2WS92

Equine rhinitis a virus at low ph
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
200
structure length
200
Chain Sequence
GTTYCYSKPDGRPPSTVSDPVTRLGPTLSRHYTFKVGEWPHSQSHGHAWICPLPSDKLKKMGSFHEVVKAHHLVKNGWDVVVQVNASFAHSGALCVAAVPEYEHTHEKALKWSELEEPAYTYQQLSVFPHQLLNLRTNSSVHLVMPYIGPGPTTNLTLHNPWTIVILILSELTGPGQTVPVTMSVAPIDAMVNGPLPNPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Equine Rhinitis a Virus and its Low Ph Empty Particle: Clues Towards an Aphthovirus Entry Mechanism?
pubmed doi rcsb
molecule tags Virus
molecule keywords P1
total genus 41
structure length 200
sequence length 200
ec nomenclature
pdb deposition date 2009-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2ws9201
5ACA2 1TMF2 4FSJA 3ZFGB 5ACA1 1RUC2 1RUC1 1ZBE2 3VBRB 1R1A1 4CEWB 1VB4A 1QJX1 5C8CA 1DDLA 1TMF3 2BBVA 5JZGB 1V9U3 1FMD2 1NCRA 1SMVA 1QJU1 2RS51 5ABJC 1FMD1 1A6CA 1AUYA 3VDDC 1VRH3 5DDJ1 1OHFA 1VBC3 1OOPC 1RMU1 1ND3B 1RUJ2 4N53A 1AR71 1ND2A 1AR72 1ND2B 1EAH3 5J98B 3VDDB 4Q4W3 3JD71 2GSYA 2R071 2X5IB 3VBHB 1ZBA3 1PVC1 4IV3B 2TBVA 3DPRA 1MQTA 4JGYC 1D4M3 1RHI1 2RS11 4PDWB 3VBFB 4RHV1 5BNOA 3VBHA 1AR83 2HWC1 3VBRA 2BUKA 1BMV2 4WM7A 2HWB2 3VBOA 1BMV1 4CEWC 1PO13 2FZ2A 4FTSA 4YVSA 1BBT2 1POV1 2WS91 1BEV1 1NA1B 1MEC3 4RR3B 2ZZQA 5CFCC 1RUF1 1CJDA 5BNPA 3IDEA 5JZGA 1NY72 1W39A 1ASJ1 1NOVA 2HWB3 1AYN2 4CDQC 1AYN1 2WZR2 1QQP3 3J8F3 1RMU3 1RUE1 4CDUC 3FBMA 1AR82 5GKAC 2RS32 2RS33 2WFF2 3JD73 4GB33 1EV13 4SBVA 1ZBA2 1QJY2 1ZBA1 1RVF1 5L7OB 1HXS1 1AL23 1QQP2 1HXS2 1QJY3 2R062 1R1A2 1RHI3 1R081 2RS13 4Q4W2 1QJU2 2RS52 1PGL1 1R093 5K0UC 1M06G 2WZR3 4YVWB 1COV3 1E57A 4BCUA 4N43C 5AC93 2MEV3 1RUG1 1RUJ1 4FTEA 3ZXAC 2RM21 4Q4V3 3VBUC 3ZFFC 4GH4C 1H8TB 2BFUL 1HRV3 3S6PA 1OOPB 1PO12 2VQ0A 1D4M2 1AR93 4Q4X1 1R1A3 4Q4X2 3CJIB 4Q4Y2 4WM8C 1HRV2 3ZFEC 3LOBA 5D8AA 4FTBA 3DPRB 1RVF3 1C8M3 5L7OC 4CEYA 4IV1C 1HRI1 4RQPA 3J8F2 3NAPB 5LK7B 1R083 4IV3C 5A33A 1AR73 4N53B 3JBG2 1V9U2 3JBG1 1R092 1R091 3VBFC 2HWE1 4RS5A 3M8LA 2HWE2 1PVC3 2WZR1 1MEC2 3VBSC 2XBO3 2R063 1RUG3 4CDWC 5BNPB 5C8CB 3ZFGA 1EV12 4QPIB 1FPN2 1NA1A 1K5MC 1B35C 1FPN1 3VBSB 4CDXA 1PVC2 1AYM2 4RR3A 1VBC1 1AYM1 2DF7A 4JGZB 4JGZA 2MEV2 5AC92 1NCRB 1AR63 1VBB2 4CDQB 5ABJB 1RUD1 1NCQA 4Q4W1 1B35B 1H8TA 2HWC2 2RMU2 4WM8B 2HWB1 4CDUB 4QPGB 1C8M2 1C8M1 2HWF2 1F2NA 3CJIA 1BEV2 2WWSA 1BBT3 1RUE3 1VBD2 2RM22 5BNNA 5CFDC 1PO23 2X5IA 1ND3C 1POV0 2PLV1 1NY71 1ASJ2 1PO11 3VBOB 4PDWC 5BNNB 3NAPA 1BEV3 1C8NA 2XPJA 1ZBE3 1OPOA 3VBHC 2GH8A 4Q4Y1 5K0UB 1PIV1 4YVWA 4WM7C 5C8CC 4CEWA 1RUI3 1F8VA 1NCRC 2ZTNA 4YVSC 1AYN3 1RVF2 4QPIA 1QQP1 1COV1 3J8F1 1K5MB 5C4WA 1QJX2 1AR61 1OOPA 1VB2A 4QPGC 2RR12 1V9U1 2RR11 4AEDA 1FMD3 5DDJ3 1HXS3 1HX6A 1Z7S3 3DPRC 4JGYA 1PGW1 3ZFEB 5C9AA 5A32A 1EAH1 1WCDJ 1VBE1 1PO21 4RQPB 1NG0A 3VDDA 4CEYB 1PO22 5BNOC 1RB8G 5D8AB 3VBOC 2MEV1 1VBB1 1VBD3 5BNOB 4YVSB 1HQNA 3JBG3 5CFCA 4GH4B 1HRV1 2FZ1A 4WM7B 1RUI1 2HWC3 5BNPC 1RUI2 1AL22 4N43A 1CD3G 4Q4X3 4CDQA 1AR92 2WS92 3VBUA 1RUF2 3HAGA 1RUH2 1RUF3 2R042 2R041 1ASJ3 4AEDB 1AL0G 5ACA3 1FPN3 5ABJA 5A32B 1RUE2 2BPA2 2XBO2 4NWWA 2HWD1 2RS31 5JZGC 3TN91 4N53C 1TMF1 1ND2C 1EV11 2RS53 1QJU3 2Y26A 5L7OA 4GMP0 1FOD3 4RFT0 1VRH1 1QJY1 5J96B 1VRH2 1COV2 4Y4YA 4CDUA 5FMOS 2R061 2BFUS 1MQTC 1R082 1VBB3 1AR62 1QJZA 1RUH3 1GFF2 3VBFA 1VBA3 4GB32 3ZFFA 5A33B 4GH4A 2RMU1 5DDJ2 1MQTB 1RUC3 3VBRC 2HWF1 4CDWA 1RMU2 1PGW2 3ZFGC 2RM23 4Q4V1 1RUG2 1QJX3 1EAH2 1VBE2 1PIV3 3ZFFB 2WFF3 3JD72 5CFCB 3VBUB 1K5MA 5K0UA 5C4WB 2R072 4RR3C 2PLV2 5FMOL 4LLFA 1TME3 4N43B 4JGZC 5C9AB 1H8TC 4RQPC 1IHMA 2IZWA 2PLV3 2R073 2QQPA 4Z92B 1X33A 1NCQB 3CJIC 1Z7S1 1Z7S2 1X36A 1ZBE1 1HRI2 1HRI3 4WM8A 4Q4Y3 5CFDA 2X5IC 4RHV3 3ZFEA 1RUH1 1VBA1 2HWE3 1VBA2 4PDWA 2RMU3 3NAPC 4IV1A 1NA1C 2HWF3 4CDXC 4IV3A 1POV3 2WS93 4CDXB 1MEC1 2WLPA 2XBO1 4YVWC 4EJRA 2HWD2 2RR13 4GMP3 4RS5B 4Y5Z0 2WFF1 4RS5C 1TME1 1VAKA 3JB4C 3VBSA 1TME2 4CDWB 1VBC2 1AYM3 4QPGA 2ZAHA 5AC91 2RS12 1RHI2 4AEDC 1RUD3 1VBE3 4RHV2 1RUD2 1PGL2 1B35A 4GB31 2R043 1ND3A 1AL21 5D8AC 4JGYB 5C9AC 5FOJB 3JB8A 1BBT1 1VBD1 1AR91 1NCQC 4Q4V2 4CEYC 2HWD3 3TN93 5CFDB 4NWVA 1FOD1 1FOD2 1D4M1 4IV1B 5BNNC 4QPIC 1RUJ3 1PIV2 5C4WC 4GMP1 1AR81 3TN92
chains in the Genus database with same CATH superfamily
4XFHA 1GBGA 2DCKA 2V4VA 4Y1ZA 3RQ0A 1W3VA 2G19A 5ACA1 4XETA 3ZYBA 4C8DA 1XNDA 2C9AA 1MS9A 1WUVA 3EQEA 1RUC1 3ZYJB 4B1MA 2JE7A 3D3AA 3PVBB 3OJBA 1ZBE2 4S2FA 3H42B 3EBRA 2XGXA 1D2QA 5DAWA 5I91A 3SKJE 4GA9A 1UU4A 1VB4A 4XUPA 1QJX1 1V6JA 4GALA 4FO9A 1UIJA 3K75B 4GWJA 1TMF3 3WP6A 4LHLA 1O3TA 4FAHA 1FX5A 5CISA 2QZ2A 2QFEA 4NIGA 1C5HA 1D2SA 1OH3A 3B3QE 3D4KA 2ZGLA 3U11A 2VMCA 2PFWA 3KF3A 2Q8DA 3RGBA 1OOPC 4Z82A 5IFTA 2E6VA 4AYUA 3I2KA 4BXSV 3FBYA 4WVZA 5J48A 4YSFA 5FP4A 1ND2A 3X29B 3BTYA 1TG7A 1HW5A 1EAH3 5JUVA 2UYAA 2ERFA 2GSYA 4JDMA 1GMMA 1SZBA 1W06A 4OZOA 5B2GB 2GP5A 3VBHB 1VIWB 1ZBA3 5F9TA 2R1BA 4DS0A 2DBNA 4IV3B 2HEVF 4PLMA 1OI6A 2TBVA 3WDUA 1UYZA 4D7SA 4NHXA 3FHQA 1JS9A 1U5XA 2QDRA 4LHKA 5FYVA 2J1EA 1CZVA 1GNHA 4RHV1 3I59B 3E5XA 3WLUA 3FHAA 1MS0A 1SDWA 1AX2A 5FZFA 1WW5A 2QCSB 4H55A 2BUKA 4XF0A 