DUR A;  1NXM A;  4JKK A;  5FIX A;  2W87 A;  4RFR B;  5FUI A;  4FXK B;  1WWY A;  4XFB A;  5A3L A;  4RGG A;  4BM8 A;  1JZ8 A;  4BIS A;  2BGO A;  3LZZ A;  4C90 A;  1AX1 A;  2IFR A;  2VW1 A;  1S55 A;  2P17 A;  1E5R A;  2ARB A;  1W2O A;  3AL6 A;  1WLT A;  4HXC A;  3AYA A;  3APB A;  1CWP A;  1W05 A;  2WN2 A;  5BNN B;  1MR5 A;  2FMD A;  2DU1 A;  3MW4 A;  3NV2 A;  3WNX A;  1QWR A;  1ASJ 3;  1PNG A;  3VHN A;  1E5I A;  5ABJ B;  1I9R A;  2XUM A;  1EV1 1;  1UW8 A;  2LRP A;  3AB0 A;  4YW4 A;  4LKF A;  2H6C A;  1HW5 A;  1VE0 A;  4ZHN A;  4LQR A;  4CTE A;  1US2 A;  2IXJ A;  2DFC A;  5H9R A;  2YC0 A;  2WO2 A;  4PF1 A;  2C5D A;  3WP4 A;  2J7M A;  3VL8 A;  2RJ2 A;  3CHX A;  4H7M A;  3BPS A;  4LUM A;  1XU2 A;  1RL3 A;  2A73 B;  2VG9 A;  4P5H A;  3I8T A;  4K7J A;  2X10 A;  1YIF A;  1WCU A;  1R1A 3;  4FPF A;  4K20 A;  1CD3 G;  4P9L A;  5DZE A;  3WP6 A;  1LEM A;  1Z7S 2;  2R0F A;  3CEW A;  5EPA A;  1J84 A;  4IE0 A;  2P6C A;  4WM7 C;  1H8T B;  4NR1 A;  4EN6 B;  1R09 1;  3SEE A;  3K2O A;  1C57 A;  2JG8 B;  2DCJ A;  2WSU A;  1MQT C;  2ZEY A;  4M01 A;  4CCD A;  3ACG A;  1BZW A;  4IE6 A;  1D4M 3;  2GP5 A;  4AGG A;  1CR7 A;  1T2X A;  1PX4 A;  2JB8 A;  1PNF A;  4NPL A;  5LBF A;  4X6R B;  4PI0 A;  1BHG A;  4FQ4 A;  5A7W B;  3SIS A;  1VR3 A;  2DCZ A;  2ZGM A;  4NAM A;  4RS5 A;  4AYU A;  5C3R A;  4QHZ A;  1OOP B;  2RMU 2;  3H7J A;  1ENX A;  3TN9 1;  4LBQ A;  5KXE A;  3LF7 A;  4JGZ C;  1DF0 A;  5FMC A;  5FOB B;  3CJI B;  3PUH A;  4BQW A;  1RUN A;  1OPM A;  1W9W A;  1LOE A;  2XLG A;  3E6C C;  5F5Q A;  4NE9 A;  5DUV A;  3SH4 A;  2WAO A;  4XXP A;  3K3N A;  1D0G A;  2VZQ A;  3I3D A;  3MBW A;  4NWV A;  4D69 A;  4M3C A;  1ZZ7 A;  4RFT 0;  1VBD 1;  1HB2 A;  1ONA A;  1QJU 1;  5FPA A;  3U4X A;  5F9T A;  2B4K A;  1XNK A;  4XDQ A;  2DBI A;  2X8K A;  5BNN C;  1NUK A;  3PIJ A;  3HEI A;  4CP0 A;  3ZDS A;  3FLR A;  1LGC A;  1JH5 A;  2WT2 A;  3FBM A;  4I0B A;  5J48 A;  1H2K A;  2DBN A;  1W06 A;  3KT1 A;  4FTE A;  2EVX A;  2ARC A;  3UGG A;  1H6X A;  2KD7 A;  4ZPI A;  3WQ1 A;  3AP5 A;  3PTY A;  5FZ9 A;  3WQ0 A;  4YZ2 A;  4ZU7 A;  3MIG A;  5BNO C;  1JMU B;  2QZ3 A;  4ZS3 A;  4BQX A;  2Z2S B;  4FI9 A;  2CL2 A;  4O7X A;  2OYZ A;  2VUJ A;  5IVJ A;  1COV 1;  1QHD A;  3IDC B;  4N9H A;  4BME A;  4XFG A;  3K48 A;  5JAX A;  2C26 A;  4AVB A;  1UAI A;  2PEL A;  2WR9 A;  3CIH A;  3O1S A;  3PVB B;  1PO2 2;  5IVB A;  2KXL A;  1PGL 1;  1GQG A;  3I3E A;  5KHG A;  4OHV A;  1QF3 A;  1RUD 2;  2BTV C;  1AR6 3;  1IS5 A;  2RS5 2;  3N9N A;  4OZX A;  1D2Q A;  4Z07 A;  4YW5 A;  2RM2 1;  5JMC A;  2GDF A;  3KHC A;  1XNA A;  2D6L X;  2MEV 3;  4TLG A;  2J1U A;  3DYM A;  2JG8 C;  5CIS A;  1RMU 3;  1OUX A;  1AR7 1;  3I59 A;  1SQ4 A;  4YZ3 A;  3WX5 A;  1CAU A;  3Q8C A;  