4FAGA

Crystal structure of the salicylate 1,2-dioxygenase from pseudoaminobacter salicylatoxidans w104y mutant in complex with gentisate
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
362
structure length
362
Chain Sequence
LDHESVTQAMQPKDTPELRALYKSFEEESIIPLWTQLGDLMPIHPKSKAVPHVWKWSTLLRLARKSGELVPVGRGGERRALGLANPGLGGNAYISPTMYAGIQYLGPRETAPEHRHSQNAFRFVVEGEGVWTVVNGDPVRMSRGDLLLTPGWCFHGHMNDTDQPMAWIDGLDIPFSQQMDVGFFEFGSDRVTDYATPNFSRGERLWCHPGLRPLSGLQNTVASPIGAYRWEFTDRALTEQLLLEDEGQPATVAPGHAAIRYVNPTTGGDVMPTLRCEFHRLRAGTETATRNEVGSTVFQVFEGAGAVVMNGETTKLEKGDMFVVPSWVPWSLQAETQFDLFRFSDAPIMEALSFMRTKIEGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Gentisate 1,2-dioxygenase
publication title The generation of a 1-hydroxy-2-naphthoate 1,2-dioxygenase by single point mutations of salicylate 1,2-dioxygenase - Rational design of mutants and the crystal structures of the A85H and W104Y variants.
pubmed doi rcsb
source organism Pseudaminobacter salicylatoxidans
total genus 98
structure length 362
sequence length 362
ec nomenclature ec 1.13.11.4: Gentisate 1,2-dioxygenase.
pdb deposition date 2012-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4fagA01
2IXLA 4K8FA 4IETA 5FPXA 1RTVA 3OD0A 4QGNA 2FMYA 3S7IA 2Q30A 3H8UA 4F7ZA 4E2QA 4I02A 4XF3A 1ZRDA 2GC3A 1J1LA 1EP0A 4IEUA 2Q4SA 4XFAA 2HKXA 1ZRRA 5KHIA 3FHIB 3E6CC 4EWEA 4H7LA 2XHKA 2ET7A 2GH2A 1X8EA 3WW1A 4O9GA 1NE4A 1OD5A 1CX4A 2BYVE 3ROUA 3MZHA 3KGLA 3QOPA 3RYRA 4N9HA 3U10A 2IXHA 3LWCA 4A2UA 1V70A 4LA3A 2E9QA 5BY5A 4XFIA 4P9GA 1G6NA 2BGCA 1OMIA 4J1WA 3E5XA 2ZKLA 2EA7A 3OCPA 3U11A 1QXRA 5LEKA 2IXCA 5F1RA 2PAEA 3S7EA 2EAAA 3HT2A 2EVXA 3BCWA 4KWKA 4AVAA 5FLIA 1TQ5A 1Q43A 2QNKA 5I0TA 4I01A 1LRHA 2PTMA 1DGRA 2VECA 2OA2A 4XFFA 4ZU4A 4MV2A 4DINB 1YFXA 4LA2A 4JTOA 2UYAA 2H6BA 3H1WA 1Y3TA 4QX5A 3RZZA 1J59A 3RYKA 1H1IA 2C0ZA 3CEWA 4HMZA 5FQ0A 1ZREA 4IEVA 1UPIA 4QM9A 1ZRCA 1OFNA 3C3VA 2CAVA 3ZDSA 3WW4A 2IXJA 2KXLA 4IEQA 5AVPA 1NXMA 3NJZA 4Q29A 3E97A 1PM7A 3EHKA 1VJ2A 4XF9A 2B8MA 4ONUA 5C8WA 4FBFA 1ZZBA 5I0SA 4XF4A 5BXXA 3IWZA 1UW8A 2F4PA 3JZVA 4NVPA 5KBFA 4PJYA 2BNMA 5I93A 2QJVA 1FXZA 2V09A 4I0AA 2PAKA 2K0GA 1CAUA 3OGJA 2PHDA 3H1MA 3H3ZA 4IEWA 4WZCA 1X7NA 4R52A 2XLFA 4MGYE 5KHHA 5FQ0B 5J48A 1YHFA 4YNIA 2CV6A 1OI6A 4UBGA 3MPBA 3D0SA 4TLFA 3USSA 4Z07A 2OZJA 4MUVA 1EY2A 4JTNA 2XL7A 2XKPA 1NYWA 4L2NA 1O5UA 3BALA 2BNNA 4XEZA 4HZFA 3PVBB 3UKNA 4LUKA 3DN7A 4MZUA 3LOIA 3I7DA 1Q5OA 5FPZA 5BUVA 5EFUA 1ZX5A 3PNAA 4WBBA 3LZZA 1XRUA 1ZZ8A 3BU7A 3NL1A 4LULA 4OFGA 1CAUB 4BHPA 5JAXA 3ETQA 4EV0A 3RDIA 4LEJA 1QXJA 5JSRA 4Q0VA 4IEOA 1RL3A 3I59A 4XF0A 3D82A 2GC0A 4HLTA 4I09A 1O7FA 2I45A 2N7GA 1ZZCA 4KU8A 4MX3A 1RUNA 1XE8A 2O1QA 1CAXA 2P17A 2B5HA 5CVRA 1GQHA 5I91A 1GQGA 4IEYA 2GU9A 3ES1A 1YFWA 1PMIA 2PHLA 3ES4A 2K9ZA 2IXKA 2XLAA 3IBMA 4IERA 3HT1A 3S0MA 4BYYA 4HN0A 5FCCA 3SXWA 4FAGA 3TNPB 3I59B 1ZRFA 2B9UA 4MGKE 4X6QB 3E6BA 1J3PA 3GBFA 1YFUA 5LRSA 3CJXA 4EWDA 2VQAA 3OF1A 2PFWA 4RD7A 5D1IA 1CAXB 5FDBA 3H1YA 2OZ6A 3QACA 3ACLA 3R6SA 1FT9A 1DZTA 3M3IA 4MH0E 4HVQA 5CADA 1CGPA 4XFBA 3FZ3A 1O3QA 3H3UA 4OLLA 3GYDA 1LB2A 2CGPA 1O3RA 2Z2SB 5LRRA 3CO2A 4E2GA 1FI2A 4LLOA 3FE5A 2BEOA 4KWJA 4ZU5A 3KGZA 2DCTA 5KHJA 1ZZ7A 2QDRA 1VR3A 3LA3A 3H7YA 4FT8A 5HI0A 2QVSB 4PIXA 2GAUA 1LR5A 2XKOA 4HN1A 1HW5A 4ZU7A 4QXKA 5FLJA 5LEJA 2H6CA 4KU7A 1J58A 3UKTA 1SFNA 4XFGA 2GC2A 3U0ZA 2GZWA 4YYOA 3SHRA 4QGLA 3FX3A 1DZRA 4B29A 5T3NA 4XF1A 4I2OA 2ETEA 3I54A 3LAGA 4J1XA 3KMHA 4O9EA 1J3QA 3IDBB 2UY9A 3PLQA 3E6DA 3BB6A 3UKVA 1LKNA 4D7TA 4PIYA 5E1RA 2QCSB 3L2HA 3FFQA 4IEXA 1YLLA 3D0JA 3H9AA 3N4MA 2CAUA 2PYTA 4PIZA 3CL1A 4YRDA 2OPKA 3SCHA 3WW3A 1IPKA 3RYPA 4CYDA 5C6CA 1ZZ6A 1CAWA 4KL1A 3EBRA 4X6RB 1CAVA 4IEPA 4AQ6A 4HVOA 3NW4A 5JSPA 2Q1ZB 4I0BA 5I8TA 3H50A 4EROA 1H1MA 3B02A 4XFCA 3LA2A 3MYXA 4F8AA 4LTAA 5BV6A 5KHKA 1RUOA 2ATFA 3NKTA 2UY8A 2PA7A 5J7MA 1YUDA 3RPQA 2MHFA 1QWRA 1J3RA 3DL3A 3HQXA 3O14A 2MNGA 1X8MA 4AVBA 3CLPA 3IDCB 4GULA 4IESA 3H7JA 1Y9QA 2GC1A 1CAWB 3MDPA 4D7SA 4QMAA 1CAVB 4I3PA 3CF6E 3M70A 2UYBA 5BPXA 4JVAA 1NE6A 2HJIA 2PAMA 1UIJA 1EPZA 3EQEA 1ZVFA 2Z69A 4XETA 1YFYA 1YWKA 5EZWA 2D93A 2H0VA 4HBNA 4KWLA 2BNOA 2D5HA 2WC2A 3WW2A 1SEFA 1I6XA 1RC6A 3RNSA 1QY4A 1U12A 3KSCA 4Q0PA 3SCGA 4LUMA 4ORFA 3G7DA 1ZNPA 4WVZA 3KCCA 2IXIA 3ELNA 1WGPA 4IEZA 4EWAA 4BH9A 3EO6A 5E16A 1IPJA 2PQQA 4AXOA 2D5FA 1UIKA 1Q3EA 3HIFA 2O8QA 5I0RA 1L3JA 1WA4A 4Q0QA 1JUHA 4QGMA 4MGIE 2Y0OA 5K8SA 1X82A 4HSJA 4E2SA 2XL9A 1I5ZA 3E5QA 5CU1A 5FLHA 4UBHA 4MGZE 3DKWA 2XLGA 1DGWA 4XFHA 2ET1A 3EJKA 1UD1A 4META 1NZCA 4Z82A 4YARA 1XE7A 4R8HA 3TNQA 4QM8A 5JR7B 4FAHA 4HVRA 4N9IA 5J3UA 3FWEA 3LA7A 4BIFA 3BPZA 3NVCA 3SMHA 1EYBA 1O3TA 4AVCA 4L11A 1ZZ9A 5JCTA 5I8SA 5I8YA 2ZCWA 1O5LA 3IIAA 4AQ2A 1UCXA 3NSTA 5JSOA 2Q0AA 4UXAA 4HSLA 3SCFA 5KHGA 3ST7A 4YSFA 3FJSA 4Q0SA 1SQ4A 1O4TA 3E5UA 3DV8A 2MPFA 2VPVA 2WFPA 2FQPA 4Q0UA 1RGSA 1WLTA 1VP6A 2XGXA 2OYZA 4JV4A 1O3SA 2IC1A 3VHRA 2D40A 5I0UA 3OTFA
chains in the Genus database with same CATH superfamily
