1BYHA

Molecular and active-site structure of a bacillus (1-3,1-4)-beta-glucanase
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
214
structure length
214
Chain Sequence
QTGGSFFEPFNSYNSGTWEKADGYSNGGVFNCTWRANNVNFTNDGKLKLGLTSSAYNKFDCAEYRSTNIYGYGLYEVSMKPAKNTGIVSSFFTYTGPAHGTQWDEIDIEFLGKDTTKVQFNYYTNGVGGHEKVISLGFDASKGFHTYAFDWQPGYIKWYVDGVLKHTATANIPSTPGKIMMNLWNGTGVDDWLGSYNGANPLYAEYDWVKYTSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYBRID
publication title Molecular and active-site structure of a Bacillus 1,3-1,4-beta-glucanase.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Hydrolase
total genus 50
structure length 214
sequence length 214
ec nomenclature ec 3.2.1.73: Licheninase.
pdb deposition date 1992-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1byhA00
4K1YA 1DQ0A 3MW4A 3WDTA 3OY8B 1LHVA 2GDFA 2P37A 2A5ZA 2ZMKA 4Y20B 4BLJA 1OQ1A 4XBNA 4LBQD 4YFWA 4YZ4A 4BLIA 1QOTA 4R9CA 1DBNA 1N1SA 1QDOA 2GNDA 4Y22B 3ZXJA 1HDKA 3FUOA 4Q26A 3VUOA 1GBGA 1W0PA 2ZHLA 2GNBA 1YRZA 3BTAA 3M3QA 1QGLA 5T55A 3WHUA 5IK7A 4I30A 1Q8QA 1YXWA 3WDYA 3VKMA 2CWMA 4BM8A 2GN3A 4FPJA 2ZGMA 3WG4A 4KBBA 4XMAA 3W58A 2B7YA 4GXLA 4UW6A 3M3CA 1W6MA 1MACA 2JJ6A 4HL0A 3GNEA 2NYYA 3ENRA 5JMCA 1W6PB 4Q1RA 1KDMA 1W0OA 3AP9A 3WV6A 2D6PA 1LJ7A 1W6OB 2PHFA 4DFSA 4YFZA 1GZ9A 1LODA 1A8DA 1MVEA 2JD4A 2ZGOA 4XILA 3ZVXA 3H0OA 2A3XA 1AVBA 2W08A 1LULA 3GALA 1DFQA 3A4UA 5FREA 5T5PA 3WNXA 3ZSMA 3AZXA 2NZ9A 5KXBA 4ZKTB 3ZSKA 2UU8A 1LOGA 1I1EA 3OJBA 5H9QA 3KQRA 2R1BA 1MS1A 3QCWA 1KJRA 2ZACA 4TZDA 1OKQA 5GM0A 4LBQA 1BYHA 3OPZA 4Q27A 3AP5A 1ZM1A 1GZCA 2NMNA 4XYXA 3OY8A 1YO8A 4Y20A 5T5LA 5GLZA 5AVAA 4M3CE 2R16A 2VU9A 4FP3A 1QNYA 1Q8PA 1CONA 4Y22A 3SH3A 1DYKA 5DZEA 3PVNA 4YM3A 4FP2A 2EXKA 3FLPA 1JW6A 2NM1A 1FNYA 2KM2A 2ZGQA 1Q8VA 3OYWB 2FHRA 5CAZA 1SACA 3BODA 3SNMA 1GKBA 4M3CB 2NP0A 5DG2A 1KQRA 4XJZA 2CNAA 5T54A 1YIFA 1DQ1A 3AXDA 4BQ1A 4C1XA 2DUOA 3AZZA 1JBCA 4DRVA 1APNA 5HCAA 2P3JA 3B00A 5KXDA 3WOGA 4FPHA 2A71A 2WLQA 5CBLA 4YGBA 1W6PA 4XXPA 1QNWA 1W6NB 1DQ2A 1UAIA 2EF6A 2ZBJA 3UK9A 1WD4A 3AYDA 1VLNA 1SCRA 1W6OA 3I4IA 2GMPA 3ASIA 1CN1A 1S0GA 4YW2A 1ULEA 2Z42A 4YW1A 2VW0A 3WG1A 2DWRA 2SLIA 1W6QB 3OBTA 4ISRA 1WLWA 4FPYA 1AXKA 4XOGA 1U0AA 3AZWA 1RIRA 2EALA 3ZSLA 1QKQA 1VIWB 3AX4A 2WT2A 3LSEA 4M3CF 3WG3A 5GJ6A 3A0NA 2HYKA 1LENA 2A70A 4YZ2A 1UN1A 5FRAA 4BPZA 1N3PA 3DGTA 1LHWA 1SCSA 5JVVA 2W52A 4YG6A 1A3KA 1FV2A 2EXHA 3AK0A 