4FAGA

Crystal structure of the salicylate 1,2-dioxygenase from pseudoaminobacter salicylatoxidans w104y mutant in complex with gentisate
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
362
structure length
362
Chain Sequence
LDHESVTQAMQPKDTPELRALYKSFEEESIIPLWTQLGDLMPIHPKSKAVPHVWKWSTLLRLARKSGELVPVGRGGERRALGLANPGLGGNAYISPTMYAGIQYLGPRETAPEHRHSQNAFRFVVEGEGVWTVVNGDPVRMSRGDLLLTPGWCFHGHMNDTDQPMAWIDGLDIPFSQQMDVGFFEFGSDRVTDYATPNFSRGERLWCHPGLRPLSGLQNTVASPIGAYRWEFTDRALTEQLLLEDEGQPATVAPGHAAIRYVNPTTGGDVMPTLRCEFHRLRAGTETATRNEVGSTVFQVFEGAGAVVMNGETTKLEKGDMFVVPSWVPWSLQAETQFDLFRFSDAPIMEALSFMRTKIEGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gentisate 1,2-dioxygenase
publication title The generation of a 1-hydroxy-2-naphthoate 1,2-dioxygenase by single point mutations of salicylate 1,2-dioxygenase - Rational design of mutants and the crystal structures of the A85H and W104Y variants.
pubmed doi rcsb
source organism Pseudaminobacter salicylatoxidans
molecule tags Oxidoreductase
total genus 98
structure length 362
sequence length 362
ec nomenclature ec 1.13.11.4: Gentisate 1,2-dioxygenase.
pdb deposition date 2012-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4fagA01
4EWAA 5FLIA 5KHJA 3QACA 3ST7A 5LRSA 4CYDA 3RPQA 2E9QA 3B02A 2QDRA 4MGYE 4E2SA 4HZFA 4IEUA 1PMIA 1U12A 2UYAA 1I5ZA 3L2HA 4HVQA 4I3PA 2IXKA 3HT1A 3OF1A 4MV2A 3RNSA 4IEPA 3GYDA 5EZWA 2Q1ZB 1DGRA 2EA7A 4XETA 4XF1A 3FX3A 4Q0PA 1V70A 2IXLA 3H7YA 4JTNA 4N9HA 2B8MA 3NW4A 2UY8A 3TNQA 2P17A 3H3UA 1NE4A 4I0AA 3KGZA 3E97A 3RYKA 1H1MA 3G7DA 5I0TA 3RZZA 4AQ6A 1WA4A 5KHKA 5D1IA 1VP6A 3SCGA 1CAWB 3H50A 4QM8A 2ZCWA 5FQ0B 3IDCB 4L2NA 5KHHA 3UKVA 3U10A 1NXMA 1O5UA 1VJ2A 3FWEA 3SHRA 1O3TA 1ZX5A 1FT9A 3U0ZA 2PHLA 4MGIE 2IC1A 3I59A 4JVAA 5FLHA 1RGSA 4I01A 1RC6A 3EHKA 4QM9A 4J1XA 1ZZ7A 2D5HA 2VQAA 4LUKA 4QMAA 4BH9A 3KMHA 5I0UA 1CGPA 4PJYA 2GU9A 1UCXA 2QVSB 4AVBA 1DGWA 2DCTA 3E5QA 1EYBA 4IEQA 2BYVE 3FFQA 1CAVA 1X7NA 2CAUA 5JCTA 5I93A 2GZWA 3HIFA 4HMZA 2QNKA 1YFYA 4KWJA 2XKPA 3LA7A 1GQHA 1X8EA 4XFBA 1Y9QA 1QWRA 3BPZA 4FT8A 4QGLA 2MNGA 1FXZA 4IEYA 1UW8A 5JSOA 1SQ4A 3H1YA 3D0SA 1IPKA 1NZCA 4I09A 1Q5OA 4B29A 4ZU7A 4QXKA 5EFUA 2IXIA 3S0MA 1OI6A 1CX4A 5I8TA 3H1WA 4AVAA 2OZJA 4IETA 2CAVA 2BNMA 5K8SA 2OPKA 1ZRFA 1YFUA 3E5UA 2PAKA 3I54A 4HBNA 5T3NA 2O1QA 3USSA 3OGJA 1QY4A 1LKNA 4OLLA 3RYPA 4YNIA 4OFGA 4A2UA 1XE7A 5JSPA 1J1LA 3CF6E 4ONUA 4UBHA 3EQEA 3MZHA 3MPBA 2O8QA 3KGLA 4Q0QA 4Q0SA 3IIAA 3S7IA 4AVCA 1YFWA 2BNNA 4QGMA 1WGPA 3ACLA 3PNAA 1ZREA 2F4PA 1ZZCA 3ES4A 2HKXA 1O7FA 3KSCA 4P9GA 1JUHA 4HN0A 4WVZA 5E16A 5I8YA 1J58A 3DV8A 5C6CA 1DZTA 3HQXA 1QXRA 2XKOA 5CU1A 1NE6A 2B5HA 4AXOA 5FCCA 3WW1A 2CV6A 1O3SA 5LRRA 3SCHA 3H9AA 4I2OA 4J1WA 3NKTA 4D7SA 4BHPA 1O3QA 3NJZA 1YLLA 3H1MA 4X6RB 4WBBA 3I59B 4XF4A 3D0JA 3E5XA 3CJXA 1L3JA 4YARA 5FDBA 2PA7A 1EPZA 4PIZA 2EVXA 4R52A 1I6XA 4XF3A 3BALA 3CO2A 4UXAA 1ZZ8A 3ZDSA 5CVRA 2Z2SB 4K8FA 1J3PA 3CLPA 1XE8A 3I7DA 2H6CA 5JAXA 3EBRA 2GC1A 3FJSA 4AQ2A 3MYXA 1CAVB 3OD0A 5AVPA 1X8MA 3FE5A 3LWCA 4Z82A 4IEZA 2XLGA 3E6DA 4JV4A 4XF9A 5KHGA 5KHIA 1G6NA 1IPJA 3ETQA 4F7ZA 3LOIA 2UYBA 3HT2A 2QJVA 2D40A 3NL1A 3PLQA 3GBFA 3LAGA 3FHIB 3H8UA 5I8SA 5FPZA 2XHKA 4PIYA 4MZUA 4XFHA 4KL1A 1ZZ9A 2FQPA 4LA3A 4F8AA 4H7LA 1OD5A 1Q43A 2Z69A 2PAMA 4HLTA 1YUDA 3QOPA 3BB6A 2XL9A 3NVCA 3SMHA 2PFWA 1EY2A 4XF0A 1O3RA 4LUMA 4I02A 3BCWA 3LA3A 1Y3TA 2MPFA 2ZKLA 1ZRCA 1DZRA 3OCPA 3WW4A 1CAUA 2C0ZA 2D5FA 4Q0VA 2IXCA 3TNPB 3PVBB 4N9IA 3DKWA 4IEWA 4IEOA 4LEJA 4FBFA 3S7EA 3LZZA 4EROA 2UY9A 1J3RA 3ROUA 3IWZA 1OMIA 2I45A 3E6BA 5BXXA 4MGKE 5I91A 5JSRA 3SXWA 3R6SA 5BV6A 4HSLA 3ELNA 1X82A 1RL3A 1PM7A 4NVPA 4MX3A 5BUVA 4XEZA 2XLFA 3DL3A 2EAAA 4IEXA 2MHFA 4XFGA 3M70A 1TQ5A 2IXHA 3C3VA 5BPXA 1NYWA 1LB2A 2GC0A 4EWEA 2N7GA 3IBMA 4DINB 5J48A 3CEWA 3KCCA 3M3IA 1YWKA 1EP0A 4MGZE 3NSTA 5LEJA 2D93A 1RUOA 4LA2A 3CL1A 2ET7A 4O9EA 5C8WA 4KWKA 5J7MA 4WZCA 5FPXA 2Q30A 1YHFA 4EWDA 1UD1A 4HSJA 4EV0A 1ZZ6A 2BNOA 4LTAA 2PAEA 2HJIA 4GULA 4YSFA 2XL7A 3LA2A 4PIXA 1XRUA 3FZ3A 1O4TA 3H7JA 5I0SA 4HVRA 4X6QB 5JR7B 3UKNA 2IXJA 2BGCA 4KWLA 4XFFA 1LR5A 2GC2A 2OA2A 4R8HA 1CAXB 4RD7A 4D7TA 5J3UA 5F1RA 2Q0AA 1SEFA 5E1RA 4FAHA 2PYTA 2Y0OA 2CGPA 5KBFA 2PHDA 4META 5CADA 2Q4SA 2V09A 2KXLA 2K9ZA 4MH0E 4XFAA 4YRDA 5LEKA 1FI2A 2OZ6A 5HI0A 1QXJA 1CAXA 3ES1A 2GAUA 3JZVA 4QGNA 2ATFA 1HW5A 1WLTA 1RUNA 2H0VA 4IEVA 2BEOA 2WC2A 2XLAA 4XFCA 1CAWA 1CAUB 4BYYA 4XFIA 5FQ0A 1SFNA 2ETEA 4O9GA 3EJKA 2B9UA 4Q29A 1UPIA 4HVOA 1ZVFA 2GC3A 4IERA 1ZRDA 3O14A 2VPVA 5FLJA 5I0RA 1J3QA 2K0GA 1GQGA 2QCSB 2VECA 1H1IA 3MDPA 3OTFA 3BU7A 3SCFA 3IDBB 4IESA 2OYZA 1Q3EA 4BIFA 5BY5A 1YFXA 4Q0UA 3UKTA 2ET1A 2H6BA 3U11A 2PTMA 1J59A 4I0BA 4Z07A 3H3ZA 1UIKA 2PQQA 3DN7A 4E2QA 4LLOA 4JTOA 1RTVA 4KU7A 4YYOA 4MUVA 3D82A 2XGXA 2FMYA 4HN1A 4TLFA 1ZZBA 4LULA 1VR3A 1UIJA 4L11A 2GH2A 3WW2A 1O5LA 3WW3A 3VHRA 4QX5A 4ZU4A 4KU8A 1ZRRA 4ZU5A 3RDIA 4FAGA 3EO6A 1OFNA 1LRHA 3E6CC 4UBGA 3N4MA 4ORFA 2WFPA 4E2GA 3RYRA 1ZNPA
chains in the Genus database with same CATH superfamily