1H6YA 2RMU1 2A3XA 1B09A 4IXLA 4LE3A 1LGBA 1LHWA 1WMFA 1N1YA 1OF3A 3ZMOA 4QXBA 2Z42A 4GB31 1Y9MA 4C91A 3H8UA 4F7ZA 5LBFA 4XF3A 1H2KA 2G9GA 3PIJA 1ZRDA 4LHSA 1J1LA 1EP0A 3P6BA 3ZFFC 5HPOA 4DXRA 1UKGA 4RHV2 2HKXA 2WQ4A 2BDRA 1UYPA 1O6UA 3W58A 1WCDJ 4H7LA 3ZPYA 5M0TA 4A7KA 5C3PA 2EIDA 2WS92 2QQNA 2WNUB 2VVDA 5LW9A 1X8EA 4FTEA 1WBLA 2ZHNA 2AZ5A 5FPLA 4GALA 3ZSEA 1OD5A 3HWJA 3O1OA 5H9QA 3THPA 1A6CA 1LULA 2I07B 1JYNA 3KGLA 2GNTA 4JAAA 1BQPA 3LWCA 1MEC2 4A2UA 3ABZA 1BZWA 2JDUA 3WV6A 3WF3A 2WFF1 4LA3A 4LBMA 2DCJA 5BY5A 2ILMA 1CVNA 1G86A 2BOIA 1G8WA 1PZ9A 3WP4A 2R062 1UZZA 5FMOL 1RUG3 1BVVA 3VKFC 3ZFFA 5DG2A 2BGCA 2ZPXA 3KV9A 1WCQA 4J1WA 3M3OA 1QXRA 2IXCA 2ZZJA 2BW8A 2PAEA 1ND3B 3W59A 2VTXJ 4D7YA 4QDRA 3N7MA 2VBDA 2XUEA 2ZTNA 3ZYPA 2X8KA 2JDNA 3JCIA 5A33B 4Q4Y1 1RMU2 3RRDA 4NIIA 3VZNA 3MLLA 2D43A 2OA2A 2ZGTA 3PURA 4XFFA 2VMGA 5F3EA 4ZU4A 1VBC1 2YBKA 3O0VA 4AFMA 3BYWA 2WNVC 4B1LA 3ZFGB 3RYKA 2GN7A 5AC93 1JOPA 4N53B 4RYDA 5EV7A 4AAXA 1RUF3 1YEWA 1W0OA 4P08A 4A7ZA 4CCOA 4JHTA 1NCQB 2PHXA 2CY6A 1D4M3 1QF3A 3AL6A 1ZREA 1UPIA 4QM9A 3VHNA 4PDWB 1YQ8A 3LEIA 3C3VA 2CAVA 4GJZA 5FR3A 3S5AA 3WW4A 3VDAA 4Z2AA 2YC2A 1VMHA 3J7HA 4XHBA 1UMZA 2KXLA 2R043 4IEQA 1NX9A 2WO1A 5DQ0A 3NJZA 3WDWA 1PM7A 4RFT0 3EHKA 1MZ6A 4XF9A 3V0BB 1S55A 1IG3A 5GZEA 4XBNA 5C8WA 1UU4A 5I0SA 4S2DA 4Y22A 1MVQA 3N7LA 2WNVA 3OBRA 4M3CE 4XVHA 4CU7A 1CZTA 2YPDA 1UW8A 2W95A 3N9MA 4TXWA 1AR92 4PLNA 3DUIA 1AUYA 3ZMNA 2Z4FA 4NUBA 4Y5SA 4UFKA 1FXZA 4I0AA 2PAKA 3KD4A 4AFDA 4DY5A 1OXCA 4MXWB 1LNSA 4LBQB 5FZLA 3OGJA 3H1MA 4IEWA 4HFSA 2A6VA 5JZGB 3Q8BA 1QDOA 1R082 2B46X 5FUIA 1JYCA 3I2FA 3POWA 3T09A 3VDCA 2CV6A 3I8TA 4NO4A 3F95A 1SLTA 1LOBA 2PXJA 3KT4A 3H8OA 4JDNA 3USSA 2ZMKA 2V4AA 2DWRA 2E63A 3AKTA 3CZJA 3NNMA 3DXTA 1IS4A 1HDKA 1UX6A 2FMDA 1AJKA 2KA3A 2OZJA 1C4RA 4MUVA 5JI7A 4FO9A 1C28A 1W9YA 2CDPA 3H8XA 1RUG1 1MS4A 1YRZA 4A3XA 5F5CA 1GWLA 1PGL2 5ISLA 2IVIB 5A7WB 3J7LA 2XJQA 1N47A 1XC6A 2ZX0A 5FPZA 4PQ9A 3WDTA 1KEXA 1T6BX 4OMDA 5BUVA 5A32A 5F5QA 2ZGKA 1AL22 3LOBA 1YIPA 1WW5A 1DDLA 4IL7A 3BU7A 1KFUL 2A75A 4OFGA 4A6SA 4EQVA 2YHJA 3TEZA 1JW6A 4YW5A 2W3JA 3ZYIB 2J42A 4FP3A 1QXJA 1S2BA 3N9NA 3OUJA 2D6NA 2CYFA 3K4ZA 3N7KA 4JGZC 2D97A 1QJY2 2RM22 1NLSA 2Y34A 4CDUC 4IEOA 2Y6KA 2AREA 5A70A 2VAUA 5GKAC 3VHOA 2YFUA 4NHLA 1O7FA 1SLLA 4LBOA 4LO6B 2JENA 4TN7A 4DNYA 2BFUS 1U5YA 2HWF3 3CJIC 5AC91 5A3UA 4LMFA 3MFCA 3W5MA 1W2NA 1RUNA 1G9CA 1POV0 5FKBA 1RUF1 2ZOEB 3ZO0B 5ANNA 2O1QA 2ZZQA 1BCXA 1W90A 1D4M1 2RJ2A 3OEAA 5F2WA 4AF9A 1PO23 2C24A 1PIV3 2VVFA 2VCAA 5JOXA 1GQGA 3MO4A 3ES1A 3GXUA 5AVAA 5FZOB 5LA0A 2R041 3ZN6A 1FV3A 1WD3A 2TUNA 1AYN2 1PMIA 2PHLA 4AEJA 1OF4A 1YCIA 4HK8A 4AGVA 3LDKA 2ZGSA 1HRI3 4JGZA 4NRQA 4ZHNA 2K9ZA 4CDUA 1GP5A 2ZX4A 1L7LA 4AGRA 2IXKA 2LRPA 3GJBA 1GLHA 1TNFA 1W8HA 2EICA 4AVSA 3OGGA 4AK3A 4O7XA 3T2QA 1CIWA 4AHWA 4FPYA 2JG9C 3CJIA 2BOJA 4HN0A 2JG8B 1WW6A 4RGGA 1K12A 4K9SA 4XUPA 3TNPB 4A6OA 5T55A 1V9U3 1WCUA 1C1FA 2VBBA 1J3PA 4D3WA 3D6EA 2DURA 5LRSA 2QQJA 4JGYB 1W6MB 4EZHA 1Q8SA 3OF1A 1NZIA 2PFWA 3N9LA 2SBAA 3OJBA 5FYBA 5C9AC 1MR5A 5CEHA 2R072 4DPNA 5A1FA 2WIIB 2VZSA 4BDVB 3HJRA 1NT0A 3A21A 4FTSA 4BQ4A 4LBKA 2DVFA 2VMHA 4LKSA 4AI8A 5F7UA 5JR2A 2XOMA 5FPVA 1G9DA 3IDEA 3LD8A 1O3QA 4MYEA 1ZM1A 3K4AA 3VZLA 1HJFA 3HQRA 3IMMA 3QH7A 3CO2A 2AEYA 2Y33A 2DU1A 3U1XA 2JE8A 5T52A 3R4UA 4XIKA 5FXWA 2BEOA 3PJYA 4KWJA 3PU3A 5FZEA 4MGQA 2JDPA 1V6MA 1BLZA 5C5TA 3ZKYA 4P14A 1DQ5A 5C9AA 1OSGA 5JDBA 3H7YA 1EAH3 1UX7A 2WR9A 1RUD3 2YV8A 3WD5A 4ISRA 1RXFA 2QVSB 2WABA 2GAUA 3FHQA 3WDYA 4HN1A 3ZLIA 1FATA 1AXYA 5DUVA 3RMXA 1AR82 1ZBE2 3N36A 4XQDA 1TE1B 3UKTA 2CWMA 3POIA 1SDDB 1LHVA 4UW6A 5EYXA 3TB0A 4ZXEA 3T1MA 4AQSA 2ZGUA 4LHLA 2C4XA 4B7KA 3RZJA 2HWF1 4JHZA 4YW7A 4R9CA 2AEZA 4BOWA 4QGLA 2JJ6A 2XWBB 1TME2 2D6OX 2BBVA 4ZZ8A 5T3NA 1PO21 1PIV1 3QBQA 3O1TA 1MPXA 2XR4A 1C3HA 1LOGA 1UY0A 3I54A 3ZIXA 2WYFA 4IE0A 2UY9A 2PMWB 3PLQA 3E6DA 4CXXA 2GP3A 3BB6A 2VW1A 3I3DA 4HPKB 1Q8QA 4XBLA 5EJZB 5FYUA 1LKNA 1HRI1 3ILRA 3RFRA 4IEXA 1FX5A 3OGRA 4PF1A 1Z78A 1US2A 3V0AB 4OZXA 1IQDC 1W0NA 1ZBA3 2VZTA 2WWSA 3LEKA 4Q4V2 1IPKA 4XZUG 3DYMA 1UU6A 3UETA 2WWJA 3FUQA 2VXJA 4ES8A 1JYWA 4CYDA 1S4CA 2JB8A 2QQVA 1V9U1 1CR7A 2VR4A 1AX0A 3EBRA 4DQAA 4W6YA 2BTVC 4B7EA 1E5SA 1K5MB 5LBEA 4WVMB 3GGLA 4MXVA 3WUCA 1W3VA 4D0QA 3TAYA 4COUA 3B02A 3TEXA 5FYIA 1UO9A 4Q4X3 5FYMA 5IAXA 3LA2A 1CJDA 2XG3A 2J1SA 4YZ5A 3C7EA 1FNYA 2VTFA 1DFQA 4FPOB 3MIFA 1R1A2 2E53A 2UY8A 1S1AA 5K4LA 4F3JA 3NNGA 2A73B 1FYUA 1YUDA 3ME2A 5FRAA 4AQTA 1OLME 3DL3A 4HT1T 3A0KA 2VQ0A 2WZEA 5CG9A 1JXNA 4CE8A 1HRV3 3OYWA 3BIEA 1CAWB 2VULA 5B4XA 1ULEA 4D7SA 1EAH1 1EPWA 1RUD1 3BIWE 5A7SA 3CF6E 2UYBA 1W6OA 3MLJA 2E33A 2PAMA 5BNNB 4CA9A 3KVBA 2R16A 2Z69A 1Q56A 1GOHA 1QH7A 1VB4A 4XXPA 3SEEA 3WNKA 3SNMA 1YFYA 3BU0A 2H0VA 1DP0A 1V6LA 3L2YA 4KWLA 1ODNA 5IK8A 1A34A 2RJLA 1NCRB 2D5HA 3KV4A 3UJQA 1WBFA 1SEFA 3NJYA 3W9AA 3CNAA 2WN3A 1RC6A 1XXNA 1JYTA 2UURA 1U12A 1XNBA 4WV8A 3VBRB 3KCXA 2XVKA 4LUMA 3LPGA 2W46A 3KCCA 4FQZA 3ELNA 2QBXA 2FHRA 1ZRIA 4TSVA 3OD4A 3IAPA 1ALYA 4W6WA 4YVSA 4EJRA 2VMFA 5CYYA 4GAZA 4Z1VA 5DPNA 3AP4A 2D5FA 3ORJA 5J09A 2RJKA 2W92A 1JN2P 4JKLA 5BNPC 5GLVA 2JD9A 4CCLA 3WP5A 4NIAA 3IAQA 2VW0A 4OHZA 1UYYA 2RS53 4Q0QA 4MGIE 1ZBA1 4XTPA 5IVCA 1VAMA 4RGAA 1W8OA 4Y1YA 2QZ2A 1KDMA 3PMSA 5FWJA 5K8SA 3G6JB 4YZ4A 