2UWBA 1J1TA 2EXJA 2PHWA 2WQZC 2ZABA 1V6NA 1LEMA 3D6EA 3OYWA 2WT0A 5GZCA 1DHKB 1GZWB 2ZGPA 1XQNA 4CTEA 4AGRA 1UPSA 2R49A 3AZVA 1S0BA 4M3CA 2ZHKA 4JRAA 4PBPA 1TEIA 1Y7BA 4P14A 2E6VA 2DVAA 4JCKA 4XBQA 1KITA 2D6KA 3AZYA 1SBEA 4H55A 2OVUA 1AX0A 1MS5A 1URXA 1W6NA 4LBNA 3NV3A 5CB7A 5IK4A 1S0CA 3AYAA 4YW5A 1LHOA 2A6XA 2A6ZA 1DZQA 3ZPYA 1G9AA 2GNTA 1ENRA 1IS3A 3MW2A 4XTMA 4YLZA 2ZHMA 2ZGNA 1FX5A 2XB6C 1W6QA 3UJOA 2A6YA 4XZPA 1MS3A 4ITCA 5DXDA 4LBLA 3AP6A 3WZ1A 3AFKA 2ZGSA 3APBA 5F9TA 1AX1A 4FPKA 3RRDA 3DUIA 3L2YA 3FUQA 3O12A 1Q56A 5DUWA 2P2KA 1LOAA 1N1TA 4GA9A 5T52A 3RS6A 2ERFA 2E53A 1ENSA 1SLLA 2ZMNA 1N3OA 2ZGLA 2OUHA 1QMJA 4IQPA 2DU1A 2GMMA 3CNAA 2CY6A 2VW2A 4UW3A 5E88A 3SITA 2V5YA 2G4IA 3AJYA 2GMEA 1BZWA 1LOEA 1IS6A 5E89A 3VV1A 2A6VA 4FPCA 5GLWA 1HKDA 5KXCA 1GZWA 1AJOA 2JECA 1N1YA 5BYNA 4XJWA 5E8AA 5JLVA 1Q8OA 2DTYA 2YXSA 3MW3A 2SBAA 1JYIA 4Y1XA 4ASMB 2OUJA 1LECA 3WUCA 4ATEA 4Y1YA 2C5DA 1CPMA 3HR9A 1BQPA 1GICA 5H9RA 5HCBA 2YV8A 5HCFA 5SV8A 3AXEA 3OBRA 5IT6A 1V6MA 2E51A 3ILRA 4UW4A 2DVFA 1VALA 4XMIA 5T50A 4YG3A 4Q8LA 4YM1A 1GANA 4OZXA 2D3RA 2EIGA 4Z8BA 2DUPA 4XBLA 3RMYA 1WLCA 1LU2A 1HLCA 3WVJA 4Y1VA 3POSA 3VKNA 1DQ4A 4K1ZA 1AXZA 3R4UA 3V0BB 4YGCA 3V0AB 1F9KA 2AGSA 1UZYA 3O5SA 1SLCA 1FAYA 1OFSA 4AYUA 2VUAA 1WBLA 3N7LA 2DTWA 5EYYA 1WD3A 2D6NA 4NOTA 1UX6A 4RA0A 2UURA 1F31A 3B9CA 1SFYA 1SLAA 3O0VA 1GV9A 1LCLA 2I2SA 3IN9A 1R1ZA 1CQ9A 4FPLA 4FPEA 4YG0A 3NWKA 4ATFA 4DQAA 1FYUA 2LALA 3PVOA 2C9AA 3AYEA 4GWMA 1LOCA 2WJSA 1QF3A 2CYFA 4XDQA 3WUDA 3AYCA 3BIWE 1KJLA 2LTNA 1B09A 1VAMA 4NO4A 3WLUA 1V6OA 1BKZA 1Z78A 1ULFA 4ISQA 5DUXA 5CNAA 5GALA 3VKFC 1WBFA 2EXIA 2WKKA 2AR6A 3HN1A 1IS4A 3N7MA 1HQWA 1JUIA 4RL7A 1JYCA 3NV1A 4XHBA 4XHXA 3WCSA 4GKYA 1QOOA 1NXD1 1RITA 1LTEA 1QOSA 3ZSJA 2DYCA 1KRIA 4Y1UA 3O0XA 1S0FA 4WVWA 4YZ5A 1V00A 1X50A 1WW7A 2JE7A 1H9WA 1RINA 3ILNA 4XXAA 3T1MA 3ZXFA 3QLQA 2CL2A 4AGVA 4L8QA 1ULDA 1LGCA 4AVVA 4GALA 1MZ5A 1WW5A 2AENA 3I8TA 3V0BA 1H30A 3V0AA 1ULCA 3U4XA 2ZGKA 3FBYA 2D3SA 1C57A 4AVSA 2A7AA 1UKGA 1GYKA 2ZGTA 3Q9OA 3FLTA 3ZXKA 3B01A 2GALA 1JOJA 3HMYA 3N36A 4YGEA 1O4ZA 1I3HA 1V6JA 2WT1A 1BXHA 2UWCA 3IPVB 5EYXA 1MS9A 3T1LA 5JOWA 4DPNA 1D0HA 2V73A 2P34A 4LBOA 1GLHA 2YMZA 3RG0A 4FOYA 4JC1A 3M1HA 1MZ6A 3WDWA 4PF5A 4PCRA 1O4YA 4U2AA 4PBOA 5F5QA 3USUB 4CRQA 3B3QE 3D4KA 1SLBA 4K21A 4WZFA 1V6KA 1JN2P 4FOWA 3N7JA 1IOAA 3JUUA 5H9PA 1V6LA 3SH4A 3R05A 3RQ0A 1LGBA 1KDKA 1LGNA 3AJZA 