3K51A

Crystal structure of dcr3-tl1a complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
160
structure length
143
Chain Sequence
GDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMPDSITVVITKVTDSYPEPTQLLMGTKSVSGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Tumor necrosis factor ligand superfamily member 15, secreted
publication title Decoy Strategies: The Structure of TL1A:DcR3 Complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 143
sequence length 160
ec nomenclature
pdb deposition date 2009-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00229 TNF TNF(Tumour Necrosis Factor) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3k51A01
1JTZX 1PK6C 1OQEA 1GR3A 1KD7A 2JG9C 3B94A 4QQPA 2AZ5A 3LKJA 2KA3A 1D0GA 1JH5A 4G4FA 4QQ2A 2WNUC 5L19A 4DOUA 4KGGA 2HEVF 2WNVB 2JG8C 3K51A 3MI8A 2WNVA 1TNFA 2QE3A 4G3YC 2RE9A 4KGQA 2JG9B 1D2QA 4DB5A 2ZJCA 2O0OA 4RSUA 2JG9A 3URFA 3IT8A 4QQHA 5KC5A 2WNUB 5KC6A 1KXGA 2JG8B 2WNUA 3B93A 2E7AA 4QQOA 1DG6A 4GIQA 2OIIA 2JG8A 1S55A 2Q1MA 1RJ7A 5HBAA 3FC0A 4F3JA 1XU1A 4E4SA 3TWIA 2ZPXA 1PK6B 4OUMA 2Q8OA 3QD6A 2TUNA 4D7YA 4NN0A 1PK6A 3TYJA 5BNQA 5L36A 2Z5WA 1WCKA 1U5ZA 5CIRA 1C28A 2RJKA 1U5YA 3ALQA 1C3HA 1OSGA 3K48A 4TWTA 4MXWB 1OQDA 4TSVA 1TNRA 2R32A 3V56A 2HEYF 4EN0A 3L9JT 3ME2A 4MXWA 4HT1T 1RJ8A 2TNFA 2WNVC 1IQAA 1A8MA 4N90A 4MXVA 4OULA 1U5XA 5TSWA 4J6GA 4QPYA 1O91A 2R30A 2QDNA 5KWRA 3B9IA 3WD5A 4QQLA 3AB0A 1DU3D 2R6QA 4E4DX 2X29A 1I9RA 2RJLA 1ALYA 4OUSA 1XU2A 1D4VB 3QBQA 4MSVA 4KG8A 2HEWF
chains in the Genus database with same CATH superfamily
5FY0A 2BOIA 5F5IA 1QJFA 2DCYA 3GNEA 4GZ9A 5D2AA 1RUI1 1OH4A 1C1FA 3AKSA 4YVSB 2OYZA 1TMF2 3MPPG 5A6QA 5I93A 4LPLA 2DDUA 3SCHA 3MIEA 4YYOA 1WWYA 4DMIA 2WNUC 3HPNA 2ZX4A 4RQPB 4LLOA 3J7LA 3M3OA 2JXAA 3NW4A 3OEBA 1WCUA 5DMYA 1HN0A 2WKKA 1OFSA 3LZZA 4QKFA 1YHFA 4KWJA 3VZKA 1VE0A 1L7QA 2CAUA 2Y33A 2P5BA 2RS33 4XJUA 3O1TA 1UXZA 4OMCA 2YMZA 4GWIA 1K12A 4RHV2 1NCRC 1GZ9A 3PMSA 2Z42A 3ETQA 3JD73 5ANQA 4QB1A 4XBLA 3RZGA 5IFPA 1G86A 2YBSA 4COVA 1ZBA1 3NAPC 3I2IA 2WSVA 5FZLA 4P00B 1BEV2 1UY1A 2D6OX 4N9HA 1CJPA 4QQOA 4XIOA 1WW4A 1UKRA 4PIXA 3RYPA 4AR2A 5IK7A 4NIGA 4Q4V1 3RYRA 3BIEA 1UY2A 1DQ1A 2OA2A 3DN7A 3LAGA 4JC1A 2R061 4XXAA 2RVAA 4U36A 4AEDA 4BHPA 3HN1A 3C7EA 5E8AA 2EIBA 1LGBA 1X8MA 2RM23 2P3KA 3LEMA 3U37A 3DPRA 2RMU1 3A0KA 1NA1B 2BZDA 4D6SA 3RNSA 3ORJA 1BHGA 4MO3M 1A78A 3MHZA 4Z8BA 4IV3B 2WNOA 1GMMA 5BNNA 2R0FA 1UYYA 4Q26A 1O3RA 2VO5A 1TME3 4N53B 4XFGA 2W2IA 2QJVA 3VZOA 2VL4A 4LBLA 2JDNA 2WZPP 2B46X 1AR71 3WHTA 4A6SA 2V5DA 2X05A 3N35A 2BFUS 4NHXA 3ALQA 4FPFA 4Q4Y3 3N7LA 1PHMA 3LEKA 4XACA 4A3ZA 4ONUA 1OSGA 4ZY9A 3CMGA 1ONAA 1OQDA 1S0BA 1TNRA 5IVCA 4H55A 4NJ4A 3PUIA 5T50A 1UIKA 4AQ2A 1E57A 1HRV3 1QJU3 3WQ0A 3AL6A 2QQJA 5FCCA 4D8MA 4ZXKA 4BZ4A 2XUMA 4IE7A 3T0AA 1KJRA 4I0BA 3OG2A 3ILRA 4INDA 4A7KA 2W9XA 3H1YA 1U5XA 1GSLA 2AC1A 4EQVA 3KHBA 5HCAA 3JB8A 4Q0UA 4PQQA 5IK5A 3U4XA 3ZMNA 4UW6A 3BVCA 2WZ8A 4B29A 2WYFA 2GC0A 1W8NA 2PHWA 5LEJA 5JIUA 2P2KA 4WM7A 1DU3D 1NLQA 3KQ4B 4C8DA 1RUOA 3P3NA 3RQ0A 5E88A 1SPPB 1RVF1 2Y26A 4MG2A 2YYOA 2PA7A 4IV1A 5DUWA 5C3QA 5KXDA 4AG4A 1CGPA 5FP7A 1COV1 1WMFA 3IMNA 5FY1A 3CIHA 4KG8A 4LKDA 1H8TA 1STMA 2MEV2 1G8WA 3VUOA 1J3RA 1Q8VA 1NXD1 2FBEA 1F5FA 1J58A 3C7OA 5BXXA 1VAVA 1XE7A 5CFCB 1ZVFA 3EXUA 1W9SA 4QQ2A 3VHOA 2FCTA 2CY6A 3LDRA 3VDDB 5A33B 3AJYA 1OXCA 1CAUB 5FPVA 1KQRA 1EAH2 4OHYA 2HH9A 4LHKA 1HRI1 2QQWA 4CDWB 1VBC2 5GLUA 2VQUA 4AEDC 3IBMA 3IPVA 5F6LB 4B7KA 4ZHNA 2QQPA 1NYWA 2J1EA 2P1BA 3JQWA 3VD3A 5FZHA 4X8PA 3DPRC 5K0UC 1GP4A 3N9OA 4KGQA 4IEQA 4RGAA 2ARAA 4JQRA 5JPNB 4M0HA 1XXNA 4YFZA 3VB9A 1W2UA 2WO7A 2YZ4A 3WEZA 5A3UA 4LBOA 2WINB 4L11A 2HYXA 3FBYA 1UZWA 1UCXA 4QDSA 1UYZA 5J96B 5K9YA 4LBKA 3IDCB 1CAVA 4QWNA 2GAUA 3C2UA 5FBZA 5C9AA 4QPIC 4SLIA 3F2ZA 3FLTA 1LHWA 4PLMA 4IE6A 4HVQA 1IGOA 1POV3 1NCQA 4HPKB 3PUQA 2CGNA 3GGLA 4LBQB 3WQBA 4FPJA 2J1RA 1QEXA 2XLGA 4AF9A 3H7JA 4FQ4A 4UW5A 5HCBA 4AHYA 2EICA 4QPGA 3TYJA 3U11A 4A7YA 4HKWA 1PM4A 1W0PA 5F3CA 1U5IA 1OLRA 1CAXA 1U5YA 4I3PA 4QXHA 5EYXA 2TEPA 5FYTA 3NO8A 3WCRA 3LPFA 3ZXKA 4BIOA 3DEMA 3IIAA 3JU9A 2C0ZA 1YQCA 2XQRA 3WINE 3CQOA 3LQCA 1K5MB 3N9MA 4E9KA 4NUBA 4K21A 4IE0A 4WM7C 5EQUA 5F39A 1ZZBA 1ZREA 3AP4A 4NOTA 1W2AX 5FYZA 1V6MA 4RQPC 4UI9L 2WDBA 2WQ4A 3S57A 3P5BA 4IV1C 3AL5A 3TN93 1PGL2 3FL7A 4HBNA 5CVRA 1RXFA 3LPGA 1CR7A 1LAJA 4XJAA 3OTFA 5IHRA 2FCVA 4D6RA 1AX0A 2GC3A 3N4MA 1CWPA 1SBFA 1TEIA 3MYXA 4XQDA 3ZFGA 2JENA 1ND2A 3AMHA 1AYN3 1H1AA 2HWB3 2UYBA 4BMBA 4YARA 1O91A 3EMRA 3WD5A 3HWJA 1PIV2 2NM1A 3LOBA 2X10A 4TZDA 3BOPA 3ZYJB 1IG0A 5DXDA 1RUG3 2CGPA 3S7IA 1UOJA 4Z07A 5FXXA 2YGMA 3IB3A 4I0WB 4MSVA 1RUI2 2VD7A 2DVFA 3WNNA 5F32A 2XKPA 2QQMA 1PVXA 3VKNA 3AMPA 4UAPA 1WKYA 3R0RA 4META 2PELA 5D8AB 4JHZA 2CDOA 5FPLA 1YWKA 1UZYA 5J98B 1AXKA 5FJKA 2DBIA 2UURA 4IV3C 2PYTA 4Q8LA 4XTMA 4ASLA 2FDIA 3LDBA 5ABJB 1X9PA 2Y8KA 4LR4A 5GZDA 1PVC2 1Y9GA 1LESA 4IETA 5LW9A 3IDAA 2EF6A 5CFDA 3H1MA 1OLQA 3O0XA 1VAKA 1ND3B 5IW0A 1DGRA 1NCQC 5IVFA 1OOPA 1ZBA2 4KL1A 5C5TA 1FPN2 3AK0A 4FPYA 4O61A 4CU7A 4RSUA 4ZPIA 4GALA 