4OUL A;  4DUW A;  2YUE A;  2OXB A;  1OOP C;  1RVF 2;  2DVA A;  5IHR A;  2CY6 A;  1EYB A;  3ZFE B;  2DCY A;  1OF3 A;  4D7Y A;  2JD4 A;  4MXW B;  1KFU L;  3MFC A;  3CJI C;  3ZN5 A;  5CAZ A;  3AX4 A;  2QUO A;  2WNE A;  1BEV 2;  1EV1 3;  3KVA A;  5AC9 1;  2IXK A;  5EYX A;  4COY A;  1CN1 A;  4E4D X;  2GC0 A;  2ZGQ A;  4PI2 A;  4Y4Y A;  1B09 A;  1XYO A;  5CYY A;  4FPE A;  5FWE A;  3I2J A;  1RUF 2;  4BMB A;  3F2Z A;  5FZG A;  1TVG A;  3PME A;  1JZ2 A;  2FDI A;  4YNI A;  5GJ6 A;  2HWF 2;  3OEA A;  5A3U A;  2R1D A;  4FP2 A;  2ID4 A;  3ZYF A;  2RVA A;  5L9V A;  1UNB A;  2VTF A;  4MUV A;  4ZON A;  3THP A;  4JKM A;  4H55 A;  1G86 A;  4LJH A;  1V6N A;  3VZN A;  3WW1 A;  2VBP A;  4TYS A;  1W8U A;  2ZAA A;  1R09 3;  1JZ6 A;  2P3J A;  3H50 A;  2EAK A;  3UJO A;  1LEC A;  2E7Q A;  4HN0 A;  3UL2 A;  1BBT 3;  2AAC A;  3EBR A;  3WHU A;  1XE7 A;  4YW7 A;  2HWD 2;  2V09 A;  2WZ8 A;  3E6B A;  3UKV A;  2NP0 A;  4P9Y A;  1PZ9 A;  5JZG A;  3S5A A;  5D21 A;  1W04 A;  4GAL A;  3FUQ A;  1NLS A;  1OQD A;  5L7O C;  3TWI A;  3FJS A;  3I2H A;  3T2T A;  3TN9 3;  3ZIW A;  4BK4 A;  3VZK A;  2ZOE B;  1PIV 2;  4WZC A;  5AFE A;  5IJR A;  3V56 A;  1FOD 1;  1LHO A;  2WL1 A;  4ORF A;  5CFC A;  1J3P A;  1FAT A;  1Q8Q A;  1MS9 A;  1U5X A;  5IFT A;  4XJ8 A;  1VB4 A;  1VAM A;  3ZYB A;  3HN3 A;  4W6W A;  3UYJ A;  1VBD 3;  1QJU 3;  1AR8 1;  5FZL A;  2AEY A;  4UFJ A;  2C24 A;  3ZFE C;  3AP7 A;  1GLH A;  2CWM A;  2PHU A;  2A5Z A;  2DCT A;  1C1L A;  3OCP A;  4Q0V A;  5APA A;  2R32 A;  1NAE A;  5FZH A;  4OI0 A;  5A3O A;  3N9L A;  1F15 A;  4E8C A;  4YM2 A;  2YMZ A;  3MPB A;  4XAE A;  2OA2 A;  5KHH A;  2PHL A;  3M3Q A;  5BNQ A;  4Q4W 2;  2D6O X;  1OKQ A;  4J1X A;  3FBY A;  1RUC 1;  1W2A X;  1LNS A;  3NNF A;  1BLZ A;  3W5M A;  4XFI A;  2R30 A;  2FZ2 A;  1GU3 A;  1Y43 B;  4CP2 A;  1GV9 A;  1COV 3;  5LBE A;  3GZT B;  3WNL A;  4GWN A;  1DP0 A;  5ERL A;  1ZBE 2;  1W6P A;  1UZW A;  2QFE A;  2WSV A;  4AFB A;  4AI3 A;  5KXD A;  4QPG A;  5FLJ A;  3IAQ A;  1TG7 A;  1A8M A;  3WCR A;  5JCT A;  2GC3 A;  4LK7 A;  2VUA A;  3III A;  1LOG A;  1PO2 1;  1VMJ A;  5FJK A;  4Y5Z 0;  3TBD A;  3I2G A;  2XL7 A;  2GU9 A;  2RM2 3;  2TUN A;  3OUJ A;  3Q8F A;  1GAN A;  3Q8A A;  1RUD 1;  2RS5 1;  4NVP A;  5C7G A;  4Q0U A;  1AR7 3;  1OH3 A;  1SHW B;  1AR9 2;  2WC2 A;  5CFD A;  2UYA A;  3CZJ A;  3LEG A;  4C0H A;  3H1W A;  4CDX B;  4L92 A;  2GH8 A;  3VV1 A;  4AFC A;  1CAV B;  4WVV A;  5C3Q A;  2Y60 A;  1G8W A;  1LOD A;  2MHF A;  3NV4 A;  3VBS A;  4UF0 A;  2FDG A;  3LOB A;  1SLI A;  4AG4 A;  2D7F A;  2YBK A;  4QQO A;  2CDP A;  1W9S A;  1VJ2 A;  1JOJ A;  1ULG A;  1MZ6 A;  5IK4 A;  4CDW B;  5ANN A;  2GN7 A;  1ZZ6 A;  4P14 A;  1IQA A;  2R07 2;  3HT1 A;  5HPO A;  2DVB A;  2OII