2WS92

Equine rhinitis a virus at low ph
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
200
structure length
200
Chain Sequence
b'GTTYCYSKPDGRPPSTVSDPVTRLGPTLSRHYTFKVGEWPHSQSHGHAWICPLPSDKLKKMGSFHEVVKAHHLVKNGWDVVVQVNASFAHSGALCVAAVPEYEHTHEKALKWSELEEPAYTYQQLSVFPHQLLNLRTNSSVHLVMPYIGPGPTTNLTLHNPWTIVILILSELTGPGQTVPVTMSVAPIDAMVNGPLPNPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords P1
publication title Equine Rhinitis a Virus and its Low Ph Empty Particle: Clues Towards an Aphthovirus Entry Mechanism?
pubmed doi rcsb
molecule tags Virus
total genus 41
structure length 200
sequence length 200
ec nomenclature
pdb deposition date 2009-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2ws9201
2WFF3 1EAH1 1V9U2 2RS52 1VBE1 5AC93 1R083 4N43A 5C4WA 2RS32 4RHV1 1PGW1 3VBHC 1MEC2 2HWF1 4RQPA 2X5IC 1RUD3 5C8CA 1QJY3 2BFUL 4GH4A 4JGYB 4CDUA 1HRV2 1X33A 1EV11 4JGZC 1ND3C 1PGL1 1AR63 4GMP0 4IV3A 3TN92 1BBT1 1AL23 5FMOL 2BBVA 2RS11 2WS92 2WZR2 2HWE1 1RUJ3 2R072 4WM7B 1AR92 1PIV1 2WWSA 3ZFEB 4Q4W3 1HRI2 1ASJ1 1RUF3 2XBO1 4QPIB 2TBVA 2RR13 4YVWC 1TMF1 5BNNC 1RMU2 2R063 4NWVA 5BNOB 4AEDB 4N53B 1PO21 1QJX3 4Q4Y3 3VBFB 5BNPC 2HWD2 3VBSC 1C8NA 1VBC3 1VRH1 4Q4X1 5DDJ2 1ZBE1 1RHI2 3VBRC 4Q4V1 1PVC2 2WFF2 5FOJB 4CDXA 1NG0A 1CD3G 5AC92 1R082 1RUC1 1VBD1 5A32B 1BMV2 4EJRA 4QPGB 4JGYA 1VBB3 4FTSA 5K0UC 2RM21 4YVSB 2HWC3 1X36A 1R1A1 1RUD2 4CDWC 5ABJB 1QJY2 4WM7A 1AYN1 1H8TC 4RFT0 1EAH3 4GB31 1AR62 4QPIA 5D8AC 1VBE3 1FPN1 5CFDC 1AL22 4RHV3 5BNOA 1K5MB 4AEDA 4N53A 1FMD3 2RMU3 3VBUA 4Q4W2 3VBFA 1RUF2 3JD71 2HWF3 5C4WB 2R043 3CJIA 1VBA1 1POV1 2RR12 1BEV1 3FBMA 2R062 1Z7S1 1OOPA 1QJX2 4Q4Y2 2ZAHA 1EV13 1QQP3 5A32A 5L7OB 1VBC2 1BBT3 5ACA1 1ND2B 4YVSA 1PIV3 5C9AA 1ASJ3 5C8CC 2PLV3 5CFCC 1TMF3 1VBB2 4RR3B 1COV1 1D4M3 4Y4YA 4GMP1 1PO23 1NCRB 2HWC2 1NOVA 3VDDB 1AR83 1VRH3 1K5MA 1TME1 4Q4V3 1NY72 1NCQC 1EAH2 4CDQB 1VBE2 1QJU3 4CEWC 1VBD3 4RHV2 2MEV1 1FMD2 2RMU2 4CDXB 1HXS1 2HWF2 5L7OA 1AR71 2R042 4CEYC 3J8F1 1OHFA 1RB8G 2RS31 1ND2A 1AYN3 5J98B 3VBOA 1NA1C 1SMVA 1EV12 4GB33 1QQP2 1MEC1 2BUKA 4JGYC 2QQPA 1BBT2 4NWWA 4RR3A 3LOBA 4JGZB 4WM8C 1ND3B 1PIV2 1NCRA 1ASJ2 3VDDA 2PLV2 1POV3 2DF7A 1TMF2 3ZFEC 1D4M2 3VBUB 4RS5A 2VQ0A 1Z7S3 1MQTC 4CDQA 4QPIC 1PO22 1ZBA1 2WZR1 3CJIB 4YVWB 1QJZA 5BNNB 4PDWB 2FZ2A 4IV1C 1AR82 4AEDC 1VRH2 5LK7B 4N53C 5ACA3 1CJDA 1OOPB 3NAPB 4Q4V2 2ZZQA 3VBFC 1IHMA 3VBSB 2HWB3 1QJU2 1VBD2 1R093 1RUE1 5C9AB 1E57A 4GMP3 1RUI3 1WCDJ 4QPGC 2WFF1 1W39A 3JB4C 3ZFGC 4JGZA 1ND3A 1TME3 2BFUS 1AYN2 3ZFFC 1F8VA 4GB32 5ABJC 1RVF1 4Y5Z0 5FMOS 1RUD1 1RUH1 1AL0G 1QJY1 1B35C 5D8AB 4YVWA 4FTEA 5BNNA 5CFDB 2ZTNA 1HXS3 4PDWA 1AR73 1PO11 1K5MC 3J8F3 1AR61 3NAPA 5JZGB 1AL21 4N43C 1HQNA 5C4WC 1Z7S2 3DPRB 3VBSA 1RUJ1 1VB2A 3VBRA 1AYM1 2RS13 2HWE3 4RQPC 1HX6A 5ACA2 3JBG1 2GSYA 2RR11 3VBOB 5L7OC 3ZXAC 2XBO3 4GH4C 2HWB2 1RUG1 5K0UA 4CDUC 1R092 4IV3C 4CDWA 1ZBA3 1RUI2 5CFCB 4Q4X3 1ZBE3 4RR3C 1GFF2 3M8LA 4RS5B 1TME2 5A33B 5D8AA 1VBB1 2IZWA 3VDDC 5CFDA 1RUC3 1PGW2 1FOD1 1C8M1 2RM23 5JZGA 1NCQB 2MEV2 3DPRA 3JB8A 1V9U1 4CEWB 2RS51 1NY71 3VBHB 1R1A3 1M06G 1HXS2 1AR72 3J8F2 2X5IB 3IDEA 4CDXC 1PGL2 4CEYB 1FPN3 1FMD1 2RMU1 5GKAC 2RS12 2Y26A 2HWE2 2R041 1RVF3 1NA1B 1RUH3 1HRV1 3JD73 2XBO2 3S6PA 5CFCA 1VBA3 4WM7C 1PO13 1BEV3 3TN91 4WM8B 1QQP1 5A33A 2WS91 2R071 1AR91 1ZBA2 1HRI1 5BNOC 4Q4X2 1ZBE2 1AYM3 3VBUC 4FSJA 1NCQA 1A6CA 5BNPB 1MQTB 2PLV1 1RMU1 3JBG3 3CJIC 4CEWA 3VBHA 4PDWC 1D4M1 1RUC2 3VBRB 4IV1B 2HWD1 1OOPC 1RUG3 3NAPC 4Z92B 2X5IA 5DDJ1 1AUYA 1COV3 2RM22 1RHI1 1AR81 1RUE2 1PVC1 4CEYA 2BPA2 1VAKA 1R1A2 5K0UB 5AC91 1R081 4YVSC 1BMV1 5C9AC 1VB4A 2WLPA 1QJU1 1NA1A 4CDWB 1FPN2 1H8TB 3ZFGB 4WM8A 2MEV3 1FOD3 1C8M3 1RVF2 3ZFFB 2FZ1A 1RUH2 3JD72 1OPOA 1VBA2 1V9U3 2RS53 3ZFEA 1PO12 1BEV2 2RS33 5BNPA 1MQTA 1B35B 2XPJA 1MEC3 4IV1A 4Q4W1 1RUF1 1RUJ2 1AYM2 5JZGC 2GH8A 4N43B 3DPRC 2R061 3JBG2 1HRV3 1QJX1 4Q4Y1 4SBVA 1ND2C 4RQPB 1RUG2 1F2NA 1VBC1 3TN93 3VBOC 1COV2 5C8CB 2WS93 2WZR3 4QPGA 4GH4B 2R073 1AR93 4CDUB 1H8TA 3ZFGA 1HRI3 4BCUA 5J96B 4FTBA 4IV3B 2HWB1 1NCRC 3ZFFA 5ABJA 1R091 1RMU3 3HAGA 2HWC1 2HWD3 4RS5C 1FOD2 1RUI1 4CDQC 1RUE3 1B35A 1C8M2 5DDJ3 1DDLA 1RHI3 1POV0 4LLFA 1PVC3
chains in the Genus database with same CATH superfamily
4UAPA 1OQ1A 1G9BA 1V9U2 2RS52 2K46A 4GALA 1R083 3U11A 5C4WA 2RS32 5DPNA 2KXLA 1TVGA 2VOVA 1PGW1 2JKBA 3LEMA 3AFGA 1YXWA 2AH2A 4A7KA 4TYSA 1XNTA 1WMEA 5J48A 4OQ9A 2HWF1 5HXVA 2JDAA 2ZCWA 3IT8A 4Y20A 3WHTA 1VMJA 2WNUC 1JZ7A 1NZCA 1JMUB 4FQ4A 3SLIA 1STMA 4Z2AA 1B09A 1Q8PA 2MHFA 4WVWA 1HRV2 4XYXA 3FE5A 4XBQA 1UCXA 5DUUA 5I0RA 2WRAA 3WQBA 4LR4A 3ALQA 4GMP0 3TN92 1PNFA 5FO9B 3ILFA 4UI9L 3E6BA 4K6BA 5FPXA 2BBVA 4LKFA 5EIYB 3FUOA 2HWE1 2WZR2 4R9BA 4Y24A 3TEXA 5FK7A 2R072 4WM7B 1PIV1 2B7YA 2WWSA 5EJZB 3WF2A 1HRI2 1ASJ1 5FP8A 5LK5A 1IKPA 5C3OA 1WMXA 1FAYA 1NT0A 1VAVA 3KWVA 2NP0A 2UU8A 4QD2A 2VMIA 4W8JA 2WWJA 4KBZA 3WDVA 5I8TA 5BYNA 1I5ZA 4AEDB 3BN6A 1RC6A 2BGPA 1YQ5A 1PO21 2KD7A 1QJX3 1G8WA 1WGPA 2TEPA 4AHXA 1KXGA 1SLBA 1CZTA 4L99A 3H7JA 3VZMA 1SBFA 1VBC3 1WW7A 1VRH1 1XRUA 3KF5A 4Q4X1 5DDJ2 