2WS92

Equine rhinitis a virus at low ph
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
200
structure length
200
Chain Sequence
GTTYCYSKPDGRPPSTVSDPVTRLGPTLSRHYTFKVGEWPHSQSHGHAWICPLPSDKLKKMGSFHEVVKAHHLVKNGWDVVVQVNASFAHSGALCVAAVPEYEHTHEKALKWSELEEPAYTYQQLSVFPHQLLNLRTNSSVHLVMPYIGPGPTTNLTLHNPWTIVILILSELTGPGQTVPVTMSVAPIDAMVNGPLPNPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords P1
publication title Equine Rhinitis a Virus and its Low Ph Empty Particle: Clues Towards an Aphthovirus Entry Mechanism?
pubmed doi rcsb
molecule tags Virus
total genus 41
structure length 200
sequence length 200
ec nomenclature
pdb deposition date 2009-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2ws9201
1X36A 2WWSA 2DF7A 1C8M1 4Q4W1 1ND2C 4IV3C 1HX6A 4CDWB 2BPA2 1HRV3 2IZWA 2WS91 5K0UC 3ZFEC 1FPN3 1PO23 1FPN2 4Y5Z0 1PO22 5JZGC 4GH4C 2HWD2 2PLV1 4CDXC 5C9AA 1BEV1 2WFF3 1BBT1 1QJY3 1RUD2 4GMP0 4JGZA 1X33A 1AL0G 2WFF2 1PGW1 1QJY2 3VBHC 4N43C 4YVSB 1MQTC 1VRH3 1GFF2 5A32B 5C4WC 1COV1 1RUJ1 1VRH2 4CEYB 1AR61 1R093 3NAPA 2R073 2XBO3 1NA1C 1ZBE3 1R092 2RR11 4JGYA 1TMF3 2R072 2XBO2 1ZBE2 2R063 1TMF2 1H8TA 5BNPB 2R062 5BNNC 1AR73 1HRV1 1ND2A 4IV3A 3VBSB 2XPJA 1AR72 1FPN1 1PO21 4WM7C 5CFCB 1TME2 1NCQC 5A33B 4CEWC 1B35B 1NG0A 1MEC3 2VQ0A 1PIV3 3TN93 5BNOB 3JB8A 3VBUB 4EJRA 1AYN3 2RS33 1PIV2 3TN92 3IDEA 5JZGA 2BUKA 2BFUS 1QJY1 1R1A3 1AYN2 2RM23 2RS32 1OOPA 2FZ1A 4CDUA 3HAGA 1R1A2 2RM22 1ND3B 1VRH1 4IV1A 4YVWA 2R071 2XBO1 2WLPA 3VBFC 5K0UB 5D8AA 1RUC3 1TMF1 1D4M3 3ZFEB 1RUC2 5C9AC 1D4M2 3ZFGC 4JGZC 2PLV3 5J96B 4LLFA 1AR71 1AYM3 4GH4B 2TBVA 1FOD3 4CDXB 2PLV2 1AYM2 1FOD2 3ZFFA 4FTBA 1DDLA 2BBVA 1AR81 1MEC1 3TN91 1PIV1 1A6CA 1PVC1 2ZTNA 1RUE1 3VBHB 3NAPC 1OHFA 1RUG3 1AYN1 1QJZA 2RS31 4N43B 5DDJ3 1MQTB 3VBOA 5L7OB 4JGYC 1R1A1 1RUG2 5C4WB 1RUF3 5DDJ2 4Q4V3 1M06G 1VBC3 1RUF2 1H8TC 1NA1B 1NCRB 4Q4V2 1VBC2 1RVF1 2RR12 3VBRA 5BNNB 2RS53 1RUC1 1HRV2 1D4M1 4PDWA 4WM7B 4RR3C 1W39A 2RS52 3VBFA 1RMU3 1NCQB 3VDDA 4CEWB 1ZBA3 2BFUL 1OOPC 1HRI3 1AYM1 4CDUC 1RMU2 1FOD1 2Y26A 1ZBA2 4QPGB 2RS13 3ZFGA 1HRI2 2RS12 4IV1C 1CD3G 4YVWC 5C8CB 1RUG1 1CJDA 5DDJ1 1C8NA 3J8F1 5D8AC 1PGL2 1AL23 1RUF1 3JD71 1AUYA 4Q4V1 5BNPA 1AR91 1VBC1 1AL22 3VBSA 4Q4Y1 5CFCA 1QJU3 5C9AB 5CFDA 3ZFFC 4JGZB 3LOBA 1IHMA 2X5IA 2RS51 1EAH3 1K5MB 1R083 5FMOS 1AR83 3VBOC 1PVC3 1RMU1 1RUE3 1QQP3 1ZBA1 1R082 1HRI1 1AR82 1MEC2 1PVC2 4RR3A 1RUE2 1QQP2 3NAPB 2RS11 3DPRB 1VBA3 4N53A 4JGYB 1POV1 1VBA2 4RHV3 1RUI1 4RQPA 4QPIB 3VBRC 4RHV2 4FSJA 1RVF3 2HWB3 1PGL1 1PO13 1ND2B 4IV3B 1RVF2 2HWB2 1AL21 4PDWC 1PO12 4WM8A 2MEV1 3VDDC 3CJIA 2WZR1 1VB2A 1QJU1 5JZGB 1HXS3 1OOPB 4FTEA 4CEYC 1EAH1 1HXS2 1R081 2RMU3 2ZZQA 4GB31 1QQP1 5ABJA 4YVWB 4AEDA 4BCUA 4RS5A 4CDQA 5BNPC 1NCRA 1VBA1 3J8F3 1V9U3 3JD73 5D8AB 1Z7S3 3VBSC 1NOVA 3J8F2 1V9U2 1AR93 4RHV1 3JD72 5CFCC 1Z7S2 4CDWA 5CFDC 1AR92 1B35C 2HWB1 1VB4A 1E57A 4Q4Y3 2HWF1 1PO11 5ACA3 2X5IC 1QJX3 4Q4Y2 4SBVA 5ACA2 1BMV1 1QJX2 2HWE3 5FMOL 4Y4YA 2HWE2 5AC93 4N53C 3JBG3 5AC92 3VBOB 5FOJB 1HXS1 3JBG2 5C8CA 1VBD1 4RQPC 4YVSA 1RUH3 2HWC3 5A32A 1POV3 2RMU1 4CEYA 1RUI3 1RUH2 1VAKA 2HWC2 1ASJ3 1RUI2 4WM8C 2HWD3 3VBRB 4RFT0 1ASJ2 5LK7B 1V9U1 3CJIC 1Z7S1 1F2NA 1RUD3 4PDWB 2MEV3 3VBFB 3VDDB 5GKAC 2MEV2 2R043 2WZR3 1K5MA 4GMP1 1SMVA 5ACA1 1QJX1 1VBE1 2R042 4Q4X3 2WZR2 5A33A 3ZFGB 1B35A 4NWWA 5BNOA 1QJU2 5L7OC 2HWE1 4Q4X2 1VBB3 3VBUA 1EV11 5ABJC 4AEDC 1VBB2 3DPRA 5AC91 4CDQC 1EAH2 4RS5C 1NCRC 4GB33 3JBG1 1ND3A 2ZAHA 4GB32 1POV0 4QPIA 4CDWC 1RUH1 2HWC1 1FMD3 2FZ2A 3FBMA 1TME3 1ASJ1 1FMD2 1H8TB 1NY72 1WCDJ 2HWF3 2HWD1 5K0UA 5CFDB 3ZFEA 4FTSA 2HWF2 1RHI3 2X5IB 4QPGC 1RUD1 4NWVA 1RHI2 2WFF1 4GH4A 1BMV2 4CDXA 4Z92B 2R041 4RR3B 5J98B 5C8CC 4YVSC 4Q4X1 4N53B 4Q4W3 1C8M3 3VBHA 4CDUB 3M8LA 1VBB1 3JB4C 1VBD3 4Q4W2 1C8M2 4N43A 1R091 4RQPB 1MQTA 1VBD2 5L7OA 2WS93 3S6PA 5C4WA 1ZBE1 2QQPA 2GH8A 4IV1B 2GSYA 2RMU2 2WS92 2R061 1NA1A 4WM8B 1F8VA 1OPOA 3CJIB 3ZXAC 1FMD1 1HQNA 1NY71 1K5MC 1BEV3 1BBT3 1TME1 5BNNA 1BEV2 5BNOC 1BBT2 4GMP3 3VBUC 1VBE3 4WM7A 1RHI1 1PGW2 1NCQA 3DPRC 3ZFFB 4CEWA 1VBE2 1RB8G 1COV3 1EV13 1RUJ3 2RM21 1AR63 4QPGA 5ABJB 1ND3C 1COV2 1EV12 1RUJ2 4AEDB 4QPIC 1AR62 2RR13 4CDQB 4RS5B
chains in the Genus database with same CATH superfamily
4QPYA 2GH2A 2JG9B 1X36A 2HEWF 4Q4W1 2G4IA 5FUPA 2Y6FA 4XE9A 2OUJA 2R0FA 2ZEWA 3EHKA 5IVFA 5FZKA 3CU7A 5I0UA 2Y38A 4AAPA 4CP9A 5KHIA 1DQ4A 1TEIA 3IIAA 2BPA2 2FCUA 4HVQA 4EWDA 4ZKTB 4CTEA 3PMSA 4YW2A 3M3EA 1C57A 2VNGA 5D1IA 3RZKA 1UQXA 2WWUA 4FQZA 4Y5Z0 2WA4A 4I0AA 2RV9A 2ZGSA 2EIDA 4YLZA 4LT5A 4CDXC 5APAA 4LULA 4UI9L 3MPPG 5C9AA 3MLJA 1UZZA 2ZX3A 3OBRA 1X9TA 4GMP0 2Y8KA 4JGZA 2D93A 3K4DA 2DUQA 1SPPB 3BTAA 5DUVA 1WCQA 2D6PA 5I0SA 2W94A 1QJY2 1OF3A 2BNNA 3WY6A 2VNOA 5LB6A 2EXKA 1VP6A 3BYWA 3MIEA 1R1ZA 4N43C 1HN0A 4X8NA 1MQTC 4YVSB 3P6BA 1ONAA 1SCRA 2ZGKA 1N3QA 5A32B 4XUQA 4YFWA 4AWDA 2WYSA 1C5IA 5C4WC 2DDUA 3S57A 4YG6A 1QXJA 1UMHA 3SISA 1EYBA 3H1MA 2JDZA 3T4HB 1R092 2RR11 4BLIA 3VKLA 2VMCA 4WZFA 4CRQA 4CU7A 3ZYFA 2R072 1ZZ7A 2BBAA 2R063 3HBKA 4KWLA 4BE3A 3INAA 2BWAA 3DUIA 1TMF2 1H8TA 1W2AX 