A;  5AC9 3;  1ZBA 2;  1MVE A;  1NZI A;  3I7D A;  3A4U A;  3LDK A;  4BQY A;  1BEV 1;  2VAU A;  4B3N A;  2J1E A;  2JB4 A;  2XJV A;  2PHD A;  4TLF A;  1W6M B;  1OA3 A;  3Q8B A;  1NX9 A;  4A41 A;  2E6V A;  2VNV A;  3GXU A;  3L2Y A;  4E2G A;  1D7P M;  3ROU A;  1UYX A;  1ZM1 A;  1URX A;  4E27 A;  1UZY A;  2J1A A;  2W1S A;  1BJQ A;  4P9W A;  4KH9 A;  4UFH A;  3JXS A;  3OGG A;  4LBO A;  4PF5 A;  5D8A B;  3RMY A;  3ZIX A;  4D3W A;  2HWF 1;  2BNO A;  4L9B A;  2DU0 A;  4B8E A;  3LDB A;  3C7H A;  4AK3 A;  1DGL A;  5IVY A;  2YRO A;  3UGH A;  3OTF A;  1OXC A;  5EJ3 A;  5A3M A;  1UYZ A;  1W8H A;  4JTO A;  1HXS 2;  3VKL A;  1UXZ A;  3AZY A;  2RDQ A;  3UET A;  4WVM A;  5HV4 A;  4W8J A;  3PVE A;  2CWS A;  2VM9 A;  1RB8 G;  2NN8 A;  1LHV A;  1OFN A;  2ZCW A;  2ZGR A;  2W94 A;  3JD7 1;  3RWN A;  1GQP A;  3IPV B;  3MV0 1;  1NCR B;  2ZJC A;  4KWL A;  1HRI 1;  5FXW A;  2UY8 A;  3KF5 A;  5L19 A;  4CUG A;  3MV1 1;  1OT5 A;  4CEW A;  1DQ6 A;  2GZW A;  1FOD 3;  4PCR A;  5GLW A;  3VGI A;  3WF4 A;  2IXC A;  2ZTN A;  5A80 A;  3WV6 A;  4E4Z A;  1PIV 1;  4FOY A;  1HQL A;  4CDX C;  4FFI A;  1LU2 A;  4Q4V 2;  4AEK A;  3DYP A;  1OUS A;  3B00 A;  4KG0 A;  3V64 A;  1ULD A;  3GBF A;  3WZ1 A;  4WM7 A;  4AED B;  2VZP A;  4AFA A;  4FQZ A;  4QDQ A;  2J22 A;  1AL2 1;  1Y9M A;  5A7Q A;  1JUH A;  2CU5 A;  1AR8 3;  2PAE A;  2ZMN A;  5FYI A;  1W03 A;  3ZPO A;  4EZH A;  1IKP A;  1MQT A;  1QH7 A;  1YQ5 A;  3D5O A;  2ILM A;  3J9S A;  5LA1 A;  1MZ5 A;  3TEZ A;  3POE A;  4RHV 2;  2PHW A;  1G6N A;  4JRA A;  4CP1 A;  1TNR A;  4P00 B;  4UAP A;  2J1R A;  4GJZ A;  2W46 A;  3N35 A;  4V2W A;  4XUT A;  3VZJ A;  4MGT A;  5C6C A;  2E7T A;  5J96 B;  3WDY A;  4WBB A;  4GKX A;  3H0O A;  1GYK A;  1RUC 3;  3I2O A;  2IC1 A;  3WDT A;  4Q4W 1;  3ZOI A;  5GLZ A;  3CJX A;  2RE9 A;  4QGL A;  2ARA A;  5CIR A;  4OUS A;  4EN8 B;  3IM0 A;  4LBK A;  1FMD 2;  3PUI A;  1DLL A;  3J7N A;  1RUI 2;  2ZGP A;  3I54 A;  3LA2 A;  1YNA A;  3O0X A;  3EHK A;  4HVO A;  4XOG A;  3ST7 A;  5CKQ A;  1QQP 2;  3WT3 A;  3S57 A;  1UU6 A;  3SHR A;  2E53 A;  5FO8 B;  1ZBE 1;  3V65 A;  2XH6 A;  1PO2 3;  3H1Y A;  1DZT A;  5FPB A;  3VDB A;  1NY7 2;  5HCA A;  1RUD 3;  4BZ4 A;  5JIU A;  3RDI A;  5I0S A;  1MEC 2;  5EXO A;  2ZGK A;  3OYW B;  1AXY A;  1SCR A;  2SBA A;  2Y0O A;  2ZML A;  4BWO A;  2VO5 A;  2VCC A;  3OPZ A;  1NCR C;  2Q30 A;  3RQ0 A;  1XBF A;  4YG0 A;  5BNO A;  4B4R A;  5JSP A;  3WDU A;  1VBE 2;  3HAG A;  1AX0 A;  5FY4 A;  4NRM A;  4MGY E;  3MGU A;  2YBS A;  1H1A A;  2RV9 A;  3LEM A;  1ASJ 2;  4IE7 A;  5FKC A;  3RYP A;  3U37 A;  3T2Q A;  1Z78 A;  2VMI A;  4KWK A;  3VD4 A;  2P6H A;  2OQ6 A;  4QXC A;  1IS3 A;  4IEP A;  3PU8 A;  4N7U A;  1XXN A;  3U07 A;  3BI3 A;  3LOI A;  1F31 A;  