2WS92

Equine rhinitis a virus at low ph
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
200
structure length
200
Chain Sequence
GTTYCYSKPDGRPPSTVSDPVTRLGPTLSRHYTFKVGEWPHSQSHGHAWICPLPSDKLKKMGSFHEVVKAHHLVKNGWDVVVQVNASFAHSGALCVAAVPEYEHTHEKALKWSELEEPAYTYQQLSVFPHQLLNLRTNSSVHLVMPYIGPGPTTNLTLHNPWTIVILILSELTGPGQTVPVTMSVAPIDAMVNGPLPNPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords P1
publication title Equine Rhinitis a Virus and its Low Ph Empty Particle: Clues Towards an Aphthovirus Entry Mechanism?
pubmed doi rcsb
total genus 41
structure length 200
sequence length 200
ec nomenclature
pdb deposition date 2009-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2ws9201
1D4M1 1RUC1 2WZR1 4GH4A 4WM8C 5ABJB 5C4WC 4WM7B 1AR61 2WS92 1QQP3 1M06G 3NAPB 3CJIA 1R1A1 4RS5A 1VBB2 4JGYA 4Q4V2 1RUH3 5AC93 5L7OC 1VRH1 2ZAHA 1ZBE2 4N43A 1Z7S3 4RHV1 1QJU1 2R063 4GMP0 4QPGC 2WZR2 1ND2C 3JBG1 2HWB3 1VBA2 1AR62 2XBO3 5CFCB 1W39A 5DDJ3 1AL21 3CJIB 5C9AB 5C8CB 4CEWC 1NG0A 1V9U1 3DPRC 3S6PA 3JD73 2IZWA 1RVF1 3IDEA 4Q4W3 5FOJB 1AL0G 1QJX2 4GB32 3VBOA 1PO21 1TME3 2HWD2 4RHV2 1AR91 1RUE1 2HWF3 2RS32 1AR72 4RQPC 1K5MC 1QJY1 1RUJ3 4WM8B 4YVSA 1AL22 5C4WB 1PO11 1V9U2 1OOPC 1AUYA 4N53C 1H8TC 1NA1C 3DPRA 1BEV1 2XPJA 1RMU1 4GMP1 4PDWC 1VB2A 5L7OB 3VDDA 5LK7B 1RHI1 1NCRC 3ZFGC 2HWE3 1F8VA 4RR3C 4QPGB 1HRV1 1ND2B 4Q4Y2 5ABJC 2RS53 1OOPA 4CEWB 4N53A 1BEV2 1H8TA 1NA1A 3DPRB 1MEC2 3VBUC 1HXS1 1RHI2 1R083 4FTSA 4SBVA 1C8M3 3J8F1 1X33A 1FOD1 1NCRA 1RUI3 1HRV2 1FMD3 1Z7S1 1AYM3 4RQPB 1OPOA 1RUG2 1K5MB 3ZFEC 4YVWC 5ABJA 2HWB1 1ASJ3 3ZXAC 5C9AC 5C8CC 3NAPA 4N53B 1H8TB 1NA1B 1EV11 5ACA1 2FZ1A 1HXS2 1HRI3 2HWC3 1RUF3 1HQNA 3JD71 2RMU2 4PDWB 1E57A 3J8F2 1COV2 1FOD2 3M8LA 1PGW2 3TN91 2RS11 1NCRB 4Q4Y3 3ZFGB 1TME1 2RR12 4RR3B 3VBFC 1TMF3 2QQPA 4YVWA 1VB4A 5CFCA 5BNPC 1RUJ1 2MEV2 5ACA2 5C8CA 5C9AA 2R041 1PIV1 4FTEA 5A33A 5FMOS 1BBT3 2R072 1AYN3 3VBUB 1B35C 1POV1 2RS12 1EAH1 2WFF3 1D4M2 3VBHB 1RUC2 1NOVA 1A6CA 1ZBA3 4IV1B 3VBFA 3ZFEB 1VBD3 4YVWB 1VBC3 4WM8A 4IV3C 1R1A2 5C4WA 3VBSC 2R042 1PVC1 2X5IB 3JB4C 5A33B 1VRH2 2RM21 1RUD3 2RR13 5L7OA 1QJU2 5FMOL 1C8M1 4QPIC 1VAKA 2GH8A 4QPGA 3JBG2 1RUI1 2WS93 4CDUC 3VBFB 1ND2A 4Q4X1 1AYM1 3JB8A 1VBB3 2PLV1 4IV3A 1PVC2 5BNPB 1FPN1 1CD3G 4CEWA 4Q4V3 1RVF2 2ZTNA 1R091 1ZBE3 2RM22 1PO22 4AEDC 1B35B 1D4M3 1AR92 1RUE2 1RUC3 2HWC1 1RUF1 2WZR3 1AR81 1VBA3 1AR63 2DF7A 1VBE1 4QPIA 4Q4X2 4RQPA 1QJY2 1K5MA 1PO12 4IV3B 3VBSB 1QQP1 1VRH3 1R092 1QJX3 1RMU2 4GB33 1HX6A 4LLFA 4RHV3 2HWD3 1QJU3 5JZGC 2GSYA 1NCQC 1BBT1 1AYN1 1RUH1 1AR73 2RS33 4PDWA 5AC91 1AR82 3ZFGA 3VBHC 4EJRA 4QPIB 1AL23 4RR3A 4IV1C 2R061 4CDUB 1V9U3 4FTBA 1MQTC 4CEYC 2XBO1 1QQP2 5D8AB 1PGL1 5DDJ1 1PO23 3ZFFC 1AR93 2X5IC 1NY71 3VBUA 4AEDB 5AC92 1NCQA 4Q4W1 2WLPA 1Z7S2 4GH4C 5CFDB 3VBHA 2HWF1 2R062 1PO13 4IV1A 4RS5C 3ZFEA 1BEV3 2HWB2 1MQTA 5A32B 1MEC3 4JGYC 1PGL2 1EV12 1OHFA 1QJZA 3ZFFA 4Q4V1 1RHI3 2X5IA 3JD72 5K0UB 5J98B 5JZGB 4Q4W2 1HRV3 1GFF2 1NCQB 3TN92 5BNNC 1TME2 2HWF2 1RUG3 4CDQC 2HWE1 1VBA1 1MQTB 4CEYB 1RUJ2 4JGZB 3LOBA 2RS51 5BNPA 1HXS3 2BFUL 2RMU3 1PIV2 3ZFFB 3VBOC 3J8F3 1COV3 1FOD3 4CDXB 1QJX1 4GB31 2HWD1 1B35A 1EAH2 5BNNA 1R081 2RS31 1AR71 2HWE2 4GH4B 4RFT0 4CDQA 4YVSC 1FMD1 2MEV3 1EV13 5ACA3 4RS5B 4JGYB 2RS52 3VBSA 2ZZQA 2Y26A 2R073 1ASJ1 5D8AC 5BNOC 4Y4YA 3FBMA 3TN93 2RS13 4N43B 3VDDC 1X36A 4BCUA 1ND3C 1F2NA 1HRI1 4Z92B 5BNNB 1R082 1SMVA 1C8M2 5CFDC 1WCDJ 4CDQB 1RUI2 4Q4Y1 1FMD2 1AYM2 1R1A3 4CDUA 4FSJA 2R043 2TBVA 2PLV2 1BMV1 1PIV3 1FPN2 1TMF1 3VBRC 1ASJ2 4CDWC 1MEC1 1POV3 5D8AA 5BNOA 3VBOB 1EAH3 5J96B 5K0UC 1HRI2 2HWC2 1RUF2 4AEDA 1ND3A 2WWSA 4NWVA 3JBG3 1VBE2 5CFDA 4YVSB 2WFF1 1RUG1 4WM7C 1PVC3 1DDLA 3NAPC 1ZBA1 1BMV2 1TMF2 2BUKA 5A32A 1RVF3 1VBD1 4NWWA 4Y5Z0 4JGZC 1VBC1 3VBRA 4CDWA 2RM23 5BNOB 5GKAC 1RUE3 3VDDB 2BPA2 4CDXC 2RMU1 5K0UA 1BBT2 5JZGA 1AYN2 1RUH2 1COV1 1ND3B 2VQ0A 1PGW1 4Q4X3 1C8NA 1POV0 1QJY3 1RUD1 2RR11 3HAGA 2WFF2 1RB8G 2PLV3 1FPN3 5CFCC 1ZBA2 2BFUS 4WM7A 3CJIC 1OOPB 2BBVA 1VBD2 2WS91 1VBC2 2MEV1 1R093 1RMU3 2XBO2 4CEYA 1VBB1 3VBRB 4JGZA 5DDJ2 4CDWB 4GMP3 1NY72 2R071 2FZ2A 4N43C 1CJDA 1AR83 4CDXA 1VBE3 1ZBE1 1IHMA 1RUD2
chains in the Genus database with same CATH superfamily
3S5QA 2PHWA 4DZGA 1W8WA 2WZR1 3T09A 1VJ2A 1UAIA 1UCXA 2GAUA 2VOVA 4WM8C 2Y64A 3EBRA 5IUQA 4TTGA 5C4WC 5F9TA 3HQXA 1E5IA 5FY7A 1H1AA 1QQP3 3LPGA 1R1A1 4RS5A 3CEWA 4XHBA 4BB3A 5C5UA 1WD3A 1SPPB 4ZS3A 3U4XA 2ARAA 3VZMA 1ENSA 1LHVA 3V64A 4Q4V2 1RUH3 1KD7A 4Q0VA 2W52A 2XONA 2ZAHA 1K42A 2J1AA 3QH7A 3LCPA 3TBDA 4BQ3A 1D2SA 2JXAA 4RHV1 3AVRA 2NMNA 4AZZA 1S2EA 2R063 4M00A 2P3JA 1LULA 1LGBA 1LOFA 1UMHA 1XNBA 2J1VA 2WZR2 4OUMA 1QH7A 4ASLA 2OW4A 1XE7A 2ERFA 1TVGA 2OUHA 2XQXA 3VZLA 2PQQA 3IDCB 4CP1A 3EJKA 3T2OA 1KRIA 1AL21 1X8MA 3CJIB 2C9AA 1NKGA 4E2GA 5C8CB 5C9AB 1UX7A 4XUOA 3GYDA 3NSTA 4LK6A 3LDRA 3S5AA 5FO9B 2RG4A 4BLJA 3CHXA 3K3OA 4KH9A 2Y6LA 3Q8EA 4MHRA 5FOJB 3ZXGA 5DAPA 4GB32 5KWRA 2DBNA 1PO21 1H6YA 3Q9OA 4RHV2 4I0AA 2HWF3 4P9GA 4XUPA 2VH9A 1ULCA 1N1SA 5K4LA 2GNMA 3RWKX 3HN3A 4PBOA 5JR7B 4KU8A 3CL1A 1QJY1 3EB7A 