4YM2A 4LBQB 3RSJA 2AREA 4YW4A 1CR7A 3MPPG 2GNMA 3FLRA 3ZXLA 4AWDA 2PHRA 3W59A 2WSVA 4Y1ZA 4YZ1A 1VAVA 1PZ9A 2R1DA 5H9SA 3WDUA 3LSDA 2ZMLA 2XG3A 1G7YA 3POYA 4FQZA 4FPOB 3WDVA 1WLDA 1ZA4A 2H0BA 4FVVA 4HANA 4WVVA 5EXOA 1GNZA 5JOXA 2D6LX 2YY1A 3PVEA 1SBFA 3WHTA 1NLSA 1UMZA 2WSUA 2ZGRA 3N35A 1LHNA 1D2SA 2P3IA 3SH5A 4P9YA 2D3PA 1QDCA 3TAYA 2ES3A 1G9CA 1Z0HA 4R9BA 3N7KA 2JKBA 5IUQA 4FPFA 1FNZA 1WW6A 3AP4A 1ENQA 1MS0A 4ZXKA 2JE9A 3JU9A 4GKXA 3VKLA 1H9PA 2W68A 1V6IA 4YGDA 3VKOA 2PHXA 5IK5A 1GNHA 1MR5A 2VH9A 1UL9A 5DUVA 2D6MA 1S1AA 1EPWA 3IPVA 3WCRA 4XIOA 1LOBA 1AXYA 2OW4A 5KXEA 3MEPA 1S0DA 3LCPA 4UW5A 2VY0A 1G9DA 5T5JA 4Q1PA 2DURA 2W39A 2TEPA 1AZDA 2DU0A 3INAA 1DLLA 2JDZA 3USUA 1IKPA 1A78A 1CVNA 2R0FA 1PZ8A 2WNEA 3B69A 4YW3A 1IS5A 1MVQA 1WUVA 3IKWA 4Y26A 3ZYRA 2DVGA 2ZZJA 3V64A 5EWSA 5DZFA 2PHTA 1G8WA 1JXNA 2VW1A 1SLIA 3O0WA 4M01A 4BMEA 4CZSA 2CTVA 1PZ7A 4DS0A 4WV8A 3AP7A 1S0IA 2ZAAA 3IM0A 1G9FA 4FQ4A 5L73A 4LBJA 3RMXA 2E7QA 4PQ9A 5JDBA 2EAKA 4LBMA 1LHUA 2D6OX 1YYNA 3C2UA 3ILFA 3V65A 1N47A 4Y24A 3PMEA 1FATA 4BMBA 3UJQA 4XJ9A 3M3OA 4XJAA 2DV9A 4P9XA 4K20A 4AVTA 3IMNA 3SLIA 2FMDA 5GZEA 3SISA 2ARXA 4DRRA 5JOYA 3A0KA 2P3KA 1LESA 2CWSA 4YZ3A 3WDXA 2A6WA 4F83A 4FOVA 2YROA 1SBDA 2A75A 4Q2FA 4SLIA 1S0JA 5CA6A 4LBKA 4XIKA 1DQ6A 3UL2A 2GN7A 3BOPA 3TB0A 3NV4A 4TYSA 5GLUA 2BQPA 4P9WA 5GZFA 4MYEA 2ZA9A 1YI7A 4Q8KA 3KM5A 1ONAA 4D69A 1DYPA 2DUQA 2ZKNA 1IKQA 4W65A 1S0EA 2VXRA 2DVBA 1AJKA 5GZDA 2AUYA 3ATGA 2R0HA 4R9AA 4BOWA 5DG1A 1AF9A 5T5OA 1AX2A 1QU0A 2PHUA 1WW4A 1LU1A 3FFZA 1Q8SA 2D43A 1DGLA 3NV2A 2D44A 4XTPA 5IK8A 2ZGUA 4U36A 3T2TA 2ARBA 3ZYPA 5DUUA 1DQ5A 2NMOA 2AH2A 2Q5TA 1CIWA 1LOFA 1N3QA 4C1WA 5LK5A 1W6MB 1C1LA 1LEDA 1C1FA 1GSLA 1N1VA 1ULGA 1MS8A 2NN8A 1G9BA 1WCSA 2UWAA 2DVDA 2YZ4A 1DIWA 1LOFC 3WG2A 1FV3A 4GWNA 4XE9A 1C4RA 3N3HA 3PJQA 3M3EA 2RHPA 5DZGA 1JHNA 1MS4A 2A3WA 1BJQA 2PELA 4M00A 1F5FA 4FPGA 5JOZA 5GZGA 2D7FA 3POWA 1SLTA 3R4SA 2AYHA 1CESA 2ENRA 1HQLA 4XJ8A 5GLTA 2E7TA 1CPNA 2A3YA 4R9DA 4YM0A 5GLVA 3ZXEA 4AGGA 4FOQA 1G86A 3D5OA 1UZZA 4XJUA 2ZHNA 3OGGA 3M2MA 1CJPA
chains in the Genus database with same CATH superfamily