3B7MA 3MW3A 4HSJA 5LBCA 2XL9A 2FCTA 1KJLA 2VH9A 5F2SA 2Q1MA 2QDNA 5FLHA 5IVVA 4NIDA 4UBHA 1OUSA 3ACIA 2W39A 4ZS2A 5CKNA 2XLGA 1POQA 2DTWA 3U07A 3ZR5A 4EE2A 3VD9A 5BNOC 4Q4X1 2I2SA 3O0WA 1UD1A 3LSEA 3SITA 4Z82A 1WUVA 4O65A 3P5BA 3WNPA 1WLCA 3PUHA 2VG9A 3FWEA 2BVVA 5LATA 3KF5A 4RSUA 2OKXA 3UV9A 1MS3A 5BNPA 3AYDA 5A3NA 4TZDA 2W5FA 4OHYA 3RZLA 1JZ3A 1EYBA 1PZ7A 2BRTA 4O61A 4AVCA 1UY4A 1ZZ9A 4B1MA 2E31A 1OPOA 1UU5A 3SH4A 2JICA 2ZCWA 5LA9A 1O5LA 4AQ2A 2PQSA 3NSTA 2Q0AA 3NV4A 5GZCA 1HRV1 1SPPB 3MV11 3SCFA 1T6GC 1W6QB 5KHGA 4XJAA 1BBT3 1BMV1 3FJSA 4U2AA 1OA2A 2LW8A 5T5LA 5BNOA 5GZGA 3DCQA 3E5UA 4HONA 1HB3A 2D6LX 3U37A 4OI2A 4NJ4A 4QPGB 3OY8B 3S30A 1X50A 4HKOA 5J96B 4AE2A 1E57A 4BMBA 3D5OA 5FZMA 3KLSA 4GKYA 3NV1A 3LFMA 3PUQA 2P3IA 4JV4A 2IC1A 3VHRA 3O0XA 4NMIA 1F5JA 3M7AA 4A3ZA 4MSVA 2C9KA 4CDQC 3FMGA 2LM3A 4XJZA 2WNVB 4K8FA 1K5JA 3R0RA 3CMGA 3TN93 3IT8A 3VLBB 4N8MA 4E8CA 1CZVA 3MIEA 4YWAA 3S7IA 4XJ8A 3VBOB 4I02A 1JU3A 4AEDB 4IV1B 3WSOA 3OSDA 2AR6A 2Q4SA 4LKDA 2K46A 5DUXA 2WSUA 4QX3A 3BPSA 1ZRRA 5KHIA 1S0CA 4LIUA 3HBKA 4EWEA 2QTWB 1OVSA 4UOJA 2ET7A 4CVUA 2HLEA 1C8M2 2XPJA 1DGLA 2RS51 3PUIA 1O8PA 4OMCA 3JB4C 4XDQA 1KS4A 1CESA 1OFSA 4CDQA 3I3EA 4BCUA 5IHRA 1KDKA 4QQOA 4XXAA 2IXHA 3VZOA 1V70A 1GP6A 2EIBA 1JHNA 1H8VA 1IKPA 2E9QA 1XNAA 1OH4A 1ZA7A 3J26N 5DG1A 2PHTA 3BN6A 4EYUA 2Y6HA 5IVJA 1VBB3 2P6CA 4L0PA 4XC9A 5A32B 3UJOA 3ZYHA 4CXWA 5A1AA 5C4WC 5IK7A 1PGW2 2XQXA 1V6JA 4QPIC 5EHDA 1W3XA 2EA7A 4GJYA 4LJHA 4K40A 3O12A 3U11A 2ZACA 3MF9A 5LEKA 4RR3A 2A70A 2VUJA 4AVVA 3AVSA 2W2IA 4RA0A 5T5PA 1AX2A 2ZAHA 1R093 1W8UA 2EAAA 1YI9A 2ZX2A 4AVTA 2W1WA 2EVXA 1MVEA 5FLIA 1TQ5A 3AP6A 5GLTA 3TEYA 1RUJ3 1JZ2A 1XSQA 4I01A 1BEV3 1LRHA 2PTMA 5FYCA 4DRVA 2D3PA 1IKQA 1DGRA 4DXSA 2VECA 1VMFA 1LOFA 4MV2A 4DINB 3AMMA 4JTOA 1YJLA 1BBT1 1FMD3 2UYAA 4NHMA 2H6BA 3H1WA 1Y3TA 2WL1A 4XMAA 2VNOA 3RZZA 2BQPA 4AWDA 5A1LA 1H4GA 5IVEA 1DLLA 2A6XA 2EAKA 2VTXA 3K48A 3PVEA 1DGRN 4IE4A 5A7PA 3T08A 3NAPC 4BPZA 3VGIA 1GICA 1TVGA 4LO8A 1BVP1 2RS33 3T1LA 4KI5M 2ZEYA 4QU1A 5FQ0A 1JI6A 3DYOA 4AHXA 1OFNA 4JGZB 1D4VB 4BMEA 4CDUB 4IV3C 1JODA 4BJ0A 1DQ1A 1AXZA 2PLV3 3TN91 5AVPA 1NXMA 1OLMA 2F6BA 2VZOA 1U5XA 1UZWA 4N7IA 1VJ2A 3CJIB 2HBUA 2B8MA 1OA3A 1GMMA 4HXCA 4V2WA 5FZDA 1IGOA 3MIHA 3C7FA 2HWC3 3ZSJA 5LBBA 4YW4A 3USUB 1RVF2 1ODMA 2A1XA 3JZVA 4NVPA 2HEYF 1OLQA 4UI9L 4DFSA 2RR12 3AZYA 2CSGA 5I93A 3NAPA 2HEWF 5A3PA 4XJUA 3BTAA 3AZVA 1CAUA 5JUVA 2VM9A 4CDXA 4Q2FA 1J1TA 3TWIA 3A4UA 4GMP3 5FP7A 2XWJB 4IV3A 2ENRA 2JB4A 3N3HA 1C5IA 3WP6A 1AZDA 2SLIA 2V5YA 2Q8OA 3AXDA 3LB9A 1FOD2 4UBGA 1G9FA 3D0SA 4OYUA 1EV12 4BQXA 1S0FA 4XJ9A 4Z07A 3VKNA 2FZ2A 4MO3M 3WCRA 3ECQA 1EY2A 2XL7A 4BU2A 5I0DA 1VBB1 1QNWA 4Y20A 2EF6A 4W6XA 2BNNA 1IS6A 1QOSA 4YGDA 5ACA3 1OOPC 2J1VA 3R05A 3RG0A 3C7GA 4LUKA 1LOCA 3DN7A 4NHYA 4QB6A 5FZ3A 3UKNA 2R0HA 1WLDA 3I7DA 3B9CA 2P3JA 2A7AA 1UOGA 1ZX5A 2CGNA 4WBBA 4H55A 5JLVA 1R091 3WXPA 2W9XA 4MGSA 2VUCA 2WAOA 1ZZ8A 3NL1A 4LULA 4XBQA 2W91A 2J1RA 1RUJ1 1UYXA 1RUC3 1VBE2 2BGPA 1BEV1 1DQ0A 1SFPA 1DYOA 1MS5A 1PVC2 1QQP3 1VBA2 3POBA 1CONA 1VMJA 4LEJA 4E4HA 5JSRA 4AAPA 2HEVF 1NG0A 3WQ7A 1MS0A 4LBJA 4X8NA 3ACFA 3I59A 1K45A 1FMD1 4QXCA 2HWE3 4XF0A 4HLTA 4I09A 1HN0A 5FZBA 4KU8A 1OOPA 3MIDA 3C2UA 3TRSB 4QB2A 3WX5A 1DYPA 1XNCA 1V6KA 2P17A 2RS31 2I74A 2Y6LA 5LCWL 1W2TA 5DDJ3 3VKMA 4AOCA 2XUMA 1AR72 2FZ1A 3AZZA 3BOWA 3Q9OA 4CTEA 5KXCA 1PK6B 2PLV1 5DXDA 3ES4A 2WZPP 4GD4A 1SBFA 3ZVXA 3VDBA 3CKHA 4PBOA 5F32A 2XJUA 2YC4A 5FWEA 2W52A 2WKKA 4NROA 5FYVA 5FY9A 3T3YA 2HWC1 5LWBA 2XLAA 3IBMA 4IERA 2ZEWA 3T0DA 2DVGA 3WEZA 2PHRA 5C8CC 1B35C 1H0BA 3WNOA 3VBFB 4YM2A 4LITA 4FXKB 2B9UA 3WF2A 4MGKE 4FCAA 4OQ9A 2WBKA 2OXBA 1RUH2 4CCMA 2TNFA 5DUWA 1NUKA 4M4PA 4GMP1 4PT6A 2VQAA 1STMA 2RV9A 3JQWA 4Q4W2 3O1UA 1NY71 3FLTA 3P1IA 1HQWA 1AHSA 1CAXB 1LODA 2VZ3A 3OBAA 2OZ6A 5DAXA 2VZRA 1FNZA 4A45A 5FDBA 1JZ5A 1XU1A 2WZ8A 1GKBA 3HAGA 4M3CB 3ZIWA 4XUQA 3M3IA 4MH0E 4RHV3 2LALA 5CADA 5IATA 1ULFA 4HKLA 4KGGA 2DCKA 2W94A 3JQXA 4DRRA 2VO5A 2XJSA 4FP2A 3N7JA 2QZ3A 4NWWA 1UOFA 3K51A 5FFOC 1G9AA 3GZEA 4Q8KA 3X29B 2WS93 3GYDA 1LB2A 5C8CA 1X9PA 1B35A 3OYWB 2L9LA 5ACA1 4W4ZA 4E2GA 2QQUA 3PJQA 2VMEA 4H7MA 4J25A 4YW3A 2X09A 1FI2A 3OPZA 1HQNA 4YZ2A 1QJU2 4LKFA 3U14A 1S0JA 3KGZA 5DZGA 5KHJA 1MEC3 1ZZ7A 5A6QA 1GBGA 3LA3A 2B42B 3NKGA 4XCBA 3VBUC 3RZGA 2A71A 1C1LA 2D98A 3MBWA 1RUC1 1QQP1 4E8DA 1JYVA 3AZXA 1LR5A 2R063 2HWD2 2WT0A 2ZEZA 5EXOA 3T2TA 4D6RA 3OEBA 4MGTA 4E9KA 1GZCA 2H6CA 4KU7A 1J58A 4W50A 4CRQA 1HJGA 2HWE1 3RWNA 3WQBA 4CUGA 5L36A 5DAPA 4N43C 4BLIA 5AFBA 3NRUA 3QD6A 3UESA 1ONAA 1PO12 2BZDA 4LO7A 3SHRA 3FX3A 1M4WA 4YVSB 1UZ0A 4RS5B 1JTZX 3J8F2 3JUUA 4COVA 1DHKB 5HXVA 3VB9A 5DDJ1 3J9SA 4XF1A 4OUMA 2QUOA 4FPLA 1RMU3 3FN9A 4RQPC 4CEWC 2FDKA 4PLMA 5A6XA 1VALA 4J1XA 3VBUA 4LBNA 4DOUA 1W9WA 1A3KA 1TEIA 4OI1A 3GHMA 2VNVA 5E1RA 2E51A 4I3GA 1YLLA 3BODA 2A6ZA 3H0OA 3D0JA 3H9AA 3PUAA 3GDBA 2CAUA 2PYTA 5C3QA 1CJPA 4NPRA 4CPBD 4YRDA 2OPKA 3WW3A 4K1ZA 3B9IA 1ST8A 4UT5A 2G9FA 4GIQA 1CQ9A 4LIVA 1DQ2A 4KL1A 3TYJA 4BQ2A 1DBNA 1W6PA 4X8PA 3IB3A 5T5OA 5LA1A 3RQ0A 1DLCA 1GNYA 3NW4A 5JSPA 1VRH2 3SLIA 2Y0IA 4I0BA 4RQPA 5A3WA 3ZFEC 2YGMA 5CNAA 