4Q4V2 4Q1RA 1H1IA 3VL9A 3NV3A 4URAA 5CAZA 1JYVA 1MEC1 2R062 1OI6A 2XR4A 1E5RA 1PGSA 1PMJX 3AMNA 4C90A 2QQUA 1FOD3 1RITA 2RMU2 1ULGA 1JZ2A 1KDKA 1DYKA 3G7DA 3WW2A 1VRH3 4IEZA 3MIFA 1WA4A 3LOIA 3HT2A 1GWMA 4XF0A 3KVBA 2RDQA 1WCDJ 2YDEA 1NE4A 1EUTA 2ZGKA 4BH9A 3I49A 3O7OA 4W6WA 2ZPXA 3DYPA 4Y20A 5BPXA 3K2OA 4B1LA 1AR72 2FHRA 3PJQA 5A7OA 3ES1A 4QDRA 1OC1A 1PK6A 3POBA 4MGYE 4B4PA 4XDQA 3D3AA 2VBBA 3POJA 2E53A 4XMIA 4NE9A 1AJKA 2VUDA 1A3KA 4HN0A 5CIRA 2EAKA 1D0HA 2XJPA 4Q27A 2IVIB 4QAWA 3J8F3 4Z2WA 1ZZCA 4D7SA 2E7TA 1D4M3 1UO9A 5FY5A 4C1XA 1VLNA 3PNAA 2XJQA 2ZACA 2WO3A 3ZYPA 4MXWB 2OZJA 3WF4A 2D40A 5CFCC 2ZGLA 2IC1A 2ATFA 3NKTA 3OD0A 4AW7A 5FZOB 1CPNA 4TLFA 4GB33 4HT1T 3ACHA 4QGMA 4Y5TA 1LHNA 4ISQA 4CCNA 4F7ZA 2ZGNA 1OT5A 3KCYA 2WN2A 3UGFA 4P9GA 2BVVA 3SITA 2C24A 4ASKA 3ZFEB 4LO8A 4HVRA 2XMLA 4EWEA 4MGIE 1X50A 3CHXA 1W6PB 5FPUA 4BWOA 3OGJA 3GBWA 1RVF2 5LZ6A 4W6XA 3V65A 5KWRA 1I1EA 2WZR3 1FX5A 1QJX1 1COV2 3AB0A 2J1SA 2PLV2 1OVPA 4Y22B 1CONA 2VNGA 4QM8A 3NV1A 4DEVA 2BW8A 4UW4A 1R1A1 3HMYA 1KDMA 1OFNA 4QT6A 1UF2C 3KV5A 2ZKNA 1ZRIA 4K6BA 3MUY1 4BQXA 3MW4A 1MQTB 1YC61 3O1UA 3OBZA 2AYHA 4WM8A 3OJBA 1ACCA 2ZKLA 1N47A 2V73A 2BU9A 2VTXJ 1ASJ1 4XILA 4UYBA 1D2SA 1IG3A 2ZAAA 1D0GA 4XHXA 1HRI2 4LORA 4R9AA 4X8NA 4YWAA 1ULCA 4S2FA 5FZMA 2BV4A 4C0HA 2GH8A 1OA2A 1SCRA 3OEAA 5IATA 1LOBA 4H2AA 2DCJA 1FYUA 1K5MC 4QGNA 1QXRA 3RVHA 5FR3A 2ZA9A 2VCAA 4NWWA 1C4RA 2RV9A 3O1RA 4JGZA 2VMDA 3BTZA 4GMP3 4BDVB 4PI0A 2DUOA 5JXJA 3FUQA 4R4XA 3I54A 5FY8A 4CDUB 2RS53 3E6DA 2QQKA 4DB5A 3UKVA 5JOXA 4CXWA 4AAPA 4L99A 2OXBA 4ASMB 1YQ8A 1TE1B 2JE8A 4MGKE 3NJVA 1RINA 2RS12 1LULA 4MHUA 1VBE3 4AVSA 2DU1A 2Z4FA 1NX9A 2VVEA 4HL0A 4P5HA 3RMYA 1YRZA 4CE8A 4M3CA 2C6SA 3AX4A 2OVUA 1BCXA 1V00A 3H42B 1R083 3EQEA 2QTWB 2VZSA 4ORFA 5FO7B 1AR83 1BXHA 1A34A 4L92A 2XJTA 3VBSA 1AZDA 1PZ7A 1XU1A 3T4VA 2JKXA 3FHQA 2J42A 2E51A 1FAYA 3U14A 3NNFA 3PIGA 4OUMA 4LKFA 1CD3G 5FYBA 3VBHA 5KHJA 2HBTA 2D6KA 3OBRA 4NIHA 3I2FA 2VVDA 1J83A 1VBD3 1VJ2A 1ZRRA 2E6VA 4OUEA 5A32A 1H9PA 1W8UA 1GQGA 5ACA3 2Y64A 5FPBA 3CJIA 3I2HA 4Y24A 1C28A 2Y6LA 2BNNA 4Q4X3 5D8AC 2LROA 4RHV1 1JMUB 5DAXA 4BA6A 4PDWA 3AP5A 3KS7A 1QXJA 1DZRA 2IZWA 5LBFA 2RJ2A 3T09A 1LODA 3CBNA 1GQPA 1ZYBA 1WMXA 1VIWB 3AVSA 3M3CA 4LE3A 4XF4A 3VL8A 2CAVA 3OUHA 1LOCA 3POFA 5HV0A 2JDKA 2VZUA 1RUJ3 5ABJC 2W68A 4D0QA 1VBB3 3WZ1A 1GNZA 1RJ8A 5T5JA 4CDQB 2OS2A 1BBT3 1POV0 4DINB 2V4VA 3K3OA 5FYHA 2B39A 4NHKA 4B4QA 4FBFA 5B4NA 4WBBA 3ZM8A 1ODMA 1W8FA 3D0SA 3W5MA 3U1XA 1QJY2 4NIDA 2V5YA 2WFF1 3USUA 4CP2A 2PHUA 4CTEA 5FO9B 3RI9A 4LXLA 3T2TA 3V0BA 5FZ9A 2KXLA 3PVNA 4XUOA 4JV4A 3S30A 2ORXA 3AYEA 2QDNA 2XHNA 4WVWA 2HLEA 4JTOA 2IFWA 2D6MA 4Q4W3 4E4DX 1SLCA 2HWD3 2X29A 2FDHA 4XHBA 3O12A 1ALYA 1CZTA 2ERFA 3HJRA 4LA3A 3THPA 1CX1A 4BLJA 1RMU3 1N1VA 1SACA 1JYXA 3HIFA 4MADA 4FP3A 3IM0A 4IL7A 5FYIA 5LBBA 4CSWA 1SHWB 2JX9A 3A23A 5LK5A 1QWRA 1V6OA 5KHKA 2ZTNA 3ZN4A 4QB2A 1AJOA 4D94A 2YB7A 4LJHA 3RZKA 3Q8BA 1LOEA 4QQPA 2AZ5A 2L9LA 1YFWA 3AYCA 1FATA 1W8OA 3AP7A 3RRDA 3GJAA 5FMCA 4BQYA 4ZZ5A 2VMEA 3EB7A 3UL2A 1H9WA 2VZOA 5CKQA 2XVKA 1QJZA 1NZCA 2V72A 4UXAA 3V64A 4DEQA 5JLVA 1IS4A 4UFHA 5EWSA 4OYUA 1HB1A 3VGIA 5FPXA 2QQVA 4QKDA 5C4WB 4E4ZA 2C5DA 3IN9A 2WS92 1ZBE2 4TTGA 4FTEA 1MS4A 2JG9A 5EJ3A 1DQ5A 3IAPA 3H8UA 4HN1A 2WT2A 2RDRA 3MIHA 3VZMA 2ORZA 3WP3A 5A70A 1F4AA 2JG8B 1QQP3 3CJIC 4UF0A 2R1BA 3ZFEC 5FUNA 2ID4A 2BFUL 4JKLA 5A7SA 3HOBA 4DUWA 2VUCA 2UY9A 4PDWC 4XF1A 2J22A 2JB4A 2VTXA 3FC0A 4P02B 3VDCA 5JXIA 1BVVA 3KV9A 2FD8A 3M8LA 3H8RA 2VULA 3OPWA 3T4HB 1JYCA 2KD7A 1K5JA 4JHTA 3T2PA 2R49A 2CV6A 3KCXA 1EAH1 3AZYA 3FFQA 3APBA 4CCOA 2QBXA 1UU5A 2C9AA 2VR4A 4UT5A 5A7PA 3NWKA 4M4RA 2WA4A 4FFHA 4RR3A 4XURA 4XZUG 1I5ZA 1DQ2A 5KHHA 2CNAA 1TZOA 3ES4A 4R52A 1PO23 1XNBA 1BMV1 5T54A 4P14A 2WAOA 1ZZ6A 4CCCA 4P9JA 3ZYFA 2ENRA 1JOBA 2Q0AA 5J37A 2ZX3A 1BK0A 1QIQA 1L7LA 4AHWA 1R093 2G4IA 1W6MA 2TNFA 1PM7A 2XJRA 2YROA 4W50A 3KZ4C 2V09A 3M3QA 2A70A 4YM0A 4CPBD 4LNVA 3AM2A 2PMWB 2VMGA 4AK3A 1QJX2 3J4UH 4ISRA 3J7NA 2PAEA 1W04A 3JZVA 1UY3A 3MEPA 4GULA 1QKQA 4MV2A 5FZIA 3EBRA 5EJ1B 5C3RA 2VQTA 1EV13 5LWBA 3MPBA 1R1A2 3ON7A 5JXHA 5CG9A 2Y0OA 3N9PA 4IQPA 3VHNA 1L3JA 2IXIA 2WSUA 5GZEA 1NZIA 4LT5A 5LA9A 5FWEA 3BTYA 2PTMA 3NVCA 2RS31 1HV1A 2PAKA 2XJSA 1U0AA 1W6NA 3BU7A 4LO6B 2NZ9A 4AQ6A 3FFZA 4GKXA 4XFBA 3WNXA 1ASJ2 4YGDA 4K20A 2WRAA 1UY4A 1CJDA 2CTVA 3JBG2 4MVTA 3UKTA 2JDAA 4BQ5A 1RGSA 2VUAA 3UETA 5CADA 3AP6A 1SLTA 1WMDA 2JG9C 1I6XA 1OPMA 1YO8A 4EV0A 5EXOA 3WUDA 1GNYA 2VGDA 4A44A 3O1PA 2BVBA 3I2OA 4NRMA 4UFJA 4FAGA 3ZN6B 2X5IB 1PO12 2A6WA 5JSRA 1CAWA 1O7FA 5A6ZA 4QMAA 5F9TA 3AXDA 5L9RA 1A6CA 3ZYHA 5FMDA 1XNDA 2VOKA 1ZM1A 4V2VA 4XYXA 3OYWA 4IGPA 3TOJA 4BXFA 5LEKA 3BI3A 2W46A 4IEVA 3MO4A 4Q0QA 2AREA 1X9TA 5FYUA 1PIV1 3THDA 5A3MA 4AVCA 3U0ZA 1VPHA 1YI9A 1BZWA 1JU3A 2DCTA 2W08A 1URXA 2VPVA 2W3JA 2QQOA 4B8EA 3QOPA 2PQQA 2PHXA 5FBJA 5D21A 2ET7A 4KNCA 1S0FA 4YG6A 3WG2A 1J84A 2WLQA 3WF1A 5A1FA 4LBMA 3RZMA 2GP5A 5FY4A 3E97A 1UL9A 3OD4A 2C4XA 3BUCA 2FMYA 3MIDA 1RUF3 5DZGA 5BNOB 4RR3C 1VR3A 3LIGA 1GZWA 1QJU1 3LCPA 1JZ8A 5HBAA 1Q8QA 2HYKA 