2Y33A 2VD7A 3MW4A 5FY8A 2W92A 4BISA 5DMYA 2GDFA 3WT3A 5J7MA 3OD0A 3BU0A 4BLJA 4BLIA 2ET7A 1OA3A 4R4ZA 1N1SA 1Q43A 2H6BA 3HBKA 1RUF2 4DXSA 3OUIA 1HJFA 5C9AA 1QGLA 4BJ0A 3O1PA 4WM7B 2EVXA 1WKYA 1WMEA 2RS52 4GB31 1YXWA 2VNRA 4RGGA 2X09A 1AR63 4Z1VA 5EIYB 4D3WA 4FPJA 3VZMA 1Y9QA 2XQRA 4IEOA 4XMAA 2BTVC 3IDAA 3FX3A 1K12A 1NY72 1W6MA 2VJXA 3M3CA 4HL0A 4UW6A 3GNEA 2OXBA 3ENRA 2VMFA 3LEGA 1KDMA 1PO13 1W0OA 3CJIB 5A6QA 3WV6A 2PLV2 3MICA 2D6PA 1HV0A 4DUWA 2PHFA 1W6OB 5FQ0B 3KHBA 4DFSA 1R1A2 3P6BA 2LUWA 5IVYA 1W8HA 2H6CA 1JS9A 5FZHA 3ZVXA 4A3XA 5AC92 1QJX1 5JWPA 4J25A 1LULA 3H1WA 1DFQA 2CV6A 5A70A 1AUYA 5KXBA 2XHKA 2MNGA 5FMDA 3WQBA 4ZKTB 1REDA 1GP4A 5H9QA 2G19A 4TZDA 3UKTA 3UYJA 1YQCA 4JGZC 5GM0A 1OKOA 1BYHA 4GJYA 1NE4A 3PU8A 5FP7A 1ZM1A 1LNSA 5K4LA 2BDRA 4Y20A 3TBDA 5L9VA 1DG6A 5T5LA 2VVEA 2BEOA 2HWC3 2VL4A 3OUJA 3WF0A 1K5MC 5FZLA 4LEJA 3SH3A 1YIPA 1LKNA 1H8TC 1MEC3 4OI1A 2NM1A 1FNYA 4C8DA 5K0UA 3BPZA 2B9UA 4BH9A 1Y3TA 3SMHA 4ZU4A 2JX9A 1H4GA 1HB4A 1F4AA 3A22A 3BODA 4Q4W1 4GQ7A 1RHI2 4QB1A 1IZ3A 2XXZA 1KQRA 3NW4A 2CNAA 4FXGB 3LEMA 3CF6E 4QWNA 4Y5Z0 5T54A 1B35A 1WMXA 4XUQA 1X9TA 4AL9A 1YI9A 3AM2A 4DRVA 3B00A 1YWKA 2A71A 2WLQA 2QNKA 4Y4YA 4YGBA 2E9QA 3J26N 1W6PA 5ANNA 2DCJA 2XJPA 1ZBA2 1QNWA 1W6NB 4NHYA 1DGWX 4B4QA 1WD4A 1DYOA 5C8CA 5IATA 2GMPA 3ASIA 1CN1A 3BU7A 1S0GA 4YW2A 3MFAA 1GWKA 5ACA1 1KD7A 1JH5A 1ULEA 1UXXX 5IW0A 5DAXA 5C6CA 3AB0A 5LBEA 3L2HA 5FMBA 2CSGA 3KZ4C 4ISRA 2X5IC 3Q8EA 2XBO2 3WF3A 3WW2A 2VTFA 4P02B 4IGOA 2VZSA 5JSRA 1W28A 1AXKA 4OHWA 1HRV2 1PMJX 3ZYIB 1W2AX 1DGRN 2CAVA 4CDXA 1QKQA 4DUXA 1VIWB 1VMJA 2W95A 4QX8A 3ZFEA 2BW8A 1UY2A 2WT2A 4B7KA 4CYDA 5FDBA 4AFMA 5GJ6A 2HYKA 4LULA 3H8UA 1LENA 2I45A 4UT5A 1XE0A 3HNYM 4JZRA 5E6HA 5FRAA 3DGTA 1LHWA 4CP0A 1QXPA 4DEQA 4YG6A 1UY3A 2EXHA 4XACA 1J1TA 2WQZC 2E32A 2HWD3 3M4FA 1V6NA 2JDNA 1OF4A 1VBD1 1VMHA 1GZWB 4PJYA 4RFRB 1OLRA 2ZGPA 1O91A 1WLTA 4QPGC 4CTEA 1J84A 3AZVA 5BNPC 3DCQA 2HBUA 1UZ0A 3QACA 3ETQA 1U12A 3PUQA 4PBPA 3S7IA 1C3HA 4W6WA 1WA6X 4XBQA 3VD4A 2VVDA 2UYBA 1ND3B 2WS92 3AZYA 4Y4RA 2Y6KA 4CXWA 4I0BA 1MS5A 4JDMA 1URXA 1NA1A 4NIAA 2C1FA 5FXWA 1S0CA 3AYAA 4XZUG 3OG2A 3NNLA 3POBA 2A6ZA 2VMEA 3U75A 1OF3A 3ZPYA 1CWPA 2IZWA 2RS31 1IG3A 4CEYB 3RDIA 2CGNA 1FX5A 2XB6C 2A6YA 5FUNA 4ITCA 5DXDA 4LBLA 3BN6A 4E4HA 1CAVB 2YPDA 4UF0A 5LA2A 2WNOA 4ZZ8A 3TEYA 4CU6A 4IV1C 2OZJA 4FPKA 3SC7X 2Q1ZB 3L2YA 1ZZ9A 2FDKA 4GH4B 3HVDA 1OLME 2P2KA 1LOAA 4XFHA 1V9U1 4Q0UA 4AFCA 2ERFA 2E53A 4CDQC 3I2OA 3ZX7A 2FDIA 3THPA 4IQPA 2GMMA 5A7NA 4RQPB 3N9MA 2VW2A 3SITA 5FLHA 5C5TA 2V5YA 3HQUA 2D97A 1J58A 4IV3C 4ASLA 4RS5B 2VMHA 3MO4A 3G6JB 4XCBA 2OQ6A 1RMU3 4Q4X3 4AFDA 4URAA 5KXCA 5JLVA 1Q8OA 3ZYBA 3USSA 4BQ4A 1UY0A 3PTYA 4MHUA 