1DQ2A 2J22A 1RUJ3 4CP9B 4YVSA 1AL22 4N8MA 2YC2A 3ABZA 5E6HA 4N9IA 2VBPA 1Z0HA 1W8UA 1IPKA 2BNOA 1VR3A 1H8TC 2CAUA 1NA1C 5FP9A 2EIGA 4UXAA 4BZ4A 1BEV1 2VUDA 2J42A 3DXTA 5APAA 1YI9A 1HB2A 3AMHA 1RMU1 1WLDA 2QBXA 5T3NA 2R6QA 4UFIA 4UBGA 5HCAA 5LA9A 2WA3A 5KC5A 2Q8OA 2VY0A 3D4KA 4PDWC 1VB2A 2D3PA 2ZMNA 4XBNA 5L7OB 3H8RA 4YSFA 1RHI1 2GNBA 5IK8A 4LO7A 1F8VA 4CTEA 2ZGUA 5FZHA 5F5AA 3U11A 2Y6HA 3PU8A 4XJUA 5IATA 5T5OA 2WWUA 1UY4A 3DXUA 1W06A 5FPVA 4LNVA 1L7RA 4GD4A 3SKVA 2ZACA 1J3PA 2P3YA 4CEWB 5A7WB 3M7AA 1BEV2 1H8TA 1G9FA 1NA1A 2ARCA 2CGPA 3MDPA 5M0TA 1Q8SA 3ZIWA 1O4ZA 5KXBA 2ZGRA 1Q56A 4HVQA 1MS9A 3AX4A 3O5SA 1HXS1 4XJ9A 2D97A 1CAWB 1UU6A 1SBDA 1GZCA 1RHI2 3TEYA 1YQCA 1LECA 5EPAA 2A6ZA 3OEBA 3SKJE 4CA9A 2E7TA 1GBGA 2ZAAA 3AYEA 4M4RA 4COUA 3K77A 4E9KA 2VCBA 1Z7S1 3KQRA 5T54A 2PN5A 1HW5A 1EPZA 4NHKA 2DTYA 5IK4A 1RUNA 4IW3A 1RUG2 2Q8CA 4QXHA 3KMHA 3KGLA 5I0UA 5AFBA 5FP8A 1LOEA 1ASJ3 2PTMA 5HV0A 1W2OA 2F6BA 2ZA9A 4AHZA 4IQPA 3WCSA 2BWCA 3S0MA 1REFA 3ACFA 1JOPA 1O8SA 2VMDA 3AZVA 5FZ9A 2H0BA 2ZABA 1W6PA 1HXS2 2Z79A 1HRI3 3NKGA 4GQ7A 4Y5TA 5FXXA 4YW5A 4GXLA 2QTWB 1C4RA 2R30A 4M0NA 1E57A 3N9LA 3V56A 1W9TA 5FKCA 2Q1ZB 1PGW2 2ZMKA 3BODA 2XWBB 2RS11 3ZKUA 2Y38A 1F5FA 1Y3TA 2WQ4A 1TME1 3AZXA 4LK7A 3O1VA 1C1LA 2P3KA 2RR12 3DKQA 4IGQA 4XFCA 5FYBA 3WDTA 4MUVA 5FYSA 3NL1A 4I3GA 3ACIA 3CZUA 4GWJA 4JDMA 2XHNA 4NIHA 2W46A 3D82A 3ZYBA 3WP6A 2QQPA 3RZMA 1UZ0A 3MPPG 2QFEA 4KBZA 5LA1A 3MEPA 5BNPC 1OD5A 1UKGA 4S2FA 1YRZA 3NNGA 3OUHA 1YWKA 3ES1A 3PJQA 4J25A 4AGRA 4MZUA 3WV6A 4OI2A 1DZTA 1MS8A 4HK8A 3AM2A 3FMGA 1QXRA 4DXZA 3AB0A 2BTVC 4FTEA 4QMAA 5FP4A 3VBUB 4MXWB 1CAVA 1PZ8A 2H6BA 4Z2AA 1MR5A 3ZOIA 1POV1 1OBNA 2RS12 1RINA 2JG9B 1UF2C 4QWNA 3ROUA 1D4M2 1ZA7A 1D0GA 5JIAA 1A6CA 3TAYA 1G9AA 5F39A 2ARBA 1AF9A 2W47A 3RFRA 3OY8B 2O14A 5HCFA 1LTEA 4L97A 2QZ3A 5I8TA 1XYNA 1U12A 1LGCA 5EZWA 2FDFA 3VBSC 4OHYA 2W95A 3FC0A 3AFKA 3ZPYA 3WG4A 1XXNA 1SEFA 3MF6A 2LM3A 3ZXLA 1AJOA 3Q8BA 4AQ6A 3J7LA 5FKBA 3AZZA 3RWNA 1XQNA 3FE5A 5I93A 2JDAA 4K7JA 4AEJA 1AXKA 5A33B 1HDKA 3ME2A 3KVAA 1DBNA 1RUD3 1FAYA 3PLQA 5EJ1B 4YM2A 1W9FA 5H9QA 1QJU2 4CP0A 5IVFA 2BWAA 2GDFA 1SLCA 1VE0A 2UYBA 2WKKA 4XDPA 4QPGA 4CDUC 1ND2A 4K8FA 3JUUA 2A7AA 1CPNA 2EAAA 4NPRA 5F1RA 4N7IA 1VMHA 1WGPA 1FPN1 4YG6A 3J7HA 4JRLA 1CD3G 1H8VA 2XLFA 2VC9A 1W8OA 4CZSA 3IN9A 1RVF2 2ZTNA 3J7NA 1N3PA 3PNAA 5AVAA 2BNNA 4KI5M 1ZBE3 5GLZA 1QXJA 3ETPA 3VD4A 3V65A 4TWTA 1BCXA 3GCWA 2DDUA 3MW4A 2CV6A 1UD1A 5J3UA 1AR92 1RUE2 1RUC3 2EIEA 4D6RA 1JUHA 1RUF1 1ZRDA 1DF0A 4MGSA 4IEVA 4QQHA 2YPJA 5JSOA 1AR81 3D0SA 4D7SA 1PX4A 2E33A 1H2KA 3N7LA 4RQPA 4EN0A 5L19A 3GXUA 2JKXA 5EWSA 1H9PA 5EYXA 4QDRA 3W58A 2FMYA 4Q0SA 3MHZA 4IV3B 3FHQA 3DL3A 4GULA 4YW1A 2E51A 3LF7A 1HQWA 4FQ4A 3OSDA 5JPNB 1QQP1 4B4QA 4A2UA 1POQA 3DEMA 4XJAA 2LTNA 4MGTA 1O5UA 2IXKA 1NXMA 2HYXA 2W2IA 4IGPA 3JQWA 4G4FA 3MLKA 3IBMA 1K12A 5A7QA 1RUH1 4LEJA 1AR73 3R4DB 3VLBB 1AR82 2VZQA 2QQMA 1EYBA 4MLOA 2CDPA 3CIHA 3O0XA 4K9SA 1O4TA 1UPIA 2DU1A 3AP7A 4IDZA 2Q8DA 3USUB 2X53S 5A6ZA 5FLJA 1OD3A 2R061 3ASIA 3WQ1A 1VRBA 4AHXA 4AVVA 5CG9A 2OQ6A 3DGTA 1MQTC 4CU7A 1UN1A 3OBZA 4A45A 2VOWA 1BKZA 1NQDA 1TE1B 1H2MA 2N7GA 4O9GA 1QQP2 5FLIA 3HPNA 4D69A 2LRPA 4Q27A 1XC6A 3ZFFC 4E2QA 3IIIA 2X5IC 3Q8AA 4R4XA 1UW8A 1S0CA 4Q26A 3I3DA 4ATFA 4AVTA 4FOYA 4CCMA 5A7OA 5C7GA 1HB1A 3KWVA 1CWPA 1G8WA 4P9XA 1QJFA 4BISA 3OGSA 2VMCA 2BERA 1SFPA 4NPMA 1LNSA 4LBOA 2HWF1 3M1HA 4ARYA 2CGOA 2R062 1IKQA 1PO13 4AVCA 5CU1A 3VDCA 3ZDSA 5FREA 1W8HA 2OIIA 3OCPA 3ZFEA 2E9QA 4YARA 1MQTA 3KCXA 1MEC3 2JDPA 4JGYC 1O3RA 4BU2A 2DVAA 3CBNA 3RS6A 3SNMA 4ORFA 4AGVA 2Z42A 1MZFA 3VKNA 5FPAA 1YQ2A 3VUOA 1S2KA 3ZFFA 3KLSA 4FFHA 5LW9A 1W6QB 2X5IA 1RIRA 3KF5A 5K0UB 5J98B 4AXOA 4YWAA 5C3RA 1XSQA 4O7XA 1GFF2 4NO4A 2D6KA 1BXHA 5HPOA 4JRAA 2HWF2 4G9SB 3OYWA 5JOZA 5LBFA 2DFCA 3AJZA 2IUWA 3KT1A 1JYXA 1RGSA 5JWPA 3RQ0A 1IPSA 3WP3A 3DUIA 1VBA1 4AYUA 1ZZ9A 4R9DA 2QKDA 4A3XA 2YDEA 1JOJA 1LOGA 2EICA 2ZPXA 4QPYA 4R8HA 4FOVA 3ZKYA 3OGVA 5FOBB 1JH5A 1RUJ2 4BJ0A 4JQRA 5C33A 1DGWX 3PDQA 3NKTA 5IT6A 2W1UA 4PQ9A 2JDZA 3GZUC 2OUJA 2VUAA 2RMU3 4E2SA 1JOBA 2JE8A 2VNGA 5GZDA 5T5PA 4HN0A 2A6XA 2VBBA 1J1TA 1XNTA 4BIOA 4CDXB 1MZ6A 3I59B 1SLAA 3GBFA 5FPLA 1PVXA 4KNCA 4CCNA 2FDKA 4QGLA 1YNAA 1LODA 4X8NA 5FUNA 4P9JA 4E8DA 3ZXEA 1UMZA 5C3PA 1W3XA 4Y20B 1D4VB 1CIYA 1OUXA 1SFNA 2CSGA 2SBAA 5FYVA 4RFT0 5FMBA 1OFSA 2LW8A 4NRMA 4AGGA 3PUAA 5FXVA 1EV13 4RS5B 1KS5A 1S2BA 4OZOA 2ZX2A 5LATA 2BYVE 4UW5A 2DVGA 2Y0OA 3AMNA 4YFWA 3U10A 5C3QA 3ACHA 2R073 1ASJ1 1FT9A 3AC0A 3L2HA 1LCLA 4ET7A 3FBMA 2R0HA 4YNIA 4IESA 5EHDA 1H4GA 3TN93 3UL2A 3ZO0B 1W90A 2PA7A 2WINB 4OLLA 4IGOA 2EXKA 1MVQA 1IKPA 1HRI1 3OD0A 4YLZA 5BNNB 1D2QA 4O9EA 1LENA 2VXRA 3CNAA 3OD4A 4NHMA 1WCDJ 3WW4A 4W8JA 5CFDC 4CDQB 1VMFA 2VVFA 1DYPA 3R05A 4XJWA 4MGIE 2W3JA 4TLGA 1R1A3 4KWKA 3VD5A 2E53A 4FSJA 4YGBA 4D3WA 2Z5WA 1BHGA 2PLV2 5FY8A 1YXWA 1BMV1 5JVVA 4R4ZA 3DKWA 2ADEA 4INDA 1ASJ2 1SHWB 3C7EA 5FBZA 2CU5A 5FZOA 4CDWC 4RGKA 4OQ8A 5F6LB 2AACA 1JW6A 1IOAA 1X7NA 1EAH3 5EFUA 1YI7A 1O4YA 5FTTC 2BOIA 3ATGA 1CX4A 3WG2A 1HRI2 2Y34A 3BTAA 2RDQA 4UBHA 