3K51A

Crystal structure of dcr3-tl1a complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
160
structure length
143
Chain Sequence
GDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMPDSITVVITKVTDSYPEPTQLLMGTKSVSGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Decoy Strategies: The Structure of TL1A:DcR3 Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Tumor necrosis factor ligand superfamily member 15, secreted
total genus 27
structure length 143
sequence length 160
ec nomenclature
pdb deposition date 2009-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00229 TNF TNF(Tumour Necrosis Factor) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3k51A01
1OSGA 4G3YC 2R32A 3TYJA 3ME2A 3K51A 2Z5WA 4F3JA 1XU2A 3TWIA 4QQHA 2JG9B 3MI8A 4QQPA 3FC0A 3LKJA 3B93A 2O0OA 4OUSA 2WNUA 2HEVF 2Q8OA 4QQOA 1KXGA 1S55A 4MXWA 2WNUB 4QQLA 5L36A 2E7AA 1RJ8A 1D2QA 4MXVA 4D7YA 1U5XA 4G4FA 4J6GA 4HT1T 3WD5A 2R30A 4DOUA 1U5YA 3V56A 1DU3D 2JG8A 1IQAA 4KG8A 1JTZX 2QE3A 1PK6C 1JH5A 4KGGA 4EN0A 3ALQA 1C3HA 1PK6B 1OQEA 5TSWA 1PK6A 1DG6A 3B9IA 2TNFA 2RJKA 2HEWF 1TNRA 3K48A 4OUMA 5HBAA 5L19A 2JG8C 2Q1MA 1D4VB 3QD6A 4N90A 4TSVA 1OQDA 3QBQA 4DB5A 2HEYF 5KC6A 1O91A 2RJLA 4OULA 4E4DX 4RSUA 1C28A 2AZ5A 2TUNA 4KGQA 4E4SA 5KC5A 1ALYA 4MSVA 1I9RA 3IT8A 2R6QA 4GIQA 2WNVB 4TWTA 1WCKA 1KD7A 2WNVC 2JG9C 2ZPXA 1RJ7A 4NN0A 2RE9A 3L9JT 1GR3A 2ZJCA 3AB0A 2WNVA 1U5ZA 1XU1A 4MXWB 1TNFA 2JG9A 2WNUC 2OIIA 1D0GA 1A8MA 3URFA 2X29A 3B94A 2JG8B 4QPYA 2QDNA 5CIRA 5BNQA 5KWRA 2KA3A 4QQ2A
chains in the Genus database with same CATH superfamily
4NRPA 3GF6A 5L9BA 1W9TA 4QKBA 4KL1A 3O1RA 2DCYA 1RYYA 5GZFA 5FPVA 4ORFA 3ZDSA 1GKBA 2I07B 5ACA1 3HNYM 1VRH1 2WNEA 5L7OC 1ZX5A 4S2HA 1RUI2 4FPCA 1HIXA 4FTEA 3OGJA 1CAUA 1GYKA 4QPIB 4XETA 3VBSA 4I2OA 4KNCA 1IKPA 3PUQA 1TVGA 2W1QA 1AR81 1W8HA 3AL6A 2O0OA 4KWLA 3USSA 5FV3A 1ZZ7A 3H8OA 1GWMA 4AVSA 2WINB 4Z92B 5C3RA 1MS1A 4QB2A 5JDBA 3OBAA 5FZ6A 4RR3A 4CDXA 3PVBB 1B35A 2EIDA 1D2QA 3H8XA 2RS53 3VDDB 1ENXA 2OUHA 2Q4SA 4NR1A 1X36A 2WJSA 4D7YA 1W6OB 3ZSJA 4P9YA 4M3CA 1AYM1 2A3WA 4YW7A 3CNAA 3TNPB 3V0AA 2VPVA 1UQXA 2VGDA 1X9TA 2JB4A 2VTXJ 4N43A 4OYUA 4QHBA 4X8PA 1UZ0A 3T3YA 4QGNA 4CUAA 1AX1A 3LSEA 4JGYB 4Y1ZA 2C5DA 1HX6A 3A21A 4XBNA 2VMEA 5J1XA 4I3PA 2DCJA 4FP2A 2AEYA 4HONA 4M4RA 4R9CA 5DAWA 2XKOA 2HWC1 1GZWB 3HBZA 3KCCA 3P3NA 4AEDB 4HG6B 4KG0A 4ASLA 4CDUC 4AHWA 1YQ6A 3IIAA 3WW3A 3AC0A 1BEV1 1TME1 4N53C 2JDHA 1PO21 2WR9A 3WDUA 1HJFA 3T2QA 1YFWA 1SDWA 1DGRA 4PQ9A 3GZAA 1L7RA 1A3KA 2RM23 4LUMA 3WP5A 1O91A 1UOFA 2WSVA 2YBKA 1RUE3 2K0GA 5DDJ1 1O8SA 2GSYA 4AEDA 4E4DX 2VZUA 5HXVA 1F15A 3ZXDA 1C28A 3I2JA 4RS5A 2DBIA 2WAAA 1LU1A 4L97A 1EV11 2ZMLA 3U78A 5C3QA 3WR0A 4UFIA 5A70A 2XH6A 4V2WA 2ES3A 5FJHA 3MFAA 3ZYRA 1DGRN 5FP4A 2ET7A 3FUQA 4CCMA 3I2OA 2FD8A 4GAZA 3PVEA 1AYN2 2IXCA 4M3CB 1ZBE2 5FYHA 3MIGA 2EXIA 4LBKA 4LT5A 4RR3C 1NX9A 3CJIA 3VKMA 3MFCA 4KWUA 5FMOS 4HFSA 5A6QA 4LA3A 1NOVA 3SC7X 1LGNA 1WMDA 2W1UA 1GICA 1KJLA 1W2OA 1F8VA 3VUOA 2WABA 1D0GA 1G6NA 5JI7A 1RUI3 3M2MA 3NNLA 5CZKA 2UY8A 2XVGA 1UY0A 5BXXA 1NCRB 2CGOA 1AYN1 1Z0HA 1N47A 5DAQA 2EA7A 3K46A 1SFYA 2HH9A 1MVQA 3OEBA 1NCQA 5CIRA 4GZ9A 1J3QA 4YGCA 4D6SA 3K2OA 3I2FA 4GJYA 1X50A 3O1PA 1AR83 3U0ZA 2R062 2YFUA 4N7IA 4TN7A 4BYYA 3P1IA 2NQYA 4HVQA 1NA1C 1OQ1A 1W9YA 4DUVA 3H3ZA 1PHMA 4UFMA 3FN9A 4A3XA 3ZKYA 4Y20A 4RN5A 4EZHA 1A6CA 2JX9A 3OPZA 3ME2A 5FAXA 5I93A 5EFUA 4QB6A 1VBA2 2HYKA 4QQHA 1PGW2 4CPBD 4LBQB 4DXTA 5F1RA 2AEZA 1DFQA 1I5ZA 1JYNA 2WAOA 2WLPA 1ZM1A 1QNYA 1CR7A 3MICA 2VQ0A 3MUZ1 1K5MB 2D6MA 1OPMA 1DCSA 4P08A 3RMXA 3RI9A 2WNUA 5LB6A 1ZA4A 3WSOA 2JDAA 1X7NA 3NW4A 1AL22 1S55A 4RD7A 5A1AA 4P9WA 1OMIA 5GKAC 2ZXQA 2ETEA 3VD5A 1ASJ2 3I3DA 2XONA 3KF3A 3LIHA 3LPFA 4Y22A 2D44A 3WD5A 2VUCA 5FZKA 4NIDA 5T3NA 1VBA3 2W9XA 4CP1A 3UNPA 1ULPA 2JG8A 1MVEA 5LBBA 4I02A 1XXNA 2QCSB 3A23A 1QIQA 1CQ9A 1AR63 1OA4A 2WWUA 2NP0A 2LS6A 4CCNA 5JR2A 2GMMA 5KXEA 3IIIA 1WMEA 4Q0QA 2B42B 2P3KA 2P3IA 2RMU2 3ZIXA 4JDMA 2SBAA 2P3JA 3LZZA 1RUC1 1ULDA 3JB8A 3K48A 1QF3A 4NRMA 5JSOA 5JR7B 4MGKE 3HT2A 2ORXA 3A7QA 5FZ1A 5GLZA 3N7MA 4M3CE 4Z2AA 2VZRA 4FPYA 2DU0A 4IESA 1RUI1 2Y0IA 5C9AA 2JB8A 1LR5A 5CISA 4AW7A 1IGOA 4JTNA 1CZVA 1RUG2 5JLVA 1YFXA 1RUF3 2PLV1 1BHGA 5T54A 3WW4A 4RQPC 5FZFA 3ZYIB 4L11A 4Y1UA 4OI2A 4KGQA 2VQUA 2XJVA 2G1MA 1F31A 3AYEA 1UU4A 2JDMA 4MSVA 3CDZB 5LA9A 3HPNA 3GCWA 2H6BA 2PHDA 3N9OA 4YZ1A 5C5UA 4QPIC 3MW3A 1QQP1 3SXWA 1WCDJ 1XRUA 1W04A 5CAZA 3H1WA 5FZ0A 2C1FA 1LOEA 1W0OA 2JIGA 5FRAA 1T2XA 2IFRA 2AC1A 2QQKA 2WZR3 4Z1VA 1G9DA 3BIWE 2ZAHA 3MV01 4NAOA 3CMGA 1LOAA 3VBHB 5C4WB 4RL7A 1IKQA 1D4M3 1S0BA 4P00B 3NV3A 3O1MA 1FNZA 1NCQC 3PUAA 4IQPA 5KBFA 5ERLA 5J37A 3IPVB 1JOBA 4QWNA 3KF5A 4Q4X1 3A22A 1GV9A 4DNYA 4NWWA 5KWRA 1BBT1 5J7MA 3EBRA 5IVCA 3ZXEA 2KA3A 2X09A 3RYPA 1PM7A 1W6PB 2ET1A 3RI8A 4EWAA 1OSGA 3KCYA 4QDRA 2VBDA 3OOXA 4XURA 5FZBA 5LA2A 1ZYBA 3WINE 1H0BA 2V5DA 3HBKA 4BOWA 1QDCA 1OD5A 1J58A 1UMZA 2GP5A 3FL7A 3I97A 2DCKA 3I3BA 4AFMA 3OPTA 3RNSA 1O4ZA 1XU2A 2DVGA 5BNPB 1YCIA 3BTZA 1RUG1 4AQTA 5KHIA 4Z2WA 1HW5A 4KWKA 1GWLA 4XUQA 5IUQA 