1ZA4A 1J3PA 3HN1A 4NN0A 4TLGA 1ULDA 1UZYA 2WUHA 3V64A 3O0WA 1UPIA 3AB0A 2K0GA 5CKQA 5JPMB 4XDPA 4LHNA 1JOPA 1PX3A 3GJAA 4JDMA 5F7UA 2J1AA 4XMIA 5CB7A 4LBKA 1BMV2 3A22A 4QPGB 3I2KA 2RHPA 4JGYA 2WNVB 1RINA 2YXSA 1SPPB 1LEMA 5IK8A 3QH7A 1J1TA 2J1UA 2CL2A 1QJEA 2VVDA 3O1PA 1SDWA 5DQ0A 4QHOA 2DTWA 1R1A1 4AQSA 3MLJA 2GH2A 3PNAA 5ABJB 5J7MA 4O65A 3M3IA 4EN7B 2P5BA 1H0BA 2JD9A 1PX4A 1AYN1 1YRZA 3E5XA 3GCXA 4WVZA 3NNGA 5FUPA 2WZ8A 4LBLA 4QB2A 1S2BA 4UBHA 2JIGA 4XUOA 3JXSA 5T5PA 1WCQA 4QPIA 1OLMA 1XYPA 3VKNA 2P3YA 3NNJA 1IS4A 2YU2A 3HBZA 1AL22 4MG2A 2ZGPA 4AXOA 1FMD3 3QH6A 4M4PA 1GNHA 2WL1A 5KC5A 3WQ0A 2HWF3 4ES8A 2Y6JA 4K21A 3USUB 4O61A 4URAA 2RR12 2VMCA 3AJYA 3ZLIA 5FQ0B 3ZSJA 4CP1A 2R062 4M00A 1Z7S1 2DCKA 2VMGA 3SNMA 4B4PA 3WQ7A 5APAA 1WA4A 4FPKA 3T3YA 5JIUA 5JPNB 5A32A 2BEOA 5FPLA 1DP0A 1V6JA 2C26A 2D3PA 3IZOA 3ZXEA 1QXPA 5ACA1 5A3TA 2ZZJA 2YB7A 3HBKA 4UFHA 2HEVF 4S2DA 3FHAA 5T5LA 5A7OA 4OQ8A 1PIV3 2IXJA 5ANQA 1OSGA 1ASJ3 3GM8A 2VZTA 1UMZA 3ACGA 4XFIA 5ERLA 2PFWA 3I54A 4XAEA 3FHQA 3H8UA 3O1SA 4XCBA 1K3IA 4ZXEA 4HZFA 4ZHNA 2V72A 1OVSA 4QXHA 3NNMA 3H8OA 4F3JA 4AI8A 2VW0A 1PO23 1J84A 1VMHA 3AYAA 1UW8A 3VD4A 3VZJA 1JODA 1UNBA 2F17A 5T55A 4G4FA 2ZS6B 1VRH3 2D5FA 1K5MA 2ILMA 2ZGLA 5FXXA 4EZ4A 1CWPA 3LDBA 4B7KA 1GP6A 1NY72 2CTVA 2D3SA 4B3NA 4CPBA 5K9YA 1GOGA 4HN1A 3D3AA 1EAH2 1LECA 2VMHA 2HBTA 2UWBA 4CDQB 4CCCA 1ZVFA 4C0HA 5KHIA 1A78A 2YGMA 5FYYA 4RHV2 4KU8A 3QD6A 3ZXGA 2JD4A 3CHXA 4K1YA 5GLVA 2RMU2 5GLZA 4NIGA 2BOIA 1Z0HA 5HBAA 3WNLA 1E5RA 1W9SA 5IWFA 5FY0A 1REDA 3IAQA 1AX1A 4AWDA 2HEYF 1XB9A 4D7YA 3H8XA 1DQ2A 2OXBA 3IM0A 3I3MA 1AYN3 5B4XA 4F83A 1FNYA 2AC1A 1WLTA 3AMPA 5BPXA 3RJ2X 1MEC1 1JYVA 5JXIA 2QQPA 1BBT2 3DN7A 4NWWA 4AQTA 1O3TA 4C91A 4P5HA 4YZ5A 4JGZB 3HD8B 4V1PA 2VE1A 5FYZA 2AGSA 2Q4SA 2Z5WA 3LIGA 5E16A 1WD3A 5CU1A 4YM2A 3HNBM 3MIBA 4ZU5A 3ZSKA 2N7GA 4QB1A 5FY8A 3MIGA 1GLHA 1GWMA 3POGA 3ZFEC 3VBUB 3JQWA 5LBBA 3LPGA 2VQ0A 1Z7S3 3Q8FA 1MVQA 4Q0VA 5F3GA 5CISA 4XF1A 1BKZA 1K12A 3ZYRA 1WCKA 2DBIA 5BNNB 2VOTA 4HVOA 4AGRA 4ZKTB 4PDWB 4NIHA 1POQA 4KG0A 4IV1C 3RYKA 2PHRA 5FO8B 3MFAA 3WEZA 5ACA3 1CJDA 4IW3A 4ARYA 5FYSA 5LCWL 3GZUC 3I2GA 5HPOA 2CDPA 2CU5A 1ENRA 2WWUA 2HWB3 3PU8A 4FI9A 5FREA 4DY5A 3UT0A 1NXD1 2C9KA 1VBD2 1JYIA 4H14A 4P9IA 5FUIA 5C9AB 1O4ZA 1PZ9A 2NYYA 4QQ2A 5F3IA 4GWIA 1UXXX 2WNUA 4BZ4A 3WF0A 1VIWB 4SLIA 2WFF1 1W39A 3NL1A 3NMBA 4R52A 2DUOA 5A7PA 4BLIA 4CCNA 3P3NA 2YBKA 2VO5A 5F5AA 3VGIA 3ELNA 4IL7A 2PHDA 4ZONA 2BVVA 5T3NA 1RJ8A 2J1VA 2KA3A 2Z4FA 4YARA 3RZZA 1OLME 4BQ3A 1C5HA 2L9LA 1U0AA 5FZFA 5HV0A 3RS6A 2DWRA 3E6CC 4YG3A 1YCIA 3DXTA 1RUD1 1RUH1 3ZXFA 5IFTA 1MPXA 2QDRA 2W5FA 1QJY1 3F2ZA 3ZIXA 2PN5A 4BLJA 3RG0A 4A42A 4EN6B 4EWAA 3S7EA 1DQ6A 1PO11 5F6KA 5BNQA 3PUHA 3HN3A 4A3XA 2D6KA 2ARXA 1GV9A 4MXWB 3WNOA 1L7RA 5JZGB 4DZGA 3DPRB 5I0TA 5KHHA 4UBGA 4AVVA 1KS4A 1VB2A 2YUEA 3V65A 3NV4A 5FZGA 1F35A 2GC2A 1AYM1 1UIJA 5A7WA 4LHKA 1W03A 4I0BA 1AXZA 3PVBB 1UZZA 3T2QA 4NR1A 4RQPC 2GSYA 2SBAA 4CCLA 1DYPA 3POSA 3Q8CA 4UT5A 3N35A 3ZPOA 4GH4C 2LTNA 3RI8A 4CDUC 2XG3A 1R092 5J37A 5JOYA 2GNDA 2VXRA 1UQXA 5GZGA 1LENA 4IV3C 5SV5A 1IOAA 2FCTA 1UMIA 3PLQA 5CFCB 1Y9GA 1ZBE3 2ARAA 1YQ8A 4RL7A 5I0UA 1APNA 1OKOA 1MZ6A 2HEWF 2Q8EA 3MFCA 2HYKA 5E6HA 5L9BA 3W59A 4FBFA 3K4DA 2BU9A 1XYOA 2F6BA 1VBB1 5C3PA 3PMSA 1CJPA 4XUQA 3H9AA 1PVXA 3HNYM 5BUVA 5JCTA 3MIFA 2RM23 2YMZA 2VPVA 1UX7A 4E4DX 2XJPA 4BWOA 4IGOA 1QDCA 3VBHB 1JZ2A 3J7NA 1AR72 1LOCA 1W6QA 2OZJA 2ZEZA 2QNKA 3J8F2 3KCXA 4LTAA 4CDXC 4JDOA 5FLIA 4GIQA 4XZUG 2AREA 3POBA 5F32A 4CUCA 3CZUA 4YLZA 4CEYB 5FZKA 3IBMA 3AZWA 4NIAA 4CRQA 5KXCA 3AKPA 1R1ZA 5FZ6A 1HJFA 4LK6A 3TB0A 3W5MA 2FDJA 3GHMA 4XFGA 1RUH3 3KV9A 3T2PA 1NLRA 3ACFA 1S0IA 2V09A 2A70A 2J1RA 1YJKA 3KGZA 1AHSA 5TSWA 1N47A 1TE1B 4ISRA 1D7PM 1PO13 1QKQA 1BEV3 3M3QA 3UJQA 5DUXA 5HCAA 3I59A 1OLRA 3K75B 4D6SA 4W65A 3VHPA 2BZDA 4L0PA 2XJVA 4AG4A 2XH6A 1AR91 4BH9A 5IVJA 3SITA 1O6UA 5BNOC 1G9FA 4YG0A 2WO1A 2P37A 1AYM3 2VW2A 4P9GA 1JHJA 4E4HA 1SCSA 1XSRA 2RDSA 1MQTB 3ME2A 4I09A 4Q2FA 1ENXA 1KDMA 4CCMA 3LEKA 3CJIC 5KXDA 2OKXA 4OI4A 3LA3A 2VMEA 1REEA 1D4M1 1RUC2 5FYMA 4LIVA 2DCTA 5J1XA 2ZGNA 4KWLA 3ZO0B 2JG9A 4UFLA 1V6MA 4XUTA 1OOPC 2XR4A 3NAPC 3OY8A 4Z92B 1AUYA 4NPMA 4XILA 1COV3 1JZ5A 2GAUA 2Y6LA 4HKOA 4YSFA 3O7OA 2E9QA 1TNRA 1A8DA 3GJBA 3RJRA 1LB2A 1XQNA 5K0UB 5FWEA 3DKQA 1JH5A 2D97A 1DGWA 2ZEYA 4LA3A 2ZX2A 3RQ0A 3U07A 2LRPA 5AC91 3KV4A 3ZMOA 5F5IA 1VB4A 1QJU1 5A1LA 4K3UA 4PJYA 1VALA 3OOXA 4O7XA 4AI0A 2CAVA 2XJTA 3ORJA 3ZSMA 4CDWB 5DZEA 1RYYA 4AGVA 4CSWA 4DIQA 2YV8A 2ZEWA 1FPN2 2C6SA 4AAXA 2ZGRA 5C5UA 3ZFGB 2JG8A 2RJ2A 2D44A 4LKSA 2EICA 1AXKA 4PIXA 5FYUA 4EZHA 3BKZA 4GD4A 1RVF2 4U2AA 4YGEA 3ZIWA 1X50A 3H1WA 1O5UA 4FPEA 4ISQA 4TLFA 4BISA 5DXDA 4BQWA 4RD7A 1XNAA 3PUIA 4K9SA 2CHHA 3I2DA 4HSLA 5FLJA 3ZFEA 1AX2A 1SHWB 4P5YA 5A7QA 4IQPA 5A80A 5FK8A 4H7MA 3THTA 1ZRCA 3U1XA 4Y22B 4AI1A 1H2KA 3OF1A 2BVBA 4IV1A 5DG1A 3MIDA 1RUJ2 1WCSA 1UO9A 3BTXA 2Y33A 3T08A 3IWZA 3GCWA 1W6OB 2C4XA 3GHNA 3H1MA 3PIGA 1DZTA 4YW6A 4IEZA 3EQEA 3BUCA 1LU1A 5E88A 3JBG2 2VC9A 3VDBA 1AZDA 2JICA 3FLRA 1S0DA 1PK6C 3K51A 3MW2A 1WWYA 