2B39A 2GAUA 2P17A 4HVOA 4WM7A 3VBOA 3VBRA 2B42B 1PO13 5F3IA 4FPHA 2FZ2A 4FTSA 2ZGPA 3MF9A 3HEIA 1BBT2 4COVA 1NA1B 3KF5A 5D21A 1DU3D 2VMDA 2ZHNA 3FX3A 3GHNA 4RR3B 3ZKUA 1RITA 4BISA 3ZXKA 3PU8A 1KS4A 2YU2A 1WD3A 4PI2A 4LK7A 1SLAA 1JOJA 1NX9A 1QEXA 2HKXA 2ZMNA 4OMCA 4LULA 4B4QA 4Q0VA 3NNGA 4ZPIA 1NY72 4MGSA 2ZAAA 2VCCA 3PIGA 5BY5A 4CCOA 1PMIA 2Q5TA 3PURA 3O12A 5JMCA 5A3WA 4YW6A 1RJ8A 1SG3A 3H1MA 1V0AA 4QQOA 1RMU3 5HCFA 2VG9A 2LRPA 2VZ1A 1YJKA 3H8UA 5FP3A 4K9SA 4OQ9A 2XJSA 1JH5A 2BNNA 2R6QA 4K20A 4IE0A 4AF9A 2VCAA 3LF7A 2WFF2 4LTAA 4QX2A 1QH7A 4NRMA 1QJFA 4AAPA 4TLGA 5FYTA 4A42A 1QJY2 5LBBA 1RVF1 4L97A 4XUQA 4UW4A 1WKYA 3AKPA 5FYUA 1A78A 1LEDA 1OUXA 4ONUA 4COZA 1OLRA 1L3JA 1LHOA 3NSTA 1LHWA 1SBDA 4W6WA 4ASKA 3QH7A 2G9FA 4CE8A 4ZHNA 4CXXA 2RS52 1PGL1 1DQ1A 4XUTA 5JLVA 3BB6A 4EV0A 2P2KA 4NHMA 4LBLA 4D8MA 1W9FA 4QKNA 3WDTA 4HZFA 1YEWA 4Y3OA 1CGPA 2D6KA 4MHUA 5KXDA 1R1ZA 2W47A 3ZYIB 4FTEA 2RM21 3SMHA 2ZHLA 4CP9B 3VBUC 2GC0A 2OX0A 4AVAA 5G05L 3ZFFC 4DUWA 2R32A 4BXFA 2LW8A 2JKXA 3FUQA 3RVHA 4BK4A 5IK4A 4BH9A 3K3OA 3UESA 1CIWA 1WMDA 1GNZA 1PMHX 3K51A 3RFRA 2VNOA 1YNAA 5LK5A 3VDCA 2JE8A 4BQWA 2FBEA 3RMXA 1GZCA 1YJLA 4PIYA 5H9QA 4EWEA 5JXIA 2KD7A 4F3JA 3P3PA 5CEHA 3DF0A 4MGKE 1V6LA 4NPMA 2VPVA 5FRAA 2EIBA 3I2FA 5FMBA 3U07A 3ZFEC 1W6NA 1W90A 3APBA 3HBKA 4IDZA 5D8AA 4PIZA 3VKMA 4A3XA 4FTBA 4OUSA 4FPCA 1C8M3 2WR9A 1WW6A 3LCPA 1XC6A 2A6WA 1IS3A 3JZVA 4HKLA 4XOGA 5T50A 2ES3A 2IXCA 3ZSEA 2VOXA 1G86A 1F15A 3ETPA 3CLPA 3AX4A 5H9PA 1NT0A 3OGRA 4COWA 1N1YA 1ULGA 4UOJA 3VBFC 2DVFA 3M8LA 2D3SA 2WZR1 4YGBA 4O9GA 2WT0A 1Q5OA 4O65A 4QPWA 5F5CA 4CP1A 1MEC2 3O14A 3VBSC 3ZIXA 2XBO3 4GWNA 2Z2SB 1RUG3 2W1UA 5LEJA 1S0GA 2VQUA 4YW7A 4XABA 1O91A 3CJXA 4XBQA 3ZFGA 1APNA 4D3WA 3RWNA 1ST8A 4AI9A 1E5SA 1FPN2 4UF0A 2WSVA 1K5MC 2DDUA 1NQJA 4CDXA 1D0HA 1URXA 2XWJB 2OT7A 3BIWE 4XMAA 5FLIA 2BGCA 4AGGA 2RJ2A 2HBTA 2W95A 4JGZA 2MEV2 2GH2A 4LITA 1Y7BA 4EN6B 4PLNA 2JB8A 1AR63 1VBB2 3AFGA 1MVEA 4QD2A 4XYXA 2VZTA 4CDQB 1DCSA 5ABJB 1RUD1 1O6UA 1EP0A 1Q3EA 3CL1A 1H8TA 4O9EA 3SH5A 3WV6A 5BUVA 3O1TA 4XAEA 1YHFA 3B9CA 4QU2A 3VDBA 2XMLA 2OIIA 2RMU2 4IXLA 4WM8B 5G04L 3NQHA 2H6CA 3Q9OA 3WXPA 3Q8FA 5FV3A 3M1HA 1YI7A 4HKOA 4WVMB 4D6SA 1JHNA 4JTNA 2WWSA 1NE6A 1BBT3 3J7HA 5IK5A 4UBGA 2CU5A 1B09A 1OLMA 3U75A 3WR0A 5CFDC 3UGHA 1DQ5A 4Y1YA 5F5IA 2D6PA 5IUQA 1EYBA 1SFYA 3MEPA 1ND3C 3MF6A 1Q8OA 4CA9A 4RFRB 2A5ZA 5ANQA 2D97A 2GU9A 2ET7A 1JXNA 1PO11 1OF4A 3BPZA 3MV01 2Q8CA 1OD5A 3VBOB 5BNNB 4KNCA 1OC1A 4QHZA 1OFSA 3K46A 4NPLA 3VZOA 2EIDA 3ZXLA 3NJXA 1HB3A 2NYYA 2AEYA 1TE1B 4UFKA 4Y1UA 4BIOA 2WO1A 3P5BA 5C33A 5HV0A 4LOSA 2VTXA 1K5JA 1RUI3 4S2HA 4XJZA 3TAYA 2VBDA 1CQ9A 1SHWB 1JYWA 3U10A 4YVSC 1RVF2 5LZ6A 3LB9A 4XXAA 5I0UA 3R0RA 3N7JA 2JKBA 4LBKA 5C70A 3H8RA 1W8HA 2D43A 4GJYA 1XYOA 4V2WA 3OTFA 4PBPA 4D6QA 4YZ5A 1OQDA 1V9U1 2RR11 4HSLA 4AEDA 2VM9A 1GICA 1OF3A 3W9AA 3PTRB 2VZRA 4CXWA 5A3MA 1UMHA 2ENRA 1XRUA 2GNTA 4XC9A 4Y1VA 4E27A 2PQQA 4DO0A 1OSGA 2WINB 4BQ1A 1H4HA 1ULOA 1WLDA 3DPRC 3L9JT 3PJQA 3QLQA 1KS5A 4JGYA 3BVCA 4BQ3A 5K7PA 3GZUC 1WCDJ 3LFIA 1PO21 3VDDA 1NG0A 1UOFA 4FOQA 1PO22 5BNOC 1RB8G 4JHTA 2XLFA 3BN6A 2VW0A 4OCTA 3E1F1 1RXFA 1H2NA 1ZRFA 2BYVE 1LEMA 4OHYA 5CAZA 4BLJA 2LM3A 1W6PA 2YPJA 2EXKA 2HYXA 2VMGA 3IBMA 3VBOC 4DXTA 1XOYA 1UZYA 4Q0UA 4KU7A 1Z0HA 1VBD3 3MYXA 4RD7A 5EJZB 4HKWA 2VNGA 3KSCA 3AMMA 4LBQA 2F6BA 4MXWB 4W8JA 1JI6A 5I0RA 4N7IA 5JOZA 3KV6A 4WM7B 2AREA 2Z69A 3MIBA 4JX0A 2JDUA 2IFRA 1GQPA 5F2SA 4YG6A 2A70A 1JOPA 4WVWA 3CNAA 1F8VA 4UXAA 3LEIA 5C3PA 3O0WA 1FNZA 4DINB 3HAGA 4BQXA 1RUH2 1RUF3 3DYOA 3GJBA 3ZPYA 5M0TA 2XJQA 5LA0A 2R041 3IAPA 4I2OA 3VHOA 2XVGA 3HNBM 2R1DA 4TYSA 3I2DA 3SITA 2CNAA 2JD9A 4DEVA 3KCYA 2IVJA 1JU4A 3LDBA 1XNCA 4XHBA 2BWCA 2E51A 4ZZ8A 3K48A 1W8WA 5JZGC 4N53C 1DGRN 2DUOA 2YG0A 1QJU3 4BE3A 3ORJA 4N90A 1JBCA 2YMZA 2GMEA 3Q8AA 3GM8A 4L2NA 3MLKA 3VZMA 4Y4YA 2W9XA 2ZGSA 1MQTC 1N1VA 3POJA 4OMDA 3UGFA 3WF0A 3E6DA 4AR2A 3R6SA 3ROUA 2BU9A 3PNAA 3WSOA 3E6CC 2HJIA 3I3DA 4YRDA 3GBGA 2F17A 2BBAA 2XL7A 5D1IA 5FY5A 3IB3A 3MUZ1 3ZFFA 4P02B 4LR4A 1F35A 2G4IA 1Y43B 1UAIA 2DVAA 4CDWA 1SLIA 1S0BA 5A1FA 2CSGA 1PGW2 1QDOA 4XJUA 4YNIA 1RUG2 2RJKA 1UF2C 1L7RA 3AZYA 3GCWA 4FFIA 3CBNA 4Y22B 2I2SA 2ZACA 3DCQA 3ZFFB 1W2NA 1YXWA 2WFF3 3I7DA 5C4WB 2WO2A 4DRVA 3AXEA 1QXJA 2PLV2 2YPDA 4RR3C 5FY7A 4LLFA 5H9RA 3LWCA 5FBJA 3ES1A 1S0DA 3OUHA 2VOTA 2RDRA 3M3QA 2C0ZA 5FO7B 5I0DA 1WGPA 4XE9A 3PUQA 4GAZA 3ZVXA 4E4DX 4EN8B 2L9LA 1CAVB 1IHMA 3H9AA 4AHXA 2V09A 3S57A 2AH2A 2IZWA 2QQOA 3I3BA 3UKNA 1ONAA 5IATA 3MIFA 4E4SA 4UAPA 1WLTA 4C1XA 2XOMA 4FFHA 4BB3A 1XE8A 3RS6A 4ZZ5A 1YIPA 4ZU4A 4HLTA 1V6OA 1W8OA 1H2KA 4MADA 5IW0A 3UK9A 5A6ZA 2EF6A 2BWAA 2WNVA 3IPVA 3K2OA 4DQAA 3LOIA 2OXBA 2WNEA 4XACA 1DZTA 2WNUA 4YFZA 2NP0A 1E5RA 3D6EA 2IXLA 1OKOA 1MR5A 3SNMA 5GZDA 3OYWA 3LGRA 3VD5A 1Y9QA 5BNQA 4X6QB 4PDWA 1OXCA 4KL1A 2JE9A 3NAPC 4IV1A 3QOPA 2GN7A 5DUXA 4CDXC 1J59A 3C7HA 5CA6A 3OY8A 4QGLA 3LSEA 4ATEA 4MYEA 5HPOA 3RI9A 3ZSLA 2RR13 4LEJA 5IFPA 2RDQA 1DQ2A 1GV9A 2W0XA 2XJPA 3S30A 1WCUA 2E32A 3QD6A 3CMGA 3T2OA 4QHBA 4ATFA 4KGGA 4CDWB 3P1IA 3NNLA 2ZX1A 