4CCKA 5BNPB 2P6HA 4OI0A 1G9DA 2ZPXA 2XVGA 1HB3A 2XB6C 1CAWA 1HRV1 1UF2C 2CV6A 3D3AA 4IV3A 5LK5A 4EN0A 4YFZA 2CSGA 3FE5A 2XPJA 2FDKA 1LHUA 1AR72 4LIUA 5A6YA 3I3BA 2UWBA 5A3NA 4XIKA 2GP3A 1TME2 1NG0A 3OGGA 1GQGA 2VQ0A 1YLLA 2YC0A 1K3IA 5JXIA 1H6XA 4OLLA 2J7MA 2A5ZA 4W6WA 3IM0A 3VBUB 2JENA 3PTYA 2VXRA 3TN92 1JYTA 4ORFA 1FYUA 3FLPA 3BB6A 3KVAA 4GXLA 2ZGUA 4I3PA 1A78A 2BFUS 4A6OA 1W8ZA 2WLQA 3D5OA 1AYN2 2RM23 2RS32 3BI3A 4R9DA 2VOTA 5GZDA 3ZXGA 4MGSA 3T09A 3WINE 4LBQA 3WW1A 1XBFA 3EYPA 3WOGA 1E5IA 5FR3A 3AP5A 1U12A 1VRH1 2OPKA 1O5LA 5FRAA 3UT0A 2WL1A 1V00A 5JMCA 1L7RA 2HH9A 2ZKNA 3UKNA 3HIFA 4LTAA 2XLAA 5DAXA 2XBO1 1UY3A 1X50A 3VBFC 4WZCA 4MVTA 5K0UB 5D8AA 2GN3A 1Q8PA 4JHTA 4XFFA 4ONUA 2IUWA 3THDA 1RUC2 3NL1A 3MV11 4Y1VA 1MS8A 3ZFGC 4W6YA 3WNMA 3LDKA 1LOGA 3MFCA 1AYM3 2ZEYA 1IQDC 5IT6A 1JTZX 1X8MA 3BKZA 1X82A 2E7AA 1JOBA 3ZDSA 1SACA 5FWJA 4CCLA 1PZ7A 3ROUA 3MO4A 4JV4A 2W1UA 5FYSA 3V65A 4GKYA 1E5HA 2VVFA 4ZS3A 4AFDA 4DEVA 1DDLA 3VDCA 1MEC1 3ZYRA 1PIV1 2ZTNA 3VD4A 4WBBA 1RUE1 5T52A 1U5IA 3LWCA 1YQ5A 1RUG3 3KVBA 1QJZA 3M3OA 1XJAA 3M3CA 4HPKA 5DDJ3 4BK5A 1VIWB 3VBOA 4H14A 3M7AA 1OI6A 4ARXA 2P4EA 2WNVB 1DZTA 1JU4A 4UFLA 4P02B 3I3MA 5KHHA 5H9SA 4ZHNA 2VOXA 2B7YA 1IQAA 2XJPA 2Z4FA 4QAWA 5FYZA 1SFNA 4JX0A 3VHOA 5FYBA 1NCRB 2VZPA 4J6GA 4YW7A 5FYIA 4YYOA 4MXWB 2VXJA 5L9VA 2RR12 2ZX1A 4R4ZA 3BODA 2WDBA 3AMHA 3MYXA 5F8PA 1CX4A 3MUZ1 4NHYA 4A41A 5FZDA 3SC7X 4TTGA 1D7PM 3RRDA 1QXRA 2VZ1A 5A3WA 3VLBB 4EN8B 3B02A 3HNBM 1HRV2 5DAQA 1D4M1 4FOWA 1HJFA 2RS52 2VQUA 4L9BA 4CEWB 1XYPA 1ZBA3 4MGKE 2RDSA 3ILFA 3NNGA 4M0HA 2OQ7A 2GNDA 1GZWA 4CDUC 1UPIA 4TYSA 3WT3A 2OA2A 2Y26A 1OLQA 1IS3A 2RS13 1XOYA 5LBEA 2XDVA 3NJZA 1SQ4A 3FL7A 3H1WA 3LKJA 1VMHA 5FPVA 1D2QA 3H1YA 3B94A 3KQ4B 4Q1RA 2JICA 3IDBB 4CUGA 5FO8B 2WN3A 5IVJA 2OPWA 2YXSA 2R1DA 3IMMA 4URAA 1S0JA 5F2SA 2EXIA 1JZ4A 1CJDA 3EO6A 2VU9A 4CUBA 3J8F1 2P3IA 4FOYA 5KC6A 1RUF1 3M70A 1AUYA 1J1TA 1YQ8A 3WVJA 4A3ZA 2G9GA 1NZCA 1D0HA 1SBFA 1AR91 1NE4A 2GAUA 2LTNA 2PQSA 5I0TA 5A3OA 5BNPA 3KCYA 5IHRA 5L9RA 3PDQA 5HV0A 1X9PA 4C90A 1VLNA 3NNFA 1W6MB 3ABZA 5FTTC 3UGFA 2UWAA 3RYKA 1VALA 1F4HA 2W1WA 5FPLA 1S0DA 4LO6B 3UESA 1GWLA 3AL6A 3ZFFC 3RNSA 2X29A 3A0KA 3IDCB 2WFPA 3LOBA 4IE4A 1OUSA 2ARBA 4HVRA 4XILA 1W9WA 5A6ZA 2E26A 2YC4A 1K5MB 3ETQA 4O61A 3OPWA 4YPJA 5JXJA 2G1MA 1KDMA 4FP3A 4HANA 5FMOS 2VJXA 1OA2A 3O5SA 1PVC3 1U5ZA 2DVDA 4FPYA 4CCDA 1JYVA 1QQP3 1QXPA 2NLRA 2TEPA 3BGAA 1VJ2A 1R082 5FZ3A 2PHWA 1MEC2 4FOVA 2UY9A 3KGZA 3PUHA 1RUE2 2JG8A 3OBTA 4QQHA 5CZKA 4ZU5A 5GLWA 4XXAA 3SCFA 3P1IA 2JDNA 3GALA 2XHKA 1ULEA 2JDPA 2RJ2A 3O0WA 4JGYB 4OFGA 3VKFC 1VBA2 3I2OA 2H0BA 1YFUA 3NV4A 5FJKA 1ZNPA 5EYXA 5JUVA 1UZYA 1W8HA 3AKSA 5D21A 1V6MA 2O8OA 5F2WA 4AVVA 1WBFA 4NPMA 3LIHA 1JOJA 3JQXA 3Q8BA 3WLUA 1MZEA 1AL21 3WG4A 2Y60A 2W0XA 3POGA 1PO12 4QDSA 4WM8A 1S0BA 2WN2A 1QEXA 3FLTA 4NRMA 5JOZA 4CCEA 4IE7A 3CJIA 1O3SA 3HT2A 4Q0VA 1W06A 1QKQA 1RC6A 1JHJA 1S0FA 2DUOA 2FBEA 2RHPA 2XVLA 4O7XA 5GALA 4ZU4A 3SCGA 2L9LA 1QJU1 4OHWA 4UYBA 2G19A 2GMPA 2ZMKA 4JQTA 5IAXA 1OOPB 3RI9A 4TLFA 1GOHA 4XJWA 2DTWA 1CN1A 4CEYC 5KWRA 2QQJA 3I3QA 1HXS2 4MGTA 3DN7A 2B9UA 2R6QA 4ZU7A 1DYKA 4LUMA 2A6VA 2W52A 2GNBA 4A44A 2BGOA 3OUIA 1O8PA 1BK1A 4NHKA 2VGDA 1WA4A 3K75B 3FJSA 3SITA 3MI8A 4AEDA 1QWRA 3POSA 3J7NA 4CDQA 2DVGA 1LULA 3VD5A 1T2XA 1NCRA 3J9SA 1M4WA 1UX7A 1SBDA 4YW3A 2Q1FA 3I2IA 3H8RA 2XLGA 3J8F2 4RHV1 4EROA 3A23A 4X6RB 3IAQA 3WF0A 4TN7A 3D8CA 1Z7S2 4CDWA 2H6CA 2VOWA 5FZIA 3OGRA 4WVVA 3WW3A 1AR92 2HWB1 4Q4Y3 1E57A 5JDBA 3AVSA 4OMDA 1V6IA 3FFZA 2XKPA 2X5IC 2FD8A 2ADEA 3IPVA 1JYWA 2I74A 4XCAA 3FWEA 1EUTA 3N9OA 4ZZ5A 5FQ0A 5ACA2 1W8TA 1JZ8A 1QJX2 2PHLA 2JDUA 3BALA 3MICA 1GP5A 5J3UA 2IWGB 2VZTA 2B45X 4RGGA 1H30A 4B3NA 5FZCA 5AC93 1ZREA 4IEVA 2BYVE 2ZA9A 2DWRA 4UBGA 1LEDA 2XKOA 1AZDA 5CNAA 5DG1A 4M3CB 4DINB 5F3GA 5T5OA 4JC1A 4AFMA 3D6EA 4KG0A 1LGNA 3KQRA 4XAAA 5A80A 4Z1VA 3GJAA 3R6SA 3RDIA 4OCTA 1X7NA 2WT0A 3FX3A 5E89A 3O1PA 4M3CF 1FX5A 3NV2A 2ADDA 1C3HA 1KJRA 1UXXX 1QJFA 1VAKA 2RJLA 3K3NA 1RUOA 1ASJ3 4NRPA 4IEPA 2Q5TA 4L11A 3V0BB 1POQA 3OY8B 2XQRA 4AQ2A 2FDHA 3VBRB 4AI2A 1OH3A 3U0ZA 1NKGA 2PMWB 3GBFA 1LGBA 2DBIA 5BY5A 1OKQA 5C71A 1WCUA 2ZHKA 4BXSV 3KT7A 1F2NA 2KR2A 4HKWA 3WF3A 4QM9A 4YW6A 4BDVB 3LA7A 3VBFB 4PIYA 3VDDB 5CVRA 4N9HA 3BIEA 1K5MA 3ILRA 4K6BA 1OVPA 4NPLA 5FP7A 3AKRA 3F95A 2R042 2W95A 3HT1A 4QKFA 3ZFGB 1B35A 4KBBA 4AYUA 4ISQA 3DKWA 2E33A 1QJU2 1UNBA 4FT8A 3ZXDA 3PVBB 3UETA 3TEYA 2HWE1 4W8JA 4QD2A 4PIXA 4CE8A 2TUNA 3K51A 5B2GB 3HEIA 4Y22B 3KV4A 1SG3A 5DAPA 2LUWA 1VBB2 4UF0A 3ZR5A 4QQ2A 2W39A 4CYDA 4E2QA 4DY5A 1BVVA 2C4XA 2OZJA 1RJ8A 4OI2A 3WW2A 1ND3A 5LBCA 1GQPA 1NXD1 2EICA 4LA3A 4QB2A 4LKDA 4AI9A 1RUH1 1O4ZA 2VBDA 2HWC1 3A21A 1FMD3 4QKBA 1BXHA 1YHFA 1V6LA 3FBMA 3OD4A 4AR2A 1TME3 2C24A 3FHIB 5JCTA 5IUQA 4BYYA 2RJKA 3O12A 5K4LA 4XBQA 2OX0A 4J1WA 5EXOA 3SKVA 4C91A 2HWF3 2YY1A 1CESA 3C7EA 3MPBA 4FBFA 4I0BA 2CGOA 4XF0A 1CAXA 5FXVA 3KCXA 4FPGA 3WSOA 1BCXA 2NP0A 4QPGC 5A70A 4YZ4A 2PHUA 3VB9A 3PVEA 5I0RA 1RHI2 2J1TA 1QNYA 2Q8CA 4UBHA 4AGRA 5G04L 2V4VA 3WP3A 3ST7A 3N36A 4CDXA 1ENSA 1OQEA 2FMYA 