4Q4Y1 4SBVA 4BXSV 4CP0A 4MGTA 4YW5A 4AFCA 1J3QA 2ZABA 1O5LA 2D93A 2X05A 4YYOA 2FCVA 1F2NA 3M3CA 3VBOC 3SHRA 4RGAA 4QWNA 2IXCA 4GQ7A 2A73B 1LTEA 1VP6A 1AR93 5FYCA 5FCCA 2EA7A 1MS1A 3L2YA 4QPWA 4NIDA 4IERA 2OW4A 1QMJA 2EXHA 1HJGA 4XHXA 1KS5A 2VMDA 3O0XA 5B4NA 1LHOA 1U5YA 4HPKA 4CUBA 3RZHA 2JENA 2GZWA 2PHTA 2VH9A 2Q8DA 1W8TA 3ZKUA 2HWC1 3S30A 2AZ5A 5I8YA 2A75A 2UY9A 1QHDA 4QXCA 4NO4A 3U37A 4DXSA 1N1YA 2ATFA 1W2NA 1BHGA 1V00A 3AXEA 1UOJA 4EWDA 4XJAA 2ZKNA 4LBQA 3R6SA 5A3PA 4FFGA 3RZJA 5AC93 2WR9A 1JU4A 1NUKA 1S55A 1WUVA 3THDA 4AHYA 3CF6E 4NHKA 2X09A 5FY1A 4XFHA 1MR5A 4W6XA 4KH9A 3DECA 1O91A 1OH3A 3OPWA 2Z69A 4RQPA 2X5IC 2ZGUA 1IQDC 4GJZA 4MSVA 2VZRA 1ZZCA 3ZVXA 1DZQA 2VXJA 3PVNA 5GZEA 3WOGA 2QQWA 2PELA 2YBPA 4IEVA 3FN9A 2BFUL 4GH4A 4COWA 4JGYB 2R1BA 5E89A 3VZLA 4CDUA 1KEXA 2ZMKA 5FPVA 1EV11 2Y6GA 5FZEA 5KWRA 3WP5A 3POWA 1ND3C 4OFGA 1AR63 1N3QA 5JAXA 1YFXA 2WQ4A 4RN5A 1QDOA 4IV3A 4CA9A 2EVXA 2OYZA 2C9AA 2G19A 1UZWA 2PXJA 1GUIA 2GMPA 2RS11 2ZX4A 3ON7A 4KGGA 4XQDA 5FMOL 2D6LX 2WS92 3AX4A 5GLWA 4HK9A 1RUJ3 4I3GA 1GP5A 4PLMA 2EAKA 3UK9A 4K8RB 3NSTA 4MGQA 4AVTA 2XL7A 4N7IA 4H3WA 2XBO1 4E8DA 4QPIB 1ENSA 5EYYA 5IVYA 3WNMA 2R49A 3EBRA 1TMF1 3SEEA 3N7JA 3AMNA 4UYBA 4YZ1A 1MS3A 1EUTA 3RRDA 2W39A 4Q4Y3 1DZRA 3OGVA 1SLAA 1H9WA 5BNPC 2HWD2 2D98A 5C70A 3VBSC 4WVMA 1N3OA 2PTMA 3VBRC 1UY0A 4COUA 1PVC2 1ULPA 2LM3A 2PHUA 3T1LA 5CADA 4QX0A 3T30A 4CDXA 4CPBD 3K3OA 1R082 4CU8A 3MBWA 4YNIA 2VG9A 5A32B 4XBNA 4MGYE 3J7MA 3KMHA 2WJSA 3O5SA 1MVEA 2V4VA 4BPZA 2Q1ZB 3ACLA 3VHRA 4Q0SA 1JU3A 3VV1A 4IE5A 1GBGA 2VZOA 4XF3A 2HWC3 1FXZA 4AEKA 4F8AA 1G9DA 3UKNA 5E1RA 4KU7A 3LWCA 5FY7A 1FV3A 4DMIA 3CBNA 4LBOA 1H8TC 1Q8OA 1YLLA 2VTXJ 3AP6A 2W1QA 3U4XA 1SG3A 2DDUA 4GB31 4K7JA 3AZVA 4WZFA 2ENRA 5CFDC 3ZDSA 3LB9A 5AVPA 2GC1A 3WF1A 5BNOA 2VZUA 1K5MB 3NJYA 2WO3A 4ET7A 4N53A 3LKJA 4LMFA 3U0ZA 2VCBA 2D6MA 4I02A 3NNFA 3VBFA 3RZKA 3DYOA 4AI2A 2VZVA 3JD71 5JSPA 1LOGA 2R043 1QWRA 5JI7A 3CJIA 1C1LA 1I5PA 1LCLA 1VBA1 1HV1A 4OYUA 1AX0A 4UW3A 4XTPA 1A3KA 2XQXA 3BB6A 3FBMA 1DGWX 2XLAA 1X8EA 1OOPA 1OF3A 4CCDA 4Y1UA 1QJX2 4Y1YA 3O1UA 1EV13 2ZAHA 2W2IA 1QQP3 2A1XA 3RYPA 4GWMA 1VBC2 5F9TA 1NQDA 3MV11 3ZSEA 3N9PA 3UGGA 1JBCA 1FATA 4IETA 4FPYA 1F5JA 4YW1A 1A8MA 5I0SA 5JI9A 3DYMA 2IFWA 5LBCA 1PHMA 1TG7A 3NV2A 4ONUA 4AAPA 3NJZA 2E7AA 4AFAA 5C8CC 1UY2A 4V2WA 2PLV3 4N8MA 2DV9A 3HOBA 1ULFA 3OBTA 1TMF3 2CDOA 2E63A 2DTYA 4M0HA 3B7MA 3B9CA 3AP4A 3OSDA 4Y4YA 5LBEA 5FZ9A 3SKVA 1RJ7A 4XZPA 2CV6A 1LEDA 3EXUA 2ZHMA 2IC1A 4GMP1 5IAVA 5DZFA 2W3JA 3EHKA 1IKQA 3ES4A 2QE3A 3CJXA 3R4UA 2A6ZA 1NOVA 1H6YA 1E5SA 3PHMA 1AR83 1QXJA 4XTMA 3RGBA 3VDAA 5FOBB 5CNAA 1TME1 3WX5A 3H3UA 2V5YA 4P9WA 2R7EB 4P14A 2G9FA 1NCQC 3I2HA 2BP6A 4IE0A 4MX3A 5DUWA 4IEYA 5JSOA 4R9CA 3M2MA 5T5JA 2B9UA 1GZWA 2IVIB 3AYEA 4PLOA 3LAGA 1BVP1 3WW3A 1FNZA 2JDNA 2NMOA 3NO8A 3WP4A 5T5OA 5JWPA 4JAAA 5IVFA 1JI6A 1OUXA 1FMD2 3ZXJA 1IGOA 4HL0A 1ULGA 3GNEA 4XE9A 4IGPA 1MS0A 2VVFA 2PYTA 5L7OA 2HWF2 4H7LA 5FXVA 2ZPXA 5A70A 1RB8G 1GSLA 2RVAA 3K46A 2AR6A 1PMHX 2RS31 3B9IA 1W0NA 3DEMA 4E27A 4HG6B 1GZ9A 1LKNA 4NHXA 5J98B 4EV0A 3VBOA 1SMVA 2XOMA 2WNUB 2XQRA 3OPZA 3OGSA 2R0FA 4GB33 5LW9A 1X9PA 2J42A 2B42B 1S0BA 1OC1A 4RR3A 1O59A 2GP5A 2QBXA 3LOBA 2E7QA 2RJKA 2Y64A 1ZZBA 4WM8C 2Y34A 1I1EA 1LGBA 1WLCA 1XE7A 1GQPA 1PIV2 1T6GC 4Q29A 1ZRFA 1ASJ2 4HBNA 1ZM1A 2BJSA 4LIUA 3VDDA 3KT7A 4QDRA 3DUIA 3SCGA 3IMMA 5GM0A 2VZ3A 5ISLA 1RITA 2W91A 4OMCA 3ZOIA 1BVVA 2GC3A 1ZX5A 3WW2A 3Q8AA 2E26A 5CKNA 5KR7A 1PO22 1ZBA1 2DU1A 2WZR1 3NW4A 4QXKA 5F5QA 1QJZA 3WR0A 1VR3A 2W46A 5EYXA 4CYDA 4AEDC 1VRH2 1ULEA 3WG4A 4Z1VA 3BCWA 2RV9A 4ZPIA 4UFJA 1IHMA 5C5TA 3KHBA 3KS7A 3LPFA 2O1QA 1CAWA 1I9RA 1U12A 1DQ4A 2KM2A 3ACIA 3AL5A 3N3HA 3NQHA 5FYBA 3FZ3A 1CVNA 1W2AX 4FOYA 5A7WB 3A7QA 4BQ5A 4CCJA 4XXPA 3WNNA 5HI0A 1RUE1 2XKPA 4LO5B 3BI3A 1E57A 1WW5A 2YBSA 3QBQA 2P3IA 4OZXA 4GKYA 1MS4A 2J1SA 3BPZA 4GMP3 1RUI3 3I49A 4QPGC 4BIOA 3P6BA 3GZEA 3H7YA 3POYA 2VNRA 1JTZX 4YZ2A 3OJBA 3LFIA 3OPTA 4I30A 4XFBA 1ND3A 1TME3 4CP9A 1AYN2 4KG8A 1PGSA 4HANA 1F8VA 4EN9B 3AKQA 4NOTA 3V0BA 2WT2A 3LE0A 5ABJC 3G6JB 4RSUA 4LNVA 2ZXQA 1OVPA 1ODMA 1UX6A 2QUOA 4LBMA 4TXWA 4MUVA 4HVRA 2EIBA 3MIEA 4D94A 4UFIA 3RZGA 3QLQA 4J1WA 4NUBA 3AP9A 2DCYA 2E7TA 4BHPA 2A3XA 2JE8A 4FVVA 1CN1A 3L2HA 4HXCA 3RI9A 3TEZA 2AUYA 4MZUA 1UY3A 3FLPA 2CSGA 1YWKA 1W04A 4HK8A 1IG3A 4WBBA 2QFEA 5EFUA 1AL21 1HQNA 3KT4A 1Z7S2 5AVAA 5JR7B 3VBSA 3C8XA 1F9KA 3WDWA 3MYXA 2QDNA 4WVVA 2B46X 2D6NA 2YZ4A 4XF9A 3VBRA 5DN2A 4DRVA 1W28A 1W6QB 4L97A 2HWE3 2JXAA 5CVRA 2VUDA 4LO6B 3BODA 4QX8A 4XPVA 2RR11 2VUAA 4FAGA 5ACA2 3O1OA 1HN0A 5DAXA 1K42A 4GKXA 3M3EA 4AL9A 2VZPA 5FYTA 2XLGA 3EMRA 2ZOEB 2HWB2 3LQCA 4NAMA 4N9IA 1PM4A 1RUG1 2A71A 3AK0A 3HIFA 5ANNA 3WF4A 4A7ZA 3X29B 4Q1PA 2WNEA 5FR3A 1V6KA 1PM7A 1DFQA 3K77A 2WFPA 4ZU7A 1YFYA 2PAEA 3ASIA 4KGQA 3RWNA 3LSEA 1GR3A 4UOJA 3RPQA 5B2GB 1ZBA3 2W68A 5FUNA 5CAZA 4I0WB 4Q4X3 1U5IA 5JXHA 3BOPA 3E97A 5E8AA 3I59B 3ZYJB 4RS5B 3KVBA 5JXGA 3GBFA 2D43A 1RUNA 4CCEA 3G7DA 2W1SA 1G7YA 4PQQA 5CFDA 4DQAA 1XNKA 2A6XA 1IPSA 1Q8QA 1Y3TA 3WLUA 2WQ8A 1QEXA 2P6CA 4XF4A 1FOD1 