4CP2A 1OLMA 3Q8FA 1FV2A 5ISLA 1ULGA 1JHJA 3M4FA 2L9LA 4BCUA 3LOBA 1W9WA 4PBPA 4XF0A 5IHRA 2WN3A 3HT1A 4QM8A 1H2MA 2Q1FA 4QX5A 3NNJA 4N43C 5JOZA 1VIWB 2CGPA 5E1RA 1RUC2 3AKPA 3GXUA 3TEZA 5L36A 1QJY1 3ZFEC 3O0VA 1X9PA 5BNOC 3BPZA 1Y4WA 3HQUA 4WVVA 3VL9A 3VZLA 1RUH2 2O14A 4Y26A 2E6VA 1UZWA 4IUGA 5IVEA 4JRLA 2XUEA 1RMU1 5GLVA 1RB8G 1OOPA 2A75A 2JD4A 3MEPA 2G4IA 3WF2A 3IDBB 2MEV3 3AVSA 5LCWL 2VZTA 4BU2A 4ET7A 2RS33 2P4EA 1JI6A 4GKXA 2ZABA 1S0GA 3POGA 3LIGA 1DG6A 3EHKA 2WZEA 3VHNA 3RPQA 5CKNA 3POWA 1K42A 1JMUB 3OGVA 1YHFA 3WQBA 4NIGA 4CXYA 3MLJA 1AL21 4JC1A 3AMNA 2R7EB 3MIBA 1D2SA 3S0MA 3HN1A 3VD9A 4A41A 3R05A 1H2NA 1KS4A 1AX2A 1STMA 1MQTB 3SHRA 1HKDA 2EXKA 4ITCA 5CADA 1R1A1 2XQXA 1CZSA 4Q4Y2 5C4WC 1V70A 1RITA 4AI2A 2X53S 1C1LA 1YYNA 2XBO3 4CDWA 1JZ6A 2RJLA 5DUWA 1NXMA 1C8M1 3VD7A 5A6YA 4L92A 4KU7A 2ZEXA 4E2SA 1CAWA 2XJTA 2BJSA 2R6QA 2VW2A 3AP6A 1J59A 2B7YA 3VBRA 2Q8EA 3AKSA 3I2KA 3GJBA 5IJRA 1JW6A 5JXGA 3J8F1 3UGFA 3AP7A 2WNVA 5L73A 2VQAA 2CU5A 4MXWB 4WZCA 3V65A 1H1MA 2XKPA 3S6PA 4XTPA 2ARXA 2VXRA 5HI0A 3ZKUA 2Z79A 4A6SA 2X29A 5BV6A 4MGSA 4Q1PA 1JYWA 4NOTA 3ZO0B 1BBT2 1K5JA 2A73B 2ADEA 4CDUB 5ABJA 2XLFA 1SLIA 1ASJ3 1DIWA 4AE2A 3BOWA 2JWPA 4FPGA 1VBE3 5A1LA 1ZBE3 3DPRA 1COV3 3VBHA 3LWCA 2KXLA 2D93A 5A7WA 1IPJA 3VDCA 4BMEA 3UKNA 3HMYA 3W5MA 1EUTA 4BQ5A 2Z5WA 5I0SA 5FMCA 3AX4A 1SDDB 2QQNA 4JCKA 4QPGA 3VZMA 4MX3A 4S2FA 4PLMA 4AOCA 2D6OX 1QGLA 2QQUA 2OKXA 1H8TB 2WT2A 3W20A 4EV0A 3NWKA 4U36A 1GNZA 1JUIA 1AL23 3KVBA 2PHXA 1VMFA 3ZSLA 3O1OA 1XNKA 1V9U1 3ZYHA 1Q43A 4OUSA 4YVSC 3TNQA 4IE5A 4YM3A 1KXGA 1YIFA 2GMPA 4JQTA 1D7PM 3CU7A 1PO11 4OUEA 3KV9A 4DEVA 1YI7A 1W99A 1DZTA 3AP9A 4Y24A 1SCRA 3ZMOA 4OCTA 4AGVA 4OHXA 3MLLA 5B4NA 2E53A 1VB2A 2I74A 5FMDA 1DYPA 2ZMNA 1CPNA 1DU3D 1XJAA 2UWAA 1PO12 4A42A 4EYUA 1ZRCA 5BYNA 5FYIA 4LBQD 2C9AA 5FPLA 3PJQA 4J1WA 2WA4A 3B69A 1QEXA 1P8JA 2ZGQA 4L2NA 1UIKA 4R8HA 2XJUA 3ZFFA 4AVCA 2QQMA 2Y38A 3ZXLA 2ZX1A 3NJXA 5A32A 3W59A 2FDJA 2GU9A 4XTMA 5FQ0A 1JOJA 1TME3 5A7OA 2HEWF 1CGPA 1WCSA 2YZ4A 4NHXA 4P9LA 5F6KA 5LRRA 3I59A 3E5UA 2VXJA 4LULA 1NE4A 3RS6A 2WO3A 4IXLA 4Y5SA 5JOXA 3RMYA 1EYBA 1OFNA 2ID4A 1OKQA 3PVNA 3VBFC 2YU2A 1QJU1 1US3A 3QBQA 1RVF2 4HKWA 4LQRA 5DDJ3 4PF1A 2QJVA 3BI3A 1KRIA 4RFT0 1CPMA 5AVAA 1LCLA 2DVAA 3B7MA 4AI1A 4BA6A 4EWDA 4XCAA 3BB6A 5C8WA 1ULCA 4YW6A 5KC5A 3NNFA 1AR92 2A6WA 4GWMA 3WCSA 2Z69A 1PO23 1NAEA 4W6YA 4E4ZA 3OYWA 1WCKA 1NY71 5CA6A 4XOGA 2JICA 1W28A 1EAH3 1UY1A 3POYA 1S0JA 5F7UA 3OUHA 2YG0A 2FCUA 1DQ4A 1UMIA 4IV1A 4B29A 5A3MA 3J7HA 2VC9A 1BXHA 1GQPA 2D43A 2FDKA 2PHLA 3O0WA 3Q8BA 4JGYA 2VBPA 4C1XA 1CESA 1QOSA 5DG2A 1QXPA 3AZZA 3ZYBA 1QU0A 1UY4A 1XE7A 2P37A 3IN9A 3KS7A 3ES1A 4XPVA 1ZRFA 1UY3A 1RINA 1LJ7A 1LU2A 3NKTA 3WG3A 4YSFA 3RRDA 1GANA 3R4SA 1YLLA 4CDQA 4YM1A 1ZVFA 1JU3A 5C8CA 1YQ2A 3THPA 5GLUA 3SH5A 4NRQA 1NCQB 1OH4A 1Y9GA 2E33A 4QU1A 4ZS2A 1ULOA 1V6OA 2RDSA 2UY9A 2G9ZA 4C90A 4BQYA 1BEV3 5GALA 4YWAA 1VBD2 1POV3 2RDQA 3AYDA 2HBTA 5HCBA 5FKBA 4BDVB 5CFCB 3KV4A 4OI1A 4ES8A 2ZGOA 2H6CA 2DUQA 4EJRA 3KT4A 5FZOA 3VDDA 3TYJA 4MV2A 1O3RA 2VU9A 3K51A 3WDTA 3GYDA 5H9RA 1SFPA 2B45X 2RS52 3O14A 4HK9A 5FO7B 5AC91 2VZVA 1LRHA 3AZWA 2HWE2 3BPSA 1WA4A 4XJUA 3VDAA 2WWSA 3E97A 1S2BA 5K4LA 4QX1A 3LKJA 3CIHA 1FYUA 2Y6JA 3LA7A 5DQ0A 3MF9A 2YC2A 4PT6A 4YVWA 1BK1A 3OF1A 2LUWA 2W87A 1DF0A 3VBSC 1RUD1 4AL9A 3AXDA 4A7YA 4EQVA 4F7ZA 3WUDA 4L0PA 3RYRA 1WWYA 3CZUA 2WO1A 5LATA 1B35C 2IUWA 2O8OA 4IEOA 3PVOA 3AP5A 3NNMA 1GQGA 4K8FA 2XL7A 3WQ7A 4FPLA 2DF7A 3GHNA 2VZ1A 1S4CA 2GP3A 4FPHA 4BB3A 1SLLA 3NNGA 1BEV2 1HRV3 4Q4Y3 1ND2A 1VBD3 1OQEA 1Q8VA 3RZHA 5CFDA 1RVF1 4Q29A 4D0QA 1DP0A 4LO6B 2Y6GA 4RGAA 2PAEA 3E5QA 3ZXAC 2ZTNA 1DLCA 5DPNA 2A6ZA 4KQ7A 1WMXA 3ZN6A 1WW5A 5DUXA 2BGPA 3KGLA 4IV3A 4FQZA 3DL3A 4FFFA 4IV3B 4QKNA 5GZEA 2ARAA 4N8MA 2Y6HA 5IK5A 4RA0A 4QMAA 5FY7A 3PL0A 3B02A 1AVBA 1F4HA 4AHZA 5FP3A 3N7KA 4DQAA 2J1VA 2I2SA 3GALA 1YEWA 3BCWA 1HRI3 1UAIA 4WM8B 2YBSA 3SKJE 3WOGA 5FK8A 1SMVA 1W8FA 5FZMA 3SH4A 4QPGC 1CD3G 2UWBA 4AGRA 1QH7A 3SISA 4SBVA 1GWKA 4FTBA 4CVUA 5JOYA 1N1YA 4CEWB 4GWNA 4H7LA 2YV8A 5FZHA 5A7NA 4GMP0 5A7QA 1MZEA 3VHRA 2WZ8A 5M0TA 2CDPA 1IOAA 3U14A 2WN2A 4WM7C 3U4XA 3VKNA 1Z7S1 4NMIA 4JGZC 3BTYA 4FOYA 4FOVA 3DXUA 1W9FA 2OIIA 4GWIA 2DVFA 4WVMB 1AR61 1H9PA 3AJYA 2HWE3 3CLPA 3G7DA 5FBZA 5FIXA 4KWJA 5B4XA 1EPZA 1BLZA 1N1TA 3K4ZA 3I54A 5FZLA 1PVC3 3URFA 1ULEA 2FDFA 3T0BA 3VD3A 3SNMA 2VNGA 3FWEA 2OZJA 3WNLA 4FT8A 1V6IA 3DPRB 4HMZA 2RMU3 5T5JA 4WBBA 1UOJA 4CP9A 3AVRA 1AR72 1UWWA 2R1BA 3HEIA 4HSLA 1AYN3 4CU8A 5BY5A 1RUH1 4P9XA 2JDKA 5T50A 2K46A 1JS9A 2R072 2XVKA 3CQOA 1G9BA 2GNBA 5LA0A 3HNMA 3N9MA 4H3WA 1JHNA 4XILA 2VVEA 5A7SA 1MZFA 1KQRA 2FZ2A 3PU3A 1TQ5A 2X10A 2ZGTA 4Q4V3 1UY2A 5BNOB 4XBQA 3B93A 3WV6A 3ZN4A 4NIIA 4LUKA 4Q1RA 1GZCA 1JZ8A 2YBPA 4LORA 2DDUA 4CDXB 1HB2A 1LENA 3LD8A 4XZPA 4FXKB 4BM8A 2A6YA 4LXLA 2YY1A 4AI3A 3T1MA 4FOWA 5JZGC 1NG0A 1Q8PA 1GP4A 3MHZA 2E7QA 2NMOA 4Z82A 4G4FA 1RUE1 4KI5M 3DEMA 5CB7A 2VECA 4MGZE 5FXVA 4XDQA 2BEOA 1SPPA 4CTEA 3ZFEA 1WW7A 2VJXA 4GB32 2MEV1 3OUJA 4GMP3 1KGYA 2WRAA 1AF9A 1VRH3 4JZRA 1BYHA 4CDQB 1REDA 4C0HA 