4CEWA 5J1XA 2XBO2 1GUIA 4EROA 4CZSA 2A6WA 5BNPB 2MEV2 2HBTA 2QQIA 1GWMA 4XFCA 3WNMA 2FCUA 4MHRA 4F8AA 4P00B 3ZN4A 4AEMA 5C3SA 3WCSA 4LHNA 4LTAA 1RITA 1UKRA 1Y4WA 2ZGOA 3MEPA 1AR93 1GSLA 4HETA 5FMOS 3VBHC 4NIHA 5FYZA 3T2OA 5FXZA 4XYXA 4V1PA 4CUCA 3VBSB 2P1BA 4WVWA 3RZHA 2WS91 2JXAA 4YG6A 4RFRB 2MHFA 5DN2A 3T4HB 2RDSA 2XQRA 4AGGA 1KFXL 4AG4A 1OKQA 3HQUA 4FFGA 3ACHA 3SH5A 1R083 3IDCB 4GULA 4BQ1A 3H7JA 1AR62 5FYHA 5L7OB 1MEC1 2X5IC 1WCKA 3ZFEA 3RMYA 3FFZA 1MQTB 1GR3A 1UNBA 2DUOA 3AB0A 4CUAA 5BYNA 3PVNA 1NKGA 4JDMA 1XE0A 1IG0A 1CAVB 2DVAA 2WNOA 4SLIA 3M70A 5T5JA 4JVAA 1NE6A 1BJQA 1OVPA 2IUWA 1LU2A 2JIGA 2R061 5GALA 4ASKA 1ENXA 4BWOA 2X53S 3WG4A 3VBHA 2ZJCA 2D93A 3B69A 1H9PA 3HPNA 5D8AC 1AL0G 1EUUA 1GZWA 3VUOA 4Y3OA 3WW2A 3UGFA 1OA4A 4D8MA 1AL23 1W6NA 5GZDA 4H3WA 1I6XA 5IWFA 3RNSA 2AH2A 4ITCA 4AI9A 3LEGA 4Q0PA 4IUGA 4ORFA 4QB1A 5C33A 4YVWC 3JD72 2X5IA 2IXIA 4URAA 2VMCA 4IEZA 1AX1A 1RMU1 3A0NA 3B94A 1UY1A 3LKJA 5E16A 2RM23 1QJY3 4DY3A 2Z5WA 1IPJA 4LXLA 2ZKNA 1WZXA 3NV2A 3MUZ1 4CEYB 3K2OA 2JG9A 1PNGA 1RUI2 4YW6A 3WLUA 1HXS2 4CDQB 3DGTA 3HIFA 2B39A 3N35A 2VQTA 4CXYA 2YGLA 1X9TA 5CFDB 1L3JA 5D8AA 5JXJA 4CCKA 4NRMA 3AXEA 3AJZA 5JI9A 3A23A 3POEA 1WMXA 2P3YA 5FYSA 1ZYBA 2ID4A 3M2MA 1U0AA 2WLQA 1X82A 1XJAA 4EN7B 5HCBA 3KVAA 1I5ZA 4P5YA 3I2IA 5FMBA 3IPVA 2W87A 5FZKA 1AYN3 2BP6A 4YVWA 1NLRA 1ND2B 2C26A 1MZFA 3D3AA 3I3QA 4WVVA 4CCCA 4ET7A 1S2KA 2A6YA 1DGWA 4UWDA 4RR3B 3U4SA 1JZ7A 3J7MA 3KV5A 5FY8A 4LOSA 3EJKA 5A6ZA 4D6QA 2WNUC 1JOBA 1NZCA 4YARA 3TNQA 5T54A 4GKXA 4QX7A 5JOZA 1PM4A 1UXXX 3B93A 4AI3A 4BXSV 2UWCA 3FL7A 4IGPA 1AR91 1TZOA 2ZGPA 4LO4B 4OCTA 5A3MA 5JXHA 4UF0A 4KBZA 2LROA 3LCPA 2FDGA 1PX3A 1PVXA 2UWAA 3MPPG 4FPGA 1NA1B 4IGOA 4MADA 3SMHA 1LJ7A 2DYCA 5IK4A 5I8SA 4FOQA 1QOTA 5I8YA 2QQWA 3IIAA 1GYKA 1L7QA 3IKWA 2R073 1V0AA 1R081 5ANQA 5F8PA 4HSLA 1E5IA 5IYYA 1UL9A 1RINA 1P8JA 1OBNA 4KGQA 3GALA 4QHOA 3VHPA 2WNUA 3CIHA 4TWTA 4Y5TA 4YZ1A 3DV8A 2VGDA 5FY5A 4ASLA 1W03A 5FZFA 1NOVA 4ZXKA 4LQRA 3ZDVA 1PGL1 4WM7B 1H2MA 3POSA 4Q0UA 4Q27A 2Q1FA 2ZXQA 3LSDA 5K7PA 1UQXA 4ZZ5A 1IS5A 2XDVA 2VUDA 2VOWA 2BJSA 3NMBA 4YM0A 3S5QA 2OVUA 4FXGB 2OQ7A 1R64A 1FPN2 5I0UA 3OTFA 1AL21 2IXLA 2WINB 4XCAA 2BWCA 1COV2 5EIYB 4QGNA 5FPUA 5IUQA 1VBD2 3ZPOA 2R32A 2F17A 2P37A 5FZ9A 3AYEA 4GH4B 2ZHKA 2Q30A 5K0UC 1A8MA 1OQ1A 4M3CF 3ZFGC 4E2QA 5J37A 4KWUA 1JOJA 1H2NA 3NAPB 5EQUA 4ZY9A 2GC3A 4YFZA 2RM21 1AVBA 1QJY1 1AR83 4KQ7A 4QDSA 1ZBE3 4JDOA 2YBSA 1UF2C 2WZR2 2YU2A 4CDXB 1NCQC 4F83A 4NIGA 3AMHA 1H8TB 2HYKA 3E1F1 4IV3B 3E6CC 4IE6A 5FZ6A 3O7OA 1LEMA 1WCSA 3I2HA 1XB9A 4YG3A 2GALA 2DCYA 2CL2A 2WO7A 5DAVA 5A33A 3WW1A 4BLJA 1TME3 2Y6JA 4L99A 1V6NA 2BYVE 3ROUA 3MZHA 3I2GA 4NAMA 4Y20B 1HB2A 3PTYA 1BYHA 2JDHA 4XOGA 3GBGA 4QHZA 2B45X 1O59A 1AYN1 2F4LA 1ULOA 2RS12 3HEIA 4QKBA 5K0UA 4CUBA 2WWUA 3ZFGA 2RG4A 1XOYA 1IZ3A 2ZEXA 4XFIA 4XABA 2D3SA 1W99A 1NCQA 2B7YA 4UFIA 4ZKTB 4LO5B 1OMIA 1DG6A 1GFF2 1LECA 3E5XA 2ZKLA 4NPMA 1F9KA 5CG8A 4Q4V3 3DF0A 5JZGC 5FY1A 3EB7A 3I2DA 5F1RA 2W08A 1QKQA 2ZGRA 4M4RA 1DQ6A 1QJX2 3S7EA 4Q1PA 3HT2A 4NRPA 3T0BA 4PI2A 4KWKA 4AVAA 3DEMA 3KF3A 3V0BA 1RHI2 4COZA 2WN2A 4Y4YA 3BTYA 3ON7A 5EP9A 4DB5A 4ZS3A 3MHZA 5CB7A 2R071 2VD7A 2V5DA 3ETPA 1GU3A 2WQ8A 5EJ3A 1YFXA 3IZOA 4LA2A 3WP3A 1UZYA 2DUPA 2WLPA 3JBG2 4EN8B 2RDQA 1BK1A 1IQAA 1TMF2 3GM8A 5FYTA 1ULGA 4B4PA 4C1XA 1SCRA 4LBQA 5LY2A 3ALQA 1H1IA 1R1A3 3UK9A 3CEWA 4K20A 1ASJ2 1BK0A 2QQLA 2YBPA 3H42B 4HMZA 3UYJA 5JZGA 5KXDA 3AX4A 3DXUA 3ZFFB 3PUSA 4H2AA 3AKQA 4XUOA 5GLUA 4IEVA 2ORZA 2GMEA 3MW2A 3P3NA 3APBA 4NHXA 3RJ2X 3H3LA 2ARCA 4TTGA 1KXGA 3I97A 3ZDSA 1CWPA 2R6QA 4SBVA 3WZ1A 3ZYJB 5G05L 1RUE2 1JS9A 3W20A 2FD8A 4Y26A 2NYYA 4C90A 5D21A 2J1EA 1PZ8A 1F15A 2HWB2 1WA6X 4M0HA 3UL2A 5EWSA 4LOTA 4P9IA 1UXZA 5CISA 4LKEA 4R9DA 5JMOA 2HH9A 1ZZBA 2D44A 3KB5A 4XF4A 5DAQA 5A7WA 3W21A 4FBFA 5JOYA 1CIYA 2P3KA 1AR81 2NZ9A 3IWZA 1I3HA 4Y1UA 1JMUB 2A3WA 2F4PA 2JIJA 1U5IA 4PJYA 4UFLA 5DABA 2BNMA 3OGSA 1Z7S2 3O1MA 2AYHA 4DMIA 5C71A 4Q8LA 5KXBA 3VDDC 2DVBA 3CHXA 3V64A 4XTMA 2PHDA 4L8QA 2B9VA 5A7QA 1TME1 2JWPA 1MZ5A 1KD7A 2O0OA 3H3ZA 1I1EA 4WZCA 1X7NA 3KZ4C 4R52A 1UYZA 4YW2A 5F37A 4K8RB 3GHNA 5KHHA 4QHBA 2ZMNA 5J48A 1YHFA 4YNIA 3VD5A 5JPMB 1AYM2 2VU9A 1OI6A 4CP9A 3MPBA 4UW4A 2DDUA 4JRAA 4QPWA 1GWKA 4UFHA 4L9BA 5FO8B 2JG8C 1R1ZA 3VL8A 1QH6A 4OQ8A 2CTVA 4A4AA 3BALA 3PHMA 1GV9A 3OB8A 4DUWA 5FTTC 4JGYC 3VKOA 2VMIA 1KQRA 4Q26A 3B3QE 1XQNA 1O91A 1JYXA 4Y22B 4OULA 4CCNA 4Q4V1 2EXHA 1Q5OA 2W47A 1H4HA 2R7EB 5FZOA 3VDDA 3WR0A 5A6YA 1XNDA 5BNQA 3PNAA 3WVJA 2IFWA 1URXA 5A3TA 3LZZA 2RMU2 4PHZA 3RGBA 2CDOA 2NMNA 3N9OA 3WT3A 3ZXLA 3ZSMA 2BWAA 4C0HA 4P9LA 5FY0A 5JAXA 4GB32 1QJEA 1K42A 4EV0A 1SBEA 2ZABA 1CD3G 4Q0VA 1S0GA 3LDBA 5G04L 3ILNA 2JG8A 3WY6A 4CSWA 2GC0A 3FLPA 4JX0A 4GWIA 4CPBA 4YLZA 2I45A 3FUOA 2N7GA 1QGLA 5A7OA 3KQ4B 1W2AX 1F5FA 1KITA 2VQUA 1W6MA 1R1A1 3GCWA 4JGYA 2G4IA 2JX9A 4MX3A 1MS1A 1XE8A 3VBUB 1JYIA 3ILFA 2FDIA 2B5HA 1UWWA 1LHUA 2FBEA 2Y26A 4AR2A 4XILA 4M01A 4IEYA 2Q8CA 3O1VA 3ZXAC 3JB8A 3B00A 4A42A 4LPLA 1DQ4A 2WFF2 5L9VA 1D2QA 2ERFA 3ATGA 4BISA 5FZCA 3M4FA 5FZHA 3DPRC 3N9QA 3K46A 4FPFA 4BZ4A 3UNPA 1RIRA 1W6PB 2XJVA 3HT1A 