2O14A 4Y1XA 1LECA 2BOIA 1W8WA 4M4PA 4ATEA 2IC1A 4QXKA 3C7EA 3PHMA 1RVF1 2PAEA 5I93A 3AXEA 3ZFFA 5CKMA 3I3MA 1V6MA 2E51A 4UW4A 3WNPA 4B29A 5IVEA 4JGYA 4XMIA 2R7EB 4AG4A 1PX3A 5T50A 1GANA 4OZXA 5FZ1A 3RWKX 4AHXA 2DUPA 2YC2A 3DXTA 3PURA 4XBLA 4PIZA 3RMYA 1NLQA 4ZXEA 3OD4A 5JZGB 5EJ1B 3B5LB 3GJAA 3POSA 1DQ4A 5FWEA 4BK4A 5A6XA 4K1ZA 1AXZA 3CQOA 5M0TA 4YGCA 1ZNPA 4I3GA 4AXOA 4KU8A 5FKBA 1UZYA 1SLCA 4FFIA 4XCAA 1JMUB 4JKLA 1OFSA 5J98B 4BE3A 4AYUA 1UXZA 3LDRA 4A42A 5EYYA 3TWIA 4NOTA 2D6NA 3UKVA 1ASJ3 3RWNA 1DDLA 1SLAA 2QVSB 5A7WB 2RM21 3AMQA 4OVEA 5FMOL 1TME1 4FPEA 3NWKA 1OT5A 3IMMA 2XHNA 5C7GA 3PIJA 1T2XA 3PVOA 1Z7S3 2C9AA 1WGPA 1UMHA 1CX4A 5FK7A 5IFTA 3BIWE 2XKPA 4LMFA 1V70A 4ISQA 1BKZA 2JG9B 1PIV2 3K75B 4IUGA 5DUXA 5GALA 3WLUA 2YU1A 5A6YA 4OQ8A 3HBZA 3NAPA 4H7MA 1NLRA 4K40A 4BQWA 2AR6A 3HN1A 2X8KA 3N7MA 1RUF3 5LWBA 5CFDB 2UY8A 2R062 3FBMA 4G3YC 4XHXA 4AEDB 1NUKA 1TMF2 5C3SA 2RDQA 1FOD1 1RITA 1EY2A 1QOSA 1JOPA 1PO22 3HQRA 2WN3A 3O0XA 3ZO0B 3JQXA 3WP4A 1V00A 2XH6A 3HD8B 1WW7A 4F8AA 5JAXA 4XUPA 3UGGA 3ZXFA 2R072 1UOBA 3GF6A 4L8QA 4E2GA 4MXWA 2AENA 1SG3A 4LK7A 1H30A 5IAXA 1ULCA 2ZGKA 2D3SA 1C57A 5ANQA 4AVSA 3VDDB 1BHGA 1UKGA 2EICA 5KC6A 3HMYA 5KHKA 2QQIA 4QXBA 4HSJA 1O3TA 1UU4A 4Z2WA 4AI0A 4CCKA 2FDHA 1RTVA 3DECA 5JCTA 4B3NA 5F1RA 2B5HA 2PQQA 5EYXA 5G05L 4B1LA 2YC0A 3T1LA 3RZMA 2K0GA 2FCTA 2TUNA 3HJRA 4JKKA 1GLHA 4LBOA 3JD72 1PGL2 2JEMA 1ZZCA 1MZ6A 3M1HA 4ZZ5A 1M06G 3I3DA 3TNQA 2PHLA 4P5HA 4PBOA 1VP6A 3NL1A 5F5QA 5F39A 3U37A 5I8TA 3IWZA 4AHYA 3LIGA 3RI8A 3DKQA 2J1UA 2GU9A 3JUUA 3BUCA 2QBXA 3J8F1 3R05A 1FMD2 3AL6A 4XABA 3RSJA 1AL21 4CDUB 2NPIA 1CR7A 4YW4A 3C8XA 1KEXA 2VQAA 3ZXLA 1H2LA 3D0JA 3W59A 4BHPA 5ABJA 2R1DA 3QOPA 2W1WA 1ZZBA 4OULA 5FY1A 3Q8CA 2XG3A 4FVVA 1W0NA 1OA4A 3AVRA 4IERA 4N43B 5EXOA 3ZLIA 4DEVA 4W8JA 3CL1A 1H2KA 4CXYA 3H8RA 3IDBB 3POGA 5KHGA 3WW1A 1QJU1 4AE2A 2VZ3A 3WHTA 1PVC3 2ZX3A 4GIQA 3RZHA 1UMZA 3H3LA 3VL9A 2ZGRA 1YJKA 3VZNA 2VZUA 3F2ZA 3E1F1 4D0QA 3OPTA 1D2SA 2BFUS 4H7LA 5EV7A 2D3PA 3SH5A 1G9CA 2ES3A 4HG6B 5FYHA 4R8HA 2JDKA 3N7KA 1LB2A 1SPPB 5HXVA 4ES9A 1S4CA 2WINB 2VUCA 1EV12 2FZ2A 5FPVA 5FYTA 2W68A 2C0ZA 3M70A 1RUC2 2YG0A 2HWB1 3VKOA 4PLMA 1GNHA 2JDPA 1X36A 1UL9A 5KWRA 1VBA1 3UKNA 3LDKA 5T3NA 3IPVA 2F17A 2OW4A 1AXYA 4MXVA 4LK6A 3B93A 5CFCC 1ND3C 3CIHA 2ORZA 4F3JA 1G9DA 3SQOA 1I9RA 1AZDA 1YCIA 5A80A 3DEMA 1IKPA 1A78A 1HIXA 4KMQA 3BIEA 2BERA 1PZ8A 4AEKA 1MVQA 