4I30A 4IGOA 3R4UA 1MZ5A 1IPKA 3U75A 2VZTA 4HK9A 2ZZQA 3Q8AA 4KMQA 5D1IA 4BU2A 5GKAC 3UGGA 2LTNA 4LTAA 1SDDB 3DXUA 1PVC1 2VOXA 4QX3A 4XUTA 3HD8B 4HKOA 2B4KA 2R1DA 2E33A 2PN5A 2Z79A 1JUIA 1QDCA 1RHI3 2ZGMA 2IXLA 1LHVA 1Y3TA 2GC2A 3KM5A 4GJYA 1WW7A 1W99A 3M1HA 1QH6A 2O8QA 1FPN1 1POQA 2WA3A 2B5HA 3ZR6A 1CX4A 3CO2A 4AVTA 4JDOA 4WVMA 4ZU7A 5KHIA 2UWCA 3WP6A 1MPXA 4CEYB 4DXTA 2ZX2A 2ZHLA 2BYVE 4QM9A 4Q0VA 1UMIA 3L2YA 2NN8A 2OZ6A 2WFF2 5K0UA 1O4YA 2J1UA 2ZGTA 5DUXA 5ISLA 1OKQA 2D93A 2BERA 5BY5A 3PUSA 1Z78A 5DAPA 3INAA 1GANA 5IWFA 5T5PA 5DUVA 5C4WC 1DDLA 2Q30A 2KR2A 4JKMA 3N7JA 2DUPA 5APAA 5GLVA 4WZFA 3OB8A 5FMOL 3NV2A 1HJGA 2PHTA 3B9IA 3POEA 3ZFFB 1AL23 1PNFA 1UX6A 1KFUL 3AFGA 4QPIA 5T55A 1Z7S3 1SBDA 1QOSA 4BMEA 4JCKA 4TYSA 2AENA 1OD3A 2OPWA 3MLLA 3LWCA 5F5QA 3WF2A 4AAXA 2VJXA 3J26N 1V6LA 5FQ0B 1XU2A 4LA2A 1YQ5A 3ZIXA 5LY1A 1IHMA 5C8CB 1UQXA 2ILMA 1AYM3 4HOOA 5JIAA 3VLBB 3AJZA 4CP0A 2HWC3 5M0TA 2W52A 1QDOA 1OQ1A 3WNKA 5A3NA 2W1WA 5L7OB 3WDTA 1SLAA 4HMZA 3HVDA 2A6XA 2UYAA 3DXTA 5FYMA 4GXLA 1AXZA 4JRAA 4Z1VA 4EWDA 3LKJA 1ZRCA 5EV7A 2DUQA 4OHZA 1RUI3 1RYYA 3AVRA 4YVSA 4Q29A 3USSA 3MF9A 5I8TA 5I8SA 4AI9A 4DOUA 1GV9A 1RTVA 3BB6A 5LA0A 5C7GA 3ZYIB 3AZZA 3QLQA 4NPRA 4RQPA 2YC2A 3KT7A 1O3QA 2VQ0A 2IXJA 4Y4RA 1FV3A 3RMXA 4TLGA 4D6QA 4F83A 2PLV1 2W1QA 4AWDA 2BUKA 4X6RB 1DFQA 5FLHA 5FAXA 4XF9A 5KXEA 5KR7A 2YBKA 2Q8DA 1JZ6A 1XB9A 5EIYB 2Y6KA 3MZHA 3KWVA 2E7AA 3KV6A 2PQSA 4L0PA 4UFKA 5LK7B 4RYDA 1H6YA 1SFNA 4A42A 1RIRA 3ELNA 2LS6A 2RR12 3UK9A 5FOBB 4Q4V3 3PU3A 1QXPA 3MLJA 3TN91 1XNKA 2C1FA 3SNMA 2AGSA 3VBOB 4DXRA 4K7JA 3C3VA 2TUNA 5IVBA 4D7YA 4AI1A 1D7PM 1FMD2 1ZA7A 1NA1A 1W0OA 4RGGA 5IJRA 1LU2A 1U12A 1AYN1 3WVJA 4F8AA 1J1LA 1E5HA 1WCKA 3O0WA 2H0BA 4IV3A 3PMEA 1W9FA 4CU6A 3GBFA 2XPJA 5DZFA 1BMV2 1A8DA 1T6BX 2VMHA 2VZPA 4N53A 1N1SA 4RFRB 4YM2A 1NKGA 4E8CA 3O1OA 4ZU4A 1RUG1 3HQUA 1GP6A 3K48A 1GP5A 4TWTA 4XZPA 5IUQA 5A80A 2BGCA 2R32A 3OGRA 1MS1A 2JD4A 2X5IC 2D3PA 3KVAA 3PUHA 2ZGPA 2RS11 3ZYGA 2XG3A 3DUIA 5T3NA 3WT3A 1HW5A 2DBNA 2LUWA 3WNMA 4MUVA 3NKGA 3SEEA 3WQ1A 1APNA 3NNJA 2X53S 4ZS2A 1IQAA 4JVAA 2Z69A 4HKLA 1R64A 3MW2A 5EPAA 3PJYA 1JXNA 1UKGA 4BOWA 3Q9OA 2ZGQA 1S0JA 1UYPA 1F4HA 3T2QA 3VBFB 3E1F1 2AR6A 2AEYA 2RS32 3KGZA 1DGWX 3Q8FA 4YFWA 4R9DA 3UESA 4AFCA 1HB2A 1GZCA 2DWRA 4UFIA 4A45A 4YVSC 3NL1A 4JGYB 1I9RA 3JD72 1HKDA 5E89A 1HB4A 4OUSA 4O7XA 5EHDA 3WHUA 1X36A 4YG3A 1ZNPA 3JCIA 1D4VB 3SXWA 4CDXB 1LOAA 3WNOA 1X33A 2Q8EA 2ZAHA 4HSLA 2P3IA 4DNYA 1SPPA 5CKNA 3E6BA 2HWF3 4LKSA 4AOCA 2LW8A 4ES9A 3VHPA 1QGLA 3E5XA 3NJZA 4OQ8A 2RM22 3T1MA 3I97A 1IPJA 1FOD1 1W90A 4OMDA 1VRH1 3I59B 1Y4WA 2FDFA 2JDZA 4FFGA 5FZFA 1CESA 2YPJA 5IFTA 5CFCA 1QJY1 2OQ6A 1UD1A 1TME2 1W05A 1H30A 2WNVB 3S7EA 2R043 1NY72 3KF5A 3N7KA 3PL0A 5A33A 2Q8CA 3VDDA 1CAUA 1ZRDA 4AE2A 3H0OA 4Q4Y2 4JTNA 1X8EA 4CEYC 1MS5A 2B9VA 4CDWA 2QQLA 1XC6A 2GNBA 3OY8B 1Q8PA 3ZOIA 5GZGA 2YY1A 2NP0A 4UBGA 1LHOA 1NA1C 3J8F1 1KXGA 1OHFA 1D4M1 2W47A 3AXEA 1HRV2 1QJU2 1B35B 1LNSA 2VMCA 2XB6C 3HEIA 3O0VA 1JHJA 3RWNA 4BQ1A 1I3HA 1WLCA 4JKKA 4LIVA 2RDNA 3FBMA 3DL3A 4N53C 1XYPA 4OFGA 2UY8A 2WO2A 1E5SA 1WCQA 1S0IA 1W6OB 5FP9A 2GNTA 4PIYA 5JZGB 4FTBA 3ZFFC 5FK8A 1WZXA 4ZZ8A 3I4IA 1W2TA 4I01A 5F2SA 4HPKA 1JYTA 4LBQA 5L73A 5LA2A 5FJHA 5A6XA 5C8CC 1AR63 1HQWA 3B69A 3WXPA 4NWVA 4YVWB 3AYDA 1BYHA 4AVAA 2NLRA 2WZR1 2QFEA 3S6PA 3A7QA 4HLTA 3HQXA 3G6JB 3I7DA 1AF9A 5FZEA 4CP9B 4P9WA 4FSJA 5FOJB 5L7OC 2WS91 1ZBE1 5DAQA 4R9CA 1WA6X 5BNOA 4RS5B 1EUUA 5G04L 3O1VA 4FPGA 2D5FA 3B02A 1V9U3 4K8RB 5ANNA 2ES3A 1K5MA 1SLLA 2Y6FA 4Q5OA 3RFRA 3POIA 4EN7B 1Y43B 5FZDA 1F2NA 4XCAA 5LY2A 4NRQA 1LGNA 1SG3A 5FFOC 4FXKB 3ZSJA 1NXMA 4XFCA 4QU2A 4DY3A 4JAAA 2ZZJA 1RUH3 1E5IA 1C1LA 1GKBA 5AFBA 1H2NA 4DIQA 3CZJA 3Q8EA 4ZS3A 1GFF2 2JD9A 2W92A 1W2NA 5A3PA 1RUE3 3O1SA 2XKOA 3LEGA 3VDBA 3BPSA 4YM1A 3I2JA 4H7LA 3EO6A 2QCSB 2WABA 3EYPA 3JUUA 1MR5A 1XE0A 4HVOA 4EWAA 4OI4A 1QOOA 3H8OA 3GJBA 3AZWA 2RS51 1UOBA 2GC1A 3VDDC 4LBQD 2IXCA 1NOVA 4QX7A 1PMIA 4R4ZA 5AC93 2YFUA 3ILNA 2VZVA 3FJSA 4KH9A 3ZLIA 1JU4A 1JODA 4CDWC 2OKXA 5K8SA 3VBOC 1VBE1 3CZUA 3O5SA 4N9IA 2B45X 4YRDA 2IFRA 2WJSA 3KF3A 5D8AA 3CDZB 1F31A 2VOTA 2KA3A 1R081 3W58A 2AEZA 4AEJA 4Q0PA 3FZ3A 1AR81 5F3GA 4YZ1A 5FXZA 4GWNA 3MFCA 2A73B 3TRSB 4CCLA 4D7TA 4BK4A 1SBEA 2JEMA 5ABJA 5HV4A 1W9WA 3K3NA 3ZPYA 2VTFA 2EA7A 2A6VA 2EXHA 3MIBA 1VBD1 2DTYA 2LRPA 4XF3A 4YW1A 5FZKA 3LA7A 5ACA1 2ADEA 3A22A 3B7MA 1ND3A 4IESA 3LIHA 3O1MA 1PZ8A 4E8DA 2VCCA 2GN3A 2BJSA 2TBVA 4M4PA 4Q4X1 2GH2A 5KC5A 2Q5TA 1VP6A 1I5PA 1HQNA 1VBA3 1N1YA 3R4SA 2CYFA 3TN92 3K77A 5FKCA 1MEC3 3JBG1 4XJWA 3F95A 1ZA4A 5FP4A 1DQ6A 1HN1A 1W8WA 2PHDA 1PMHX 3VKOA 5DQ0A 3IIIA 3GHMA 5SV8A 1VBB1 5BNOC 2NPIA 2W5FA 1XYNA 1US3A 2EXKA 4HFSA 1BBT1 1AYN2 1BJQA 2HWB2 3ZMOA 1P8JA 3MW3A 1N3OA 3AP9A 1MVEA 1PO11 4JGYC 5F3EA 2BWCA 3AKQA 3QD6A 4RGKA 2JE9A 2VC9A 4OI0A 3JB4C 1X82A 2H6BA 5A7WB 1MZFA 1RUG2 3PURA 4AGVA 2NQYA 2VU9A 3I3QA 4M3CF 2D7FA 1S0DA 2JDPA 4XBQA 4D3WA 2R7EB 1QNWA 4PLNA 4Q4W1 3V0AB 2HWE3 4BQ4A 2MPFA 2XLAA 3RZZA 4CXXA 2R0HA 1UZ0A 4GJZA 1NQDA 1RMU1 4PF5A 4TSVA 4FPOB 1WUVA 3RG0A 2WQZC 