4AEDA 4NWVA 4MH0E 2IVIB 2G4IA 2VD7A 4TYSA 3VD3A 1ZZ6A 3BPZA 2BU9A 2CWMA 5A1LA 1VBE2 1FX5A 4NMIA 5CFDA 4KBBA 3UJOA 4EN8B 4YVSB 5LBCA 1LRHA 4AFAA 4WM7C 1PVC3 2UY9A 3F2ZA 2K9ZA 3MBWA 2QQNA 3SQOA 2ZEXA 1BMV2 1LHOA 2BUKA 3H50A 3POFA 3ZSMA 5A32A 2UYAA 5JSRA 1ZNPA 1REEA 1G9BA 4XMIA 1F15A 4CDWA 2RM23 4AHYA 1ODNA 1JMUB 1DGRN 1QH6A 3FBYA 3PVOA 2BPA2 5GLTA 1GZWA 5GLWA 2GMMA 2OKXA 1WCKA 3PVEA 4B1MA 2XJUA 5JDBA 4Q4X3 5FK8A 1QJY3 1RUD1 2JB8A 3CKHA 5I8SA 2BOJA 4J1XA 3LGRA 4DY5A 5SV5A 1VP6A 3NW4A 1JS9A 4W4ZA 4FT8A 4FPLA 5CFCC 4M3CB 2E63A 4HBNA 4QKFA 4WM7A 4JQTA 5FY1A 5L9RA 2ZCWA 4EZ4A 1YUDA 4P14A 2PAMA 4H7LA 1NAEA 1RMU3 3ZPOA 2NZ9A 4HMZA 1WWYA 2QQJA 3BU0A 1FV2A 1X9PA 1WZXA 3AMPA 4SLIA 3HN1A 1QKQA 5CKQA 2D6PA 1J83A 4N43C 1ENXA 4W6WA 5FY5A 1ULFA 1ZBE1 2WAAA 2WWJA 4FAGA 5I0SA 2QNKA 4YM0A 1IHMA 2I74A 1RUD2 3D5OA 3LAGA 3NRUA 4N90A 4AAPA 1RUC1 3D8CA 5BPXA 3LWCA 4W65A 2AZ5A 2GC3A 4GH4A 4XAAA 3UGFA 1OC1A 3RZLA 3GZAA 3V0BB 3OGRA 1EP0A 4BXFA 2LALA 2OZJA 3DN7A 3N7MA 1UY2A 1M06G 1YIPA 3E6DA 2A5ZA 2TEPA 3IPVA 4GKXA 2AENA 3PIJA 3SHRA 3VL9A 2X05A 2GC1A 2QQUA 2ZGKA 3VN4A 2HBUA 4QQLA 1QOTA 4BWOA 5IVCA 1W6PB 2BNMA 5FP7A 4DY3A 2ZX1A 4RFRB 5A6YA 1Y7BA 4GA9A 4RA0A 1OH4A 2O8OA 1OURA 4H2AA 4ES8A 5A3NA 4AI1A 4M3CF 5FUPA 1ZBE2 4N43A 4Y1VA 4P00B 2NYYA 1Z7S3 4UF0A 5IVJA 1SBEA 2PELA 2V72A 1FNYA 2TNFA 1CAUA 4LQRA 3W20A 2EVXA 2Z4FA 4PIYA 3VDBA 4EE2A 2YU1A 3JBG1 4NJ4A 4PLNA 3G6JB 3QH6A 4XQ4A 4DFSA 4GJZA 5KHKA 3UGHA 1APNA 3IWZA 4PF1A 2YZ4A 4XF4A 1W2NA 4YG0A 2VU9A 1F4AA 2UWCA 5DDJ3 3O1SA 4QGNA 1GKBA 4MG2A 4NOTA 1HB3A 2R49A 2PHXA 2ZHKA 5FYUA 4NRQA 2D98A 2IZWA 4KL1A 4LOTA 1C5IA 1BZWA 4V2WA 4OYUA 1TME3 3R4SA 4YYOA 1ZRIA 4L2NA 3KF3A 2P6CA 5KHIA 1JZ7A 2ZOEB 3IDAA 1AR72 2YG0A 2W08A 2J1SA 3H0OA 5EP9A 4YG3A 1K5MC 2IFRA 4NHLA 3PUQA 3UKVA 4LBJA 3WUDA 3DYOA 3NNJA 4LTAA 1J59A 1O7FA 2HEVF 1BLZA 1PO11 4UFLA 1AUYA 3K2OA 4TN7A 2UURA 1ULOA 4R52A 1I3HA 3WDVA 4P5HA 3WT3A 1BVVA 4OHXA 4PI2A 3KGZA 1JUIA 4FPEA 3OPTA 1ZVFA 4AI9A 4XQWA 3E6CC 3NV1A 3ZSKA 1GWLA 3VZOA 1K5JA 1QWRA 2CGNA 2WJSA 1XOYA 2NN8A 4DEVA 1URXA 3LE0A 4E8CA 3T2PA 3VHNA 3M3OA 1AX0A 2HEYF 3HNYM 3H9AA 3ZFGC 1W05A 3NO8A 3PTYA 4NR1A 1UY3A 4Z82A 2JDNA 2VMHA 3X29B 1F35A 2WN2A 4XE9A 5FR3A 4RR3C 4QPGB 5JI9A 3CLPA 1UU5A 4GWIA 2DYCA 1ND2B 4I0BA 4Q4Y2 4QHBA 3TNPB 4DXRA 3U07A 4AI2A 2VW2A 4FPHA 4AVBA 5ABJC 3WNPA 2JICA 5FZDA 2CL2A 2VZOA 4IERA 3RI9A 3ZM8A 2JIGA 1OA4A 1XE0A 3DPRB 1MEC2 4K1ZA 4XCBA 5LWBA 5DAVA 4O61A 1EPWA 4COWA 4QGMA 3FL7A 1RTVA 2DUQA 2WT1A 3O1MA 4XILA 1GR3A 1JHNA 2VXJA 4TSVA 3I3MA 3BOPA 3I7DA 3ZN6B 4DIQA 1R083 1J3QA 3ZLIA 5K9YA 4Z8BA 2WUHA 4EWDA 1IG3A 5A3LA 1UNBA 5DUXA 3GHNA 3VL8A 1DZQA 1QHDA 2LUWA 1OT5A 5FFOC 2FQPA 4COYA 4RQPB 1QY4A 2PHUA 2DUPA 2VCMA 5LRSA 5G04L 2VTXA 3K75B 4PQQA 5FXZA 5J37A 1W6MA 3WOGA 4CU8A 4CCJA 4KMQA 5ABJA 2HWB1 4A6SA 4LHKA 2DVDA 3KZ4C 3ZXAC 3O0VA 4BPZA 3NAPA 4N53B 4BQ2A 5LA0A 1XNAA 4ZHNA 5CAZA 3LDKA 4LBLA 5GZFA 1EV11 5HV4A 1XNDA 2PMWB 2OYZA 2ZKLA 1UY1A 2X09A 4A3ZA 1SLBA 2DUOA 3BOWA 4Y1XA 1RUF3 2WZ8A 3JD71 3O14A 2RMU2 1LB2A 3SLIA 4YGCA 5I0TA 4XFIA 1MS5A 2DBIA 4AI0A 3I2KA 4EQVA 3TN91 5DPNA 1G9CA 4PHZA 1NCRB 3B02A 1TG7A 1F5JA 2HBTA 4UW6A 3K3NA 1V00A 3O12A 4OQ9A 3N35A 3PMEA 4P9WA 4P02B 5A7NA 2EA7A 5FZ8A 2O0OA 4IEWA 4RD7A 2VG9A 4AI3A 4ZZ5A 2O1QA 1CR7A 5KBFA 3M3EA 3AP4A 4D7YA 1JN2P 3G7DA 1JYWA 5DMYA 5JPMB 4B4RA 4EZHA 1CJPA 2R072 1G86A 1B35C 4R9CA 5ANQA 3B94A 4QX8A 4D6SA 5FZIA 3SCHA 4A44A 1NE4A 1EAH1 3LSEA 2VOTA 2VMEA 4XTMA 2JX9A 4XF3A 4DS0A 5HXMA 5F2WA 3NJXA 2VZRA 5LASA 5LBEA 2P34A 3F95A 1JBCA 2E7QA 3ZFEB 4YVWB 3NNFA 2GMPA 2ZHNA 3MI8A 4WM8A 3WY6A 2BP6A 1R1A2 1P8JA 5C4WA 3TOJA 3WQBA 1YQ6A 1KXGA 1PVC1 2ARXA 3RYKA 5C3SA 2JDKA 1Y9GA 4DXTA 3BCWA 4IEYA 3RMXA 3U75A 2X5IB 2XDVA 2BQPA 1HV1A 4H14A 2AEYA 4C91A 2RM21 4DINB 5FZKA 1JU3A 4J1WA 1PX3A 4MGZE 5FZ4A 3CZJA 1JU4A 4I01A 4UYBA 4BMEA 1T6BX 3LEKA 1C8M1 1T6GC 2ZMLA 2XQRA 1LHUA 4I02A 4QPIC 4WVMA 5E8AA 2GH8A 1QNWA 2JB4A 3J26N 3P6BA 3VBFB 4ITCA 3V0AB 4Q4X1 3KVBA 3RNSA 3JB8A 3WDXA 2UU8A 2E7AA 3T3YA 3WDYA 3E5XA 3LEMA 4KGGA 1PVC2 1QOSA 4I30A 1AJKA 5A3UA 1PNFA 2XXZA 5GZGA 5D1IA 2YC0A 3DV8A 2HJIA 2RM22 1PO22 2VUJA 3C3VA 2R16A 3HNBM 1UL9A 3POSA 2PXJA 2FCUA 1WA4A 3W9AA 4O65A 1VBA3 1AR63 3AKSA 4QPIA 2Z2SB 1WCSA 4B3NA 2VTFA 4Q4X2 1QJY2 3RVHA 5ANNA 2VOKA 3C2UA 3BIWE 2R1DA 3WNLA 4QX0A 1SCRA 2RDRA 4HETA 4FPGA 3TWIA 3AYCA 3WHUA 3B00A 5DZGA 1VRH3 1RMU2 4QB2A 3ZSEA 2JDUA 4LLFA 3AZYA 3FUQA 1J84A 2D6MA 3LOIA 4FP3A 4XPVA 2GP5A 3WF1A 5JZGC 1JYIA 2Y60A 4AFBA 3BALA 4EYUA 3MV01 1AYN1 4PDWA 5FPUA 1TZOA 5FYCA 4W6YA 1HKDA 5IFPA 5JUVA 1PM4A 3N3HA 3VBHC 4XQDA 5TSWA 4QU2A 2PAKA 4DXSA 4EN7B 4IEXA 2BRTA 3ZYJB 5HCBA 3O1UA 2W68A 3LZZA 1OF3A 2VZPA 4BQ4A 4D0QA 1HQLA 3SH4A 2PYTA 2VZSA 4QT6A 5LRRA 4CEYC 4UOJA 4Q8LA 3KHBA 3SISA 5FZLA 2XVLA 3T0BA 5CG8A 5JOWA 4OHVA 3AKQA 5JXIA 4Q29A 5DDJ1 2A6YA 2W87A 3APBA 1U5ZA 5FP3A 3TRSB 3ZXKA 2WDBA 1NY71 5D2AA 3CO2A 5FUIA 1W8NA 1GOHA 2VZVA 5CBLA 3IMMA 4AEDB 1SZBA 2WR9A 4RGGA 1G6NA 3I3QA 4W50A 2CYFA 4XYXA 2BJSA 5GJ6A 5IHRA 5J09A 1AVBA 4C90A 4BDVB 1Z7S2 4XW3A 3K46A 3UK9A 5CFDB 2ZX0A 3VBHA 2IXHA 1IGOA 2HLEA 3I2DA 