3NJVA 1SBEA 3OUJA 1SLCA 4LA2A 5FZDA 2WLQA 4JDNA 1C5IA 3JQXA 4IEWA 2QKDA 1UKGA 2JDKA 4XIKA 1NY71 1R1A3 1UF2C 1YC61 1LOEA 3H3LA 4LITA 5IVEA 4KNCA 2JG9B 4PI0A 3N9LA 3OY8B 4LJHA 2A3WA 4AVBA 1WA6X 2ORZA 4R9AA 1PGL2 1XOYA 1W6PA 4DFSA 2Y6HA 2ZAAA 4AFMA 3FFZA 2RMU1 5JOXA 1YFUA 2Y26A 3HQXA 3RMYA 2OA2A 4Y5SA 1MS8A 3UL2A 3FL7A 2E6VA 3K4AA 2GN3A 4HFSA 1W8OA 4IE7A 5LA2A 1DQ0A 3UKTA 1HB4A 1W8HA 3B01A 3VKFC 4PCRA 5EXOA 5DG2A 1CX4A 5FP4A 2VVEA 2H6BA 3THPA 2JG8B 2VW1A 4AEMA 4IXLA 4AHZA 2VMFA 5A6QA 5JOWA 3I2IA 5A33A 2ZJCA 4A44A 1V6LA 3AZXA 3LCPA 5C3SA 1MS9A 2VUJA 4BA6A 3WCRA 3VHOA 5KXEA 1H2LA 1ZBE2 2GMEA 2ZMLA 4JRLA 4KWJA 4INDA 3VBUC 3N9QA 1NCQA 4QGMA 3I4IA 1LR5A 3GGLA 3JUUA 1AJKA 4L9BA 1RMU1 2WABA 4JVAA 2VR4A 2EXJA 4PDWC 2GU9A 3M7AA 2TUNA 4IV1B 1NLSA 1OKQA 4PBOA 4NPRA 1CQ9A 4W6YA 2FQPA 2HKXA 2OQ7A 1RUG3 1T6BX 1DBNA 3J4UH 2YC0A 1NXMA 4XF0A 5FP7A 3WUCA 2RM22 2Y6KA 1GQHA 1RHI1 3OB8A 4JHTA 1HDKA 2WDBA 1EY2A 3CMGA 3LD8A 4OHVA 1KRIA 1DLLA 1VAKA 3AMHA 5GZCA 4G9SB 1QOTA 3I3QA 3FHIB 4AZZA 2X10A 1EP0A 1W9WA 4PQ9A 4AOCA 3TWIA 4YGBA 1W06A 2D40A 4QX3A 4GULA 4YVSC 5LEKA 5C9AC 2WLPA 3LIHA 4BK4A 3GDBA 4HMZA 1QXRA 3J26N 3ATGA 4C8DA 4XACA 5A1AA 4Q8KA 1IG0A 5BXXA 2ETEA 4M0NA 3H42B 2BNMA 3BTAA 2BTVC 4WM8A 5FMCA 3MZHA 1FOD3 4DNYA 3KCYA 4OUMA 2IXHA 3PTYA 1GOHA 2WQZC 5FBZA 1RUH2 2JWPA 2YYOA 4HONA 4JC1A 4MGKE 2D6PA 4HPKB 4DUVA 4OI0A 3NKGA 1S0GA 3ZKYA 1ENQA 1JW6A 2Z79A 1PO12 1NE4A 1BEV2 3I2JA 4AVAA 1XNBA 5FXWA 5C6CA 2ARCA 3AZZA 3LDKA 2VGDA 3OG2A 5IJRA 2A6VA 2XPJA 2G9ZA 3KQRA 4DUWA 1MEC3 3GZAA 3PUQA 4Q4W1 4XVHA 1RUF1 4BQ4A 4XHBA 3ETPA 4LBQB 2WYFA 1AYM2 1YFWA 5JZGC 1CAVA 2GH8A 3C7GA 3DPRC 4JV4A 3W20A 4BB3A 4QPYA 2YFUA 1M4WA 4P9XA 1HQLA 4IEQA 4ATEA 4DEVA 4QQLA 2BBAA 1ND2C 2BQPA 2PQSA 4RQPB 4XFFA 4MV2A 1IPKA 1COV2 3WVJA 3S5AA 3D5OA 3SMHA 2FMYA 1W0PA 1EYBA 4P02B 4QPGA 4XQ4A 4GH4B 3SXWA 1UYXA 1ZZ7A 1W6MA 4CDUB 1LOFC 2YC2A 2Y8KA 5JUVA 2QQJA 2XL9A 4I01A 5J96B 1OPMA 2ZX0A 5A7NA 4E9KA 2VNVA 2FDKA 1S2EA 1GYKA 4IV3B 1NCRC 1SLTA 2E53A 2F4PA 1W05A 3QACA 5F5CA 3BU0A 2Q1FA 4XIOA 5ABJA 1R091 1RMU3 4TSVA 1UU5A 4AF9A 1QU0A 1AXYA 1U5XA 1F31A 3BOWA 3WF3A 1OFNA 4CU6A 1O3QA 4DEQA 2VUCA 2I07B 1BCXA 5CIRA 1DDLA 1G6NA 1RHI3 2ADDA 1W3XA 3IB3A 1POV0 4LLFA 3ZXDA 4BJ0A 2IUWA 2WFF3 4PHZA 1WBLA 2LALA 4XUPA 4CE8A 1W6NA 3EYPA 2GP3A 4DS0A 2IVJA 1VBE1 1W8ZA 4Q0QA 4FFIA 5JVVA 5KXBA 5JOZA 1W8UA 3MPBA 4G3YC 4WVMB 3WDXA 2QQVA 4A41A 3FMGA 3VBHC 2OUHA 5FQ0A 1SCRA 5LA0A 2XKOA 2W1WA 5IYYA 1HN1A 4QDSA 1J83A 3MO4A 1RUD3 4NMIA 3UGHA 4A6OA 2VZSA 1QJY3 4PIZA 4CZSA 2JEMA 1HV0A 4CCOA 2Q30A 3TBDA 1LESA 1YQ6A 4AFBA 3ZYFA 4HLTA 1PZ7A 2BGOA 5FXZA 1KFUL 5K7PA 4A6SA 3OGGA 3FX3A 1WMFA 3WP3A 4ZU4A 2VD7A 1Z78A 1ZA7A 3SH3A 1QF3A 3PVOA 4A45A 1AR92 2W47A 4OMDA 3MIHA 2JDZA 2V4AA 4Q4W3 5FZ1A 1RUF3 2DCZA 3I3DA 3CEWA 1IZ3A 1GU3A 3VLBB 2J1TA 4QMAA 2ZGKA 3ES1A 4YVWC 1XYNA 2B9VA 5HCHA 3ZX7A 3NJXA 1C4RA 2XJUA 2LW8A 5BNOB 4D6QA 4N53B 4P9YA 3VHNA 3O14A 5FYVA 3CU7A 3WP6A 5IATA 3VBFB 4YFWA 2Y0IA 2UWCA 1OT5A 4GJYA 1C8NA 2W87A 2PAMA 3MI8A 5H9QA 3GYDA 2FDIA 1L3JA 2RDNA 4IEOA 4Q4V1 2QQMA 4BOWA 4D7SA 3WQ1A 5FKCA 4EN8B 4FXKB 1W90A 3ENRA 4P9JA 1I6XA 1LOBA 1UY4A 3CO2A 2QCSB 2ZX1A 4XC9A 5AC92 1RUC1 3I3EA 4QX7A 4Q0PA 1CAUA 3HT2A 3GF6A 4MHRA 1BQPA 1ST8A 4UF0A 5IFPA 1G9CA 2Q8OA 3TNPB 3WHUA 1VBB3 4FTSA 4XCAA 5K0UC 2VJXA 1QJFA 3ZN5A 1ZNPA 3WT3A 3LFMA 4QXBA 1LNSA 4NROA 4O9GA 2NQYA 5A3UA 1SLIA 4LUKA 2WNOA 1C3HA 2DVBA 4CDWC 4NAOA 3TOJA 3W9AA 5I93A 1WLWA 5FZ3A 2YU1A 4RFT0 3WW4A 1PZ8A 2WN3A 5HV4A 4NHLA 3C7OA 1N1VA 1AR62 5D8AC 1VBE3 3KQ4B 1FPN1 3BPSA 3DF0A 1LODA 3IDBB 4GXLA 2PA7A 1JYNA 1YYNA 3WUDA 1E5HA 5I0DA 2EXIA 1O3RA 4HOOA 5GZFA 3VBUA 3ZR6A 2NLRA 4X6RB 5LASA 2BWAA 1DYOA 2C1FA 3NWKA 2IXKA 5BV6A 3PDQA 5C4WB 2QQNA 1LULA 5FP9A 4HKLA 2WINB 1DGRN 3ECQA 1GZWB 3ZYHA 3ZN6A 1W9YA 4E2QA 4CUGA 5JIAA 3VD5A 2ZA9A 2F4LA 5FIXA 4Q4Y2 4Y20B 1OF4A 4AHWA 1GZTA 4AI9A 2HLEA 4WZCA 5L7OB 4Y1ZA 1W3VA 4LKDA 2OS2A 1OFSA 1NZIA 2RJLA 5FMDA 2A3YA 1G9AA 2P17A 3BIWE 4YW7A 1H6XA 2V73A 3CKHA 4PI2A 5LRSA 2EXKA 3AYDA 1O4TA 1OD5A 4YVSA 1LOAA 5C9AA 5IVBA 3NKTA 1DLCA 4LE4A 4LT5A 4JRAA 1XPWA 3LOIA 1JZ3A 2CGPA 3TNQA 1BJQA 2X53S 4R4XA 5IK4A 4NIIA 1CZSA 4F7ZA 4RR3B 1D4M3 4GWNA 3KSCA 4R9DA 2A5ZA 2CYFA 2QQUA 4W4ZA 5F2SA 3VD9A 2HWC2 2B45X 4L92A 3OBZA 5HCFA 1JZ4A 2XUEA 3VDDB 4IEUA 3SH4A 1OD3A 3PMEA 1D2QA 3DGTA 1H1MA 1UOGA 1N3PA 4LO7A 1UY1A 5FBJA 5G04L 2Q8CA 4Q4V3 3I2FA 4NRQA 1L7LA 2JB8A 2RDQA 2TNFA 1XU1A 3PJYA 4LQRA 3V0AA 1QJU3 1K5JA 4CEWC 2I74A 4XDOA 2QQIA 2MEV1 5CKMA 4L11A 4UWDA 4NJ4A 1C28A 2XJQA 4MXWA 3I2OA 2OX0A 1E5IA 3J7LA 1HXS1 3ZYGA 2R042 2VTFA 2PQQA 4Z82A 1CAWB 5H9PA 3P1IA 3WD5A 4LHLA 5IVCA 4IUGA 5FJKA 4B1LA 4H55A 2W9XA 1YI9A 1ND2A 2NN8A 3LF7A 4QKDA 3RSJA 3T09A 3GXUA 4HSJA 4D3WA 2HJIA 3OBAA 1NA1C 4IE6A 1EV12 2Q1MA 3MDPA 4NRMA 2JDPA 4NHYA 2B5HA 1QQP2 2BUKA 1LHUA 2YY1A 3E5UA 2MPFA 4JGYC 2DU0A 3VUOA 1W2OA 4MGZE 1QH7A 4ES9A 2WKKA 1ULCA 1ND3B 1P8JA 3U10A 5CG9A 4CP9B 4FOWA 5LY2A 3UV9A 3KT1A 1NCRA 4OCTA 2P34A 3MUZ1 5FZ0A 1H1IA 2BDRA 2W95A 4JQRA 4LO4B 3V0BB 1LGNA 1IS3A 3H1YA 1O8SA 2PLV2 2WO2A 3WDTA 1CPNA 2A6WA 2DF7A 1H1AA 1TMF2 4LK7A 