4XBQA 4PBPA 5C9AB 1BCXA 2VE1A 3LE0A 2RG4A 4WVVA 1REEA 5KHJA 2W1QA 4BXSV 5ACA2 4L99A 3POJA 5FY5A 5LRSA 1GOFA 4RFT0 4YM3A 3OBZA 1LJ7A 1UPSA 3LDKA 1DG6A 1PMJX 4XOGA 3N7MA 4CUBA 4B1LA 3VBRB 1GZTA 4FPCA 4AAPA 4CCNA 3KT1A 4IEUA 4XACA 4NPRA 5FY4A 4Q26A 1GZWB 1UOFA 2R043 4BCUA 2VOTA 2H0BA 3ZVXA 5GLWA 3K3NA 3IIIA 3HJRA 4IEPA 2WO3A 5FUPA 2P6CA 1DGRA 3ILFA 1B35B 2G1MA 2HWF3 4I3GA 4ZHNA 5F8PA 1RUC2 1WD4A 2Y6KA 2QDNA 1RUC1 3AKTA 4N9HA 5FY7A 3S30A 2B8MA 3VBRA 4NIGA 3NW4A 2B42B 3VZJA 2UY8A 4RL7A 5FZ8A 3TNQA 2LUWA 3VBUB 4KG0A 5GLVA 1G9CA 2P17A 3H3UA 1NE4A 2EAKA 2W39A 4MLOA 1ND2C 3C7OA 4QPIC 4GXLA 3AMMA 3G7DA 1G8WA 4Y1XA 1WA4A 3MLJA 2Q8OA 3RZZA 3ZFEA 4QT6A 3GCWA 4JGYA 1VP6A 4BIOA 1CAWB 2ADEA 4QM8A 2FZ2A 1JYTA 3WF4A 5FJHA 3MEPA 3IDCB 1O4YA 1MPXA 2PLV2 3AJZA 4L2NA 5IFTA 5KHHA 2Y64A 2B4KA 2PLV1 4JGZA 3UYJA 2R1DA 2RMU3 3ASIA 1JBCA 2D6OX 4XVHA 4WM7C 3ZKYA 2ERFA 4ZS2A 5FMOS 5HCFA 3AB0A 3MFAA 1NG0A 4MHUA 2IC1A 4MOAA 1W8WA 1TE1B 2VCBA 1RXGA 1V6JA 1JHJA 1ZBA2 5J37A 1ULGA 3O0WA 2E33A 3IAPA 1GFF2 2V73A 1ZBA1 3LPFA 3VD5A 2D5HA 2VQAA 4Q5OA 4LUKA 4QQ2A 4QMAA 1SLTA 4YVWC 2YYOA 4FPLA 4FPGA 4PJYA 1N1VA 3AXEA 5FWEA 2GU9A 3M1HA 4E8CA 1D4VB 4D3WA 3VBSB 2RM23 3BU0A 1QOOA 1GBGA 3E5QA 3P5BA 4PF5A 2WNUA 2X29A 5J09A 1V6KA 3IB3A 2P1BA 3DCQA 3POFA 4N43B 2CAUA 3ENRA 5FP4A 1S0GA 3GZUC 4URAA 1YFYA 5F5AA 2WUHA 4YZ4A 5FIXA 1X8EA 1VLNA 4NR1A 4Z2WA 3IZOA 1MACA 3OEBA 4RN5A 3ZYIB 2FCVA 3KS7A 4GZ9A 2VBPA 1ZYBA 1NT0A 1NQJA 2ORZA 4IUGA 4QHBA 3T2OA 3RMYA 4Y4YA 3D0SA 1CJDA 5FZOA 1IPKA 1U5IA 1H1AA 4I09A 5I0DA 1N3QA 1Q5OA 1S0IA 1V6LA 1LHWA 3C7GA 4B29A 4ZU7A 4C0BA 3H8OA 1OC1A 2JB4A 4QXKA 5FMCA 2IXIA 1OI6A 1OQEA 1QJY2 1WLWA 3IPVA 4WM8B 2OZJA 1QJY1 1QH6A 3RI8A 1DQ5A 4FPFA 3MV11 2JX9A 3N3HA 5D21A 1WKYA 2C9AA 4XDQA 1YFUA 2VZUA 4HPKA 1S4CA 4UOJA 3THPA 3E5UA 2PAKA 2JDYA 3I54A 3LCPA 1RITA 4BJ0A 1GR3A 2O1QA 2RDNA 1W6QA 2RJKA 4Q4W3 1LOFA 2XQXA 3OGJA 1LKNA 2VCCA 1Z0HA 5CIRA 4OFGA 3UJQA 3AK0A 3VKNA 1OXCA 1XE7A 4P00B 5FYBA 3TEWA 2IVJA 1MZ5A 3DECA 3HAGA 3AYAA 3M8LA 4FFFA 3R05A 1Z7S2 4Q4V2 5BNOC 4GWJA 1NA1C 3KGLA 1OPOA 1Z7S1 4Q0SA 4Q4V1 2AACA 2RS33 3S7IA 4MHRA 5JXGA 4XUQA 4MG2A 4QGMA 1WGPA 4L8QA 5H9PA 2RV9A 2FBEA 2WJSA 3LSEA 1MQTC 4YGEA 2WO2A 1ZZCA 4M3CB 2EXHA 4LNVA 2G9GA 1ZREA 2YFUA 3NNFA 3KSCA 4K8RB 3ZX7A 2Y38A 1VMFA 2DBIA 2WQZC 3JUUA 2OPWA 3PUSA 4WVZA 3AMNA 3MIGA 1NQDA 4FPYA 1KD7A 1DZTA 3T4HB 1WW6A 4QX8A 4EQVA 3ZR6A 3WF3A 3D4KA 1PX4A 4DXSA 2NZ9A 1IQDC 4PHZA 1UX6A 3DXTA 5FCCA 3PTRB 5HI0A 1V9U3 1W0PA 2X10A 1EUUA 5LRRA 4CDUA 2ZGNA 4I2OA 2HBUA 4LBNA 4BQ1A 1GYKA 2BU9A 3CJIB 2JECA 5B4XA 1HV1A 2VXRA 1PIV3 4FPHA 4LE4A 5F3CA 3TEZA 4D8MA 4Y22B 2W87A 4S2HA 4QD2A 5JOXA 1BBT2 1XYOA 2VAUA 1L7RA 1D0HA 3L9JT 1BBT1 5FKCA 4IV1A 5A7OA 5A6YA 2CU5A 2QQIA 4XF4A 4CVUA 1PZ7A 3CJXA 5FY0A 4B4QA 1JYNA 4AF9A 2SLIA 1L3JA 2YDEA 3CQOA 1O91A 5FZDA 4AFMA 4I0WB 5ISLA 2VW2A 2JXAA 1UNBA 3KM5A 4IDZA 5ACA3 1RUG2 2A7AA 2V72A 2Y34A 3CO2A 1C3HA 1ZZ8A 4XQ4A 1RUG1 4BMBA 4CP1A 4PF1A 4D0QA 2Z2SB 3MLKA 1XE8A 3M3OA 4ZZ8A 3S57A 1FV3A 3EBRA 4QDRA 1KQRA 4Y22A 2P34A 4LQRA 3CU7A 4RR3B 4AQ2A 1UMHA 3HNYM 1CAVB 3HBKA 4FXGB 4JC1A 3U75A 4XIOA 4KGGA 4Y1UA 1O4ZA 3FFZA 2A6WA 4YVSA 1GNYA 3ZFGB 4JV4A 4QPGA 4Y26A 4CCEA 3AP7A 4XZPA 1PM4A 5C8CC 2NPIA 5DZEA 3V0AB 3PUQA 2JE7A 1G6NA 1RUC3 4LO4B 1K42A 2YZ4A 1SFPA 3AL5A 4V2VA 2FDJA 4LBQB 1QHDA 3T1MA 1YEWA 3SNMA 3HT2A 3PLQA 4LK7A 4AI2A 1AVBA 1IS4A 4W6YA 5IUQA 4HKWA 3H8UA 2V4VA 1KGYA 2HLEA 3BGAA 4XFHA 3N9OA 4NJ4A 4KWUA 5JPNB 3T08A 2OUJA 4BLJA 3I97A 5FR3A 4CCJA 4JKMA 3O1TA 1A8MA 2CWMA 4RQPC 5LBEA 4XXAA 2ZHKA 2HWB2 5BYNA 3AC0A 2WFF2 1PHMA 2HWB1 2ADDA 3RZKA 4HLTA 2WFF1 5CFDC 2DCZA 1A78A 1NCQC 4NHMA 3T2QA 5FOBB 1JZ8A 2WO7A 2JIJA 5A1AA 2JDMA 3NVCA 2QFEA 5GZFA 1UKRA 4LJHA 2VVFA 3GHMA 5J36A 1EY2A 4YW2A 3ZN6A 2CSGA 3B00A 4LUMA 1O3RA 1VB2A 1ZBA3 2MPFA 1ODNA 2ZKLA 1W8HA 4XUPA 3R4DB 2GN3A 3WF0A 3WW4A 3ZXJA 2C0ZA 1SLLA 2ZOEB 3C8XA 4CEYC 2IXCA 3EB7A 1DQ2A 4OHZA 3DKWA 4LEJA 2ZZJA 4X8NA 5C3QA 1YQ2A 1VIWB 2ZJCA 4Y20A 1J3RA 3IWZA 2D43A 2XBO3 1KDMA 3H3LA 3WXPA 2JDZA 4MGKE 2JG8B 2ZMNA 3OB8A 1IZ3A 4HSLA 2FMDA 3I2FA 5FPBA 3KQ4B 3N9NA 2A6ZA 3LSDA 1L7LA 3BVCA 3AYCA 2WA3A 4CDWB 1BLZA 1LOGA 1QOSA 3DL3A 5FZLA 4QX3A 3ZYRA 4DXZA 4DUXA 4XFGA 1SBEA 2WT2A 1NKGA 2IXHA 4AFDA 1NYWA 3S5QA 4CU9A 4JKKA 1AR73 2GC0A 3ZLIA 2YUEA 2N7GA 5F3IA 4EWEA 2JG8A 4JDMA 5C9AC 5C4WA 3AZYA 3HEIA 1AR62 4A7ZA 1QJY3 3CEWA 3H42B 3M3IA 2O8OA 2RVAA 4EN6B 1AR61 3ZYGA 5LEJA 1XSQA 1C57A 1G7YA 4XTPA 1RUOA 4ITCA 5B2GB 1WW4A 2I74A 4O9EA 5C8WA 4KWKA 3VBRC 2W94A 5FPXA 2Q30A 2X8KA 4PQ9A 5ABJB 3RS6A 3VBHB 4CCCA 4ASMB 2WA4A 4EV0A 5KXBA 3MI8A 3I3MA 4TXWA 4JRLA 3RJ2X 5JI9A 1JOBA 3SKJE 3TEYA 4AEKA 1W9TA 3LA2A 4Q4V3 4MO3M 5FKBA 3J9SA 1B35C 2QZ3A 4BPZA 3OPWA 2VTXJ 1O4TA 4CU6A 4WZFA 4LKSA 5I0SA 4CE8A 1YQ6A 1LEDA 4HVRA 1W39A 2DFCA 4NRPA 3UKNA 4AG4A 2QQMA 1VE0A 3VBUC 4XUOA 4CCDA 3ALQA 3VBHA 2PXJA 1CIYA 3WVJA 4DY5A 4KWLA 3UETA 5L19A 1LR5A 2QQPA 2OA2A 1CAXB 4P9XA 2QZ2A 1W8UA 2Z42A 4KI5M 5F1RA 2NN8A 1R1A2 4UFJA 1FPN2 1SEFA 3R0RA 5E1RA 2PYTA 2Y0OA 2CGPA 1R1A1 3OOXA 4V1PA 1FPN1 4QKFA 3LF7A 4GJYA 4Z2AA 1E57A 4HETA 2V09A 3ZYBA 2KXLA 4P02B 4AZZA 1UL9A 3VZMA 1GMMA 1AZDA 1OT5A 3T2TA 4B7EA 1C28A 5LEKA 2WLQA 2J42A 4RS5A 1VAMA 5JMCA 3MUZ1 4DQAA 2JEMA 4JCKA 1CAXA 3GHNA 3ES1A 3VDAA 1H2MA 2VXJA 3CZUA 4QGNA 