4LPLA 3BTZA 1Y4WA 5JCTA 2XH6A 3ZIXA 3FLTA 1S0BA 2VGDA 2B42B 3T4VA 3B93A 4H3WA 5A32B 1PNGA 4FAHA 2WO2A 4HVRA 4AEKA 2JG8C 1UYYA 1XU2A 1OHFA 4UW3A 2A73B 1GP4A 4XAEA 4AOCA 3L9JT 4DQAA 5A3OA 2VNVA 1VPHA 4AQTA 1GZWB 3ZYFA 1E5SA 2WLQA 1SACA 3HVDA 1HRV3 1NCQB 1D7PM 4TLFA 1W3VA 1TME2 4BQXA 2VW1A 1UWWA 4I2OA 2W0XA 2KR2A 4EV0A 5LCWL 2C4XA 3O0WA 5E89A 3ITQA 1KDMA 2EF6A 1L7QA 1RJ8A 2WFPA 1CQ9A 2IWGB 3H1WA 4FOWA 4FVVA 4GIQA 2C6SA 1US2A 4YZ2A 1MS4A 2EIDA 2RDNA 3RZKA 4C1WA 1YCIA 3AL6A 5BNPA 4AE2A 3NMBA 3WD5A 1ENQA 3TB0A 4CUAA 5IK7A 3O1PA 3VBOC 1PZ9A 2Y6JA 4XURA 1FOD3 1QJX1 4XFBA 1CONA 2JKBA 3ZN5A 3KV5A 5A3WA 4D6QA 3OBRA 2HWD1 2WNOA 5FJKA 1UMIA 3ZR6A 4XEZA 3W5MA 1Q3EA 4HL0A 1R081 2RS31 4GH4B 3KCCA 1DQ6A 2EXHA 2XL7A 1BYHA 2E31A 3WG1A 1VIWB 3SH3A 4YW7A 1IQAA 3BGAA 1YJKA 2D3RA 1WA6X 4XBQA 3I3BA 4DRRA 3IPVB 4DUVA 3PTRB 2VNOA 3GHMA 4XJ8A 3VBSA 5FPZA 4AQ2A 1UXXX 2KD7A 2ZZQA 2HYKA 2Y26A 3EMRA 5D8AC 4YZ1A 2XVGA 1WKYA 5BNOC 2F4PA 4YPJA 4QKBA 4KQ7A 3ZYIB 3VDDC 4N43B 3VHOA 5CADA 1X36A 2BZDA 3URFA 1W6NA 3ZVXA 1YFUA 2B7YA 3BN6A 4FPYA 3RYPA 1F2NA 1CAUB 2SLIA 3UGGA 1D0HA 2GU9A 1R082 3N36A 5T55A 3NV4A 4YZ5A 1SMVA 1MVEA 3ES4A 1WW7A 1CAXB 5B2GB 1W0NA 3R6SA 4OHZA 4LHNA 4U2AA 3WUCA 5F5QA 4CDUA 2R043 2WO7A 1DU3D 4HVOA 3P5BA 1PIV3 1FPN2 2ZGLA 4CP2A 4QB1A 4Y33A 3VBRC 4BA6A 3UYJA 2BEOA 2IXLA 3A22A 1GLHA 5D8AA 5BNOA 3ZMOA 1AZDA 4CPBD 2GP3A 3H1YA 1OQEA 2YMZA 1MPXA 2W5FA 3VD7A 1RUF2 5BXXA 3VZKA 1L3JA 2WWSA 2WIIB 4P9IA 1N3OA 4Y1ZA 3K4DA 3A21A 3JBG3 5J48A 2VMGA 1BK1A 1UZZA 5DUUA 4XF0A 4NHYA 4C1XA 1W04A 4LT5A 3BPSA 1QF3A 4BQYA 1UYPA 3H3UA 1OSGA 4ES9A 1V0AA 1ACCA 4XOGA 3HJRA 2YUEA 4PLOA 4Y3OA 1QU0A 5DXDA 3WF3A 2FDGA 5J7MA 3R0RA 3ZX7A 5B4XA 4QQ2A 3VBRA 1NE6A 5GKAC 1RC6A 1JZ6A 1GOGA 3UETA 1WLCA 3UKTA 4FPFA 2A3XA 1S0FA 2FMDA 1FATA 4CCLA 1OH3A 1RUH2 1COV1 1ND3B 1W99A 2WO1A 3W59A 1S55A 4OZXA 2DCYA 2OQ7A 4HN1A 1U5IA 1C8NA 3PMSA 1MZ5A 4UFJA 3WINE 3HAGA 4CUBA 1RB8G 1O59A 3C7HA 4ISRA 3SEPA 1VAMA 3CJIC 5LEKA 1KFUL 3AZWA 4HPKB 1W8TA 1UY0A 3A0NA 2VZUA 2DCKA 2MEV1 1R093 4A42A 2VOXA 2WNVB 2C24A 3AP9A 3MV11 3H3LA 3LQCA 3LFMA 5GZEA 2VMIA 1OLMA 2D6LX 1RL3A 2WQZC 2FZ2A 3T08A 1GICA 5A7PA 2XLAA 3CU7A 2VL4A 3ST7A 4AFCA 1IS3A 3LD8A 4N7UA 4UFHA 2ZGNA 4GWNA 4XACA 3RYRA 4JKMA 2DCZA 3B9IA 5DAQA 3POWA 4LBQA 5K8SA 2RJKA 3SEEA 3KM5A 1NLSA 4NAMA 4NRPA 5ABJB 1AR61 4HK9A 2E32A 3UT0A 1YFYA 3CJIA 1S0IA 2VPVA 3C7GA 1JI6A 3NAPB 1OF4A 4NIGA 1HJFA 4DPNA 2XR4A 3FFZA 4JGYA 5LY2A 4FPCA 1W0OA 2XJSA 2RV9A 4LXLA 4I0WB 1DQ1A 4YGEA 1YYNA 1A8MA 1GQHA 3ELNA 1MACA 3UJQA 3H8UA 4K21A 3UV9A 3ZXFA 4LITA 1VRH1 1ZYBA 5L7OC 4URAA 2GZWA 2A75A 5FZMA 3NJYA 4LE4A 2IXIA 2B46X 4V1PA 4ONUA 5FJHA 1XYOA 3MPBA 1JXNA 2HWB3 1VBA2 3OBTA 4KG8A 3NNMA 1ZZCA 5A1FA 1F9KA 2K46A 2XBO3 1AR62 3GNEA 1OI6A 4M3CE 3U14A 2NPIA 4CEWC 1NG0A 3T30A 2YGMA 3JCIA 4YW2A 2J1UA 3EYPA 5FY0A 2J1EA 2QJVA 3JD73 1JZ3A 3HBZA 4FPKA 2P17A 3MICA 4LORA 4PT6A 3WP5A 3RI8A 3WCRA 1AL0G 5E1RA 1REDA 5FY4A 2ES3A 4LO8A 5DZEA 5EJ3A 2RJLA 5GLUA 2OT7A 2X29A 1RUOA 2VUCA 2JE7A 1OA2A 2YGLA 2FHRA 4W6XA 5FQ0A 3B7MA 4PLMA 5E16A 1OLQA 1DQ5A 1I9RA 5KHHA 4R9AA 5C71A 1CESA 3SXWA 3AFGA 4WM8B 3H8XA 4S2HA 4BIFA 2YXSA 1OVSA 5C4WB 3AYDA 4LHLA 4P9LA 5FZ7A 4EN6B 1DYKA 1LHNA 1SLIA 2VW0A 2EAKA 2V73A 3PHMA 3M70A 2ZX3A 5A7WA 3FN9A 3OGGA 1OKQA 4I09A 4Q1RA 4BYYA 4QD2A 5FYTA 3KCYA 2UWAA 3RG0A 1GWMA 4GMP1 3VDAA 1A34A 4B29A 4MOAA 4BQ1A 2B39A 5LK7B 3WNOA 1GMMA 3HOBA 2HWE3 3ENRA 4YM1A 1AX1A 4WVMB 1YIFA 2Z69A 5T52A 1W8FA 2ET7A 1HRV1 4ZXKA 5FY9A 3ZSJA 4Q0QA 4HG6B 1W0PA 3VKFC 2RS53 1QIQA 4K20A 1OUSA 1V6JA 2R1BA 1LHWA 3JXSA 3CQOA 3EHKA 2VCAA 4JAAA 4LUKA 2Y8KA 2P4EA 1Y43B 2WL1A 4XXPA 4P5YA 2W9XA 3DYMA 3OBAA 3VBUC 4OULA 3VD9A 1GNZA 3OGJA 4D94A 1W6OA 4FXKB 5D21A 2JG9C 4L0PA 4SBVA 1WW5A 1C8M3 4FTSA 3K48A 3M2MA 1XE8A 2B45X 1FOD1 5A80A 3WP4A 1B09A 5G05L 1HRV2 2GC2A 2H0VA 3HR9A 2ADDA 2ATFA 4NIAA 1CN1A 3WNKA 5DAXA 2NM1A 5IAXA 5FYIA 4IE7A 2Q0AA 2P5BA 1QOOA 2VNRA 5C70A 2QQKA 3J9SA 4OMDA 1H8TB 4Y22A 1NA1B 1NUKA 2DURA 4IE4A 3KB5A 2FZ1A 5FXWA 1V6NA 1H0BA 3BVCA 1O6UA 3HQUA 4YM3A 4CU6A 3T0AA 4LO5B 4PDWB 3BB6A 1FOD2 3M8LA 2Q4SA 5FO8B 3U0ZA 3CJXA 4KGQA 5FYZA 3ZR5A 5LBBA 2HH9A 4YW3A 1OVPA 4IE0A 3RGBA 1TMF3 3GJAA 5CFCA 3USSA 1UIJA 2QQVA 4IEUA 3ILNA 4AEMA 5H9RA 3NNLA 2W39A 2E6VA 3NJVA 2R041 2C9KA 2VR4A 1R1ZA 2QCSB 1PIV1 1WCQA 2XGXA 3KV9A 5A33A 1AYN3 3NVCA 1KEXA 3BIEA 4L11A 2BW8A 4Y4RA 3PJYA 4XVHA 3I2JA 5FZ1A 5FZGA 5FYYA 4IE5A 2GH2A 1NT0A 3IIAA 2WFF3 1V6MA 3U37A 3VBHB 1RUC2 1V6KA 1CGPA 1NOVA 2JDMA 3UKNA 3PUIA 1NLQA 5F32A 1X82A 3RSJA 1PM7A 4FPJA 3T2TA 1N1YA 4AF9A 1VBD3 2QQWA 2BGPA 2C1FA 3TYJA 4PIXA 4IV3C 1MS0A 1QGLA 2NQYA 1ZRFA 1LESA 3GF6A 2R042 3POGA 4QU1A 1FV3A 4XFAA 4QX1A 3WX5A 5L36A 2ZGMA 4EROA 2QQIA 2WYSA 4UFKA 5IFTA 3LA3A 1CAVB 3WG3A 3CMGA 3ZSLA 5JOYA 5DZFA 4META 5F5CA 2RR13 2YBPA 4M0HA 5EV7A 3ZMNA 4WZCA 4CXWA 4E4SA 4CUGA 2A1XA 2GMEA 1UOBA 1VAKA 4AFMA 4C0HA 1PMHX 3JBG2 1RUI1 2WS93 4I3PA 4LKDA 1N1TA 5I91A 1AYM1 3AVSA 1VBB3 2FDJA 1DHKB 2VZ3A 3DCQA 4AWDA 4IV3A 1XJAA 3E97A 5FZ3A 2QQOA 4AQSA 5BNPB 1DLLA 2FCVA 1K45A 1YJLA 3VZJA 1ALYA 4X6QB 1J3RA 2GN7A 4E27A 4PJYA 5DQ0A 