4MG2 A;  2R07 1;  3W20 A;  1DFQ A;  4NPM A;  2ARE A;  3W58 A;  1O6U A;  3BVC A;  1BEV 3;  3THC A;  4KBB A;  4AED C;  4LO7 A;  4BCU A;  1ZBA 1;  4CXW A;  2ARX A;  2PQQ A;  2PFW A;  2LRO A;  2VXR A;  1S4C A;  2AC1 A;  4LEJ A;  4MGS A;  2JG8 A;  3SNM A;  3LKJ A;  4XF1 A;  2AZ5 A;  3THT A;  2RJK A;  3K77 A;  4R9A A;  4X8P A;  3ZYP A;  1XNC A;  2ZA9 A;  5A7W A;  2BFU L;  1QDC A;  1QOT A;  3POW A;  4PHZ A;  4QKF A;  1OA2 A;  5F2S A;  2HWF 3;  3T0B A;  1NE6 A;  4JCK A;  5IK7 A;  1OOP A;  2HEW F;  2YPJ A;  2ENR A;  1V9U 2;  3O7O A;  2R1B A;  4A44 A;  2QDR A;  3ACF A;  3O12 A;  1SLB A;  4E9K A;  1D4M 2;  5FZE A;  5I0T A;  3ZXJ A;  4XQD A;  2A75 A;  4AVS A;  3FMG A;  2EXH A;  3OUI A;  2X05 A;  4CDU B;  5I93 A;  3ZYH A;  2FDK A;  1F4A A;  3JD7 3;  4XMA A;  4P5Y A;  3RZK A;  4D6S A;  2W92 A;  5FYV A;  1NA1 A;  4XAA A;  1HRI 3;  3M3C A;  2P4E A;  4OLL A;  4XZP A;  3S5Q A;  3RI8 A;  1A6C A;  3JCI A;  2ZEX A;  3ZSM A;  4HLT A;  1O8P A;  2P3I A;  4R8H A;  3VKM A;  1G9B A;  2JEC A;  4YGE A;  2WS9 1;  1DU3 D;  1PIV 3;  2BEO A;  1OFS A;  4MV2 A;  2W5F A;  3TRS B;  1ZRC A;  1LOC A;  2QCS B;  3MLK A;  4Z2W A;  5GZC A;  1S0D A;  4Q4V 1;  2R7E B;  4XFH A;  1OLR A;  1YI7 A;  2D3P A;  3OBA A;  4AHW A;  2YC4 A;  2JKX A;  2J1S A;  1AL2 3;  1NKG A;  4DXT A;  3BTY A;  2E51 A;  1QOS A;  4OMC A;  2VW2 A;  2XG3 A;  3VBO A;  3N7L A;  3TOJ A;  4NID A;  1CVN A;  1UD1 A;  3KGZ A;  1LHW A;  4NRQ A;  4MVT A;  4RHV 1;  2LW8 A;  1SAC A;  2PHF A;  2WZR 1;  4HK9 A;  1G9F A;  1ULF A;  3GDB A;  3MIF A;  5L7O A;  2D44 A;  1F4H A;  5CKN A;  4UW3 A;  1KRI A;  1W3X A;  4Y1Y A;  3K3O A;  1IPS A;  2BOI A;  4Q4W 3;  5A32 A;  2ZXQ A;  3WDX A;  4JV4 A;  1C28 A;  5B2G B;  1ACC A;  3NST A;  4QXB A;  5A3N A;  2WYF A;  2YGM A;  3B5L B;  4K8F A;  1R64 A;  4IV3 B;  3CO2 A;  5DZG A;  3ACI A;  1KXG A;  5IVV A;  4IEQ A;  2XHK A;  3LIG A;  5J3U A;  1ZBE 3;  4P9G A;  3DEM A;  2YB7 A;  4OFG A;  2OW4 A;  3OB8 A;  4LIV A;  3QAC A;  4ZU5 A;  4D6R A;  2RDR A;  2NQY A;  1H1I A;  3ZR6 A;  5F5I A;  5KXB A;  4DOU A;  3ZX7 A;  1BVP 1;  2I2S A;  2K2S A;  4LUK A;  1FT9 A;  1NY7 1;  2NYY A;  1RUG 1;  3R6S A;  4CDU C;  2Y0I A;  4QPY A;  2XHN A;  4AVV A;  4YW6 A;  1MEC 1;  1RJ7 A;  1W8O A;  5C3P A;  1V6L A;  1DQ1 A;  1H30 A;  2VME A;  3JB8 A;  5H9S A;  1CIY A;  2XVK A;  4NO4 A;  4HN1 A;  1A34 A;  4HMZ A;  3P5B A;  2WA3 A;  3WVJ A;  4KI5 M;  2W47 A;  1VMH A;  2V4V A;  2DTW A;  3ZSK A;  2GMP A;  1ULP A;  4NJ4 A;  2QQP A;  5JWP A;  1VBE 1;  1YYN A;  4PLO A;  1RUH 2;  1EV1 2;  2QQV A;  4BQ3 A;  3URF A;  3AYE A;  4TWT A;  2VZO A;  2R07 3;  4DXS A;  4AEM A;  1PMH X;  5ACA 2;  1RGS A;  2HJI A;  4QX2 A;  4X6Q B;  3OJB A;  1H9W A;  1NG0 A;  1XJA A;  2JIC A;  1OVS A;  1N47 A;  