3LDBA 5FMBA 2PAMA 4DFSA 4OZXA 1IS3A 1OBNA 4G9SB 1VAVA 4HN0A 1UYXA 4IV1B 2GDFA 1MZ6A 4OUMA 4RS5B 4BQ1A 3LSDA 1T6BX 4HKLA 4CCJA 4COVA 2A6XA 5ACA2 3VZOA 4KBBA 4Y1YA 3JXSA 4UOJA 4AQ6A 1CX1A 4GULA 3KV5A 2WQZC 2RR11 4A6OA 2QZ3A 2RHPA 3U37A 4FFIA 3NV4A 1S1AA 4K1ZA 1GMMA 1Z7S3 1ZZ6A 2GN7A 2K2SA 3D0JA 3T1LA 1VLNA 1H6YA 2XR4A 5DUVA 4B1MA 1O59A 1AR62 2UU8A 1SLAA 4Q4W3 2AZ5A 3LA3A 2G19A 4WVMA 1OD3A 3ACFA 4K7JA 4X6RB 5ANQA 5GM0A 3S7EA 2RS51 5AC92 2P6CA 3ZPYA 2LALA 3WNMA 2WNVB 5FYUA 5HXMA 4OHYA 1PZ7A 2ERFA 4MO3M 4XIOA 3N9QA 4XHXA 5JSRA 2LM3A 3N36A 1RJ7A 1UKRA 5DN2A 2JXAA 2PTMA 3WHTA 3VBOB 1TE1B 2GZWA 3KQ4B 4MGYE 4EE2A 5I8SA 1E5SA 3N9LA 3T0DA 1VBB3 3KM5A 1ST8A 5F5CA 2DU1A 3IKWA 2HWF1 3POEA 2W0XA 3ACHA 3ZIWA 2B9UA 4AHXA 5FO9B 2QQVA 1XNAA 4GMP1 5T5PA 2A7AA 3W5NA 5C9AB 2JDZA 1AHSA 3HJRA 4XJAA 5EZWA 4AGGA 5DG1A 1YQCA 2CL2A 2JG8B 3POBA 5FZ3A 4FPJA 5HV4A 3RZKA 3O1TA 3FMGA 2QQJA 4RYDA 3T2TA 3VKOA 4BE3A 3INAA 1MEC1 3N3HA 5FKCA 3T08A 4MGQA 1DQ6A 1YIPA 3TN92 3WP6A 1HN1A 1PIV2 1GOFA 5FY8A 1G9AA 2WS93 3RGBA 3QLQA 3OY8A 3B9CA 3WLUA 5A7WB 5KHJA 4IL7A 2ARCA 3MLKA 1AXZA 4N53A 2W94A 3AL5A 4BXFA 1PO22 2V5YA 2VCBA 1OVPA 4FAGA 3WG2A 1NY72 3A0NA 1NZCA 3JQXA 1ODNA 1Q8QA 2RR12 4AXOA 2CTVA 1LOFA 2CDOA 1BVP1 2VULA 3F95A 4EN8B 1OA3A 1LHOA 3ZDVA 4DXZA 2A5ZA 5BNNA 1L3JA 1AR73 1K45A 5CEHA 1QJY2 4LITA 1ENSA 2FBEA 2PELA 1AX0A 5FCCA 2HEVF 2VMHA 1GSLA 3KV6A 1GUIA 4PDWA 2EALA 2GNTA 3H50A 3UJOA 2IXLA 2ZKLA 3X29B 4DUWA 4LNVA 5FYBA 3SQOA 1JZ2A 3D6EA 3MV11 2OT7A 4W50A 4HT1T 2VOTA 2J1SA 3BGAA 2DVDA 3P6BA 4CDXC 2VOXA 4GB31 4Z07A 3ZR5A 1RUNA 5CG9A 1QY4A 1LEMA 5IVYA 3CJXA 2JIJA 2Z4FA 3NSTA 1DQ1A 1NKGA 2W68A 3NJYA 4JKKA 4KG8A 3ILNA 1DGWA 1KDKA 1J3RA 1JTZX 3O1VA 2W95A 3KD4A 4XXAA 2ZZJA 3OD0A 1K3IA 4BZ4A 4D6QA 3H7JA 1VBC3 1NZIA 4H2AA 4K20A 2GC3A 2X5IB 4J1XA 2YPJA 2UYAA 3RWKX 2DBNA 1GP6A 3E1F1 4YW3A 3ROUA 2EIGA 3VBOC 2R0HA 3RVHA 2CSGA 2Y6KA 4D6RA 4FPEA 2D5FA 4COWA 3QD6A 1VBC2 4JHTA 1OA2A 5KXDA 3BTXA 1QDOA 1VBB2 4M00A 1H1IA 4BWOA 3H8UA 4LIUA 4IGQA 1GNYA 1APNA 5FY4A 5CFDB 1EAH2 1IS5A 2QBXA 4K8RB 1MZ5A 4CEYC 5DMYA 1JZ4A 3LEGA 3VHOA 2WYFA 4AF9A 1HB1A 5FZEA 4E4SA 2RDNA 2Y0OA 3IT8A 5IVBA 4D7SA 5FZ8A 1EAH1 1PX3A 1W8ZA 3GHMA 4OVEA 1HRV2 2BNOA 4B1LA 2BUKA 3AKTA 4JKLA 4O61A 1GBGA 1RHI3 1TME2 1XYOA 1Y9MA 2RE9A 4IGOA 1Z7S2 1PM4A 4FAHA 1HN0A 3AMPA 4FFHA 1G9CA 1F2NA 2V09A 1N3OA 3ACLA 3MYXA 4J25A 4AFBA 2WWJA 3U1XA 1HLCA 4XFFA 1AYM3 2ZGPA 4CCDA 1VALA 3K3OA 4LKSA 2EICA 3FFZA 4R9DA 1ZBA3 4B3NA 1YFYA 3SITA 1NXD1 1OLME 4ZPIA 4LKFA 1DQ5A 3A0KA 2D98A 3J8F2 2BRTA 3EJKA 4CDQC 4AYUA 1N3PA 5FYSA 5FXXA 3IMMA 1FATA 3SCFA 2QQIA 3WUCA 4CDWC 5EYXA 2WBKA 1H2KA 1CIYA 2OVUA 3AFGA 4G3YC 5FFOC 5FR3A 1SEFA 1YC61 3AXEA 1XOYA 4V2VA 1RIRA 3M70A 3EMRA 4TLGA 2JE8A 5C3SA 4Q4W1 3VBOA 4Q4V1 1SLCA 1O3TA 3WNXA 1DDLA 1R1A2 3B3QE 3KGZA 3O7OA 5F5AA 5F32A 5EYYA 4CUGA 3LOIA 4AAPA 2CWSA 4AEDC 1NYWA 3JUUA 2DFCA 4AWDA 4CCCA 1B35B 3NO8A 1W05A 4IEQA 4L8QA 5FREA 4CP9B 4ZZ8A 5K7PA 3H1MA 3BUCA 3ZMNA 3PJYA 5T5LA 1UOBA 4FBFA 3BU7A 3HIFA 4JKMA 4RHV2 4LBNA 3HD8B 1L7QA 4NIHA 4DPNA 2QZ2A 3USUA 1UMHA 2AENA 4XW3A 5FLJA 4UWDA 2XWJB 4W6WA 3ZFGC 4BJ0A 2R30A 4YG3A 5K8SA 3TEYA 2BBVA 1REEA 1FMD3 2YYOA 4E4HA 1V9U2 2P17A 2WNOA 4NIAA 4Q8KA 2EIEA 5I8YA 2A3XA 2QFEA 1C4RA 3MW2A 4DEQA 3DPRC 4ONUA 1TMF3 4UFKA 5D8AA 2DUOA 4P5HA 3ON7A 1RXFA 3FBYA 4UYBA 2JENA 4I3GA 2WFF1 1PK6C 2VG9A 4PI2A 3LF7A 5JPMB 3N7JA 1WMFA 4HKOA 1QJX2 2BU9A 4BIOA 1EUUA 2BBAA 1R093 1VBC1 1UXZA 2KD7A 4XJZA 4B7KA 1EY2A 1GZTA 2GH8A 4P9JA 2ORZA 2JG8C 4MUVA 3OGSA 2D3SA 2BZDA 1W03A 3LAGA 2Q1MA 5F3GA 2D6KA 2V4AA 1ODMA 3TEWA 4IEWA 3IAQA 3AYAA 2X5IC 3I3EA 4PQQA 4BLIA 2J1EA 1H1AA 1NLRA 1JN2P 1YXWA 5IK4A 5DAPA 1J83A 2OS2A 2VZSA 3PTRB 3I2IA 1VBE1 4IEXA 2FDGA 5F2SA 3FFQA 3FLTA 2CV6A 2GAUA 3GBGA 1LHUA 3CJIB 1XQNA 2E26A 4B4RA 1ZREA 2HWB3 3OBRA 1CJDA 4NAMA 2D6LX 1EV12 1WZXA 3K4AA 3I2GA 3QH6A 2RMU1 1L7LA 3GGLA 2VCCA 3AB0A 4LHSA 2NYYA 4A7ZA 2OUJA 2DV9A 2O1QA 3RFRA 4AFAA 3HQXA 5FZIA 2JDNA 4AFCA 2CHHA 5FYTA 3NAPC 3AK0A 4H55A 1R1A3 3EQEA 3IM0A 3H1YA 4HANA 4XVHA 3T2OA 5JWPA 2IZWA 1A8MA 1ZZBA 1W2TA 1LHVA 4C0BA 3OBZA 1CAVA 1OKOA 1AR91 2XHKA 4X8NA 2PHTA 3APBA 5IAXA 4PDWB 1Q8SA 1QOTA 5LBEA 3O1SA 1JZ7A 2Q30A 3C2UA 5FZCA 4C91A 2VMFA 2AH2A 2RS11 5EJZB 4ZU4A 2ZBJA 3WDXA 5JXJA 1PNGA 3F2ZA 2A6VA 4RHV1 4XQ4A 4Y20B 3ZR6A 4PJYA 3KWVA 5A33A 4E2QA 1V00A 4I01A 1HV0A 2JDYA 3AFKA 4AK3A 5A3TA 1QWRA 1SBDA 3B00A 1PGL1 5D8AB 2C24A 4CU9A 1BZWA 2VUJA 2W08A 3OSDA 4WZFA 2E7TA 2UURA 4JTOA 4CCLA 1VBA1 3SMHA 3M3OA 3MI8A 4RQPA 1AYM2 3WNNA 1XB9A 2BOJA 5I0RA 4S2DA 4CSWA 5FUIA 3H8RA 2WSUA 1O5LA 1URXA 1ZA7A 3CO2A 4AEKA 1WBFA 2XLAA 1ZZ9A 1PX4A 1QJY3 3C8XA 2VNOA 4QQOA 1LKNA 3Q8AA 1RGSA 1OF4A 2XJPA 3JZVA 1C8M2 3MBWA 5FY1A 4OMDA 5C8CB 5BPXA 3V0BB 2Y34A 2K9ZA 2Y60A 3H3UA 4J6GA 4NHKA 3VBRC 3LEMA 3OJBA 4DOUA 1N1SA 1R092 3IBMA 1X8MA 3DV8A 4JDNA 5L9VA 2VCMA 3VZKA 2OPKA 5KHHA 3OTFA 2RS31 3ZPOA 4NVPA 1A8DA 4HN1A 4ZXKA 3M3IA 1WLTA 5FYCA 2ZX3A 2EXJA 5GLWA 4YNIA 2Y8KA 4YARA 1IHMA 2OW4A 3DECA 2D40A 2DWRA 2W52A 1LGBA 1EP0A 2PAKA 2HWD1 2C0ZA 2CAVA 4LTAA 4UT5A 4I30A 4XE9A 4TZDA 4GQ7A 1HXS2 2ARBA 