1CZVA 1OUXA 3N9LA 1UZZA 4ET7A 5CG8A 1ENXA 1NUKA 4OVEA 4MXWA 4XOGA 3ZXDA 2FZ2A 2DU0A 3V0BB 1PGW1 1UPIA 3JXSA 2BGOA 5E6HA 3MLKA 4AFAA 1W6QB 2WNVC 2XGXA 1A8MA 1LKNA 3A21A 4O9EA 3ZXFA 4NAMA 4E27A 3GYDA 1XNAA 3WUCA 5FZOA 1ULFA 4J6GA 5TSWA 4I02A 2ZABA 3ZPOA 4EZHA 3H3ZA 3OUJA 5I0RA 1XBFA 2J1VA 4U2AA 1OA4A 2UWBA 1H4HA 5J36A 3UV9A 3AYAA 4HZFA 3ZFEA 1AR93 2PHLA 2R30A 4TN7A 1DZQA 2B8MA 2I07B 2VMFA 4QKNA 2PAMA 1W6PA 3POWA 1B35C 4GH4B 2WIIB 5DPNA 4YNIA 1R1ZA 2GP3A 2WWSA 2RJLA 1YYNA 4OZXA 2DF7A 3LFIA 3K4AA 2DV9A 4Y22A 5KXBA 1GOGA 2P3JA 3GALA 1Y7BA 1FOD2 2IXKA 3ZSMA 3VN4A 3HT1A 4P9XA 1GNHA 2HEWF 4DXZA 5JZGC 2ZGRA 1VRH2 2VECA 4QGLA 3ZSEA 3IWZA 3OSDA 5JUVA 2I45A 3DKWA 4HXCA 1ND3C 2YC0A 1BQPA 4XJZA 1RUD3 3VBUB 2ETEA 1G9FA 1MQTA 1UYXA 4IEXA 2JDHA 4N43B 2ZEXA 2VZRA 2WT0A 3KD4A 5H9RA 4XCBA 4ATFA 1JZ4A 5FXWA 3WF3A 5FY7A 4CEWB 4XDPA 2RG4A 4I2OA 5DDJ3 1S0CA 4W4ZA 2XL7A 4XFAA 3CL1A 1MACA 5BNPB 1WLWA 2YC4A 3KLSA 5A1AA 1C8M3 5J48A 1VMJA 4RS5C 3ZVXA 3RZJA 3J8F2 1OH3A 1D4M2 2QE3A 1H1MA 3ZDVA 2K2SA 5JAXA 1RUC3 1REFA 2XWBB 3SQOA 1D2QA 1XOYA 5FDBA 2ZGUA 1OLME 2R071 4HONA 4NHLA 4MHRA 3ZX7A 2Q1ZB 3IT8A 2A3YA 2WNUB 3KB5A 2X09A 4CDUA 4XJ9A 5IAXA 4EN6B 5EFUA 4GB32 2P3YA 1MS3A 5CNAA 4BJ0A 1PO21 4Z2AA 2CGOA 1H4GA 2W95A 2XBO3 3LDKA 3I2DA 5I8YA 1HXS3 2VM9A 5DN2A 5A7QA 1JN2P 4XTPA 4HETA 1R091 5I0DA 4IEPA 1NCRB 2DFCA 5JXGA 2VZQA 1ZZ9A 1ENRA 1TMF3 3L2HA 5HCFA 2WZR2 3TAYA 3NAPB 3W21A 1JHNA 4HG6B 2ZCWA 2FDGA 1EV11 5GZFA 1OF4A 1YJLA 4CPBA 2BBAA 3T08A 4DQAA 3AKRA 3LEIA 1WCSA 3BALA 5C3PA 4FP2A 3WG4A 1XPWA 2AH2A 1C3HA 2K9ZA 1QY4A 2DVAA 2XDVA 4RL7A 2ZS6B 3NNLA 4XQ4A 3UKNA 1DZTA 4RHV3 1CIWA 3V56A 2HEYF 1Q43A 1S2EA 2ZEWA 3WG1A 2OQ7A 2G1MA 2E9QA 3LFMA 1WW5A 4HK8A 2YPDA 1EYBA 1BEV3 5H9PA 4JX0A 3LB9A 5FKBA 3ZN5A 4NMIA 4ZU5A 1JYWA 2RR11 2VNOA 2O14A 4CDQA 2ZEZA 2VW0A 2LM3A 2XUEA 1KFXL 5IAVA 2VXRA 3EJKA 3VBRB 5C5UA 1LGCA 2KM2A 3ZDSA 1VB4A 1NQJA 5LATA 5FTTC 1ZZ8A 3H7YA 1CQ9A 1FMD1 1MQTC 2A6ZA 3FX3A 4LLFA 4SBVA 3LA3A 4QQLA 5CYYA 5FREA 1F5JA 2RS52 2MNGA 5EJZB 4XW3A 4AFMA 1YIPA 5LA1A 3H50A 3MUZ1 3A0NA 4QX8A 4B1MA 3GZEA 1IS3A 5DG2A 2WQ8A 1VBE2 3OBAA 2IWGB 4OLLA 2D3RA 2GNMA 1O4ZA 3VKFC 2QQNA 4OHXA 1FXZA 1V6JA 4IEUA 1R082 4UFLA 4GA9A 3RGBA 3GZTB 1RC6A 1AR82 1FNZA 3D6EA 3B01A 4YW2A 3ZSKA 5FUPA 1O3SA 4FI9A 3FE5A 3MGUA 4E2GA 1RUF1 3MF6A 3WW4A 4CYDA 4K1ZA 5FY9A 3D0JA 3R05A 1DLLA 3R4DB 4CDUC 1JH5A 3NJYA 3ZYBA 4G4FA 5LCWL 2J1AA 3E5UA 4Y3OA 3ACLA 1VBD2 2E63A 1OA3A 5KXCA 3GF6A 3N9NA 5ACA2 3RZHA 1QH7A 4KWUA 5I0SA 3R6SA 1BKZA 4FAHA 4GQ7A 5FZ1A 4Q4X2 3SC7X 5CBLA 1UU6A 2IXHA 2AACA 1RHI1 3JD71 5FYYA 3WP5A 3VZNA 5GJ6A 4IEOA 2K0GA 4N8MA 5J09A 2O0OA 5C4WA 2QZ3A 1ODNA 4QQHA 1YQ2A 5FYCA 2W87A 1LEMA 1RUJ2 3KMHA 4H14A 4JDMA 2YBPA 5FRAA 5CISA 2G9GA 1UIJA 1VBB2 1SQ4A 4FOVA 4P9LA 2NMOA 5C70A 2QVSB 4QXKA 3C7GA 3ACGA 1BBT2 4LOTA 5CKMA 4IE5A 1UU4A 4AEDB 4L97A 1VMHA 1KS4A 1N3QA 2JG8A 1S55A 4BXSV 2VCMA 2RM21 3ATGA 3DPRB 1O8PA 2MEV3 4QD2A 4QHZA 5JSOA 1ULPA 3NV4A 3E5QA 3LE0A 4S2HA 1UZVA 1H2KA 1Z0HA 4CU8A 2UWAA 3FHIB 1WD3A 3RI8A 5BNNB 1JUHA 3POSA 4GH4C 4XFIA 3QCWA 2D43A 2D6LX 5JVVA 1WD4A 2D97A 3ZIWA 5A3LA 2W0XA 4AXOA 3UGHA 1TG7A 1NE6A 3K4ZA 3OCPA 4Q4W2 1TME1 2HWD2 4G9SB 2WAAA 1AXYA 4QX0A 1NY71 4YM3A 3POGA 3VD9A 1EAH3 1Q8SA 3WP4A 3WNLA 1GUIA 1RMU2 1U5ZA 1AL21 3N7MA 1DYOA 2RJKA 4CDQC 2GMEA 4Q4Y1 1ULDA 1REEA 1VBC3 1Z7S1 5LBEA 3SH3A 4Y1YA 4Q0SA 2BNMA 2BEOA 2A75A 1PGW2 4XPVA 2F4PA 3VBUC 5JSPA 1W28A 1OVSA 2YV8A 3THCA 5JR2A 3SH5A 2YG0A 1HRV1 1GWLA 4LKEA 3FN9A 2JWPA 2I2SA 1LOFA 5JMCA 2HWC1 2G19A 4CEWC 4E2SA 5BNPC 5C3SA 4N90A 4WVZA 4MXVA 4LE4A 1IS6A 4LEJA 4YZ3A 1V6KA 2FZ1A 5AFEA 2H0VA 4LO4B 4QPYA 3KT1A 3DV8A 2VY0A 2ZMNA 4GMP0 4WM7B 1DQ0A 3PHMA 1XE8A 4K3UA 1DHKB 4RFT0 3FHAA 4X6QB 4LITA 4M01A 1US2A 5J7MA 5FP8A 2R6QA 3FUOA 3SISA 3ZR5A 4AHZA 4IV1B 4Y4YA 4EYUA 3WLUA 4GWMA 4PCRA 4ITCA 4YGCA 1W2OA 1QQP2 1F8VA 4CP1A 1H8TB 5IVEA 2GU9A 1ENSA 5F5CA 1H2MA 3IKWA 2HJIA 4H7MA 2SBAA 1G9AA 1SEFA 4D69A 1JW6A 5EP9A 3WY6A 2O8OA 2IUWA 2ET1A 2VVFA 3BIWE 4MGTA 4XAEA 1DGWA 5C6CA 3BOWA 5FPAA 4YZ5A 4W65A 1MVQA 1UX7A 1IKPA 3SEPA 5FWJA 3BGAA 3VD5A 5L19A 1O8SA 2Y38A 4R8HA 2VAUA 3PTYA 3IPVB 2X5IA 4LMFA 2XVGA 4QXCA 1SZBA 2JG8C 5FZBA 5A3WA 5F8PA 5A3OA 2R072 3HN3A 5DABA 2BBVA 5F37A 4CCDA 4UFMA 4YW4A 5HXMA 5JR7B 4KU8A 2G9ZA 3CF6E 2WYSA 3ZXJA 2RE9A 1DP0A 4Y33A 4LOSA 4LIUA 4CCJA 1PIV3 2ZJCA 1PO22 1UOFA 4IGQA 4J1XA 1F9KA 1BK1A 5FZ4A 1NG0A 5DZEA 1CAVB 1V0AA 1R092 3P6BA 4FOYA 4CA9A 4EN8B 3M7AA 5FO8B 3W5NA 3WCSA 5C9AB 3VBRC 5IVYA 4COUA 1W06A 3C7FA 1S0EA 3GZAA 4K9SA 4QKBA 3TEXA 4CZSA 4YW3A 1NCQB 3WOGA 1POV1 1YUDA 2OUJA 2Q1MA 1G9CA 4AHXA 4F3JA 1EP0A 2XOMA 3CJXA 5IK8A 2GALA 1EV12 5FPZA 4QB6A 3ST7A 1SMVA 4RD7A 3HAGA 1LOFC 2VOVA 1ZZ7A 4QPGB 4BM8A 5CB7A 3X29B 1TQ5A 3MIGA 5JPMB 4AI8A 3T30A 3WQ7A 1CAXB 1KGYA 1PVC3 3OPZA 4QX5A 3IAQA 4FVVA 5SV5A 5JOZA 2ZMLA 2EVXA 5LRRA 2ZGSA 2EXJA 2H6CA 2BDRA 3OGVA 1BVP1 4LUKA 2BP6A 1W3XA 2D3SA 1YLLA 3I8TA 1VALA 2QDRA 2Y6JA 3ZXEA 5KHGA 2EAAA 2C26A 4O65A 2Y0IA 1UAIA 1ZBA3 1AL0G 4URTA 3U10A 1FPN3 3J9SA 1UMZA 3J7HA 3PU8A 4XBNA 5A3TA 4BLIA 2NYYA 1GZTA 2QQIA 2W91A 3GHNA 3I3EA 