1YLLA 1AYM3 2W1WA 4TSVA 3W20A 5KC5A 3H8OA 2VNVA 5AC91 2JG8C 3PJYA 3MIHA 1CR7A 1HLCA 2NMOA 4IESA 4A6OA 4N9HA 5K9YA 1SQ4A 1VRBA 5BXXA 1Q8VA 3VL9A 1B35A 4M00A 2R043 2XL9A 3USSA 1W03A 1O5LA 3O1VA 1MS4A 2O0OA 1ND3A 1C4RA 4J25A 4QGMA 1AL21 3I54A 4LKSA 5J37A 1JYCA 2ZCWA 4JGYB 1UOGA 1KEXA 2DUQA 3LPFA 2QVSB 2VZQA 1VBD1 3OYWB 4XCBA 3IAQA 1QIQA 2FD8A 4LO8A 2E7AA 3SISA 2D5HA 1POQA 4EROA 1BJQA 2GC3A 1WBFA 3ZLIA 2XONA 3FLPA 3EB7A 5A7PA 1NYWA 2WABA 4URTA 5FZOA 1CWPA 1UU5A 3RZGA 4NWVA 1GP6A 3V65A 5AFEA 4X6RB 3HBZA 1G9CA 5EJ3A 1P8JA 1VR3A 3AZWA 4P5HA 5FZGA 4IW3A 4AGRA 4ET7A 2FDIA 4D94A 5EIYB 4A4AA 1F4HA 1YQ5A 3RG0A 5FZAA 2RDSA 3ZFGB 2D7FA 2CGPA 1M4WA 2JEMA 2RJLA 3HNYM 4H7LA 3THCA 2PN5A 2WN2A 5EZWA 5FIXA 1REFA 1H1IA 1VAVA 1ZRIA 3T2PA 4BMEA 2CHHA 3C2UA 5KHGA 1PMJX 2YGLA 4M01A 4XEZA 5FZ0A 2ZGNA 5C8CA 3EYPA 2G9GA 2YUEA 4DMIA 5FZ3A 2BBVA 1SMVA 2XKOA 1QJU1 2JENA 1G9FA 2JIGA 1H9PA 1WLCA 3HWJA 5CKQA 5FZ8A 5ABJC 5A7QA 2LTNA 2VUJA 4GZ9A 5CIRA 2MNGA 5DDJ1 2DU0A 3ACHA 1HN1A 1OHFA 4AAXA 1MS1A 1VBC3 4QX8A 2O8OA 1RMU1 3TNQA 1ND3B 4LPLA 4YGEA 4A41A 4AVVA 5JXHA 2FCTA 1SCSA 3LA3A 1AR71 2PHWA 3MBWA 4XBLA 1AR72 5J98B 3GBWA 3VDDB 4OVEA 4Q4W3 3WF4A 4LA3A 3POGA 2R49A 3WNXA 1RJ7A 2D6NA 2PHUA 5C3OA 2X5IB 2AR6A 3IMMA 4BQ5A 4CP2A 4G4FA 1F5FA 1PVC1 2UY8A 4YGDA 5A7NA 5T52A 4IEPA 1PX3A 2VH9A 2Y6LA 3NV1A 1YFYA 5C6CA 2FMYA 4LBQD 2UYBA 1LODA 2JDPA 4UYBA 5J3UA 5FYBA 2ZXQA 3LIHA 3VBFB 5EPAA 1C1LA 3BODA 2Y6GA 2UURA 3KT1A 4AE2A 4E2QA 5IT6A 1S0CA 4ES9A 4XIKA 3MIEA 1QOSA 2P3IA 5FBZA 3T09A 3VKOA 3QCWA 3SH4A 2E63A 4UFMA 5A7SA 1RTVA 5A3NA 4ZKTB 4IUGA 3H0OA 2VL4A 3NO8A 3R4DB 4A7YA 4LA2A 4P9JA 1CJDA 1EPZA 3RZKA 5A7OA 3OEBA 5JZGA 5E89A 4QB2A 3SEEA 1ASJ1 1NOVA 3VZNA 2YC2A 1TEIA 1Y4WA 3MW3A 1AYN2 1LR5A 4QT6A 3OB8A 5FPVA 3WCRA 1AYN1 2VOVA 4CDQC 1F4AA 3DKWA 4AK3A 1VJ2A 4AFAA 4XFAA 3J8F3 1N3PA 5CG8A 1I6XA 3I2JA 1GWMA 4R4ZA 3MPPG 1W8TA 1TVGA 4IETA 4DB5A 4BM8A 2X10A 1AR82 3BU7A 3A7QA 3PIJA 2Y0OA 4URAA 1EV13 1US2A 1ZBA2 2FHRA 4Q0PA 4BMBA 5L7OB 1W2TA 3LDRA 1HXS1 1S1AA 2E9QA 1AL23 1QQP2 2PHLA 3KVAA 4CU6A 5HXMA 2H0VA 2R062 2Y64A 3O7OA 1GUIA 3PUSA 4E2SA 1RHI3 2RS13 1BVVA 4PLOA 4ZONA 1DIWA 2VCMA 1S4CA 3M70A 3C3VA 3L2HA 3P6BA 4J6GA 1I3HA 4Q4W2 1UY4A 1QJU2 4W65A 2QQWA 3ZM8A 4I0AA 3W5NA 3VKLA 1M06G 2WZR3 4FT8A 2RVAA 3AP7A 5CADA 1GKBA 4FOVA 1O59A 4K1ZA 1YIFA 5DAVA 3UGGA 2JDZA 4BCUA 4N43C 4LE3A 3OCPA 5AC93 1NZIA 1RUG1 1QKQA 5FKCA 1IS4A 2QQLA 1W2OA 2WYFA 3NNMA 3R4UA 4L0PA 3U4SA 1LGNA 1SLLA 5JI7A 3O0VA 4GH4C 2BEOA 4IEWA 2A3YA 3KV9A 1HRV3 1UPSA 4GQ7A 4QQHA 1CZTA 4ASMB 5KXEA 2ZEXA 1YQ8A 1S0FA 1XPWA 3PMEA 3QACA 1H8VA 2OZJA 4JDOA 1AHSA 2ZABA 3KS7A 4Q4X1 3MIDA 4DY5A 3CU7A 1XNBA 4Q4X2 4XJAA 5FDBA 5GZCA 1HJGA 1V70A 4Q4Y2 4QAWA 4NAMA 2WNVC 1FI2A 2O1QA 3ZYGA 2ARAA 4LO5B 4G9SB 2PHRA 2W46A 4IQPA 4KQ7A 1XNTA 2E26A 5GALA 3ECQA 1W8ZA 4DXRA 5BPXA 4OHWA 2GC1A 3N9OA 4XHXA 1O4ZA 5L36A 1K45A 4AXOA 2CY6A 2Q1MA 3RNSA 3ST7A 4CEYA 1HRI1 4HSJA 4RQPA 1QDCA 3AP9A 3J8F2 3HD8B 3HMYA 3I8TA 3NAPB 4XPVA 3WW3A 1FATA 1ULEA 2ARCA 4FOWA 1Y9MA 4IV3C 4KWJA 4YW2A 5GLTA 4D6RA 1AR73 3AJZA 5FZ6A 3JBG2 1GZ9A 1CPMA 2QTWB 2JIJA 3V0BB 1H2LA 1R092 4E4HA 1ZZ9A 1R091 5FXXA 2HWE1 2HWE2 1PVC3 2IXJA 1JZ5A 4IEYA 4IE5A 4DRRA 4FPKA 4JKMA 3WNNA 2CDOA 3CZJA 4INDA 2GALA 1US3A 1OUSA 4QWNA 2ZOEB 5BYNA 1ODNA 5C8CB 2C9KA 5LRSA 1RYYA 1GZWB 4FSJA 4AVCA 1W8FA 4CP9A 2VY0A 1NA1A 1QNYA 3ZSMA 1B35C 1UU6A 2C24A 3WQBA 4CYDA 4R9AA 3MDPA 5LASA 3WNLA 5I93A 2I74A 1VBC1 1XE7A 2WZ8A 2ZGKA 4XFGA 1YFXA 3KB5A 5AC92 3K4ZA 3J9SA 2BRTA 1XXNA 4Q4W1 4Q8LA 3GHMA 2OQ6A 4WZFA 2HWC2 3RDIA 2TEPA 2VVFA 4AOCA 2VECA 2BQPA 1C8M2 4QPGB 3NV3A 1YQ2A 4QQPA 4ZS3A 4B1LA 1ULFA 4HG6B 3ILFA 5FJHA 4PQQA 1RUNA 3AFKA 1W6MA 1W6MB 4DZGA 2A6YA 1DP0A 1PO23 2XWBB 3IPVB 4XJ8A 4GULA 1U12A 3WUCA 1LULA 1POV0 3VV1A 3H7YA 1U5YA 3RZJA 2VUCA 3I4IA 3INAA 2BP6A 3LPGA 1WMEA 4BK5A 1DGRA 2WSUA 4XQDA 5T54A 5EFUA 2XPJA 3THTA 2J1VA 1ZBE3 4Q26A 2VUDA 3NL1A 3VBHC 2GH8A 4HT1T 4DXSA 1UCXA 2H0BA 2NM1A 2VGDA 3BTAA 4V1PA 3C7OA 3IDCB 3MFAA 2W92A 3C7EA 4YVWA 2ZHMA 3F95A 1UL9A 3G6JB 4OI1A 5C8CC 1IQDC 4TZDA 3HJRA 2ZTNA 4O61A 1AYN3 4N7UA 3VD3A 1W28A 4QX5A 3ZN4A 4C0HA 4NROA 3J8F1 5C4WA 3IIIA 4P9YA 4CCCA 1OOPA 1VB2A 3KD4A 3TOJA 3ZMNA 2ZA9A 1SFNA 2CYFA 4LQRA 5F32A 3TB0A 4AFCA 1LGBA 3I2HA 1F5JA 1HJFA 1SLTA 2OZ6A 1IGOA 1FMD3 3DKQA 1HXS3 4CU9A 3B01A 2B7YA 1DGLA 2YC4A 1Z7S3 2QQKA 4KBZA 3ZSJA 3DUIA 4PQ9A 5FK7A 2XKPA 2I07B 1YI9A 4FPJA 1VPHA 2UWBA 4R9DA 2K9ZA 2P1BA 2OKXA 3AKRA 3POEA 5C9AA 3I97A 3WZ1A 1EAH1 4H14A 5FMCA 3N9QA 1VBE1 4HOOA 3ZYHA 4EE2A 5A3OA 1C28A 2QQJA 4RQPB 4COUA 4DUXA 1U5IA 1X8EA 2WNVB 4CEYB 4CUGA 2JDAA 2IFWA 5A3LA 1BXHA 1UX6A 4M3CB 1WW7A 1X8MA 4HXCA 1ENSA 1QMJA 2PAKA 4H7MA 4XDOA 5E1RA 5KR7A 4J1XA 5IAXA 5BNOB 2RV9A 1CAXB 1GR3A 4M3CA 3MFCA 4MGIE 1LAJA 2Y34A 4AI1A 1CJPA 1HRV1 3AP5A 2FZ1A 4B4RA 2PHDA 2PYTA 3MLJA 2HWC3 5FZ1A 1RUI2 3EJKA 2DFCA 3M3IA 3PVNA 3WW2A 5FY0A 4Q4X3 5LWBA 1MACA 2Y8KA 2DVBA 3N9LA 2J1UA 5KHJA 4NUBA 4Q1RA 4I30A 1VMJA 3O1SA 2ZMKA 1S0EA 5EJ1B 3RSJA 1G6NA 4XQWA 2HEWF 4BLIA 2DVDA 5GZEA 4Y26A 1AX0A 4UFJA 4ES8A 3UJOA 2JG8B 5A32B 2XQRA 4CCMA 5LEKA 1XB9A 2FDJA 