1WLTA 3AKSA 3UK9A 1BBT3 1F15A 1TVGA 2A3YA 4EZ4A 2FHRA 4C8DA 3OUJA 5FFOC 4XW3A 4OI2A 2WC2A 2B45X 3BODA 2XLAA 1OH3A 2P3IA 3AJYA 1YIPA 5LBCA 1CAUB 2CGOA 1RUG3 2UURA 2DUOA 2ZKNA 3VBSC 5LW9A 3R4UA 3THDA 4ZY9A 1SFNA 1VRBA 4CUCA 3K48A 5A7WA 4LBOA 3KCYA 4Q29A 2B9UA 4OULA 3DPRB 4R4ZA 4RHV2 3SEEA 4C1WA 5IVJA 2A6YA 4N43C 2GC3A 4RHV1 4IERA 2R063 4QKDA 2DTWA 2ZX1A 1J3QA 1LESA 4HANA 1JYCA 2K0GA 2JDUA 4XJUA 3BOWA 1NY72 1DQ1A 3NV4A 2QCSB 4LBLA 3P3PA 5IJRA 1NY71 3MDPA 1OKOA 4CUGA 4NIIA 4BOWA 3RMXA 2Z79A 3TN93 4BIFA 3POIA 1RJ7A 4XJAA 2OQ7A 4GMP1 2UWCA 2H6BA 3ZDVA 1SDWA 3U11A 2XXZA 1J59A 1FYUA 3TAYA 5IVEA 1N3OA 1DF0A 3PDQA 4N53B 3J7LA 3DN7A 3ZSLA 1VMJA 5BNPB 2VZQA 5CFCB 1S0JA 4WM8C 4RGAA 2R042 4HN1A 1PMHX 4TLFA 2PHUA 1UWWA 2HWB3 2ZEZA 1VR3A 2R041 4V2WA 3VL9A 2WFF3 1H8TA 1UAIA 4CCKA 2QQVA 1H6YA 1UU6A 5GZCA 2ORXA 4BU2A 4NWVA 2W1UA 4X8PA 5GALA 3WG2A 3ZXDA 3I3QA 2GNDA 5C3OA 3VHRA 5JZGC 5A32B 4CXWA 2HWF1 1TMF3 2VL4A 1KITA 1WMDA 2WNVB 4H2AA 2JICA 4UT5A 3UJOA 2R16A 2WQ4A 3AP4A 4M00A 1Q8OA 2WFPA 4ATFA 4E2GA 3RYRA 3U4XA 4GH4C 3KT7A 4YM2A 4AR2A 2BTVC 3VBFA 4AI1A 1QF3A 1JOPA 1WBLA 3A0NA 3LDRA 5IATA 1ZM1A 1N1SA 2DWRA 2EIGA 4BQYA 4HKOA 1C4RA 2EXIA 5FZMA 3QACA 2W3JA 2WSUA 3VD3A 2VCMA 5BNNB 3OJBA 4CU7A 5DZFA 1H4GA 4N7UA 5FPVA 1OVSA 2PHXA 5FYIA 4GALA 3U4SA 4IV3B 1OLMA 1PMIA 2OT7A 1U12A 2RJLA 2UYAA 4I3PA 1MS1A 1C8M2 3OF1A 1QGLA 4C0HA 3RNSA 3S6PA 1PVC3 1C8M1 2XQRA 1QKQA 3ZO0B 4A4AA 2JG9A 2Q1ZB 4CTEA 5AFEA 4BQ3A 4TLGA 5FZIA 2VM9A 3CJIC 3D8CA 3WDUA 4DXTA 5FBJA 2P37A 3DGTA 4MYEA 4Y24A 2J1SA 3LB9A 2IXLA 1MEC3 4NAMA 4JTNA 3T0DA 1S2BA 3MIHA 4CEWB 4PLNA 4Z8BA 4IE7A 2OKXA 4B4PA 3V56A 3O5SA 1LECA 5A3OA 3FLPA 1KRIA 1NX9A 2XUEA 1VMHA 4YZ2A 1B09A 4AI8A 4K9SA 4I0AA 3T1LA 3VKMA 1OF3A 3NQHA 3LEIA 1D0GA 2AR6A 5E8AA 4NHXA 4CDQB 1QU0A 4NHLA 4JX0A 1F31A 4LOSA 4YGCA 5D1IA 3SCGA 3O0VA 1HB4A 2ZCWA 4NWWA 3WNPA 2XJVA 1VBC2 4XE9A 1VBC1 1RYYA 3UKVA 1NXMA 1O5UA 1O3TA 2P3JA 2DVAA 4DEVA 4CEWA 4RR3C 1W8OA 4CPBA 4MXVA 4MGIE 2CYFA 1WMFA 1WUVA 4LHSA 1AX1A 1A34A 3ZFGC 3IAQA 1IS5A 5FYHA 4JVAA 3NV1A 4LLFA 1RGSA 1C1LA 4W6XA 4PDWB 1RC6A 1TZOA 3EHKA 1UX7A 2LS6A 3FMGA 3V0BA 3O0XA 3KF3A 1ZZ7A 3JU9A 1QEXA 2JB8A 3ACFA 4NAOA 1VBA3 1WA6X 2RJ2A 2Y33A 3I49A 2YROA 3M3CA 1UKGA 1W9WA 1JOJA 1OF4A 2QVSB 2WO1A 2X05A 1GWKA 2ZX4A 4UF0A 1S1AA 3F95A 3F2ZA 3B94A 2EXJA 4U2AA 1EYBA 3LDBA 3D6EA 4QPWA 1D4M2 4Q4W2 4QU2A 3VV1A 4A7YA 1JZ3A 1D4M1 1OLQA 4K3UA 4Q4W1 1C5HA 5JCTA 2BP6A 2QNKA 5IAVA 1BEV3 1LENA 3LA7A 1LAJA 1Q8VA 1Y43B 3WT3A 1H9PA 2NMNA 5T55A 2R30A 4XFBA 2W08A 3K4DA 2TUNA 4YG6A 5LY1A 2FD8A 3NJXA 1XOYA 1MZEA 2BVBA 3IKWA 4H55A 5C7GA 2BZDA 3P1IA 5JR2A 2D6NA 3I8TA 3WLUA 4JHTA 2BBVA 1NZCA 2VVDA 5JIAA 5IHRA 1SLAA 1HJGA 2I07B 3ZOIA 1DQ0A 3KT4A 1W8NA 4QX0A 5DAVA 3ZYJB 4BK4A 1K5MB 4LBMA 5IVBA 3W58A 5EFUA 3NJYA 3AVSA 5I8TA 4FO9A 3H1WA 5C4WB 1CX1A 2WNOA 1PZ8A 3NKGA 5FO8B 1OVPA 2K46A 1V9U2 1H4HA 2UWAA 3I2HA 4GA9A 2VTFA 4UFMA 1V9U1 5EXOA 2VW0A 1WBFA 5K0UC 2JJ6A 4Q8LA 3THCA 1UYZA 5C5TA 2JDKA 3J7MA 3I3EA 1H30A 4BM8A 5F3EA 5LK7B 2WL1A 1BK1A 1ACCA 4UBHA 3EQEA 3I2IA 1OPMA 4CDWC 1E5HA 4NIHA 3N9LA 4GMP3 1GQPA 4FFIA 2BBAA 5LA1A 5IK7A 3IIAA 1GWMA 4LHKA 4P9JA 4PCRA 1IQAA 1YFWA 2BNNA 5FXXA 1MZ6A 5EP9A 5GZEA 2VGDA 5ACA1 1JYIA 5FUIA 2ZGTA 3ACLA 5DUVA 5FYYA 1V6IA 4G4FA 3OSDA 4TWTA 5FYUA 2IVIB 1O7FA 2AENA 4XZUG 1UU4A 1JUHA 2BVVA 5AVAA 4NIAA 2KD7A 5I8YA 1GUIA 3ZSMA 1J58A 4AVTA 2DU1A 3TB0A 3GM8A 2XH6A 3ZPYA 3HQXA 2LRPA 1HRI3 2XKOA 4NE9A 5EJ1B 3T30A 4C90A 1OQDA 2DURA 5LB6A 2B5HA 3UV9A 1ND3A 2K2SA 3WW1A 3AKRA 2RDQA 4QXHA 4JGYB 4PBOA 3ZFEB 1ZBE2 2D7FA 5ABJC 3VBHC 1O3SA 1S2KA 4M0HA 4PT6A 1ZBE1 4LE3A 1F2NA 3H9AA 4J1WA 4KH9A 4JGZB 1LGCA 2DCKA 2WINB 3POWA 4BHPA 2ILMA 2VMGA 1DU3D 1H9WA 1VPHA 5FMBA 3W5MA 1YLLA 3KHBA 5IK4A 1UMZA 3Q8AA 5FO7B 3VDDA 4Y1ZA 1XNDA 4CP0A 4LKEA 3Q8EA 1W6MA 2X5IA 2Y26A 3FHAA 3E5XA 3ME2A 4L92A 3AZVA 4YARA 1UYPA 1XYNA 2XMLA 1STMA 4XXPA 1GV9A 4XHBA 2BV4A 4OZOA 1ASJ3 4UXAA 1MZFA 3HQRA 4DY3A 3LGRA 2BWCA 2CL2A 3AMHA 3OGSA 5E89A 4GB33 1YI7A 1CZSA 1CVNA 3BYWA 3MF9A 2IFRA 5JAXA 2OX0A 2XJUA 2WNUB 4LBJA 2GC1A 3ON7A 4EN7B 3ZFFA 2XVGA 2GMMA 2RS12 1C8M3 3OD0A 3SH3A 1X8MA 2GDFA 3RZMA 2RS11 3B93A 4DUVA 1QH7A 3WDYA 4Z82A 4C1XA 4F3JA 2XLGA 5A6ZA 3RJRA 5KHGA 3WCRA 4P9WA 1IPJA 3IDAA 2E31A 1QJU2 2ZGRA 4LO7A 1W2AX 2WN3A 3A22A 4EJRA 1LHNA 1QJU1 1W99A 5DMYA 2UYBA 3PIGA 2D40A 3O1RA 3LFMA 2VVEA 5FZOB 2D98A 5FK8A 2XBO2 3PL0A 5FP8A 2ZXQA 4HFSA 2DTYA 1DQ6A 2J7MA 2WT0A 5ANQA 2XBO1 5FXZA 2W1SA 3OY8A 1F5JA 1CJPA 5CZKA 4QQLA 2NYYA 5J96B 5IK5A 4XQDA 1OOPA 4LA3A 2QQKA 2D6LX 2O0OA 3AYDA 4RGKA 2EF6A 2WABA 1VBC3 1OD5A 1Q43A 4A41A 1U5ZA 3DPRC 2Z69A 3IPVB 4MXWB 2HWC2 3WNKA 4Y5SA 4AEDA 5HCAA 5GJ6A 4BQXA 2YY1A 1YUDA 1K5JA 2HWC1 3KCXA 3VD7A 5F6KA 4CDXA 2WRAA 4UFKA 3RVHA 4HPKB 4XJZA 1AXYA 4OHWA 5KR7A 5JOZA 2XL9A 2WWJA 2F17A 1W6QB 4A44A 3MGUA 3VDCA 4YM0A 3IMMA 1AR72 1HB1A 2Q5TA 5JXJA 1QMJA 1AR71 4XMAA 2VQ0A 3PJQA 3WY6A 1DZRA 1NCRC 4CCLA 3QCWA 4MXWA 5KWRA 5CKMA 2B7YA 1PVXA 1VBE3 4N53C 2F4LA 4J25A 2KM2A 4EROA 5BNPC 4CXXA 4CSWA 1QNWA 3O1SA 1D4M3 5CFCC 1GOGA 2I45A 2XJPA 4ISQA 5A6QA 5BXXA 4AI3A 1FNZA 3ZPOA 2I2SA 1S0FA 5J1XA 1PO13 4BISA 3ELNA 1X82A 2ZAAA 3PUAA 1OLME 2DYCA 