1OD3A 2P3YA 5C6CA 2W46A 3E6BA 1UYZA 5JSOA 1XNBA 4LBQD 3D0JA 1N1YA 2VC9A 3I3EA 4MGZE 4YVSC 5C8CC 5T5JA 1UMIA 2VZRA 3VD3A 4Q4W3 3GZEA 4GZ9A 4XDOA 4XABA 2VUAA 1F5FA 4CDUB 3M8LA 4HG6B 2OVUA 3JB4C 2GC3A 3K77A 4NHLA 4XIOA 5C3OA 5B4NA 2QZ2A 4N43A 2ZCWA 5F37A 4RQPB 1MQTA 4Y1ZA 1OKOA 4JDOA 4BMBA 2BV4A 1YI9A 1ZBE1 2WWJA 4HMZA 5C4WA 5T55A 2LALA 4OULA 1GQHA 2RG4A 2Y33A 2OZ6A 3C7OA 2WS92 1LCLA 2YGLA 4AI3A 5EZWA 3RZLA 2GZWA 4EYUA 1HB2A 1QOTA 2YV8A 3T1MA 4ARYA 1IZ3A 3AYAA 3RJRA 3FUQA 4YG3A 4RGKA 4G9SB 3USUB 3ZXAC 3I2FA 5CG9A 1QDCA 1JYCA 4D6QA 1NY71 2SLIA 3OUJA 5M0TA 3W21A 3I8TA 4PQQA 5FY0A 4HK8A 1XE0A 1H8VA 2W08A 3VBUC 1LB2A 1TNFA 3VZOA 2OT7A 1F31A 4GWNA 2XJTA 3ZFFB 3U14A 3PL0A 5DUXA 1BK0A 1TE1B 4GAZA 4FXGB 1J3PA 3J7LA 1GV9A 3O14A 4Y20B 3WG1A 5FPUA 1MS3A 1KS4A 3K3OA 1AR62 2RR13 2E9QA 4RS5B 5T5PA 2ZXQA 4QB6A 1AJOA 1NXMA 2WWSA 2DF7A 2BERA 2WO1A 4Z2AA 2PA7A 1ND2C 1AVBA 1V6JA 4J1XA 1DGLA 2Y0OA 3AMNA 1XE8A 3TNPB 4K9SA 1JBCA 1XXNA 1HX6A 1W3XA 1W6PB 1HRV3 4G4FA 5K0UC 5FP3A 3WF1A 4FFHA 1ZA4A 1WWYA 2PYTA 3THPA 3S0MA 1H4GA 4AK3A 1FPN2 1CVNA 3WQBA 4CP0A 1PO22 3WG3A 1Q3EA 1MZ5A 2JEMA 1V6KA 2MPFA 3MUY1 1CPMA 1LOEA 1MZ6A 2PLV1 1UW8A 3GBGA 1V0AA 1GU3A 4E27A 5F6KA 2BOIA 1MS5A 4NRQA 2WUHA 4R9BA 5EJ1B 1BEV1 3LEIA 5FPZA 2WFF3 1BBT1 4KG8A 4QT6A 1HDKA 3QH6A 4BPZA 3GCXA 3WF2A 4AGVA 3KT1A 1Y9QA 1QHDA 1SLIA 3RZGA 1HJGA 3OGSA 1CX1A 3AJYA 3OEBA 1TNRA 1MS1A 1VRH3 3KB5A 3WDTA 1QY4A 2WNVC 1GFF2 4MGQA 1J83A 3M2MA 4B1MA 4Y4RA 1CAUA 1S2EA 2Q0AA 3AMQA 4COUA 1CIWA 4CEYB 5LRSA 3MV01 3ZX7A 4LBOA 4HONA 2XBO3 1P8JA 4FPCA 3RSJA 3B9IA 3W59A 3WV6A 5LA2A 2VMEA 4HETA 4WVMA 2YBKA 4NMIA 1ZBE2 2IXCA 1RL3A 5CADA 4EN7B 1YFXA 4FFGA 3MFAA 4K21A 2AC1A 4LKFA 1PX4A 2FHRA 4BQXA 4BA6A 2CAVA 4HN1A 2WT1A 5T50A 1IG0A 1HN1A 1LGCA 3RWNA 1F35A 4CEWC 2RE9A 3RPQA 4FPOB 1MEC3 5AFBA 1PIV3 3MDPA 2ID4A 4ZPIA 4DEQA 2XG3A 3IDEA 5JZGA 5FKBA 4XBLA 2BUKA 2O8QA 1LAJA 1QJY1 2QBXA 1LRHA 4MHUA 2FZ1A 1NZIA 3AZWA 4CDUA 1T6GC 1URXA 1W9FA 2D6LX 1R1A2 4GD4A 2YU1A 4N7UA 1GICA 2CL2A 4FP2A 4MH0E 4NIDA 2A73B 4XQDA 4QGNA 2TNFA 4MLOA 2HBUA 1C1FA 3AYCA 4QB1A 2Q30A 2VULA 3EJKA 3PUAA 5A7OA 3VL9A 5DG2A 3ZSMA 5FO9B 2PN5A 2P2KA 1D2SA 4RN5A 2R071 3T08A 3HOBA 2PFWA 4GWMA 1QU0A 3POJA 1TMF1 1D4M3 1WA6X 4F7ZA 3BOPA 5F5QA 2HEYF 4P9IA 4B7KA 5A6XA 3BIWE 3DV8A 2ZEZA 5FZHA 4GJZA 2VMIA 2WZEA 5BV6A 1AR71 5BYNA 2YZ4A 1V70A 1PK6C 2VW2A 3MF9A 2ETEA 3NQHA 2PLV2 5FMCA 1WMFA 2UY8A 2WKKA 5IVYA 2VPVA 3ES4A 3WXPA 4IDZA 4O9GA 1FOD2 3ZFFA 2OUHA 4FTBA 1IKPA 5FXXA 3KF3A 2YUEA 1AR81 4PLNA 4QMAA 3TN91 1A6CA 2D43A 4IGOA 1N3PA 2VVEA 3I2JA 4NN0A 2VNRA 1AYN1 2RS31 4LBKA 3I7DA 2D97A 3LPFA 4LE3A 3NJXA 1W9SA 2A1XA 5EP9A 1W9TA 2RDNA 4FFIA 4JGYC 4N90A 1G9FA 1YFYA 3M3QA 1RUF3 4U2AA 2Z79A 1M06G 2A7AA 5FYYA 2LS6A 2HYXA 3FUOA 3H7JA 4FPJA 1PMJX 1W8NA 4XF9A 4OUMA 4Q4V2 5I0DA 3GM8A 3VL8A 3N7JA 1VBC2 4AFCA 4Y3OA 1PNFA 2GC0A 3MW3A 4W6XA 1YIFA 1S4CA 2JIGA 4XF1A 2VH9A 1ZRFA 4AI1A 5FWEA 2BDRA 4K40A 1W6NA 3RZMA 5BNNB 1YQCA 1LNSA 2E63A 2A3WA 1W0PA 1RUC1 2UWCA 1IS6A 1KS5A 2ZKLA 5FK8A 1W39A 2VZSA 1VRBA 2BFUL 4S2DA 1XQNA 4ZONA 1OOPC 3FN9A 4Y1XA 1RMU2 3HN3A 2Y6HA 2WO3A 3GCWA 4HT1T 3IB3A 3AP6A 4QPGB 4YWAA 1HRI2 2DVAA 4JVAA 3I49A 4LOTA 1CZSA 4IV1C 1EP0A 1J3QA 1PM4A 3C8XA 1CD3G 1PMIA 2C6SA 1GOGA 4C1XA 2W91A 4XVHA 1FXZA 5C8CB 2PTMA 3N7LA 4OHZA 4A7KA 4IEQA 1ZM1A 4IL7A 1PGL2 2ET7A 4B29A 1AL23 4EE2A 3JD71 1Y7BA 3VD9A 4QQLA 5J09A 5GLVA 2X53S 4BQYA 2BRTA 5L73A 3ZXLA 3BOWA 5IVCA 3VKNA 1CAVB 3AC0A 4Q8KA 5HI0A 1EUUA 3E5UA 2HKXA 3AJZA 4NAOA 3OBZA 4A2UA 1QJU3 1NLQA 1HQWA 1WMDA 2QDRA 4K20A 2D3PA 2VMFA 1ULPA 4XDQA 1LJ7A 5FY5A 3OYWB 5JVVA 4DFSA 4CZSA 2VO5A 5FMBA 5LA9A 2X5IA 1Y9GA 2RS51 2QQLA 4IEZA 4M4PA 2XXZA 1U5XA 1ZRDA 1OC1A 4AW7A 1OFNA 1GNHA 4H7LA 4E4ZA 4NR1A 4LA2A 4LEJA 3CJXA 1WMEA 4HSLA 1AR82 4IERA 1HW5A 4RR3A 1WD4A 3FMGA 3K2OA 4XBNA 3NAPB 5BNQA 2XUMA 4HVOA 1UU4A 4KU7A 1VAMA 1ODNA 4Q5OA 2Y6LA 3AMPA 4NIGA 1FAYA 1WLTA 1ZX5A 3B9CA 3SXWA 4QM8A 4RHV3 5IK4A 1O59A 4OHVA 4DMIA 1RUI1 1UZ0A 1LEMA 5FP4A 1K42A 5FXWA 5TSWA 2WYFA 1H4HA 5C5UA 1XPWA 3VBRC 5FPAA 3S7IA 1RVF3 2HWB3 2ARAA 2YFZA 4N8MA 1ND2B 2BQPA 1US2A 3HBZA 3IAPA 4A42A 5LZ6A 4LHKA 1GR3A 3CQOA 1Y43B 2BU9A 2MEV1 3AMMA 2VZUA 3ILNA 4H2AA 3VDDC 3HQRA 5C3QA 3AP7A 1SEFA 3QLQA 2WZR1 3WDYA 2D3SA 1FNZA 2ZHMA 3WW4A 3O1RA 3OEAA 3SNMA 3I2KA 3GF6A 1A34A 4FTEA 1EAH1 1W0OA 2C5DA 1AXKA 4PCRA 2ZGQA 5LY1A 2BNOA 1F9KA 1R081 4JKKA 1JXNA 3U07A 3H9AA 4N7IA 1W6OA 1HB4A 3OG2A 4R4XA 5EHDA 4EQVA 3V0AA 1YI7A 3I59B 4XFHA 4QQOA 1OLME 4YVWB 5T5LA 2FDIA 5FZ8A 4BCUA 2EXJA 4A4AA 2JG9A 1MS0A 1VBA1 4S2FA 1BYHA 4B1LA 5A7WB 1V9U2 4CP1A 2UYBA 2YFUA 2QQWA 3JD72 4ISRA 4OMCA 3TWIA 3CDZB 3WDXA 2VG9A 2B8MA 2G9ZA 2VM9A 3OBAA 4MOAA 3T0AA 3O1UA 5FOBB 2AUYA 5F6LB 1Z0HA 1PO11 4IEYA 4R9AA 4L99A 1I9RA 4V2WA 5IFPA 1O4YA 1YC61 4S2HA 1C28A 4URTA 2Z42A 3MEPA 4COWA 3K4AA 2XHNA 4Y1UA 4P9JA 2IXJA 2J1RA 4M4RA 1BMV1 4XF3A 2HWE3 1JOPA 5FMOL 3T2OA 4MX3A 2YBSA 5F32A 4C0HA 2Y6GA 3OTFA 3AKTA 4IEOA 2CHHA 4LMFA 4Y4YA 1ZZ6A 5FJHA 4P5YA 3ZO0B 3H3LA 1SPPA 5CG8A 1RXFA 2EF6A 4JKLA 1SDWA 2Q1ZB 2ZABA 4UOJA 2W1QA 5E88A 1ALYA 1HXS1 5JR7B 4AFAA 3NV1A 3R05A 