5JWPA 3DXTA 3LA2A 2JB4A 1DQ6A 1ULCA 4MSVA 5LBFA 3RZHA 2W39A 2HWD1 2CWMA 2D3RA 3T4VA 3TN91 3KGLA 5ANNA 1GSLA 4CRQA 5FP9A 3KT4A 1H30A 2RS53 2VBBA 3NJVA 1ZM1A 1UZVA 4OUMA 2WN3A 5C3RA 4UWDA 5FQ0A 5L7OA 1PM7A 3B00A 1STMA 1BK0A 1UYYA 4RGAA 4W6XA 3BTZA 1TNRA 5FMOS 1LJ7A 3JCIA 1R082 1VBB3 1UKRA 1AR62 1O4YA 1C57A 5J09A 1UN1A 4LT5A 2B8MA 2PAMA 2P6HA 3CKHA 4XDQA 4AI3A 3BYWA 1CONA 5DG1A 4QM8A 5AFBA 4XCAA 3V64A 4K3UA 2WYSA 2I45A 2Z79A 5HV4A 5FYMA 3N9MA 1MQTB 2VMEA 2VQAA 2BJSA 1PK6A 1YYNA 3M7AA 3VBRC 3WW4A 3GDBA 5FCCA 4B3NA 3OGJA 2GP3A 3ZFGC 2RM23 4LUKA 2JG9C 1VBE2 3OEAA 4LJHA 1OA3A 4LKDA 4ZS2A 2R072 3VB9A 1DBNA 5FMOL 1W3XA 3WT3A 1CESA 5I0SA 3LEGA 2UY9A 3J4UH 4OYUA 3SC7X 3L2YA 4YW3A 3POFA 3N35A 1SCRA 1LU2A 4HETA 4F83A 2WQZC 4W50A 3SKVA 1JZ6A 1JYVA 5FWEA 2SLIA 3AZVA 1DFQA 2CL2A 3ZSKA 3E5QA 3JUUA 4RQPC 2YDEA 4HPKA 5LATA 3KVBA 1N1SA 2OVUA 4W6YA 2Q30A 4PF5A 2R073 4XDPA 4AFMA 3K3NA 4Q1PA 4Z92B 4MH0E 3UETA 2X29A 1Q8PA 2NMNA 2WRAA 3TBDA 2B5HA 4CUBA 1Z7S1 2YFUA 1CAUA 5FY8A 5IYYA 2EICA 4I0BA 1ZBE1 1UO9A 4WM8A 1PX4A 5CFDA 3I3MA 5SV8A 3M3EA 3MV11 2W3JA 2QQVA 2BGPA 3OD0A 1OH4A 4ZY9A 5FJKA 2CTVA 1NLSA 1W6PB 2VC9A 4M0NA 4FFGA 5DUUA 1VBA1 2PHXA 3IMNA 2ARXA 1VBA2 5JXJA 4FXKB 4JDNA 1T6BX 1XYPA 2RMU3 4R8HA 1I1EA 3RZZA 1NA1C 1W6QB 2EAAA 3LAGA 4FXGB 1POV3 4WVMA 4CDXB 1MEC1 3ZIWA 1G9DA 1IPJA 4QPYA 2HWD2 4EWAA 1QJEA 2WLQA 4RS5B 4OHVA 1DZQA 2OQ7A 2VULA 2XJUA 3I59A 1QXRA 3N7MA 3OGVA 3KLSA 2QDNA 3V0BA 2GZWA 3AYCA 4MG2A 4LO6B 4XFBA 4HONA 1TME1 3JB4C 4MLOA 5CKMA 2W94A 2J1AA 1WMFA 1H9WA 1OQ1A 2FCUA 2ZHKA 4GKYA 3ZYFA 1XE0A 4QPGA 2ORZA 2ZAHA 2XB6C 2CDPA 3KZ4C 4HN1A 5IAVA 1UIKA 1RUD3 5JOYA 1LU1A 1VBE3 4XUNA 2HYKA 4FQZA 4DIQA 4RHV2 4F8AA 1RUD2 1PGL2 2ZEZA 1OKQA 2ID4A 4GB31 5A3TA 2KM2A 2UWCA 5A7WA 2GNBA 3OPTA 5T3NA 3WHTA 3HN1A 2P34A 5D8AC 3CF6E 1KDKA 1LHNA 3D82A 3T2TA 5C71A 3C7FA 4UW5A 3JB8A 1BBT1 1OVPA 3DECA 1NCQC 4Q4V2 4PI0A 3B69A 4NO4A 4P00B 3ZPOA 1W9TA 4K7JA 2PA7A 2V73A 4HK9A 5DXDA 3VZKA 4RSUA 5JSRA 1SBFA 1LCLA 2HWD3 3VDAA 3E6BA 1UY0A 1FV3A 4FPFA 3TN93 5FLJA 4E9KA 2DBIA 4XF4A 2W2IA 5J36A 1TQ5A 2B9VA 2JECA 4AZZA 1CX4A 3UV9A 3HQXA 4CUAA 2PQSA 5FYIA 3IDAA 3AYDA 3ES4A 4D0QA 4OHXA 4E4ZA 5BNNC 4P9XA 4H2AA 3N4MA 1RUJ3 3T2QA 4S2DA 4META 1X82A 1PIV2 3P3NA 3T1MA 4LIUA 4KMQA 3RMYA 2W87A 4LBMA 3TN92 4LIVA 1TMF2 4AI2A 5ACA2 5LY2A 3V0AB 2CWSA 2OW4A 2VOWA 2ZPXA 4RL7A 1JYIA 1HN0A 3ENRA 1RUC2 1X9PA 4FPGA 2AEZA 1KRIA 5IK8A 2DCYA 1UY1A 2OUJA 4JRLA 2LROA 4K40A 4UFLA 3VBRB 3WG3A 3CHXA 2NPIA 3POIA 3J7NA 3T0DA 1HB1A 4CEWB 1N3OA 4NHLA 5JPNB 1DDLA 3IIAA 4M3CE 2D40A 4XFFA 1OLME 2D5FA 5FZEA 5JZGB 1NCRA 2EAKA 3MHZA 2RS51 2J1TA 3NV2A 4LUMA 4C1WA 1A6CA 2VMHA 3FMGA 3VDDC 3BU0A 4M4PA 1WMXA 4ASLA 5EXOA 5A7WB 1HIXA 3PL0A 2FDKA 2Q1FA 3MLLA 2MPFA 3EHKA 3TEXA 1BVP1 4Z8BA 1RUJ2 3AZXA 4FP3A 3JQWA 1XNKA 3KQ4B 5LY1A 2D98A 4QKDA 1ND2B 4YYOA 1OD3A 1G7YA 2R071 4BDVB 5GLZA 4JQRA 4QDSA 2WNUB 5FUPA 2AENA 3AKTA 1MQTA 1D4M3 1W6OB 4CCNA 5FPBA 2ADDA 1O7FA 5K4LA 2JDHA 4CTEA 1RHI1 1IS6A 1T6GC 1W04A 2RS11 5IVBA 3MI8A 1VAMA 5AVPA 4UI9L 4XF9A 1AR83 4MZUA 1BCXA 3PVOA 3B5LB 3S7IA 5FO8B 1BMV2 1PNFA 1BMV1 4CEWC 1OT5A 5FY4A 4CCLA 5FPUA 2PXJA 2SBAA 4YVSA 3QBQA 4UT5A 2WA3A 1POV1 5HBAA 2Q8OA 1LRHA 1MEC3 3KM5A 3AP4A 1VMHA 4L11A 2Y6JA 2ZZQA 3I2GA 5CFCC 3T0AA 2WO3A 4L99A 2DURA 1RUF1 2VZOA 5BNPA 4EN7B 5F8PA 4DEQA 3GZAA 3IDEA 5LBEA 1GANA 1GZWA 5FY1A 5CBLA 1Q43A 5LW9A 4QGNA 4B7EA 4FFFA 4R4XA 1ZZCA 1MZEA 3A22A 2WZR2 4HFSA 1GZTA 5L9BA 1H6XA 5L9VA 5F3GA 3PUAA 4ISRA 1DF0A 4OULA 5H9SA 2WT1A 4QB1A 3S5QA 3KCCA 1BZWA 3FBMA 4XUOA 3SHRA 1O3QA 5GKAC 5CKNA 2RS33 3JD73 4M0HA 4GB33 1UZ0A 5HXVA 1J84A 5CB7A 3BCWA 5L19A 1NZCA 4Y5SA 4LO7A 2YHJA 1IG3A 3W5MA 3N9NA 2TNFA 1QJY3 2Q4SA 3DN7A 3K4AA 1YRZA 5JI9A 5DG2A 3ON7A 1PK6C 5FXWA 3TWIA 1OBNA 2JX9A 1IZ3A 4Y24A 3VZJA 2JG9A 5A6QA 3GALA 1R093 1JODA 4JC1A 1AF9A 1REEA 3U37A 4AI8A 2F4PA 2R0FA 5DUVA 1WZXA 4Q2FA 5FO9B 2C4XA 1DQ4A 5EV7A 3THPA 4JAAA 1COV3 1LB2A 1JTZX 1E57A 2VQTA 2MEV3 1RUJ1 1C3HA 4LE4A 4LXLA 3AYEA 4Q4V3 5LBCA 2CAUA 5JAXA 2G9ZA 4XF3A 2AC1A 2BOJA 4XF1A 2BFUL 3FJSA 3N3HA 4K8FA 4TXWA 3VUOA 1FT9A 2XJRA 1OOPB 1DYPA 1PO12 2WZEA 2VQ0A 4MX3A 5CYYA 2JG8A 4KG0A 1GWKA 4LBNA 4IGPA 4NAOA 2AACA 1LOFA 4I01A 1H0BA 1F31A 3CJIB 4WBBA 3VHPA 2NLRA 3E5UA 1Y9GA 2D6OX 1IKPA 1V00A 4HPKB 3HQRA 2OPWA 2YY1A 1LGCA 3KCXA 1XYNA 1LOAA 4FCAA 4M3CF 3D5OA 3SEPA 3UKTA 4IV1C 4Q5OA 1A3KA 2BTVC 5LK7B 3O1OA 1H1AA 1OVSA 4IEVA 5FFOC 1R083 1ZRRA 2PELA 4IERA 1ZRDA 5GM0A 3WNKA 2WWJA 1V9U2 5FK8A 3AM2A 5CNAA 3ITQA 3WG2A 5FREA 3GZTB 2EXJA 2VJXA 1LECA 1GWLA 3JU9A 1IPSA 4HBNA 3PU3A 1QOTA 1YFUA 3FLTA 2WBKA 1YCIA 4LBOA 3RWKX 2R063 5T5PA 1CAWA 1D4VB 3GZEA 3ZYPA 4LBJA 4YZ4A 1EV12 5T5JA 2V4AA 3ASIA 1X50A 3I3EA 2ZEWA 1FPN1 4A3ZA 3M3OA 4LHSA 1Q8QA 1Q8SA 5B4XA 1AYM2 3DGTA 4HANA 3ZXEA 5IVJA 1CX1A 1AYM1 2DF7A 3FZ3A 3ACLA 1EUTA 3FE5A 4XMIA 4GWMA 4UW6A 4BA6A 4BU2A 1S2KA 1NCRB 1ZX5A 1QWRA 5FZLA 3VLBB 5DABA 1DYKA 1KXGA 4DFSA 1ULPA 5FZCA 2XDVA 1NCQA 1B35B 4C90A 1EY2A 2DCTA 2D44A 3Q8BA 2EALA 2WWUA 3ILRA 3TEWA 1GLHA 2C5DA 3IZOA 1V6MA 4IEZA 5FPZA 5A1LA 3C8XA 1QXPA 3VHRA 3ACIA 4QKFA 1CPNA 4B4PA 4IEQA 