4XILA 4AFAA 3VDBA 2WIIB 1Y9MA 3I2DA 5F5QA 5FYSA 2DFBA 3B69A 3DEMA 2VNVA 5EYXA 4NIDA 2VMHA 5LY2A 1JU4A 3ZYFA 1HLCA 5HV4A 2XLFA 2WNVC 4W6WA 4FPKA 4IEXA 2MHFA 3WX5A 4YWAA 1V0AA 5IFPA 1Y9GA 3M70A 1ULPA 4HG6B 3C3VA 2UWBA 3WUCA 1HXS3 2JDAA 2WNEA 2EALA 4MADA 4NRQA 4BQ5A 3NJVA 5FPLA 2CY6A 4DINB 3R4SA 1W2UA 3Q9OA 3ZXGA 4KQ7A 5J48A 2R0HA 3ACIA 1W2NA 3T0AA 1JN2P 3KCCA 4IV1B 5LATA 1EP0A 4MGZE 1YCIA 3NSTA 5L9VA 2D93A 2FCUA 3NNMA 4Q4X2 5BNNC 4QXCA 3APBA 4LA2A 1ODMA 4Q4X1 2WN2A 5FPAA 4IE5A 3ZSJA 4GWMA 1XU2A 3CDZB 4WZCA 1X50A 4XAEA 4IV3C 4EWDA 4QX2A 5IVFA 3FBMA 1RUD3 1F35A 1SDDB 1UD1A 2E63A 2VULA 5FP3A 3OGGA 4NOTA 4FQ4A 1ZZ6A 4TSVA 1DDLA 3MBWA 5C33A 2XJQA 3X29B 1WZXA 4KMQA 2C9KA 4YSFA 5GZDA 4LO6B 2WZPP 3TEXA 4UFLA 5FXWA 2Q1FA 2XL7A 1EPWA 5A7NA 1BJQA 3NRUA 4QB1A 3FZ3A 3AP5A 4YVSB 4YW5A 2EIDA 4BQWA 4YGBA 2ZMLA 2ZGPA 4QPGB 4CCMA 1RIRA 3PUHA 5ANNA 4CEWC 3WINE 3MO4A 1RMU2 1REFA 2IXJA 3WZ1A 1RMU1 1ULOA 1GP6A 4LO8A 1QDCA 4XFFA 2GC2A 3JB8A 3K4ZA 4D7TA 5A1FA 2LALA 1PK6C 2PQSA 1JH5A 2R062 2Q0AA 2VUCA 3GBWA 4CDQC 3O1VA 3ZXKA 2R061 4KGQA 2JKXA 1WW7A 4AFBA 1G9BA 2DDUA 1NZIA 3N7JA 4S2DA 1S0BA 4YW6A 2DVFA 4QX1A 1MR5A 1CIWA 1ZBE3 4MH0E 1XB9A 3TN92 1YIFA 2VUAA 2W5FA 5FZ7A 2ZX3A 5JMOA 3TN91 3RFRA 1IPSA 3SH5A 1R1ZA 2HEVF 1FI2A 1IS6A 2OZ6A 1HDKA 2R073 2Y8KA 2YG0A 5E88A 5J98B 1HQNA 1ULFA 2GAUA 3JZVA 5L7OA 1HW5A 4IGQA 4M01A 5D8AA 4PDWC 2ZEWA 1JODA 1W6PA 4AE2A 5A6XA 3ZN6B 2BEOA 3POGA 2LTNA 2J22A 5GM0A 4BXFA 2EXKA 4NO4A 1F9KA 1C1FA 1RHI3 5IVYA 1LOEA 1UZWA 5FQ0A 2RE9A 3VBOB 5LBBA 4QDQA 2ETEA 2V5YA 2Y6GA 3USUA 5F9TA 4HKLA 4OUMA 1YXWA 5CNAA 4BB3A 1ZVFA 4Y20B 1ZRDA 3O14A 1TMF2 1XXNA 3OD4A 5I0RA 1KJRA 1WLCA 1TMF1 2R0FA 2RS13 4LOTA 1PNGA 5DZGA 3M2MA 3NV2A 2VECA 1I9RA 2YHJA 3DUIA 3OTFA 5JDBA 4Y5TA 5JIUA 2CHHA 5FYCA 3SCFA 2VZVA 5DAPA 1MS4A 3BI3A 5EQUA 1Q3EA 2OYZA 5IW0A 2XUMA 5BY5A 3VBOA 4Y1VA 2P6HA 1YFXA 1OLRA 1QJU3 4Q0UA 4ATEA 3VB9A 1NUKA 2YXSA 2VU9A 3VHNA 1Z78A 2ZS6B 1WCUA 1YRZA 4I0BA 2MEV2 2ZZQA 1J1TA 1SCRA 1K5MC 1UIKA 2MEV1 4JTOA 2IWGB 5TSWA 1D2QA 2WKKA 2HEYF 2HWE3 2DBNA 2XGXA 3QLQA 4FXKB 3SKVA 1VRH3 2FMYA 1PO23 1W9YA 4KBBA 4AHZA 2VTXA 1S0EA 3CZJA 4CDUB 1N47A 2JKBA 4DOUA 1W9FA 5LBFA 3HBZA 5K7PA 2HWC3 1PVC2 1UXXX 2IZWA 2W47A 4L97A 3LD8A 1GP4A 4A42A 3RZJA 1PVC1 1UY4A 2J1RA 5F6LB 1WWYA 2XJRA 5FWJA 1RVF3 4UAPA 1W6OB 4D7YA 1T2XA 4KU8A 4DEQA 1W3XA 3ZIWA 1MEC2 4ZU5A 3RDIA 5KC6A 3C7HA 4QWNA 1MEC1 4XC9A 4NPLA 3B9IA 1OQ1A 1OHFA 4K7JA 3GJBA 1BVP1 2E51A 3GALA 3N4MA 3J26N 5H9SA 4ZONA 1N1TA 4SBVA 1PX3A 4JQTA 5FYZA 2YU2A 4IE4A 4EWAA 1N1YA 5FLIA 3VD4A 3BN6A 4DFSA 1DBNA 3WDTA 2DUQA 2F6BA 3N9MA 1W6OA 1SACA 2WZ8A 2YB7A 3JBG2 5DPNA 1DYPA 1DYKA 1HIXA 1GSLA 1UMIA 2GSYA 5FZ3A 3JBG1 2OQ6A 3RPQA 2FDHA 2YC0A 1I1EA 5LK5A 4MGYE 3MICA 1JYXA 2XB6C 4HZFA 4QXBA 2DF7A 2X09A 2A6XA 2AC1A 1HQLA 3LIGA 1I5ZA 3L2HA 1DZQA 4ZXKA 4CPBD 3TBDA 3LEGA 3ZFEC 1HRV2 3AX4A 4JGYC 1I3HA 4MV2A 3A23A 1HRV1 4CP9A 1OA4A 1POV3 5EZWA 5F2WA 4INDA 3W59A 3K3OA 4Y5Z0 4JGZC 1VBA2 2GNBA 2HWD2 4Q0PA 1YO8A 3KVAA 1VBA1 2HWD1 5JOYA 2KR2A 4BDVB 5EIYB 2D6PA 3H7YA 4RS5B 1A3KA 2YMZA 4FFHA 2GP3A 5C3PA 3U14A 5T5OA 2VZPA 5FREA 5EWSA 3RZHA 1Q8PA 3KGZA 3RYKA 4FPOB 4D6QA 1GANA 4XCAA 3EYPA 1DP0A 1WCSA 3OYWA 5I0TA 2A3WA 2JENA 4Q4X3 4AFCA 1QDOA 1BEV2 5KHKA 3PIJA 2BFUL 1ND2B 3H50A 1BEV1 4QPIB 1PGL2 1GOHA 3PUIA 4QQHA 3UESA 2ZGUA 2W95A 3PMSA 3SISA 3WHUA 2WNUC 3FWEA 1VJ2A 3POBA 1SLIA 5A7WB 4AL9A 4CRQA 4YZ1A 5FZGA 4LT5A 2QKDA 2BDRA 5FYVA 1CQ9A 2UU8A 3VHOA 2C1FA 3W20A 2VZ3A 3PU3A 1QIQA 1LU1A 3I59A 1JS9A 5FLHA 1JI6A 2VZTA 1WMEA 5HBAA 5SV5A 4QM9A 1A8DA 1IHMA 3CIHA 4Q4Y2 1ND2A 2LW8A 3MV01 4QPIA 3KMHA 1MVQA 5I0UA 3RQ0A 4Q4Y1 1CGPA 3DF0A 4HT1T 1BXHA 1RMU3 2ARCA 4OI4A 4AVSA 4Q1RA 2E6VA 4Q8KA 4TN7A 4YW4A 2ZAHA 4AVBA 1DGWA 3HVDA 1US3A 2BERA 4ASKA 2W0XA 4NUBA 4OVEA 5DN2A 1HJFA 1QJZA 5IVCA 4EN0A 2YBKA 2OW4A 2VC9A 5BNQA 4WM7A 4LORA 5F2SA 2ZEXA 2GZWA 3ZYHA 2ZHMA 5I93A 3HIFA 1DCSA 4TZDA 4YFZA 1LULA 1Y7BA 3BKZA 4H3WA 3WD5A 5FZAA 2W2IA 5T5JA 4AHWA 1Y4WA 2VMIA 4FCAA 1UZVA 1H8TB 1QWRA 2DUPA 4YVWA 3BPZA 2OXBA 1ULEA 1UZ0A 4IEYA 5C3SA 1LOFC 1UW8A 3N35A 5FZ0A 2ZGKA 1H2LA 2A71A 3FLRA 2VZOA 3H1YA 4GAZA 5CB7A 3P6BA 5A33A 4B3NA 1FV2A 2C26A 1SBFA 1SCSA 2WWSA 4B8EA 4A3XA 2WDBA 5M0TA 3T4VA 3S0MA 1RB8G 1CX4A 3URFA 2W92A 1W03A 2ES3A 3GNEA 1HRI2 1UZYA 2Y6LA 3VBFB 2CAVA 1HRI1 2BNMA 4HXCA 2ZA9A 5K8SA 5FBZA 2HEWF 4NHYA 2OPKA 2PMWB 4QHOA 1KS5A 2OIIA 2E26A 2A5ZA 4HBNA 5T3NA 2C5DA 3BIEA 4ZXEA 2D6KA 4OQ8A 1QY4A 3A4UA 5HCHA 2VD7A 4UW3A 3VZLA 4LO5B 3K2OA 1AUYA 5JSPA 1H8VA 2VZSA 4ONUA 3MZHA 5C71A 4SLIA 1K45A 1GZ9A 1XPWA 3T09A 2GMEA 4N90A 3M3QA 4CDUC 2JG9B 2Y6HA 3POSA 4AGVA 5HCBA 1C5IA 3DYMA 3WP6A 4BK5A 2JDHA 5BNOB 1ASJ2 1URXA 2MEV3 3GBGA 4PI0A 1ULDA 5C70A 3PNAA 1BQPA 1RUE2 1ASJ1 2F4PA 3TWIA 4DO0A 4GB32 4MGQA 2JD4A 2Z5WA 3K77A 1RUE1 2HKXA 3M7AA 5F3GA 3H8XA 4GB31 2HH9A 1MS5A 4IE6A 1W6NA 4IV1C 4HN0A 1G9DA 1UY1A 3DV8A 1H0BA 4B7KA 4F83A 5C6CA 3AZWA 1FNYA 1O6UA 3LPGA 3MIBA 5FUNA 2BFUS 1HB3A 3AVRA 5CU1A 3C7FA 4AXOA 5FMDA 1R092 2ZGQA 3P3NA 4W8JA 1XNBA 2CV6A 2OUHA 3J8F2 5F32A 5L9BA 4D6SA 3RGBA 5A3LA 5HPOA 5BNOA 1NA1A 1O8SA 3J8F1 4P14A 1OA2A 1GNZA 5IYYA 4RSUA 4MGTA 2FDFA 4N8MA 3UT0A 1UZZA 