4OHYA 2DFCA 2JE7A 2YHJA 2K2SA 4QGLA 3B93A 1H8VA 4QPIC 1OI6A 5KC6A 3ROUA 1W9TA 1XU2A 1Q56A 1CPMA 3UJOA 5DUVA 1AR82 3GBWA 1O8PA 5LK7B 3PURA 3KB5A 5FTTC 1H4HA 2OUJA 2X8KA 4I2OA 3VBSB 1O7FA 1SACA 4QT6A 2FD8A 3BYWA 5FZMA 3M4FA 3VD7A 2X29A 3OYWA 2DURA 2UWAA 3L9JT 4PF5A 3OUIA 3LSDA 3CL1A 4FO9A 1NYWA 4CXXA 2AACA 4FFFA 2VZ1A 4FCAA 1EUUA 3RWKX 5LWBA 4N7UA 4IE4A 1OBNA 2FMDA 1WCDJ 2HBUA 5L9RA 5DAQA 3JB4C 3MHZA 3TEWA 1KJRA 1S0FA 2BFUS 1XC6A 3MLLA 4PIYA 3ZFFC 5LY1A 1GNZA 3MF6A 5DAWA 1Y43B 3O1VA 2VM9A 4OHWA 3TYJA 4D8MA 2VNOA 4GB32 5CG8A 3WSOA 2OT7A 5FZOA 2FHRA 1HLCA 4PT6A 2JE9A 4Y5Z0 1H4GA 5IW0A 5FMOS 4YZ3A 3KLSA 4COYA 1Q5OA 3S57A 1OA4A 2NMNA 1B35C 3VKMA 4YVWA 1GWKA 4C90A 4FTEA 5CFDB 1REFA 3U75A 1HXS3 5FZIA 1W8WA 1JOJA 1K5MC 1FI2A 2G1MA 1C1FA 1UYZA 2YPJA 1N1TA 5F2WA 4YRDA 3VDCA 1YEWA 3NAPA 4LKEA 4YGCA 4E4ZA 4CXYA 1YIFA 4D6RA 1JYWA 4N43C 1YHFA 4ATFA 4UW4A 3WCSA 3WNXA 2OVUA 3W58A 1KDKA 2E51A 4MLOA 1LHNA 2RS13 4Y3OA 3SISA 4PLNA 1VLNA 3IPVA 1MACA 3T2OA 4C0BA 3BU7A 3O1MA 3ACHA 1GQGA 4GWJA 5D2AA 3URFA 4XBLA 4AK3A 1WZXA 2D7FA 2XBO3 1CZVA 1W6PB 2FDFA 3AZYA 1ZYBA 5K0UA 4BYYA 1GP4A 1HIXA 3HPNA 5KHKA 2WA4A 4HETA 1SLLA 3D6EA 3N9MA 3LA7A 3PIJA 5T50A 1OQDA 3JCIA 4XABA 4FQZA 4XETA 3R05A 1SEFA 3WG1A 4ZZ5A 4CDWA 5AFEA 4AE2A 1RUI2 5GLTA 2LS6A 1DHKB 3MF9A 3B02A 1OMIA 1IS5A 4LBJA 1XJAA 2OIIA 2R0HA 1JOBA 3AMMA 1GOFA 2BERA 1TME2 3M8LA 5LB6A 5A33B 1S1AA 5D8AA 4EROA 3NV1A 1T2XA 2ZGMA 1URXA 2VECA 4FFHA 4XJ9A 1TZOA 4DXZA 1PGW2 4ZXKA 1C8M1 2WA3A 1HW5A 1QH6A 1NCQB 5D21A 5JMOA 1UL9A 1YQ2A 3A21A 2QQKA 4Q8LA 3VZNA 3CIHA 3VKOA 1W2UA 3DCQA 3JB8A 1ZZ9A 1V9U1 2DUPA 2R16A 2RS51 3KM5A 2ET7A 4HN0A 4TTGA 1PK6A 1QIQA 2XMLA 3Q8BA 3V56A 2AYHA 2ZGSA 3KZ4C 4U36A 1QNYA 1S4CA 4OULA 1W6OA 4OLLA 2J7MA 1JUHA 4FT8A 5FYHA 1NAEA 2B39A 5G05L 2OZ6A 1FMD1 4AYUA 2BYVE 4BM8A 4DUXA 1CAXA 5JR2A 2HWE2 4L2NA 4XXAA 3LGRA 3M3OA 4QKNA 2WAAA 4ORFA 4LOSA 3O1TA 1WBFA 2XDVA 5DABA 1HRV1 2OQ6A 3CLPA 3JD73 4L8QA 2QJVA 3WNPA 2IFRA 4JKMA 1VBA3 1W99A 1S0CA 3ZDVA 2BNNA 2ADEA 2D6OX 2EF6A 3OGJA 3AVSA 4WM7C 4UW6A 3TN91 1SZBA 5SV8A 2VTXA 2FBEA 4WM8B 4LXLA 4Y26A 4Z07A 4TZDA 4I3PA 3MUY1 4Y5TA 1MZFA 3ZSLA 3A4UA 1RXFA 4LBNA 4BQXA 5A6ZA 2R071 3WW1A 1H2NA 4D69A 4QU1A 1ZBA2 1HRI1 3RVHA 1OLQA 5HXMA 3KHCA 4Q4X2 4E2GA 2WO7A 3NNLA 4FSJA 2VCAA 2CWSA 4YGDA 3HT1A 4ARXA 2EAAA 3LA2A 1UWWA 2EIEA 3F95A 3RNSA 4CEWA 1J58A 1W2TA 3IN9A 5FZ7A 3T0BA 2P3JA 2V5DA 4MADA 1BYHA 2Y0OA 3CZJA 3U14A 4JCKA 4QM8A 2X5IA 5DDJ1 1CAVB 1ONAA 4N9HA 2XXZA 4UFKA 3K3NA 3T0AA 1RUE2 2VQAA 3ZN4A 2BPA2 5FPZA 2GC0A 2WNVC 4GA9A 3O1RA 4Q0UA 1R1A2 5CA6A 3U78A 1BMV1 2GNTA 2PHLA 2UURA 3OUHA 1NA1A 3POFA 2Y38A 3APBA 1VRBA 1YIPA 3LDRA 4IEPA 2ZHLA 1ALYA 4Y1XA 1W6MB 1WCUA 4GZ9A 3O12A 5CEHA 5FFOC 2VCCA 3T0DA 2AEYA 1C8M3 4JTOA 1W8FA 1IQAA 2FZ1A 4EE2A 1J59A 1F4HA 3MW3A 2UYBA 5F37A 3C7EA 4DXRA 1DIWA 1V9U3 2RS53 4R4ZA 4EN0A 3MICA 1LJ7A 4J1XA 1YO8A 3IIIA 3P3PA 2DYCA 5EV7A 2RS33 5BNPA 3AC0A 2BV4A 1GNYA 1NQJA 4RFRB 3Q8EA 3NVCA 3DL3A 2DVDA 3OD4A 1DU3D 5FZBA 1LAJA 1VMFA 1ODNA 1Y9MA 1W6NB 3RYRA 3S0MA 2A6YA 3D0SA 5EP9A 3B3QE 3ZXLA 4IEXA 4BQ2A 4IGQA 2ZKLA 2GALA 1UIKA 4S2GA 2R061 5FV3A 1Q3EA 2W0XA 4XJWA 1HRV3 1TEIA 3WNKA 4ASMB 4FPGA 2VNGA 2B8MA 2JKXA 4AVSA 1RUG2 3TN93 2ZMNA 1NE6A 1F5FA 3C7FA 4MYEA 2WZR3 2O0OA 5GJ6A 3DV8A 2R073 1UD1A 5C33A 4JTNA 3WG2A 1H8TA 3WDYA 1HRI3 4UXAA 4DINB 5A3MA 3OEAA 2D3RA 5J3UA 1XE8A 1YQCA 3N7KA 3KVAA 4H2AA 3T4HB 5FAXA 4E8CA 2HWB1 3ZFFA 4FTBA 3PL0A 4BQ1A 1RTVA 3VKLA 1UMHA 3P5BA 4MH0E 3GALA 3ST7A 3SCHA 2LROA 4M3CA 2A7AA 1XE0A 4RS5C 1FOD2 4IDZA 4CDQC 1RUE3 1B35A 5DDJ3 5IUQA 2Z2SB 1O4YA 4AI3A 4M4RA 2DCJA 5FPAA 1H30A 4MO3M 4QQOA 4AGGA 1EAH1 3AKSA 3PJQA 4QKFA 1BK1A 3SC7X 4AQ6A 1UAIA 3SEPA 1JZ8A 3AJZA 4N43A 5FY4A 5F39A 2WBKA 2EIGA 1G86A 2XJSA 4RHV1 3C2UA 5GALA 1D2SA 3UESA 3ZMNA 4XJUA 2VCMA 4LEJA 4ASLA 1MEC2 2H6CA 2ZGOA 2JG9C 3NRUA 4RGKA 1AJOA 2VAUA 4META 2VY0A 4FP2A 2ZBJA 1JHNA 4E4SA 3UETA 5C8CA 3ILNA 1CAUB 2NZ9A 4LLOA 4QX1A 4UF0B 1LHVA 3O0VA 4BMEA 4XJZA 4A7YA 1CR7A 3TEYA 3UKVA 5F3EA 3BVCA 4FOQA 5H9RA 3KV6A 1X33A 4XAAA 4JGZC 3T2TA 4C1XA 2VBBA 4YM1A 1PGL1 4OUSA 4YWAA 3H8RA 4MOAA 3OGRA 1BBT1 1AL23 4J6GA 2IXLA 4P00B 1WW4A 1OA3A 1Y4WA 3QOPA 1UOFA 2YGLA 4P08A 2JG8C 3ZFEB 1ULOA 2CGNA 3FWEA 2PMWB 3S5QA 1IS6A 5FPUA 5KBFA 2TBVA 1S0EA 2RR13 3AYCA 5BNNC 2C5DA 1ZRRA 1OA2A 1RMU2 2R063 2K9ZA 4NRPA 4NWVA 5I91A 5KHJA 3H50A 3SCFA 3DXUA 2SLIA 3ILRA 4BK5A 4OI2A 1UZ0A 3AP7A 4UFMA 2QZ2A 4KWUA 3WV6A 3R4DB 1ZBE1 4AVCA 1ZREA 1F4AA 1OUSA 1RHI2 3NV3A 1CESA 4HT1T 5GLUA 1HB3A 3TAYA 3ZN6B 3RZLA 2DVFA 3E5QA 2WFF2 3N36A 5CYYA 5FOJB 3M70A 2I2SA 1NG0A 2D5HA 4LBQD 1CD3G 4XDQA 1V0AA 3VZOA 2WT0A 1VBD1 2YROA 1RL3A 1OH4A 4EJRA 2AEZA 1WMDA 5H9SA 2ET1A 2RM21 4K8FA 2VQUA 2CY6A 3KGLA 4YVSB 3UYJA 2VQTA 4DPNA 4JHZA 1X36A 4FXGB 1RUD2 1SFPA 1O3SA 3A23A 4FPHA 2WIIB 1QJY2 4QHBA 3AL6A 5J09A 4WM7A 4XUNA 4XQWA 1DCSA 5FZ8A 3A0KA 1EAH3 4X8PA 1ACCA 2J22A 4YG6A 3LEIA 4Q26A 4S2HA 2G4IA 2XGXA 4YM0A 5FWJA 5LEJA 2ZACA 1D0HA 5JSRA 1US2A 4RHV3 1FX5A 1WKYA 2W92A 5FZ4A 5FP3A 4Z8BA 4AEDA 3J9SA 2RMU3 2W08A 1U5ZA 3PTRB 4Q4W2 4B29A 1RUF2 5FPBA 1YI7A 2QQLA 3PUSA 3FFQA 