1F2NA 3CJIA 5IVYA 1L7LA 1VBD2 1IOAA 2RM22 1LESA 1WD4A 2HLEA 2VD7A 2DUPA 4IGOA 5BNNA 1KFUL 4IE7A 5FPXA 3PHMA 3I2OA 1HKDA 4Y20A 2J1SA 2X5IA 3K4DA 1N1TA 1DLLA 2PLV1 3O1UA 1LOEA 1NY71 1J3PA 1W2UA 2R0HA 2VZSA 3ATGA 3GF6A 4PDWC 2JXAA 3U14A 3V56A 4JQTA 3VD7A 2YV8A 3AVRA 3HT2A 3KWVA 3NAPA 3PMSA 3SCGA 1C8NA 5J1XA 2OA2A 4QQLA 5JXGA 2WAAA 3HT1A 3GGLA 5T5OA 5A6YA 1JYNA 3U0ZA 2ZGQA 1GYKA 1R64A 1I9RA 4A2UA 5FZIA 4WM7C 4RYDA 5BV6A 3NMBA 1S2BA 1CVNA 3OPZA 1IPKA 2IXHA 2LS6A 1NKGA 5DAQA 1NCRC 1XSRA 2XLAA 3N7LA 1PNGA 4AQSA 1IS5A 1S0IA 2VW1A 1COV1 2A1XA 4E8CA 3ZR5A 1QGLA 1QHDA 1QJX2 4P9LA 5A70A 4Z2AA 5C8WA 2WJSA 4FQ4A 2RR12 5JOXA 4AQTA 1JZ7A 2XH6A 3AMPA 1XNAA 3H7JA 4UF0B 1DLCA 2NZ9A 3OPWA 1AXYA 3ZDSA 1ZZ6A 3B02A 2ZGTA 3UKVA 5DDJ3 2WKKA 3H8XA 4QB6A 2E7QA 1HX6A 1V6IA 2DVGA 1JW6A 3OD4A 5T55A 1PZ9A 2B4KA 3HVDA 4PIXA 1IQAA 3A23A 3BPSA 1PGW1 1PZ8A 5DAXA 3ZFEB 4AHYA 3OOXA 4DPNA 4WVVA 2W1QA 1H4GA 3POSA 5DN2A 4RN5A 1JUIA 2MHFA 5FYYA 2BW8A 1GQGA 2C6SA 2DYCA 2VAUA 2VXRA 3ILNA 4G3YC 1N47A 4NMIA 3VHNA 4E8DA 1UOJA 1W6NB 5D8AB 3ZOIA 5IHRA 2ZBJA 3D0JA 4ZXEA 2P4EA 4YPJA 2JJ6A 5EWSA 2MEV1 3I2IA 1UZZA 5FYSA 3U4XA 1VBB1 1X7NA 4L9BA 4AVTA 1K12A 4B8EA 4YVSB 4BOWA 4ISQA 3NKGA 5JR7B 3TYJA 2TUNA 1YQ6A 4FPEA 1I5PA 2ZGOA 5CFCA 4GH4B 4XJWA 3LEKA 1W6OA 5EHDA 2X05A 5BNPC 3POBA 3AK0A 4JKKA 1AL22 1SACA 1BKZA 1CD3G 4Q8KA 2DFBA 4CZSA 4Z1VA 3H3UA 3RYPA 4MGTA 2E53A 3ALQA 5EYYA 1AR92 2QQUA 4CDQA 1JN2P 2WS92 3VBUA 3O5SA 3VD4A 5GLUA 1RUF2 3MPBA 1O8PA 4XVHA 4BPZA 1VP6A 2QNKA 4Y5TA 2R042 1RC6A 4OHZA 1JYXA 1ASJ3 1WWYA 1Z78A 4AEDB 2ZZJA 1FPN3 4XBNA 4QXBA 5ABJA 5JSPA 3T30A 5LA1A 2YBPA 2IXKA 4FP2A 5DZEA 1GOHA 4IGQA 3MW2A 4P9GA 1W99A 4JZRA 1ZREA 3RJRA 2VZVA 1RUE2 2BPA2 2XBO2 1J83A 2VZUA 4A44A 3USUA 2OUHA 3B9IA 5D2AA 5EQUA 3LEMA 4CCJA 4YZ2A 3H1WA 3LFMA 5KWRA 1ND2C 5I8YA 1EV11 3WHUA 3AVSA 4JCKA 1G8WA 1NUKA 4GMP0 2ZX0A 3KHBA 4RFT0 4Z07A 1CIYA 1VRH1 5LB6A 4AEJA 4BIFA 1VRH2 4OFGA 3AZZA 4TWTA 1COV2 4CDUA 3WF1A 3Q8EA 2ATFA 5SV5A 2R061 3B93A 4TN7A 2QQIA 1NLQA 1KQRA 2R16A 2YBKA 3DL3A 4KWUA 5CU1A 2IWGB 2QQMA 3EXUA 1QJZA 1ULDA 1O3RA 3AXDA 1JHJA 3VBFA 3KGZA 3WG1A 1GOGA 2P3KA 1VBA3 2PHFA 3FN9A 3ZXFA 4B7KA 1W6QA 1JZ8A 3RYKA 1SLBA 4GH4A 2RMU1 3CZUA 2E33A 4N8MA 1XU2A 4QKBA 5DDJ2 4LK6A 3B7MA 3ZXDA 3OBZA 1OA2A 3WW1A 2HEYF 2ZGMA 3ME2A 1RMU2 5E6HA 3LE0A 5FYZA 2BERA 3RRDA 4LKEA 2A3XA 4NR1A 4CSWA 2V72A 1XU1A 1SFPA 3OBAA 3AC0A 3JD72 5CFCB 4XILA 1K5MA 5K0UA 5A6XA 4IE6A 5DMYA 3Q8CA 1XSQA 4MGZE 3MZHA 5KXCA 1FAYA 2PMWB 1TME3 1LOGA 4N43B 4YM3A 4JGZC 2A7AA 4E2GA 4CP0A 2V5DA 3T1LA 5JPMB 2VO5A 3RI8A 4UBHA 3ACGA 3BALA 1H8TC 1NQDA 1J1LA 2GDFA 1AZDA 4QU1A 4IEXA 1NAEA 4ARYA 2Z42A 2ZS6B 1ENXA 3HPNA 3OGSA 2PLV3 2IC1A 2OYZA 1H1MA 3KV5A 1UKGA 1NCQB 2QUOA 2PTMA 3TEYA 3ETQA 5L73A 2QBXA 5IVVA 2CGNA 2CAVA 2YFZA 3POYA 1HRI2 5LCWL 2VUAA 2EXIA 1ZZ8A 2DTWA 3GYDA 4FPYA 1H2MA 3C7GA 1DG6A 5FOBB 1RUH1 3NJZA 1O4TA 1W9SA 2UU8A 2HWE3 3WNOA 2WNOA 5E8AA 1NLRA 2Q0AA 1LHUA 2BVVA 3WP3A 1SEFA 2EIEA 1W0NA 2JDMA 5JIAA 3WVJA 4CCKA 4FOYA 1YO8A 3VKFC 2HWF3 4KBBA 5C7GA 2WS93 3ZMOA 3D8CA 3OUJA 2WLPA 5FZOB 2AYHA 1V6KA 1OA4A 4AGVA 4JHZA 2XBO1 1XQNA 4GD4A 4QDQA 3LQCA 4QHOA 5DPNA 1KITA 5GLVA 3W59A 4EZ4A 4Y5Z0 2ZKNA 2B9UA 3GJAA 4RS5C 1WLWA 2ETEA 5FYCA 2X53S 1IG0A 3ZDVA 1XBFA 2XUMA 1O5UA 2VMIA 1VAKA 2W91A 2A3WA 3VBSA 2W1SA 1WCSA 1VBC2 1LTEA 3LZZA 1LNSA 2RHPA 3NW4A 1VE0A 3HQUA 3OBRA 4L92A 4AEDC 4EN0A 1NXD1 4NRQA 4DUVA 3VGIA 4MV2A 4YG0A 1JUHA 2KXLA 4J1WA 5FZBA 2IXIA 4QX7A 4W4ZA 2NQYA 2IUWA 5C3SA 4XZPA 3LSDA 5FOJB 1RUOA 1QNWA 3CO2A 2YXSA 1AR91 2ZX4A 3IN9A 3DXUA 4LOTA 4CEYC 3BUCA 1OURA 2HH9A 4LLOA 3SH3A 4MXVA 4P08A 4YFWA 4AG4A 2DTYA 5FUNA 4X8PA 5LRRA 3WDXA 4NRPA 5KHIA 3LIGA 4Z2WA 3TRSB 4QX0A 3OY8B 2W5FA 3NRUA 1PK6B 1UY3A 4UFIA 3WQ1A 1A8MA 2ET1A 3NV4A 4JKLA 5HI0A 4Q29A 2LALA 4XFIA 1D4M1 4IV1B 1JZ2A 4NE9A 3AB0A 1KJRA 4XFCA 2FCVA 3R05A 4COYA 5C4WC 3J7LA 3NWKA 4I3PA 4GMP1 1PGSA 1AR81 4QXCA 5A80A 4CCEA 2JDYA 1YQCA 1A34A 1TZOA 2JG9B 5T5LA 2P3JA 1GU3A 5FZ7A 4I09A 1OPMA 1NE4A 4LMFA 3RZMA 2YROA 2VTFA 2BNOA 4FBFA 4QQ2A 5GLWA 1HV0A 1C1FA 1KGYA 1R1A1 3JXSA 2PHTA 1G9AA 2Y6FA 3URFA 1T2XA 2FQPA 4OZXA 1UYPA 3OUIA 1UD1A 1V9U3 1FMD2 3ABZA 3BTXA 1FMD1 4QXKA 1AUYA 2WAOA 3OBTA 1VRH3 1OMIA 3U1XA 2FDFA 1MVQA 4NHYA 2XQXA 4KGQA 2EVXA 4YG3A 3WP5A 4BWOA 5GJ6A 2EXHA 4YW1A 3M4FA 4MVTA 4N53A 4PHZA 2O14A 1PM4A 5GZGA 4SLIA 2CV6A 5FYHA 3ZYRA 1ENQA 2C1FA 3JD71 4IEOA 3KMHA 5KHHA 4BQYA 4A6SA 1LHVA 2O8QA 5F3CA 2XVLA 1TNFA 4EZHA 4AFDA 3DPRA 4JGYC 2VZPA 3H3LA 2XLGA 2XXZA 3M2MA 3WUDA 5EP9A 4D7TA 4PDWB 3AKQA 1CAXA 4R9CA 3ZXJA 2ORXA 5BNOA 1U0AA 5FZ4A 3VBHA 4CUCA 2VMFA 4JRAA 1ZNPA 1VALA 2HWC1 3IWZA 2HWB2 1UX7A 4ARXA 1CAWB 2OPKA 4R9BA 5HCBA 5FKBA 1HB4A 4MGQA 4XW3A 2WS91 1BEV1 1WA4A 2QZ3A 4P9WA 3WY6A 4M4RA 4XXPA 4H3WA 3T0BA 3K77A 1W0PA 1EPWA 3HOBA 3FFQA 5FR3A 2ZGUA 5FUIA 4ZU5A 2B45X 2YBSA 4MUVA 4ZXKA 1Y3TA 3N9PA 1W39A 2Q1ZB 4L8QA 2HWB3 3FLRA 3GCXA 1QQP3 4KI5M 2JWPA 3BKZA 2JICA 1RUE1 4EYUA 4CDUC 2PAEA 5F6LB 2A6VA 4X8NA 4MHRA 4MOAA 1GOFA 2RS32 2VW2A 2WQ8A 2YGMA 5JDBA 1ZYBA 1ODMA 1X9TA 4GIQA 4SBVA 3R4SA 1ZBA1 5DZFA 4YWAA 1UXXX 4CU7A 4CVUA 1JZ3A 