1Y43B 4FPJA 1C57A 4YGBA 3S0MA 4RQPB 1SLBA 5FCCA 4UFMA 5FP3A 3SXWA 2PHUA 3ZKUA 3HNMA 3PL0A 4A44A 1HQLA 4FAGA 1UPSA 5HBAA 1OT5A 4WM8C 2G9ZA 2GMPA 4RL7A 4QXHA 2Q5TA 2WAAA 4NE9A 3SC7X 2VY0A 2RVAA 4AZZA 4RD7A 2VC9A 3AJYA 4ARXA 1N3PA 1V6IA 3K77A 4Q4Y2 4AHZA 5D1IA 5FP9A 2R1BA 2AENA 3QACA 5FV3A 3ZYBA 5C4WA 2Z79A 1HB1A 3ACLA 1F4HA 3R6SA 1VBC2 1YQCA 2HYXA 4QPIA 2IZWA 4JCKA 2JDZA 4BQ3A 1DZTA 4HVQA 3AP5A 1JH5A 2B4KA 3ZN6B 2ZX3A 3DPRA 4QU2A 4LT5A 4XFBA 4GWMA 3H3UA 5SV5A 5D2AA 2CGPA 3BVCA 1K5MC 1C8M3 5LRRA 2WRAA 2Q8DA 3K3OA 4HG6B 3AKRA 3J4UH 3OGVA 4URTA 2TBVA 4COYA 4E4ZA 1CN1A 2NP0A 4WM8A 1F8VA 5IVFA 4FFIA 3T30A 2DBNA 2C9AA 1SLAA 1F2NA 1IS3A 2CWSA 3PU8A 5JWPA 1QEXA 4CP2A 4OI0A 1VR3A 2OUJA 2WO3A 1AF9A 4MLOA 3LPFA 3NO8A 1H30A 1ENQA 1DCSA 2W68A 3OPWA 2VCMA 4PIXA 3ZYRA 3V0AA 3HBZA 3GCXA 3P3PA 3Q8AA 1W06A 5LEJA 1SBDA 2P5BA 4XFGA 3TBDA 3U4XA 1MS9A 2ZS6B 3LE0A 4FPKA 2GC2A 1W8ZA 3U0ZA 1K5MA 2GZWA 4DEQA 4WVMA 3FBYA 3M8LA 4PLOA 4NPLA 1UMHA 3ITQA 1DZRA 3NQHA 1OLRA 5FIXA 1D7PM 5L9BA 3T4VA 2JG9B 4PCRA 5BNNC 4NAOA 4I2OA 1YI7A 5FMDA 2VUAA 4BXFA 5CFCC 2YC0A 3IDBB 3PTRB 4Y4RA 1UZVA 3HR9A 5DZFA 4P5HA 3UKVA 5FP4A 1O8SA 4B4RA 2D6PA 1XNTA 1NCRC 4XQWA 5F5IA 4BK4A 3D4KA 4D7TA 5C9AB 4QQPA 2QCSB 3FFQA 1RUG2 3JU9A 4JZRA 1WD4A 5F6LB 3AC0A 4P9XA 3R4DB 2QE3A 5E88A 3VBRC 3CL1A 4BB3A 4YVWB 2OW4A 3ZYFA 2KD7A 3GJAA 4JKMA 2ES3A 5CKMA 3RYPA 5IVBA 2D7FA 3WNLA 4CU6A 5C6CA 1ZZ6A 3AP7A 1GNZA 1CAWA 3Q8CA 2ZGLA 2GNMA 4L92A 3RSJA 2Y64A 4X6RB 4IEPA 3BUCA 4HVOA 2P4EA 2Y8KA 2Q1ZB 5BNNA 1RXGA 2JECA 2QKDA 2ZBJA 1CPMA 5CFCA 1E5RA 1H1MA 4UF0B 3ZSLA 1F35A 1D0HA 2GP5A 2BUKA 3LQCA 3AL5A 3HNYM 2YXSA 3LEMA 1XYPA 4CP1A 1NCRA 5BV6A 1RVF3 5KHKA 1RUOA 1SZBA 2ZMLA 1JZ8A 2ADEA 2RR13 3CQOA 2GMMA 2ATFA 3NKTA 1KS5A 1NXD1 4LLFA 2BU9A 2JDYA 2R49A 3VBRA 2PA7A 5AC92 2BVBA 3LDRA 3KQRA 1RUF2 1C8M1 1QWRA 3VKLA 4ATFA 1D4M2 1LHNA 1MACA 1UAIA 3M3CA 3O14A 4M0NA 2MNGA 2J22A 4LORA 1X8MA 4XPVA 4AVBA 2X05A 1GQPA 5E89A 4UAPA 3HOBA 2V73A 4DIQA 1Y9QA 2R042 1FOD3 5C70A 2GC1A 4YFWA 3Q8FA 5FJKA 1EV13 4QMAA 4W8JA 5FKCA 3F2ZA 3NNJA 3I2KA 2ADDA 4LBQD 3THCA 1UIJA 2DF7A 2O8OA 1EPZA 1L7RA 1QMJA 3R4SA 1A8DA 3PVOA 3GZUC 3RJRA 3WOGA 1VPHA 3V65A 2C6SA 3VD7A 4XETA 1PGW1 1YWKA 2BFUL 4G3YC 5EZWA 4IW3A 1XPWA 1J83A 2BNOA 4AYUA 2GNBA 4NOTA 5FBZA 1S0EA 4D6SA 2WC2A 3OG2A 4FFHA 5ABJC 1Q8VA 1QY4A 3KSCA 2RDNA 1RB8G 3SCGA 4INDA 2JDKA 4P9YA 1ENSA 4ZONA 1ZNPA 1VBE3 4WVZA 1VBA3 1PVC3 2VZPA 3NWKA 2ZGQA 1WGPA 5FZ0A 4BH9A 3EO6A 1JHJA 4QPGC 3ZXDA 4DEVA 4BQYA 3I3MA 4DUXA 1ENRA 1XSRA 2PQQA 1U5ZA 4XJWA 4AXOA 4FFFA 2YU1A 2K2SA 3TEWA 3VD3A 1QJZA 1UIKA 3NNFA 5FK8A 1NAEA 2O8QA 3CZUA 3MUY1 3OPTA 2QFEA 4IE5A 2TEPA 4QQ2A 3WHTA 1W6OB 2YDEA 2XONA 5EJ1B 4QPYA 2Q8EA 4QGMA 5IJRA 4C0BA 5LK7B 5K0UB 1VB2A 2H0BA 3WDXA 4E27A 2ZGMA 1SPPA 4CDWC 5ABJA 4JQRA 3VBOC 1W6QA 1AR73 2VZ1A 2YFZA 3AVRA 1LGNA 1GZ9A 4IV1C 2XJTA 1JBCA 4AEDC 5B2GB 3QH6A 5CU1A 2BERA 1DYKA 3POJA 3VL9A 3UGGA 4QX8A 2P2KA 2JE7A 3DKWA 4OUSA 4XE9A 4QPGA 5F5AA 1E5HA 3OY8A 1SFYA 4GQ7A 2VE1A 4FPEA 2FDFA 4A7YA 4XAAA 4I0WB 1ULPA 2XJPA 4R8HA 4AFBA 5H9RA 1VLNA 5JR7B 1RVF1 1W9TA 2V72A 4OHVA 4CU9A 4AI2A 4IE7A 4HVRA 3IM0A 5C3OA 2RR11 2VMDA 1TG7A 2HWF2 1CZSA 3LIGA 4AHYA 1T2XA 3CBNA 3NNLA 5HXMA 4XQ4A 1O3TA 2Y60A 5DMYA 2QQKA 1RUH3 2AACA 2FDJA 4CDWA 2XVLA 3VBOA 2D6KA 1QXPA 2W1UA 3A7QA 4Q4W3 5TSWA 1DGWX 5JCTA 1PO22 4AEDA 1PIV2 4IV1A 1SLCA 3MLKA 3KWVA 1V6OA 4UXAA 1WMEA 2VOTA 5E8AA 1WW4A 1FOD1 3WG1A 3ST7A 4YSFA 1EV11 2BBAA 2VOXA 3C8XA 1VRBA 4Y33A 5A7NA 1HRI2 1O4TA 2JKBA 4N43A 2PHFA 3HD8B 2EXKA 4OZOA 4AI0A 4DZGA 3ENRA 1JU4A 5IK5A 5L19A 2UWBA 4XAEA 2BPA2 2XGXA 1H9WA 1VP6A 4NHKA 4Q1RA 5B4NA 2EXIA 1C5HA 2QQOA 2OYZA 1H2LA 2WA3A 4S2HA 2LTNA 1O3SA 4S2GA 1QJU3 4LBLA 1YIFA 2R0FA 1V9U2 2ZAAA 3M3QA 5FZGA 2D40A 4R9BA 3ZX7A 4FOVA 4KNCA 4BIOA 1D2SA 4IETA 5FPXA 3POGA 1RTVA 3OD0A 1HKDA 1LTEA 1W9SA 3K75B 2FMYA 4CCDA 3WG2A 3I49A 4GXLA 1VBE1 5L73A 3WDUA 1VBA1 1PVC1 4RHV1 3ZM8A 5JPNB 4P02B 1LU1A 4XDPA 3SISA 2DTYA 1PX4A 2HWD3 1KGYA 4IEUA 4BQWA 5FPBA 1ULDA 2VZUA 3PMEA 5FAXA 3KHCA 4OHXA 4PQQA 4XDOA 4XFAA 2RDRA 3LGRA 4ES9A 2DFCA 4R9AA 2OIIA 3FHIB 1SHWB 4FVVA 1LENA 1QDCA 1MS8A 2C1FA 3UGHA 5BNOB 2XHKA 4DXZA 1O4YA 2GH2A 1PO13 2ARAA 4CP9B 4O9GA 1NE4A 3AYCA 4OVEA 4Y1VA 1CX4A 3J8F3 5LY1A 5DZEA 5LK5A 1S0DA 1WKYA 4AW7A 3QOPA 3RYRA 4N9HA 3U10A 1AR71 3AMQA 3SKVA 2DV9A 2ORXA 5K9YA 2XB6C 2YMZA 2ZGNA 3DECA 3ZXJA 1OPMA 1EAH2 1RUD2 5FY7A 4UW3A 5IW0A 2YUEA 3FHAA 1W9FA 3NJVA 3VDDB 1N3QA 4P9GA 3AKSA 3QCWA 5EPAA 2VZVA 3K4DA 4K7JA 3UT0A 3ZYGA 5F9TA 1G6NA 4PF5A 4Y1ZA 2J7MA 3MF6A 1N1TA 3HNBM 4S2FA 5FO9B 3OCPA 1JZ6A 3WINE 2P34A 2YZ4A 1YQ2A 2ZHLA 1OHFA 5FPAA 3V56A 1SDWA 4QQLA 4XIOA 1J84A 4JQTA 3EXUA 4XW3A 4EN0A 1OURA 3BCWA 4E4SA 1RUH1 1VRH3 5GLWA 3BTZA 2YB7A 1Q43A 2QNKA 4Q4W1 5I0TA 4TYSA 2XBO3 3GNEA 1DU3D 3MV01 5APAA 1REFA 2MEV3 3VV1A 3USUA 4QD2A 4CU8A 3THTA 5C3RA 2DUQA 1D0GA 2LUWA 1QOOA 3BGAA 3POFA 4Z2WA 5CA6A 1M06G 2G1MA 4YZ3A 4DS0A 3KCYA 1W04A 4K6BA 5CIRA 3NV3A 4QX5A 3WQ1A 1UY2A 1J59A 2X10A 2P6HA 2C0ZA 3IN9A 1G9BA 3N9PA 5F39A 1OD3A 2Y38A 3SH3A 5H9SA 1LAJA 4R4XA 2BGOA 1ZBA2 3AP9A 2QQPA 4BQ5A 3S57A 5A80A 1ZRCA 1QJU1 4UYBA 2IXJA 1YNAA 1AR63 2W1QA 2V4VA 1KJRA 