5HV0A 4CP9A 3CMGA 1PK6C 1HXS2 4XUOA 1JXNA 1SLIA 4CZSA 3OPWA 4C0HA 3WP6A 3W5MA 2FCUA 2W47A 4I3PA 4RSUA 4DS0A 2J1TA 3ZR6A 4NIHA 1ZREA 1G9FA 2AC1A 1OOPC 3UGHA 4BYYA 4QKBA 2EAKA 5A3OA 2XL7A 4RFT0 2V4VA 3LIHA 1H8TA 2J1SA 3VBOB 1QXRA 4C0BA 4P9IA 4PLNA 1OURA 4MADA 4META 3RJ2X 4DO0A 1JOBA 2WS93 4FO9A 3JBG1 3V65A 4Y24A 4MX3A 1ZRCA 4BMBA 3PIGA 1CAXB 5E1RA 4XJAA 4IGQA 1AR62 2J1RA 1AR93 3CKHA 4NAMA 2BV4A 5GZEA 1I6XA 2L9LA 3AKTA 3A0KA 1U5YA 2DF7A 3OTFA 2P3KA 3WDXA 5JIAA 5L9RA 4FOVA 1HJGA 2A75A 4R52A 4Q2FA 2YHJA 1PO12 4LBKA 4IEPA 4B4RA 4KG0A 3UL2A 1W9WA 1QHDA 3OBAA 4UXAA 3TB0A 5JPMB 3IAQA 2RJLA 4LO7A 3P3NA 3PUAA 5GZFA 5LEJA 4MGZE 1KS5A 3J7LA 1KS4A 4NWVA 3BTZA 3G7DA 4D69A 1HN1A 2DCZA 1SFNA 2DUQA 2OA2A 3NJXA 3ECQA 4D7YA 4EN8B 2VXRA 2DVBA 3NNGA 4DNYA 4OMDA 5JXIA 1MZFA 3E6DA 3OUHA 4Q4Y1 2YGLA 1D2QA 5FYYA 1H0BA 2XPJA 1JZ3A 3OGSA 2LROA 3K77A 2D43A 2VVFA 1DGLA 1Q3EA 2D44A 2E26A 2Z4FA 2ZGUA 4NHMA 3I54A 5A1AA 5LA9A 1UPIA 1SHWB 4E9KA 1F8VA 2HWF2 1OQEA 1LOFA 1N3QA 3M8LA 3KVBA 1G9BA 1C1LA 4LE3A 1GSLA 1LRHA 2N7GA 2W1UA 2DVDA 1HRI1 3KS7A 4LXLA 1MEC2 2YZ4A 3PUHA 1BEV1 5LBFA 3WG2A 5ISLA 4HK9A 4GWNA 4XE9A 3O1SA 4FTSA 5J09A 2OT7A 3WP3A 1O3SA 4YVWA 5I0TA 5DZGA 5FTTC 4FTEA 2WN2A 5BNPA 2A3WA 1XNBA 1JZ7A 1BVVA 4Y33A 4KU7A 5JOZA 3FFQA 2WZR2 2V4AA 4GB32 2AYHA 1AR81 2KXLA 1HQLA 2R6QA 1HB1A 4LOSA 1MQTA 2JG9C 5BNNC 4YNIA 4JGZB 2A3YA 3UETA 2PMWB 2BZDA 2J1EA 1G86A 3D5OA 5A33A 1YFYA 4C90A 1PVXA 1NQDA 5I8YA 2WWSA 5CFDC 4K1YA 3WNNA 1DQ0A 4FTBA 4K3UA 3MLKA 1K5MB 1LHVA 2P37A 4NRQA 4NROA 5F32A 5IVJA 2WO7A 4LBQD 2VNGA 5LA1A 5FKCA 4R9CA 2RJ2A 2Z69A 4IEQA 4Y22B 5J96B 1HDKA 3FUOA 4NHLA 3ETPA 1W0PA 5FZBA 2GNBA 3FL7A 3M3QA 1REFA 4A3ZA 2PAMA 5BNOA 3A7QA 4QGLA 3VBRA 2ZEZA 4K8FA 4NAOA 1FPN3 5G04L 4BM8A 3MV11 2ZGMA 4IEYA 3W58A 5IYYA 2P4EA 3VDDC 4BU2A 2JJ6A 3KT4A 2NYYA 5FK8A 1OI6A 1JHJA 5FR3A 3U0ZA 2BBVA 2HWD2 4Q1RA 3AP9A 4CXXA 3KT7A 1BBT1 4HETA 2LRPA 3VBHC 1XYPA 2WO2A 4PDWC 4RHV3 1C8NA 1A8DA 2ZGOA 4NMIA 2X5IB 3GHMA 4QHZA 1PMIA 5EJ3A 1AVBA 2W08A 3GALA 3J7HA 4L11A 2NZ9A 1ACCA 1L7RA 2DCYA 1LOGA 2WBKA 4IE7A 4UAPA 4DZGA 3OJBA 4K8RB 3KQRA 5KBFA 1SZBA 3FJSA 2WR9A 4CDUC 2FDJA 3AP5A 3CZUA 3ZOIA 1JYXA 1M4WA 1GZCA 2BGPA 3KT1A 4QB6A 4XYXA 5C71A 1YO8A 1NCRB 2DFCA 2JICA 2WZPP 4CSWA 2BFUL 2R16A 3CBNA 1O59A 1QNYA 1Q8PA 4FP3A 2J22A 1RL3A 2BNNA 1ND2C 2WIIB 3PVNA 4N43C 4FP2A 3FLPA 3GCXA 5AFBA 4QPGB 1S2EA 2BOJA 3OYWB 3ZYJB 4ZU5A 1C8M3 4WM7A 5CADA 3JD73 