5LCWL 3JBG2 3CF6E 3WF4A 5C8CA 4RQPC 4YVSA 4FPEA 2DVFA 1RUH3 3EMRA 2HWC3 3DECA 5DAVA 5FZOB 5A32A 1N3OA 1POV3 4AVCA 2RMU1 3OJBA 3WX5A 1J84A 2VW0A 3HNYM 2YPJA 1JYXA 1V6OA 2DU1A 5FCCA 3C3VA 1RUI2 3CZJA 1JW6A 3KLSA 4RFT0 5FZ6A 5LK7B 2P3KA 2DFCA 4AQSA 2D6OX 1DBNA 1JN2P 4PI0A 3R4SA 1UY0A 4A7YA 5C3SA 1Z7S1 4KWUA 4RFRB 1UL9A 2V5YA 4FAGA 1GP6A 5SV8A 4PDWB 4J25A 1XYOA 2WQ8A 3FHQA 4PLMA 5B4XA 3OYWA 3THTA 4XUPA 1UO9A 2MEV2 4XF4A 4IEXA 4GMP1 1BQPA 1SMVA 5ACA1 1QJX1 2R16A 1VBE1 3IBMA 3ON7A 2WZR2 3ETPA 4Y5SA 2XL9A 4NWWA 4AHYA 3PURA 4NUBA 4EZ4A 1KQRA 5L7OC 1JYIA 2LROA 4Q4X2 3VBUA 1PK6B 1KEXA 4AXOA 1H9WA 4OUSA 3I2GA 4K8FA 3ACLA 1GMMA 4D7YA 4MZUA 1EAH2 4RS5C 3W5NA 3O1VA 4GB33 1GLHA 3GHNA 1QDOA 1SDDB 3LE0A 3RMYA 1POV0 4V1PA 5FZLA 5EQUA 1JH5A 3DL3A 3POEA 4Z82A 3WUCA 1QJEA 3AP4A 5GLZA 2JWPA 1FATA 2JE9A 4MYEA 2YHJA 4GA9A 1XYNA 4BOWA 4YW5A 4EN9B 2ERFA 3AYDA 4NJ4A 4EWAA 3BUCA 3HNMA 2HWD1 5K0UA 5CFDB 2YC2A 2IXHA 4YZ3A 2AYHA 3MW4A 3OF1A 4W65A 4FTSA 2DUPA 5DQ0A 3H7YA 4HKLA 4P9LA 3LQCA 3NJVA 4NWVA 2IFWA 3A7QA 3RYPA 3NMBA 4LLOA 1BMV2 3ES1A 3EXUA 2D6KA 1GZCA 4H3WA 4HOOA 4QU1A 4SLIA 2OS2A 1UOBA 2R041 2ZGNA 3G6JB 2J22A 3ZPYA 4NO4A 5DN2A 2WINB 5ANQA 5FZ0A 4N53B 5K8SA 3AZVA 1G9CA 5FLJA 1J1LA 1VBB1 1KGYA 1LU2A 1VBD3 1YWKA 1C8M2 3RJ2X 2WQ4A 4XQ4A 4AFBA 4DXTA 1J3RA 3FBYA 4Q29A 1YCIA 2WNVA 2A71A 3P3NA 3S6PA 4XACA 3WHTA 2XWBB 2KD7A 4IV1B 1KXGA 4TXWA 5A7WA 3RZJA 1KFUL 1QGLA 2C9AA 2F4LA 2RMU2 5HCAA 3C7HA 3ZM8A 2R061 4QX8A 2MHFA 5FZMA 5FLIA 3M3IA 1F8VA 4MXWA 1XU2A 1LR5A 1PX3A 5LATA 1XRUA 2ZGLA 3VHPA 3Q9OA 4XHXA 3P3PA 1BEV3 3VHNA 1BBT3 3WDVA 4WVWA 2ZEXA 1J58A 2E31A 4E2SA 2ARCA 1A8DA 4KWJA 3R4DB 4LO4B 2FDJA 4FPLA 3SMHA 3A4UA 3DYOA 4XJUA 2OIIA 1QOOA 3M1HA 1AHSA 1RHI1 1SFPA 1PGW2 1XNDA 3CMGA 2FCVA 2KM2A 1LOFC 4FPFA 4CEWA 3FC0A 1VBE2 2B9VA 2X05A 2P6CA 5IK8A 1EV13 2RM21 5E8AA 4AQTA 3O1SA 1I5PA 1UYPA 2VR4A 3Q8FA 3RZZA 2PHRA 3VZJA 5ABJB 2NM1A 1COV2 1RUJ2 4QHBA 4QKDA 1YRZA 4QPIC 4ZY9A 2KXLA 4BMEA 1R64A 3N9QA 1E5SA 3BVCA 2I45A 2YBPA 4IV3C 4OUEA 1H2NA 4IE6A 1IGOA 5FLHA 5IK5A 5SV5A 3TEWA 5EJZB 4IEUA 3SCHA 3OOXA 2WS91 3KF5A 1LENA 4AQ6A 1GP4A 4PBOA 2WZPP 4D0QA 3AXEA 2B4KA 5BXXA 3WZ1A 4LE4A 1Z78A 4DOUA 2HWD2 3ZPOA 4YSFA 1W6MA 4YRDA 3SEEA 3MW2A 1QJY3 4Q1PA 3ZN5A 1DF0A 5A7SA 2D7FA 1D4VB 1XSQA 1SLAA 1UMZA 1AL0G 1N1VA 1WD3A 3ZN6B 4AEJA 3POWA 2J1UA 5KBFA 5A7PA 5HXVA 3IKWA 2WABA 4IE0A 4Q27A 3ZKYA 2I07B 2BTVC 4BQ5A 2GDFA 5JAXA 2WR9A 5GM0A 5LY2A 5JMOA 2VY0A 4KGQA 3HVDA 3MF6A 5H9RA 2NYYA 4KGGA 4OYUA 4U36A 1AR61 2QZ3A 1R093 2WO7A 2K0GA 3VV1A 2WZ8A 4DB5A 1GSLA 1APNA 1EPWA 2R073 3K46A 3LF7A 5K7PA 3VD7A 4JGYA 3I54A 4FVVA 4HSJA 3NJYA 1TMF3 4QKNA 4EZHA 5DABA 3OUHA 3GZUC 2GP5A 4AEMA 2R062 1QNWA 1UKGA 3ACGA 1LHNA 5FV3A 2BOJA 3J7MA 1AR73 2D44A 4JZRA 5FXZA 4ASMB 2BEOA 3TYJA 2ZOEB 2WAAA 1FPN1 2PHFA 2HBTA 3CLPA 1PO21 2P3JA 3LCPA 5A1FA 3ZSJA 5A33B 4CCOA 3ZYJB 4LHNA 3L2YA 3TN93 5BNOB 4AE2A 4GJYA 5KHKA 4ES8A 3JB8A 3JCIA 4IE5A 3ZMOA 4Q0SA 5FK7A 1G86A 1AYN3 2RS33 4XJAA 4GALA 3T3YA 4DQAA 4EJRA 5LWBA 4L0PA 4XYXA 5FY9A 3H42B 3UJOA 3ACFA 4BISA 4RA0A 1OOPA 1X8EA 1XNAA 3H8UA 3UGGA 1EPZA 4ZXEA 5IVEA 3MIDA 1K45A 2IFRA 1FI2A 2RM22 4LPLA 4RGAA 5IJRA 4YARA 1NYWA 2E7TA 1O4TA 4Q0PA 1UX6A 5CEHA 4XFIA 4XZUG 3ELNA 4IV1A 4EV0A 1I1EA 1OUXA 2VCCA 3T2TA 5L36A 2EA7A 1WW6A 4IXLA 2GN7A 2CWMA 4K8RB 1JU3A 1ZRCA 1Y9MA 3MIBA 2WLPA 3S5QA 3RZHA 4NHXA 5L19A 1LU1A 4MV2A 1SHWB 4PIZA 1RUC3 3WNLA 3ZFEB 3THCA 1LKNA 3PJQA 1UXZA 3LPGA 3O1TA 3S5AA 3N9MA 4M0NA 4QXKA 5FUIA 1QIQA 5A1AA 2VE1A 2QJVA 5FBJA 3J4UH 5JI7A 1WW5A 3CO2A 4GH4B 4AVTA 5C33A 2PELA 3NWKA 3PLQA 4JRLA 3R4UA 2O0OA 2WSUA 1AYM2 2PAEA 1WCSA 4DXZA 4ZXKA 4UWDA 3CZUA 3KV6A 3V56A 2BBVA 1WCKA 4DRVA 5ISLA 1PVC1 1KJLA 3VBHB 3WHUA 1UAIA 2W47A 3U4SA 2QQIA 3DGTA 3NAPC 4OZXA 2H6BA 4PBPA 1DYPA 1N47A 2WQZC 5L7OB 1R1A1 1DGRA 1H1MA 1RUG2 3OB8A 4G3YC 4M3CA 5DDJ2 5HCBA 2JX9A 1UYYA 3DYPA 4OHXA 1UY2A 4AGGA 2QDNA 4MO3M 4E2GA 3OSDA 1ULOA 1NA1B 1TVGA 1VMJA 2DBNA 2Z69A 4YGCA 3UJQA 1WZXA 3DXUA 3P5BA 5CIRA 4DIQA 2A6ZA 4XCBA 5IVBA 2UU8A 5EWSA 4UFJA 2PHXA 4DS0A 2WNUB 4NIIA 3WDWA 3OY8A 3V0BA 3BN6A 3IT8A 3VBRA 2F17A 2CY6A 4LKEA 3KHBA 4AOCA 2RS53 5H9PA 2D98A 3E1F1 3FLRA 1CGPA 4E4SA 2IVIB 4COVA 3IWZA 4WM7B 5BNNC 1W28A 2V4AA 4AVAA 1D0GA 3VBFA 5F7UA 1W90A 3WP4A 1CR7A 1NCQB 3VDDA 2NMOA 4XFAA 2QUOA 4P08A 2GC2A 1L7LA 2VCAA 5JWPA 1FOD1 2XH6A 1ZBA2 3WG2A 2GU9A 3WUDA 1O3TA 2VBPA 1J59A 3ZFGA 4Y26A 1O91A 5BPXA 4NIAA 4WVZA 1NT0A 2RS12 2WIIB 3LFIA 4OQ8A 2YYOA 3Q8EA 4Y22A 1NQJA 2W68A 2WJSA 4YVWC 1KD7A 3BPSA 2H0VA 4ZS2A 3GBWA 1UD1A 4CP9B 3LEKA 3MLLA 3TEXA 3TEZA 3ZXKA 4FPKA 3JXSA 2JIJA 1WMXA 5FYMA 4PI2A 1MACA 1CIYA 3OPZA 2XGXA 1HLCA 5H9QA 1BLZA 2EVXA 4E8DA 1YNAA 4HZFA 3ZYBA 2IXKA 4N9IA 4Q4V1 1GZ9A 1ZRRA 3O1MA 1VBC1 2CYFA 4GWJA 4BIFA 1LOBA 4Z8BA 4M00A 3ZOIA 4BQWA 3VDBA 1OBNA 3ZMNA 2Y0IA 3D4KA 3E97A 4Q4Y1 2VZQA 1ZZ8A 3SEPA 1JUHA 3E6CC 1HB1A 3NO8A 1REEA 1RIRA 5HCHA 3DYMA 5C9AB 1DU3D 1W8UA 2ILMA 4M3CE 4XFBA 5FY7A 4JGZB 1YQ2A 2AEYA 2CAUA 3N7MA 4YZ1A 1EAH3 2JXAA 2YGMA 3AFKA 5JXGA 1L7QA 3X29B 3H3ZA 3BTYA 2EAAA 4QU2A 5CKMA 1R083 1A3KA 5IAVA 1GBGA 3B7MA 1RMU1 3DEMA 1RUE3 