4NVPA 3RJ2X 3L9JT 4KWLA 2HWF1 2VOWA 4CXYA 2R063 4CEYA 1V6IA 1JZ5A 3DKQA 1J59A 1S2KA 2CWMA 1YNAA 4OULA 2RMU3 2PXJA 3ZFGB 2YUEA 5FZCA 4E4HA 1ND2B 4DY5A 3AZVA 4ZONA 2HWB1 3THTA 2LALA 3BKZA 2V4AA 4CUBA 5A1LA 2MHFA 3TEWA 5CU1A 2WZEA 1IPSA 4YLZA 1ZRFA 2BOJA 1C57A 3T1LA 3NRUA 2D5HA 1GOFA 4L2NA 3P3PA 3P1IA 1OUSA 2GMMA 1OKOA 1AR73 1LECA 2R041 2WWJA 4FCAA 2VH9A 2JJ6A 4XIKA 2Q1FA 4YW5A 4OI1A 3WG3A 5C33A 4FQZA 3ZFFA 1UXXX 3M2MA 4P9YA 3TEYA 4I0AA 3ZXLA 2ARXA 3KT4A 1LTEA 1RUF2 2WR9A 2B42B 3KGLA 3MICA 3POYA 5FQ0A 5GZCA 2P6HA 5C8CA 5BNNC 5CEHA 3SH4A 5J3UA 1PZ9A 4S2DA 1GR3A 1GICA 1GLHA 4AFBA 2D6NA 5FLJA 3B94A 1NAEA 1YEWA 2O1QA 4COWA 2PFWA 4Y5SA 3I3DA 5L7OA 1LOGA 2DVDA 4EJRA 4CRQA 1J1TA 1KJLA 4LK6A 4IERA 3N36A 5CFDB 1QOTA 3D5OA 4Y1UA 4EN9B 1RHI2 4NHYA 1LU1A 5FK7A 4XJ8A 4DFSA 1OOPB 1W8TA 3DECA 3OOXA 3K51A 4CCEA 3UJOA 5CA6A 1F15A 1QJEA 2DFBA 2E32A 3LD8A 4AQTA 2VUJA 2JECA 1RVF3 1AR61 4R9BA 1DBNA 3WDUA 3ZO0B 1IS5A 2FDKA 4IE4A 4JDNA 3SLIA 1COV3 4LULA 2PLV3 4Y26A 2XJVA 1QNYA 2HBUA 1KRIA 5FZAA 1G9DA 1V9U1 1DG6A 4GIQA 2OIIA 2F4LA 3CKHA 2ZHMA 3WDVA 1RJ7A 2WUHA 3H8XA 4LO7A 4AZZA 5FZ8A 3BTAA 4Y20B 2ZX0A 4AI2A 3HNMA 5FZ7A 1IQDC 1J3PA 2ARCA 3H9AA 4EZ4A 4PI2A 4FOWA 2RHPA 4AL9A 1PK6B 1Q3EA 1Q56A 1AL22 1RUH1 4K1YA 4N7UA 5DG1A 4OZOA 1HRI3 4PQ9A 1Z7S2 2YU2A 3SCFA 2FCUA 3AMMA 2XXZA 3OUIA 3M4FA 3VBOA 1EPZA 1H8TC 2A71A 5GLZA 2VNVA 5BNQA 2AUYA 5L36A 1OPOA 1ULOA 5FMBA 4A6OA 1RUE1 4M00A 1AVBA 3VDAA 1S2BA 4DRVA 4B7EA 5F3IA 1AYM2 1GYKA 3UYJA 3SKJE 1S1AA 2F6BA 4IEYA 1J3QA 2HWC2 2W94A 1UW8A 1Q8OA 3HQRA 4Z82A 1RUNA 1XRUA 1M06G 2BRTA 3B3QE 5T5LA 3IDEA 4DRRA 4BQ3A 1RXGA 4GB31 4I3GA 1W03A 5DUUA 5AC91 4IUGA 5I0TA 4FPKA 4L9BA 2RS13 1SFPA 1N3PA 3NMBA 3AC0A 3RWKX 4YGBA 1XSRA 3PTRB 4C0BA 4DS0A 3GXUA 3IDBB 1H6XA 2P6CA 3KQRA 4P5YA 1WMEA 4IXLA 3U07A 3D8CA 4BQWA 3Q8CA 3QH6A 3M3EA 2A6YA 3VZJA 5FMOS 4YPJA 1PX4A 4FXGB 4XXPA 5E1RA 5IT6A 3AMQA 3LSEA 3QH7A 1UWWA 1HJFA 2E7QA 3ACFA 2JDMA 3IZOA 3VBFA 5FXVA 3U4SA 2D98A 2XJUA 1SLIA 2CL2A 5C9AC 2WWUA 3N9QA 4JGYA 2XWJB 4XC9A 3TBDA 5F5AA 1JYIA 3QBQA 2GN7A 4J1WA 4N7IA 3CU7A 4V1PA 4AGRA 4WM8B 4CDXA 4BK5A 1H2LA 1JBCA 1VBA1 1JTZX 4DPNA 4W6YA 1NLSA 1RB8G 1KD7A 3ACIA 3LSDA 4QPGC 5AVAA 3UJQA 3ZKUA 4BISA 1VRBA 1ST8A 2FQPA 2XH6A 1EY2A 3TB0A 1GU3A 2ZEYA 4PHZA 4QXBA 5GM0A 3WF0A 5HI0A 3FWEA 1HB3A 3MV11 4LHLA 3H3LA 3K75B 3I59A 3TNPB 2HEVF 5F6KA 1TVGA 1B09A 4H3WA 1QJY3 1X7NA 3PUAA 4JGZB 5G05L 1K42A 3NNGA 4GMP1 2WNVA 1JOJA 2A1XA 1PNGA 3J7MA 3WV6A 5HPOA 4NO4A 1FI2A 3FLRA 4QHBA 3WDYA 4GD4A 4CUAA 4JZRA 4YG0A 3URFA 1OURA 1LR5A 1Q5OA 3H1WA 4XAAA 2HWE1 2WNEA 5FIXA 2VW1A 5BV6A 1DIWA 5KC6A 3ZXGA 3OY8A 1MS9A 4C1WA 1HLCA 3WW1A 4M3CB 4LUMA 4ZXEA 3ZFGC 4BE3A 4YZ2A 1V70A 1ND2C 2W1SA 3BYWA 2DYCA 1B35A 1F35A 4Y1XA 4LO5B 1MS0A 4MX3A 2OUHA 3VBSB 3A4UA 1IOAA 1VAMA 4JRLA 1G9BA 2YXSA 1WBFA 2P37A 3T3YA 3MFAA 5B4XA 4FT8A 3ASIA 4NRPA 3W9AA 3ZKYA 3RS6A 2ZGOA 5LASA 3VBHB 5FUIA 5JCTA 5JI9A 3RJRA 4E4SA 5L9VA 2W1UA 1W6OA 5ERLA 3ETPA 1SFYA 5JZGA 2Q8OA 2VXJA 1KEXA 1LJ7A 3BODA 5A32B 3GDBA 4AGGA 3CJIB 4Y1ZA 2VCBA 3LGRA 3OGGA 3RDIA 4LBJA 1QF3A 1AR91 1CPMA 4EE2A 1G6NA 3LA2A 4K40A 4BYYA 5FZGA 4PF1A 4EROA 1UMHA 5FP3A 4PDWB 2B9UA 4WVVA 4XMAA 1CVNA 4YVWA 3EHKA 2HWF2 1YQ6A 2Y6GA 3HBKA 4XETA 5F2WA 3CNAA 4TXWA 4LHSA 4CP9A 5IVVA 1W9YA 1ZBE3 1YCIA 1RUJ1 2JKBA 2WS93 4QX2A 3VBFC 3OGSA 1CN1A 4EN0A 1W8HA 4ZKTB 4FPLA 4RS5A 4MGSA 3WX5A 4FPEA 4IW3A 1CZSA 4XFFA 3CEWA 5CFDC 1T2XA 1S0GA 2A3XA 1HDKA 4O9GA 3HBZA 1OOPC 3USUB 2VE1A 4QPWA 1RUD1 2DURA 1AUYA 2P4EA 3GCXA 3CLPA 1W39A 1FT9A 4HANA 4CDXC 4M3CE 4IEWA 3ILFA 3T2OA 2GDFA 2R042 4GWJA 5EYYA 5LBCA 3U78A 5CZKA 1HX6A 3C8XA 2VZ3A 1S4CA 4IDZA 4CCKA 1WBLA 2CHHA 2FMDA 2YU1A 3S0MA 4XDOA 5DDJ1 3K4DA 2XL9A 3OBTA 1JOPA 2HWD1 1WGPA 2EIEA 3WDWA 2VW2A 4WZCA 4YW6A 2RDSA 3NNMA 1C8M1 5JOWA 4A2UA 1CIYA 1FV2A 4XVHA 4AEKA 1W0NA 3W59A 1RUC1 2CU5A 1LB2A 2BNOA 3NJXA 1OD5A 5E16A 4HSJA 3WW3A 2DVBA 3MV01 2BGPA 1SDWA 2K46A 4BB3A 4BQ2A 5C71A 4B4RA 5BUVA 5FYVA 1LENA 4KQ7A 4NAOA 1JZ3A 1C5IA 3NQHA 4UWDA 3ZN6A 3BN6A 3SMHA 1PK6C 2JIJA 3AFKA 5LRSA 1DLCA 1LHUA 5FZ3A 4NIAA 2XBO1 3N3HA 2P34A 1HXS1 3ZYRA 2ARBA 4QHOA 5AVPA 1MZEA 3WDXA 1JS9A 4Z92B 4AVVA 3TEZA 3HR9A 3IMMA 1AR62 1TMF1 1AX2A 1AX1A 3DYMA 3I3BA 3M70A 4P9IA 1OBNA 1C5HA 1QJX3 2VBDA 2VQAA 3ECQA 3ROUA 1TNFA 4A3XA 4OQ9A 1EPWA 4FFFA 2JG9B 5FV3A 1KS5A 1XNCA 2Z2SB 1R1A3 1ZX5A 1V9U2 2XONA 1NT0A 2Y34A 5I0UA 5IK4A 4NPLA 4UF0B 1QQP1 1SLBA 2A5ZA 2A7AA 2WBKA 4AFDA 2VZ1A 4FTSA 4KU7A 3QACA 3B93A 1JYNA 2R16A 1DQ4A 3H3UA 1ASJ3 1GOHA 2EALA 3E6CC 4YVWC 1RUH2 1IKQA 2VNRA 1W8ZA 4YZ4A 4PBPA 2X8KA 2CDPA 1VB2A 3JBG3 3SHRA 1BEV1 4XE9A 3C7HA 2BPA2 2VG9A 2NMNA 1YFUA 4JQTA 1RUE2 3TNQA 2B7YA 3KCCA 1LEDA 3B00A 1PO13 1O3TA 4MOAA 2D44A 2P17A 3HNYM 5DAWA 4ARXA 2JDYA 4KWKA 4LHNA 4RR3B 5FZ0A 2QUOA 4YGEA 4WM8C 1OF3A 5A7WA 3PDQA 4I09A 2FDJA 1DGRN 2BWAA 1DF0A 5GALA 5AC92 4ARYA 4C91A 4GAZA 5T5OA 3V0AA 1YFYA 1YFXA 1UPSA 5JI7A 3T0DA 1V6NA 4MGQA 4J25A 2ZHKA 2SLIA 3AKTA 2OX0A 4ES8A 1W6MB 1REDA 5GLTA 2ZHNA 4XUNA 1HQLA 4UW3A 2GSYA 5DAVA 3SCGA 3BTXA 2E31A 2YGLA 3RSJA 4MGZE 1WLDA 1KITA 4OHWA 1FNYA 4JGZC 1PX3A 1O5LA 