4P9LA 1UOGA 4JKLA 3ITQA 3NJZA 1VBD3 2YPDA 2TBVA 4YM1A 1MQTA 2GNMA 5FTTC 1SZBA 4QU1A 1GP5A 4YVSC 2WLPA 4QPGC 5GLTA 1UOBA 3K51A 3QBQA 1NOVA 1TME3 3V0BB 5FDBA 3WG1A 5IK8A 3LEKA 3ZKUA 3KV4A 2WR9A 1EPZA 4ASLA 2XJTA 2EVXA 1I6XA 1L7QA 2ARAA 3NMBA 3BALA 3JBG3 3RWKX 3O1OA 1VB4A 1D2SA 5CVRA 3CLPA 2H6CA 2WSVA 2RDRA 4UF0B 4ZPIA 4ET7A 3AMPA 3IDEA 3DYOA 1TEIA 4UYBA 3ZXAC 1HV0A 1LCLA 4CP2A 3FJSA 4HK9A 1APNA 1YC61 5CAZA 1YI9A 3I4IA 1RUH2 1HN0A 1HRV3 1LHOA 1JHNA 2VOXA 1AF9A 1BYHA 1EUTA 2G4IA 3OBRA 3Q8CA 1RUH1 4LIUA 4RYDA 5AVPA 3ZN4A 2YU1A 1WW5A 3GDBA 4IEZA 3E6DA 5T54A 1DGLA 3VKLA 2P4EA 5FY1A 3AXDA 1JZ4A 5KHIA 1VAVA 2HWD3 4QQOA 4QB6A 4XDPA 3HR9A 4AVVA 3W9AA 1XNKA 2VNRA 3ETQA 1GU3A 4KNCA 1LHUA 2J1AA 4F7ZA 3KLSA 1VBE2 3WUDA 1LOCA 1NAEA 4DRVA 4OUSA 5LASA 1VBE1 2FDGA 3LOIA 1EAH3 1OA3A 3GBFA 2BOIA 3BOPA 3LAGA 3NNGA 4Y1YA 3T2PA 4BA6A 3KB5A 2DVGA 2ENRA 3O1MA 5I8SA 4UFHA 4MZUA 3WNLA 1FMD2 2XWJB 4I30A 2LM3A 3VBOC 1OKQA 1PO12 3KHCA 1ZZ9A 4IXLA 1Q8SA 4ARXA 4F8AA 5KXEA 4H7LA 1PO11 1CD3G 4ZKTB 4FTEA 5FZEA 3WDXA 4OHVA 5FOJB 2PAMA 1LGNA 1HX6A 4H14A 3ZXLA 5C8CA 1ENRA 1OFSA 3QOPA 2PHWA 4QKNA 3J7NA 1VAKA 1AHSA 5EPAA 1UXZA 3ZIXA 2PFWA 3KWVA 4YW1A 4XF0A 1HXS2 4COWA 3WDWA 4UWDA 3BCWA 1W9SA 3LA3A 4XYXA 1HXS1 1UOJA 5DAXA 3ZMNA 2VUJA 1ZRCA 4Q4Y3 3OCPA 5HXMA 4MVTA 5F39A 1COV3 4Q0VA 4LHNA 1W3VA 5CG8A 4E4ZA 3TNPB 1VBB2 4N9IA 4FFGA 4IEWA 4RQPA 4IEOA 1VBB1 1DYOA 3S7EA 4CUAA 5FPUA 3LZZA 4ISRA 2WZR3 5CKQA 2UY9A 1H2KA 2AEZA 4FOQA 1ENSA 1RJ8A 3ROUA 2NP0A 5CFDA 4FVVA 1NCQA 1NLSA 2JG8C 5A7QA 5T5LA 1RUD2 1OMIA 4BLIA 5C4WC 1QQP2 3KD4A 4OMDA 1RUD1 3O1UA 3WCSA 1QQP1 3INAA 5A7SA 5JSRA 2FDKA 4AW7A 2ZHNA 2WAOA 3PJYA 4XTMA 3SXWA 1CESA 3R6SA 5BV6A 3GF6A 3AZXA 5FP9A 2Q8DA 1RL3A 3S5AA 2AREA 1A6CA 1PM7A 1ND3B 1PGSA 5SV8A 4MX3A 4CEYA 4XEZA 1XSRA 1BHGA 2WWUA 4XABA 3AYEA 3BTZA 5FZ9A 2J1VA 1AYM3 1TQ5A 5DUXA 4QAWA 4YFWA 1LB2A 2L9LA 3JQWA 4IW3A 3IBMA 3TRSB 2VOKA 3VDDB 3ZMOA 4XJ9A 2WS92 3AFKA 3H8RA 2Y6JA 2SBAA 5C5UA 1W90A 2QQWA 1W6MB 2X5IB 2WS91 2RDSA 2WBKA 4XCBA 1YWKA 2V5DA 3T0BA 4D94A 4YLZA 5GLZA 5GZGA 5K9YA 3ETPA 5KXDA 5FY9A 4NROA 4R4XA 4GMP0 3KV6A 4L9BA 1UU5A 4A3ZA 1QJX2 3GXUA 4FPJA 2VW1A 4HOOA 3MF6A 1QJX1 2R072 4QDSA 4QX7A 4K6BA 1IOAA 2EIBA 4XQWA 2R071 3WHTA 2BNOA 2PAEA 3OBTA 1SPPA 2VMFA 3B01A 3MFCA 3TOJA 1GZCA 4QB2A 5LA0A 3ZFFB 2XG3A 3FUOA 4PIXA 1XRUA 3NNJA 5C9AA 1S0CA 1RHI2 4GKXA 4E9KA 3VZNA 4NMIA 1RHI1 3H7JA 4RS5C 5F7UA 4DZGA 5E6HA 2ARXA 3UL2A 4YZ3A 1RUE3 2BGCA 4AYUA 3PURA 2HBTA 4M3CF 4AHXA 1MVEA 4R8HA 3N36A 2YC4A 4RD7A 3KQRA 3OUHA 2QQJA 5FJKA 4LMFA 5FZKA 5FZHA 3VKFC 4Y33A 3E1F1 3WNXA 3ZSKA 5J3UA 4YGDA 1GZWA 1OUXA 4QKBA 1TNRA 2PHDA 3IM0A 3NO8A 5CADA 2Q4SA 2ZABA 1M4WA 2K9ZA 3OY8B 5D2AA 1R093 1UY3A 2C4XA 4UFIA 5DAQA 4DMIA 3J8F3 3WF2A 4K1YA 4YW3A 1OOPB 4XFAA 2VOWA 1B35A 2WQ8A 1NLRA 5CYYA 1W04A 2G9FA 4AEDB 1TG7A 3VZOA 4XUTA 4EZHA 3JD72 3UGFA 3HPNA 3OUIA 1S0DA 3Q8FA 4CDXB 4IE0A 1QXJA 2CDPA 3CMGA 2WAAA 3JD71 3PHMA 2ATFA 4LIVA 3VBUA 2NM1A 1RUNA 2R32A 1BVVA 2H0VA 4IEVA 1CZTA 1UYYA 3MW3A 4LBQD 3WNNA 1XYPA 1AL23 2HWE2 2B39A 2IFWA 4P9IA 2E32A 3ZYPA 1VRH2 5CA6A 2HWE1 1PO22 1CAWA 1VRH1 3POEA 4BYYA 2XDVA 1PO21 4XFIA 4JAAA 3G6JB 1JYWA 1GNHA 5B4NA 4K40A 2ID4A 4AHYA 1VALA 2Y6FA 1UY0A 5FRAA 4YG0A 1J83A 1DGRN 2NQYA 3EJKA 3POYA 3PVOA 3VN4A 1RVF2 1CN1A 2QQUA 4R9DA 1AL0G 4CA9A 3FBYA 1K3IA 1CWPA 4DB5A 1RVF1 1H6XA 2JE9A 1OUSA 2VBDA 1RUH3 4QQPA 1GQGA 3JXSA 4OUEA 1YNAA 3I2GA 1H1IA 2V4AA 4HK8A 1EV12 5DUUA 5A7PA 1H8TC 3BU7A 1EV11 4IESA 4AEMA 1W28A 3HWJA 4UW5A 3FUQA 2AUYA 3J7HA 3O1PA 1K12A 1KDKA 5EYYA 3UKTA 5CISA 3NV3A 1JUIA 3OBAA 4XAAA 2WZEA 5HXVA 3VBSA 2PTMA 3UGHA 3HN3A 1ZA7A 1X33A 1JZ5A 2YV8A 4Z07A 2PQQA 1YQ8A 3BTAA 5DUWA 3RRDA 2VQTA 4AK3A 2VNGA 3VL8A 4E2QA 1U5XA 1FMD3 4N43A 1D7PM 1RXFA 4L0PA 4W4ZA 4YYOA 1F8VA 5DABA 4H7MA 2CDOA 4J6GA 4Q2FA 4K1ZA 3VBFC 5LZ6A 1XJAA 5G04L 5A3WA 4AAXA 2PHRA 3K46A 4HONA 3WNMA 1ZZBA 3TYJA 1R083 5H9RA 1UIJA 3GGLA 2GH2A 3WQ7A 3BTXA 4COVA 5JUVA 4DUWA 4Z92B 1POV1 2VMDA 3EXUA 1E5SA 3WW3A 1UYXA 5JVVA 4QX5A 3I2JA 4FOWA 5EJ3A 3NNLA 3VZKA 1KJLA 5A80A 1TNFA 3WOGA 1IS3A 2BUKA 5JZGB 3EO6A 1OFNA 3U1XA 1LRHA 2VG9A 5CEHA 4IL7A 4A6SA 5LCWL 2JG9C 1ZNPA 4XDOA 1J84A 2W68A 3O12A 4XJWA 3DYPA 4WM8A 1VBB3 3ZXFA 4FSJA 4GH4B 5CBLA 4OHYA 2RR13 5A70A 3ST7A 3VKOA 2DVBA 3WP3A 4NN0A 2E7AA 4N7IA 4CYDA 2E9QA 2PHFA 3B02A 2QDRA 3UNPA 3ABZA 1QQP3 4NHKA 5JZGA 1KFUL 1PZ9A 5L36A 4E2SA 2QQNA 3OPZA 3VHPA 3WEZA 2FZ1A 4E8DA 4HVQA 2IXKA 4JDNA 1QJFA 3HT1A 4R9BA 3FC0A 3GYDA 2HYXA 1F4AA 2GALA 4GH4A 3MIEA 4XETA 2EA7A 4XF1A 2W52A 3FX3A 2AZ5A 3AP9A 4XBLA 1E5IA 3CKHA 1V70A 1UF2C 3PVEA 3BIWE 4COZA 4M3CA 1X36A 1DLCA 5APAA 2BW8A 3U07A 4AI9A 3BTYA 3H0OA 3CBNA 3BUCA 5L7OB 2VY0A 5D8AB 3RWNA 1DIWA 5FAXA 1W6PB 2WS93 2GNTA 1IKPA 1YQCA 1H1MA 2VNOA 3E97A 4M4PA 4AQ6A 4B4RA 2FCTA 4LBKA 5FP7A 5DXDA 2XONA 2XHNA 2YBPA 1T6BX 5FQ0B 2GN7A 3VD9A 3WF1A 1QJX3 4G3YC 2ZGOA 1S55A 4MGSA 4XPVA 3SHRA 3U10A 3USUB 3CJIA 1ZX5A 1FT9A 1JW6A 4OQ9A 3U0ZA 2A70A 2PHLA 2X53S 4R9AA 5T50A 1G86A 1REDA 1GWLA 4JDOA 3W21A 2R1BA 4FTSA 4M4RA 4E27A 4I01A 3NWKA 5IVVA 2YPJA 4J1XA 3GZAA 1HQWA 4BH9A 4BE3A 1RUI2 2AGSA 3MUY1 5KC5A 4M0NA 1UCXA 5K4LA 1RUI1 3BPSA 1WCQA 2DCTA 