4IL7 A;  3MYX A;  4QD2 A;  5T54 A;  5BNP B;  1J1T A;  4Y5T A;  2WNU B;  3NWK A;  5AFB A;  5FYU A;  4XVH A;  1ZZ9 A;  2Q4S A;  3VZL A;  3J4U H;  2XJT A;  3LQC A;  3M8L A;  4JVA A;  4CU6 A;  4EN7 B;  2WT0 A;  4Y33 A;  1JHJ A;  1JN2 P;  5C71 A;  2VOK A;  4CXX A;  4FSJ A;  2PTM A;  5H9P A;  4OI2 A;  1PHM A;  1WW4 A;  4RYD A;  3TYJ A;  4XW3 A;  4Y4R A;  4IDZ A;  1V6I A;  3FFQ A;  3ZXE A;  1K12 A;  1OF4 A;  1BBT 2;  1SLA A;  1QH6 A;  1V9U 1;  1N1T A;  4QPI B;  5FO7 B;  5EWS A;  1UOF A;  1W2U A;  4H3W A;  3VD7 A;  3ACH A;  4UFK A;  2I74 A;  2D6M A;  1UU5 A;  2WT1 A;  3H3L A;  4A45 A;  3O5S A;  3TN9 2;  1OVP A;  1QEX A;  2VMF A;  5A33 B;  1UO9 A;  3V0A B;  1K45 A;  5IT6 A;  3I2K A;  3GCW A;  3S0M A;  2W95 A;  2XQX A;  5FYS A;  3ZFF B;  1G9C A;  2WS9 3;  2E31 A;  1LKN A;  4K3U A;  4LBQ D;  4LLO A;  5LBC A;  5JXG A;  3TEW A;  1YCI A;  4Y22 B;  1PVX A;  3LWC A;  2DYC A;  5KHK A;  4CPB A;  3MLJ A;  1S0I A;  2WQ8 A;  4Q4V 3;  4QQH A;  2B9V A;  4Q4X 1;  1QJU 2;  1VBA 2;  4XXA A;  3SC7 X;  3DUI A;  5CBL A;  4RQP B;  3NVC A;  3WY6 A;  3NAP B;  4LPL A;  3BOD A;  4YVS C;  3ZYR A;  4AVA A;  4IEZ A;  4YG6 A;  1J58 A;  2WNV B;  4IXL A;  5A70 A;  1VAL A;  1YO8 A;  5GZG A;  4HKO A;  5EP9 A;  3OY8 B;  4AE2 A;  5FUN A;  3DKQ A;  4FFG A;  4PIY A;  4RHV 3;  2VPV A;  1GKB A;  4NIH A;  1GNZ A;  2WZR 3;  4YFZ A;  3E5Q A;  4HT1 T;  5LA9 A;  4F83 A;  3KCX A;  3RS6 A;  4I0W B;  3RPQ A;  3T1M A;  1QDO A;  3VBH A;  2AEZ A;  3SQO A;  3NJX A;  3TEX A;  5BNP C;  2WNU C;  1QXP A;  3S7I A;  1PM4 A;  2JG9 B;  2VOV A;  3NKT A;  4EWE A;  2Q1F A;  1JXN A;  3I4I A;  4UT5 A;  1F8V A;  3ZKU A;  4Z1V A;  1JOD A;  2B42 B;  2GMM A;  1YLL A;  1C4R A;  5JDB A;  2AH2 A;  5C3O A;  4A7Y A;  3ABZ A;  4BH9 A;  2LAL A;  4MAD A;  2RM2 2;  3HNM A;  3H7Y A;  1US3 A;  4MO3 M;  2C4X A;  4TTG A;  2EA7 A;  2RHP A;  4QPI C;  1AR7 2;  4XUP A;  1RC6 A;  1N1V A;  1KJL A;  1KFX L;  3PVO A;  1IS4 A;  2L9L A;  4NHM A;  4YW3 A;  1WD3 A;  1X7N A;  3TEY A;  3PIG A;  2QQM A;  3NV1 A;  1RUG 3;  4I2O A;  2ZGO A;  1MEC 3;  2HYK A;  4Y26 A;  4IEO A;  3U10 A;  3N7M A;  3ZSJ A;  4E8D A;  4AVT A;  1GZC A;  4ERO A;  1LAJ A;  5FYM A;  5LK5 A;  2H6B A;  3ZFG B;  1GP4 A;  1YFY A;  3ATG A;  4IUG A;  3UNP A;  2CGP A;  4FCA A;  2OVU A;  1W6M A;  4Z82 A;  5FZO B;  4XET A;  1X9P A;  1DBN A;  2TEP A;  3QBQ A;  1OHF A;  1VBE 3;  2D5F A;  3ZFF C;  3W5N A;  4FPG A;  1SFY A;  5DUW A;  5FMD A;  2PN5 A;  4XTM A;  5AC9 2;  2JKB A;  5DZF A;  4GH4 B;  1RUH 1;  3KV4 A;  3ZYG A;  1ZZB A;  3FLT A;  1O4Z A;  3W9A A;  3T2P A;  4Z2A A;  5BYN A;  4I01 A;  5IVC A;  4Q8L A;  3DXU A;  5E89 A;  4YG3 A;  3UT0 A;  4COZ A;  5K7P A;  4RQP C;  1VPH A;  1SCS A;  5ACA 1;  1NCQ B;  3NAP C;  5GLU A;  2BBA