2C0ZA 2YROA 4FXGB 1WW6A 1R091 3UESA 1D4M3 4MO3M 4FFIA 3MIEA 4QPWA 2HWC1 3C7OA 4C0BA 4OCTA 2ZGOA 4BOWA 2ZEWA 5C6CA 3VKMA 5JR2A 2YB7A 2AC1A 2CDOA 5IVEA 1IG0A 3KQ4B 2BGOA 5HCHA 1LU1A 2DTWA 3MUY1 3RJ2X 5FIXA 1K5MA 3THDA 3WEZA 2XWJB 1ULPA 4GWMA 1PO12 5GLVA 1C28A 4LJHA 3VBSB 2OXBA 2I45A 5JI7A 4XHXA 2CNAA 2CY6A 2YYOA 1R092 1QJX3 3MF9A 3SH5A 5KHJA 3ZYHA 1FYUA 1STMA 3LA7A 4XFHA 2HWD3 5BY5A 3H3ZA 1W6NB 1QJU3 3GALA 2A70A 2GSYA 1S1AA 1BBT1 5F7UA 4GJYA 2RS33 5EXOA 2XMLA 2RE9A 3ZFGA 5HBAA 1JZ2A 3LSDA 4EJRA 3MO4A 1H1IA 4MYEA 4LMFA 4RR3A 4IV1C 1SLTA 4CDUB 5A3PA 1V9U3 4BH9A 4PBPA 4WVZA 4LOSA 4ZZ8A 4QM9A 4YFZA 1KJLA 2MNGA 1OKOA 1QXPA 5EQUA 3ZXJA 1SQ4A 3N9PA 2ORZA 2AUYA 4PCRA 1MZEA 1JYNA 2XBO1 3PU3A 1O91A 2ZHLA 3HEIA 5D8AB 3U4SA 2Y0IA 2JEMA 1PGL1 4Q5OA 1AR93 1WUVA 3FFQA 1W8ZA 4S2DA 1YEWA 4HSJA 2PAEA 5FZEA 2UY8A 2XOMA 1KITA 5HI0A 2GNTA 2XL9A 3WNXA 2WLPA 3PVNA 4GAZA 5FYHA 2DWRA 1WW4A 4OI1A 5A3MA 1JZ5A 3N4MA 2W91A 3THPA 2WC2A 3ECQA 1KFXL 4OUSA 4IUGA 4H55A 4AHWA 3T0DA 1HLCA 1Q5OA 4IV1A 4KU7A 2WQ8A 2V5DA 4RS5C 4IL7A 2VQAA 2HWB2 3ZN4A 1UOFA 2JIJA 2WSVA 1H1MA 3HMYA 4XFGA 4LE3A 4XXAA 1EV12 1PGL2 5LZ6A 3WF2A 3POEA 1YQ8A 1DGWA 1U5XA 2WNUC 4Q4V1 3JD72 2J7MA 3SC7X 3I97A 1PGSA 3MIDA 3I59A 2A6VA 1W9SA 3RDIA 3POIA 4IEPA 2RVAA 3TN92 5BNNC 1N3QA 4BQ5A 4CVUA 1VMJA 3BUCA 1S4CA 4Y20A 1UO9A 4K6BA 4MV2A 4UW4A 4CDQC 1LR5A 1XRUA 2HWE1 2YC4A 3I2FA 1G9DA 5LEJA 3OPWA 1I6XA 2GN3A 2PHRA 1DGRA 3AP6A 4XIKA 4CE8A 1UU4A 2VQUA 1MQTB 3MGUA 3MW3A 4CCCA 4HSLA 4ARXA 2E26A 5A7SA 3SCGA 4AK3A 4CXXA 1UQXA 2RS51 3S7EA 2DCTA 1H4HA 2BFUL 2OS2A 2Q5TA 2VZTA 2X8KA 3OF1A 4QDQA 2WNUA 4XJZA 3VB9A 3ZFFB 2A71A 1OMIA 1CIWA 4LA3A 3J8F3 1GZ9A 4JDOA 1COV3 3RPQA 5FLHA 4GB31 4XTPA 1GQGA 2DVBA 2Y6FA 4E4ZA 4BLIA 1B35A 2QDRA 3GCXA 1EAH2 3LB9A 1DGLA 5BNNA 5ISLA 1LKNA 2P2KA 1MS1A 5KXCA 1JODA 2D6NA 2QDNA 3OYWB 2HWE2 5EIYB 1TEIA 3CF6E 2RHPA 4FOQA 4K40A 4LBQB 5IW0A 1ZRRA 4YVSC 4CDQA 3HT1A 1NXD1 4K8RB 2NLRA 2WRAA 2FCTA 3QBQA 4XUQA 2MEV3 4QXCA 1AX2A 2FDHA 5ACA3 3RMYA 1Y9QA 1NZCA 5T5LA 5JXJA 4JGYB 2RS52 5F3CA 1FI2A 3BYWA 3OTFA 3DF0A 2L9LA 1DQ4A 2WN3A 5FZFA 2D5HA 3NV3A 4DEQA 4YW4A 4JKKA 1S0EA 4OI0A 4BCUA 5FPXA 2JD9A 4CCOA 3RJRA 5FZCA 4FI9A 1XU1A 3OJBA 4URTA 5JSPA 4PIZA 1C8M2 1LU2A 1Q8PA 4R9BA 4AAXA 4LBNA 4QDSA 5IYYA 3FZ3A 4XETA 1H2NA 5EYYA 2K2SA 2KXLA 4FQZA 1W2TA 2PFWA 2YHJA 4A7YA 1YQ5A 3AK0A 3N7KA 5ERLA 1CZSA 3OUIA 5GZCA 4LBKA 2VM9A 5FV3A 3ALQA 1TMF1 3FLPA 5DABA 4Z1VA 3HNMA 3FWEA 3SCFA 1LAJA 2JJ6A 1FXZA 2V09A 3MIGA 4XABA 3OG2A 3FX3A 4AR2A 2D6OX 5J96B 2JDYA 3E5QA 3LDBA 4YZ4A 2P6HA 3T1LA 4K3UA 4XMAA 1LEMA 5FQ0B 2ZEYA 4AVAA 5CEHA 4UI9L 2G19A 1BVP1 1X50A 2W1WA 2YY1A 4MXVA 3WDWA 1DCSA 4RYDA 2WFF1 1RUG1 1WD4A 1VLNA 4HKLA 4M3CA 1HJGA 3I2IA 2XUEA 1DDLA 3WHTA 1TMF2 1NYWA 3MUZ1 1VBD1 4NWWA 2ZX4A 4Y5Z0 4JGZC 2B9VA 3THCA 3ZDVA 5FZOB 1JYTA 5FYMA 4HLTA 2B5HA 3B69A 2R32A 2YFUA 4DUWA 4FPOB 1GZTA 3WLUA 1NX9A 2VJXA 5DG1A 3IKWA 3KV4A 3GDBA 4GALA 5JZGA 1AYN2 1XBFA 4BHPA 5IAVA 2PQSA 4NUBA 4QKDA 1PGW1 4ZS2A 3RZGA 2D40A 2IVJA 3JQXA 5L9BA 2RR11 4A7ZA 2A6WA 2C26A 4Y24A 5FK7A 2WFF2 3AP5A 2PLV3 4UT5A 3V0BA 4KWJA 1DZRA 4XZPA 2ENRA 4JHTA 3WR0A 4RL7A 2BBVA 1HN0A 1VBD2 2WS91 2QQLA 5IJRA 5CB7A 1ST8A 4CEYA 4QXKA 1VBB1 1CX1A 4COVA 4JGZA 2VCCA 4FFFA 1O8PA 4XBLA 5DDJ2 4GMP3 1KJRA 4QX3A 5F6KA 4CDWB 4Y5SA 4CUCA 1NY72 3JU9A 1NLRA 4FFGA 1W6OB 1GYKA 1CJDA 5I0DA 2WT2A 1V70A 2WT0A 3PUSA 1VBE3 4V2VA 3KD4A 4WVVA 2VVDA 5LK5A 2AGSA 3B3QE 1SDDB 2CTVA 1D4M1 4B7KA 5FAXA 5CYYA 3WZ1A 1W28A 2G9ZA 1JYVA 4WM7B 2WS92 2G1MA 4QAWA 4Z07A 4BMBA 3RZZA 5JOXA 3GM8A 4Z2WA 4Y22B 1VBB2 2D3SA 2KA3A 4BK4A 2Q1MA 2VO5A 2JG8A 3IMNA 5B4NA 5BV6A 2ZKNA 3ILRA 4LKSA 3P3NA 1YLLA 4Q0UA 4DRVA 5AC93 4A41A 2WAOA 2WBKA 5GALA 5IWFA 1GNYA 1AXYA 5CNAA 4M01A 1OA3A 5F8PA 1IZ3A 1UKRA 3VZNA 1QJU1 5L9VA 4GMP0 2EXIA 4QPGC 3B5LB 1ND2C 4HFSA 1AHSA 2QE3A 5SV8A 4OFGA 4YRDA 3T1MA 1GNHA 5CFCB 1W39A 4OHWA 5LB6A 5JAXA 4E4HA 3MFAA 3VHRA 4KG0A 1S0GA 1V9U1 2JDHA 2OPKA 3DPRC 4XDQA 2XJRA 5FWEA 3S6PA 3SMHA 3WNNA 4DMIA 1UXZA 4NHXA 1RVF1 3IDEA 4M4PA 3I2GA 4Q4W3 2ET1A 2VULA 1QJX2 3CDZB 3VBOA 2HWD2 1AR91 1RUE1 3ETQA 4UF0B 4ZU7A 1LOAA 3A0KA 2XLGA 3AKRA 1XPWA 4ZXEA 1ZX5A 4F8AA 2D44A 2RS32 2LS6A 4RQPC 3PURA 4D7TA 4LIVA 1V6LA 4CU9A 1WMXA 1PK6C 4WZFA 4NIIA 3E5UA 3ORJA 3THTA 2C5DA 1V9U2 1OOPC 1RXGA 4Y26A 3B01A 4N53C 3I4IA 4AI8A 3MIBA 3AXDA 3K4ZA 5FCCA 1W9YA 3DPRA 1U5YA 2XPJA 1R64A 5CKMA 1C3HA 4JHZA 3AKTA 1ULGA 3M3QA 1RITA 3OPZA 2WO3A 1ZA4A 3EO6A 3ZN6A 4ATEA 3OB8A 2W1QA 1H2LA 2ILMA 2VMFA 3VDDA 3WF4A 4BE3A 5F2SA 2K0GA 1GQPA 1NCRC 2JENA 4HANA 4P08A 2XJVA 1IS6A 1GP5A 3I2OA 4NAOA 3WF0A 4OI4A 5F5IA 5JXHA 4B7EA 1PK6A 5BNQA 3GGLA 2IXJA 3AXEA 1U0AA 1I5ZA 4HKOA 1H9WA 2Y33A 4JV4A 1OFNA 5T50A 4S2GA 4F83A 1OOPA 4XUNA 3AJYA 1QDOA 4N53A 5A6XA 1S0DA 4D8MA 1XYPA 2OX0A 2CAVA 1BJQA 1GSLA 2A3WA 3HIFA 2O8QA 4MGKE 5JXGA 3MLJA 2W1SA 4LR4A 4XF1A 4DB5A 4EN9B 2ZS6B 3J8F1 1X33A 4JCKA 1NCRA 3A7QA 3LPFA 1RUI3 3L2YA 4G3YC 4QQPA 3FHAA 1FMD3 3PIGA 4MADA 2Q8EA 1HIXA 2PHDA 1AYM3 2ZGQA 3HD8B 3Q8CA 4IETA 1A78A 1OPOA 4WBBA 4Y1UA 1EY2A 2CHHA 1RXFA 4QXBA 1K5MB 1T2XA 3ZFEC 4CCKA 4YVWC 1ULDA 3ZYPA 