1RUJ3 1MS0A 5A7PA 3WNKA 2V4VA 4XHBA 4C1WA 1R64A 3FZ3A 4HK8A 5AFEA 2VZOA 4LR4A 2BW8A 3MF6A 4LJHA 5APAA 5FZGA 1HQNA 4WVWA 1W8WA 3TB0A 3MO4A 5FO8B 4XUTA 4K3UA 2C4XA 3VBHC 1V6NA 3D3AA 4IE4A 5A3OA 3W21A 2VTFA 4NUBA 1AUYA 3ZFEB 1A34A 3NJVA 5A3UA 4OLLA 4W4ZA 2XLGA 3ZYJB 2V73A 4R52A 2DTWA 2YPDA 2NN8A 1KEXA 4FCAA 4FPKA 4QXKA 4Y33A 4MHUA 4XJ9A 1OVSA 5LBCA 2B9VA 4LO7A 1C5HA 1QHDA 2BFUL 1BBT3 1I9RA 3NV1A 4XFCA 5CKMA 5JIAA 3L2HA 2XJRA 4MLOA 2ZGKA 4JRAA 4FXGB 2RVAA 4N43B 4YW2A 3T30A 3KHCA 3LPGA 5E8AA 1JYCA 4FOQA 3UV9A 4XMAA 5SV8A 3WXPA 4E27A 1J1LA 1W6OA 5A1FA 3L9JT 1FOD1 3I3QA 4P5YA 5E88A 4GALA 3TBDA 2KR2A 4UW3A 1U5ZA 4F83A 2IXHA 5FZDA 3JBG1 5JUVA 2XXZA 1UCXA 4BXSV 4CYDA 4E2GA 2NLRA 1NUKA 1OHFA 2VMGA 3BVCA 3JU9A 4LPLA 5T55A 4AEMA 5C3PA 4M0HA 3T4HB 4ATFA 4AQ2A 2BPA2 1WW4A 4QX0A 4HOOA 2D7FA 1BKZA 1NLSA 2YC0A 3WW1A 5C7GA 2WZR1 2R0FA 4IEPA 1WLDA 3RQ0A 2YGMA 3WDVA 5A6XA 4QU2A 5CBLA 3ST7A 4Q4X2 4XZUG 5C70A 4Q8LA 4PIYA 5F8PA 3JD72 3WDWA 3DCQA 1MQTC 1W6QA 2WKKA 4X6QB 4B4PA 5FPBA 1W0PA 4OI0A 2UYBA 1HV1A 3W9AA 1UF2C 1S0IA 1CAUB 1XNCA 4QPIA 1LTEA 5EQUA 3RG0A 3VBUC 2BVBA 3NVCA 3NL1A 1JZ3A 1HXS3 3IPVA 1TEIA 2E63A 3FC0A 3SEEA 3TEXA 4WM7B 3PUHA 3RZMA 2J1TA 2ZZQA 3LEKA 3RZLA 3G6JB 2WQ8A 3HN3A 4YGEA 4W65A 3ABZA 2ATFA 3ZX7A 1QXJA 1H9WA 2XWBB 1SQ4A 3ILRA 3QACA 1H4HA 4QQLA 2FCVA 5IWFA 1ZRDA 3J7MA 1NLQA 4HVRA 1TZOA 1UX6A 3CL1A 1VE0A 5J96B 1MPXA 5DZFA 5JZGA 1QJEA 2VMIA 4DRRA 4LLFA 2J1AA 1AR93 1NA1A 5FY5A 1RUF1 2PLV3 1J84A 4HPKB 1VJ2A 5CFDC 2Y6LA 1Q5OA 1E5HA 4Q5OA 2ZGLA 1O5UA 1AL0G 3VGIA 1WCQA 2GALA 2QE3A 1UYYA 4ZU7A 2FCTA 3ALQA 1FNYA 4LMFA 1PK6B 1LOBA 2XQRA 2LRPA 4R9AA 4YRDA 1PK6A 4YZ3A 1XPWA 1S0FA 3OB8A 2WS91 4LBLA 5F5IA 5HBAA 4H14A 4Q4W2 2XJSA 4Q0SA 4OHVA 3K3NA 2ZX2A 2TBVA 2QTWB 4EN7B 2WO7A 5EHDA 3GZTB 3B5LB 4YG0A 2IVIB 1LNSA 1CONA 2QUOA 3BU0A 4Y1VA 1GNHA 5C5TA 4DB5A 5IFTA 1G8WA 3ZSKA 1FT9A 2ZGRA 2VNVA 2VW0A 3RSJA 1SBEA 1VRH2 2J1RA 2VM9A 2Z42A 1H8TC 2BNMA 2P2KA 2ZGUA 4LK6A 1SCSA 4P9GA 5ACA3 2YUEA 5IT6A 5HCHA 1TG7A 3C3VA 5FZAA 4NHMA 5CU1A 1PVXA 2VD7A 4MGTA 2B8MA 3ZYFA 3L2YA 2OQ6A 4MYEA 4ZU5A 1ZBE1 1H8VA 2Q8CA 4WVZA 3ZSMA 1D4M2 2JG9C 3KZ4C 4Y22B 4QXHA 2XBO2 1XNBA 1OOPB 2VR4A 4O7XA 4XIKA 1C1FA 2JKXA 1XNDA 2ZHKA 3TN93 3OGGA 3JCIA 5GZGA 2ENRA 5FLHA 3R0RA 1HRV1 1QKQA 2WNUC 4TLFA 3IDEA 4IV1C 1CZTA 5FOJB 3RYKA 3DUIA 2PHRA 2P1BA 4B7EA 4HBNA 1QQP2 1VBB1 1UD1A 2R16A 3IZOA 4QKFA 4CDUA 2AUYA 2YMZA 3THCA 4PF5A 1YFUA 4YVWB 3THDA 2AREA 2P3YA 2QQWA 1FXZA 3ACIA 4PI0A 4QQ2A 1GP5A 2R043 5GLTA 4Q27A 4K9SA 4AVTA 3VZNA 5A6ZA 4ARXA 2WIIB 4URTA 1RUG3 4Q4X3 5FJKA 5EIYB 5C71A 4SLIA 2DTYA 4Y5Z0 1HB4A 2R32A 4CPBA 4LHLA 5IK8A 4E9KA 3V0BA 4BLJA 5JIUA 4UF0A 4DMIA 3ASIA 1UXXX 3NQHA 1IS4A 1SPPB 1MACA 4INDA 1PMIA 1LB2A 4D94A 3UESA 3WP3A 1ND3C 1MS8A 3UGHA 2R063 3HAGA 1LOCA 1D0HA 1W3XA 1RXGA 1NE6A 4CXWA 5CYYA 5FPXA 3LGRA 3RJRA 2Q8OA 5G04L 4JVAA 5BNNC 4ZHNA 3FJSA 1WGPA 3VZJA 2WQ4A 3LB9A 1IPKA 3WNPA 4ZZ5A 1T6GC 2AYHA 2NZ9A 2WS92 5L7OA 3NAPB 1UYPA 4MXVA 5HCFA 5IW0A 4DRVA 2HWD3 4RR3B 2WYSA 3H3LA 2PN5A 1WW6A 2CY6A 1QJU3 4QPGB 5FY9A 1IQAA 4BQXA 2QVSB 4A45A 5IK7A 2W1WA 4ZXEA 4CA9A 2XPJA 3PMSA 5A3NA 2VL4A 3PU8A 2ILMA 4KGGA 2RM22 4CCKA 4EN0A 1US2A 5IYYA 3UJQA 1JUHA 4QKDA 1K5MC 3E6DA 2PYTA 3GZEA 5D21A 2FDHA 3R4UA 1WKYA 2ZGNA 4CE8A 2WL1A 5FMOL 3E6CC 2A70A 3IAPA 3WVJA 4AI8A 4D7TA 1BVVA 1R083 4BH9A 3FX3A 1KDMA 3THTA 5I0UA 1CX4A 3EB7A 1W8OA 5H9PA 4ASKA 1DHKB 1Y43B 5F3CA 5FUPA 4AVAA 3WG4A 4IW3A 2BQPA 2WUHA 1J1TA 1PMJX 1IG3A 2RS32 3HR9A 1UPIA 3ELNA 3P3PA 5F6LB 3SCGA 2EAKA 5E16A 3BALA 4ATEA 2A1XA 4XUPA 3N35A 4JV4A 1A78A 1CIWA 2XJQA 2YHJA 1POV0 2B39A 2WFPA 3J8F3 3JD71 2MNGA 4KH9A 5FQ0B 3SKVA 3ZLIA 2DCTA 2F4PA 3AZVA 2R073 2XHNA 4IERA 4OQ9A 3UYJA 3VBSB 4EWEA 3EXUA 2BDRA 1AJKA 3AKQA 3C7GA 4LO4B 4TXWA 4CEWC 4AZZA 4R9BA 4GD4A 2W1SA 4XFAA 2XG3A 3MPBA 3H42B 2RS13 3Q8CA 3ETPA 2E9QA 2BGOA 3KB5A 3K77A 1XU1A 3N4MA 1YO8A 2PFWA 2JDUA 3ATGA 4FFGA 2EAAA 1V6KA 2VTXA 1SACA 3AP4A 4HVOA 4BK5A 3POIA 5A33B 3GM8A 1PVC2 1YRZA 4R4ZA 4XUNA 1AXKA 3AM2A 1W8NA 2Y26A 4I0WB 3B94A 4FI9A 1DLLA 4KMQA 4IEUA 1M4WA 4OI4A 4ASMB 4RQPB 4XABA 3ZN6B 3O5SA 2FQPA 2WZPP 2QDNA 5BNQA 1OC1A 3AMMA 4UI9L 2GN3A 1QXRA 1DGLA 3I49A 1AZDA 2R49A 4WM7A 2RS12 1WCUA 5JPNB 5ABJB 3NRUA 2PHFA 4IGPA 5FBJA 3GJAA 1YJLA 4QX2A 4YM2A 5DZGA 4Y4YA 4NPLA 1V9U3 3MIHA 4NE9A 2VUDA 1SZBA 2OPWA 4HXCA 4XQDA 1LEDA 1R1ZA 2VMDA 4XDOA 3TAYA 2Q1ZB 3D4KA 4RS5C 5FWEA 2Q8DA 1POQA 1UU6A 5DUUA 1G9FA 1HJGA 1YNAA 1BQPA 3WF0A 2RJ2A 4B4QA 2WZR2 3H7YA 5EPAA 4MH0E 3JB4C 3VDBA 4NJ4A 3WQ1A 3OUIA 4AI9A 4AEJA 5K0UC 2W3JA 4UXAA 4CZSA 5H9SA 3R6SA 2FHRA 4LO8A 1H30A 2VW1A 3JBG2 5KXCA 4MADA 5SV5A 5FXWA 2X8KA 3WHUA 1FPN1 2BVVA 1FX5A 5FXZA 2O8QA 5IVFA 1EPWA 1WBLA 3OD4A 1BMV1 4FTSA 3DGTA 3N9NA 4QGMA 5CNAA 4XACA 4YZ5A 5BNPC 4QT6A 4LBMA 5EWSA 1C3HA 3ILFA 3KT7A 4OHWA 4COZA 5F5QA 5IVJA 5J98B 3WT3A 1K12A 2E51A 1PNFA 2VAUA 3DKWA 3P5BA 3B9IA 4P14A 2F4LA 4FPFA 5DZEA 4F8AA 3UETA 1CAXB 5HCAA 2W39A 1FV3A 5GJ6A 3WF4A 2A71A 4Q4Y1 2R071 4HPKA 1IPSA 5LW9A 1BJQA 2JECA 3PIGA 4PIXA 2GH2A 2WFF2 1ZRIA 5FP8A 1D4VB 1H2LA 5LWBA 1AR71 4LE3A 4YG6A 5FPZA 3ZYPA 2H0VA 