A;  1DYO A;  1TZO A;  4JGY B;  4BHP A;  1LCL A;  1UWW A;  2UU8 A;  4K1Z A;  5C8C B;  2Z42 A;  4D6Q A;  3LEK A;  5FZM A;  2VTX A;  3PUA A;  3HJR A;  4EJR A;  2JDK A;  2WZE A;  3D8C A;  1JYC A;  1POV 1;  3IPV A;  1FPN 1;  1V0A A;  2DVD A;  4ET7 A;  1RXG A;  1HRV 1;  3RMX A;  3WNK A;  1SFP A;  5FBJ A;  2DWR A;  4NHY A;  1V9U 3;  5C33 A;  5JOX A;  1RIT A;  4Q26 A;  2JG9 C;  3WNM A;  1YJL A;  5FMO L;  4C1X A;  1BBT 1;  1GIC A;  2IZW A;  3DXT A;  5FZD A;  5JXJ A;  2IVJ A;  5LA0 A;  3BTX A;  1XND A;  2WN3 A;  5A6Z A;  3SMH A;  4AED A;  1CES A;  1UKG A;  3VKN A;  1PGW 2;  4PLM A;  1HV1 A;  3WG3 A;  1WMD A;  4LO4 B;  2NPI A;  4DEV A;  1FOD 2;  4BQ4 A;  5LY1 A;  4NN0 A;  4ASM B;  5JR7 B;  1JUI A;  2VVD A;  5FQ0 B;  3POI A;  4WV8 A;  4AI0 A;  2XPJ A;  1VRH 2;  4AGV A;  3CL1 A;  1CPN A;  5B4N A;  3AFK A;  4HSJ A;  4GWJ A;  4Y20 B;  3PUR A;  1H4H A;  3H8U A;  4TSV A;  3W21 A;  5LK7 B;  2BGC A;  1AZD A;  2A3Y A;  3RYR A;  4Q4X 3;  3VDD B;  1AR8 2;  1W6N B;  3K4Z A;  4QMA A;  3ZFG C;  1NZC A;  5FY5 A;  3WHT A;  2AUY A;  2W3J A;  2GAL A;  1KDK A;  1VBA 1;  3VDA A;  3D82 A;  1WA6 X;  5A3P A;  4UYB A;  2F17 A;  4N43 B;  3OGJ A;  4HG6 B;  1CZV A;  3ZSL A;  1NYW A;  4HSL A;  4P9X A;  4LHK A;  1DHK B;  2Y34 A;  2ZGU A;  1A78 A;  4QX8 A;  3C8X A;  3NV3 A;  2BOJ A;  2Z4F A;  4GH4 C;  1RYY A;  4EN0 A;  5ABJ C;  5C70 A;  2QQJ A;  1GZT A;  3MZH A;  1RUC 2;  1W90 A;  2QVS B;  2YFZ A;  3ZKY A;  3NQH A;  4ZXE A;  1GOH A;  4XUQ A;  1QKQ A;  3FL7 A;  5DAW A;  1NCQ C;  3N9O A;  4LNV A;  3ZR5 A;  4IE4 A;  4JGY C;  5C8C C;  1AXK A;  3MFA A;  2B46 X;  5FXV A;  1OMI A;  2XBO 2;  2D97 A;  4JDM A;  1UPS A;  4U36 A;  1HQW A;  4N8M A;  4QX7 A;  4XIO A;  2RR1 1;  2F4P A;  4M0N A;  3BU7 A;  4JGZ B;  5FZA A;  3THD A;  1JZ7 A;  2JIJ A;  1H8V A;  4UFL A;  3CF6 E;  1WGP A;  2B5H A;  4QKN A;  3WG4 A;  4CPB D;  2VVF A;  5DUX A;  1I6X A;  1DQ0 A;  3AMQ A;  4FT8 A;  1H8T C;  1IS6 A;  3U14 A;  4EYU A;  3N9M A;  1ZRR A;  4QKD A;  1PVC 1;  2V72 A;  3I2D A;  3CDZ B;  4CDQ B;  3T09 A;  4UBH A;  5JOW A;  3KQR A;  1GNY A;  4MOA A;  4IEX A;  4PBO A;  3O1V A;  3WUD A;  2BPA 2;  1JBC A;  3KV6 A;  1GBG A;  3BYW A;  4S2H A;  5KBF A;  5BUV A;  2FBE A;  3RZH A;  5A6X A;  4DZG A;  1TMF 1;  1QIQ A;  4HPK B;  1VIW B;  4UI9 L;  4DXZ A;  4FAG A;  5I8T A;  4J1W A;  2RS3 1;  4FFH A;  2OPW A;  4F3J A;  5JSO A;  2KM2 A;  3ILF A;  4JQR A;  2GN3 A;  3N4M A;  4NOT A;  4QHB A;  5FPL A;  2FDH A;  2MNG A;  3LE0 A;  2E63 A;  4O61 A;  5FZ7 A;  3VD3 A;  1RUH 3;  3KM5 A;  4BIF A;  2VXJ A;  2QE3 A;  4LA3 A;  2D6N A;  3HIF A;  4XFF A;  4QXK A;  1SPP B;  2BUK A;  3DV8 A;  3IIA A;  4I3P A;  5ACA 3;  4XC9 A;  2UWC A;  2A3X A;  3O14 A;  1VB2 A;  2JJ6 A;  4N43 C;  3S30 A;  5FYC