4YPJA 5C7GA 1WLWA 3RI9A 1NQJA 4Q29A 2JEMA 3RI8A 3E97A 3LFIA 1GOFA 3RS6A 3IIIA 4XUNA 1YC61 3RVHA 3OUHA 5KWRA 2OPWA 2G19A 1F4AA 4ONUA 2E32A 2WSVA 4Q4X2 5GLZA 3ZXEA 2HWD1 1MZEA 3PIGA 5JXIA 3J7NA 2FDHA 5BXXA 2X29A 3GF6A 1QNYA 2E7AA 2OX0A 1OQDA 5DAWA 4RN5A 1OQEA 3ZOIA 2VOVA 3HN3A 5KBFA 4MG2A 3GZTB 1APNA 2QJVA 2XVGA 2XJRA 2V09A 4JC1A 1N3OA 2K0GA 4B3NA 1PO11 5C4WB 2E26A 1PK6C 3OBZA 1LCLA 4QPIB 3Q8EA 4UFJA 4OI4A 1Y7BA 4A41A 3J8F1 1YO8A 4GWNA 3DPRB 5FUNA 2XLFA 3ZXGA 2CGOA 3JD73 1LHOA 3NJXA 4FOWA 4MGYE 5FJHA 2JDAA 5FQ0B 5FXVA 1ND3C 2AGSA 1HRV2 4XHXA 1RYYA 3BOPA 2J1TA 3ZSKA 1DIWA 4FSJA 1I5PA 3MW4A 4TLFA 1BMV2 1HX6A 5KC5A 1RUI3 3DYPA 3VBFC 4JTNA 1HXS3 2XKPA 4WM8B 4Z8BA 3RZMA 1NYWA 3HMYA 1O5UA 2VCCA 4L2NA 1VAVA 3W5NA 3WG3A 2W1SA 2R30A 4Z92B 3KM5A 4XEZA 4HZFA 3PVBB 5GM0A 4LK6A 3BI3A 4N7UA 4QWNA 4MZUA 3LOIA 3OOXA 4C8DA 5CKQA 5HV4A 4PBPA 5EFUA 5JXGA 1PK6A 4ZPIA 1V00A 4GA9A 2XH6A 4YG0A 5FZAA 1XRUA 2R1DA 1W28A 3POYA 4XURA 2WQZC 2PN5A 1VRH1 2VL4A 3C7HA 4N53C 3AMNA 4QKDA 5HV0A 1CAUB 1LOEA 1ND3A 1LOAA 2XBO1 2ARXA 3ETQA 1HV1A 4BHPA 5FOJB 2MEV1 1G7YA 3RDIA 2VNRA 3AYAA 2D3RA 4PDWC 1BHGA 1HV0A 4DUVA 3D8CA 2IWGB 2WNEA 1DF0A 2JE9A 3VBFA 2XXZA 1RL3A 1N1SA 4P9JA 5FMCA 3WF4A 3D82A 4FPHA 2NQYA 3KT7A 4YM1A 2DFBA 2PHWA 1LEDA 1ZZCA 2XMLA 1RJ8A 1W8NA 3GZAA 1VAKA 3VZJA 3ASIA 5IFTA 2RS52 4FI9A 4CCJA 1CAXA 2WJSA 3U78A 5CVRA 5CBLA 3I4IA 3PDQA 2CHHA 1GQHA 5L9RA 3WHUA 5LZ6A 2WYSA 4M3CA 5FY4A 5T50A 3I2JA 5I91A 5IT6A 2GU9A 4XACA 5J36A 1AR61 4N53A 2C5DA 4C1WA 1YFWA 2YY1A 4LHKA 1AXKA 2OQ6A 3T0AA 4FOYA 1HN1A 4Y1XA 3AK0A 1I9RA 1OUXA 3KHBA 4PDWA 4EZ4A 3MGUA 2DCZA 5CAZA 2Y6FA 2VZQA 4YVSC 1W2UA 4XZPA 4E4DX 4BK5A 4GZ9A 4RS5C 3THDA 1W8FA 4BYYA 1W39A 5FREA 5HCFA 4AFAA 2GH8A 5CFCB 3I59B 1ZRFA 5FUPA 3VD4A 5FZ8A 1Y9GA 1FPN3 1POV3 1SLIA 3E6BA 4X6QB 3GBFA 4L97A 1YFUA 1COV3 1OOPB 4G9SB 4KG0A 3CJXA 5H9PA 2E7TA 1VBD3 4EWDA 5A3LA 1NQDA 2CNAA 4ISQA 3JD71 3H1YA 3HN1A 2WT2A 3IMNA 4MXWA 4OHWA 3ZR6A 4DO0A 1FT9A 5KC6A 2WZR3 1Q8OA 1BBT2 5KR7A 1UY3A 4Q5OA 1RUI1 1CGPA 1K3IA 2DBIA 1HXS1 3FZ3A 4HOOA 5GJ6A 2BV4A 5C5UA 3QLQA 4OLLA 1S2EA 4GMP0 4RS5A 4V2VA 1O3RA 1LESA 2Z2SB 3LF7A 1IOAA 1UOJA 2UU8A 4COWA 4Y24A 4NWVA 4TLGA 4LLOA 2E7QA 2VNGA 4LE4A 3AMPA 3FE5A 4YGCA 4ZU5A 3ZN5A 2DCTA 3MFAA 4CCEA 2QDRA 5E6HA 2QQMA 3TN92 4KH9A 3URFA 2RS13 1X36A 4FT8A 4NN0A 5FXXA 5IAVA 2D6MA 1ZBE1 4ARYA 5JOWA 5HI0A 5F3GA 3VBSC 2XKOA 3MIGA 1HW5A 4KG8A 4ZU7A 4QXKA 4U36A 5FLJA 2DU0A 3M1HA 3LIHA 5DUUA 1SFNA 1QHDA 2OT7A 4K21A 4AEKA 2KM2A 5JMCA 4QDQA 1A78A 1WW7A 5CZKA 1OC1A 5FBJA 2JD4A 1QJX3 2NPIA 3WNNA 4YYOA 5L7OC 4UW5A 1MQTC 2ZA9A 4QX1A 1VE0A 3SKJE 4ASMB 1YXWA 5LB6A 2YG0A 1NLQA 5C8CB 1RHI3 1B35B 1Q8PA 4QX2A 4YM3A 4B29A 1W05A 1W8WA 4HK9A 5A3OA 5JVVA 3I3BA 2ETEA 4KBBA 3LAGA 3KMHA 4O9EA 1J3QA 2EIEA 2FCVA 4FQ4A 3SQOA 5KXEA 4QQHA 4JRLA 3JBG3 3VBSA 1TMF3 4YW1A 4LNVA 5SV8A 4PIYA 4BA6A 2WO2A 3L9JT 1VBB2 5ABJB 3L2HA 1ASJ3 3N4MA 4PIZA 3KV6A 4WZFA 4Y5Z0 4B4QA 1HB4A 2AC1A 2YPJA 3O1RA 3SCHA 1AJOA 4EN9B 2EALA 5L7OA 1REEA 1ULCA 5LA2A 1GANA 3EYPA 3HVDA 1MQTA 1GP4A 1FV2A 1FPN1 1POV1 1R092 1WMDA 3MI8A 1OH3A 4RGKA 2DVDA 1CAVA 1RUE3 1HLCA 1XBFA 4AQ6A 5AFEA 1COV1 3RZKA 4CEYC 1RUJ2 2E6VA 1VBD1 2HWB3 2VJXA 5I8TA 3H50A 4DXTA 1TNRA 1BEV2 1Z0HA 1XYOA 4QT6A 1SMVA 4K3UA 1PGSA 1YYNA 2GNDA 4K1YA 3O1SA 3MYXA 5CFDC 4QKFA 4JKKA 1ACCA 1JZ4A 1F31A 4W65A 3AKPA 2WZR1 4AI1A 1FMD2 1C8NA 2WT1A 5FZ7A 4CDWB 3H8RA 3U75A 1Z7S3 4M00A 1PMJX 5ERLA 5J7MA 1ZA4A 5FP8A 2A5ZA 3RPQA 1ND2C 2RS32 1J3RA 4XMIA 2CU5A 4FTBA 3HQXA 4B8EA 4RR3C 1QIQA 4N43B 3CLPA 5FZ4A 2GN3A 2J1UA 4IESA 1AYM3 2ZHMA 4CEYA 5HCHA 2VOKA 4HANA 3M3EA 2PLV2 4P9WA 3WF0A 3MDPA 3FBMA 5JIUA 1BKZA 2RS11 2JDMA 3OUIA 1QU0A 4I3PA 5FOBB 5BPXA 4R4ZA 1PNFA 4QAWA 2HJIA 5FO7B 3DKQA 5CFDA 4OUEA 4QKNA 3EMRA 1XYNA 3EQEA 1ZVFA 4CEWB 3TOJA 4HL0A 2HWC2 5LASA 3KT1A 1LOFC 1NA1C 3SEPA 2Y6GA 3VZMA 4CP0A 4HBNA 1PMHX 2O14A 1SACA 4IQPA 3I2OA 3BTXA 5JIAA 2VBPA 4N90A 3S6PA 1QJX1 3ZXFA 1ND2A 3K3NA 2RMU3 2LS6A 3MICA 5FZ1A 2RHPA 3VN4A 2WUHA 1VIWB 3AFGA 4KMQA 1CX1A 1LGCA 3VZKA 3WF1A 1RHI1 3G7DA 3WUDA 1NY72 2VW2A 4GB33 2VXRA 5IVYA 4EWAA 1S0BA 5IFPA 1US3A 4WM7C 5F3CA 1EUTA 4ATEA 4AL9A 3JBG1 1TMF1 3ZFEB 3O1PA 2VVEA 1NA1A 1Q3EA 4IGQA 2IVJA 1N1VA 5I0RA 1IPSA 2A3YA 3FC0A 1W2OA 4G4FA 1ASJ1 1GOGA 1WA4A 2KR2A 3O5SA 5ACA2 1JUHA 3KS7A 4H14A 1HIXA 4HPKA 2Y0OA 5EYYA 4GH4C 3VBHB 5F6KA 4MVTA 1SCSA 3OBTA 4NR1A 2PELA 4E2SA 1GZWB 2YYOA 1RUE1 3E5QA 1PHMA 4CDXC 1FAYA 1RJ7A 2OS2A 1H8TC 1W6NB 2EIGA 2WFF3 2HWB1 4MGZE 4PI0A 1YQ5A 1OKOA 2OUHA 1RUC2 3C7OA 1QQP2 2JKXA 4D69A 1SG3A 1UN1A 4WM7A 2ET1A 4XFHA 1X33A 2GDFA 2ZX1A 3A22A 3AM2A 3B01A 4META 1XE7A 3GBWA 2X5IB 4LK7A 4QM8A 4QX0A 5F3IA 2GSYA 1XNKA 5FK7A 4IDZA 2HWE2 2WDBA 4FAHA 4N9IA 4EN6B 1YJKA 5J3UA 4YGEA 1Z7S1 3LA7A 5J98B 3CDZB 4BIFA 4BE3A 4D94A 3BPZA 3NVCA 2YROA 1O4ZA 4FPCA 5FZIA 1DZQA 2NM1A 3MIBA 4AFCA 5HCAA 1REDA 2WA4A 4GH4A 2XHNA 4L11A 1JUIA 1W8TA 2J1AA 5D8AB 3ZXKA 3FLRA 1GNHA 2RE9A 3B5LB 3IDAA 5DDJ2 1UCXA 1GZTA 1BXHA 4MOAA 4MHUA 1UOBA 4Q4Y3 4HKWA 2VCBA 4XUTA 5FYYA 5JSOA 2NLRA 3WQ0A 1AYM1 1H8TA 4I30A 1VBC3 1H1AA 4GWJA 2ARBA 2NMOA 4LR4A 4Q0SA 3IPVB 1SQ4A 3ACGA 1S0IA 4J6GA 3AFKA 1H6XA 3JXSA 3BKZA 2W0XA 2IFRA 2MPFA 2VPVA 2WFPA 2AUYA 3WNXA 2FQPA 2NN8A 1QJFA 4BM8A 1RGSA 1WLTA 1XU2A 3AZWA 3INAA 3WDVA 5GZFA 3CU7A 3T2PA 1IHMA 1KRIA 3RWKX 2EXJA 1CPNA 1W0PA 1UMIA 1YQ6A 1WWYA