2Q4SA 2EXHA 3EBRA 3N35A 3ZLIA 3ZYGA 2DFBA 2A3XA 1HRI1 4BZ4A 2J1SA 1UY4A 1NUKA 1PVC2 4KI5M 2BVVA 3B00A 1QQP2 3LA2A 2JKXA 3PUIA 3S30A 1PMHX 1VBA3 4I09A 3SHRA 2JDKA 2VTXJ 2D6NA 2A6XA 4K3UA 2VAUA 3O0XA 4M01A 3KT4A 3KHCA 1QH7A 3N9LA 2XUEA 3T1LA 4C8DA 1L3JA 1ULCA 2D40A 4RQPA 2A70A 4QPIB 5J36A 5FYCA 1PGL1 1C4RA 3AP9A 3PU8A 2A6WA 3WP6A 1JZ2A 1PO13 1CAWB 4IV3B 4UT5A 5K9YA 3OD0A 2IVJA 4BLJA 3G7DA 1RGSA 4PDWC 1VR3A 5FP8A 3MHZA 5FYUA 2Q1MA 2RDRA 3KZ4C 4W4ZA 4LO8A 3USUA 2DCKA 4IETA 5FKCA 2FDGA 2CTVA 2W87A 3MIGA 3BTZA 4CA9A 1OA4A 3D82A 4NIHA 1W2OA 2LW8A 2E51A 1VB2A 1ZVFA 2VTFA 2ARXA 3DF0A 3MGUA 3GYDA 3HN1A 4QPWA 4RD7A 5A7NA 1HXS3 2W9XA 4K1YA 4BHPA 2CDPA 2A75A 3W9AA 5I93A 3I2DA 4B8EA 2PAMA 5I8TA 2ZACA 3I4IA 5F1RA 4LBQB 1F15A 2RMU3 2IXIA 3ZKUA 1UY1A 4E4DX 3ZYPA 2ET1A 4Y20A 2CGPA 4GKXA 4P00B 3ZSEA 3T4VA 4OZOA 4RS5A 5A3TA 1WLCA 4LNVA 4XJ9A 3UV9A 3J8F3 3H8XA 2VMGA 1Q8QA 2B39A 4ASLA 1JZ5A 1H2MA 4L8QA 2ZGOA 2ZJCA 4XUTA 1Z7S3 4XXPA 3J26N 1NOVA 3ATGA 1SZBA 2OQ6A 5D8AB 3VBSC 5JIAA 1AR93 3VZMA 4E9KA 3T0BA 4BQ3A 5CFCC 1W6PA 3KV9A 3GZTB 5CFDC 1GNZA 1B35C 4IGPA 1VB4A 2HWF1 2VZVA 5FY1A 1JHNA 1K12A 2HEVF 5ACA3 2QQMA 1QJX3 4LIVA 4Q4Y2 4SBVA 1BKZA 1JODA 1U0AA 3J7HA 5F5AA 1G8WA 5JSRA 3MZHA 2YU2A 4LHSA 2KA3A 1LECA 2NQYA 5CB7A 1XC6A 3UKVA 4DPNA 1DQ6A 4MGYE 2VOKA 3MIFA 4AVSA 1OT5A 3I3DA 2R30A 2VECA 4KMQA 4N53C 4BH9A 3VZNA 4HPKB 5HPOA 5AC92 3VBOB 1PHMA 5AVPA 4LR4A 1Q8VA 2W3JA 4QWNA 3QBQA 2GMMA 2EALA 3AZZA 4CVUA 5J48A 4NOTA 5CAZA 5KXDA 4QX3A 5A1LA 5A3LA 2XJVA 1RINA 4CEYA 1OMIA 4R52A 4QHZA 5J1XA 4PT6A 3HQUA 5CKQA 2HWD3 5A7QA 2CGNA 1ASJ2 2W2IA 4WV8A 1V9U1 2BZDA 3PU3A 4P14A 1DP0A 2C1FA 2R0HA 5FZ1A 1HQLA 4BK4A 3MBWA 4KL1A 4COZA 2JE7A 2VQTA 1Y4WA 3IIIA 2OW4A 3KGLA 4DY3A 3AXDA 3C7FA 2DV9A 4XEZA 5E16A 5FZ7A 2R043 5EYYA 4META 1DIWA 1GWKA 1GZWB 5FYVA 5LEJA 2P17A 1HV1A 1W2NA 5GZEA 5C5TA 2XJQA 1DHKB 1OLMA 5A3MA 1G7YA 2BJSA 4MG2A 2D5FA 1EY2A 4QXHA 4C1WA 1VBB3 4L2NA 3SQOA 5ABJC 1BVP1 1LOFA 3RWKX 2ORZA 2PQQA 3O1OA 2EIGA 4QXCA 5EJ3A 3JBG1 5LA1A 2PXJA 3A0NA 2ZAHA 1W9YA 4LBJA 2JKBA 4QPIA 1ENQA 1S0GA 4BB3A 1KFXL 3LEMA 1YJLA 2IXLA 2QE3A 3UL2A 3LA3A 4LJHA 3WD5A 2FZ2A 4XFCA 4O65A 3TNQA 1JZ6A 2N7GA 2PHDA 1FMD2 1OD5A 1WLWA 3PNAA 3U37A 5KXCA 2W92A 2XMLA 2YPDA 5GZGA 1ZZBA 1Q56A 4KQ7A 1WBLA 3B3QE 4PQ9A 1E5RA 1GZTA 3IDAA 4QX1A 1W3VA 2HWF2 1RHI3 4HK9A 4YNIA 3TRSB 4AI8A 4YM0A 4AL9A 1RUD1 3USSA 2DVBA 4H55A 2ZGPA 3CKHA 2WC2A 4K1ZA 2DURA 2K2SA 2WFF1 4LHLA 2VUJA 5JPMB 4LORA 2Y34A 1OA3A 2YMZA 4Z92B 3AKQA 1AXYA 4IESA 3ZXJA 4XOGA 5J98B 3BPZA 2JG8B 5KHGA 3N9NA 1F4AA 4IQPA 4Q4X1 1SCSA 3NKGA 4D6RA 3KWVA 5FYTA 1ZYBA 3F2ZA 4IGQA 1O5UA 2QNKA 4KH9A 4Q4W2 5I8SA 4B4QA 3TAYA 4EWEA 3PHMA 4OI1A 5JOXA 4CSWA 2WS93 2XQXA 3S7EA 1CZTA 1DQ5A 2QQPA 2GH8A 3LB9A 1LHVA 1NLRA 1GYKA 2C9KA 2ZAAA 5FDBA 3C2UA 2DCJA 5E6HA 5LEKA 3LZZA 4I30A 3WP5A 4CUCA 2BGPA 5CBLA 3E5QA 1TZOA 2ZGTA 5DUUA 3QD6A 4WM8B 4QX7A 4XJZA 2OXBA 1AF9A 1ENXA 1OPOA 1ULFA 2WO2A 4R9CA 4XPVA 3CJIB 3RS6A 1Q8OA 4CUAA 1Q5OA 3NV3A 4LQRA 2P37A 4BQ2A 5DZEA 1DGWA 3U75A 5BNNA 1ENRA 5LW9A 4JTOA 1LESA 1STMA 4LBLA 1RTVA 3VZKA 3DCQA 3ALQA 5BNOC 1OLRA 1RJ7A 2WNEA 4YM3A 3NW4A 3FHAA 1DQ1A 3AM2A 5EPAA 5FZ4A 4GULA 5KHJA 5L9BA 3POFA 4C0BA 5KR7A 2QCSB 3H0OA 3DPRC 4XFGA 3WNXA 4Y1YA 4JAAA 2QFEA 2VW1A 1FV2A 1RB8G 4F3JA 4ATEA 1AR63 1SBEA 4QPGA 5FZBA 4KBZA 3VKMA 1XE7A 1DGWX 4AEDB 1CZVA 4CDQB 1ZZ9A 5LBBA 5GLUA 5E1RA 1OH4A 3NVCA 5GZCA 1C8M1 3KS7A 1O6UA 2DCTA 3ITQA 3LSEA 2J42A 2NN8A 4BQ1A 3B69A 3OGVA 1W0NA 3ZIWA 4CDWB 2XJSA 2IZWA 2Q8OA 1A8MA 2JB8A 4HL0A 1B09A 1UCXA 3WEZA 3T0DA 3UYJA 3ZFEC 1FPN3 4JTNA 5LBFA 1S2KA 4YW4A 5FIXA 1NQDA 1PO23 1RYYA 4CU8A 5IVVA 3AZXA 4YZ5A 4FO9A 1OF4A 3IPVB 1OURA 1CAVA 3KD4A 2QQOA 5FQ0B 5JZGC 4GH4C 4A6SA 3N7KA 4QGLA 5EFUA 4DUXA 5CISA 1YIPA 2V5DA 3EQEA 5F3EA 4CU9A 5AFEA 3A22A 5FMDA 1REDA 3T30A 4AAXA 1RUD2 4CXYA 4IUGA 3SH3A 5LRRA 3HWJA 5I91A 1X33A 2NZ9A 2WFF2 5HV4A 5JI9A 1PGW1 5DMYA 2JB4A 5G05L 1NLSA 3VBHC 3BCWA 2QVSB 3BU7A 2VZOA 3OPTA 4Y5TA 3WDUA 1GNYA 1JUIA 4MADA 4AEKA 4F83A 2XJRA 5KXBA 4HN0A 5JLVA 1ST8A 3C7GA 2D5HA 1COV1 1RUJ1 2E6VA 2GNMA 1C5HA 1UKRA 1VRH2 4P5HA 2AREA 4TSVA 3NAPA 3AKPA 1NA1C 1ZBE3 2AENA 5DZGA 1PNGA 4PF1A 1IS4A 2JD4A 4AG4A 2JDMA 1W05A 1S1AA 5BUVA 3LGRA 2XBO2 3QACA 5FZEA 3JU9A 4QHOA 1O3RA 3ZYHA 2XWJB 2WNUC 4PLOA 2B46X 4GWIA 4GQ7A 2VMHA 5KC5A 1NX9A 4LXLA 2J1VA 5D2AA 1DQ0A 4UFHA 1ND2A 2W1SA 4FQ4A 3VBSB 4BQ4A 1IOAA 2Z5WA 3VGIA 4D3WA 1W03A 5F9TA 4WM7C 5CFCB 4AZZA 4P9GA 1I6XA 2XJUA 2BNMA 1NCQC 4JQRA 1UOFA 1B35B 1QH6A 3HJRA 3LD8A 1ODMA 1V6NA 4OQ9A 1IS5A 1W6QB 1PIV2 4OVEA 4BU2A 4D69A 3NNJA 5DZFA 3ZSLA 4UF0B 2ZS6B 1R1A3 2GMEA 1HIXA 2LM3A 3VZLA 3WNOA 4ET7A 3L2HA 1O8SA 4X6QB 3PIJA 3HAGA 5CYYA 1G6NA 3RMXA 2VCBA 3V64A 1ND3B 2X8KA 3NNMA 5GZFA 3W5MA 1UOGA 4PHZA 4RYDA 1S0CA 3I59A 4YVWA 5KXEA 2QQVA 3U4XA 4QXBA 4AHXA 4CPBA 4ASKA 1CJPA 4INDA 1DCSA 2AZ5A 5A3PA 4D6SA 5FP9A 5EIYB 1CAXB 4LITA 3QOPA 2E7QA 5C9AC 5FPXA 1ZRIA 4B4PA 1D4M2 4JGZC 2PLV3 4CP2A 4XJ8A 5J96B 2EIBA 1UN1A 2P5BA 4LLFA 1H1IA 3MIHA 1NE6A 1Y3TA 1WGPA 1LOAA 1AX1A 2TBVA 1FOD3 4XTMA 5T54A 3UKTA 4CDXB 2NMNA 1SLCA 2JE8A 2WNOA 5JOYA 1UU5A 