1FMD1 2D97A 1IQDC 2PHWA 1UW8A 3PHMA 1ONAA 1TMF2 4GH4A 5DXDA 3BIEA 1VB4A 2XGXA 2YGLA 4LIVA 3I3MA 2DFBA 2JD9A 1F35A 1UOGA 1W8TA 1QOOA 1LOFC 4QB1A 2J7MA 5FPUA 1OUSA 4TTGA 2YFZA 4K40A 4Y3OA 3DXTA 2Y64A 4PCRA 4Q26A 4HZFA 1ZZ8A 2JDPA 2BWAA 4TWTA 4IEYA 2IXKA 2XUMA 4QDSA 4LKEA 2WNVC 4QDQA 5FLIA 5KC6A 3EYPA 3PLQA 3PMEA 1OPOA 5FZ7A 2ZJCA 5AFBA 4Y4RA 2EVXA 2JJ6A 4N9HA 2ZHLA 1DQ0A 4JQRA 2HWF2 1IZ3A 5JOWA 1MR5A 1WA6X 2B46X 3VBUB 1ZNPA 2BFUS 3MUY1 4Q4V2 3FBMA 2PXJA 2AACA 3ECQA 1REFA 4UW4A 1LULA 3TOJA 3DYOA 4URAA 1VAKA 4YM0A 5J09A 1MS9A 2F6BA 1JU4A 1H4GA 3J9SA 2ZGMA 4COYA 4Q2FA 5CG8A 1NCRA 1VRBA 3CKHA 4BPZA 4XXPA 2JE7A 4XFGA 1PGSA 3OCPA 3FLRA 1SBFA 3AKRA 2ZEYA 2BV4A 1XYPA 4LOTA 1XSQA 4GXLA 5ANNA 2FMDA 2GC1A 2D3RA 1VPHA 1OXCA 1WD3A 2LW8A 2W5FA 3BOPA 1FAYA 1XE0A 4XF4A 3DF0A 4AAXA 3GCXA 5BNOA 1UO9A 1V0AA 2C9KA 2WA3A 5KXBA 1FOD2 5F2WA 3ZXKA 2KM2A 1U12A 2NMNA 5HPOA 4XJ8A 3CF6E 5I8TA 1ENQA 4CU7A 3U07A 4GH4C 1OOPC 3KT1A 2BERA 3QCWA 1RHI1 5LEJA 5C9AC 1I5PA 2WNUB 2R042 1PZ8A 1CAVB 3GNEA 4UFJA 5EP9A 3V64A 1W2UA 3VHPA 4BQ4A 1C57A 3HOBA 3SCHA 1O4TA 2JEMA 1ZZCA 2C26A 5A3WA 1W90A 5IFPA 3U10A 3MGUA 5FZ9A 1YQ5A 2VOVA 3RZZA 1HXS1 3V56A 3ZFGA 4BQ2A 5IATA 4YZ2A 1ZBA1 3C7OA 4YGDA 3AYCA 2E31A 5C3OA 4YPJA 1N3QA 1BK0A 1RUE2 4YW1A 1GU3A 1YUDA 2D3PA 2GC2A 4XJWA 3DKQA 4I09A 5FY0A 4QXBA 1RUOA 2PQQA 1ND2C 3C7HA 3IDCB 3UKVA 1AJOA 1FMD2 1W2NA 1GZWA 1CWPA 4CRQA 3I59B 4ARYA 1Y7BA 2TNFA 4MG2A 4QPWA 3RZJA 2QKDA 2BWCA 1QQP3 4HETA 5D1IA 3WDYA 1W6MA 1VBD1 3M1HA 2VZQA 5BUVA 4META 3T2PA 3EO6A 2WLQA 2XVLA 4OQ8A 1GQHA 4N90A 3MIFA 2HWF3 2TEPA 3CHXA 2MHFA 4CP0A 1JYTA 3AJZA 3M8LA 2HEYF 1XC6A 5EV7A 1ZRRA 1F5FA 2EF6A 1ULFA 1W8UA 4OULA 2VCAA 1RUJ2 2IXJA 4RSUA 2V72A 1ALYA 1LGCA 3WNOA 3ZVXA 3SEPA 1Y9QA 1QJX1 3ENRA 4AG4A 4GIQA 4NROA 5JXHA 5BNNB 1OLRA 2VO5A 4KBZA 2ADDA 2VUAA 1CAWB 1KD7A 3FLPA 4GWJA 1W6NA 3K75B 1CVNA 2W46A 2I45A 1GOGA 4FO9A 4V1PA 3M3EA 1VMHA 4MZUA 3ETQA 1RMU3 3OYWB 2XBO1 1SLBA 3MDPA 4W8JA 5T52A 2RG4A 4K21A 3WW2A 4BK4A 2CNAA 3H0OA 2XL9A 1TNFA 1U0AA 2XOMA 3Q8EA 3M3QA 2QQLA 4OFGA 5A3LA 2WFF3 5JSPA 2GNDA 3VN4A 5K0UB 1ZBA2 3LQCA 1FOD3 1XBFA 4LHKA 5FTTC 4XAAA 4M0NA 5F3IA 1UX7A 2X05A 1UU5A 2FMYA 5JAXA 1O6UA 1SLTA 1YQ8A 5F37A 4M01A 5FPAA 1CN1A 1RTVA 4RGGA 3T09A 4CCOA 5GZCA 3AZXA 3B01A 4CEYB 1OLQA 4JAAA 2J22A 3UKTA 1Z78A 3GBWA 2VY0A 1LECA 3IWZA 4DXRA 4IDZA 1XNTA 4FVVA 1JXNA 3IB3A 4AVVA 3VL8A 5CFCA 3OGRA 1YWKA 1RUD2 4BQWA 2NM1A 1PZ9A 2VZPA 3MIEA 3S57A 4PLNA 5I91A 3ZYGA 2RDRA 4F3JA 3JBG3 1N1VA 4DS0A 1Q8OA 2IWGB 5A3PA 2ZACA 4Z8BA 2ZGSA 3NJZA 4QHZA 3Q9OA 3AMHA 3NAPA 4YZ4A 1WLWA 4FPOB 3J7LA 3UT0A 2BNNA 4JGZB 4S2GA 1GOHA 1S0DA 3VKLA 2GC0A 1JYXA 3FE5A 1NQDA 2HWC3 1OURA 2OYZA 4YGBA 1VBE2 5GZDA 1I6XA 4IEZA 3POSA 5LK5A 4BHPA 4Q0PA 3UK9A 5CKQA 1SFNA 5JVVA 1U5XA 1W0NA 1R091 5LBFA 3WY6A 2VNRA 3IDAA 4QXCA 1U5YA 5IVVA 3WX5A 4BIFA 4CDWB 2DYCA 3UGGA 1QH6A 1DYOA 1OT5A 5J3UA 5A80A 4YYOA 3BYWA 2ZX0A 3I2HA 1W2AX 2ZHMA 2C6SA 2OZ6A 3WP4A 2QQPA 2VBBA 1W39A 2WC2A 1XE8A 2HKXA 2HWB2 1C8NA 1HQWA 3M3CA 5DDJ2 1PMHX 5ABJC 3VV1A 3KHBA 5DAXA 3FHQA 3D82A 4I0AA 1RMU2 2ZKNA 4AHYA 1DZRA 1QJFA 3OPWA 2BP6A 4JDOA 2CGNA 5L19A 1WD4A 5JMOA 4YW5A 3RJ2X 3S5AA 4UW6A 1VAMA 4L99A 2D5HA 3QH7A 3VDDC 3AZYA 3BN6A 3ES4A 4N9IA 5J36A 3HVDA 2HYXA 4PDWC 4TSVA 1KJRA 3RWNA 1D4M1 4O9GA 4DY3A 1RHI2 2WT1A 3SLIA 4PBOA 1UN1A 4N7UA 2RM21 5FYZA 3WCRA 4ZS3A 4XF1A 4DUXA 3V0AB 1LHWA 1G86A 2RR13 4Q0VA 1PO13 1RL3A 3KCXA 4COUA 4O9EA 1I3HA 3S7IA 4LEJA 5L7OB 2JKBA 2VQTA 1UZVA 3KLSA 1F4AA 4NPRA 1QJX3 4B8EA 5KHGA 1JODA 2IFWA 3OG2A 4QHOA 5KR7A 1PIV1 5FUNA 5I0TA 1KITA 4Y5TA 4EZ4A 1CAXA 2IXIA 1VR3A 4CU6A 3I8TA 1GR3A 1HQLA 5I0DA 2ZA9A 2ZEWA 3C7EA 3U11A 4MGIE 1I1EA 4M3CF 3LEIA 5B2GB 5FZ4A 3ITQA 1QNWA 3NV2A 1H6XA 3POFA 2VZ3A 3T0AA 1KS5A 2CWMA 3PURA 4XQWA 4NO4A 4IEVA 4WV8A 3MPPG 3PUIA 4HLTA 1RUH3 4RHV3 4UFHA 4QPYA 2F17A 1V6MA 4NHYA 1SHWB 1MQTA 5FYYA 1AXYA 3R4DB 2JE9A 5D2AA 4JX0A 4Y1XA 5CFCC 1RUC3 1JOPA 1C8M3 5FP9A 3GDBA 1RUF2 5LRSA 1UPSA 4XFIA 4DXSA 2IC1A 3ZFGB 3VBFA 4DO0A 1UZYA 2YDEA 2DCZA 4IV3C 4AQSA 1O7FA 1S2KA 1OUXA 1S0CA 2DURA 1UIJA 2W47A 3S30A 3ZSEA 5F39A 1O3SA 3A4UA 1QJU2 4YW4A 3DYPA 1HB3A 2Z2SB 1TMF1 3D8CA 4N53B 3WF3A 3J4UH 5C33A 2HWD2 1Q3EA 2OQ7A 1UNBA 2BOIA 2JG9B 4QQPA 1HDKA 2BYVE 5E6HA 2BGCA 3ORJA 3K4DA 5JI9A 1POV1 4LLOA 1IS6A 4D3WA 4PLOA 3J7NA 2HWB1 1O3QA 3H9AA 1UYZA 2CAUA 1E5IA 1F9KA 4NHLA 2D6NA 4WM8A 2OA2A 3LCPA 4ZONA 3CJIC 1S2EA 4I0BA 4MXWA 4R4XA 4IETA 1RJ8A 4JHZA 3M7AA 4QX7A 4QX8A 4YLZA 3I4IA 3LE0A 3WEZA 4EN9B 2ZAAA 5F3EA 4AI0A 4ISRA 2DUPA 3VBRB 1WUVA 5K9YA 2EXHA 1HRI2 1PVC1 5LZ6A 4IE7A 3BODA 2XDVA 4XF9A 4YFZA 3MZHA 4IE6A 4CUCA 1VMJA 2FDIA 3ZFFC 5LEKA 4XDPA 3HQRA 4DIQA 2HWC2 5JMCA 1PIV3 5D8AC 1NCRC 3I7DA 3U75A 4A44A 1S0EA 1QJZA 1VP6A 3CBNA 4GB33 4BISA 3DYMA 5FDBA 1BMV2 1ND2B 2Q5TA 2XB6C 1KFXL 2UWCA 3OBTA 1EV13 1O8PA 2H0BA 3E5XA 3S5QA 1X8EA 1LAJA 3GBFA 4QD2A 4EROA 4HL0A 4CUBA 2BTVC 1U5IA 5DABA 5AC93 5C6CA 2NPIA 1BCXA 4FSJA 3VD4A 3O12A 5FK7A 4LHNA 5EJ1B 5T5OA 1OFSA 2P34A 1OQDA 2VH9A 1OH3A 3FHIB 4QX3A 3SH3A 5LA1A 3LDRA 4YVSA 4A7KA 4D69A 4WM8C 4MOAA 1G7YA 3N7LA 4BMBA 1KFUL 1AR82 2R041 