chains in the Genus database with same CATH topology
2RMU1 2A3XA 1B09A 4IXLA 4LE3A 1LGBA 1LHWA 1WMFA 1N1YA 3ZMOA 2Z42A 4GB31 4C91A 3H8UA 4F7ZA 4XF3A 1H2KA 2G9GA 1ZRDA 1J1LA 1EP0A 3ZFFC 1UKGA 4RHV2 2HKXA 2WQ4A 3W58A 1WCDJ 4H7LA 3ZPYA 4A7KA 2WS92 2WNUB 2VVDA 1X8EA 4FTEA 1WBLA 2ZHNA 2AZ5A 4GALA 3ZSEA 1OD5A 3HWJA 5H9QA 3THPA 1A6CA 1LULA 2I07B 3KGLA 2GNTA 4JAAA 1BQPA 3LWCA 1MEC2 4A2UA 1BZWA 3WV6A 2WFF1 4LA3A 4LBMA 2DCJA 5BY5A 2ILMA 1CVNA 1G86A 1G8WA 1PZ9A 3WP4A 2R062 1UZZA 5FMOL 1RUG3 1BVVA 3VKFC 3ZFFA 5DG2A 2BGCA 2ZPXA 4J1WA 3M3OA 1QXRA 2IXCA 2ZZJA 2BW8A 2PAEA 1ND3B 3W59A 4D7YA 3N7MA 2ZTNA 3ZYPA 2X8KA 3JCIA 5A33B 4Q4Y1 1RMU2 3RRDA 3VZNA 3MLLA 2D43A 2OA2A 2ZGTA 4XFFA 4ZU4A 2VMGA 1VBC1 3O0VA 4AFMA 2WNVC 3ZFGB 3RYKA 2GN7A 5AC93 4N53B 5EV7A 1RUF3 1W0OA 4A7ZA 1NCQB 2PHXA 2CY6A 1D4M3 1QF3A 1ZREA 1UPIA 4QM9A 3VHNA 4PDWB 3C3VA 2CAVA 3WW4A 4XHBA 1UMZA 2KXLA 2R043 4IEQA 3NJZA 3WDWA 1PM7A 4RFT0 3EHKA 1MZ6A 4XF9A 3V0BB 1S55A 5GZEA 5C8WA 4XBNA 1UU4A 5I0SA 4S2DA 4Y22A 1MVQA 3N7LA 2WNVA 3OBRA 4M3CE 1UW8A 1AR92 4PLNA 3DUIA 1AUYA 3ZMNA 1FXZA 4I0AA 2PAKA 3KD4A 4AFDA 4DY5A 4MXWB 4LBQB 3OGJA 3H1MA 4IEWA 4HFSA 2A6VA 5JZGB 1QDOA 1R082 2B46X 1JYCA 3POWA 2CV6A 3I8TA 4NO4A 1SLTA 1LOBA 3KT4A 4JDNA 3USSA 2ZMKA 2DWRA 2E63A 3AKTA 1IS4A 1HDKA 1UX6A 2FMDA 1AJKA 2KA3A 2OZJA 1C4RA 4MUVA 5JI7A 4FO9A 1C28A 1RUG1 1MS4A 1YRZA 4A3XA 1PGL2 2XJQA 1N47A 2ZX0A 5FPZA 3WDTA 4PQ9A 5BUVA 5A32A 5F5QA 2ZGKA 1AL22 3LOBA 1YIPA 1WW5A 1DDLA 4IL7A 3BU7A 1KFUL 2A75A 4OFGA 2YHJA 1JW6A 4YW5A 3ZYIB 4FP3A 1QXJA 1S2BA 2D6NA 2CYFA 3N7KA 4JGZC 2D97A 1QJY2 2RM22 1NLSA 4CDUC 4IEOA 2AREA 5GKAC 3VHOA 4NHLA 1O7FA 1SLLA 4LBOA 4LO6B 2JENA 4DNYA 2BFUS 1U5YA 2HWF3 3CJIC 5AC91 3MFCA 1RUNA 1G9CA 1POV0 3ZO0B 1RUF1 2ZOEB 2O1QA 2ZZQA 1BCXA 1D4M1 4AF9A 1PO23 2VVFA 1PIV3 5JOXA 1GQGA 3ES1A 5AVAA 2R041 3ZN6A 1FV3A 1WD3A 2TUNA 1AYN2 1PMIA 2PHLA 4AEJA 1YCIA 4HK8A 4AGVA 2ZGSA 1HRI3 4JGZA 2K9ZA 4CDUA 2ZX4A 4AGRA 2IXKA 1GLHA 1TNFA 4AVSA 3OGGA 4AK3A 1CIWA 4AHWA 4FPYA 2JG9C 3CJIA 4HN0A 2JG8B 1WW6A 4RGGA 4K9SA 3TNPB 5T55A 1V9U3 1C1FA 1J3PA 4D3WA 3D6EA 2DURA 5LRSA 4JGYB 1W6MB 1Q8SA 3OF1A 2PFWA 5C9AC 2SBAA 3OJBA 1MR5A 2R072 4DPNA 2WIIB 4FTSA 4LBKA 2DVFA 2VMHA 4AI8A 1G9DA 3IDEA 1O3QA 4MYEA 1ZM1A 3VZLA 3QH7A 3CO2A 2DU1A 5T52A 3R4UA 4XIKA 2BEOA 3PJYA 4KWJA 1V6MA 5JDBA 4P14A 1DQ5A 5C9AA 1OSGA 3H7YA 1EAH3 1RUD3 2YV8A 3WD5A 4ISRA 2QVSB 2GAUA 3WDYA 4HN1A 1FATA 1AXYA 5DUVA 3RMXA 1AR82 1ZBE2 3N36A 4XQDA 1TE1B 3UKTA 2CWMA 1LHVA 4UW6A 5EYXA 3TB0A 3T1MA 4AQSA 2ZGUA 4LHLA 4B7KA 2HWF1 4R9CA 4BOWA 4QGLA 2JJ6A 2XWBB 1TME2 2D6OX 2BBVA 5T3NA 1PO21 1PIV1 3QBQA 1C3HA 1LOGA 3I54A 3ZIXA 2UY9A 3PLQA 3E6DA 3BB6A 2VW1A 4HPKB 1Q8QA 4XBLA 1LKNA 1HRI1 3ILRA 4IEXA 1FX5A 1Z78A 3V0AB 4OZXA 1ZBA3 2WWSA 4Q4V2 1IPKA 1UU6A 3FUQA 4ES8A 4CYDA 1V9U1 1CR7A 3EBRA 1AX0A 4DQAA 4W6YA 2BTVC 4B7EA 1K5MB 4WVMB 4MXVA 3WUCA 3TAYA 4COUA 3B02A 4Q4X3 3LA2A 1CJDA 2XG3A 4YZ5A 1FNYA 1DFQA 4FPOB 3MIFA 1R1A2 2E53A 2UY8A 1S1AA 4F3JA 2A73B 1FYUA 1YUDA 3ME2A 5FRAA 4AQTA 3DL3A 4HT1T 3A0KA 2VQ0A 5CG9A 1JXNA 1HRV3 3OYWA 2VULA 1CAWB 4D7SA 1ULEA 1EAH1 1EPWA 1RUD1 3BIWE 3CF6E 2UYBA 1W6OA 3MLJA 2PAMA 5BNNB 2R16A 2Z69A 1Q56A 1VB4A 1QH7A 4XXPA 3SNMA 1YFYA 2H0VA 1V6LA 3L2YA 4KWLA 5IK8A 2RJLA 1NCRB 2D5HA 3UJQA 1WBFA 1SEFA 3W9AA 3CNAA 1RC6A 1XXNA 2UURA 1U12A 1XNBA 4WV8A 3VBRB 3KCXA 2XVKA 4LUMA 3KCCA 4FQZA 3ELNA 2FHRA 4TSVA 3OD4A 1ALYA 4W6WA 4YVSA 4EJRA 4Z1VA 3AP4A 2D5FA 5J09A 2RJKA 1JN2P 5BNPC 5GLVA 3WP5A 2VW0A 4OHZA 2RS53 4Q0QA 4MGIE 1ZBA1 4XTPA 1VAMA 4RGAA 4Y1YA 2QZ2A 1KDMA 3PMSA 5K8SA 3G6JB 4YZ4A 3B7MA 3MW3A 4HSJA 2XL9A 1KJLA 2VH9A 2Q1MA 2QDNA 5FLHA 4UBHA 2W39A 2XLGA 2DTWA 3U07A 5BNOC 4Q4X1 2I2SA 3O0WA 1UD1A 3LSEA 3SITA 4Z82A 1WUVA 1WLCA 2VG9A 3FWEA 2BVVA 5BNPA 4RSUA 4TZDA 3UV9A 1MS3A 4OHYA 3AYDA 1EYBA 1PZ7A 4AVCA 1ZZ9A 1OPOA 1UU5A 3SH4A 2JICA 2ZCWA 1O5LA 4AQ2A 3NSTA 2Q0AA 3NV4A 5GZCA 1HRV1 3SCFA 5KHGA 1T6GC 1W6QB 4XJAA 1BBT3 1BMV1 3FJSA 4U2AA 1OA2A 5T5LA 5BNOA 5GZGA 3E5UA 2D6LX 4OI2A 4QPGB 3OY8B 3S30A 1X50A 4HKOA 5J96B 4AE2A 1E57A 4BMBA 3D5OA 3KLSA 4GKYA 3NV1A 2P3IA 4JV4A 2IC1A 3VHRA 3O0XA 4CDQC 1F5JA 3M7AA 4MSVA 3FMGA 2LM3A 4XJZA 2WNVB 4K8FA 3TN93 3R0RA 3IT8A 3VLBB 3MIEA 3S7IA 4XJ8A 3VBOB 4I02A 4AEDB 4IV1B 2AR6A 2Q4SA 5DUXA 2WSUA 1ZRRA 5KHIA 1S0CA 4EWEA 2ET7A 1C8M2 2XPJA 1DGLA 2RS51 3JB4C 4XDQA 1KS4A 1CESA 1OFSA 4CDQA 4BCUA 1KDKA 4QQOA 4XXAA 2IXHA 3VZOA 1V70A 1JHNA 1H8VA 1IKPA 2E9QA 3J26N 5DG1A 2PHTA 1VBB3 5A32B 3UJOA 5IK7A 5C4WC 1PGW2 4QPIC 1V6JA 3U11A 2EA7A 4K40A 3O12A 5LEKA 2ZACA 3MF9A 4RR3A 2A70A 2VUJA 4AVVA 4RA0A 5T5PA 1AX2A 2ZAHA 1R093 2EAAA 2ZX2A 1YI9A 4AVTA 2EVXA 1MVEA 5FLIA 1TQ5A 3AP6A 5GLTA 1RUJ3 4I01A 1BEV3 1LRHA 2PTMA 4DRVA 2D3PA 1IKQA 1DGRA 2VECA 1LOFA 4MV2A 4DINB 3AMMA 4JTOA 1YJLA 1BBT1 1FMD3 2UYAA 4NHMA 2H6BA 3H1WA 1Y3TA 2WL1A 4XMAA 2VNOA 3RZZA 2BQPA 4AWDA 1H4GA 1DLLA 2A6XA 2EAKA 3PVEA 3K48A 1DGRN 4BPZA 3NAPC 3VGIA 1GICA 4LO8A 1BVP1 2RS33 3T1LA 5FQ0A 4AHXA 1OFNA 4JGZB 1D4VB 4BMEA 