5T54A 3N4MA 2PHWA 3AKRA 3V0AB 4K1ZA 1POV1 1BEV1 4DRRA 2FDGA 4QX2A 5AFBA 2YFZA 3B5LB 4CCKA 5CZKA 2VL4A 3K2OA 5KHGA 2C0ZA 4YPJA 2GMMA 2EALA 4Z2WA 5A3NA 1KJLA 2JIJA 2UY8A 3AM2A 1JZ6A 1HKDA 3W21A 1V6OA 1BBT3 2WNVA 5JDBA 1SPPA 2YPDA 4YW2A 4CUAA 4W6WA 3GBGA 1ND2B 2ARBA 3PU3A 4OHZA 4K20A 4K40A 4QGNA 2XB6C 1SDDB 2ZHKA 2CGOA 1XNDA 2H0VA 1OQEA 2E31A 2I45A 3BALA 5LA9A 2QVSB 1RGSA 4ZS2A 5FDBA 2DVAA 5CFCC 2W94A 3FC0A 5F6LB 1VBB2 1COV1 4QKBA 3E1F1 3OBRA 2JECA 4B4RA 1RIRA 1NCRB 3JU9A 1QOSA 3HMYA 4M3CE 5CBLA 3MGUA 1RXGA 2GDFA 2JDMA 1UYYA 3I97A 5K8SA 3N7MA 4IESA 4RA0A 4X8NA 4HVQA 2VOWA 5C8WA 2BGCA 1UU6A 1VPHA 3WXPA 3POEA 3USUA 2P6HA 1X7NA 1VBE2 4FAHA 1LGCA 1Q8VA 4YFZA 3W5NA 2VULA 3VL8A 1VBD3 3WZ1A 1CIYA 4Y1VA 4R8HA 2IWGB 4AQ2A 4KBBA 3RFRA 4CP2A 1UOBA 1XSQA 1SBDA 3FJSA 2IXIA 5FZHA 4CDXB 2NM1A 1V70A 4TN7A 3VB9A 2XVGA 1TQ5A 1AR71 5A3LA 2HH9A 3PVEA 3J8F1 3LZZA 4CEYC 1OHFA 1UYPA 2WZEA 1DG6A 4MHUA 3H0OA 4EQVA 3OYWB 2P4EA 2ZEXA 4QU2A 5EHDA 2XUMA 1NX9A 3OD0A 4CU9A 5EPAA 4D7TA 3GZTB 3IDAA 4Q27A 2WSVA 5C3QA 5IK7A 5EZWA 3HQRA 1HB1A 1NLQA 4JZRA 3VL9A 2WAOA 5IAXA 5FMBA 4PBPA 2BOJA 1ZRDA 2ES3A 2YC4A 3WINE 5L36A 3BGAA 3U4SA 5FZOB 3ZPYA 1POV3 5A1FA 1PMJX 3N9OA 1VAMA 3MW4A 5F1RA 3INAA 1D4M2 2DVGA 2VZQA 4RS5A 4XFCA 1MQTC 2XJRA 4CDQA 3H3ZA 3E6DA 3HR9A 3CJIB 2J1EA 3J7HA 4YVWB 3C3VA 1YJLA 2KR2A 3CNAA 2JDUA 2FZ2A 4XURA 5LA1A 4JX0A 4N53C 1X8MA 2WYSA 3D4KA 1OOPB 2XHNA 1D0GA 2ZZQA 3NAPB 4Q4V2 3VBFC 1QNWA 2XWJB 4LORA 3WY6A 3ETQA 4BXFA 4XEZA 1MZEA 4X6QB 3I3BA 1QJU2 1J1LA 5A3WA 2JDHA 2ORXA 1V6IA 2Q0AA 1UN1A 1R093 2FCUA 2XHKA 3IPVB 3POJA 1Q43A 3N9NA 1UZVA 1L7QA 2AENA 1DGRA 5BY5A 4MGSA 4Q5OA 4OVEA 2W1UA 4OHXA 3TRSB 5EWSA 4D0QA 2BNOA 2WC2A 2DUQA 3ZYBA 3B94A 3ZFGC 4FP3A 5LBFA 4B7EA 4JGZA 2VBPA 3MEPA 2ZHNA 4YM3A 5HCBA 1EPWA 1SFNA 5LZ6A 3I8TA 4B8EA 3N7LA 1UKRA 3BIEA 3KV5A 1GKBA 2DFBA 2P2KA 1RVF1 4BMBA 5FZCA 1TNFA 2ZGQA 1FT9A 5EQUA 1AL0G 4P9LA 4O9EA 3HJRA 3SQOA 5D8AB 1GICA 1JYCA 5I8SA 5BNNA 2ZTNA 4PDWA 1AR73 5JXJA 1DQ5A 3J8F3 3WDUA 1AR61 1YUDA 3HVDA 5D1IA 4ASKA 5A6XA 4URTA 4HKWA 4AR2A 1GZCA 4QDQA 4DO0A 1KQRA 5C4WC 1XXNA 1D4VB 4KL1A 5K4LA 1JS9A 2Z42A 1RUJ1 4LUMA 1CX1A 4Y4RA 2OPKA 1US3A 1OXCA 1PK6B 4MVTA 1QOOA 4A2UA 1HX6A 1JN2P 1KGYA 2ZX3A 1MZ5A 1GMMA 1DGLA 2JX9A 3JBG1 4XMAA 4QHZA 4KI5M 5FZLA 3VBOB 2JDYA 5L7OC 3ZXAC 2RDRA 1J3RA 3BTYA 1VJ2A 1S2KA 1C57A 1CONA 5A6YA 4LE3A 2R6QA 1CAXB 5FO7B 4QB6A 2GNMA 2NPIA 4XFAA 1S0JA 2VOKA 5IT6A 1W9FA 3ABZA 4TWTA 2GN7A 2O8QA 2QTWB 4LO8A 4CU7A 1CGPA 1I3HA 3IAPA 4CXWA 1QY4A 4XW3A 4OI1A 4ITCA 4RR3C 1GANA 4JKKA 1H2MA 1GFF2 1Y7BA 2MNGA 2O14A 3R0RA 1HQWA 3AFKA 3LEGA 1X82A 3EO6A 4LPLA 4B1MA 3MPPG 2XWBB 1X9TA 2IZWA 3VDDC 1RUC3 4NPLA 4BIFA 3FUQA 2P1BA 3UGFA 4GAZA 4FOVA 2CWMA 2PHFA 3B69A 3C7HA 3POIA 1F15A 1R64A 3Q9OA 1VE0A 2EIDA 4J25A 4WV8A 2MEV2 1PMIA 5JZGA 5M0TA 3DPRA 4ZY9A 2E33A 1KD7A 5A7SA 4DOUA 4QM9A 2WT1A 4CEWB 2WSUA 2QZ3A 4MXVA 3SH5A 1M06G 1HXS2 5EJ3A 5J36A 3ZXKA 3SKJE 3RMXA 2X5IB 3IDEA 2LUWA 3ZR5A 1PNGA 1BLZA 3OTFA 3USSA 3CDZB 5C7GA 1WW6A 2PAKA 4Q1RA 1FPN3 5EJ1B 5GKAC 1UU4A 1ZZ8A 1LOFA 1ZRIA 2ERFA 1UXZA 2RS12 3OCPA 1Q8SA 3R4SA 2UYAA 4KQ7A 1GWLA 3VN4A 2R041 3ZM8A 3VZKA 1FV2A 1RVF3 4LHSA 4B4QA 4E2SA 1KFXL 1NA1B 1DYKA 2WZPP 3AVRA 2Y60A 3HWJA 4JKLA 2C24A 3A0NA 5FRAA 2XBO2 3S6PA 4ZZ8A 5CFCA 5FY9A 2CAUA 5LRRA 1XNCA 2CNAA 1OURA 3AKTA 1DQ1A 3HEIA 3DKWA 1AF9A 1QQP1 5IVVA 1LU2A 2DBNA 4COZA 1H9PA 2WS91 1DF0A 5IHRA 2O8OA 1BZWA 3AMQA 4A3ZA 3ITQA 5L9VA 4PF1A 3RZMA 5DMYA 3KD4A 3HNMA 1RUOA 3QCWA 5FZAA 1NKGA 1A6CA 5FYIA 2VOXA 5BNPB 2PLV1 4FPLA 5F8PA 3EB7A 3JBG3 3D8CA 5DAVA 2GNBA 5JLVA 2XONA 3CQOA 3VBHA 3VBRB 4AW7A 2RE9A 2HWD1 1K45A 4A4AA 3ZYPA 4LULA 1CIWA 2BW8A 3MV01 3IKWA 2B4KA 1AR81 2G9GA 1PVC1 4CEYA 1V6NA 2QQOA 4M3CF 1N1SA 1YNAA 5L19A 4BDVB 4CTEA 2ZGTA 1QGLA 4YZ4A 1R081 1FYUA 2Y6FA 4M01A 5JMCA 5IK5A 3D0JA 2YDEA 4NVPA 4QQPA 1BK0A 5FLHA 3ZYIB 2H0BA 1AVBA 1MS5A 4BU2A 3K4ZA 3MLKA 3KCCA 4FPCA 4MGIE 1A34A 4ZS3A 5L73A 1H8TB 4EYUA 3B00A 4DXTA 2MEV3 2R30A 1JUIA 1W8NA 2PHXA 3IIAA 4N90A 2Q5TA 2WN2A 3ZFFB 1SFYA 2E32A 4AEJA 3FLTA 3JZVA 4LOTA 4NE9A 2XVLA 3JD72 1W0OA 1OPOA 2R32A 4S2FA 1IPJA 1VBA2 4UW5A 2P3KA 1SQ4A 1XBFA 4FPOB 5DZGA 4M3CB 5A3OA 3PUAA 5LATA 2YG0A 3T4VA 1MQTA 4XOGA 5FY5A 2HYXA 4I0AA 1B35B 3HQUA 3RDIA 3T1MA 3AXDA 1HB2A 3M1HA 4RYDA 2VU9A 4FPFA 4QAWA 4EWEA 3IMNA 4AFDA 4CVUA 1JYXA 4N43B 4KMQA 4XJ8A 3KF3A 2FDHA 1WD4A 1ZZ6A 2ID4A 4OUEA 2BRTA 4OZOA 4BE3A 3AP5A 4QX5A 1QJX1 1WLDA 1KITA 2JB4A 3OEBA 4DY3A 3K48A 1Y9QA 2W52A 1UPSA 1VBC1 4NHMA 4DB5A 5C71A 4FPJA 4Y33A 1BXHA 5C8CB 5FKBA 4JQTA 4COVA 2WS93 3D82A 3FBYA 5DAPA 1JYTA 3UNPA 5C3RA 5T52A 2VBDA 3ZFGA 2XVKA 3I7DA 4BQYA 4BCUA 4YW4A 3WG3A 2RG4A 2JJ6A 4V2VA 2OPWA 3THCA 3VD3A 2R1DA 4C1WA 1LHWA 5F3CA 3BTZA 3HAGA 2BWCA 4QQHA 5FJHA 3S7IA 3DYPA 5GZDA 2HWD3 2XLFA 1RUI1 4YW3A 4W50A 4KWKA 1C8M2 1EPZA 1JXNA 4Y22A 4RGGA 3EJKA 3IDCB 1PVC3 1LRHA
chains in the Genus database with same CATH topology