2VZ3A 1HXS2 1BLZA 2YU1A 5AVAA 3VKNA 1R1A2 5FZHA 3HN3A 2WNUC 3BOPA 3NVCA 1R081 2D93A 1MPXA 4TTGA 1QY4A 5DQ0A 2CGOA 3NNFA 3ZN6B 4KU8A 1J1TA 2VE1A 3AL6A 2XUEA 4AHZA 1O3SA 2J7MA 1JYTA 5K8SA 2HBUA 5K0UC 1QH6A 2DCZA 2WQ4A 4NVPA 2RE9A 4YVWB 4CPBA 1ZZ7A 3H50A 4YZ1A 4AQ6A 4A7KA 3OSDA 3ZN5A 4O7XA 3ZXAC 1HQWA 2XVKA 2Y6HA 1W8NA 4Y4RA 2DCJA 1H8TB 1YWKA 3THDA 4A45A 5KC6A 3EO6A 4AEMA 4ORFA 4BJ0A 3S6PA 3WD5A 2W52A 4Y33A 3H3ZA 1J58A 2D6MA 1D4M2 4P5YA 4LNVA 1AX1A 1AR93 1R1A3 3BIEA 1W8UA 1UMIA 1FYUA 4JVAA 4WM8C 1CAVA 4AW7A 3CDZB 3AJYA 1GQHA 1UZWA 5F37A 1WW4A 5DUWA 1HRV2 3USUB 3LOBA 4FPOB 4XTPA 1G9BA 4OI0A 4C91A 3DPRB 1KFXL 4HN0A 3WX5A 1RVF3 4JTOA 1AXKA 5L7OC 3VZLA 2P3YA 2XHNA 1MS3A 1CZSA 1D0GA 4Y20B 5A33A 1V6NA 2YYOA 1GNYA 3N7KA 2RDNA 4K1YA 1IKQA 4N53B 4NN0A 5CG9A 3JBG1 3A4UA 2Q8EA 4QX1A 2BVBA 4Q27A 2A6XA 3MGUA 2W08A 3WNMA 4RS5A 2Y33A 5FZMA 1BK1A 4K8RB 5I0TA 3O1PA 4LORA 1MZ6A 1UWWA 3H1YA 2VVDA 2ZKLA 4ZU7A 1RL3A 4HVQA 1HQLA 1W9WA 2A75A 2K2SA 5C5UA 2Z5WA 1YFWA 1C5IA 3CEWA 1L7QA 5FZDA 4CDWC 5BNPB 3WDYA 3V0AA 3PTYA 3AYAA 3O1RA 5LA2A 4QPIB 3TEZA 5IVEA 2VXJA 5FP7A 3VBSB 1PVXA 1UW8A 3LD8A 5E88A 4PBOA 1PVC2 3OG2A 4RR3A 1HV1A 2A71A 2ARBA 1JOBA 4JGZB 1UMZA 5KXBA 3IT8A 3ZX7A 3WQ7A 2Y60A 2C26A 2J1RA 2Y6KA 2J22A 2D3PA 3FL7A 3KT7A 1H6YA 1QOOA 2VBPA 4FAGA 4KWLA 2D6LX 2AGSA 3SCFA 4K6BA 4BHPA 4AVBA 1WA6X 2HWB1 4CDUB 5GZFA 2YB7A 1GP4A 2A73B 2VOKA 1C8M1 2HWF2 5FXVA 2WZPP 5JMOA 3FUOA 4U2AA 2QKDA 1FXZA 3S0MA 4XAAA 4NPRA 4YM0A 1BEV2 4EWDA 3S5AA 1RUE3 1PZ7A 4FVVA 3HR9A 5B4NA 3UL2A 2DU1A 4AL9A 5APAA 4D7YA 1J3RA 3RJ2X 3MIGA 3W58A 4DOUA 5C5TA 1K3IA 1O8SA 4OUEA 2N7GA 4OLLA 5F39A 4AI0A 1JU3A 5FXZA 3TNPB 1ASJ2 2XJVA 1KDMA 4AVSA 2JDNA 3PUIA 5CVRA 5DZGA 1SPPB 3MW4A 2WL1A 2BGOA 1BEV3 2E7TA 2Z4FA 3VL8A 3J7MA 1OPOA 4WZCA 4Q4Y1 3GBFA 1SLCA 1MS8A 5A3UA 5K0UB 1PIV1 5F7UA 2ZEYA 1GP5A 4XTMA 2WIIB 3WINE 2UWAA 4PT6A 1U5ZA 4CEWA 3M3CA 1LOCA 1UQXA 2H6BA 4BQ2A 3KHCA 3A0KA 4UFHA 3IM0A 1AXZA 3WEZA 1W0OA 2BZDA 2NN8A 2V5YA 4PF1A 2VU9A 2ADEA 4Q0SA 1VMFA 4QPIA 1CN1A 1QQP1 1HB2A 1BQPA 1HDKA 1UOBA 1WBLA 1YUDA 2ZX3A 3EMRA 1K5MB 4LKFA 4XIOA 4YLZA 3BGAA 1AR61 4N9IA 4QPGC 3WF3A 5ISLA 2LUWA 4RA0A 4I02A 3ZO0B 1UYXA 1SBEA 1S2EA 2WC2A 3DYPA 2DV9A 2RG4A 3SLIA 3AP6A 2OS2A 3NKTA 5A32A 1OLQA 3AMNA 4YW4A 3ELNA 2EA7A 4KG8A 2WT2A 4B29A 3WP4A 5FPAA 2IVIB 2FDHA 2P37A 1F9KA 1ACCA 3ZXGA 1MZFA 4EN9B 2VVEA 3GXUA 1E5HA 4Q0QA 3G7DA 5IVCA 2P5BA 1ZA7A 3B94A 2GMPA 1SPPA 4PCRA 2R30A 2ZMLA 4NIAA 3T08A 4I0WB 4YZ3A 5JCTA 1A8DA 1J3QA 4IE4A 1LKNA 4AQ2A 4DNYA 5HCAA 5JR2A 1HQNA 3JBG3 3W21A 4BYYA 4XQ4A 2WA4A 3U78A 4AEKA 3PVEA 1RUI1 5A1AA 5FZKA 3D0SA 2R7EB 3NJYA 3PDQA 2P6CA 4N43A 4LO4B 3FHIB 3I3QA 5FY9A 5CZKA 4BQ4A 1W9YA 1JMUB 1DQ0A 3DYMA 4QMAA 3S7EA 3T4HB 3OF1A 4GWIA 1DGWX 2ZGRA 4YW5A 5FAXA 5FZ9A 3BI3A 4QM9A 1AL0G 1YC61 3UYJA 5ACA3 1NXMA 3A21A 3MO4A 2BNMA 4HMZA 4NHKA 4PJYA 5FLHA 4HVRA 1D7PM 2FDGA 2F4LA 2DWRA 4GJZA 2YC0A 2YZ4A 4KH9A 4C0BA 1K42A 1RXGA 4MO3M 4NWWA 2RS31 3OGGA 1S55A 2XHKA 5F5AA 1TMF1 2VTXJ 2G1MA 2Y26A 2GC2A 1FOD3 1I5ZA 1DYOA 1CAUB 2KA3A 4WV8A 3ZN6A 1QJY1 4DY3A 5J96B 3PUHA 5JOWA 3UNPA 4FPLA 5EYXA 2XR4A 5KHKA 4CCDA 4YGCA 1ENRA 2BFUS 2ILMA 1DZRA 1DGWA 5F1RA 4CU8A 1RUH3 1RGSA 3MUY1 5FWJA 1GFF2 5FP8A 1OQEA 3AL5A 4GB32 4CPBD 4Y1XA 5KBFA 3A0NA 5TSWA 5A33B 3O0XA 2J42A 5F3EA 2XJTA 1RUC3 2QQNA 4KWKA 3RYRA 2AUYA 2HWF1 4NIIA 1XJAA 3LDKA 1UPIA 3GNEA 1REDA 2QE3A 1RINA 4Q4V1 1QJX3 1EAH2 2E31A 1PIV3 2WDBA 4F7ZA 3VBUB 3F2ZA 2GNMA 3CQOA 1S0JA 4P9IA 5LA9A 5F5QA 4QX3A 2ZX2A 1QF3A 3T3YA 5C9AB 3AMHA 4IL7A 4AHWA 5L9RA 1ZZBA 3WG4A 4UW3A 3WQ0A 3UJQA 2AZ5A 3E97A 4QXHA 2GMMA 5IK7A 1ZVFA 4D69A 1BHGA 1UNBA 1WCQA 4YARA 3RZLA 4XZUG 2WUHA 3DEMA 4OI2A 5JVVA 4LHNA 2QQPA 1PHMA 1X33A 2EIGA 3RPQA 2X8KA 3CJIC 1N3QA 2B46X 3N36A 3AKSA 3WDVA 5FTTC 1Z7S2 4EQVA 1X36A 4OI4A 5FQ0B 3WOGA 4HK8A 4GXLA 1HRI3 4Q4Y3 4BZ4A 3LA7A 2JDKA 4MGYE 4QDRA 2X5IC 4RHV3 1UY2A 1VLNA 2K46A 1SDDB 3ZFEA 4S2GA 1FV2A 4ITCA 2FMDA 5FMDA 1BYHA 3KV4A 1ALYA 1MS5A 5IWFA 1LOBA 3SXWA 4XJ9A 4TLFA 3PLQA 3ZKYA 4V2VA 4I3GA 4FI9A 2XG3A 4NOTA 1AJOA 1W05A 4IV3A 4XURA 4YM2A 3WDWA 4RGKA 1JZ4A 4OQ8A 4YVWC 2Y38A 5JIUA 5JSOA 3POWA 4EJRA 4NJ4A 3O1MA 4GMP3 4NIDA 1AJKA 2WFF1 4JV4A 1KD7A 3J26N 3HNMA 4DXZA 1ZRCA 3WCSA 1LENA 4CXYA 3IDBB 2WFPA 4HL0A 3WF2A 2ZJCA 4A7ZA 1TME2 3HIFA 4P14A 3AMQA 3FWEA 3DV8A 2K0GA 4IEUA 3FFZA 1MZ5A 1DHKB 1RIRA 2BV4A 3NNJA 1RHI2 2RS12 4U36A 5ERLA 4RGGA 4AWDA 2WO7A 5E16A 1E5IA 1LOFC 2BDRA 3I49A 3QH6A 4GKXA 4NIHA 1OFNA 5IJRA 1KJLA 3CIHA 2KR2A 1W2AX 1AVBA 3LKJA 4YM1A 3UT0A 2X09A 3KQRA 1FNYA 5DAPA 3FC0A 5FPLA 2GN3A 1Q56A 1WCKA 2GNDA 3VN4A 5C9AC 1UXZA 5I8SA 5C3QA 1EUUA 5J7MA 2VNRA 5F2WA 2W68A 1QU0A 3ZR6A 4K21A 5CFDB 5IVFA 5HCHA 4AFBA 3BOWA 3SQOA 5I8TA 5A3PA 1FOD1 2BOIA 1FOD2 5F6KA 3WNPA 3MICA 4Y22A 2VCBA 3JQXA 4QPIC 3ACFA 4LBQB 2QJVA 2A6ZA 2Y0IA 3IKWA 1ZA4A 4MXWA 3SCHA 4R52A 2JD4A 3VD9A 2VR4A
chains in the Genus database with same CATH topology