A;  4K21 A;  1OPO A;  1CON A;  3OUH A;  5F5A A;  4YRD A;  4YWA A;  5IUQ A;  5F37 A;  3R4S A;  2X09 A;  1Q56 A;  1CZT A;  1EAH 2;  1POV 3;  1RIN A;  1FPN 3;  4I02 A;  2X5I A;  4JRL A;  4XFC A;  3T30 A;  4HVQ A;  2I45 A;  3T2O A;  1HRV 3;  3NNG A;  1X8E A;  4M0H A;  4YFW A;  2BQP A;  3N7J A;  4Q1P A;  1Q8V A;  1XQN A;  4QGM A;  3WR0 A;  5FO9 B;  2FDJ A;  1PK6 B;  3GHM A;  4XZU G;  4RSU A;  4KL1 A;  3U78 A;  3VBU A;  2CTV A;  3HPN A;  3KT4 A;  3L9J T;  2ATF A;  4AFM A;  4CP9 B;  4CVU A;  2P1B A;  3AP4 A;  1MS1 A;  1IGO A;  1AXZ A;  3JD7 2;  1HB4 A;  1SDD B;  3H9A A;  4PDW A;  1W28 A;  3MDP A;  3MO4 A;  1HRI 2;  4OMD A;  1ZYB A;  4QX0 A;  4B4P A;  1FYU A;  2G9F A;  1BYH A;  2JX9 A;  3O1U A;  1TME 1;  1S0J A;  1HB1 A;  1PGW 1;  3BOW A;  2D6K A;  2A1X A;  3C7F A;  4QQP A;  3RSJ A;  1I1E A;  4Q2F A;  2VQU A;  4O65 A;  4AHY A;  5KR7 A;  1JZ4 A;  4RR3 A;  3NNJ A;  1QJX 1;  3NW4 A;  1SFN A;  3HVD A;  4A2U A;  1VRH 1;  1ZRI A;  4YPJ A;  1AL2 2;  4KGQ A;  1ND3 B;  3WNO A;  1NLQ A;  3ME2 A;  3OGS A;  4Q0P A;  1K5M B;  3WCS A;  3OF1 A;  5DN2 A;  1AJO A;  4AQS A;  1W6Q B;  4DNY A;  4DY5 A;  1VBA 3;  3AKT A;  4CCC A;  1O3R A;  4BLJ A;  4YGB A;  3ZYI B;  4O9G A;  1UYP A;  2VQ0 A;  1GOF A;  5HI0 A;  4AHZ A;  4BU2 A;  1W8F A;  2H0B A;  1W3V A;  1W8T A;  2QQU A;  2J1T A;  3IDA A;  3ZM8 A;  3ILN A;  1C3H A;  5LRS A;  2SLI A;  2HWC 2;  3M3I A;  1DQ4 A;  2WII B;  4NHK A;  4CU7 A;  5LCW L;  5K0U B;  5BV6 A;  1YJK A;  5SV5 A;  2VMH A;  1CAW B;  3O1O A;  3V0B B;  3FC0 A;  1UIK A;  3N3H A;  1Q8O A;  2DUQ A;  4IES A;  3ELN A;  3BOP A;  1RXF A;  3LCP A;  1J3Q A;  4AFD A;  4JQT A;  2ZX2 A;  4V1P A;  2RR1 3;  2EAL A;  2XBO 1;  2ORX A;  2R04 1;  5DAB A;  4WVZ A;  3BU0 A;  4MGI E;  2GNB A;  4YVS A;  3CQO A;  1X33 A;  4K1Y A;  3TAY A;  1PVC 3;  2NZ9 A;  3AXD A;  5FZ1 A;  3K4A A;  1AL0 G;  5T3N A;  2XLA A;  1V6J A;  1CX1 A;  1WW7 A;  2WFP A;  1RHI 1;  4ES9 A;  2FHR A;  5E88 A;  3WNP A;  1TMF 3;  2N7G A;  2PHR A;  2RS3 3;  2VNO A;  3KV9 A;  5GLT A;  5IFP A;  4TN7 A;  4PBP A;  1S0F A;  1IPJ A;  2F4L A;  1O5U A;  3ES4 A;  3SIT A;  1U5Z A;  4DY3 A;  4JDO A;  5A7O A;  4EWD A;  5JOZ A;  3E1F 1;  2HBU A;  1U0A A;  2EIG A;  3PLQ A;  2JEN A;  2W1Q A;  2VW0 A;  3PJQ A;  2VNR A;  4GKY A;  1C8M 1;  5IVE A;  1ND3 C;  5C9A B;  1W9T A;  2G9Z A;  1U5I A;  1K5M C;  3A7Q A;  2A7A A;  2HEV F;  4QPI A;  4R4Z A;  1LOB A;  2G1M A;  3IN9 A;  2WNO A;  4L99 A;  4NPR A;  3UV9 A;  3R4D B;  1JYT A;  1SEF A;  2QQL A;  4NAO A;  1X9T A;  4XAC A;  3OBZ A;  4KG8 A;  3PMS A;  5F1R A;  2VEC A;  1B35 B;  2D98 A;  2J42 A;  3ES1 A;  5E16 A;  3VZO A;  1V6M A;  3KHB A;  2XJP A;  4LMF A;  1ZA7 A;  2P3Y A;  5FP7 A;  5IWF A;  1EAH 1;  5CAD A;  5A3T A;  1WCD J;  