3BKZA 4UBGA 4XCBA 3VBUA 4LKDA 2PHUA 4H7MA 3ACGA 1C5IA 3USUB 3J26N 4L9BA 5LY2A 3W58A 2CYFA 4UAPA 1COV1 1W3VA 3KMHA 4GJZA 2MPFA 1DBNA 1DGWX 1LESA 2LTNA 3MW4A 1Q56A 2MEV2 2ZPXA 4LO5B 4NN0A 5EXOA 3ZOIA 1RVF3 2PQSA 3DN7A 2YB7A 5FYVA 1FPN3 3PIJA 4YVSB 4RGKA 4E8DA 2Y33A 4MHRA 3VBFB 2HLEA 1J3PA 3N9PA 1MEC2 2N7GA 4XFHA 1W9SA 4GH4B 4HSJA 5FWJA 4XUOA 3VKFC 1V6JA 1Y3TA 5LK7B 1RUJ1 3FUOA 2J42A 4O65A 3KQRA 2VOKA 2HJIA 2VMCA 2X5IA 1E57A 3HNBM 4JGZA 1LOGA 3UL2A 5CVRA 4FP3A 3NMBA 2IVJA 5FZOB 1HRI1 1F5JA 2WO2A 4GA9A 4MVTA 1W6PA 1OF3A 3PDQA 3VB9A 4U2AA 3O1UA 4OHZA 2G9FA 3TRSB 2DVBA 3LA2A 2W2IA 5A32B 3WZ1A 2E32A 4ZKTB 3TWIA 1UZZA 3ZM8A 3PNAA 4AVBA 2PA7A 1SG3A 3ZFFB 5FYMA 2YC4A 2QDRA 2W91A 4AFDA 4UF0B 3RZGA 3AMQA 3FHAA 5LASA 4CEYA 2AR6A 1JZ5A 4CXXA 4M4PA 2EIBA 4OZOA 1UL9A 1YJKA 1H8TA 5C4WA 5F9TA 2YROA 5JZGB 1XYNA 4XAEA 3CEWA 5E89A 4JGYC 1PGL2 4Q0UA 1V6LA 1RC6A 4IE0A 1MS5A 3QOPA 2ZOEB 2E7AA 1FI2A 1O4YA 2VVDA 4NWVA 4PIZA 4LK7A 2RV9A 5LY1A 1GZ9A 5K0UA 1LODA 4QM9A 2P5BA 1JYIA 4LA2A 4A4AA 1GLHA 4CCEA 2AGSA 3C7FA 2LROA 2ZX4A 1ENRA 4K1YA 4LBOA 4XEZA 1B09A 4XFBA 1NQJA 4RFRB 1IG0A 1K5MA 3LFIA 2B4KA 5FOBB 2J1UA 1UKGA 2VVFA 1JBCA 3T4VA 1M06G 1PGW1 1COV2 1JH5A 1W6NB 2ZEZA 4LBQA 1W06A 1ACCA 4FQ4A 4XC9A 1JYVA 3OY8B 3NKGA 4XF3A 4XYXA 1DQ2A 5TSWA 2PMWB 1MS3A 3OEAA 1ND3A 3POJA 4ISQA 2RJKA 3PTYA 4D8MA 1TNRA 2GMEA 1DYKA 2Y6FA 4A3ZA 2ZS6B 3MIDA 2G9GA 5JXIA 1MEC3 5BNPA 2WT0A 4LBJA 1GFF2 4W6XA 3VLBB 4UFLA 4ZY9A 4UBHA 4C8DA 1WLCA 1FPN2 1NT0A 3I2DA 4DY5A 3CZJA 4ES9A 2R061 2YXSA 3ZN5A 3KSCA 5J48A 2HWE1 2Q0AA 2FZ1A 3PUSA 4YVWC 1QMJA 2QQOA 3TN91 4UW5A 4CEWA 3ZXGA 5HV0A 1X33A 3GZUC 2PLV2 2ZMKA 3D5OA 2TUNA 3O0XA 1LHNA 3LDKA 5KHKA 4DZGA 4BQ3A 3ZXJA 4NPMA 5FP7A 3LFMA 3HWJA 2A3YA 1YI9A 4OMCA 4XBLA 2ZCWA 3KVAA 1CJPA 3IMNA 1X82A 4K6BA 5EJ3A 5IAVA 1OI6A 1ND3B 5DAVA 4A2UA 5AVPA 4P9IA 4PHZA 2GNMA 5G05L 1DZQA 1E5RA 1W6MB 2JG9A 2WDBA 3D0SA 3ZXFA 5L9RA 2OX0A 1XSRA 1R082 3WQ0A 1MS4A 2ZHNA 4KU8A 3BTAA 4TYSA 5C8CC 4QGLA 2HBUA 2D6PA 4P02B 3E6BA 2B5HA 1NA1B 4DINB 2QNKA 3JQWA 4XMIA 5JCTA 2SLIA 3WG1A 4GKYA 2VE1A 1RUD3 2W92A 3WF1A 4E8CA 1R081 4AR2A 4YFWA 2P6HA 2OXBA 3JD73 3RDIA 3U4SA 4LOSA 2R1DA 2VOWA 4QAWA 2YU1A 4LE4A 1W6QB 1ASJ1 4EN6B 5H9QA 2XMLA
chains in the Genus database with same CATH topology
3GF6A 4KL1A 2DCYA 5GZFA 4ORFA 3ZDSA 1GKBA 2I07B 5ACA1 1VRH1 2WNEA 5L7OC 1ZX5A 4S2HA 1RUI2 4FPCA 1HIXA 4FTEA 3OGJA 1CAUA 1GYKA 4QPIB 4XETA 3VBSA 4I2OA 4KNCA 1IKPA 4KWLA 1AR81 3USSA 2O0OA 1ZZ7A 4AVSA 2WINB 4Z92B 1MS1A 5JDBA 4CDXA 4RR3A 3PVBB 1B35A 1D2QA 2RS53 3VDDB 1ENXA 2OUHA 2Q4SA 4NR1A 1X36A 2WJSA 4D7YA 1W6OB 3ZSJA 4P9YA 4M3CA 1AYM1 2A3WA 3CNAA 3TNPB 3V0AA 2VPVA 2VGDA 4N43A 4QHBA 4X8PA 4QGNA 1AX1A 3LSEA 4JGYB 4Y1ZA 2C5DA 1HX6A 4XBNA 4I3PA 2DCJA 4FP2A 4R9CA 5BNPA 2XKOA 2HWC1 1GZWB 3HBZA 3KCCA 3P3NA 4AEDB 4KG0A 4ASLA 4CDUC 4AHWA 3IIAA 3WW3A 1BEV1 1TME1 4N53C 1PO21 3WDUA 1YFWA 1SDWA 1DGRA 4PQ9A 3GZAA 1A3KA 2RM23 4LUMA 3WP5A 1O91A 2WSVA 4AEDA 5DDJ1 1RUE3 2K0GA 2GSYA 4E4DX 5HXVA 3ZXDA 1C28A 4RS5A 1LU1A 4L97A 1EV11 2ZMLA 3WR0A 2XH6A 2ES3A 3ZYRA 3MFAA 1DGRN 2ET7A 3FUQA 3PVEA 1AYN2 2IXCA 4M3CB 1ZBE2 3MIGA 2EXIA 4LBKA 4LT5A 4RR3C 3CJIA 3VKMA 3MFCA 5FMOS 4HFSA 4LA3A 1NOVA 1LGNA 1WMDA 1GICA 1KJLA 1F8VA 3VUOA 1D0GA 1G6NA 5JI7A 1RUI3 3M2MA 2UY8A 2XVGA 5BXXA 1NCRB 2CGOA 1AYN1 1Z0HA 1N47A 2EA7A 1SFYA 1MVQA 1NCQA 5CIRA 4YGCA 1J3QA 1X50A 1AR83 3U0ZA 2R062 4N7IA 4BYYA 2NQYA 4HVQA 1NA1C 1OQ1A 3H3ZA 1PHMA 4A3XA 4Y20A 1A6CA 2JX9A 3OPZA 3ME2A 5FAXA 5I93A 5EFUA 1VBA2 2HYKA 4QQHA 1PGW2 5F1RA 4LBQB 1DFQA 1I5ZA 2WLPA 1ZM1A 1QNYA 1CR7A 3MICA 2VQ0A 1K5MB 2D6MA 1OPMA 3RMXA 3RI9A 2WNUA 1ZA4A 1X7NA 3NW4A 1AL22 1S55A 4RD7A 4P9WA 1OMIA 5GKAC 2ETEA 1ASJ2 4Y22A 2D44A 3WD5A 5T3NA 1VBA3 4CP1A 2JG8A 1MVEA 4I02A 1XXNA 2QCSB 1CQ9A 1AR63 1OA4A 2NP0A 2GMMA 5KXEA 4Q0QA 1WMEA 2B42B 2P3KA 2P3IA 2RMU2 3ZIXA 4JDMA 2SBAA 2P3JA 3LZZA 1RUC1 1ULDA 3JB8A 3K48A 1QF3A 5JSOA 5JR7B 4MGKE 3HT2A 5GLZA 3N7MA 4M3CE 4FPYA 2DU0A 4IESA 1RUI1 2Y0IA 5C9AA 1LR5A 4AW7A 1IGOA 4JTNA 1RUG2 5JLVA 1YFXA 1RUF3 2PLV1 5T54A 3WW4A 4RQPC 3ZYIB 4L11A 4Y1UA 4OI2A 4KGQA 2XJVA 1F31A 3AYEA 1UU4A 4MSVA 2H6BA 2PHDA 4YZ1A 4QPIC 3MW3A 1QQP1 3SXWA 1WCDJ 1XRUA 5CAZA 3H1WA 2C1FA 1LOEA 1W0OA 5FRAA 1G9DA 2IFRA 2WZR3 4Z1VA 3BIWE 2ZAHA 1LOAA 3VBHB 5C4WB 4RL7A 1IKQA 1D4M3 1S0BA 3NV3A 1FNZA 1NCQC 4IQPA 5KBFA 5J37A 3IPVB 4Q4X1 1GV9A 4DNYA 4NWWA 5KWRA 1BBT1 5J7MA 3EBRA 3ZXEA 2KA3A 3RYPA 1PM7A 1W6PB 2ET1A 3RI8A 4EWAA 1OSGA 3KCYA 1ZYBA 3WINE 1H0BA 4BOWA 1QDCA 1OD5A 1J58A 1UMZA 2DCKA 4AFMA 3RNSA 1O4ZA 1XU2A 2DVGA 5BNPB 1YCIA 1RUG1 4AQTA 5KHIA 4Z2WA 1HW5A 4KWKA 4CP2A 5IUQA 1FV2A 1ULGA 3M4FA 4BCUA 3LOBA 4PBPA 4XF0A 3HT1A 4QM8A 1H2MA 4QX5A 4N43C 5JOZA 1VIWB 2CGPA 5E1RA 1RUC2 3AKPA 5L36A 1QJY1 3ZFEC 3O0VA 5BNOC 3BPZA 4WVVA 3VL9A 3VZLA 1RUH2 4Y26A 2E6VA 4JRLA 1RB8G 1RMU1 5GLVA 1OOPA 2A75A 2JD4A 3MEPA 2G4IA 3IDBB 2MEV3 2RS33 4GKXA 2ZABA 1S0GA 1DG6A 3EHKA 3VHNA 3RPQA 3POWA 1YHFA 3MLJA 1AL21 4JC1A 3AMNA 3MIBA 1D2SA 3S0MA 3HN1A 3R05A 1H2NA 1KS4A 1AX2A 1MQTB 3SHRA 1HKDA 2EXKA 4ITCA 5CADA 1R1A1 5C4WC 4Q4Y2 1V70A 1RITA 4AI2A 2X53S 