3OF1A 4AQSA 5JMOA 2JICA 1W6QA 5H9QA 1G7YA 4LQRA 2ZBJA 3ABZA 4MH0E 3O14A 2WL1A 2WC2A 3T0BA 2OW4A 3DGTA 3M3IA 4QDQA 4LK7A 2EIDA 3HNBM 3ITQA 4UBHA 4XEZA 1OLMA 2QKDA 1JI6A 4YSFA 1XNTA 4KBBA 3DCQA 4BCUA 1W6NB 5K4LA 5BYNA 1QHDA 1L7RA 4K8FA 2JE7A 4S2GA 3UT0A 4XFHA 1ULEA 1VBA2 4GH4A 2IVJA 2C9KA 3PVOA 2ADDA 3VBSC 3VHRA 4COZA 4FOQA 3BPZA 3BCWA 4UOJA 1XYOA 1YJKA 4M0NA 1MEC2 3WR0A 2VBPA 5JOYA 4B3NA 4WV8A 5J1XA 3DF0A 2HKXA 3VBHC 4XABA 4DUVA 2UU8A 2DCZA 2QZ2A 2VMIA 2WFPA 1HIXA 3ENRA 3OPTA 1OQEA 2N7GA 4Y1VA 4DO0A 3KHCA 2JDUA 3D82A 3SKVA 1H8VA 5A7NA 4E2QA 2ZXQA 1CAWB 1QU0A 4FPCA 5FYSA 5K7PA 2MEV1 2WFF3 4QU1A 4DUXA 5F7UA 5IYYA 1YXWA 3VBUA 3ZSLA 2BTVC 4Q2FA 1O6UA 4A41A 4AI0A 3OYWB 4BIFA 2W39A 2E26A 4N43A 2WLPA 4KGGA 4PIZA 3MDPA 4NPMA 4AYUA 1RL3A 2WO1A 3B5LB 3GM8A 1O4TA 2ZMKA 3FMGA 3I2GA 5EZWA 4CEWA 3RPQA 3MI8A 5GLWA 3S5AA 1MS8A 4FPHA 1T6GC 2HWE2 4PT6A 3ZXAC 5BNPA 1C8NA 1W9TA 4G3YC 5T52A 3B9CA 1M4WA 3I2KA 5B2GB 3VD4A 4DZGA 5LB6A 3GCWA 5F1RA 3RZLA 4MLOA 1VBC1 3VD7A 1XSQA 1JZ7A 4FFIA 2J1TA 4OCTA 2R073 5HCHA 1AHSA 5A6YA 4OHVA 2XHKA 1UN1A 2JIGA 4BPZA 3W20A 2WNUA 1GZWB 1DGLA 5FLIA 1N1TA 3PLQA 3S5QA 4PJYA 2YFZA 4AEMA 4P08A 2DVGA 2WT1A 3VV1A 2J7MA 2WN3A 2XQXA 1GWKA 1XQNA 1Y9MA 4COYA 1AR92 4KG0A 1DYPA 3VKLA 4XUPA 3TWIA 4KBZA 2GZWA 2OT7A 3RYKA 3WSOA 4Q8KA 3KSCA 1NCRA 1W3VA 2JB8A 5JWPA 2YHJA 1YIFA 4Q1PA 4YW7A 2OPKA 4NN0A 4CUCA 5KBFA 1K3IA 1UOGA 1HV0A 3PVEA 3NAPA 2Z5WA 2PHFA 1K45A 3PIJA 3PVBB 4GKYA 1LCLA 4NIIA 4MYEA 4A7ZA 1NLRA 1O5UA 2ZX1A 2A3WA 4WVMB 3D4KA 5HXVA 2BQPA 3FLPA 3NSTA 5IVJA 4LBNA 5JDBA 3KV4A 1OMIA 3I3MA 1WW6A 5I91A 1BLZA 1QMJA 3WNPA 5K0UB 2GNDA 4PBOA 3VKMA 1RUD2 3GZUC 5C8WA 3UNPA 1H0BA 4FO9A 2CWSA 3ME2A 2ZOEB 2Q4SA 4ATEA 4PLOA 1GBGA 4V2WA 2CSGA 1GQHA 3GBGA 1MZ6A 4NR1A 4NHMA 4AI3A 3JQXA 2EIGA 1Y9QA 4W8JA 5DDJ2 4AVBA 4CCMA 3AZXA 4OI2A 4RA0A 1UY0A 1YI7A 2GMPA 4Y5Z0 4NROA 3LF7A 2Y60A 5H9SA 1C8M2 2RR13 4CUGA 4QX1A 2DCKA 4QPIB 2DTWA 1PGL1 1LRHA 3VBRA 1DCSA 1RUC2 3AKPA 4XUQA 3DYOA 2QNKA 5C3OA 2I74A 2G9FA 2EXIA 1FMD3 1ENQA 4MZUA 1IZ3A 4RN5A 4N43C 2PHRA 1SCSA 2XVLA 4XQWA 1AYM1 1VMFA 3VZLA 4CVUA 2F17A 3K46A 4DXSA 4KI5M 4L8QA 1XJAA 2D6PA 5L9BA 1UNBA 2Y6HA 2XBO2 4A4AA 5FZ6A 4CU9A 3BU0A 1O59A 1HXS2 1WLTA 2XLFA 3MBWA
chains in the Genus database with same CATH topology
2DCYA 3GNEA 1RUI1 3AKSA 1C1FA 4YVSB 2OYZA 5I93A 1TMF2 3MPPG 3SCHA 3MIEA 4YYOA 4DMIA 2WNUC 2ZX4A 4RQPB 4LLOA 3NW4A 3M3OA 2JXAA 2WKKA 1OFSA 3LZZA 1YHFA 4KWJA 3VZKA 2CAUA 2RS33 4XJUA 2YMZA 4RHV2 1NCRC 1GZ9A 3PMSA 2Z42A 3ETQA 3JD73 4XBLA 1G86A 4COVA 1ZBA1 3NAPC 2WSVA 1BEV2 4N9HA 2D6OX 4QQOA 1CJPA 4XIOA 1WW4A 1UKRA 4PIXA 3RYPA 5IK7A 4Q4V1 3RYRA 1DQ1A 2OA2A 3DN7A 3LAGA 4JC1A 2R061 4XXAA 4U36A 4AEDA 4BHPA 3HN1A 3WCRA 5E8AA 2RM23 1LGBA 1X8MA 2P3KA 3DPRA 2RMU1 3A0KA 1NA1B 3RNSA 1A78A 4Z8BA 4IV3B 5BNNA 2R0FA 1O3RA 4Q26A 1TME3 4N53B 4XFGA 2QJVA 3VZOA 4LBLA 2WZPP 2B46X 1AR71 3WHTA 3N35A 2BFUS 3ALQA 4FPFA 4Q4Y3 3N7LA 1PHMA 4ONUA 1OSGA 1ONAA 1OQDA 1S0BA 1TNRA 4H55A 5T50A 1UIKA 4AQ2A 1E57A 1HRV3 1QJU3 3WQ0A 5FCCA 4ZXKA 4BZ4A 2XUMA 1KJRA 4I0BA 3ILRA 4INDA 4A7KA 3H1YA 1U5XA 1GSLA 5HCAA 3JB8A 4Q0UA 5IK5A 3U4XA 3ZMNA 4UW6A 4B29A 2GC0A 2PHWA 5LEJA 5JIUA 2P2KA 4WM7A 1DU3D 1RUOA 3P3NA 3RQ0A 5E88A 1RVF1 2Y26A 2YYOA 2PA7A 4IV1A 5DUWA 5KXDA 1CGPA 4AG4A 1COV1 1WMFA 3IMNA 4KG8A 1H8TA 2MEV2 1G8WA 3VUOA 1J3RA 1Q8VA 1NXD1 2FBEA 1F5FA 1J58A 5BXXA 1VAVA 1XE7A 5CFCB 1ZVFA 3EXUA 4QQ2A 3VHOA 2CY6A 3VDDB 5A33B 3AJYA 1CAUB 1KQRA 1EAH2 4OHYA 4LHKA 1HRI1 4CDWB 1VBC2 5GLUA 4AEDC 4B7KA 3IBMA 3IPVA 5F6LB 2QQPA 1NYWA 3JQWA 4X8PA 3DPRC 5K0UC 4KGQA 4RGAA 4IEQA 4JQRA 5JPNB 4M0HA 1XXNA 4YFZA 1W2UA 2YZ4A 4LBOA 2WINB 4L11A 3FBYA 1UCXA 5J96B 5K9YA 4LBKA 3IDCB 1CAVA 2GAUA 3C2UA 5FBZA 5C9AA 4QPIC 4SLIA 3FLTA 1LHWA 4PLMA 4HVQA 1IGOA 1POV3 1NCQA 4HPKB 2CGNA 4LBQB 4FPJA 2XLGA 4AF9A 3H7JA 4FQ4A 4UW5A 5HCBA 4AHYA 4QPGA 3TYJA 3U11A 4A7YA 4HKWA 1W0PA 1U5IA 1OLRA 1CAXA 1U5YA 4I3PA 5EYXA 3ZXKA 2TEPA 4BIOA 3NO8A 5BNOB 3IIAA 3JU9A 2C0ZA 3WINE 4E9KA 1K5MB 4K21A 4WM7C 1ZZBA 1ZREA 3AP4A 4NOTA 1V6MA 4RQPC 2WQ4A 4IV1C 3TN93 1PGL2 4HBNA 5CVRA 1CR7A 4XJAA 3OTFA 1AX0A 2GC3A 3N4MA 1SBFA 1TEIA 3MYXA 4XQDA 3ZFGA 2JENA 1ND2A 3AMHA 1AYN3 1H1AA 2HWB3 2UYBA 4BMBA 4YARA 1O91A 3WD5A 3HWJA 1PIV2 2NM1A 3LOBA 4TZDA 3BOPA 3ZYJB 5DXDA 1RUG3 2CGPA 3S7IA 4Z07A 2YGMA 4I0WB 4MSVA 1RUI2 2DVFA 2XKPA 1PVXA 3VKNA 3AMPA 3R0RA 4META 2PELA 5D8AB 1YWKA 1UZYA 5J98B 1AXKA 4ASLA 2UURA 4IV3C 2PYTA 4Q8LA 4XTMA 5ABJB 4LR4A 5GZDA 1PVC2 1LESA 4IETA 2EF6A 5CFDA 3H1MA 1OLQA 3O0XA 1VAKA 1ND3B 1DGRA 1NCQC 1OOPA 1ZBA2 4KL1A 1FPN2 3AK0A 4FPYA 4RSUA 4GALA 4Q4V2 4Q1RA 1H1IA 3VL9A 3NV3A 5CAZA 1MEC1 2R062 1OI6A 1PGSA 3AMNA 4C90A 2RMU2 1FOD3 1RITA 1ULGA 1KDKA 1DYKA 3G7DA 3WW2A 1VRH3 4IEZA 3MIFA 1WA4A 3LOIA 3HT2A 4XF0A 1WCDJ 2YDEA 1NE4A 2ZGKA 4BH9A 3O7OA 4W6WA 2ZPXA 4Y20A 1AR72 2FHRA 3PJQA 3ES1A 1PK6A 4MGYE 4B4PA 4XDQA 2E53A 4XMIA 1AJKA 4HN0A 1A3KA 5CIRA 2EAKA 1D0HA 2XJPA 4Q27A 4Z2WA 3J8F3 1ZZCA 4D7SA 2E7TA 1D4M3 4C1XA 1VLNA 3PNAA 2XJQA 2ZACA 3ZYPA 4MXWB 2OZJA 2D40A 5CFCC 2ZGLA 2IC1A 2ATFA 3NKTA 3OD0A 4AW7A 1CPNA 4TLFA 4GB33 4HT1T 4QGMA 