1OQ1A 1G9BA 1V9U2 2RS52 4GALA 1R083 3U11A 5C4WA 2RS32 2KXLA 2VOVA 1PGW1 2JKBA 3AFGA 1YXWA 2AH2A 4A7KA 4TYSA 1WMEA 5J48A 2HWF1 5HXVA 2ZCWA 3IT8A 4Y20A 3WHTA 2WNUC 1NZCA 3SLIA 4FQ4A 1B09A 1Q8PA 2MHFA 4WVWA 1HRV2 4XYXA 3FE5A 4XBQA 1UCXA 5DUUA 4LR4A 3ALQA 4GMP0 3TN92 1PNFA 5FO9B 3ILFA 3E6BA 4K6BA 5FPXA 2BBVA 3FUOA 2HWE1 2WZR2 4R9BA 4Y24A 2R072 4WM7B 1PIV1 2B7YA 2WWSA 1HRI2 1ASJ1 5LK5A 1IKPA 1FAYA 1VAVA 2NP0A 2UU8A 4QD2A 2VMIA 3WDVA 5I8TA 5BYNA 1I5ZA 4AEDB 1RC6A 1PO21 1QJX3 1G8WA 1WGPA 2TEPA 4AHXA 1KXGA 1SLBA 4L99A 3H7JA 3VZMA 1SBFA 1VBC3 1WW7A 1VRH1 1XRUA 4Q4X1 5DDJ2 1ZA4A 1J3PA 3HN1A 4NN0A 1ULDA 1UZYA 3V64A 3O0WA 1UPIA 3AB0A 2K0GA 5JPMB 4LHNA 4JDMA 1BMV2 4XMIA 5CB7A 4LBKA 4QPGB 2RHPA 4JGYA 2WNVB 1RINA 2YXSA 1LEMA 5IK8A 3QH7A 1J1TA 2VVDA 2CL2A 1SDWA 2DTWA 1R1A1 4AQSA 3MLJA 2GH2A 3PNAA 5ABJB 5J7MA 3M3IA 4EN7B 1H0BA 4AFCA 1AYN1 1YRZA 3E5XA 4WVZA 4LBLA 1S2BA 4UBHA 5T5PA 4QPIA 1XYPA 3VKNA 1IS4A 3HBZA 1AL22 2ZGPA 4AXOA 1FMD3 3QH6A 1GNHA 2WL1A 5KC5A 3WQ0A 2HWF3 4ES8A 4K21A 3USUB 2RR12 3AJYA 4CP1A 5FQ0B 3ZSJA 2R062 4M00A 1Z7S1 2DCKA 2VMGA 3SNMA 4B4PA 3WQ7A 1WA4A 4FPKA 5JIUA 5JPNB 5A32A 2BEOA 1V6JA 3ZXEA 2D3PA 1QXPA 5ACA1 2ZZJA 2HEVF 4S2DA 5T5LA 1PIV3 2IXJA 1OSGA 1ASJ3 4XFIA 1UMZA 2PFWA 3I54A 3H8UA 4HZFA 4F3JA 4AI8A 2VW0A 1PO23 3AYAA 1UW8A 3VZJA 5T55A 4G4FA 2ZS6B 1VRH3 2D5FA 1K5MA 2ILMA 2ZGLA 4B7KA 2D3SA 1NY72 2CTVA 4B3NA 5K9YA 4HN1A 1EAH2 1LECA 2VMHA 4CDQB 2UWBA 1ZVFA 4C0HA 5KHIA 1A78A 2YGMA 4RHV2 4KU8A 3QD6A 3ZXGA 2JD4A 4K1YA 5GLVA 2RMU2 5GLZA 1Z0HA 1REDA 1AX1A 4AWDA 2HEYF 4D7YA 1DQ2A 3IM0A 1AYN3 4F83A 1FNYA 1WLTA 3AMPA 5BPXA 3RJ2X 1MEC1 2QQPA 1BBT2 3DN7A 4NWWA 4AQTA 1O3TA 4C91A 4P5HA 4YZ5A 4JGZB 3HD8B 4V1PA 2AGSA 2Q4SA 2Z5WA 5E16A 1WD3A 5CU1A 4YM2A 3MIBA 4ZU5A 3ZSKA 2N7GA 3MIGA 1GLHA 3ZFEC 3VBUB 3JQWA 2VQ0A 1Z7S3 1MVQA 4Q0VA 4XF1A 1BKZA 3ZYRA 1WCKA 5BNNB 4HVOA 4AGRA 4ZKTB 4PDWB 4KG0A 4IV1C 3RYKA 2PHRA 5FO8B 3MFAA 5ACA3 1CJDA 3GZUC 1ENRA 4DY5A 2HWB3 5FREA 1NXD1 1VBD2 1JYIA 4H14A 4P9IA 5C9AB 1O4ZA 1PZ9A 2NYYA 4QQ2A 2WNUA 4BZ4A 1VIWB 4SLIA 2WFF1 1W39A 3NL1A 4R52A 2DUOA 4BLIA 3P3NA 3VGIA 3ELNA 4IL7A 2PHDA 2BVVA 5T3NA 1RJ8A 2KA3A 4YARA 3RZZA 1C5HA 1U0AA 3RS6A 2DWRA 3E6CC 4YG3A 1YCIA 1RUD1 1RUH1 3ZXFA 2QDRA 1QJY1 3ZIXA 2PN5A 4BLJA 3RG0A 4EN6B 4EWAA 3S7EA 1DQ6A 1PO11 5F6KA 5BNQA 4A3XA 2D6KA 1GV9A 2ARXA 4MXWB 5JZGB 4DZGA 3DPRB 5I0TA 5KHHA 4UBGA 4AVVA 2YUEA 1KS4A 1VB2A 3V65A 3NV4A 2GC2A 1AYM1 1UIJA 4LHKA 4I0BA 1AXZA 3PVBB 1UZZA 4NR1A 4RQPC 2GSYA 2SBAA 1DYPA 3POSA 3N35A 4GH4C 2LTNA 3RI8A 4CDUC 2XG3A 1R092 5J37A 5JOYA 2GNDA 2VXRA 5GZGA 1LENA 4IV3C 5SV5A 1IOAA 5CFCB 3PLQA 1ZBE3 4RL7A 5I0UA 1APNA 1MZ6A 2HEWF 3MFCA 2HYKA 4FBFA 1XYOA 2F6BA 1VBB1 3PMSA 1CJPA 3H9AA 1PVXA 5BUVA 5JCTA 3MIFA 2RM23 2YMZA 2VPVA 4E4DX 2XJPA 4BWOA 1QDCA 3VBHB 1AR72 1LOCA 1W6QA 2OZJA 3J8F2 2QNKA 3KCXA 4LTAA 4CDXC 4JDOA 5FLIA 4GIQA 2AREA 4YLZA 4CEYB 3IBMA 3AZWA 4CRQA 5KXCA 3AKPA 1R1ZA 3TB0A 3GHMA 4XFGA 1RUH3 1NLRA 1S0IA 2V09A 2A70A 1YJKA 3KGZA 1AHSA 5TSWA 1N47A 1TE1B 4ISRA 3M3QA 1PO13 1QKQA 1BEV3 3UJQA 5HCAA 5DUXA 3I59A 1OLRA 4W65A 3VHPA 2XJVA 4AG4A 2XH6A 1AR91 4BH9A 3SITA 5BNOC 1G9FA 4YG0A 2P37A 1AYM3 2VW2A 4P9GA 1SCSA 4Q2FA 1MQTB 3ME2A 4I09A 1ENXA 1KDMA 5KXDA 3CJIC 4OI4A 3LA3A 1REEA 1D4M1 1RUC2 2DCTA 2ZGNA 4KWLA 3ZO0B 2JG9A 1V6MA 1OOPC 3NAPC 3OY8A 4Z92B 1AUYA 4XILA 1COV3 2GAUA 4HKOA 4YSFA 3O7OA 2E9QA 1TNRA 1A8DA 3RJRA 1LB2A 1XQNA 5K0UB 1JH5A 2D97A 1DGWA 4LA3A 5AC91 2ZX2A 3RQ0A 3U07A 3ZMOA 1VB4A 1QJU1 4K3UA 4PJYA 1VALA 4AI0A 2CAVA 2XJTA 3ZSMA 4CDWB 5DZEA 4AGVA 2YV8A 1FPN2 2ZGRA 3ZFGB 2JG8A 2D44A 4PIXA 1AXKA 1RVF2 4U2AA 4YGEA 3ZIWA 1X50A 3H1WA 1O5UA 4FPEA 4ISQA 4TLFA 5DXDA 4RD7A 4K9SA 3I2DA 4HSLA 5FLJA 3ZFEA 1AX2A 4IQPA 4H7MA 3THTA 1ZRCA 4Y22B 4AI1A 1H2KA 3OF1A 2BVBA 4IV1A 5DG1A 3MIDA 1RUJ2 1WCSA 3IWZA 1W6OB 3GHNA 3H1MA 1DZTA 4IEZA 3EQEA 1LU1A 5E88A 3JBG2 1AZDA 2JICA 3FLRA 1S0DA 1PK6C 3K51A 3MW2A 4Q4Y1 4SBVA 4CP0A 4YW5A 1J3QA 2ZABA 1O5LA 2D93A 4YYOA 1F2NA 3M3CA 3VBOC 3SHRA 4RGAA 2IXCA 4GQ7A 2A73B 1LTEA 1VP6A 1AR93 5FCCA 2EA7A 1MS1A 3L2YA 4IERA 2OW4A 1QMJA 2EXHA 4XHXA 1KS5A 3O0XA 1LHOA 1U5YA 4HPKA 2JENA 2GZWA 2PHTA 2VH9A 2HWC1 3S30A 2AZ5A 5I8YA 2A75A 2UY9A 1QHDA 4NO4A 1N1YA 2ATFA 3AXEA 1V00A 4EWDA 4XJAA 2ZKNA 4LBQA 3R6SA 5AC93 1S55A 1WUVA 4AHYA 3CF6E 4NHKA 4XFHA 1MR5A 4W6XA 4KH9A 1O91A 2Z69A 4RQPA 2X5IC 2ZGUA 3ZVXA 4MSVA 1ZZCA 1DZQA 3PVNA 5GZEA 3WOGA 2PELA 4IEVA 2BFUL 4GH4A 4COWA 4JGYB 2R1BA 5E89A 3VZLA 4CDUA 2ZMKA 1EV11 5KWRA 3WP5A 3POWA 1ND3C 4OFGA 1AR63 1N3QA 5JAXA 1YFXA 2WQ4A 1QDOA 4IV3A 2EVXA 2OYZA 2C9AA 2ZX4A 4KGGA 4XQDA 2GMPA 2RS11 5FMOL 2D6LX 2WS92 3AX4A 5GLWA 4HK9A 1RUJ3 4I3GA 4PLMA 2EAKA 3UK9A 3NSTA 4AVTA 2XL7A 4N7IA 4H3WA 2XBO1 4QPIB 1ENSA 5EYYA 2R49A 3EBRA 1TMF1 3N7JA 3AMNA 4YZ1A 1MS3A 3RRDA 2W39A 4Q4Y3 1DZRA 1SLAA 1H9WA 5BNPC 2HWD2 2D98A 3VBSC 4WVMA 1N3OA 2PTMA 3VBRC 4COUA 1PVC2 2LM3A 2PHUA 3T1LA 5CADA 4CDXA 1R082 4YNIA 2VG9A 5A32B 4XBNA 4MGYE 3KMHA 2WJSA 3O5SA 1MVEA 4BPZA 2Q1ZB 3ACLA 3VHRA 4Q0SA 3VV1A 1GBGA 4XF3A 2HWC3 1FXZA 4AEKA 4F8AA 1G9DA 3UKNA 5E1RA 4KU7A 3LWCA 1FV3A 4DMIA 4LBOA 1H8TC 1Q8OA 1YLLA 3AP6A 3U4XA 4GB31 4K7JA 3AZVA 4WZFA 2ENRA 5CFDC 3ZDSA 3LB9A 5AVPA 2GC1A 5BNOA 1K5MB 4N53A 3LKJA 3U0ZA 2D6MA 4I02A 3VBFA 4AI2A 3JD71 5JSPA 1LOGA 2R043 1QWRA 5JI7A 3CJIA 1C1LA 