4CDUB 4IV3C 1DQ1A 1AXZA 2PLV3 3TN91 5AVPA 1NXMA 2F6BA 1U5XA 4N7IA 1VJ2A 3CJIB 2B8MA 1OA3A 1IGOA 3MIHA 2HWC3 3ZSJA 4YW4A 3USUB 1RVF2 3JZVA 4NVPA 2HEYF 1OLQA 4DFSA 2RR12 3AZYA 5I93A 3NAPA 2HEWF 4XJUA 3BTAA 3AZVA 1CAUA 4CDXA 4Q2FA 1J1TA 3TWIA 3A4UA 4GMP3 2XWJB 4IV3A 2ENRA 3N3HA 1C5IA 3WP6A 1AZDA 2SLIA 2V5YA 2Q8OA 3AXDA 3LB9A 1FOD2 4UBGA 1G9FA 3D0SA 1EV12 1S0FA 4XJ9A 4Z07A 3VKNA 2FZ2A 3WCRA 3ECQA 1EY2A 2XL7A 1VBB1 1QNWA 4Y20A 2EF6A 4W6XA 2BNNA 1IS6A 1QOSA 4YGDA 5ACA3 1OOPC 3RG0A 3R05A 3UKNA 4LUKA 1LOCA 3DN7A 2R0HA 1WLDA 3I7DA 3B9CA 2P3JA 2A7AA 2CGNA 1ZX5A 4WBBA 4H55A 5JLVA 1R091 3WXPA 1ZZ8A 3NL1A 4LULA 4XBQA 1RUJ1 1VBE2 1BEV1 1RUC3 1DQ0A 1MS5A 1PVC2 1QQP3 1VBA2 4LEJA 1CONA 5JSRA 2HEVF 1NG0A 3WQ7A 1MS0A 4LBJA 4X8NA 3I59A 4XF0A 1FMD1 2HWE3 4HLTA 4I09A 4KU8A 1OOPA 3MIDA 3C2UA 3TRSB 3WX5A 1DYPA 1XNCA 1V6KA 2P17A 2RS31 2I74A 5DDJ3 3VKMA 2XUMA 1AR72 2FZ1A 3AZZA 3BOWA 3Q9OA 4CTEA 5KXCA 1PK6B 2PLV1 5DXDA 3ES4A 2WZPP 3ZVXA 1SBFA 4PBOA 2XJUA 2W52A 2WKKA 2HWC1 2XLAA 3IBMA 4IERA 2DVGA 2PHRA 5C8CC 1B35C 1H0BA 3VBFB 4YM2A 4FXKB 2B9UA 4MGKE 4FCAA 1RUH2 2TNFA 5DUWA 4GMP1 4Q4W2 2VQAA 3JQWA 1NY71 3FLTA 1HQWA 1AHSA 1CAXB 1LODA 5FDBA 2OZ6A 1FNZA 1XU1A 4M3CB 1GKBA 3HAGA 3ZIWA 3M3IA 4MH0E 4RHV3 2LALA 5CADA 1ULFA 4HKLA 4KGGA 2DCKA 3JQXA 4DRRA 2XJSA 4FP2A 3N7JA 2QZ3A 4NWWA 1G9AA 3K51A 5FFOC 4Q8KA 3X29B 2WS93 3GYDA 1LB2A 5C8CA 1B35A 3OYWB 5ACA1 4E2GA 3PJQA 4H7MA 4YW3A 1FI2A 3OPZA 1HQNA 4YZ2A 1QJU2 1S0JA 3KGZA 5DZGA 5KHJA 1MEC3 1ZZ7A 1GBGA 3LA3A 2B42B 3NKGA 3VBUC 2A71A 1C1LA 2D98A 1RUC1 1QQP1 3AZXA 1LR5A 2R063 2HWD2 2WT0A 5EXOA 3T2TA 4E9KA 1GZCA 2H6CA 4KU7A 1J58A 4CRQA 2HWE1 3RWNA 5L36A 4N43C 4BLIA 5AFBA 3QD6A 1ONAA 1PO12 4LO7A 3SHRA 3FX3A 1M4WA 4YVSB 4RS5B 1JTZX 3J8F2 3JUUA 4COVA 1DHKB 5HXVA 5DDJ1 3J9SA 4XF1A 4OUMA 2QUOA 4FPLA 1RMU3 4RQPC 4CEWC 4PLMA 1VALA 4J1XA 3VBUA 4LBNA 4DOUA 1A3KA 1TEIA 4OI1A 3GHMA 5E1RA 2E51A 4I3GA 1YLLA 3BODA 2A6ZA 3H0OA 3D0JA 3H9AA 2CAUA 2PYTA 1CJPA 4NPRA 4YRDA 2OPKA 3WW3A 4K1ZA 3B9IA 2G9FA 4GIQA 1CQ9A 3TYJA 1DQ2A 4KL1A 1DBNA 1W6PA 4X8PA 5T5OA 3RQ0A 3NW4A 5JSPA 1VRH2 3SLIA 2Y0IA 4I0BA 4RQPA 3ZFEC 4CEWA 2YGMA 5CNAA 2XBO2 4EROA 4CZSA 2A6WA 5BNPB 2MEV2 4XFCA 4F8AA 3ZN4A 4AEMA 3WCSA 4LHNA 4LTAA 1RITA 1UKRA 2ZGOA 3MEPA 1AR93 1GSLA 4HETA 5FMOS 3VBHC 4XYXA 4V1PA 3VBSB 4WVWA 2WS91 2JXAA 4YG6A 2MHFA 4AGGA 1KFXL 4AG4A 1OKQA 3SH5A 1R083 3IDCB 4GULA 4BQ1A 3H7JA 1AR62 5L7OB 1MEC1 2X5IC 1WCKA 3ZFEA 3RMYA 3FFZA 1MQTB 1GR3A 2DUOA 3AB0A 5BYNA 3PVNA 4JDMA 5T5JA 1CAVB 2DVAA 4SLIA 3M70A 4JVAA 1NE6A 1BJQA 1LU2A 2R061 5GALA 1ENXA 4BWOA 2X53S 3WG4A 3VBHA 2ZJCA 2D93A 3B69A 1H9PA 5D8AC 1AL0G 1GZWA 3VUOA 3WW2A 1OA4A 1AL23 1W6NA 5GZDA 4H3WA 1I6XA 3RNSA 2AH2A 4ITCA 4Q0PA 4ORFA 5C33A 4YVWC 3JD72 2X5IA 2IXIA 4IEZA 1AX1A 1RMU1 3A0NA 3B94A 3LKJA 5E16A 2RM23 1QJY3 4DY3A 2Z5WA 1IPJA 2ZKNA 3NV2A 4CEYB 2JG9A 1PNGA 1RUI2 3WLUA 1HXS2 4CDQB 3DGTA 3HIFA 2B39A 3N35A 2YGLA 5CFDB 1L3JA 5D8AA 3AXEA 3AJZA 5JI9A 1ZYBA 3M2MA 1U0AA 2WLQA 1X82A 4EN7B 5HCBA 1I5ZA 3IPVA 1AYN3 4YVWA 1NLRA 1ND2B 4WVVA 1MZFA 1S2KA 2A6YA 1DGWA 4RR3B 3EJKA 2WNUC 1NZCA 4YARA 3TNQA 5T54A 4GKXA 5JOZA 3B93A 4AI3A 2UWCA 1AR91 2ZGPA 4LO4B 5A3MA 3LCPA 2UWAA 1PVXA 3MPPG 4FPGA 1NA1B 3SMHA 1LJ7A 2DYCA 5IK4A 5I8SA 4FOQA 1QOTA 5I8YA 3IIAA 1GYKA 3IKWA 2R073 1R081 4HSLA 1UL9A 1RINA 4KGQA 3GALA 3VHPA 2WNUA 4TWTA 4YZ1A 3DV8A 2VGDA 4ASLA 1NOVA 4ZXKA 1PGL1 4WM7B 1H2MA 3POSA 4Q0UA 4Q27A 3LSDA 5K7PA 1IS5A 2VOWA 4YM0A 2OVUA 4FXGB 1FPN2 5I0UA 3OTFA 1AL21 2IXLA 2WINB 2BWCA 1COV2 4QGNA 5IUQA 1VBD2 2R32A 2P37A 3AYEA 4GH4B 2ZHKA 2Q30A 5K0UC 1A8MA 1OQ1A 4M3CF 3ZFGC 4E2QA 5J37A 1JOJA 1H2NA 3NAPB 4YFZA 2GC3A 2RM21 1AVBA 1QJY1 1AR83 4KQ7A 1ZBE3 4JDOA 1UF2C 2WZR2 4F83A 4CDXB 1NCQC 3AMHA 1H8TB 2HYKA 4IV3B 3E6CC 3O7OA 1LEMA 1WCSA 4YG3A 2GALA 2DCYA 2CL2A 5A33A 3WW1A 4BLJA 1TME3 4L99A 1V6NA 2BYVE 3ROUA 3MZHA 4Y20B 3PTYA 1BYHA 4XOGA 3GBGA 2B45X 1AYN1 2RS12 5K0UA 3ZFGA 1IZ3A 4XFIA 2D3SA 1NCQA 2B7YA 4ZKTB 4LO5B 1OMIA 1DG6A 1GFF2 1LECA 3E5XA 2ZKLA 1F9KA 5CG8A 4Q4V3 3DF0A 5JZGC 3I2DA 5F1RA 2W08A 1QKQA 2ZGRA 1DQ6A 1QJX2 3S7EA 4Q1PA 3HT2A 4KWKA 4AVAA 3V0BA 1RHI2 4COZA 4Y4YA 4DB5A 5CB7A 2R071 5EJ3A 1YFXA 4LA2A 3WP3A 1UZYA 2DUPA 2WLPA 3JBG2 4EN8B 1BK1A 1IQAA 1TMF2 1ULGA 4B4PA 4C1XA 1SCRA 4LBQA 3ALQA 1H1IA 1R1A3 3UK9A 3CEWA 4K20A 1ASJ2 4HMZA 5JZGA 5KXDA 3AX4A 3ZFFB 3AKQA 5GLUA 4IEVA 2GMEA 3MW2A 3P3NA 3APBA 3RJ2X 1KXGA 3ZDSA 2R6QA 4SBVA 3WZ1A 3ZYJB 1RUE2 4Y26A 2NYYA 4C90A 1PZ8A 2HWB2 4M0HA 3UL2A 5EWSA 4P9IA 4R9DA 3KB5A 1ZZBA 2D44A 4FBFA 4XF4A 5JOYA 2P3KA 2NZ9A 1AR81 3IWZA 4Y1UA 1I3HA 2A3WA 2F4PA 1U5IA 4PJYA 2BNMA 1Z7S2 2AYHA 4DMIA 5KXBA 4Q8LA 3VDDC 2DVBA 3V64A 4XTMA 2PHDA 4L8QA 3VL9A 1TME1 3H3ZA 1MZ5A 1KD7A 2O0OA 1I1EA 4WZCA 1X7NA 3KZ4C 4R52A 4YW2A 3GHNA 5KHHA 4QHBA 2ZMNA 5J48A 1YHFA 4YNIA 5JPMB 1AYM2 2VU9A 1OI6A 3MPBA 4UW4A 4JRAA 4L9BA 5FO8B 2JG8C 1R1ZA 3VL8A 1QH6A 2CTVA 3BALA 3PHMA 1GV9A 5FTTC 4JGYC 3VKOA 2VMIA 1KQRA 4Q26A 3B3QE 1XQNA 1O91A 4Y22B 4OULA 4Q4V1 2EXHA 1Q5OA 3WR0A 1H4HA 3VDDA 1XNDA 5BNQA 3PNAA 3WVJA 2IFWA 1URXA 3LZZA 2RMU2 3WT3A 2NMNA 3ZXLA 3ZSMA 2BWAA 4C0HA 4P9LA 5JAXA 4GB32 4EV0A 1SBEA 2ZABA 1CD3G 4Q0VA 1S0GA 3ILNA