4LBMA 4ISQA 1ZRCA 2B9UA 2ZZJA 4AG4A 5C9AC 1XSRA 4HXCA 5C8CC 5J1XA 1EUTA 4JDNA 1E5HA 5JLVA 1I5PA 5ACA1 3E6BA 1SPPA 5DUVA 4EWEA 1X8EA 2NP0A 4A7KA 2ORXA 1AXZA 1V6OA 2HWC3 2X10A 1HQNA 2XJTA 1ZREA 2Y6KA 1VALA 3WVJA 3QACA 3J8F2 3LA2A 1COV2 2P3IA 3IT8A 4Q4Y3 3ZFGB 2JD4A 2D43A 4XZUG 5CVRA 4CSWA 3EXUA 4Q2FA 4RR3B 5E88A 4MHUA 4HZFA 3VBFC 4B1LA 3KV6A 4YVWA 1JTZX 1W6MB 3WW2A 3GBGA 1GOFA 1VB4A 3BU7A 1RUJ1 2MEV2 2R0FA 1YHFA 1WBFA 4MGYE 5ACA2 5C8CA 5C9AA 2B4KA 1CVNA 1DYOA 4ZU5A 1SCSA 3NJZA 2GC0A 2YPDA 2DVFA 1SDWA 4XCAA 3WDUA 5FBJA 1KS4A 4C8DA 3DECA 1C57A 3LKJA 4COZA 5FMOS 1BBT3 3O7OA 1RJ7A 2PHTA 2ID4A 2XJQA 1K3IA 4JKLA 5IVYA 2FDIA 5FO7B 3MFCA 5CA6A 3IZOA 3IAPA 3LIGA 3PVBB 5L73A 3IDBB 3MYXA 1FNZA 2DCJA 2WA4A 2XUMA 1ZBA3 3VGIA 4IV1B 2D5FA 5KHGA 3VBFA 2G9GA 2IXCA 2XKPA 3D6EA 3QD6A 3ZXDA 3V0AA 1VBC3 2FBEA 1Q8VA 4CP9A 1KQRA 2JWPA 1O3TA 3GZTB 1SFYA 1GV9A 2ZEZA 2RJ2A 4JZRA 2D93A 5JMCA 3FUOA 4JVAA 5FDBA 2RDSA 1XB9A 5KXDA 5A70A 1C1FA 3JB4C 1LEDA 3K4AA 1HN1A 1HV0A 3KSCA 4A6OA 2V4VA 1VRH2 2H6CA 1XNKA 5I8YA 5L7OA 1LOBA 3A4UA 3ON7A 2XKOA 4ZY9A 3SITA 1KDKA 3C8XA 5C5TA 5FMOL 3H8OA 3VHPA 3FHIB 4XF9A 4KWLA 3KT4A 1ZZ7A 4HKWA 1KGYA 2EXJA 2AR6A 3I3EA 1W2AX 5FMCA 3UNPA 2PLV1 4B8EA 1W9WA 3P3PA 4ASKA 4A4AA 5BYNA 4DO0A 4YZ3A 1UZYA 5FZAA 4CEWA 1SBFA 4Q4V3 2WNUB 4K1YA 3H42B 2V4AA 4IEZA 1M4WA 2BBAA 3DYPA 1CZTA 3LEIA 3EQEA 2BVBA 2ZXQA 4AEDC 4IEOA 1B35B 3TEZA 4FO9A 3MW2A 1CAWA 3ACLA 4JTOA 1CPMA 2WZR3 2XG3A 2YFZA 1JZ8A 4XDOA 1QDCA 4XUTA 3VKLA 2NMOA 3OOXA 1QJEA 1BK0A 1PHMA 2OPWA 3AMQA 1N47A 1PMJX 1V6IA 2DF7A 1LOCA 1VBE1 1A3KA 2VVEA 2VBDA 4N9HA 4U36A 2J1TA 1WLWA 3KS7A 4GZ9A 4Q1PA 3TEWA 1F4HA 5FZBA 3JZVA 2ZBJA 1YFXA 2TUNA 3QCWA 5H9PA 5IVVA 3P1IA 2WZPP 2VECA 1DQ0A 5CIRA 3KHCA 2HKXA 1Q8OA 2KM2A 4XC9A 3WW1A 5K7PA 3J7MA 4XIOA 2I07B 4QM8A 2QUOA 1WBLA 4GB33 3A23A 1HX6A 1DFQA 4RHV3 1Y9MA 1F31A 2OA2A 2Q30A 4HONA 4WV8A 4F3JA 1NCQC 4LLOA 2VAUA 5LA2A 1A8DA 5AC91 2AH2A 2QZ2A 3I54A 3H7JA 4QPIB 1AL23 3BKZA 1O3QA 1IS4A 2OZ6A 4JX0A 1IQDC 1DP0A 5FWJA 1WMDA 4FTBA 2GALA 2AYHA 4L99A 1O3SA 3IM0A 1WMFA 2ZHMA 4ZPIA 4FCAA 1PO23 1UX6A 3VV1A 1ZM1A 1UOGA 1ENRA 4TZDA 3PL0A 2P1BA 1WMEA 2QVSB 4UAPA 3NQHA 5T5JA 1VAVA 4LIUA 4QQOA 2B8MA 3VBUA 4BXSV 2VTXJ 4MXWA 5FRAA 4LHSA 5AC92 1ZZBA 4JTNA 3O1OA 1NCQA 4Q4W1 5LY1A 2JG9A 2R7EB 5FPBA 3WSOA 4GH4C 2IC1A 1N1VA 1NZIA 3INAA 4QHZA 3QOPA 4NROA 5C3OA 4NN0A 1WCUA 3RZHA 3QLQA 3S57A 3K51A 3C7FA 3LFIA 4JC1A 3WNMA 2D7FA 5CKNA 3OY8A 4NPLA 3M3CA 1BEV3 1EUUA 4QX2A 1ULEA 2BVVA 3NWKA 4HOOA 1LGNA 1E5RA 3ILFA 5F3IA 1TQ5A 2ZJCA 5BUVA 4LO6B 1QJZA 5IK5A 4CRQA 3FLRA 2WYFA 1QMJA 3S30A 1RHI3 1GWKA 3NV2A 2JECA 5IVBA 5JZGB 4Q4W2 3N7JA 2HEWF 1YO8A 4OVEA 4BK5A 3KT7A 5JIUA 2XB6C 3E1F1 1UZWA 3U78A 1UPSA 1RUG3 1TNFA 2XHKA 4TXWA 3RRDA 4BM8A 5C8WA 2F4LA 2I2SA 3W5NA 2VQTA 4X8PA 1WLTA 2EIBA 1H30A 4YW6A 4QB6A 3T2QA 3WXPA 3WW3A 2W94A 4F7ZA 4ZONA 2XJPA 4CYDA 5FZ0A 5FZ6A 4PF5A 4CEYB 5A1AA 2YBKA 1JHJA 4QX7A 4DUXA 1BQPA 4JGZB 1TNRA 3LOBA 1HXS3 1L7LA 2IFWA 5I0RA 5HXVA 4Q8KA 1GANA 1HB4A 2PHFA 1PIV2 1LJ7A 5F37A 2W92A 5AVPA 4EWAA 3POJA 1OQDA 5DG2A 5F3GA 4B4PA 3MIHA 4WVWA 1GP6A 2CWSA 2DV9A 4NVPA 5DUWA 4CCDA 4GKYA 3MZHA 2VZ1A 4HT1T 1JYCA 1AR71 4J6GA 4ZKTB 2FD8A 4PI0A 1CAXA 2WABA 1NQJA 1DIWA 1FMD1 2Q1FA 4YGDA 3O1RA 2AEZA 2P37A 2BDRA 4QHOA 3GJBA 5A3TA 3POBA 3HWJA 2JG8B 2ZGPA 1J58A 2OVUA 2G9FA 2WZEA 1ONAA 4RSUA 4Y4YA 3ZYGA 5DAWA 4XFFA 3FJSA 2LROA 3N9MA 1I1EA 2RS13 3OEAA 1PZ7A 2GNDA 1ND3C 2VE1A 2J1RA 1US3A 4KWUA 3T4HB 4AFDA 4Z92B 3H7YA 3M4FA 1UYXA 3U1XA 3TEXA 1GUIA 4FBFA 3I8TA 1J1LA 4LKFA 3S7IA 4LKEA 1RUI2 4Q4Y1 1FMD2 3USUA 5KC6A 1AYM2 2JE9A 3GZEA 3OUJA 3VKOA 4ASMB 3I49A 1QNYA 2MHFA 1Q43A 2UWBA 2TBVA 3AL5A 3WQ7A 1RYYA 1YFWA 1CZVA 3AYAA 1Z78A 4IXLA 3HBKA 1OQ1A 1IPJA 1S0JA 4DOUA 2WNVC 2MPFA 1MEC1 1Q8QA 4FP2A 4CCEA 1POV3 3HQRA 4L9BA 3N9NA 5EJZB 1UIKA 1X9TA 2ETEA 2F17A 5KR7A 1JZ4A 4IEQA 1OLME 3VBOB 1OPMA 2Y6GA 5K0UC 3W21A 1ODMA 1XNCA 3MLLA 5H9SA 3I2HA 2HWC2 1H6XA 1G7YA 1ND3A 1SLLA 3LIHA 5J36A 3Q8FA 4LULA 3R4UA 3WQ0A 2WNEA 3M3IA 2DFBA 2EALA 4DNYA 2AREA 4MX3A 2YU2A 3D3AA 1UOJA 3B9CA 5A6QA 3GBWA 1ZBA1 3NAPC 4L8QA 3IAQA 3MIFA 4HPKA 4AVSA 3RZJA 4RN5A 1RVF3 4MSVA 1DG6A 1VBC1 3AKPA 2WNVA 1W2UA 2A3YA 1PMIA 1OXCA 4LBQD 5BNOB 3LEGA 1RUE3 4L92A 4MGQA 2YV8A 3D0JA 4QX5A 3VDDB 1W6QA 4CDXC 2RMU1 5K0UA 3POYA 1BBT2 1O5LA 4NIDA 4CXYA 2WSUA 2VQ0A 2ZGTA 2ZGSA 4H7MA 2BGCA 3J4UH 4IE6A 5F3EA 1UZVA 1SG3A 1POV0 2BV4A 5CZKA 3BTXA 3BI3A 5DN2A 5GM0A 4LUMA 4LA2A 4AL9A 1QEXA 1PK6B 3O1TA 3PUHA 4E4DX 1FPN3 4OUEA 1ZBA2 4NE9A 4Y1YA 4CPBA 2YBSA 2BFUS 3TNQA 3IB3A 4AW7A 3BTYA 1OOPB 1YC61 4UFMA 1UYZA 5FMDA 1VBC2 2PHLA 1OLRA 3ACGA 2XBO2 3HT2A 1C5HA 1IS5A 1DLCA 2V5YA 4X6RB 3VBRB 4OMCA 3AMMA 5JMOA 3N9QA 4BQWA 4UWDA 1ZZ8A 4Q0PA 4QKNA 5KXEA 3H1MA 1MS3A 4RGAA 2R071 5CISA 4LO4B 1AR83 4MVTA 4P9YA 4CDXA 3N9OA 5AFEA 3ZYRA 1GU3A 1W03A 2XVKA 4ZU4A 1LOFC 2DU0A
chains in the Genus database with same CATH topology