4XFHA 1GBGA 2DCKA 4Y1ZA 3RQ0A 5ACA1 4FSJA 4XETA 1XNDA 2C9AA 1MS9A 1WUVA 3EQEA 1RUC1 3ZYJB 2JE7A 3PVBB 3OJBA 1ZBE2 4S2FA 3EBRA 2XGXA 1D2QA 5I91A 4GA9A 1UU4A 1VB4A 1QJX1 1V6JA 4GALA 4FO9A 1UIJA 1TMF3 3WP6A 4LHLA 1O3TA 4FAHA 1FX5A 2QZ2A 2QFEA 1C5HA 1D2SA 3B3QE 3D4KA 2ZGLA 3U11A 2PFWA 1OOPC 4Z82A 2E6VA 4AYUA 3FBYA 4WVZA 5J48A 4YSFA 3X29B 1ND2A 1HW5A 1EAH3 2UYAA 2ERFA 2GSYA 4JDMA 5B2GB 3VBHB 1VIWB 1ZBA3 5F9TA 2R1BA 4DS0A 4IV3B 4PLMA 2HEVF 3WDUA 1OI6A 2TBVA 4D7SA 1U5XA 4LHKA 2QDRA 1GNHA 4RHV1 3I59B 3E5XA 3WLUA 1MS0A 1SDWA 1AX2A 2QCSB 1WW5A 4H55A 2BUKA 4XF0A 2B39A 2GAUA 2P17A 4HVOA 4WM7A 3VBOA 3VBRA 2B42B 1PO13 4FPHA 2FZ2A 4FTSA 2ZGPA 3MF9A 1BBT2 4COVA 1NA1B 1DU3D 3FX3A 2ZHNA 3GHNA 4RR3B 1RITA 3ZXKA 1KS4A 1WD3A 1SLAA 1JOJA 2ZMNA 2HKXA 4B4QA 4LULA 4Q0VA 1NY72 2ZAAA 5BY5A 1PMIA 2Q5TA 3O12A 5JMCA 1RJ8A 4QQOA 3H1MA 5HCFA 1RMU3 2VG9A 1YJKA 3H8UA 4K9SA 2XJSA 1JH5A 2BNNA 2R6QA 4K20A 4AF9A 2WFF2 4LTAA 1QH7A 1QJY2 1RVF1 4L97A 4UW4A 3AKPA 1A78A 1LEDA 4ONUA 4COZA 1OLRA 1L3JA 1LHOA 3NSTA 1LHWA 1SBDA 4W6WA 3QH7A 2G9FA 2RS52 1PGL1 1DQ1A 5JLVA 3BB6A 4EV0A 2P2KA 4NHMA 4LBLA 3WDTA 4HZFA 1CGPA 2D6KA 5KXDA 1R1ZA 3ZYIB 4FTEA 2RM21 3SMHA 2ZHLA 3VBUC 2GC0A 4AVAA 3ZFFC 2R32A 3FUQA 5IK4A 4BH9A 1CIWA 1WMDA 1GNZA 3K51A 2VNOA 1YNAA 5LK5A 2FBEA 3RMXA 1GZCA 1YJLA 4PIYA 5H9QA 4EWEA 4F3JA 3P3PA 3DF0A 4MGKE 1V6LA 2VPVA 5FRAA 3U07A 3ZFEC 1W6NA 5D8AA 3APBA 3VKMA 4A3XA 4FTBA 4PIZA 4OUSA 4FPCA 1C8M3 3LCPA 1WW6A 2A6WA 1IS3A 3JZVA 4HKLA 4XOGA 5T50A 2ES3A 2IXCA 3ZSEA 2VOXA 1G86A 3CLPA 3AX4A 5H9PA 4COWA 1N1YA 1ULGA 3VBFC 2DVFA 3M8LA 2D3SA 2WZR1 4YGBA 4O9GA 2WT0A 1Q5OA 4CP1A 1MEC2 3O14A 3VBSC 3ZIXA 2XBO3 4GWNA 2Z2SB 1RUG3 5LEJA 1S0GA 1O91A 3CJXA 4XBQA 3ZFGA 1APNA 4D3WA 3RWNA 1FPN2 2WSVA 1K5MC 4CDXA 1NQJA 1D0HA 1URXA 3BIWE 2XWJB 4XMAA 5FLIA 4AGGA 2BGCA 4JGZA 2MEV2 2GH2A 1Y7BA 4EN6B 4PLNA 1AR63 1VBB2 3AFGA 1MVEA 4QD2A 4XYXA 4CDQB 5ABJB 1RUD1 3WV6A 1EP0A 1Q3EA 3CL1A 1H8TA 4O9EA 3SH5A 5BUVA 3N4MA 1YHFA 3B9CA 4QU2A 2OIIA 2RMU2 4IXLA 4WM8B 2H6CA 3Q9OA 3WXPA 3M1HA 1YI7A 4HKOA 1JHNA 4JTNA 2WWSA 1NE6A 1BBT3 5IK5A 4UBGA 1B09A 3WR0A 5CFDC 1DQ5A 4Y1YA 5IUQA 2D6PA 1EYBA 1SFYA 3MEPA 1ND3C 3MF6A 1Q8OA 2A5ZA 2D97A 2GU9A 1JXNA 1PO11 2ET7A 3BPZA 3VBOB 1OD5A 5BNNB 4KNCA 1OFSA 3VZOA 3ZXLA 4Y1UA 2NYYA 4BIOA 1TE1B 5C33A 3TAYA 4XJZA 1RUI3 4S2HA 1CQ9A 3U10A 4YVSC 1RVF2 3LB9A 4XXAA 5I0UA 3R0RA 3N7JA 2JKBA 4LBKA 2D43A 1XYOA 3OTFA 4PBPA 4YZ5A 1OQDA 1V9U1 2RR11 4HSLA 4AEDA 1GICA 3W9AA 5A3MA 2ENRA 1XRUA 2GNTA 4E27A 4Y1VA 2PQQA 1OSGA 2WINB 4BQ1A 1H4HA 1WLDA 3DPRC 3L9JT 3PJQA 4JGYA 3QLQA 1KS5A 5K7PA 3GZUC 1WCDJ 1PO21 3VDDA 1NG0A 4FOQA 1PO22 5BNOC 1RB8G 2XLFA 2VW0A 4OHYA 1H2NA 2BYVE 1LEMA 5CAZA 4BLJA 2LM3A 1W6PA 2YPJA 2EXKA 2VMGA 3IBMA 3VBOC 1UZYA 4Q0UA 4KU7A 1Z0HA 1VBD3 3MYXA 4RD7A 4HKWA 2VNGA 3KSCA 3AMMA 4LBQA 2F6BA 4MXWB 5I0RA 4N7IA 5JOZA 4WM7B 2AREA 2Z69A 3MIBA 2IFRA 4YG6A 2A70A 4WVWA 3CNAA 4UXAA 3O0WA 1FNZA 4DINB 3HAGA 1RUH2 1RUF3 3ZPYA 2XJQA 4I2OA 2R041 3VHOA 2XVGA 2R1DA 4TYSA 3I2DA 3SITA 2CNAA 3KCYA 1XNCA 4XHBA 2BWCA 2E51A 3K48A 5JZGC 4N53C 1DGRN 2DUOA 1QJU3 4BE3A 4N90A 1JBCA 2YMZA 2GMEA 4L2NA 3MLKA 3VZMA 4Y4YA 2ZGSA 1MQTC 1N1VA 3E6DA 3R6SA 3ROUA 3PNAA 3E6CC 2HJIA 4YRDA 3GBGA 2XL7A 5D1IA 3ZFFA 4LR4A 2G4IA 1Y43B 1UAIA 2DVAA 4CDWA 1SLIA 1S0BA 4YNIA 1PGW2 1QDOA 4XJUA 1RUG2 2RJKA 1UF2C 3AZYA 4Y22B 2I2SA 2ZACA 3ZFFB 2WFF3 1YXWA 3I7DA 5C4WB 4DRVA 3AXEA 1QXJA 2PLV2 4RR3C 4LLFA 5H9RA 3LWCA 3ES1A 1S0DA 3M3QA 2C0ZA 5FO7B 1WGPA 4XE9A 3ZVXA 4E4DX 4EN8B 1CAVB 1IHMA 3H9AA 4AHXA 2V09A 2AH2A 2IZWA 3UKNA 1ONAA 3MIFA 4E4SA 1WLTA 4C1XA 1XE8A 3RS6A 1YIPA 4ZU4A 4HLTA 1V6OA 3UK9A 1H2KA 2EF6A 2BWAA 2WNVA 3IPVA 4DQAA 3LOIA 2WNEA 1DZTA 2WNUA 4YFZA 2NP0A 3D6EA 2IXLA 3SNMA 1MR5A 5GZDA 3OYWA 3LGRA 1Y9QA 5BNQA 4X6QB 4PDWA 4KL1A 2JE9A 3NAPC 4IV1A 3QOPA 2GN7A 5DUXA 4CDXC 1J59A 5CA6A 3OY8A 4QGLA 3LSEA 4ATEA 4MYEA 3RI9A 3ZSLA 2RR13 4LEJA 1DQ2A 1GV9A 2W0XA 2XJPA 3S30A 3QD6A 4QHBA 4ATFA 4KGGA 4CDWB 2ZX1A 1YLLA 1AYM3 4TSVA 5KC5A 5AC91 2JG8C 3PJYA 3MIHA 1CR7A 1HLCA 2NMOA 4IESA 5K9YA 4N9HA 1SQ4A 3VL9A 5BXXA 1Q8VA 1B35A 4M00A 2R043 2XL9A 3USSA 1O5LA 1MS4A 2O0OA 1ND3A 1C4RA 4QGMA 5J37A 1AL21 3I54A 1JYCA 2ZCWA 4JGYB 2DUQA 2QVSB 1VBD1 3OYWB 4LO8A 2E7AA 3SISA 2D5HA 4EROA 1BJQA 2GC3A 1WBFA 3FLPA 1NYWA 4URTA 1UU5A 4NWVA 3V65A 5AFEA 4X6RB 3HBZA 1G9CA 5EJ3A 1VR3A 3AZWA 4P5HA 4AGRA 4D94A 3RG0A 3ZFGB 2D7FA 2CGPA 1M4WA 2JEMA 2RJLA 4H7LA 2PN5A 5EZWA 1REFA 1H1IA 1VAVA 4BMEA 3C2UA 5KHGA 2YGLA 4M01A 4XEZA 2ZGNA 5C8CA 2G9GA 2YUEA 4DMIA 2BBVA 1SMVA 2XKOA 1QJU1 2JENA 1G9FA 3HWJA 1H9PA 1WLCA 5ABJC 2LTNA 2VUJA 5CIRA 2MNGA 5DDJ1 2DU0A 1OHFA 1MS1A 1VBC3 2O8OA 1RMU1 3TNQA 1ND3B 4YGEA 4AVVA 1SCSA 3LA3A 1AR71 2PHWA 4XBLA 1AR72 5J98B 3GBWA 3VDDB 4OVEA 4Q4W3 4LA3A 2R49A 3WNXA 1RJ7A 2D6NA 2PHUA 2X5IB 2AR6A 4CP2A 4G4FA 1F5FA 1PVC1 2UY8A 4YGDA 5T52A 4IEPA 2VH9A 3NV1A 1YFYA 5C6CA 2FMYA 4LBQD 2UYBA 1LODA 5J3UA 3VBFB 1C1LA 3BODA 2UURA 3KT1A 4AE2A 4E2QA 5IT6A 1S0CA 4ES9A 4XIKA 3MIEA 1QOSA 2P3IA 5FBZA 3VKOA 3QCWA 3SH4A 2E63A 1RTVA 4ZKTB 3H0OA 3NO8A 4A7YA 3R4DB 4LA2A 4P9JA 1CJDA 1EPZA 5JZGA 5E89A 3VZNA 1ASJ1 1NOVA 3V0BB 1TEIA 3MW3A 1AYN2 1LR5A 4QT6A 3WCRA 4CDQC 1AYN1 2VOVA 3DKWA 4AK3A 1VJ2A 4AFAA 4XFAA 3J8F3 1N3PA 5CG8A 1I6XA 4R4ZA 3MPPG 4IETA 4DB5A 4BM8A 1AR82 3BU7A 2Y0OA 1EV13 