1SACA 2CU5A 5FXXA 1CJDA 4M3CB 1X33A 4XJZA 4MO3M 1TVGA 2Y60A 5F2WA 4ARXA 4BXFA 3N9LA 1JODA 5F6LB 4AHZA 2W91A 4C1XA 1NZIA 1RUI1 1C5HA 4QU2A 3C7HA 1JBCA 1O8PA 1X8MA 1NG0A 2DCTA 1POQA 5KXDA 2W46A 5L7OC 3POJA 3K2OA 4HT1T 3W5NA 1RMU2 4MLOA 3CJIA 4Q4X2 4XXPA 1DQ2A 2EF6A 3WF1A 4Q0QA 3AYDA 2RS11 1W6OA 3I4IA 4HLTA 5FQ0A 2E7AA 4D8MA 4IE4A 4HMZA 4P00B 4LHLA 5BPXA 5FOBB 2Z42A 5A7QA 1I5ZA 5A3WA 1YQ8A 2VBBA 3T2QA 4IV1B 1ZRIA 1ODNA 5C70A 4UWDA 4CPBD 3HQXA 3KCCA 1HB2A 3AZWA 2V5DA 4XOGA 3NKTA 2RMU3 1VBC1 4RD7A 4B7EA 1EUUA 4UI9L 2XKOA 5LK7B 2HWE2 4LO4B 2WNVC 1H2MA 1NAEA 2C9KA 4M3CF 4XF3A 4G4FA 3SEEA 2VBDA 2QQMA 2VCMA 3I2FA 2A70A 2ZX0A 2GC1A 4IV3B 4A7ZA 4YZ2A 1N3PA 1O5LA 4HZFA 5J48A 4MV2A 5JR7B 4HVOA 1A3KA 2JG8C 4LR4A 1QJY3 1RUG3 1LEMA 2ZABA 3D6EA 5I8SA 4NIGA 3WY6A 1W3XA 4LO6B 2V09A 4QM9A 3ZR5A 1SDDB 4L2NA 1HB3A 1JYNA 4FFGA 4AGRA 2QFEA 2R49A 4O9GA 1PNFA 1TQ5A 4JRAA 2D93A 1RUE1 3QH7A 2TBVA 4RR3C 1TEIA 1Y7BA 1ENXA 2E6VA 2DVAA 3BB6A 4JCKA 4BK5A 3O7OA 1KITA 2D6KA 2P3YA 4H55A 4QX1A 2OVUA 4A2UA 1AX0A 4DXTA 4LO8A 1E5IA 1GR3A 1W6NA 3K4AA 1YQ2A 4CCDA 5JIUA 3KCXA 4RGKA 4A45A 4IEWA 4DIQA 1OMIA 3U07A 2XQXA 3AL5A 1RXGA 4YW5A 4QX2A 3H3UA 2GNTA 1ENRA 3DN7A 4YLZA 2ZHMA 2ZGNA 2RG4A 3EJKA 5CKNA 4L0PA 1MS3A 1VBE1 3FHAA 3AFKA 2WABA 3H3ZA 4COZA 1SQ4A 5FYMA 1VB2A 2NQYA 3O12A 3RS6A 2HWC1 1SLLA 4XEZA 5FYIA 1QMJA 2VAUA 2FMYA 2ZJCA 1W8UA 1UIJA 4INDA 3CNAA 2BNMA 1COV1 1ZA7A 2CY6A 3LKJA 3BVCA 3WQ1A 3WF4A 1ZRDA 2G4IA 3C3VA 3PL0A 4KGQA 2FBEA 3AKQA 4W50A 1IS6A 4D6QA 2JE8A 3VV1A 5IWFA 1WCQA 1ZBE3 2A6VA 4EQVA 4WZCA 5I0SA 1HKDA 2QUOA 1GZWA 1OH4A 4XC9A 1XYOA 5FZOB 5E8AA 3RZJA 3MW3A 3N9QA 4YPJA 1GQHA 3MLJA 1ODMA 5FV3A 4AI8A 3MLLA 3WUCA 5F3CA 3ES4A 1GOGA 4ZY9A 3RPQA 4Y1YA 2WFF2 2C6SA 5HCFA 3DL3A 3THTA 1ND3A 5IT6A 5BUVA 2XUEA 2RE9A 2VECA 5HPOA 2QKDA 1NCQC 3DYPA 3TN93 5I0UA 2IXKA 2VCBA 2ZZQA 4YG3A 1RUD2 3BYWA 5IFPA 4CEWB 2HWF3 2D3RA 4HVRA 2FQPA 4CEYA 5B4NA 4QHBA 5FY5A 1GP6A 2YU2A 1GFF2 1QJFA 1UYYA 1RUNA 3T4VA 2W5FA 4R4XA 1O7FA 1YEWA 1CAVA 3R4UA 3WQ0A 3L9JT 2AGSA 3O5SA 3ZYFA 2Y26A 3O1MA 3HAGA 4GH4A 4QQ2A 2VUAA 1RUH2 1WBLA 3NRUA 1YUDA 4CP1A 4OZOA 1WD3A 2C26A 3I7DA 2FZ1A 4AVBA 1VJ2A 2WZR3 1AYM2 4GB33 1FOD2 2OIIA 3AC0A 5L36A 4X8PA 1F31A 3B9CA 4RQPA 4ET7A 1LCLA 1PVC2 1R64A 2P5BA 1TE1B 3VBSC 5JSOA 4FPLA 4ATFA 4RS5A 3QBQA 3I2HA 3T0BA 4GWMA 3AYEA 4NUBA 1LOCA 4XFFA 2BUKA 2YC4A 1PX4A 1KJLA 4XQDA 3KQ4B 1VAMA 2AZ5A 5IK4A 4AK3A 2XJRA 1Z78A 