3QCWA 3CHXA 2RVAA 2DU0A 1O3QA 2ZMLA 4YW1A 2FMDA 3PUSA 4TZDA 1DZQA 2WT2A 3GJBA 4Q8LA 2JDYA 2K46A 2P34A 2BW8A 2P1BA 3ZVXA 1ZA7A 4CXWA 2VD7A 1XB9A 3KCCA 5GJ6A 1OHFA 1W04A 3HQXA 2Y64A 5CU1A 3RFRA 3W58A 4N43B 2QQUA 4BJ0A 1MQTB 1H2KA 3GHMA 3JQWA 3AFGA 5C3PA 3LSDA 1DZRA 5C4WB 3HPNA 3CNAA 4Q0UA 3ENRA 3KMHA 2O1QA 2ZX4A 4Q4V3 4AHWA 1GUIA 4MHRA 1MVQA 1VBC3 1UZWA 4I02A 1RUF2 1Q43A 2JDAA 1H8TC 3LOIA 5FZOA 5A6QA 3BU0A 2D6MA 4RSUA 4XUOA 2DYCA 2J1EA 1RVF1 1VMFA 1W8WA 3NRUA 3N4MA 2UYAA 3L9JT 5A3UA 2XVKA 1YYNA 1ULDA 1LTEA 1RXGA 2EAKA 4QX0A 2Q8EA 3RI8A 4PJYA 4R8HA 1MVEA 4XURA 4UFIA 3SH5A 3URFA 3TOJA 4JDMA 4PDWA 4NPRA 4RR3C 3ZIXA 3LFMA 1O7FA 1GOFA 1RMU3 1H6YA 2PAKA 2VOVA 3ACHA 2X10A 3DXTA 4NROA 3WQ0A 4FXKB 3ZXFA 5HBAA 5JR2A 2QTWB 1HRI3 1AYM1 4DXSA 2VNVA 1I3HA 1OQDA 3U78A 3VDAA 4YM2A 3WQ1A 3H50A 1PM7A 2AACA 4UXAA 3ZN4A 1S0EA 1XU1A 2XOMA 4BXFA 1IPJA 2C0ZA 4B4RA 1PK6A 4CCCA 1OXCA 1AX0A 1H2LA 4XMAA 4QDRA 1S55A 4KNCA 1RUG1 5FY4A 5FO7B 3TB0A 2V72A 2VVDA 1VE0A 4HLTA 1LODA 5DDJ1 1C8NA 4AF9A 3KSCA 5FZFA 5D8AC 3QH7A 1UU6A 2HJIA 3D0SA 1W2UA 4I01A 4AVBA 3Q8AA 4D7SA 1G9AA 1AL22 2ZX2A 1PZ8A 1F5JA 4Z2WA 2CU5A 5HCFA 4AHZA 3IMNA 5FBZA 5F3CA 2XL7A 1SLBA 4MGIE 3VBSA 1FT9A 2ZGRA 2D3RA 3I2HA 3RGBA 4F8AA 4D94A 4DUVA 1WLDA 2YG0A 1W2TA 5CFCA 3RQ0A 1W8FA 3U10A 5F3IA 4P9YA 5CFDA 4Y24A 3UNPA 2LRPA 2B42B 1SLLA 5FAXA 2Y6KA 1DFQA 5ERLA 1IHMA 2AEZA 4D7TA 1W6QA 2GALA 1T6BX 5C3RA 3GZAA 3ASIA 5J7MA 4YG0A 1FNYA 3NKTA 5JPNB 1AR83 1MS4A 2JG9C 3VBOC 1ZBA1 2ZGMA 3WQ7A 4XZPA 1CAUB 3AL5A 2CWSA 2F6BA 3LIGA 2EIEA 2RS11 3DPRB 3GXUA 4N53A 3GNEA 3T2PA 3O0VA 1LHOA 4DUWA 1BZWA 4ITCA 1YEWA 2ENRA 1POV1 4WVMB 1CONA 2E32A 1JZ3A 1OVSA 2VL4A 3H3UA 4XETA 3VUOA 1UYXA 3U11A 4XQWA 2R49A 4RHV2 1AJKA 1DG6A 4FSJA 3IN9A 4CCJA 1YUDA 3ECQA 2GC1A 1UOJA 2NPIA 1RVF2 2HWB2 4LO7A 4NVPA 3SLIA 4HBNA 5IW0A 2ORXA 1K5JA 4PF5A 1AX2A 3GGLA 3HD8B 2X09A 2PHTA 2XLFA 3BTXA 3TBDA 4A7ZA 1QOSA 1HKDA 2VCMA 4B7EA 2Y6JA 2JDHA 4ES9A 3CIHA 3POBA 5JZGB 1KRIA 1IPKA 2BWCA 4XTPA 2GNTA 5CA6A 3EB7A 5IYYA 1ZZCA 2RDQA 5IWFA 2YB7A 3AK0A 2WRAA 3B01A 4UAPA 4LBNA 2WA3A 3JUUA 4YGBA 5FZAA 3O7OA 2ES3A 2R32A 2ZZQA 3POYA 1QQP1 4GB31 4XW3A 4BWOA 5ABJA 3WNNA 1H9PA 3W20A 3VKOA 4A3XA 5BNPC 3RG0A 2SBAA 1V9U3 4QDQA 2AH2A 2HLEA 4BIOA 1GANA 5IFTA 3WR0A 4H7MA 2VUCA 3JD73 3ME2A 4JDNA 1UWWA 2JD9A 4P9WA 4AI0A 5JIUA 1RITA 2CDOA 1N1SA 3CBNA 1DLLA 3PMEA 1I5ZA 4S2GA 1WW4A 5ANNA 3ZYIB 1KDKA 3E5XA 2VTXA 2Q8DA 3AYEA 1BHGA 4FFFA 4D8MA 4YM1A 3AX4A 5FY8A 3ZXEA 4XAEA 2QKDA 3VN4A 1XNCA 1PGSA 1UIJA 1LOCA 4I0WB 1KITA 4LBMA 4K7JA 2A3YA 4IEWA 2CNAA 2V73A 4UFMA 4E8CA 3IZOA 2HWE2 1H1AA 1FV3A 1LHWA 3KV5A 2F4PA 2JJ6A 2AGSA 2JG8C 4LK7A 4E4HA 4CXXA 3HR9A 4ZZ8A 3N9PA 5I8YA 3JBG3 4MXVA 4FCAA 2JECA 5DAWA 5AVAA 5FOJB 3ZN6A 4OHYA 4UW4A 3OCPA 1RUNA 3B5LB 4LUKA 4XDPA 3RVHA 5JSPA 1NAEA 1VBD1 3R0RA 4FI9A 1XSRA 4DZGA 3POIA 3APBA 1MPXA 3SKJE 4X8PA 2O14A 4DO0A 3ZDVA 1RUI3 1RUH2 3LEGA 4YGEA 2HWC2 1AXZA 2VQAA 1G9BA 1OPMA 2K9ZA 3LDRA 4LK6A 4WM8C 5DXDA 4DNYA 1DQ2A 1W6NB 4L97A 1C1LA 3GDBA 3PJYA 1OFSA 3SH4A 5C7GA 3AZYA 3CJIC 4I3GA 4JCKA 3NNLA 3PTRB 1RUD3 3LAGA 1REFA 5EV7A 1MZFA 2MNGA 1PVXA 2MEV3 4KWKA 4NHMA 3FZ3A 2ZMNA 4I2OA 3Q8CA 4XUNA 5GKAC 2ZZJA 3B93A 3K48A 2WZR3 2Z2SB 3WCRA 5F5IA 4XMIA 4Q4X3 4FPHA 5FYHA 3JZVA 5A33A 2FDFA 5LASA 3CL1A 5BNOA 3OGJA 2C26A 4O9EA 4JKMA 4EN6B 4XHBA 4LOSA 1JYNA 3PUQA 2QQNA 4Y33A 3UGHA 5IK7A 1HV0A 3HMYA 1EV11 4CCMA 1WUVA 5FFOC 1JI6A 4AEDC 3VHRA 1JZ7A 3DPRA 5AC91 2A6YA 2AR6A 5DUWA 4CDQC 1OSGA 1TG7A 1NCRC 1W99A 1GKBA 2W5FA 4CCNA 5FPBA 4QX2A 4GB32 4P9XA 4Z07A 4LO5B 2VZ3A 5HXMA 5JXHA 1S0IA 1DYOA 4JHZA 1QF3A 4CDWC 4CU6A 5J37A 1US3A 2DCZA 1UPSA 4XC9A 3LDBA 5IATA 1YO8A 3M4FA 4HKOA 1ASJ1 4MSVA 1JS9A 1H8TB 1NY72 3ZR6A 4QGMA 1PZ9A 1WCDJ 2G9FA 1SFYA 3KM5A 3MLKA 1MR5A 2WBKA 2QQKA 3CEWA 4UW3A 3WNKA 3ZFEA 4NAMA 2BGCA 4YZ2A 1IPSA 1QMJA 2X5IB 3ZSKA 4GIQA 1VPHA 1W8OA 2ZHNA 3NSTA 1DLCA 4GH4A 1Q8SA 1ULGA 3N3HA 1WW7A 2VBBA 3WCSA 1N1TA 2ZX0A 1YXWA 3I97A 1JMUB 4NE9A 2ATFA 4QQPA 4RR3B 2FCTA 2ZBJA 4UW5A 4UFKA 1C8M3 3RYRA 3UK9A 1CPNA 1UIKA 4Q26A 3ACIA 4A45A 3VBHA 1U5YA 4V2VA 2B5HA 5FREA 1IG3A 4HFSA 4L92A 4CPBD 1R091 3PVNA 1CQ9A 1VBD2 5L7OA 1YFWA 4KU8A 5FUNA 1DGRN 2V09A 5CKNA 2GSYA 1XNKA 2YROA 1VAVA 4YGDA 4ATFA 2VUDA 3PVOA 3DKQA 2BVBA 2YDEA 1YQ6A 5F39A 4Q0QA 1NA1A 2R1BA 3AB0A 3WNPA 4OI4A 2E53A 3H8OA 2I2SA 2VMDA 1UZVA 2OYZA 2UURA 3ORJA 1OQ1A 3K4ZA 1CWPA 2FQPA 1BJQA 1FMD1 4FAHA 2DTYA 1HQNA 2IC1A 2WNUA 4JRAA 1IKQA 1K5MC 4RL7A 1TQ5A 2WAOA 4FOQA 1TME1 4TLGA 3E6DA 2XR4A 3U1XA 4DRRA 1SLTA 3PIGA 2R7EB 1MS9A 1BEV2 1WKYA 1ACCA 1GWMA 1BBT2 2HYKA 4COYA 4HXCA 1S2BA 4Q2FA 4GMP3 5C70A 2OKXA 3FFQA 5JOWA 2XONA 1VBE3 3T2QA 4WM7A 1H0BA 5LA0A 4BM8A 4IW3A 1NCQA 2WSVA 1XNTA 5FZGA 3AVRA 4W50A 5T3NA 1COV3 1RUJ3 5FZ9A 4TWTA 2DCYA 5DPNA 5C8WA 1W6OB 1YJKA 4LKSA 3V0AB 1ND3C 4DXRA 4UW6A 2J1AA 1EV12 5GLTA 2BP6A 4QX5A 2ZHLA 4MUVA 5F5CA
chains in the Genus database with same CATH topology