1LCLA 1VBA1 1HV1A 1AX0A 4UW3A 4XTPA 1A3KA 3BB6A 3FBMA 1DGWX 2XLAA 1X8EA 1OOPA 4Y1UA 1QJX2 4Y1YA 1EV13 2ZAHA 1QQP3 3RYPA 4GWMA 1VBC2 5F9TA 1NQDA 3ZSEA 1JBCA 1FATA 4IETA 4FPYA 1F5JA 4YW1A 1A8MA 5I0SA 5JI9A 2IFWA 1PHMA 3NV2A 4ONUA 5C8CC 4AFAA 3NJZA 2E7AA 2PLV3 2DV9A 1ULFA 3OBTA 1TMF3 2E63A 2DTYA 4M0HA 3B7MA 3B9CA 3AP4A 4Y4YA 1RJ7A 4XZPA 2CV6A 1LEDA 3EXUA 2ZHMA 2IC1A 4GMP1 5DZFA 3EHKA 1IKQA 3ES4A 2QE3A 3CJXA 3R4UA 2A6ZA 1NOVA 3PHMA 1AR83 1QXJA 4XTMA 5FOBB 5CNAA 1TME1 3WX5A 3H3UA 2V5YA 4P9WA 4P14A 2G9FA 1NCQC 5DUWA 4MX3A 4IEYA 5JSOA 4R9CA 3M2MA 5T5JA 2B9UA 1GZWA 4PLOA 3AYEA 3LAGA 1BVP1 3WW3A 1FNZA 2NMOA 3NO8A 3WP4A 5T5OA 5JWPA 4JAAA 3ZXJA 1FMD2 1IGOA 4HL0A 1ULGA 3GNEA 4XE9A 1MS0A 2VVFA 2PYTA 5L7OA 2HWF2 4H7LA 2ZPXA 1RB8G 1GSLA 2AR6A 2RS31 3B9IA 4E27A 1GZ9A 1LKNA 5J98B 4EV0A 3VBOA 1SMVA 2WNUB 3OPZA 4GB33 2R0FA 2B42B 1S0BA 4RR3A 3LOBA 2E7QA 2RJKA 1I1EA 1ZZBA 4WM8C 1LGBA 1WLCA 1XE7A 1PIV2 1T6GC 4Q29A 1ZRFA 1ASJ2 4HBNA 1ZM1A 3VDDA 3KT7A 3DUIA 3SCGA 5GM0A 1RITA 1BVVA 2GC3A 1ZX5A 3WW2A 1PO22 1ZBA1 2DU1A 2WZR1 3NW4A 4QXKA 5F5QA 1QJZA 3WR0A 1VR3A 5EYXA 4CYDA 4AEDC 1VRH2 1ULEA 3WG4A 4Z1VA 3BCWA 1IHMA 3KS7A 2O1QA 1CAWA 1I9RA 1U12A 1DQ4A 2KM2A 3N3HA 3FZ3A 1CVNA 4FOYA 4XXPA 5HI0A 1RUE1 2XKPA 4LO5B 1E57A 1WW5A 3QBQA 2P3IA 4OZXA 4GKYA 1MS4A 3BPZA 4GMP3 1RUI3 4QPGC 4BIOA 3H7YA 3POYA 2VNRA 1JTZX 4YZ2A 3OJBA 4I30A 4XFBA 1ND3A 1TME3 1AYN2 4KG8A 1PGSA 4HANA 1F8VA 4EN9B 3AKQA 4NOTA 3V0BA 2WT2A 5ABJC 3G6JB 4RSUA 4LNVA 1UX6A 2QUOA 4LBMA 4MUVA 4HVRA 3MIEA 4D94A 3QLQA 4J1WA 3AP9A 2DCYA 2E7TA 2A3XA 4FVVA 1CN1A 3L2HA 3RI9A 2AUYA 4MZUA 3FLPA 4HK8A 1YWKA 4WBBA 2QFEA 5EFUA 1AL21 1HQNA 3KT4A 1Z7S2 5AVAA 5JR7B 3VBSA 3WDWA 1F9KA 3MYXA 2QDNA 4WVVA 2B46X 2D6NA 2YZ4A 4XF9A 3VBRA 4DRVA 1W6QB 4L97A 2HWE3 2JXAA 5CVRA 4LO6B 4XPVA 3BODA 4FAGA 5ACA2 2RR11 2VUAA 4GKXA 3M3EA 2XLGA 2ZOEB 2HWB2 5I0RA 4N9IA 1RUG1 2A71A 3AK0A 3HIFA 4A7ZA 3X29B 4Q1PA 2WNEA 1V6KA 1PM7A 1DFQA 2WFPA 4ZU7A 1YFYA 2PAEA 3ASIA 4KGQA 3RWNA 3LSEA 1GR3A 3RPQA 5B2GB 1ZBA3 2W68A 5CAZA 4I0WB 4Q4X3 1U5IA 3BOPA 3E97A 5E8AA 3I59B 3ZYJB 4RS5B 3GBFA 2D43A 1RUNA 3G7DA 1G7YA 5CFDA 4DQAA 1XNKA 2A6XA 1Q8QA 3WLUA 1Y3TA 4XF4A 1FOD1 4LA2A 1SBEA 1SLCA 2WLQA 4JDNA 1C5IA 3JQXA 4IEWA 2QKDA 1UKGA 4XIKA 1NY71 1R1A3 1UF2C 1LOEA 4KNCA 2JG9B 3OY8B 2A3WA 4AVBA 4R9AA 1PGL2 1W6PA 4DFSA 2ZAAA 4AFMA 3FFZA 2RMU1 5JOXA 1YFUA 2Y26A 3HQXA 3RMYA 2OA2A 1MS8A 3UL2A 2E6VA 2GN3A 4HFSA 3UKTA 1DQ0A 3VKFC 3B01A 4PCRA 5EXOA 5DG2A 1CX4A 3THPA 2VVEA 2H6BA 4AEMA 2JG8B 2VW1A 4IXLA 4AHZA 5JOWA 5A33A 2ZJCA 1V6LA 3AZXA 3LCPA 1MS9A 2VUJA 4BA6A 3WCRA 3VHOA 5KXEA 1H2LA 1ZBE2 2GMEA 2ZMLA 4JRLA 4KWJA 4INDA 3VBUC 1NCQA 4QGMA 3I4IA 1LR5A 3JUUA 4L9BA 1AJKA 1RMU1 4JVAA 2EXJA 4PDWC 2GU9A 3M7AA 2TUNA 4IV1B 1NLSA 1OKQA 4PBOA 4NPRA 1CQ9A 4W6YA 2FQPA 2HKXA 3J4UH 1RUG3 3W59A 1DBNA 2YC0A 1NXMA 4XF0A 3WUCA 2RM22 1GQHA 1RHI1 1HDKA 4OHVA 1EY2A 1KRIA 1DLLA 1VAKA 3AMHA 5GZCA 4G9SB 1QOTA 3FHIB 1EP0A 4PQ9A 3TWIA 4YGBA 2D40A 4GULA 4YVSC 5LEKA 5C9AC 2WLPA 4HMZA 1QXRA 3J26N 3ATGA 4Q8KA 5BXXA 2ETEA 4M0NA 2BNMA 3BTAA 2BTVC 4WM8A 3MZHA 1FOD3 4DNYA 3KCYA 4OUMA 2IXHA 3PTYA 2WQZC 5FBZA 1RUH2 2YYOA 4JC1A 4MGKE 2D6PA 4HPKB 4OI0A 3NKGA 1S0GA 1ENQA 1JW6A 2Z79A 1PO12 1NE4A 1BEV2 4AVAA 1XNBA 5C6CA 3AZZA 2VGDA 2A6VA 2XPJA 3KQRA 1MEC3 3GZAA 4Q4W1 1RUF1 4XHBA 4LBQB 1AYM2 1YFWA 5JZGC 1CAVA 2GH8A 3DPRC 4JV4A 4QPYA 1M4WA 4P9XA 1HQLA 4IEQA 4ATEA 4QQLA 1ND2C 2BQPA 4RQPB 4XFFA 4MV2A 1IPKA 1COV2 3WVJA 3D5OA 3SMHA 2FMYA 1W0PA 1EYBA 4QPGA 4XQ4A 4GH4B 3SXWA 1ZZ7A 1W6MA 4CDUB 1LOFC 2XL9A 4I01A 5J96B 1OPMA 2ZX0A 4E9KA 1GYKA 4IV3B 1NCRC 1SLTA 2E53A 2F4PA 3QACA 4XIOA 5ABJA 1R091 1RMU3 4TSVA 1UU5A 4AF9A 1QU0A 1AXYA 1U5XA 1F31A 3BOWA 1OFNA 1O3QA 2I07B 1BCXA 5CIRA 1DDLA 1G6NA 1RHI3 1POV0 4LLFA 3ZXDA 2WFF3 1WBLA 2LALA 1W6NA 4DS0A 1VBE1 4Q0QA 5JVVA 5KXBA 5JOZA 3MPBA 4G3YC 4WVMB 3WDXA 3FMGA 3VBHC 2OUHA 5FQ0A 1SCRA 2XKOA 1RUD3 1QJY3 4PIZA 4CZSA 2JEMA 1HV0A 2Q30A 3TBDA 1LESA 4AFBA 4HLTA 1PZ7A 1KFUL 5K7PA 3OGGA 3FX3A 1WMFA 3WP3A 4ZU4A 1Z78A 3SH3A 1QF3A 3PVOA 1AR92 3MIHA 2JDZA 4Q4W3 1RUF3 2DCZA 3CEWA 1IZ3A 3VLBB 4QMAA 2ZGKA 3ES1A 4YVWC 1XYNA 3ZX7A 1C4RA 2XJUA 5BNOB 4N53B 4P9YA 3VHNA 3O14A 3CU7A 3WP6A 3VBFB 4YFWA 2Y0IA 2UWCA 1C8NA 2PAMA 3MI8A 5H9QA 3GYDA 1L3JA 4IEOA 4Q4V1 4BOWA 4D7SA 4EN8B 3WQ1A 4FXKB 3ENRA 4P9JA 1I6XA 1LOBA 3CO2A 2QCSB 2ZX1A 5AC92 1RUC1 4Q0PA 1CAUA 3HT2A 3GF6A 1BQPA 1G9CA 2Q8OA 3TNPB 3WHUA 1VBB3 4FTSA 5K0UC 3ZN5A 1ZNPA 3WT3A 4O9GA 2NQYA 1SLIA 4LUKA 1C3HA 2DVBA 4CDWC 3TOJA 3W9AA 5I93A 1WLWA 4RFT0 3WW4A 1PZ8A 4NHLA 1N1VA 1AR62 5D8AC 1VBE3 1FPN1 3DF0A 1LODA 3IDBB 4GXLA 2PA7A 1YYNA 3WUDA 2EXIA 1O3RA 5GZFA 3VBUA 2NLRA 4X6RB 2BWAA 5C4WB 2C1FA 3NWKA 2IXKA 5BV6A 1LULA 4HKLA 2WINB 1DGRN 3ECQA 1GZWB 3ZN6A 4E2QA 5JIAA 2ZA9A 4Q4Y2 4Y20B 4AHWA 4WZCA 5L7OB 4Y1ZA 1OFSA 2RJLA 2A3YA 1G9AA 2P17A 3BIWE 2V73A 5LRSA 2EXKA 3AYDA 1O4TA 1OD5A 4YVSA 1LOAA 5C9AA 3NKTA 4LE4A 4LT5A 4JRAA 2CGPA 3LOIA 3TNQA 1BJQA 2X53S 4R4XA 5IK4A 4F7ZA 4RR3B 1D4M3 4GWNA 3KSCA 4R9DA 2A5ZA 2CYFA 2HWC2 2B45X 4L92A 5HCFA 3VDDB 4IEUA 3SH4A 3PMEA 1D2QA 3DGTA 1H1MA 1N3PA 4LO7A 4Q4V3