2A73B 2D6MA 2WT1A 4GJZA 4WVWA 2QUOA 4IEQA 4BZ4A 4RR3A 1F4HA 5A1LA 2BYVE 3FFQA 1CAVA 5F5IA 3M4FA 1JXNA 2XWBB 1X7NA 2XVLA 1ULCA 3SH4A 4A45A 3AL6A 4HMZA 4FP2A 4KWJA 3ZFGA 2XKPA 4DIQA 1GQHA 2WYSA 4XURA 1W0NA 2VMCA 3V0AA 4P5YA 1LHVA 2YC2A 1JYVA 5FYTA 1ST8A 1Y9QA 2PLV3 5DG2A 3AKPA 1JZ2A 4DS0A 5HV0A 3C7EA 5EHDA 3JD73 5KXCA 1YJKA 4FT8A 2MNGA 1FXZA 2DV9A 1ENQA 4LBQA 4QGLA 3RI9A 3SEPA 3WR0A 4P9YA 3D3AA 5JSOA 1SQ4A 2ZGSA 1W06A 5A3MA 1NXD1 3KF5A 1LEMA 1LGBA 2GP5A 3M3EA 3SLIA 4O61A 2NMOA 2HYKA 2W9XA 3RSJA 2BOJA 2DCYA 1AR92 5FZBA 4AVAA 1ONAA 1UQXA 4P08A 4WV8A 1AR91 4IETA 3WDVA 1KXGA 4GD4A 2ZX2A 1FOD2 3NAPB 4K21A 4TYSA 1ZRFA 2XOMA 1LTEA 3ACHA 5JOWA 1FOD1 1XU1A 3SQOA 1HN1A 1LOBA 1POQA 3USSA 3ACGA 1W05A 3HNMA 2ZHLA 1YYNA 4OLLA 4AEJA 3RYPA 4YNIA 1VBD2 5EV7A 2JIGA 5K0UB 3ORJA 1EV13 4A2UA 3AM2A 1VBD1 1J1LA 3CF6E 2E7QA 3HQUA 1RUJ2 3MPPG 4HL0A 4A6OA 1ND3C 1SLBA 1RUJ1 4QHZA 3MPBA 4GKYA 3MLLA 2O8QA 1TME2 2YBSA 4CP9B 4Q0QA 5LWBA 1X9TA 1DLLA 2R7EB 2XJSA 3WNOA 1TME1 3V64A 3NAPA 1BZWA 4AVCA 4CCOA 2R6QA 4Z1VA 4PLOA 4Q1PA 2QBXA 3UGGA 4EN9B 1FX5A 2D3SA 2E7TA 1SFYA 1SMVA 3VDDC 3N7LA 3ES4A 5JPMB 5FK7A 4P9GA 5JLVA 5K0UA 2QQLA 2VZRA 2BGOA 2X5IC 2BWAA 5E16A 1QJEA 2D3RA 3ZM8A 2RS52 1BK0A 5AC92 3IMNA 4OYUA 2VBBA 2RS51 2RHPA 4XIKA 5AC91 4G9SB 2LROA 1QXRA 3B3QE 5A3PA 1OH4A 1NE6A 3AFGA 3OYWB 3PMEA 1XQNA 4LHLA 3LIHA 1XE0A 4CDWA 4RFRB 1AXZA 3MW4A 3PTYA 2W1WA 3QH6A 3WG3A 3SCHA 2G19A 3Q8BA 1AX2A 4GWIA 4Q27A 3HD8B 3NKTA 4D7SA 2TNFA 4JQRA 3WSOA 2P2KA 5AFBA 3ZFFC 5JWPA 1JZ6A 1O3QA 3KZ4C 1WMXA 1EAH2 3J4UH 3WG4A 3GZTB 1HB2A 3FN9A 1V6MA 3H1MA 1EAH1 3LKJA 4CZSA 4X6RB 3WQ0A 3FL7A 3I59B 4WBBA 3ZN5A 1Z7S3 1PGW2 5JXIA 3D0JA 2A6VA 3KV9A 1NLQA 1PGW1 1DHKB 5FYMA 4LKDA 2PA7A 3HMYA 5FY8A 1DFQA 4XJ8A 3OGRA 5L73A 3LEMA 4PIZA 4P5HA 4R52A 2D44A 2JD9A 4XF3A 3ZDSA 1PGL1 2R49A 1POV0 2TEPA 4KG8A 4K8FA 1S2EA 1OURA 1J3PA 1F5FA 4OMCA 3I7DA 5ABJA 5FO9B 3WP5A 1DQ4A 1W8ZA 3KV5A 2DU0A 3PVNA 1XNAA 4UW4A 4LR4A 3WQBA 1AR82 1SHWB 1G9FA 3MYXA 1AYN2 4K20A 4ZS3A 1CZVA 2JDPA 3WV6A 4AGRA 2VH9A 1AR81 1OOPC 1AYN1 4WM7B 4FP3A 2ZACA 3FE5A 3I2KA 3LWCA 5IWFA 4AEDC 4FOYA 2Q8CA 3SC7X 3KVBA 1I5PA 4XF9A 1COV2 1RUF2 4FQZA 4JHZA 4CDXC 3RZGA 3I3BA 1COV1 1RUF1 3AKQA 3OG2A 4YVWB 5T5PA 2PN5A 4BQ2A 3N9PA 1G9AA 3A0KA 1M06G 3GJAA 2VQUA 2G9ZA 2WZR2 2O14A 2NLRA 2QJVA 3NL1A 3DKQA 1FATA 4LXLA 2WZR1 4XHXA 3FHIB 4GWNA 4S2GA 5FPZA 2XHKA 1AJKA 4PIYA 3N9QA 4Y4RA 5A33B 3I2OA 1U0AA 3EMRA 3IN9A 3JB4C 4XMIA 4KL1A 5DDJ2 2J1EA 2FQPA 5A3NA 2Z4FA 5DDJ1 4E4SA 3SITA 3B9CA 1H2NA 4LPLA 1ZA4A 1UN1A 4GIQA 1RINA 2ZGMA 5LA9A 1LOAA 3BB6A 2BPA2 5JXHA 2ARBA 2Y60A 1ALYA 3SMHA 1SLCA 1WLDA 1AYM2 2ZX0A 4Y3OA 2GH8A 4W65A 2ZEYA 4COYA 5T52A 1XNTA 1AYM1 4I02A 1T6GC 1WD3A 2Q1MA 3ZSEA 1Y3TA 1C8NA 2VCAA 2XVKA 4IGOA 3I3DA 4LITA 1CAUA 2D5FA 2YGMA 3JQXA 3OGVA 3T3YA 3THTA 2A75A 1CR7A 1CONA 1RUI3 3PVBB 1X9PA 2D3PA 4UI9L 3U78A 4QPYA 1DGWX 1NCRB 4FBFA 3ILRA 4FI9A 1LU2A 1XBFA 3DPRA 4S2FA 1BMV2 3PU8A 2VO5A 4PI2A 4DXRA 3CHXA 4C91A 2ZBJA 1BMV1 5FZFA 3LFIA 2PHTA 4OHXA 1JMUB 3E6BA 1KFXL 5C3RA 1W6NB 5I91A 3FLTA 3W5NA 2KA3A 1W2OA 1XC6A 4FOVA 2ZMKA 4XBNA 1E5RA 1MS3A 4YG3A 1NCRA 2C6SA 4AGGA 4O7XA 4NVPA 5GKAC 1NA1B 5BUVA 2HWF2 1W2TA 3MW2A 1MS9A 4N53A 4ES8A 2EAAA 1UY2A 2W91A 4XUNA 4EYUA 5BNPA 1CPNA 5BPXA 2A3XA 3QH7A 4EN8B 3HN1A 1MQTB 2EICA 3O7OA 4M3CE 5CFCA 1OBNA 2CNAA 2B9VA 1WCKA 5CKNA 1W8FA 2ZPXA 2AH2A 1AR93 3ILNA 4D69A 3A21A 2VOVA 2WYFA 1V6OA 1FOD3 3ECQA 1R091 3CL1A 2ET7A 4COUA 3GCXA 2GMPA 5FZ4A 5J7MA 3D5OA 5A32A 5DG1A 1GICA 3LOBA 1CPMA 1YHFA 5LA2A 4JRAA 2ZGLA 1Q8QA 4BMEA 2XPJA 4HSJA 4RA0A 2RMU2 2WNVA 4R9CA 2RMU1 4LTAA 4NRMA 2HJIA 4B1MA 4UW6A 1MS0A 1OSGA 4GULA 1KS4A 1RUJ3 3LQCA 5CG9A 1MS8A 3RG0A 1AL22 1US2A 2XR4A 5DQ0A 1AL21 2FDIA 1ENXA 4DPNA 1P8JA 2CWSA 4X6QB 1BKZA 5JR7B 5L9RA 4ARYA 2OS2A 5BNNA 5L7OC 1AJOA 3HOBA 5D8AC 4URTA 1W0OA 2RM22 3MIDA 1AXKA 4BQ4A 4TTGA 4IV3A 2RM21 3CNAA 2P5BA 2P3KA 1OD3A 2RS53 5AC93 3AP6A 4MSVA 1JZ7A 5F5CA 1AR63 4FAHA 2EIEA 5KBFA 2J1TA 2JWPA 4META 3QD6A 3K75B 1PK6B 3OEAA 3B7MA 4OZXA 4U36A 5FZCA 2BQPA 4BWOA 3OPTA 3A7QA 1UO9A 5FZ1A 1ZRIA 2OVUA 3VLBB 1U5YA 4YRDA 5EJZB 2YGLA 3IT8A 1SG3A 2BJSA 2CTVA 3B5LB 5A3TA 2YFZA 4A7KA 2AYHA 5C8CB 2VR4A 2BRTA 5JI7A 2C24A 2CGNA 4O65A 3V65A 4KBZA 2Y0IA 4PQQA 3U37A 1SBDA 4CU8A 3K4AA 4IGPA 1IG0A 4FTBA 1O8PA 3C2UA 4W50A 1LODA 2DVDA 2A1XA 4PLMA 1PK6A 1HKDA 1FMD1 4CDQA 3MHZA 5A3UA 4E4DX 3RZLA 4ZZ5A 4XFCA 4AQTA 4GQ7A 3AMQA 1WCDJ 5FZ6A 4AWDA 1R082 1IG3A 4LK6A 4OCTA 1R081 3AZZA 1W8TA 4RQPB 1AX0A 2AEYA 4YPJA 1V6NA 4O9GA 1JU3A 1N3PA 2IUWA 1UPIA 2QE3A 2VUDA 4HVOA 5H9QA 4AI0A 5IAXA 4CXYA 4OI0A 5GLUA 5CFDB 1AR83 1NCQB 1R1A3 2VPVA 1YQ5A 1AYN3 1FPN3 5FLJA 5F37A 5IT6A 4IQPA 5FMOL 4PDWA 1Q56A 4NPMA 1XNCA 3ATGA 3IDBB 3FHQA 3JCIA 1RUF3 1GKBA 1QNYA 3GZEA 2ET1A 2W46A 1PNFA 2RS32 2VMEA 4YW7A 3HNBM 4CEYB 1LNSA 2RR12 1IKQA 2RS31 4YZ5A 4WVMB 4RGGA 3L2YA 2D97A 2ZTNA 3DXUA 2RR11 1QOTA 2VJXA 1JTZX 3H3ZA 4AQSA 2E53A 3VGIA 4LLOA 1V00A 2QTWB 1O59A 1RTVA 4KU7A 3WQ1A 4MUVA 3D82A 2Q8EA 2QQOA 5G05L 5FXVA 5DDJ3 4FPEA 4JZRA 1FAYA 3ZXEA 2VZ1A 4D6RA 3NAPC 4LULA 4L11A 5DAWA 2J1UA 2B46X 2PELA 3ZR5A 3WW2A 5FV3A 1R64A 1IGOA 1O5LA 3WP4A 2BGPA 4WVMA 2P3YA 4RHV3 4E4HA 4ES9A 4ZU4A 3N7KA 5ERLA 1ZRRA 2DCJA 4AOCA 1KEXA 3MIFA 4DNYA 4FAGA 1QXPA 4DRRA 1YJLA 4EE2A 1PIV2 1K5MA 4LKFA 1SPPB 3VUOA 3E6CC 4UBGA 1PIV1 1GLHA 4ORFA 4OI1A 2JE8A 2JDNA