4QPYA 2GH2A 2JG9B 1X36A 2HEWF 4Q4W1 2G4IA 4XE9A 2OUJA 2R0FA 3EHKA 3CU7A 5I0UA 2Y38A 5KHIA 1DQ4A 1TEIA 3IIAA 2BPA2 4HVQA 4EWDA 4ZKTB 4CTEA 3PMSA 4YW2A 3M3EA 1C57A 2VNGA 5D1IA 4FQZA 4Y5Z0 2WA4A 4I0AA 2ZGSA 4YLZA 4LT5A 4CDXC 4LULA 3MPPG 5C9AA 3MLJA 1UZZA 2ZX3A 3OBRA 4GMP0 4JGZA 2D93A 2DUQA 5DUVA 3BTAA 5I0SA 2D6PA 1QJY2 2BNNA 3WY6A 2VNOA 2EXKA 1VP6A 3MIEA 4N43C 1R1ZA 4X8NA 4YVSB 1MQTC 1ONAA 1SCRA 2ZGKA 1N3QA 5A32B 4AWDA 4YFWA 5C4WC 1C5IA 4YG6A 1QXJA 3SISA 1EYBA 3H1MA 2JDZA 1R092 2RR11 4BLIA 3VKLA 4WZFA 4CRQA 2R072 1ZZ7A 2R063 4KWLA 4BE3A 3INAA 2BWAA 3DUIA 1TMF2 1H8TA 5BNPB 4OI0A 1G9DA 2ZPXA 2XVGA 2XB6C 1CAWA 1HRV1 1UF2C 2CV6A 4IV3A 5LK5A 4EN0A 2XPJA 4YFZA 3FE5A 1LHUA 1AR72 2UWBA 4XIKA 1TME2 1NG0A 3OGGA 1GQGA 2VQ0A 1YLLA 2YC0A 4OLLA 2A5ZA 4W6WA 3IM0A 3VBUB 2JENA 3PTYA 2VXRA 3TN92 4ORFA 1FYUA 3FLPA 3BB6A 4GXLA 2ZGUA 4I3PA 1A78A 2BFUS 2WLQA 3D5OA 1AYN2 2RM23 2RS32 4R9DA 5GZDA 3ZXGA 4LBQA 3WW1A 3WOGA 3AP5A 1U12A 1VRH1 2OPKA 1O5LA 5FRAA 2WL1A 1V00A 2ZKNA 3UKNA 3HIFA 4LTAA 2XLAA 2XBO1 1X50A 3VBFC 4WZCA 4MVTA 5K0UB 5D8AA 2GN3A 1Q8PA 4XFFA 4ONUA 1RUC2 3NL1A 4Y1VA 1MS8A 3ZFGC 4W6YA 1LOGA 3MFCA 1AYM3 5IT6A 1JTZX 1X8MA 1X82A 2E7AA 3ZDSA 1SACA 1PZ7A 3ROUA 4JV4A 3V65A 4GKYA 2VVFA 4AFDA 1DDLA 1MEC1 3ZYRA 1PIV1 2ZTNA 4WBBA 1RUE1 5T52A 1U5IA 3LWCA 1RUG3 1QJZA 3M3OA 3M3CA 4HPKA 5DDJ3 1VIWB 3VBOA 4H14A 3M7AA 1OI6A 2WNVB 1DZTA 5KHHA 5H9SA 2VOXA 2B7YA 1IQAA 2XJPA 1SFNA 3VHOA 1NCRB 4J6GA 4YYOA 4MXWB 2RR12 2ZX1A 4R4ZA 3BODA 3AMHA 3MYXA 1CX4A 3RRDA 1QXRA 4EN8B 3VLBB 3B02A 1HRV2 1D4M1 4FOWA 2RS52 4L9BA 4CEWB 1XYPA 1ZBA3 4MGKE 3ILFA 4M0HA 2GNDA 1GZWA 4CDUC 1UPIA 4TYSA 3WT3A 2OA2A 2Y26A 1OLQA 1IS3A 2RS13 3NJZA 1SQ4A 3H1WA 3LKJA 1D2QA 3H1YA 3B94A 4Q1RA 2JICA 3IDBB 5FO8B 2YXSA 2R1DA 1S0JA 2EXIA 1CJDA 3EO6A 2VU9A 3J8F1 2P3IA 4FOYA 5KC6A 1RUF1 3M70A 1AUYA 1J1TA 3WVJA 2G9GA 1NZCA 1D0HA 1SBFA 1AR91 1NE4A 2GAUA 2LTNA 5I0TA 5BNPA 3KCYA 4C90A 1VLNA 1W6MB 5FTTC 2UWAA 3RYKA 1VALA 1S0DA 4LO6B 3ZFFC 3RNSA 2X29A 3A0KA 3IDCB 2WFPA 3LOBA 2ARBA 4HVRA 4XILA 1K5MB 3ETQA 1KDMA 4FP3A 4HANA 5FMOS 1OA2A 3O5SA 1PVC3 1U5ZA 2DVDA 4FPYA 1QQP3 1QXPA 2NLRA 2TEPA 1VJ2A 1R082 2PHWA 1MEC2 4FOVA 2UY9A 3KGZA 1RUE2 2JG8A 3OBTA 4QQHA 4ZU5A 5GLWA 4XXAA 3SCFA 3GALA 2XHKA 1ULEA 3O0WA 4JGYB 4OFGA 3VKFC 1VBA2 2H0BA 1YFUA 3NV4A 1ZNPA 5EYXA 1UZYA 3AKSA 4AVVA 1V6MA 2O8OA 1WBFA 1JOJA 3JQXA 3WLUA 1MZEA 1AL21 3WG4A 2W0XA 1PO12 4WM8A 1S0BA 3FLTA 5JOZA 3CJIA 1O3SA 3HT2A 4Q0VA 1QKQA 1RC6A 2XVLA 1S0FA 2DUOA 2FBEA 2RHPA 5GALA 4ZU4A 3SCGA 1QJU1 4OHWA 2GMPA 2ZMKA 1OOPB 3RI9A 4TLFA 4CEYC 4XJWA 2DTWA 1CN1A 5KWRA 1HXS2 3DN7A 2B9UA 2R6QA 4ZU7A 1DYKA 4LUMA 2A6VA 2W52A 2GNBA 1BK1A 4NHKA 2VGDA 1WA4A 3SITA 3FJSA 3MI8A 4AEDA 1QWRA 3POSA 4CDQA 2DVGA 1LULA 3J9SA 1NCRA 1M4WA 1SBDA 4YW3A 2XLGA 3J8F2 4RHV1 4EROA 4X6RB 3D8CA 1Z7S2 4CDWA 2H6CA 2VOWA 4WVVA 3WW3A 1AR92 2HWB1 4Q4Y3 1E57A 5JDBA 1V6IA 3FFZA 2XKPA 2X5IC 3IPVA 2I74A 3FWEA 5FQ0A 5ACA2 1QJX2 2PHLA 3BALA 3MICA 5J3UA 2IWGB 2B45X 4RGGA 1H30A 4B3NA 5AC93 1ZREA 4IEVA 2BYVE 2ZA9A 2DWRA 4UBGA 1LEDA 2XKOA 1AZDA 5CNAA 5DG1A 4M3CB 4DINB 5T5OA 4JC1A 4AFMA 3D6EA 4KG0A 1LGNA 3KQRA 4Z1VA 3R6SA 3RDIA 1X7NA 2WT0A 3FX3A 5E89A 4M3CF 1FX5A 3NV2A 1C3HA 1KJRA 2RJLA 1VAKA 1RUOA 1ASJ3 4IEPA 2Q5TA 4L11A 3V0BB 3OY8B 4AQ2A 3VBRB 4AI2A 3U0ZA 3GBFA 1LGBA 5BY5A 1OKQA 2ZHKA 3KT7A 1F2NA 4HKWA 4QM9A 3LA7A 3VBFB 4PIYA 3VDDB 5CVRA 4N9HA 1K5MA 3ILRA 4K6BA 3AKRA 2R042 3HT1A 4AYUA 3ZFGB 1B35A 4KBBA 4ISQA 3DKWA 1QJU2 4FT8A 3ZXDA 3PVBB 2HWE1 4QD2A 4PIXA 2TUNA 3K51A 5B2GB 4Y22B 2LUWA 1VBB2 4QQ2A 2W39A 4CYDA 4E2QA 4DY5A 1BVVA 2OZJA 1RJ8A 4OI2A 3WW2A 1ND3A 1NXD1 4LA3A 1RUH1 1O4ZA 2HWC1 1FMD3 1BXHA 1YHFA 1V6LA 3FBMA 3OD4A 5JCTA 1TME3 3FHIB 5IUQA 4BYYA 2RJKA 3O12A 4XBQA 4J1WA 5EXOA 4FBFA 4C91A 2HWF3 2YY1A 1CESA 3MPBA 4I0BA 2CGOA 4XF0A 1CAXA 3KCXA 4FPGA 1BCXA 2NP0A 4QPGC 4YZ4A 2PHUA 3PVEA 5I0RA 1RHI2 1QNYA 4UBHA 3WP3A 3ST7A 3N36A 4CDXA 1ENSA 1OQEA 2FMYA 5C6CA 3E6BA 5JSOA 1XNBA 4LBQD 3D0JA 1N1YA 4MGZE 5C8CC 4YVSC 5T5JA 4Q4W3 2VUAA 1F5FA 4CDUB 3M8LA 2OVUA 3JB4C 2GC3A 4XIOA 4NHLA 2QZ2A 4N43A 2ZCWA 4RQPB 1MQTA 4Y1ZA 4JDOA 4BMBA 4HMZA 1YI9A 1ZBE1 5C4WA 5T55A 2LALA 4OULA 1GQHA 2OZ6A 4AI3A 2WS92 1LCLA 2YGLA 5EZWA 2GZWA 1QOTA 2YV8A 3T1MA 1IZ3A 3AYAA 3RJRA 3FUQA 4YG3A 4G9SB 3USUB 3ZXAC 5CG9A 1QDCA 1JYCA 1NY71 2SLIA 3I8TA 4HK8A 2W08A 1H8VA 3VBUC 1LB2A 1TNFA 3VZOA 1F31A 4GWNA 2XJTA 3ZFFB 5DUXA 1TE1B 4FXGB 1J3PA 1GV9A 3O14A 4Y20B 3WG1A 1MS3A 1KS4A 1AR62 2RR13 2E9QA 4RS5B 5T5PA 1AJOA 1NXMA 2WWSA 2DF7A 2PA7A 1ND2C 1AVBA 1V6JA 4J1XA 1DGLA 2Y0OA 3AMNA 1XE8A 3TNPB 4K9SA 1JBCA 1XXNA 1HX6A 1W6PB 1HRV3 4G4FA 5K0UC 1ZA4A 3THPA 2PYTA 3S0MA 1H4GA 4AK3A 1FPN2 1CVNA 4CP0A 1PO22 3WG3A 1Q3EA 1MZ5A 2JEMA 1V6KA 2MPFA 1CPMA 1LOEA 1MZ6A 2PLV1 1UW8A 3GBGA 4E27A 5F6KA 1MS5A 4R9BA 5FPZA 1BEV1 2WFF3 1BBT1 4KG8A 4QT6A 1HDKA 3QH6A 4BPZA 4AGVA 3KT1A 1Y9QA 1QHDA 1SLIA 3AJYA 1TNRA 1MS1A 1VRH3 3KB5A 3WDTA 1QY4A 2WNVC 1GFF2 4AGRA 3M2MA 1CAUA 2Q0AA 3AMQA 4COUA 5LRSA 1CIWA 4CEYB 3ZX7A 4LBOA 2XBO3 4FPCA 3RSJA 3B9IA 3W59A 3WV6A 4HETA 4WVMA 1ZBE2 2IXCA 1RL3A 5CADA 4EN7B 1YFXA 3MFAA 4K21A 2FHRA 4BA6A 2CAVA 4HN1A 2WT1A 5T50A 1LGCA 3RWNA 4CEWC 2RE9A 3RPQA 4FPOB 1MEC3 5AFBA 1PIV3 3MDPA 2XG3A 3IDEA 5JZGA 4XBLA 2BUKA 2O8QA 1QJY1 1LRHA 2FZ1A 3AZWA 4CDUA 1T6GC 1URXA 2D6LX 