1C1LA 1YYNA 2XBO3 4CDWA 2RJLA 5DUWA 1NXMA 1C8M1 4L92A 4KU7A 4E2SA 1CAWA 2XJTA 2R6QA 2VW2A 3AP6A 1J59A 2B7YA 3VBRA 3AKSA 1JW6A 3J8F1 3AP7A 2WNVA 5L73A 2VQAA 4MXWB 4WZCA 3V65A 1H1MA 2XKPA 3S6PA 4XTPA 2ARXA 2VXRA 5HI0A 2Z79A 2X29A 5BV6A 4Q1PA 4NOTA 3ZO0B 1BBT2 2A73B 4CDUB 5ABJA 2XLFA 1SLIA 1ASJ3 1DIWA 4AE2A 3BOWA 4FPGA 1VBE3 1ZBE3 3DPRA 1COV3 3VBHA 3LWCA 2KXLA 2D93A 1IPJA 4BMEA 3UKNA 3HMYA 2Z5WA 5I0SA 3AX4A 4JCKA 4QPGA 3VZMA 4MX3A 4S2FA 4PLMA 2D6OX 1QGLA 1H8TB 2WT2A 4EV0A 3NWKA 4U36A 1GNZA 1JUIA 1AL23 3ZSLA 2PHXA 1XNKA 1V9U1 1Q43A 4OUSA 4YVSC 3TNQA 4YM3A 1KXGA 1YIFA 2GMPA 3CU7A 1PO11 1YI7A 1DZTA 3AP9A 4Y24A 1SCRA 3ZMOA 4AGVA 4OHXA 3MLLA 2E53A 1VB2A 2I74A 1DYPA 2ZMNA 1CPNA 1DU3D 2UWAA 1ZRCA 1PO12 5BYNA 4LBQD 2C9AA 3PJQA 4J1WA 2WA4A 3B69A 2ZGQA 4L2NA 1UIKA 4R8HA 2XJUA 3ZFFA 4AVCA 2Y38A 3ZXLA 2ZX1A 5A32A 3W59A 2GU9A 4XTMA 5FQ0A 1JOJA 1TME3 2HEWF 1CGPA 1WCSA 2YZ4A 5F6KA 4P9LA 5LRRA 3I59A 3E5UA 4LULA 1NE4A 3RS6A 4IXLA 5JOXA 3RMYA 1EYBA 1OFNA 3PVNA 1OKQA 3VBFC 4HKWA 1QJU1 3QBQA 1RVF2 5DDJ3 1KRIA 2QJVA 4RFT0 1CPMA 5AVAA 1LCLA 2DVAA 3B7MA 4AI1A 4BA6A 4EWDA 3BB6A 5C8WA 1ULCA 5KC5A 1AR92 2A6WA 4GWMA 3WCSA 2Z69A 1PO23 4W6YA 4E4ZA 3OYWA 1WCKA 1NY71 5CA6A 4XOGA 2JICA 1EAH3 3POYA 1S0JA 1DQ4A 4IV1A 4B29A 5A3MA 1BXHA 2D43A 2PHLA 3O0WA 4C1XA 4JGYA 1CESA 1QOSA 5DG2A 1QXPA 3AZZA 1QU0A 1XE7A 2P37A 3IN9A 3KS7A 3ES1A 4XPVA 1ZRFA 1RINA 1LJ7A 1LU2A 3NKTA 3WG3A 4YSFA 3RRDA 1GANA 3R4SA 1YLLA 4CDQA 4YM1A 1ZVFA 5C8CA 3THPA 5GLUA 3SH5A 1NCQB 1V6OA 2UY9A 4C90A 1BEV3 5GALA 1VBD2 1POV3 3AYDA 5HCBA 5CFCB 4OI1A 4ES8A 2ZGOA 2H6CA 2DUQA 4EJRA 3KT4A 3VDDA 3TYJA 4MV2A 1O3RA 2VU9A 3K51A 3WDTA 3GYDA 5H9RA 2B45X 2RS52 4HK9A 3O14A 5FO7B 5AC91 3AZWA 1LRHA 2HWE2 1WA4A 4XJUA 2WWSA 3E97A 1S2BA 3LKJA 3LA7A 1FYUA 3MF9A 4YVWA 1BK1A 3OF1A 2LUWA 1DF0A 3VBSC 1RUD1 3AXDA 4A7YA 4F7ZA 3WUDA 3RYRA 1B35C 2O8OA 4IEOA 3PVOA 3AP5A 1GQGA 4K8FA 2XL7A 3WQ7A 4FPLA 2DF7A 3GHNA 4FPHA 1SLLA 1BEV2 1HRV3 4Q4Y3 1ND2A 1VBD3 1OQEA 1Q8VA 5CFDA 1RVF1 4Q29A 4LO6B 4RGAA 2PAEA 3E5QA 3ZXAC 2ZTNA 2A6ZA 4KQ7A 3ZN6A 1WW5A 5DUXA 3KGLA 4IV3A 4FQZA 3DL3A 4IV3B 5GZEA 5IK5A 4RA0A 4QMAA 3B02A 1AVBA 4AHZA 3N7KA 4DQAA 2I2SA 3GALA 3BCWA 1HRI3 1UAIA 4WM8B 3WOGA 1SMVA 3SH4A 4QPGC 1CD3G 2UWBA 4AGRA 1QH7A 3SISA 4SBVA 4FTBA 5JOYA 1N1YA 4CEWB 4GWNA 4H7LA 2YV8A 4GMP0 1MZEA 3VHRA 1IOAA 4WM7C 3U4XA 3VKNA 1Z7S1 4JGZC 4FOYA 4FOVA 2OIIA 4WVMB 2DVFA 1AR61 1H9PA 3AJYA 2HWE3 3CLPA 3G7DA 5FBZA 4KWJA 1EPZA 1N1TA 3I54A 1PVC3 3URFA 1ULEA 3SNMA 2VNGA 3FWEA 2OZJA 4FT8A 1V6IA 3DPRB 4HMZA 2RMU3 5T5JA 4WBBA 1AR72 2R1BA 4HSLA 1AYN3 5BY5A 1RUH1 4P9XA 5T50A 2R072 2XVKA 1G9BA 2GNBA 4H3WA 1JHNA 4XILA 2VVEA 1MZFA 1KQRA 2FZ2A 1TQ5A 2ZGTA 4Q4V3 5BNOB 4XBQA 3B93A 3WV6A 3ZN4A 4LUKA 4Q1RA 1GZCA 4CDXB 1LENA 4XZPA 4FXKB 4BM8A 2A6YA 2YY1A 4AI3A 3T1MA 4FOWA 5JZGC 1NG0A 1Q8PA 2E7QA 2NMOA 4Z82A 4G4FA 1RUE1 5CB7A 2VECA 4MGZE 4XDQA 2BEOA 4CTEA 3ZFEA 1WW7A 4GB32 2MEV1 4GMP3 4CDQB 1AF9A 1VRH3 1BYHA 1REDA 4C0HA 2PAMA 4DFSA 4OZXA 1IS3A 4G9SB 1VAVA 4HN0A 4IV1B 2GDFA 1MZ6A 4OUMA 4RS5B 4BQ1A 3LSDA 4HKLA 4COVA 2A6XA 5ACA2 3VZOA 4KBBA 4Y1YA 4AQ6A 4GULA 2WQZC 2RR11 2QZ3A 2RHPA 3NV4A 1S1AA 4K1ZA 1Z7S3 1ZZ6A 2GN7A 2K2SA 3D0JA 3T1LA 1VLNA 5KC6A 1AR62 5DUVA 1ZRDA 2UU8A 1SLAA 4Q4W3 2AZ5A 3LA3A 4WVMA 4K7JA 4X6RB 5GM0A 3S7EA 2RS51 5AC92 3ZPYA 2LALA 2WNVB 4OHYA 1PZ7A 2ERFA 4XIOA 4XHXA 5JSRA 2LM3A 3N36A 1RJ7A 1UKRA 2JXAA 2PTMA 3WHTA 3VBOB 1TE1B 2GZWA 4MGYE 5I8SA 1VBB3 3KM5A 2DU1A 3IKWA 2HWF1 2W0XA 3ZIWA 5FO9B 2B9UA 4AHXA 4GMP1 5T5PA 2A7AA 5C9AB 2JDZA 1AHSA 5EZWA 4XJAA 4AGGA 5DG1A 2CL2A 2JG8B 4FPJA 3FMGA 3T2TA 3VKOA 4BE3A 3INAA 1MEC1 3N3HA 1DQ6A 1YIPA 3TN92 3WP6A 1PIV2 1G9AA 2WS93 3QLQA 3OY8A 3B9CA 3WLUA 5KHJA 4IL7A 3MLKA 1AXZA 4N53A 1PO22 2V5YA 4FAGA 3WG2A 1NY72 3A0NA 1NZCA 3JQXA 1Q8QA 2RR12 4AXOA 2CTVA 1LOFA 2VULA 1BVP1 4EN8B 1OA3A 1LHOA 4DXZA 2A5ZA 5BNNA 1L3JA 1AR73 1QJY2 1ENSA 2FBEA 2PELA 1AX0A 5FCCA 2HEVF 2VMHA 1GSLA 4PDWA 2EALA 2GNTA 3H50A 3UJOA 2IXLA 2ZKLA 3X29B 4LNVA 3D6EA 4HT1T 2DVDA 4CDXC 2VOXA 4GB31 4Z07A 1RUNA 5CG9A 1QY4A 1LEMA 3CJXA 3NSTA 4KG8A 1DQ1A 2W68A 3ILNA 1DGWA 1KDKA 1J3RA 1JTZX 3KD4A 4XXAA 2ZZJA 3OD0A 4BZ4A 3H7JA 1VBC3 4K20A 2GC3A 2X5IB 4J1XA 2YPJA 2UYAA 4YW3A 3ROUA 2EIGA 3VBOC 2R0HA 4FPEA 2D5FA 4COWA 3QD6A 1VBC2 5KXDA 1OA2A 1QDOA 1VBB2 4M00A 1H1IA 4BWOA 3H8UA 1APNA 5CFDB 1EAH2 1IS5A 4CEYC 1MZ5A 3VHOA 4AF9A 4E4SA 2Y0OA 3IT8A 4D7SA 1EAH1 3GHMA 4OVEA 1HRV2 2BNOA 2BUKA 3AKTA 5H9QA 1GBGA 1RHI3 1TME2 1XYOA 2RE9A 4FAHA 1G9CA 1Z7S2 3AMPA 1F2NA 2V09A 1N3OA 3ACLA 3MYXA 4AFBA 1HLCA 4XFFA 1AYM3 2ZGPA 1VALA 3FFZA 4R9DA 1ZBA3 4B3NA 1YFYA 3SITA 1NXD1 1DQ5A 3A0KA 2D98A 3J8F2 3EJKA 4CDQC 4AYUA 1N3PA 3SCFA 1FATA 4CDWC 3WUCA 5EYXA 1H2KA 2OVUA 3AFGA 4G3YC 5FFOC 1SEFA 3AXEA 1RIRA 3M70A 4Q4W1 3VBOA 4Q4V1 1SLCA 1O3TA 3WNXA 1DDLA 1R1A2 3B3QE 3KGZA 3O7OA 5EYYA 3LOIA 2CWSA 4AEDC 1NYWA 3JUUA 2DFCA 4AWDA 1B35B 3NO8A 4IEQA 4L8QA 5FREA 5K7PA 3H1MA 3ZMNA 3PJYA 5T5LA 4FBFA 3BU7A 3HIFA 4RHV2 4LBNA 3HD8B 4DPNA 2QZ2A 3USUA 2AENA 4XW3A 5FLJA 2XWJB 4W6WA 3ZFGC 2BBVA 2R30A 4YG3A 5K8SA 2YYOA 1REEA 1FMD3 4Q8KA 1V9U2 2P17A 