2PHWA 4DZGA 2WZR1 1VJ2A 1UAIA 1UCXA 2GAUA 2VOVA 4WM8C 3EBRA 5IUQA 5C4WC 5F9TA 3HQXA 1H1AA 1QQP3 1R1A1 4RS5A 3CEWA 4XHBA 1WD3A 3U4XA 3VZMA 1ENSA 1LHVA 3V64A 4Q4V2 1RUH3 1KD7A 4Q0VA 2W52A 2ZAHA 3QH7A 3LCPA 3TBDA 1D2SA 2JXAA 4RHV1 2NMNA 4M00A 2R063 2P3JA 1LULA 1LGBA 1LOFA 1XNBA 2WZR2 4OUMA 1QH7A 4ASLA 2OW4A 1XE7A 2ERFA 2OUHA 3VZLA 2PQQA 3IDCB 4CP1A 3EJKA 1KRIA 1AL21 1X8MA 3CJIB 2C9AA 4E2GA 5C8CB 5C9AB 3GYDA 3NSTA 5FO9B 4BLJA 4KH9A 5FOJB 3ZXGA 4GB32 1PO21 3Q9OA 4RHV2 4I0AA 2HWF3 4P9GA 2VH9A 1ULCA 1N1SA 2GNMA 4PBOA 5JR7B 4KU8A 3CL1A 1QJY1 1DQ2A 1RUJ3 4YVSA 1AL22 4N9IA 1Z0HA 1IPKA 2BNOA 1VR3A 1H8TC 2CAUA 1NA1C 2EIGA 4UXAA 4BZ4A 1BEV1 1YI9A 5T3NA 3AMHA 1RMU1 1WLDA 2R6QA 4UBGA 5HCAA 2WA3A 5KC5A 2Q8OA 2VY0A 3D4KA 4PDWC 1VB2A 2D3PA 2ZMNA 4XBNA 5L7OB 4YSFA 1RHI1 2GNBA 5IK8A 4LO7A 1F8VA 4CTEA 2ZGUA 3U11A 4XJUA 5T5OA 4LNVA 2ZACA 1J3PA 4CEWB 3M7AA 1BEV2 1H8TA 1G9FA 1NA1A 2CGPA 3MDPA 1Q8SA 3ZIWA 1O4ZA 5KXBA 2ZGRA 1Q56A 4HVQA 1MS9A 3AX4A 3O5SA 1HXS1 4XJ9A 2D97A 1CAWB 1UU6A 1SBDA 1GZCA 1RHI2 1LECA 2A6ZA 2E7TA 1GBGA 2ZAAA 3AYEA 4COUA 4E9KA 1CGPA 3KQRA 1Z7S1 2PN5A 1HW5A 1EPZA 4NHKA 2DTYA 5IK4A 1RUNA 1RUG2 3KMHA 3KGLA 5I0UA 5AFBA 1LOEA 1ASJ3 2PTMA 2F6BA 2ZA9A 4AHZA 4IQPA 3WCSA 2BWCA 3S0MA 1REFA 3AZVA 2H0BA 2ZABA 1W6PA 1HXS2 2Z79A 1HRI3 3NKGA 4GQ7A 4YW5A 4GXLA 1C4RA 2R30A 4M0NA 1E57A 3V56A 2Q1ZB 1PGW2 2ZMKA 3BODA 2XWBB 2RS11 2Y38A 1F5FA 1Y3TA 2WQ4A 1TME1 3AZXA 1C1LA 2P3KA 2RR12 4XFCA 3WDTA 4MUVA 3NL1A 4I3GA 4JDMA 3D82A 3WP6A 2QQPA 3MPPG 2QFEA 3MEPA 5BNPC 1OD5A 1UKGA 4S2FA 1YRZA 1YWKA 3ES1A 3PJQA 4AGRA 4MZUA 3WV6A 4OI2A 1DZTA 1MS8A 4HK8A 3AM2A 3FMGA 1QXRA 4DXZA 3AB0A 2BTVC 4FTEA 4QMAA 3VBUB 4MXWB 1CAVA 1PZ8A 2H6BA 1MR5A 1POV1 2RS12 1RINA 2JG9B 1UF2C 3ROUA 1D4M2 1D0GA 5JIAA 1A6CA 3TAYA 1G9AA 2ARBA 1AF9A 3OY8B 5HCFA 1LTEA 4L97A 2QZ3A 5I8TA 1XYNA 1U12A 1LGCA 5EZWA 3VBSC 4OHYA 3FC0A 3AFKA 3ZPYA 3WG4A 1XXNA 1SEFA 3MF6A 2LM3A 3ZXLA 1AJOA 4AQ6A 5KHKA 3AZZA 3RWNA 1XQNA 3FE5A 5I93A 4K7JA 4AEJA 5A33B 1AXKA 1HDKA 3ME2A 1DBNA 1RUD3 1FAYA 3PLQA 4YM2A 5H9QA 1QJU2 4CP0A 2BWAA 2GDFA 1SLCA 2UYBA 2WKKA 4QPGA 4CDUC 1ND2A 4K8FA 3JUUA 2A7AA 1CPNA 2EAAA 4NPRA 5F1RA 4N7IA 4YG6A 1WGPA 1FPN1 4JRLA 1CD3G 1H8VA 2XLFA 4CZSA 3IN9A 1RVF2 2ZTNA 5AVAA 1N3PA 3PNAA 2BNNA 1ZBE3 5GLZA 1QXJA 3V65A 4TWTA 1BCXA 3MW4A 2CV6A 1UD1A 5J3UA 1AR92 1RUE2 1RUC3 1JUHA 1RUF1 1ZRDA 1DF0A 4IEVA 4QQHA 2YPJA 5JSOA 1AR81 3D0SA 4D7SA 1H2KA 3N7LA 4RQPA 4EN0A 5L19A 5EWSA 1H9PA 5EYXA 3W58A 2FMYA 4Q0SA 4IV3B 3DL3A 4GULA 4YW1A 2E51A 5JPNB 1HQWA 4FQ4A 1QQP1 4B4QA 4A2UA 4XJAA 2LTNA 1O5UA 2IXKA 1NXMA 3JQWA 4G4FA 3MLKA 3IBMA 1RUH1 4LEJA 1AR73 3R4DB 3VLBB 1AR82 1EYBA 4MLOA 3O0XA 4K9SA 1O4TA 1UPIA 2DU1A 3AP7A 3USUB 2X53S 5FLJA 3WQ1A 2R061 3ASIA 4AHXA 4AVVA 5CG9A 3DGTA 1MQTC 1UN1A 2VOWA 1BKZA 1NQDA 1TE1B 1H2MA 2N7GA 4O9GA 1QQP2 5FLIA 4D69A 4Q27A 3ZFFC 4E2QA 2X5IC 4R4XA 1UW8A 1S0CA 4Q26A 4ATFA 4AVTA 4FOYA 1G8WA 4P9XA 4LBOA 2HWF1 3M1HA 2CGOA 2R062 1IKQA 1PO13 4AVCA 5CU1A 3ZDSA 5FREA 2OIIA 3OCPA 3ZFEA 2E9QA 4YARA 1MQTA 3KCXA 1MEC3 4JGYC 1O3RA 2DVAA 3RS6A 3SNMA 4ORFA 4AGVA 2Z42A 1MZFA 3VKNA 3VUOA 1S2KA 3ZFFA 3KLSA 1W6QB 2X5IA 1RIRA 5K0UB 5J98B 4AXOA 1GFF2 4NO4A 2D6KA 1BXHA 4JRAA 2HWF2 4G9SB 3OYWA 5JOZA 2DFCA 3AJZA 3KT1A 1RGSA 5JWPA 3RQ0A 3WP3A 3DUIA 1VBA1 4AYUA 1ZZ9A 4R9DA 2QKDA 4A3XA 2YDEA 1JOJA 1LOGA 2ZPXA 4QPYA 4R8HA 4FOVA 5FOBB 1JH5A 1RUJ2 4JQRA 5C33A 1DGWX 3NKTA 5IT6A 4PQ9A 2JDZA 3GZUC 2OUJA 2VUAA 2RMU3 4E2SA 2VNGA 5GZDA 5T5PA 4HN0A 2A6XA 1J1TA 4CDXB 4BIOA 1MZ6A 3I59B 1SLAA 3GBFA 1PVXA 4KNCA 4QGLA 1YNAA 1LODA 4X8NA 4P9JA 3ZXEA 1UMZA 4Y20B 1D4VB 1SFNA 2SBAA 4RFT0 1OFSA 4AGGA 1EV13 4RS5B 1KS5A 1S2BA 2ZX2A 2BYVE 4UW5A 2DVGA 2Y0OA 3AMNA 4YFWA 3U10A 2R073 1ASJ1 1FT9A 3L2HA 1LCLA 3FBMA 2R0HA 4YNIA 4IESA 3ZO0B 1H4GA 3TN93 3UL2A 2PA7A 2WINB 4OLLA 2EXKA 1MVQA 1IKPA 1HRI1 3OD0A 4YLZA 5BNNB 1D2QA 4O9EA 1LENA 2VXRA 3CNAA 3OD4A 4NHMA 1WCDJ 3WW4A 5CFDC 4CDQB 2VVFA 1DYPA 3R05A 4XJWA 4MGIE 1R1A3 4KWKA 2E53A 4FSJA 4YGBA 4D3WA 2Z5WA 2PLV2 1YXWA 1BMV1 5JVVA 4R4ZA 3DKWA 4INDA 1ASJ2 5FBZA 4CDWC 5F6LB 1JW6A 1IOAA 1X7NA 1EAH3 5EFUA 1YI7A 1O4YA 5FTTC 3ATGA 1CX4A 3WG2A 1HRI2 3BTAA 4UBHA 4AEDA 4NWVA 4MH0E 2G4IA 4TYSA 1ZZ6A 3BPZA 2CWMA 1VBE2 1FX5A 5CFDA 4KBBA 3UJOA 4EN8B 4YVSB 1LRHA 4AFAA 4WM7C 1PVC3 2UY9A 2K9ZA 1BMV2 1LHOA 2BUKA 3H50A 3ZSMA 5A32A 2UYAA 5JSRA 1ZNPA 1REEA 1G9BA 4XMIA 4CDWA 2RM23 4AHYA 1DGRN 1QH6A 3FBYA 3PVOA 2BPA2 5GLTA 1GZWA 5GLWA 2GMMA 1WCKA 3PVEA 2XJUA 5JDBA 4Q4X3 1QJY3 1RUD1 5I8SA 4J1XA 3LGRA 4DY5A 5SV5A 1VP6A 3NW4A 4FT8A 4FPLA 5CFCC 4M3CB 2E63A 4HBNA 4WM7A 2ZCWA 1YUDA 4P14A 2PAMA 4H7LA 1RMU3 2NZ9A 4HMZA 1FV2A 3AMPA 4SLIA 3HN1A 1QKQA 2D6PA 4N43C 1ENXA 4W6WA 1ULFA 1ZBE1 5I0SA 4FAGA 2QNKA 4YM0A 1IHMA 2I74A 1RUD2 3D5OA 3LAGA 4N90A 1RUC1 3D8CA 5BPXA 3LWCA 4W65A 2AZ5A 2GC3A 4GH4A 3GZAA 3V0BB 1EP0A 2LALA 2OZJA 3DN7A 3N7MA 1M06G 1YIPA 3E6DA 2A5ZA 2TEPA 3IPVA 4GKXA 2AENA 3SHRA 3VL9A 2GC1A 2ZGKA 3VN4A 4BWOA 4QQLA 1QOTA 1W6PB 2BNMA 4DY3A 2ZX1A 1Y7BA 4GA9A 4RA0A 2O8OA 4ES8A 4AI1A 4M3CF 1ZBE2 4N43A 4Y1VA 2NYYA 1Z7S3 1SBEA 2PELA 1FNYA 2TNFA 1CAUA 2EVXA 4PIYA 3JBG1 4PLNA 4DFSA 3G6JB 3QH6A 4XQ4A 1APNA 3IWZA 4XF4A 2YZ4A 4YG0A 2VU9A 5DDJ3 2UWCA 4QGNA 1GKBA 4NOTA 2R49A 2PHXA 2ZHKA 2D98A 2IZWA 4KL1A 1C5IA 1BZWA 1TME3 3R4SA 4YYOA 4L2NA 5KHIA 2ZOEB 