5BXX A;  2OZJ A;  2YU2 A;  4YVW B;  5C5U A;  2BDR A;  4BB3 A;  1IHM A;  1MS0 A;  2OX0 A;  3HQX A;  3BIW E;  3SKJ E;  1H2L A;  2ET7 A;  2VMD A;  4XCA A;  1EPW A;  1VLN A;  3VZM A;  3O0W A;  5FP9 A;  3POJ A;  1ENQ A;  1ZVF A;  2WBK A;  4Q29 A;  5BPX A;  3POY A;  4RQP A;  2BER A;  2O1Q A;  4H14 A;  4ITC A;  1TME 3;  4IV1 B;  4DEQ A;  4F8A A;  5FKB A;  4CU9 A;  5DQ0 A;  2WS9 2;  2W9X A;  4JTN A;  1BKZ A;  4DUX A;  4IEW A;  5FPX A;  5CNA A;  3E6D A;  2QQI A; 
#chains in the Genus database with same CATH homology
 4NUB A;  2Q8E A;  5FV3 A;  3K3O A;  3N9N A;  5LW9 A;  2OT7 A;  4CCN A;  3KV5 A;  5ANQ A;  5FY9 A;  4QX8 A;  4XDO A;  4QXB A;  5A3N A;  5FJK A;  5FPV A;  5FYZ A;  5FZ6 A;  4BIS A;  5FZB A;  4V2V A;  3AVS A;  3PUQ A;  2OQ7 A;  3N9Q A;  4BU2 A;  5IVV A;  3PUS A;  3OPW A;  5FPB A;  5F2W A;  3AL6 A;  3N9O A;  3ZLI A;  4HON A;  4IGQ A;  4Y3O A;  4LIV A;  4D6R A;  5F3E A;  5FZ0 A;  5F5I A;  5FXV A;  4UF0 A;  2PXJ A;  5FYT A;  4QX7 A;  5FP3 A;  2YBK A;  3NJY A;  3PU3 A;  5FZA A;  4XDP A;  3LD8 A;  5CEH A;  4E4H A;  5FUP A;  4CCO A;  2P5B A;  3KVA A;  4AI9 A;  2VD7 A;  2YPD A;  5FY4 A;  4EYU A;  3N9M A;  5FY7 A;  5IVF A;  2YBS A;  5FWE A;  4LIU A;  3PDQ A;  5FYM A;  2OQ6 A;  4QXC A;  5A1F A;  3PU8 A;  5FZG A;  3KV6 A;  5F32 A;  5FZ1 A;  5K4L A;  5FZO B;  5IVC A;  5A1L A;  5F3C A;  1VRB A;  5FY1 A;  5A7S A;  3OPT A;  4URA A;  2WWJ A;  4DO0 A;  2XML A;  3K2O A;  4CCK A;  4GD4 A;  4ASK A;  2YU1 A;  3KV4 A;  2XDV A;  5A3W A;  2GP5 A;  5F3G A;  3KV9 A;  5FZC A;  5FPL A;  5FZ3 A;  2XUE A;  5F3I A;  4GAZ A;  4TN7 A;  5FZ7 A;  3DXU A;  3LDB A;  5A7W A;  3RVH A;  5F2S A;  5FYU A;  5FYB A;  5IVY A;  5FP8 A;  5A7W B;  4DIQ A;  4QWN A;  4Y33 A;  5A7O A;  4D6Q A;  5FZM A;  2Q8C A;  5F39 A;  3PUA A;  2GP3 A;  5FZE A;  5IVE A;  4Y4R A;  5FPU A;  5FYC A;  5F5A A;  5LY2 A;  5FZO A;  5F37 A;  2XXZ A;  5FZF A;  4HOO A;  4AAP A;  3KVB A;  5F5C A;  5FYH A;  3K3N A;  3PTR B;  5FBJ A;  5FXW A;  4EZ4 A;  3AL5 A;  5LWB A;  4CUG A;  4LXL A;  4QU1 A;  2Q8D A;  4CSW A;  4D6S A;  5FYV A;  5FZK A;  5E6H A;  5A80 A;  5FPA A;  3DXT A;  5FP7 A;  5IWF A;  5FZD A;  2OS2 A;  5FZ4 A;  2WWU A;  5A7N A;  3U78 A;  3UYJ A;  4CCM A;  5A3T A;  5FZL A;  2YU2 A;  5FWJ A;  5FXZ A;  4BXF A;  2W2I A;  2OX0 A;  5FYS A;  5A7Q A;  4EZH A;  3ZPO A;  5FZI A;  4IGP A;  5FZH A;  5FP4 A;  5FYI A;  3N9L A;  5FZ8 A;  5IW0 A;  5LY1 A;  4CCJ A;  5FY8 A;  5FZ9 A;  5FP9 A;  4GJY A;  4GJZ A;  4V2W A;  4LIT A;  5IVJ A;  5FYY A;  3PUR A;  4CCL A;  4C8D A;  5FY0 A;  4UF0 B;  5KR7 A;  3AVR A;  5FJH A;  5FY5 A;  2YBP A;  5IVB A;  5ISL A;  4IGO A;  4QXH A;  5A7P A;  3U4S A;  5FXX A;  3N9P A;  5A3P A;  5FUN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...