5I8YA 2A3XA 2QFEA 1C4RA 3MW2A 3DPRC 4ONUA 1TMF3 5D8AA 2DUOA 4P5HA 3FBYA 2JENA 4I3GA 2WFF1 1PK6C 2VG9A 5JPMB 3N7JA 1WMFA 4HKOA 1QJX2 4BIOA 1R093 1VBC1 4XJZA 4B7KA 1EY2A 4P9JA 2GH8A 2JG8C 4MUVA 2D3SA 3LAGA 2Q1MA 2D6KA 4IEWA 3AYAA 2X5IC 4BLIA 1H1AA 1NLRA 1JN2P 1YXWA 5IK4A 4IEXA 1VBE1 3FFQA 3FLTA 2CV6A 2GAUA 3GBGA 1LHUA 3CJIB 1XQNA 4B4RA 1ZREA 2HWB3 3OBRA 1CJDA 2D6LX 1EV12 3QH6A 2RMU1 3AB0A 2NYYA 4A7ZA 2OUJA 2DV9A 2O1QA 4AFAA 3HQXA 4AFCA 3NAPC 3AK0A 4H55A 1R1A3 3EQEA 3IM0A 3H1YA 4HANA 5JWPA 1A8MA 1ZZBA 2IZWA 1LHVA 4C0BA 1CAVA 1AR91 2XHKA 4X8NA 2PHTA 3APBA 4PDWB 1Q8SA 1QOTA 2Q30A 3C2UA 4C91A 2AH2A 2RS11 4ZU4A 2ZBJA 3WDXA 1PNGA 2A6VA 4RHV1 4XQ4A 4Y20B 4PJYA 4E2QA 5A33A 1V00A 4I01A 1HV0A 3AFKA 4AK3A 1QWRA 1SBDA 3B00A 1PGL1 5D8AB 1BZWA 2VUJA 2W08A 4WZFA 2E7TA 2UURA 4JTOA 1VBA1 3SMHA 3M3OA 3MI8A 4RQPA 1AYM2 5I0RA 4S2DA 2WSUA 1O5LA 1URXA 3CO2A 4AEKA 1WBFA 2XLAA 1ZZ9A 1QJY3 2VNOA 4QQOA 1LKNA 1RGSA 2XJPA 3JZVA 1C8M2 5C8CB 5BPXA 3V0BB 2K9ZA 4J6GA 3H3UA 4NHKA 3VBRC 3OJBA 4DOUA 1N1SA 1R092 3IBMA 1X8MA 3DV8A 4JDNA 3VZKA 2OPKA 5KHHA 3OTFA 2RS31 4NVPA 1A8DA 4HN1A 4ZXKA 3M3IA 1WLTA 2ZX3A 2EXJA 5GLWA 4YNIA 4YARA 1IHMA 2OW4A 2D40A 2DWRA 2W52A 1LGBA 1EP0A 2PAKA 2HWD1 2C0ZA 2CAVA 4LTAA 4XE9A 4I30A 4TZDA 4GQ7A 1HXS2 2ARBA 1RUJ3 1MS0A 4XHBA 4C1WA 3FZ3A 4HK8A 5AFEA 4LR4A 2BW8A 3MF6A 1HQNA 4WVWA 3TB0A 5FO8B 4K3UA 3VBHC 1V6NA 1AUYA 3ZFEB 4OLLA 2XLGA 3ZYJB 2V73A 4R52A 2DTWA 4FCAA 2NN8A 4QXKA 4FPKA 4XJ9A 4LO7A 1C5HA 1QHDA 2BFUL 1BBT3 1I9RA 3NV1A 4XFCA 5JIAA 3L2HA 2XJRA 4MLOA 2ZGKA 4JRAA 4FXGB 4N43B 4YW2A 5E8AA 4E27A 1JYCA 4FOQA 3UV9A 4XMAA 5SV8A 3WXPA 1J1LA 1W6OA 3L9JT 1FOD1 5E88A 4GALA 3TBDA 4UW3A 1U5ZA 4F83A 2IXHA 3JBG1 1UCXA 4CYDA 4E2GA 2NLRA 1OHFA 2VMGA 3JU9A 5T55A 4AEMA 4M0HA 4ATFA 4AQ2A 2BPA2 1WW4A 2D7FA 1BKZA 1NLSA 2YC0A 3WW1A 2WZR1 2R0FA 4IEPA 1WLDA 3RQ0A 2YGMA 3WDVA 4QU2A 5CBLA 3ST7A 4Q4X2 4Q8LA 4PIYA 3WDWA 3JD72 1MQTC 1W6QA 2WKKA 4X6QB 4B4PA 1W0PA 4OI0A 2UYBA 1HV1A 3W9AA 1UF2C 1S0IA 1CAUB 1XNCA 4QPIA 1LTEA 3RG0A 3VBUC 2BVBA 3NVCA 3NL1A 1HXS3 3IPVA 1TEIA 2E63A 3FC0A 4WM7B 2ZZQA 3G6JB 4YGEA 4W65A 2ATFA 3ZX7A 1QXJA 1H9WA 2XWBB 1SQ4A 3ILRA 3QACA 1H4HA 4QQLA 4HVRA 1UX6A 3CL1A 5J96B 5DZFA 5JZGA 2VMIA 4DRRA 4LLFA 1AR93 1NA1A 5CFDC 1RUF1 2PLV3 4HPKB 1VJ2A 1Q5OA 2ZGLA 1O5UA 1AL0G 3VGIA 2GALA 2QE3A 4ZU7A 3ALQA 1FNYA 1PK6B 1LOBA 4R9AA 4YRDA 1PK6A 4YZ3A 1S0FA 2WS91 4LBLA 5HBAA 4H14A 4Q4W2 2XJSA 4Q0SA 4OHVA 2ZX2A 2TBVA 4EN7B 3GZTB 3B5LB 4YG0A 1CONA 2QUOA 4Y1VA 1GNHA 4DB5A 1G8WA 3ZSKA 2ZGRA 1FT9A 2VW0A 3RSJA 1SBEA 1VRH2 2Z42A 1H8TC 2BNMA 2P2KA 2ZGUA 4P9GA 1SCSA 5ACA3 5IT6A 2YUEA 3C3VA 4NHMA 5CU1A 1PVXA 2B8MA 3L2YA 4ZU5A 4MYEA 1ZBE1 1H8VA 4WVZA 3ZSMA 1D4M2 2JG9C 3KZ4C 4Y22B 2XBO2 1XNBA 1OOPB 4XIKA 1C1FA 2ZHKA 1XNDA 3TN93 3OGGA 3JCIA 5GZGA 2ENRA 5FLHA 3R0RA 1HRV1 1QKQA 2WNUC 4TLFA 3IDEA 4IV1C 5FOJB 3RYKA 3DUIA 2PHRA 4B7EA 4HBNA 1QQP2 1VBB1 1UD1A 2R16A 4CDUA 2AUYA 2YMZA 4PF5A 1YFUA 4YVWB 2AREA 1FXZA 4QQ2A 4AVTA 2R043 5GLTA 4Q27A 4K9SA 3VZNA 2WIIB 4URTA 1RUG3 4Q4X3 4SLIA 2DTYA 4Y5Z0 2R32A 4LHLA 5IK8A 4E9KA 3V0BA 4BLJA 5JIUA 4DMIA 3ASIA 1IS4A 1MACA 4INDA 1PMIA 1LB2A 4D94A 3WP3A 1ND3C 1MS8A 2R063 3HAGA 1LOCA 1D0HA 1NE6A 5FPXA 3LGRA 3RJRA 2Q8OA 5BNNC 4JVAA 3FJSA 1WGPA 3VZJA 2WQ4A 3LB9A 1IPKA 1T6GC 2AYHA 2NZ9A 2WS92 5L7OA 3NAPB 4MXVA 5HCFA 4DRVA 2HWD3 4RR3B 2PN5A 1WW6A 2CY6A 1QJU3 4QPGB 1IQAA 2QVSB 5IK7A 3PMSA 2ILMA 4KGGA 2RM22 4EN0A 3UJQA 1JUHA 1K5MC 3E6DA 2PYTA 3R4UA 2ZGNA 2WL1A 5FMOL 3E6CC 2A70A 4AI8A 3WVJA 4D7TA 1BVVA 1R083 4BH9A 3FX3A 1KDMA 3THTA 5I0UA 1CX4A 5H9PA 1DHKB 1Y43B 4AVAA 3WG4A 2BQPA 1J1TA 2RS32 5F6LB 3HR9A 1UPIA 3ELNA 3P3PA 3SCGA 4ATEA 2EAKA 5E16A 3BALA 3N35A 4JV4A 1A78A 1CIWA 2XJQA 2YHJA 1POV0 2B39A 2WFPA 3J8F3 3JD71 2MNGA 4KH9A 5FQ0B 2DCTA 2F4PA 3AZVA 2R073 4IERA 3VBSB 2XPJA 4EWEA 3EXUA 3AKQA 1AJKA 4LO4B 4CEWC 4R9BA 4XFAA 2XG3A 3MPBA 2RS13 2E9QA 3KB5A 1XU1A 3N4MA 1YO8A 2PFWA 3ATGA 4Q2FA 2EAAA 1V6KA 1SACA 3AP4A 4HVOA 5A33B 4R4ZA 1PVC2 1YRZA 1AXKA 3AM2A 2Y26A 4I0WB 3B94A 1DLLA 4IEUA 1M4WA 4OI4A 4ASMB 4RQPB 3ZN6B 3O5SA 2FQPA 2WZPP 2QDNA 5BNQA 3AMMA 2GN3A 1QXRA 1DGLA 1AZDA 2R49A 4WM7A 2RS12 5JPNB 5ABJB 2PHFA 5DZGA 1YJLA 4YM2A 4Y4YA 1V9U3 3MIHA 4XQDA 1LEDA 1R1ZA 3TAYA 2Q1ZB 3D4KA 4RS5C 1UU6A 5DUUA 1G9FA 1YNAA 1BQPA 4B4QA 2WZR2 3H7YA 4MH0E 3JB4C 3WQ1A 4AEJA 5K0UC 4UXAA 4CZSA 5H9SA 3R6SA 2FHRA 4LO8A 1H30A 2VW1A 3JBG2 5KXCA 5SV5A 2X8KA 3WHUA 1FPN1 2BVVA 1FX5A 2O8QA 1EPWA 1WBLA 3OD4A 1BMV1 4FTSA 3DGTA 4QGMA 5CNAA 4YZ5A 5BNPC 4QT6A 4LBMA 5EWSA 1C3HA 3ILFA 3KT7A 4OHWA 4COZA 5F5QA 5J98B 3WT3A 2E51A 3DKWA 1PNFA 3B9IA 4P14A 4FPFA 5DZEA 4F8AA 1CAXB 5HCAA 2W39A 1FV3A 5GJ6A 2A71A 4Q4Y1 2R071 4HPKA 1BJQA 2JECA 4PIXA 2GH2A 2WFF2 1D4VB 1H2LA 1AR71 4LE3A 4YG6A 5FPZA 3ZYPA 2H0VA 1FMD1 2D97A 2PHWA 1UW8A 3PHMA 1ONAA 1TMF2 4GH4A 5DXDA 1VB4A 2XGXA 2YGLA 2DFBA 1QOOA 1LOFC 4K40A 4PCRA 4Q26A 4HZFA 1ZZ8A 2BWAA 4TWTA 4IEYA 2IXKA 2XUMA 5FLIA 2WNVC 3PLQA 3PMEA 1OPOA 5AFBA 2ZJCA 2EVXA 2JJ6A 4N9HA 2ZHLA 1DQ0A 4JQRA 2HWF2 1IZ3A 5JOWA 1MR5A 2B46X 3VBUB 1ZNPA 2BFUS 4Q4V2 3FBMA 3ECQA 1REFA 4UW4A 1LULA 3TOJA 1VAKA 4YM0A