chains in the Genus database with same CATH topology
4XBQA 4PBPA 5C9AB 1BCXA 4WVVA 1REEA 5KHJA 5ACA2 4L99A 5LRSA 4RFT0 4YM3A 1LJ7A 1UPSA 1DG6A 4XOGA 3N7MA 3VBRB 4FPCA 3KT1A 4IEUA 4NPRA 4Q26A 1GZWB 2R043 4BCUA 2H0BA 3ZVXA 5GLWA 4IEPA 1DGRA 3ILFA 1B35B 2HWF3 4I3GA 1RUC2 1WD4A 2QDNA 1RUC1 3AKTA 4N9HA 3S30A 3VBRA 2B8MA 3NW4A 2B42B 3VZJA 2UY8A 4RL7A 3TNQA 2LUWA 3VBUB 4KG0A 5GLVA 1G9CA 2P17A 3H3UA 1NE4A 2EAKA 2W39A 4MLOA 1ND2C 4QPIC 4GXLA 3AMMA 3G7DA 1G8WA 4Y1XA 1WA4A 3MLJA 2Q8OA 3RZZA 3ZFEA 4QT6A 4JGYA 4BIOA 1VP6A 2FZ2A 1CAWB 4QM8A 3MEPA 3IDCB 1O4YA 2PLV2 3AJZA 4L2NA 5KHHA 2PLV1 4JGZA 2R1DA 2RMU3 3ASIA 1JBCA 2D6OX 4WM7C 2ERFA 5FMOS 5HCFA 3AB0A 3MFAA 1NG0A 2IC1A 1TE1B 1V6JA 1ZBA2 5J37A 1ULGA 3O0WA 1GFF2 2V73A 1ZBA1 2D5HA 2VQAA 4QQ2A 4LUKA 4YVWC 4QMAA 1SLTA 2YYOA 4FPLA 4FPGA 4PJYA 1N1VA 3AXEA 2GU9A 3M1HA 1D4VB 4D3WA 3VBSB 2RM23 1QOOA 1GBGA 3E5QA 4PF5A 2WNUA 2X29A 5J09A 1V6KA 4N43B 2CAUA 3ENRA 1S0GA 3GZUC 1YFYA 4YZ4A 1X8EA 1VLNA 4NR1A 4Z2WA 1MACA 3ZYIB 3KS7A 1ZYBA 4QHBA 1NQJA 3RMYA 4Y4YA 3D0SA 1CJDA 1IPKA 1U5IA 1H1AA 4I09A 1N3QA 1Q5OA 1S0IA 1V6LA 1LHWA 4B29A 4ZU7A 4C0BA 4QXKA 2IXIA 1OI6A 1OQEA 1QJY2 1WLWA 3IPVA 4WM8B 2OZJA 1QJY1 1QH6A 3RI8A 1DQ5A 4FPFA 2JX9A 3N3HA 2C9AA 4XDQA 1YFUA 4HPKA 3THPA 3E5UA 2PAKA 3I54A 3LCPA 1RITA 1GR3A 2O1QA 2RJKA 1W6QA 4Q4W3 1LOFA 3OGJA 1LKNA 1Z0HA 5CIRA 4OFGA 3UJQA 3AK0A 3VKNA 1XE7A 1MZ5A 3HAGA 3AYAA 3M8LA 3R05A 1Z7S2 4Q4V2 5BNOC 1NA1C 3KGLA 1OPOA 1Z7S1 4Q0SA 4Q4V1 2RS33 3S7IA 4QGMA 1WGPA 4L8QA 5H9PA 3LSEA 2FBEA 2WJSA 4YGEA 1MQTC 3ZSJA 4CDUB 1ZZCA 4M3CB 2EXHA 4LNVA 2G9GA 1ZREA 3KSCA 3ZX7A 2Y38A 4WVZA 2WQZC 3JUUA 3AMNA 3MIGA 1NQDA 4FPYA 1KD7A 1DZTA 1WW6A 3D4KA 2NZ9A 1UX6A 5FCCA 1V9U3 1W0PA 5LRRA 4CDUA 2ZGNA 4I2OA 4LBNA 4BQ1A 1GYKA 3CJIB 2JECA 1HV1A 2VXRA 1PIV3 4FPHA 4LE4A 4Y22B 4S2HA 4QD2A 5JOXA 1BBT2 1XYOA 1D0HA 3L9JT 1BBT1 4IV1A 4XF4A 1PZ7A 3CJXA 4B4QA 4AF9A 2SLIA 1L3JA 2YDEA 1O91A 4AFMA 4I0WB 2VW2A 2JXAA 3KM5A 5ACA3 1RUG2 2A7AA 4XQ4A 3CO2A 1C3HA 1ZZ8A 4BMBA 1RUG1 4CP1A 2Z2SB 3MLKA 1XE8A 3M3OA 1FV3A 3EBRA 1KQRA 4Y22A 2P34A 3CU7A 4RR3B 4AQ2A 1CAVB 4JC1A 4FXGB 4XIOA 4KGGA 4Y1UA 1O4ZA 3FFZA 2A6WA 4YVSA 3ZFGB 4JV4A 4QPGA 4Y26A 3AP7A 4XZPA 5C8CC 2NPIA 5DZEA 3V0AB 2JE7A 1G6NA 1RUC3 4LO4B 2YZ4A 4LBQB 1QHDA 3T1MA 3SNMA 3HT2A 3PLQA 4AI2A 1AVBA 1IS4A 4W6YA 5IUQA 4HKWA 3H8UA 4XFHA 5JPNB 2OUJA 4BLJA 1A8MA 2CWMA 4RQPC 4XXAA 2ZHKA 2HWB2 5BYNA 2WFF2 1PHMA 2HWB1 4HLTA 2WFF1 5CFDC 2DCZA 1A78A 1NCQC 4NHMA 5FOBB 3NVCA 2QFEA 5GZFA 1UKRA 2VVFA 3GHMA 5J36A 1EY2A 4YW2A 3ZN6A 1O3RA 3B00A 4LUMA 1VB2A 1ZBA3 2MPFA 2ZKLA 3R4DB 2GN3A 3WW4A 3ZXJA 2C0ZA 1SLLA 2ZOEB 4CEYC 2IXCA 1DQ2A 4OHZA 3DKWA 4LEJA 2ZZJA 4X8NA 1VIWB 2ZJCA 4Y20A 1J3RA 3IWZA 2D43A 2XBO3 1KDMA 3WXPA 2JDZA 4MGKE 2JG8B 2ZMNA 4HSLA 1IZ3A 2FMDA 2A6ZA 3LSDA 3AYCA 2WA3A 4CDWB 1LOGA 1QOSA 3DL3A 3ZYRA 4DXZA 4XFGA 1SBEA 2WT2A 2IXHA 4AFDA 1NYWA 1AR73 2GC0A 2YUEA 2N7GA 4EWEA 2JG8A 4JDMA 5C9AC 5C4WA 3AZYA 1AR62 4A7ZA 1QJY3 3CEWA 3M3IA 2O8OA 4EN6B 1AR61 3ZYGA 5LEJA 1C57A 1G7YA 4XTPA 1RUOA 4ITCA 5B2GB 1WW4A 2I74A 4O9EA 5C8WA 4KWKA 3VBRC 5FPXA 2Q30A 2X8KA 4PQ9A 5ABJB 3RS6A 3VBHB 4ASMB 2WA4A 4EV0A 5KXBA 3MI8A 4JRLA 3RJ2X 5JI9A 4AEKA 3LA2A 4Q4V3 3J9SA 1B35C 2QZ3A 4BPZA 1O4TA 4WZFA 5I0SA 1LEDA 4HVRA 1W39A 2DFCA 3UKNA 4AG4A 3VBUC 3ALQA 3VBHA 5L19A 3WVJA 4DY5A 2QQPA 4KWLA 1LR5A 2OA2A 1CAXB 4P9XA 2QZ2A 2Z42A 5F1RA 2NN8A 1R1A2 1FPN2 1SEFA 3R0RA 5E1RA 2PYTA 2Y0OA 2CGPA 1R1A1 4V1PA 1FPN1 1E57A 4HETA 2V09A 2KXLA 1UL9A 3VZMA 1AZDA 4B7EA 1C28A 5LEKA 2WLQA 4RS5A 1VAMA 5JMCA 4DQAA 2JEMA 4JCKA 1CAXA 3GHNA 3ES1A 1H2MA 4QGNA 1WLTA 3AKSA 3UK9A 1BBT3 2A3YA 2FHRA 5FFOC 4XW3A 4OI2A 2WC2A 2B45X 3BODA 2XLAA 2P3IA 3AJYA 1YIPA 1CAUB 2CGOA 1RUG3 2UURA 2DUOA 2ZKNA 3VBSC 3R4UA 1SFNA 3K48A 4LBOA 3KCYA 4Q29A 2B9UA 4OULA 3DPRB 4R4ZA 4RHV2 4C1WA 2A6YA 4N43C 2GC3A 4RHV1 4IERA 2R063 2DTWA 2ZX1A 1J3QA 1LESA 4HANA 1JYCA 2K0GA 4XJUA 3BOWA 1NY72 1DQ1A 3NV4A 2QCSB 4LBLA 3P3PA 1NY71 3MDPA 4BOWA 3RMXA 2Z79A 3TN93 4BIFA 1RJ7A 4XJAA 4GMP1 2UWCA 2H6BA 1SDWA 3U11A 1J59A 1FYUA 3TAYA 1N3OA 1DF0A 4N53B 3DN7A 3ZSLA 5BNPB 5CFCB 1S0JA 4WM8C 4RGAA 2R042 4HN1A 4TLFA 2PHUA 2HWB3 1VR3A 2R041 3VL9A 2WFF3 1H8TA 1UAIA 1UU6A 5GZCA 4NWVA 4X8PA 5GALA 3WG2A 3ZXDA 2GNDA 3VHRA 5JZGC 5A32B 2HWF1 1TMF3 1KITA 1WMDA 2WNVB 2JICA 3UJOA 2R16A 2WQ4A 3AP4A 4M00A 1Q8OA 2WFPA 4ATFA 4E2GA 3RYRA 3U4XA 4GH4C 3KT7A 4YM2A 2BTVC 3VBFA 4AI1A 1QF3A 1WBLA 3A0NA 1ZM1A 1N1SA 2DWRA 2EIGA 4HKOA 1C4RA 2EXIA 3QACA 2WSUA 5BNNB 3OJBA 5DZFA 1H4GA 4N7UA 2PHXA 4GALA 4IV3B 1PMIA 2RJLA 1U12A 2UYAA 4I3PA 1MS1A 1C8M2 3OF1A 1QGLA 4C0HA 3RNSA 3S6PA 1PVC3 1C8M1 1QKQA 3ZO0B 2JG9A 2Q1ZB 4CTEA 5AFEA 3CJIC 3D8CA 3WDUA 2P37A 3DGTA 4MYEA 4Y24A 3LB9A 2IXLA 1MEC3 4JTNA 1S2BA 3MIHA 4CEWB 4PLNA 4Z8BA 4B4PA 3V56A 3O5SA 1LECA 3FLPA 1KRIA 4YZ2A 1B09A 4AI8A 4K9SA 4I0AA 3T1LA 3VKMA 1D0GA 2AR6A 5E8AA 4CDQB 1QU0A 4NHLA 4YGCA 1F31A 5D1IA 3SCGA 3O0VA 2ZCWA 4NWWA 2XJVA 1VBC2 4XE9A 1VBC1 3UKVA 1O3TA 1NXMA 1O5UA 2P3JA 