1LHNA 4ISQA 4F7ZA 2ZGNA 3KCYA 4P9GA 2BVVA 3SITA 3ZFEB 4LO8A 4HVRA 4EWEA 4MGIE 1X50A 1W6PB 4BWOA 3OGJA 3GBWA 1RVF2 4W6XA 3V65A 5KWRA 1I1EA 2WZR3 1FX5A 1QJX1 1COV2 3AB0A 2PLV2 4Y22B 1CONA 2VNGA 4QM8A 3NV1A 2BW8A 4UW4A 1R1A1 3HMYA 1KDMA 1OFNA 4QT6A 1UF2C 2ZKNA 4K6BA 3MW4A 1MQTB 2AYHA 4WM8A 3OJBA 2ZKLA 1N47A 2V73A 1ASJ1 4XILA 1D2SA 2ZAAA 1D0GA 4XHXA 1HRI2 4R9AA 4X8NA 1ULCA 4S2FA 4C0HA 2GH8A 1OA2A 1SCRA 1LOBA 2DCJA 1FYUA 1K5MC 4QGNA 1QXRA 2ZA9A 4NWWA 1C4RA 4JGZA 4GMP3 2DUOA 3FUQA 4R4XA 3I54A 4CDUB 2RS53 3E6DA 4DB5A 3UKVA 5JOXA 4L99A 4ASMB 1TE1B 4MGKE 1RINA 2RS12 1LULA 1VBE3 4AVSA 2DU1A 2VVEA 4HL0A 4P5HA 3RMYA 1YRZA 4M3CA 3AX4A 2OVUA 1BCXA 1V00A 4ORFA 1R083 3EQEA 5BPXA 5FO7B 1AR83 1BXHA 4L92A 2XJTA 3VBSA 1AZDA 1PZ7A 1XU1A 2E51A 1FAYA 4OUMA 1CD3G 3VBHA 5KHJA 2D6KA 3OBRA 2VVDA 1VBD3 1VJ2A 1ZRRA 2E6VA 5A32A 1H9PA 5ACA3 1GQGA 3CJIA 4Y24A 1C28A 2BNNA 4Q4X3 5D8AC 4RHV1 4BA6A 4PDWA 3AP5A 3KS7A 1QXJA 1DZRA 2IZWA 1LODA 1ZYBA 4LE3A 1VIWB 4XF4A 3M3CA 3VL8A 2CAVA 1LOCA 5ABJC 1RUJ3 2W68A 1VBB3 3WZ1A 1GNZA 1RJ8A 5T5JA 4CDQB 1BBT3 1POV0 4DINB 2B39A 4NHKA 4B4QA 4FBFA 4WBBA 3D0SA 1QJY2 2V5YA 2WFF1 3USUA 4CP2A 2PHUA 4CTEA 5FO9B 3RI9A 3T2TA 3V0BA 2KXLA 3PVNA 4JV4A 3S30A 3AYEA 2QDNA 4WVWA 4JTOA 2IFWA 2D6MA 4Q4W3 4E4DX 1SLCA 2HWD3 2X29A 4XHBA 3O12A 1ALYA 2ERFA 4LA3A 3THPA 4BLJA 1RMU3 1N1VA 1SACA 3HIFA 4FP3A 3IM0A 4IL7A 2JX9A 5LK5A 1QWRA 1V6OA 5KHKA 2ZTNA 3ZN4A 4D94A 1AJOA 1LOEA 4QQPA 2AZ5A 1YFWA 3AYCA 1FATA 3AP7A 3RRDA 3UL2A 1H9WA 2XVKA 1QJZA 1NZCA 4UXAA 3V64A 5JLVA 1IS4A 5EWSA 3VGIA 5FPXA 5C4WB 4E4ZA 2C5DA 3IN9A 2WS92 1ZBE2 4FTEA 1MS4A 2JG9A 5EJ3A 1DQ5A 3H8UA 4HN1A 2WT2A 3MIHA 3VZMA 3WP3A 2JG8B 1QQP3 3CJIC 2R1BA 3ZFEC 2BFUL 2UY9A 4PDWC 4XF1A 3FC0A 1BVVA 3M8LA 2VULA 1JYCA 2R49A 2CV6A 3KCXA 1EAH1 3AZYA 3FFQA 3APBA 1UU5A 2C9AA 3NWKA 2WA4A 4RR3A 1I5ZA 1DQ2A 5KHHA 2CNAA 3ES4A 4R52A 1PO23 1XNBA 1BMV1 5T54A 4P14A 1ZZ6A 4P9JA 2ENRA 2Q0AA 5J37A 2ZX3A 4AHWA 1R093 2G4IA 1W6MA 2TNFA 1PM7A 2XJRA 2YROA 3KZ4C 2V09A 3M3QA 2A70A 4YM0A 4LNVA 3AM2A 2VMGA 4AK3A 1QJX2 3J4UH 4ISRA 2PAEA 3JZVA 3MEPA 4MV2A 4GULA 1QKQA 3EBRA 1EV13 3MPBA 1R1A2 5CG9A 2Y0OA 4IQPA 3VHNA 1L3JA 2IXIA 2WSUA 5GZEA 4LT5A 2PTMA 3NVCA 2RS31 1HV1A 2PAKA 2XJSA 1U0AA 1W6NA 3BU7A 4LO6B 2NZ9A 4AQ6A 3FFZA 4GKXA 4XFBA 3WNXA 1ASJ2 4YGDA 4K20A 1CJDA 2CTVA 3JBG2 4MVTA 3UKTA 1RGSA 2VUAA 5CADA 3AP6A 1SLTA 1WMDA 2JG9C 1I6XA 1OPMA 1YO8A 4EV0A 5EXOA 3WUDA 2VGDA 2BVBA 4FAGA 3ZN6B 2X5IB 1PO12 2A6WA 5JSRA 1CAWA 1O7FA 5F9TA 4QMAA 3AXDA 1A6CA 1XNDA 2VOKA 1ZM1A 5LEKA 4XYXA 3OYWA 3TOJA 4IEVA 4Q0QA 2AREA 1PIV1 5A3MA 4AVCA 3U0ZA 1YI9A 1BZWA 2DCTA 2W08A 1URXA 2VPVA 4B8EA 3QOPA 2PQQA 2PHXA 2ET7A 4KNCA 1S0FA 4YG6A 3WG2A 2WLQA 4LBMA 3E97A 1UL9A 3OD4A 2FMYA 3MIDA 1RUF3 5DZGA 4RR3C 1VR3A 1GZWA 1QJU1 3LCPA 5HBAA 1Q8QA 2HYKA 4I30A 3R4UA 1MZ5A 1IPKA 4HK9A 2ZZQA 5D1IA 5GKAC 2LTNA 4LTAA 1PVC1 2VOXA 3HD8B 4HKOA 2R1DA 2PN5A 2Z79A 1JUIA 1QDCA 1RHI3 2ZGMA 2IXLA 1LHVA 1Y3TA 2GC2A 3KM5A 1WW7A 3M1HA 1QH6A 2O8QA 1FPN1 2WA3A 2B5HA 1CX4A 3CO2A 4AVTA 4JDOA 4WVMA 4ZU7A 5KHIA 2UWCA 3WP6A 4CEYB 2ZX2A 2ZHLA 2BYVE 4QM9A 4Q0VA 3L2YA 2NN8A 2OZ6A 2WFF2 5K0UA 1O4YA 2ZGTA 5DUXA 1OKQA 2D93A 5BY5A 1Z78A 3INAA 1GANA 5T5PA 5DUVA 5C4WC 1DDLA 2Q30A 5GLVA 3N7JA 2DUPA 4WZFA 5FMOL 3NV2A 2PHTA 3B9IA 3ZFFB 1AL23 1PNFA 1UX6A 1KFUL 3AFGA 4QPIA 5T55A 1Z7S3 1SBDA 1QOSA 4BMEA 4JCKA 4TYSA 2AENA 3MLLA 5F5QA 3LWCA 3J26N 1V6LA 5FQ0B 1XU2A 4LA2A 3ZIXA 1IHMA 5C8CB 2ILMA 1AYM3 5JIAA 3VLBB 3AJZA 4CP0A 2HWC3 2W52A 1QDOA 1OQ1A 5L7OB 3WDTA 1SLAA 4HMZA 2A6XA 2UYAA 4GXLA 1AXZA 4JRAA 4Z1VA 4EWDA 3LKJA 1ZRCA 5EV7A 2DUQA 4OHZA 1RUI3 4YVSA 4Q29A 3USSA 3MF9A 5I8TA 5I8SA 4DOUA 1GV9A 1RTVA 3BB6A 3ZYIB 3AZZA 3QLQA 4NPRA 4RQPA 3KT7A 1O3QA 2VQ0A 2IXJA 3RMXA 1FV3A 4F83A 2PLV1 4AWDA 2BUKA 4X6RB 1DFQA 5FLHA 5FAXA 4XF9A 5KXEA 3MZHA 2E7AA 5LK7B 1SFNA 1RIRA 3ELNA 2RR12 3UK9A 5FOBB 4Q4V3 1QXPA 3MLJA 3TN91 1XNKA 2C1FA 3SNMA 2AGSA 3VBOB 4K7JA 3C3VA 2TUNA 4D7YA 4AI1A 1FMD2 1NA1A 1W0OA 4RGGA 1LU2A 1U12A 1AYN1 3WVJA 4F8AA 1J1LA 4IV3A 1WCKA 3O0WA 2H0BA 3PMEA 3GBFA 2XPJA 5DZFA 1BMV2 1A8DA 2VMHA 4N53A 1N1SA 4YM2A 4ZU4A 1RUG1 3K48A 4TWTA 4XZPA 5IUQA 2BGCA 2R32A 1MS1A 2JD4A 2X5IC 2D3PA 3ZYGA 2ZGPA 2RS11 2XG3A 3DUIA 5T3NA 3WT3A 1HW5A 2LUWA 4MUVA 3NKGA 3WQ1A 1APNA 2X53S 1IQAA 4JVAA 2Z69A 4HKLA 3MW2A 3PJYA 1JXNA 1UKGA 4BOWA 3Q9OA 2ZGQA 1S0JA 3VBFB 2AR6A 2RS32 3KGZA 1DGWX 4YFWA 4R9DA 4AFCA 1GZCA 2DWRA 4YVSC 3NL1A 4JGYB 1I9RA 3JD72 1HKDA 5E89A 3WHUA 4OUSA 1X36A 4YG3A 1ZNPA 3JCIA 1D4VB 3SXWA 4CDXB 1LOAA 1X33A 2ZAHA 4HSLA 2P3IA 4DNYA 3E6BA 2HWF3 4ES9A 3VHPA 1QGLA 3E5XA 3NJZA 2RM22 3T1MA 1IPJA 1FOD1 1VRH1 3I59B 2JDZA 1CESA 2YPJA 5CFCA 1QJY1 1UD1A 1TME2 1H30A 2WNVB 3S7EA 2R043 1NY72 3N7KA 5A33A 3VDDA 1CAUA 1ZRDA 4AE2A 3H0OA 4Q4Y2 4JTNA 1X8EA 4CEYC 1MS5A 4CDWA 2GNBA 3OY8B 1Q8PA 5GZGA 2YY1A 2NP0A 4UBGA 1LHOA 1NA1C 3J8F1 1KXGA 1OHFA 1D4M1 3AXEA 1HRV2 1QJU2 1B35B 2XB6C 3O0VA 3RWNA 4BQ1A 1I3HA 1WLCA 3FBMA 3DL3A 4N53C 1XYPA 4OFGA 2UY8A 1S0IA 1W6OB 4FTBA 2GNTA 4PIYA 5JZGB 3ZFFC 3I4IA 4I01A 4HPKA 4LBQA 5L73A 5C8CC 1AR63 1HQWA 3B69A 3WXPA 4NWVA 4YVWB 3AYDA 