1AR72 2W08A 3H0OA 4YG3A 1K5MC 2IFRA 4NHLA 3UKVA 4LBJA 3WUDA 4LTAA 1J59A 1O7FA 2HEVF 1PO11 1AUYA 2UURA 4R52A 1I3HA 3WDVA 4P5HA 3WT3A 1BVVA 4OHXA 3KGZA 1JUIA 4FPEA 1ZVFA 3E6CC 4XQWA 3NV1A 3ZSKA 3VZOA 1QWRA 2CGNA 2WJSA 2NN8A 1URXA 3VHNA 3M3OA 1AX0A 2HEYF 3ZFGC 3H9AA 3NO8A 3PTYA 4NR1A 3X29B 4Z82A 2VMHA 5KBFA 4XE9A 5JI9A 4RR3C 4QPGB 3CLPA 1UU5A 4I0BA 2DYCA 1ND2B 4Q4Y2 4QHBA 3TNPB 3U07A 4AI2A 2VW2A 4FPHA 4AVBA 5ABJC 2JICA 2CL2A 4IERA 3RI9A 1OA4A 3DPRB 1MEC2 4K1ZA 1EPWA 4COWA 4QGMA 1RTVA 2DUQA 2WT1A 4XILA 1GR3A 1JHNA 4TSVA 3BOPA 3I7DA 3ZN6B 1R083 1J3QA 5K9YA 4Z8BA 4EWDA 5A3LA 5DUXA 3GHNA 3VL8A 1DZQA 1QHDA 2LUWA 5FFOC 2FQPA 4COYA 4RQPB 1QY4A 2PHUA 2DUPA 5LRSA 5J37A 1W6MA 3WOGA 5ABJA 2HWB1 4LHKA 2DVDA 3KZ4C 3ZXAC 3O0VA 4BPZA 3NAPA 4N53B 5CAZA 4LBLA 5GZFA 1EV11 1XNDA 2OYZA 2ZKLA 1SLBA 2DUOA 3BOWA 4Y1XA 1RUF3 3O14A 3JD71 2RMU2 1LB2A 3SLIA 4YGCA 5I0TA 4XFIA 1MS5A 4AI0A 3TN91 1G9CA 1NCRB 3B02A 1F5JA 4UW6A 1V00A 3O12A 3N35A 3PMEA 4P9WA 2EA7A 2O0OA 4IEWA 4RD7A 2VG9A 4AI3A 2O1QA 1CR7A 3M3EA 3AP4A 4D7YA 1JN2P 3G7DA 5JPMB 4B4RA 1CJPA 2R072 1G86A 1B35C 4R9CA 3B94A 3SCHA 1NE4A 1EAH1 3LSEA 4XTMA 2JX9A 4XF3A 4DS0A 2P34A 1JBCA 2E7QA 3ZFEB 4YVWB 2GMPA 2ZHNA 3MI8A 4WM8A 3WY6A 1R1A2 5C4WA 3TOJA 1KXGA 1PVC1 2ARXA 3RYKA 3BCWA 4IEYA 3RMXA 2X5IB 2BQPA 1HV1A 4H14A 4C91A 2RM21 4DINB 4J1WA 4MGZE 4I01A 4BMEA 1C8M1 1T6GC 2ZMLA 4QPIC 1LHUA 4I02A 4WVMA 5T54A 5E8AA 2GH8A 1QNWA 3J26N 3VBFB 4ITCA 3V0AB 4Q4X1 3RNSA 3JB8A 3WDXA 2UU8A 2E7AA 3WDYA 3E5XA 4KGGA 1PVC2 1QOSA 4I30A 1AJKA 1PNFA 5GZGA 5D1IA 2YC0A 3DV8A 2HJIA 2RM22 1PO22 2VUJA 3C3VA 2R16A 1UL9A 3POSA 1WA4A 3W9AA 1VBA3 1AR63 3AKSA 4QPIA 2Z2SB 1WCSA 4B3NA 4Q4X2 1QJY2 2VOKA 3C2UA 3BIWE 2R1DA 1SCRA 4HETA 4FPGA 3TWIA 3AYCA 3WHUA 3B00A 5DZGA 1VRH3 1RMU2 3ZSEA 4LLFA 3AZYA 3FUQA 3LOIA 2D6MA 4XPVA 4FP3A 1JYIA 5JZGC 4AFBA 3BALA 1AYN1 4PDWA 4W6YA 1HKDA 3N3HA 3VBHC 4XQDA 5TSWA 4QU2A 2PAKA 4EN7B 4IEXA 3ZYJB 5HCBA 2W68A 3LZZA 1HQLA 3SH4A 2PYTA 4QT6A 5LRRA 4CEYC 4Q8LA 3SISA 2XVLA 5CG8A 5JOWA 4OHVA 3AKQA 4Q29A 5DDJ1 2A6YA 3APBA 1U5ZA 3TRSB 3ZXKA 1NY71 3CO2A 5CBLA 4AEDB 4RGGA 1G6NA 2CYFA 4XYXA 5GJ6A 5J09A 1AVBA 4C90A 1Z7S2 4XW3A 3UK9A 5CFDB 2ZX0A 3VBHA 2IXHA 1IGOA 3I2DA 5JCTA 2XH6A 3ZIXA 3FLTA 1S0BA 2VGDA 2B42B 3B93A 4H3WA 5A32B 1PNGA 4FAHA 4HVRA 4AEKA 2JG8C 1XU2A 1OHFA 4UW3A 2A73B 4DQAA 3L9JT 4AQTA 1GZWB 2WLQA 1SACA 1HRV3 1NCQB 4TLFA 1TME2 4I2OA 2VW1A 2W0XA 4EV0A 3O0WA 5E89A 1KDMA 2EF6A 1RJ8A 2WFPA 1CQ9A 2IWGB 3H1WA 4FOWA 4FVVA 4GIQA 4YZ2A 1MS4A 4C1WA 1YCIA 5BNPA 4AE2A 3WD5A 1ENQA 3TB0A 5IK7A 3VBOC 1PZ9A 1FOD3 1QJX1 4XFBA 1CONA 2JKBA 3ZN5A 3OBRA 2HWD1 4XEZA 1Q3EA 4HL0A 1R081 2RS31 4GH4B 3KCCA 1DQ6A 2EXHA 2XL7A 1BYHA 3WG1A 1VIWB 3SH3A 1IQAA 1YJKA 2D3RA 4XBQA 4DRRA 3IPVB 2VNOA 3GHMA 4XJ8A 3VBSA 5FPZA 4AQ2A 2ZZQA 2HYKA 2Y26A 5D8AC 4YZ1A 5BNOC 2XVGA 2F4PA 4KQ7A 3ZYIB 3VDDC 4N43B 3VHOA 5CADA 1X36A 1W6NA 3ZVXA 1YFUA 2B7YA 4FPYA 3RYPA 1F2NA 1CAUB 2SLIA 1D0HA 2GU9A 1R082 3N36A 5T55A 3NV4A 4YZ5A 1SMVA 1MVEA 3ES4A 1WW7A 1CAXB 5B2GB 3R6SA 4OHZA 4LHNA 4U2AA 3WUCA 5F5QA 4CDUA 2R043 1DU3D 4HVOA 1PIV3 1FPN2 2ZGLA 4CP2A 3VBRC 4BA6A 2BEOA 2IXLA 5D8AA 1GLHA 5BNOA 3ZMOA 1AZDA 3H1YA 1OQEA 2YMZA 1RUF2 5BXXA 3VZKA 1L3JA 2WWSA 2WIIB 4P9IA 1N3OA 4Y1ZA 3JBG3 5J48A 2VMGA 1BK1A 1UZZA 5DUUA 4XF0A 4C1XA 4LT5A 1QF3A 3H3UA 1OSGA 4ES9A 4XOGA 2YUEA 4PLOA 1QU0A 5DXDA 5J7MA 3R0RA 3ZX7A 3VBRA 4QQ2A 1NE6A 5GKAC 1RC6A 1WLCA 3UKTA 4FPFA 2A3XA 1S0FA 2FMDA 1FATA 1RUH2 3W59A 1COV1 1ND3B 1S55A 4OZXA 2DCYA 4HN1A 1U5IA 1C8NA 3PMSA 1MZ5A 3WINE 3HAGA 1RB8G 4ISRA 1VAMA 3CJIC 5LEKA 1KFUL 3AZWA 4HPKB 3A0NA 2DCKA 2MEV1 1R093 2VOXA 2WNVB 3AP9A 5GZEA 2VMIA 2D6LX 1RL3A 2WQZC 2FZ2A 1GICA 2XLAA 3CU7A 3ST7A 4AFCA 1IS3A 4N7UA 2ZGNA 4GWNA 3RYRA 2DCZA 3B9IA 3POWA 4LBQA 5K8SA 2RJKA 3KM5A 1NLSA 5ABJB 1AR61 4HK9A 1YFYA 3CJIA 1S0IA 2VPVA 3NAPB 4DPNA 3FFZA 4JGYA 4FPCA 1W0OA 2XJSA 4I0WB 1DQ1A 4YGEA 1YYNA 1A8MA 1GQHA 3ELNA 1MACA 3UJQA 3H8UA 4K21A 3UV9A 3ZXFA 5L7OC 1VRH1 1ZYBA 2GZWA 2A75A 4LE4A 2IXIA 2B46X 4V1PA 4ONUA 3URFA 1XYOA 3MPBA 1JXNA 2HWB3 1VBA2 3OBTA 4KG8A 1AR62 1ZZCA 1F9KA 2XBO3 3GNEA 1OI6A 4M3CE 2NPIA 4CEWC 1NG0A 2YGMA 3JCIA 4YW2A 2QJVA 3JD73 3HBZA 4FPKA 2P17A 3MICA 3WP5A 3RI8A 3WCRA 1AL0G 5E1RA 1REDA 2ES3A 4LO8A 5DZEA 5EJ3A 2RJLA 5GLUA 2X29A 1RUOA 2JE7A 1OA2A 2YGLA 2FHRA 4W6XA 5FQ0A 3B7MA 4PLMA 5E16A 1OLQA 1DQ5A 1I9RA 5KHHA 4R9AA 1CESA 3SXWA 3AFGA 4WM8B 4S2HA 4BIFA 2YXSA 5C4WB 3AYDA 4LHLA 4P9LA 4EN6B 1DYKA 1LHNA 1SLIA 2VW0A 2EAKA 2V73A 3PHMA 3M70A 2ZX3A 3OGGA 1OKQA 4I09A 4Q1RA 4BYYA 4QD2A 3KCYA 2UWAA 3RG0A 4GMP1 4B29A 4BQ1A 2B39A 5LK7B 2HWE3 3ENRA 4YM1A 1AX1A 4WVMB 1YIFA 2Z69A 5T52A 2ET7A 1HRV1 4ZXKA 3ZSJA 4Q0QA 1W0PA 3VKFC 2RS53 4K20A 1V6JA 2R1BA 1LHWA 3EHKA 4JAAA 4LUKA 1Y43B 2WL1A 4XXPA 3VBUC 4OULA 1GNZA 3OGJA 4D94A 1W6OA 4FXKB 2JG9C 4SBVA 4FTSA 1WW5A 1C8M3 3K48A 3M2MA 1XE8A 2B45X 1FOD1 3WP4A 1B09A 1HRV2 2GC2A 2H0VA 3HR9A 2ATFA 1CN1A 2NM1A 2Q0AA 1QOOA 2VNRA 3J9SA 1H8TB 4Y22A 1NA1B 2DURA 3KB5A 2FZ1A 1V6NA 1H0BA 4YM3A 4LO5B 4PDWB 3BB6A 1FOD2 3M8LA 2Q4SA 5FO8B 3U0ZA 3CJXA 4KGQA 4YW3A 1TMF3 5CFCA 3USSA 1UIJA 4IEUA