1R1A2 4N7UA 1GICA 2CL2A 4FP2A 4MH0E 2A73B 4XQDA 4QGNA 2TNFA 4MLOA 1C1FA 3AYCA 2Q30A 2VULA 3EJKA 3VL9A 5DG2A 3ZSMA 5FO9B 2PN5A 2P2KA 1D2SA 2R071 2PFWA 4GWMA 1QU0A 1TMF1 1D4M3 4F7ZA 3BOPA 5F5QA 2HEYF 4P9IA 4B7KA 3BIWE 3DV8A 2VMIA 5BV6A 1AR71 5BYNA 2YZ4A 1V70A 1PK6C 2VW2A 3MF9A 2ETEA 5KXBA 2PLV2 1WMFA 2UY8A 2WKKA 2VPVA 3ES4A 3WXPA 4O9GA 1FOD2 3ZFFA 2OUHA 4FTBA 1IKPA 2YUEA 1AR81 4PLNA 4QMAA 3TN91 1A6CA 2D43A 1N3PA 2VVEA 4NN0A 2VNRA 1AYN1 2RS31 4LBKA 3I7DA 2D97A 4LE3A 4JGYC 4N90A 1G9FA 1YFYA 3M3QA 1RUF3 4U2AA 2Z79A 1M06G 2A7AA 3FUOA 3H7JA 4FPJA 4XF9A 4OUMA 4Q4V2 3VL8A 3N7JA 1VBC2 4AFCA 1PNFA 2GC0A 3MW3A 4W6XA 1YIFA 1ZRFA 4XF1A 2VH9A 4AI1A 4K40A 1W6NA 5BNNB 2E63A 2A3WA 1W0PA 1RUC1 2UWCA 1IS6A 1KS5A 2ZKLA 1W39A 2BFUL 4S2DA 1XQNA 1OOPC 4Y1XA 1RMU2 4HT1T 4QPGB 3AP6A 1HRI2 2DVAA 4JVAA 4IV1C 1EP0A 1J3QA 1CD3G 1PMIA 4C1XA 1FXZA 5C8CB 2PTMA 3N7LA 4OHZA 4A7KA 4IEQA 1ZM1A 4IL7A 1PGL2 2ET7A 4B29A 1AL23 3JD71 1Y7BA 4QQLA 5J09A 5GLVA 2X53S 5L73A 3ZXLA 3BOWA 3VKNA 1CAVB 4Q8KA 5HI0A 3E5UA 2HKXA 3AJZA 4A2UA 1QJU3 1WMDA 1HQWA 2QDRA 4K20A 4XDQA 2D3PA 5JVVA 4DFSA 1LJ7A 3OYWB 4CZSA 2X5IA 2RS51 4IEZA 1U5XA 1ZRDA 4AW7A 1OFNA 1GNHA 4H7LA 4E4ZA 4NR1A 4LA2A 4LEJA 3CJXA 1WMEA 4HSLA 1AR82 4IERA 1HW5A 4RR3A 1WD4A 3FMGA 5BNQA 3NAPB 2XUMA 4HVOA 1UU4A 4KU7A 1VAMA 3AMPA 1FAYA 1WLTA 1ZX5A 3B9CA 3SXWA 4QM8A 4RHV3 5IK4A 4OHVA 4DMIA 1RUI1 1LEMA 5TSWA 1H4HA 3VBRC 3S7IA 1RVF3 2HWB3 1ND2B 2BQPA 3HBZA 4LHKA 1GR3A 1Y43B 3AMMA 2MEV1 3VDDC 3ILNA 3AP7A 1SEFA 3QLQA 2WZR1 3WDYA 2D3SA 1FNZA 2ZHMA 3WW4A 3SNMA 3GF6A 4FTEA 1EAH1 1W0OA 2C5DA 1AXKA 4PCRA 2ZGQA 2BNOA 1F9KA 1R081 1JXNA 3U07A 3H9AA 4N7IA 1W6OA 4R4XA 3V0AA 1YI7A 3I59B 4XFHA 4QQOA 4YVWB 5T5LA 4BCUA 2EXJA 2JG9A 1MS0A 1VBA1 4S2FA 1BYHA 1V9U2 4CP1A 2UYBA 3JD72 4ISRA 3TWIA 3WDXA 2VG9A 2B8MA 5FOBB 2AUYA 5F6LB 1Z0HA 1PO11 4IEYA 4R9AA 4L99A 1I9RA 1O4YA 4URTA 4S2HA 1C28A 2Z42A 3MEPA 4COWA 4Y1UA 4P9JA 2IXJA 1BMV1 4XF3A 2HWE3 5FMOL 4MX3A 4C0HA 3OTFA 4IEOA 3AKTA 4Y4YA 1ZZ6A 3ZO0B 5CG8A 2EF6A 1SDWA 2Q1ZB 2ZABA 5E88A 1ALYA 1HXS1 5JR7B 4AFAA 3NV1A 3R05A 3JBG2 3CF6E 5C8CA 4RQPC 4YVSA 4FPEA 2DVFA 1RUH3 2HWC3 5A32A 1N3OA 1POV3 4AVCA 2RMU1 3OJBA 3WX5A 2VW0A 2YPJA 1V6OA 2DU1A 5FCCA 3C3VA 1RUI2 1JW6A 3KLSA 4RFT0 5LK7B 2P3KA 2DFCA 4AQSA 2D6OX 1DBNA 1JN2P 3R4SA 4A7YA 1Z7S1 4FAGA 1UL9A 2V5YA 5SV8A 4PDWB 1XYOA 4PLMA 3OYWA 3THTA 2MEV2 4XF4A 4IEXA 4GMP1 1BQPA 1SMVA 5ACA1 1QJX1 2R16A 1VBE1 3IBMA 2WZR2 2XL9A 4NWWA 4AHYA 5L7OC 1KQRA 1JYIA 4Q4X2 3VBUA 1PK6B 4AXOA 1H9WA 4OUSA 4K8FA 3ACLA 4D7YA 4MZUA 1EAH2 4RS5C 4GB33 1GLHA 3GHNA 1QDOA 3RMYA 1POV0 4V1PA 1JH5A 3DL3A 4Z82A 3WUCA 3AP4A 5GLZA 1FATA 2JE9A 4MYEA 2YHJA 4GA9A 1XYNA 4BOWA 4YW5A 4EN9B 2ERFA 3AYDA 4EWAA 2HWD1 5K0UA 5CFDB 2IXHA 4YZ3A 2AYHA 3MW4A 3OF1A 4W65A 4FTSA 2DUPA 3H7YA 4HKLA 4P9LA 4NWVA 2IFWA 3RYPA 4LLOA 1BMV2 3ES1A 3EXUA 2D6KA 1GZCA 4H3WA 4SLIA 2R041 2ZGNA 3G6JB 3ZPYA 4NO4A 2WINB 4N53B 5K8SA 3AZVA 1G9CA 5FLJA 1J1LA 1VBB1 1VBD3 1LU2A 1YWKA 3RJ2X 1C8M2 2WQ4A 4XQ4A 4AFBA 1J3RA 3FBYA 4Q29A 1YCIA 2WNVA 2A71A 3P3NA 3S6PA 3WHTA 2XWBB 4IV1B 1KXGA 1KFUL 1QGLA 2C9AA 2RMU2 5HCAA 2R061 2MHFA 5FLIA 3M3IA 1F8VA 4MXWA 1XU2A 1LR5A 1XRUA 2ZGLA 3VHPA 3Q9OA 4XHXA 3P3PA 1BEV3 3VHNA 1BBT3 3WDVA 4WVWA 1J58A 4E2SA 1A8DA 4KWJA 3R4DB 4LO4B 4FPLA 3SMHA 3A4UA 4XJUA 2OIIA 1QOOA 3M1HA 1AHSA 1RHI1 1PGW2 1XNDA 2KM2A 1LOFC 4FPFA 4CEWA 3FC0A 1VBE2 5IK8A 1EV13 2RM21 5E8AA 4AQTA 3RZZA 3VZJA 5ABJB 2PHRA 2NM1A 1COV2 1RUJ2 4QHBA 1YRZA 4QPIC 4BMEA 2KXLA 2I45A 4IV3C 1H2NA 1IGOA 5FLHA 5IK5A 5SV5A 4IEUA 3SCHA 2WS91 4AQ6A 1LENA 4PBOA 2WZPP 3AXEA 5BXXA 3WZ1A 4LE4A 1Z78A 4DOUA 2HWD2 4YSFA 1W6MA 4YRDA 3MW2A 1QJY3 4Q1PA 3ZN5A 1DF0A 2D7FA 1D4VB 1SLAA 1UMZA 1AL0G 1N1VA 1WD3A 3ZN6B 4AEJA 3POWA 5KBFA 5HXVA 3IKWA 4Q27A 5JAXA 2I07B 2BTVC 2GDFA 5GM0A 2VY0A 4KGQA 3MF6A 5H9RA 2NYYA 4KGGA 4U36A 1AR61 2QZ3A 1R093 3VV1A 2K0GA 4DB5A 1GSLA 1APNA 1EPWA 2R073 5K7PA 4JGYA 3I54A 4FVVA 4HSJA 1TMF3 3GZUC 4AEMA 2R062 1QNWA 1UKGA 5BNNC 1LHNA 4ASMB 1AR73 2D44A 2BEOA 3TYJA 2ZOEB 1FPN1 2PHFA 3CLPA 1PO21 2P3JA 3LCPA 3ZSJA 5A33B 3ZYJB 4LHNA 3L2YA 3TN93 5BNOB 4AE2A 5KHKA 4ES8A 3JB8A 3JCIA 3ZMOA 4Q0SA 4EJRA 1G86A 1AYN3 2RS33 4XJAA 4GALA 4DQAA 4XYXA 3UJOA 4RA0A 1OOPA 1X8EA 3H8UA 1EPZA 3MIDA 2IFRA 1FI2A 2RM22 4RGAA 4YARA 1NYWA 2E7TA 1O4TA 4Q0PA 1UX6A 4XFIA 3ELNA 4IV1A 4EV0A 1I1EA 5L36A 3T2TA 2EA7A 1WW6A 4IXLA 2GN7A 2CWMA 1ZRCA 3MIBA 2WLPA 5L19A 1LU1A 4MV2A 4PIZA 1RUC3 3ZFEB 1LKNA 3PJQA 4QXKA 4M0NA 2QJVA 5JI7A 3J4UH 1WW5A 3CO2A 4GH4B 4AVTA 5C33A 2PELA 3NWKA 3PLQA 4JRLA 3R4UA 2O0OA 2WSUA 1AYM2 2PAEA 1WCSA 4DXZA 4ZXKA 3V56A 2BBVA 1WCKA 4DRVA 1PVC1 1KJLA 3VBHB 3WHUA 1UAIA 3DGTA 3NAPC 4OZXA 2H6BA 4PBPA 1DYPA 1N47A 2WQZC 5L7OB 1R1A1 1DGRA 1H1MA 1RUG2 4G3YC 4M3CA 5DDJ2 5HCBA 2JX9A 4OHXA 4AGGA 2QDNA 4E2GA 1NA1B 3UJQA 2Z69A 4YGCA 5CIRA 2A6ZA 2UU8A 5EWSA 2PHXA 4DS0A 2WNUB 3WDWA 3V0BA 3OY8A 3IT8A 3VBRA 2CY6A 2RS53 5H9PA 2D98A 3FLRA 1CGPA 4E4SA 4COVA 3IWZA 4WM7B 4AVAA 1D0GA 3VBFA 3WP4A 1CR7A 1NCQB 3VDDA 2NMOA 4XFAA 2QUOA 2GC2A 5JWPA 1FOD1 2XH6A 1ZBA2 3WG2A 2GU9A 3WUDA 1O3TA 1J59A 3ZFGA 4Y26A 1O91A 5BPXA 4WVZA