1BYHA 4AVAA 2NLRA 2WZR1 2QFEA 3S6PA 4HLTA 3HQXA 3G6JB 3I7DA 1AF9A 4P9WA 4FSJA 5FOJB 5L7OC 2WS91 1ZBE1 4R9CA 5BNOA 4RS5B 4FPGA 2D5FA 3B02A 1V9U3 2ES3A 1K5MA 1SLLA 4EN7B 1Y43B 1F2NA 5FFOC 1LGNA 4FXKB 3ZSJA 1NXMA 4XFCA 4QU2A 4DY3A 4JAAA 2ZZJA 1RUH3 1C1LA 1GKBA 5AFBA 1H2NA 1GFF2 1RUE3 2XKOA 4YM1A 4H7LA 3EO6A 2QCSB 3JUUA 1MR5A 4HVOA 4EWAA 4OI4A 1QOOA 3AZWA 2RS51 2GC1A 3VDDC 4LBQD 2IXCA 1NOVA 1PMIA 4R4ZA 5AC93 3ILNA 3FJSA 4KH9A 4CDWC 5K8SA 3VBOC 1VBE1 3O5SA 4N9IA 2B45X 4YRDA 2IFRA 2WJSA 5D8AA 1F31A 2KA3A 1R081 3W58A 4AEJA 4Q0PA 3FZ3A 1AR81 4YZ1A 4GWNA 3MFCA 2A73B 3TRSB 4D7TA 1SBEA 2JEMA 5ABJA 3ZPYA 2EA7A 2A6VA 2EXHA 3MIBA 1VBD1 2DTYA 4XF3A 4YW1A 5ACA1 3LA7A 3B7MA 1ND3A 4IESA 1PZ8A 4Q4X1 2GN3A 2TBVA 5KC5A 2GH2A 2Q5TA 1VP6A 1HQNA 1VBA3 1N1YA 3R4SA 2CYFA 3TN92 1MEC3 3JBG1 4XJWA 1ZA4A 1DQ6A 2PHDA 3VKOA 3GHMA 5SV8A 1VBB1 5BNOC 2NPIA 1XYNA 2EXKA 4HFSA 3ZMOA 1BBT1 1AYN2 1BJQA 2HWB2 3MW3A 1N3OA 3AP9A 1MVEA 1PO11 4JGYC 2BWCA 3AKQA 3QD6A 2JE9A 4OI0A 3JB4C 1X82A 2H6BA 1MZFA 1RUG2 4AGVA 2NQYA 2VU9A 4M3CF 2D7FA 1S0DA 4XBQA 4D3WA 1QNWA 4PLNA 4Q4W1 3V0AB 2HWE3 2MPFA 2XLAA 3RZZA 2R0HA 1NQDA 1RMU1 4PF5A 4TSVA 4FPOB 1WUVA 3RG0A 2WQZC 5CG8A 1UZZA 1ENXA 3ZXDA 4OVEA 4MXWA 4XOGA 2FZ2A 2DU0A 1PGW1 1UPIA 3MLKA 4AFAA 1W6QB 2WNVC 2XGXA 1A8MA 1LKNA 4O9EA 3ZXFA 4E27A 3GYDA 3WUCA 1ULFA 4J6GA 5TSWA 4I02A 2ZABA 5I0RA 3H3ZA 4U2AA 1OA4A 2UWBA 1H4HA 5J36A 3UV9A 3AYAA 4HZFA 3ZFEA 1AR93 2PHLA 2R30A 1DZQA 2B8MA 2I07B 2PAMA 1W6PA 3POWA 1B35C 4GH4B 2WIIB 4YNIA 1R1ZA 2WWSA 2RJLA 1YYNA 4OZXA 2DF7A 2DV9A 4Y22A 5KXBA 2P3JA 3GALA 1Y7BA 1FOD2 2IXKA 3ZSMA 3VN4A 3HT1A 4P9XA 1GNHA 2HEWF 4DXZA 5JZGC 2ZGRA 1VRH2 2VECA 4QGLA 3ZSEA 3IWZA 2I45A 3DKWA 1ND3C 2YC0A 1BQPA 4XJZA 1RUD3 3VBUB 2ETEA 1G9FA 1MQTA 4IEXA 4N43B 2WT0A 3KD4A 5H9RA 4ATFA 4CEWB 4I2OA 5DDJ3 1S0CA 2XL7A 4XFAA 3CL1A 1MACA 5BNPB 1WLWA 3KLSA 5J48A 1C8M3 4RS5C 3ZVXA 3J8F2 1D4M2 2QE3A 1H1MA 5JAXA 2K2SA 1RUC3 1REFA 2XWBB 1D2QA 5FDBA 2ZGUA 2R071 4NHLA 3ZX7A 2Q1ZB 3IT8A 2A3YA 2WNUB 3KB5A 4CDUA 4XJ9A 4EN6B 5EFUA 4GB32 1MS3A 5CNAA 1PO21 2CGOA 1H4GA 2XBO3 5I8YA 3I2DA 1HXS3 1JN2P 4XTPA 4HETA 1R091 4IEPA 1NCRB 2DFCA 1ZZ9A 1ENRA 1TMF3 3L2HA 5HCFA 2WZR2 3TAYA 3NAPB 1JHNA 2ZCWA 1EV11 5GZFA 1YJLA 4DQAA 3AKRA 1WCSA 3BALA 4FP2A 3WG4A 2AH2A 1C3HA 2K9ZA 1QY4A 2DVAA 4RL7A 4XQ4A 2ZS6B 3UKNA 1DZTA 4RHV3 1CIWA 3V56A 2HEYF 1Q43A 3WG1A 2E9QA 1WW5A 4HK8A 1EYBA 1BEV3 5H9PA 3LB9A 3ZN5A 4ZU5A 2RR11 2VNOA 4CDQA 2VW0A 2LM3A 3VBRB 1KFXL 2VXRA 3EJKA 1LGCA 2KM2A 3ZDSA 1VB4A 1NQJA 5FTTC 1ZZ8A 3H7YA 1CQ9A 1FMD1 1MQTC 2A6ZA 3FX3A 4LLFA 4SBVA 3LA3A 4QQLA 5FREA 1F5JA 2RS52 2MNGA 4XW3A 4AFMA 1YIPA 3H50A 3A0NA 1IS3A 5DG2A 1VBE2 4OLLA 2IWGB 2D3RA 2GNMA 1O4ZA 3VKFC 4OHXA 1FXZA 1V6JA 4IEUA 1R082 4GA9A 3GZTB 1RC6A 1AR82 1FNZA 3D6EA 3B01A 4YW2A 3ZSKA 1O3SA 3FE5A 3MGUA 4E2GA 1RUF1 3MF6A 3WW4A 4CYDA 4K1ZA 3D0JA 3R05A 1DLLA 3R4DB 4CDUC 1JH5A 4G4FA 3E5UA 3ACLA 1VBD2 2E63A 1OA3A 5KXCA 3GF6A 5ACA2 1QH7A 5I0SA 3R6SA 1BKZA 4FAHA 4GQ7A 4Q4X2 5CBLA 1UU6A 2IXHA 1RHI1 3JD71 3WP5A 3VZNA 5GJ6A 4IEOA 2K0GA 5J09A 2O0OA 5C4WA 2QZ3A 4QQHA 4ATEA 4JDMA 1LEMA 1RUJ2 3KMHA 4H14A 5FRAA 2G9GA 1UIJA 1VBB2 1SQ4A 4FOVA 4P9LA 2NMOA 2QVSB 4QXKA 1BBT2 4AEDB 1UU4A 4L97A 1KS4A 1N3QA 2JG8A 1S55A 2RM21 3ATGA 3DPRB 2MEV3 4QD2A 5JSOA 3NV4A 3E5QA 4S2HA 1H2KA 1Z0HA 2UWAA 3FHIB 1WD3A 3RI8A 5BNNB 1JUHA 3POSA 4GH4C 4XFIA 3QCWA 2D43A 2D6LX 5JVVA 1WD4A 2D97A 3ZIWA 5A3LA 2W0XA 4AXOA 1NE6A 3OCPA 4Q4W2 1TME1 2HWD2 4G9SB 1AXYA 1NY71 4YM3A 1EAH3 1Q8SA 3WP4A 4CDQC 1RMU2 1U5ZA 1AL21 3N7MA 2RJKA 2GMEA 4Q4Y1 1ULDA 1REEA 1VBC3 1Z7S1 3SH3A 4Y1YA 4Q0SA 2BNMA 2BEOA 2A75A 1PGW2 4XPVA 2F4PA 3VBUC 5JSPA 2YV8A 3SH5A 1HRV1 2I2SA 1LOFA 5JMCA 2HWC1 4CEWC 4E2SA 5BNPC 4N90A 4WVZA 4MXVA 4LE4A 1IS6A 4LEJA 4YZ3A 1V6KA 2FZ1A 5AFEA 2H0VA 4LO4B 4QPYA 3KT1A 3DV8A 2VY0A 2ZMNA 4GMP0 4WM7B 1DQ0A 3PHMA 1XE8A 4K3UA 1DHKB 4RFT0 4X6QB 4M01A 5J7MA 2R6QA 3FUOA 3SISA 4AHZA 4IV1B 4Y4YA 3WLUA 4GWMA 4PCRA 4ITCA 4YGCA 1QQP2 1F8VA 4CP1A 1H8TB 2GU9A 1ENSA 1H2MA 3IKWA 2HJIA 4H7MA 2SBAA 1G9AA 1SEFA 4D69A 1JW6A 3WY6A 2O8OA 2ET1A 2VVFA 3BIWE 5C6CA 1DGWA 3BOWA 4YZ5A 4W65A 1MVQA 1IKPA 5L19A 2Y38A 4R8HA 3PTYA 3IPVB 2X5IA 3ZN6A 2XVGA 2JG8C 2R072 2BBVA 4YW4A 5JR7B 4KU8A 3CF6E 3ZXJA 2RE9A 1PIV3 2ZJCA 1PO22 4J1XA 1F9KA 1BK1A 1NG0A 5DZEA 1CAVB 5FO8B 1R092 4FOYA 4EN8B 3M7AA 3WCSA 5C9AB 3VBRC 4COUA 1S0EA 3GZAA 4K9SA 4CZSA 4YW3A 1NCQB 3WOGA 1POV1 1YUDA 2OUJA 2Q1MA 1G9CA 4AHXA 4F3JA 1EP0A 3CJXA 5IK8A 2GALA 1EV12 5FPZA 3ST7A 1SMVA 4RD7A 3HAGA 1LOFC 2VOVA 1ZZ7A 4QPGB 4BM8A 5CB7A 3X29B 1TQ5A 3MIGA 5JPMB 4AI8A 3WQ7A 1CAXB 1PVC3 3OPZA 4QX5A 5SV5A 4FVVA 5JOZA 2ZMLA 2EVXA 5LRRA 2ZGSA 2EXJA 2H6CA 1BVP1 4LUKA 2D3SA 1YLLA 3I8TA 1VALA 2QDRA 3ZXEA 5KHGA 2EAAA 2Y0IA 1UAIA 1ZBA3 1AL0G 4URTA 3U10A 1FPN3 3J9SA 1UMZA 4XBNA 4BLIA 2NYYA 4NVPA 3GHNA 3RJ2X 3L9JT 4KWLA 2HWF1 2VOWA 2R063 4CEYA 1V6IA 1J59A 1S2KA 2CWMA 1YNAA 4OULA 2RMU3 3ZFGB 2YUEA 1ND2B 4DY5A 3AZVA 3THTA 2HWB1 2LALA 2MHFA 5CU1A 4YLZA 1ZRFA 1C57A 3T1LA 2D5HA 4L2NA 3P3PA 2GMMA 2R041 1AR73 1LECA 4FCAA 4XIKA 4YW5A 2VH9A 2JJ6A 4OI1A 3WG3A 5C33A 4FQZA 3ZFFA