1ZBA2 2FHRA 4Q0PA 4BMBA 5L7OB 1HXS1 1S1AA 2E9QA 1AL23 1QQP2 2PHLA 2H0VA 2R062 3O7OA 4E2SA 1RHI3 2RS13 1BVVA 4PLOA 1DIWA 4J6GA 3M70A 3C3VA 3L2HA 4Q4W2 1I3HA 1QJU2 4W65A 4I0AA 3VKLA 1M06G 2WZR3 4FT8A 3AP7A 5CADA 1GKBA 4FOVA 4K1ZA 1YIFA 2JDZA 4BCUA 4N43C 4LE3A 3OCPA 5AC93 1RUG1 1QKQA 1IS4A 3R4UA 1LGNA 1SLLA 5JI7A 3O0VA 4GH4C 2BEOA 4IEWA 2A3YA 4QQHA 1HRV3 1UPSA 4GQ7A 4ASMB 5KXEA 1S0FA 3PMEA 3QACA 1H8VA 2OZJA 4JDOA 1AHSA 2ZABA 3KS7A 4Q4X1 3MIDA 4DY5A 3CU7A 1XNBA 4Q4X2 4XJAA 5FDBA 5GZCA 1V70A 4Q4Y2 2WNVC 1FI2A 2O1QA 3ZYGA 4LO5B 4G9SB 2PHRA 4IQPA 4KQ7A 5GALA 3ECQA 5BPXA 4OHWA 2GC1A 4XHXA 1O4ZA 5L36A 4AXOA 2CY6A 2Q1MA 3RNSA 3ST7A 4CEYA 1HRI1 4HSJA 4RQPA 1QDCA 3AP9A 3J8F2 3HD8B 3HMYA 3I8TA 3NAPB 4XPVA 3WW3A 1FATA 1ULEA 4KWJA 4FOWA 4IV3C 4YW2A 5GLTA 1ZRFA 1AR73 3AJZA 3JBG2 1GZ9A 1CPMA 1H2LA 1R092 1ZZ9A 1R091 2HWE1 2HWE2 1PVC3 2IXJA 4IEYA 4DRRA 4FPKA 4INDA 2GALA 2ZOEB 5BYNA 5C8CB 5LRSA 1GZWB 4AVCA 2VY0A 1NA1A 1QNYA 3ZSMA 1B35C 1UU6A 4CYDA 4R9AA 3MDPA 5I93A 2I74A 1VBC1 1XE7A 2ZGKA 4XFGA 1YFXA 3KB5A 5AC92 3J9SA 1XXNA 4Q4W1 4Q8LA 3GHMA 4WZFA 2HWC2 3RDIA 2TEPA 2VVFA 2VECA 2BQPA 1C8M2 4QPGB 3NV3A 4QQPA 1ULFA 3ILFA 1RUNA 3AFKA 1W6MA 1W6MB 4DZGA 2A6YA 1PO23 2XWBB 3IPVB 4XJ8A 4GULA 1U12A 3WUCA 1LULA 1POV0 3VV1A 3H7YA 1U5YA 3I4IA 3INAA 1WMEA 1DGRA 2WSUA 4XQDA 5T54A 5EFUA 2XPJA 3THTA 4Q26A 1ZBE3 3NL1A 3VBHC 2GH8A 4HT1T 1UCXA 2H0BA 2NM1A 2VGDA 3BTAA 4V1PA 3IDCB 3MFAA 4YVWA 2ZHMA 3G6JB 1UL9A 4OI1A 5C8CC 4TZDA 2ZTNA 1AYN3 4N7UA 4QX5A 3ZN4A 4C0HA 3J8F1 5C4WA 4P9YA 1OOPA 1VB2A 3KD4A 3TOJA 3ZMNA 2ZA9A 1SFNA 2CYFA 3TB0A 4AFCA 1LGBA 1F5JA 1SLTA 2OZ6A 1FMD3 1IGOA 1HXS3 3B01A 2B7YA 1DGLA 1Z7S3 3ZSJA 3DUIA 4PQ9A 2XKPA 2I07B 1YI9A 4FPJA 2UWBA 4R9DA 2K9ZA 5C9AA 3AKRA 1EAH1 4H14A 1VBE1 1C28A 4COUA 4RQPB 1U5IA 1X8EA 2WNVB 4CEYB 5A3LA 2IFWA 1BXHA 1UX6A 4M3CB 1WW7A 1X8MA 1ENSA 1QMJA 2PAKA 4H7MA 5E1RA 4J1XA 5BNOB 1CAXB 1GR3A 4M3CA 3MFCA 4MGIE 4AI1A 1CJPA 1HRV1 3AP5A 2FZ1A 4B4RA 2PHDA 2PYTA 3MLJA 2HWC3 1RUI2 3EJKA 2DFCA 3M3IA 3PVNA 3WW2A 4Q4X3 1MACA 2DVBA 5KHJA 4Q1RA 4I30A 2ZMKA 1S0EA 3RSJA 1G6NA 4XQWA 2HEWF 4BLIA 2DVDA 5GZEA 4Y26A 1AX0A 4ES8A 3UJOA 2JG8B 5A32B 5LEKA 5JWPA 3LA2A 1DQ6A 1ULCA 4MSVA 2W39A 2HWD1 2CWMA 2D3RA 3TN91 3KGLA 1GSLA 4CRQA 3KT4A 1H30A 2RS53 1ZM1A 4OUMA 5L7OA 5FQ0A 1PM7A 3B00A 4RGAA 4W6XA 1TNRA 5FMOS 1LJ7A 3JCIA 1R082 1VBB3 1UKRA 1AR62 1O4YA 1C57A 5J09A 1UN1A 4LT5A 2B8MA 2PAMA 4XDQA 4AI3A 1CONA 5DG1A 4QM8A 5AFBA 3V64A 4K3UA 2I45A 2Z79A 1MQTB 2VQAA 3VBRC 3WW4A 1PK6A 1YYNA 3M7AA 5FCCA 4B3NA 3OGJA 3ZFGC 2RM23 4LUKA 2JG9C 1VBE2 1OA3A 2R072 1DBNA 5FMOL 3WT3A 1CESA 5I0SA 2UY9A 3J4UH 3L2YA 4YW3A 3N35A 1SCRA 1LU2A 4HETA 4F83A 2WQZC 2SLIA 3AZVA 1DFQA 2CL2A 3ZSKA 3E5QA 3JUUA 4RQPC 2YDEA 4HPKA 1N1SA 2OVUA 4W6YA 2Q30A 4PF5A 2R073 4AFMA 4Q1PA 4Z92B 4MH0E 2X29A 1Q8PA 2NMNA 3TBDA 2B5HA 1Z7S1 1CAUA 4I0BA 1ZBE1 4WM8A 5CFDA 5SV8A 3M3EA 3OD0A 2CTVA 1NLSA 1W6PB 4M0NA 5DUUA 1VBA1 2PHXA 3IMNA 2ARXA 1VBA2 4FXKB 4JDNA 1XYPA 2RMU3 4R8HA 1I1EA 3RZZA 1NA1C 1W6QB 2EAAA 3LAGA 4FXGB 1POV3 4WVMA 4CDXB 1MEC1 3ZIWA 1G9DA 1IPJA 4QPYA 2HWD2 4EWAA 2WLQA 4RS5B 4OHVA 1DZQA 2VULA 2XJUA 3I59A 1QXRA 3N7MA 3V0BA 3KLSA 2QDNA 2GZWA 3AYCA 4LO6B 4XFBA 1TME1 3JB4C 4MLOA 1WMFA 1H9WA 1OQ1A 2ZHKA 4GKYA 4QPGA 2ZAHA 2XB6C 3KZ4C 4HN1A 1UIKA 1RUD3 5JOYA 1LU1A 1VBE3 2HYKA 4FQZA 4RHV2 4F8AA 1RUD2 1PGL2 1OKQA 4GB31 2KM2A 2UWCA 2GNBA 5T3NA 3WHTA 3HN1A 2P34A 5D8AC 3D82A 3CF6E 1KDKA 1LHNA 3T2TA 4UW5A 3JB8A 1BBT1 1NCQC 4Q4V2 3B69A 4NO4A 4C0BA 4K7JA 5JSRA 2PA7A 2V73A 4HK9A 5DXDA 3VZKA 4RSUA 1SBFA 1LCLA 2HWD3 3E6BA 4FPFA 1FV3A 3TN93 4E9KA 5FLJA 4XF4A 5J36A 1TQ5A 2JECA 1CX4A 3UV9A 3HQXA 3AYDA 3ES4A 4OHXA 4E4ZA 5BNNC 4P9XA 1RUJ3 4S2DA 4META 1X82A 1PIV2 3P3NA 3T1MA 3RMYA 4LBMA 3TN92 4AI2A 1TMF2 5ACA2 3V0AB 2CWSA 2OW4A 2VOWA 2ZPXA 4RL7A 1JYIA 3ENRA 1RUC2 4FPGA 1KRIA 5IK8A 2DCYA 2OUJA 4JRLA 4K40A 3VBRB 3WG3A 2NPIA 4CEWB 1N3OA 4NHLA 5JPNB 1DDLA 3IIAA 4M3CE 2D40A 4XFFA 2D5FA 5JZGB 1NCRA 2EAKA 2RS51 3NV2A 4LUMA 4C1WA 1A6CA 2VMHA 3FMGA 3VDDC 4ASLA 5EXOA 1HIXA 3MLLA 2MPFA 3EHKA 4Z8BA 1BVP1 1RUJ2 3AZXA 4FP3A 3JQWA 1XNKA 2D98A 1ND2B 4YYOA 1G7YA 2R071 5GLZA 4JQRA 2WNUB 2AENA 3AKTA 1MQTA 1D4M3 1W6OB 1O7FA 4CTEA 1RHI1 1IS6A 1T6GC 2RS11 3MI8A 1VAMA 5AVPA 4XF9A 1AR83 4MZUA 1BCXA 3PVOA 3B5LB 3S7IA 5FO8B 1BMV2 1PNFA 1BMV1 4CEWC 2SBAA 4YVSA 3QBQA 5HBAA 2WA3A 1POV1 2Q8OA 1LRHA 1MEC3 3KM5A 3AP4A 4L11A 2ZZQA 5CFCC 4L99A 2DURA 1RUF1 5BNPA 4EN7B 3GZAA 3IDEA 1GANA 1GZWA 5CBLA 1Q43A 4QGNA 4B7EA 4R4XA 1ZZCA 1MZEA 2WZR2 4HFSA 5H9SA 4ISRA 1DF0A 4OULA 2WT1A 3KCCA 1BZWA 3FBMA 3SHRA 1O3QA 5GKAC 2RS33 3JD73 4M0HA 4GB33 5HXVA 5CB7A 3BCWA 5L19A 1NZCA 4LO7A 2YHJA 2TNFA 1QJY3 2Q4SA 3DN7A 1YRZA 5JI9A 5DG2A 1PK6C 3TWIA 2JX9A 1IZ3A 4Y24A 3VZJA 2JG9A 3GALA 1R093 4JC1A 4AI8A 1AF9A 1REEA 2F4PA 2R0FA 5DUVA 4Q2FA 5FO9B 1DQ4A 5EV7A 3THPA 4JAAA 1COV3 1LB2A 1JTZX 1E57A 2MEV3 1RUJ1 1C3HA 4LE4A 3AYEA 4Q4V3 2CAUA 5JAXA 4XF3A 4XF1A 2BFUL 3FJSA 3N3HA 4K8FA 3VUOA 1FT9A 2XJRA 1OOPB 1DYPA 1PO12 2VQ0A 4MX3A 2JG8A 4KG0A 4LBNA 1LOFA 4I01A 1H0BA 1F31A 3CJIB 4WBBA 3VHPA 2NLRA 3E5UA 2D6OX 1IKPA 1V00A