2DVAA 4CEWA 4RR3C 4MXVA 4MGIE 2CYFA 1WMFA 1WUVA 1AX1A 3ZFGC 1IS5A 4JVAA 3NV1A 4LLFA 1RGSA 1C1LA 4W6XA 4PDWB 1RC6A 3V0BA 3EHKA 3FMGA 3O0XA 1ZZ7A 3JU9A 1VBA3 2YROA 3M3CA 1UKGA 1JOJA 2QVSB 2ZX4A 1S1AA 3B94A 2EXJA 4U2AA 1EYBA 3D6EA 1D4M2 4Q4W2 4QU2A 3VV1A 4A7YA 1D4M1 1OLQA 4K3UA 4Q4W1 1C5HA 5JCTA 2QNKA 1BEV3 1LENA 3LA7A 1Q8VA 1Y43B 1H9PA 2NMNA 5T55A 2R30A 4XFBA 2W08A 4YG6A 2TUNA 1MZEA 2BVBA 3IKWA 4H55A 2D6NA 3I8TA 3WLUA 2BBVA 1NZCA 2VVDA 5JIAA 1SLAA 2I07B 1DQ0A 3KT4A 3ZYJB 1K5MB 4LBMA 3W58A 5EFUA 5I8TA 4FO9A 3H1WA 1PZ8A 3NKGA 5FO8B 1V9U2 1H4HA 2UWAA 4GA9A 1V9U1 5EXOA 2VW0A 1WBFA 5K0UC 2JJ6A 4Q8LA 1H30A 4BM8A 5LK7B 2WL1A 1BK1A 4UBHA 3EQEA 1OPMA 4CDWC 4GMP3 5IK7A 3IIAA 4P9JA 4LHKA 4PCRA 1IQAA 1YFWA 2BNNA 1MZ6A 5GZEA 2VGDA 5ACA1 1JYIA 2ZGTA 3ACLA 5DUVA 1V6IA 4G4FA 4TWTA 1O7FA 2AENA 1UU4A 1JUHA 2BVVA 5AVAA 5I8YA 3ZSMA 4AVTA 1J58A 2DU1A 3TB0A 2XH6A 3ZPYA 3HQXA 1HRI3 2XKOA 4C90A 1OQDA 2DURA 3UV9A 2B5HA 1ND3A 2K2SA 3WW1A 3AKRA 3ZFEB 4JGYB 4PBOA 5ABJC 1ZBE2 2D7FA 1O3SA 3VBHC 1S2KA 4M0HA 1ZBE1 4LE3A 1F2NA 3H9AA 4J1WA 4KH9A 4JGZB 1LGCA 2DCKA 2WINB 3POWA 4BHPA 2ILMA 2VMGA 1DU3D 1H9WA 1YLLA 5IK4A 1UMZA 5FO7B 3VDDA 4Y1ZA 1XNDA 4CP0A 1W6MA 2X5IA 2Y26A 3E5XA 3ME2A 4L92A 3AZVA 4YARA 1XYNA 4XXPA 1GV9A 4XHBA 1ASJ3 4UXAA 1MZFA 4DY3A 3LGRA 2BWCA 2CL2A 3AMHA 5E89A 4GB33 1YI7A 1CVNA 3MF9A 2IFRA 5JAXA 2XJUA 2WNUB 4LBJA 2GC1A 4EN7B 3ZFFA 2XVGA 2GMMA 2RS12 1C8M3 3OD0A 3SH3A 1X8MA 2GDFA 2RS11 3B93A 1QH7A 3WDYA 4Z82A 4C1XA 4F3JA 2XLGA 3RJRA 5KHGA 3WCRA 4P9WA 1IPJA 2ZGRA 1QJU2 4LO7A 4EJRA 1LHNA 1QJU1 2UYBA 2D40A 2VVEA 2D98A 2XBO2 4HFSA 2DTYA 1DQ6A 2WT0A 2XBO1 3OY8A 1F5JA 1CJPA 5IK5A 4QQLA 2NYYA 5J96B 4XQDA 1OOPA 4LA3A 3AYDA 2D6LX 2O0OA 2EF6A 4AGVA 1VBC3 1OD5A 1Q43A 1U5ZA 3DPRC 2Z69A 3IPVB 4MXWB 2HWC2 4AEDA 5HCAA 5GJ6A 2YY1A 1YUDA 2HWC1 3KCXA 4CDXA 5F6KA 4HPKB 4XJZA 1AXYA 4OHWA 5JOZA 2XL9A 1W6QB 3MGUA 4YM0A 1AR72 2Q5TA 1QMJA 1AR71 4XMAA 2VQ0A 3PJQA 3WY6A 1DZRA 1NCRC 3QCWA 4MXWA 5KWRA 2B7YA 1PVXA 1VBE3 4N53C 5BNPC 2KM2A 4EROA 1QNWA 1D4M3 5CFCC 2I45A 2XJPA 4ISQA 5BXXA 4AI3A 1FNZA 2I2SA 1S0FA 1PO13 3ELNA 1X82A 2ZAAA 4XILA 4AFAA 2DYCA 2WIIB 3I2DA 5F5QA 2DFBA 3B69A 5EYXA 2VMHA 1HLCA 2XLFA 2WNVC 4W6WA 4FPKA 4IEXA 2MHFA 3WX5A 3M70A 3C3VA 2UWBA 3WUCA 1HXS3 2WNEA 2EALA 2CY6A 4DINB 3R4SA 1W2UA 3Q9OA 3ZXGA 4KQ7A 5J48A 2R0HA 1JN2P 3KCCA 4IV1B 1EP0A 4MGZE 1YCIA 3NSTA 2D93A 4Q4X2 5BNNC 3APBA 4LA2A 4Q4X1 4GWMA 1XU2A 4WZCA 1X50A 4IV3C 4EWDA 3FBMA 1RUD3 2E63A 1UD1A 2VULA 4B4RA 3OGGA 4NOTA 4FQ4A 1ZZ6A 4TSVA 5C33A 2XJQA 3X29B 4YSFA 5GZDA 4LO6B 2WZPP 2XL7A 1EPWA 1BJQA 3FZ3A 3AP5A 4YVSB 4YW5A 4YGBA 2ZMLA 2ZGPA 4QPGB 1RIRA 4CEWC 3WINE 1RMU2 1REFA 2IXJA 3WZ1A 1RMU1 4LO8A 1QDCA 4XFFA 2GC2A 3JB8A 4D7TA 2LALA 1PK6C 3GBWA 1JH5A 2R062 2Q0AA 4CDQC 3ZXKA 2R061 4KGQA 1WW7A 4AFBA 1G9BA 3N7JA 4S2DA 1S0BA 2DVFA 1MR5A 1CIWA 1ZBE3 4MH0E 3TN92 1YIFA 2VUAA 2ZX3A 3TN91 3SH5A 1R1ZA 2HEVF 1FI2A 1IS6A 2OZ6A 1HDKA 2R073 5E88A 5J98B 1HQNA 1ULFA 2GAUA 3JZVA 5L7OA 1HW5A 4M01A 5D8AA 4PDWC 4AE2A 1W6PA 3ZN6B 2BEOA 2LTNA 5GM0A 2EXKA 4NO4A 1F9KA 1C1FA 1RHI3 1LOEA 5FQ0A 2RE9A 3VBOB 2ETEA 2V5YA 3USUA 5F9TA 4HKLA 4OUMA 1YXWA 5CNAA 1ZVFA 4Y20B 1ZRDA 3O14A 1TMF2 1XXNA 3OD4A 5I0RA 1KJRA 1WLCA 1TMF1 2R0FA 2RS13 1PNGA 5DZGA 3M2MA 3NV2A 2VECA 1I9RA 2YHJA 3DUIA 3OTFA 5JDBA 5JIUA 3SCFA 1MS4A 2OYZA 1Q3EA 5BY5A 2XUMA 3VBOA 4Y1VA 1YFXA 1OLRA 1QJU3 4Q0UA 4ATEA 2YXSA 2VU9A 3VHNA 1Z78A 2ZS6B 1YRZA 4I0BA 2MEV2 2ZZQA 1J1TA 1SCRA 1K5MC 1UIKA 2MEV1 4JTOA 2IWGB 5TSWA 1D2QA 2WKKA 2HEYF 2HWE3 2XGXA 3QLQA 4FXKB 1VRH3 2FMYA 1PO23 4KBBA 5C4WB 4AHZA 1S0EA 1N47A 2JKBA 4DOUA 5K7PA 3HBZA 2HWC3 1PVC2 2IZWA 4L97A 1PVC1 5F6LB 2XJRA 1RVF3 1W6OB 4D7YA 4KU8A 3ZIWA 1MEC2 4ZU5A 3RDIA 5KC6A 1MEC1 3B9IA 1OQ1A 1OHFA 4K7JA 1BVP1 2E51A 3GALA 3N4MA 3J26N 5H9SA 1N1TA 4SBVA 4EWAA 1N1YA 5FLIA 4DFSA 1DBNA 3WDTA 2DUQA 2F6BA 1W6OA 1SACA 3JBG2 1DYPA 1DYKA 1HIXA 1GSLA 2GSYA 3RPQA 3JBG1 2YC0A 1I1EA 5LK5A 4MGYE 3MICA 2XB6C 4HZFA 2DF7A 2A6XA 1HQLA 1I5ZA 3L2HA 1DZQA 4ZXKA 3TBDA 3ZFEC 1HRV2 3AX4A 4JGYC 1I3HA 4MV2A 1HRV1 1OA4A 1POV3 5EZWA 3W59A 4INDA 4Y5Z0 4JGZC 1VBA2 2GNBA 2HWD2 4Q0PA 1YO8A 1VBA1 2HWD1 5JOYA 2D6PA 3H7YA 4RS5B 1A3KA 2YMZA 5T5OA 5FREA 5EWSA 1Q8PA 3KGZA 3RYKA 4FPOB 1GANA 5I0TA 1WCSA 3OYWA 2A3WA 2JENA 4Q4X3 4AFCA 1QDOA 1BEV2 5KHKA 2BFUL 1ND2B 3H50A 1BEV1 4QPIB 1PGL2 4QQHA 2ZGUA 3PMSA 3SISA 3WHUA 2WNUC 3FWEA 1VJ2A 1SLIA 4CRQA 4YZ1A 4LT5A 2QKDA 1CQ9A 2UU8A 3VHOA 2C1FA 1LU1A 3I59A 5FLHA 5HBAA 1WMEA 5SV5A 4QM9A 1A8DA 1IHMA 4Q4Y2 1ND2A 4QPIA 3KMHA 1MVQA 5I0UA 3RQ0A 4Q4Y1 1CGPA 3DF0A 4HT1T 1BXHA 1RMU3 4AVSA 4OI4A 4Q1RA 2E6VA 4Q8KA 4YW4A 2ZAHA 4AVBA 1DGWA 2W0XA 4OVEA 1QJZA 4EN0A 2OW4A 5BNQA 4WM7A 5I93A 2GZWA 2ZHMA 3HIFA 4TZDA 4YFZA 1LULA 1Y7BA 4H3WA 3WD5A 5T5JA 4AHWA 2VMIA 4FCAA 1H8TB 1QWRA 2DUPA 4YVWA 3BPZA 1ULEA 4IEYA 1LOFC 1UW8A 3N35A 2ZGKA 1H2LA 2A71A 3FLRA 3H1YA 5CB7A 5A33A 4B3NA 1FV2A 1SBFA 1SCSA 2WWSA 4B8EA 4A3XA 3S0MA 1RB8G 1CX4A 3URFA 2ES3A 3GNEA 1HRI2 1UZYA 3VBFB 2CAVA 1HRI1 2BNMA 5K8SA 2ZA9A 5FBZA 2HEWF 2OPKA 1KS5A 2OIIA 2A5ZA 4HBNA 5T3NA 2C5DA 2D6KA 1QY4A 3A4UA 4UW3A 3VZLA 4LO5B 1AUYA 5JSPA 1H8VA 4ONUA 3MZHA 4SLIA 1GZ9A 2GMEA 4N90A