2VR4A 4M0NA 1OPOA 5CNAA 3VKFC 3ACHA 4E2QA 1DF0A 3IZOA 2K9ZA 3PUIA 3GZTB 1HQNA 5A7SA 3BKZA 1UCXA 2Y6JA 1JUIA 3MI8A 1JYCA 3NV1A 4JVAA 4EWDA 1W8FA 2KD7A 2VQUA 3ZSJA 1Q5OA 2C24A 1D4M1 2TNFA 3E5XA 1KRIA 1W3VA 5FIXA 1S0FA 3I97A 4YZ5A 1X50A 4PT6A 2JE7A 3ILNA 4XXAA 2AACA 5HBAA 1NCRC 5FZ6A 3QLQA 2IFRA 2FDFA 1W2OA 5JZGA 1MZ5A 3DKWA 1O6UA 1E5RA 4D7TA 3DPRC 2VC9A 3LE0A 3VB9A 1W06A 1ZZ7A 4QMAA 5F5AA 4CUCA 2GZWA 4GAZA 2BP6A 2Q1MA 2R042 3B01A 3KWVA 4NWWA 1JOJA 1PNGA 2YUEA 2JIGA 1I3HA 2JXAA 5IHRA 2ET1A 1OD5A 4LUKA 5CFCB 5A7WA 1BXHA 3KV6A 3VD3A 2J1AA 3VBUC 2UWCA 3BOWA 1MS9A 1XU1A 2ZAHA 4PIXA 4NIIA 4DPNA 3ZFGA 4OLLA 2HKXA 1AR92 1JI6A 1QJU2 2B39A 2YPJA 3ABZA 3R4DB 5FXVA 4BIFA 4PF5A 5CU1A 5CZKA 1F2NA 1EAH1 1O4YA 3J9SA 1DGWA 2RR11 2J42A 3USUB 3VDAA 4CRQA 1AR72 2JG9A 3OB8A 1PK6B 4D6SA 4LA2A 1V6KA 1JN2P 4LKEA 4S2FA 5H9PA 5IVCA 3RQ0A 1LGBA 1KDKA 1LGNA 3AJZA 3OGRA 4OYUA 4Q4V2 1EUTA 3KV9A 5E16A 3ZKYA 4MG2A 4JTOA 3MPPG 2P6HA 5CFDA 2Q8OA 5B2GB 1OOPB 1KFUL 4AEDA 4QX3A 5FPBA 2QQJA 2IXJA 3WDUA 2MEV1 3LSDA 5D8AC 4FPOB 2IVIB 1U5XA 2H0BA 1CAUB 5LY2A 5K9YA 1IQAA 1XYNA 2QQKA 1VRH1 2YYOA 4WBBA 4NPLA 1CD3G 2MHFA 4E8DA 1SBFA 1BMV1 3U78A 3S0MA 2WSUA 5DDJ1 5A32B 2NP0A 1DU3D 3VDBA 3TAYA 3K3OA 3LEKA 3R0RA 4P9YA 3ZMNA 2HLEA 4WM8C 4O61A 5CG9A 4R9BA 2Y6FA 3I2DA 2JKBA 3MHZA 3WXPA 4FPFA 3LA2A 1FNZA 2VG9A 1ASJ1 4XW3A 3VDDA 1UWWA 5C5UA 1MS0A 5EJZB 4ZXKA 4CCEA 1VBD3 2JE9A 3JU9A 4CCNA 3ZDVA 1H9PA 4PLOA 3LQCA 1MR5A 1S55A 1Y9MA 2P6CA 2ZTNA 3UNPA 1Z7S1 1QQP1 2PXJA 3O1RA 3WCRA 4XIOA 1LOBA 2ILMA 4PIYA 3T0AA 1GNYA 3E6BA 2HWE3 2W9XA 5FZCA 2VY0A 2XJQA 3POEA 5FZ8A 2DURA 3QD6A 3NNMA 1ZZ8A 1DLLA 1RUF1 5FY9A 3KV5A 3RYPA 3IT8A 2WNEA 3B69A 1IS5A 3IKWA 4JKMA 4J1WA 2DBNA 4KWLA 2RS33 1GUIA 2RS51 4LHSA 3V64A 4CDUA 1W8TA 1SDWA 2IXLA 2CTVA 1IG0A 2WLPA 3PUSA 1OLQA 4WV8A 1NY71 1C5IA 3LFIA 4LBJA 2E7QA 1UU6A 2XVKA 5JDBA 2VE1A 4AVCA 3PDQA 1DLCA 4N43A 3S6PA 2D6OX 1V9U3 2PYTA 3M3IA 2PLV1 1W2UA 4OUMA 3ILFA 4DY3A 1R1A1 1N47A 4JDNA 5BY5A 2BVVA 3I2GA 2VOWA 5HCHA 4XJ9A 2X29A 5AC91 3I2JA 1FPN2 5FXZA 3BCWA 4AVTA 3TRSB 1SPPA 3IMNA 3SLIA 4CVUA 5BNNB 4I2OA 5C3QA 2VZVA 4XFIA 4O7XA 1ZRFA 1LESA 2CWSA 2XMLA 4MGTA 3I49A 3WNKA 2YROA 1SBDA 3B7MA 2B8MA 4XFCA 3OGVA 4YRDA 4XIKA 2VZPA 4AQ2A 2J1VA 5KC5A 4Y5SA 2VOKA 2BQPA 4P9WA 4ARYA 4RHV2 4V1PA 4MYEA 2ZA9A 2RJKA 5C4WC 1ULPA 2GP5A 4MGYE 4N90A 3O1TA 5FPLA 1IGOA 1P8JA 2GH2A 3CDZB 4XFBA 2ZKNA 4NJ4A 4N9IA 3I3QA 1BK0A 1HW5A 1S0EA 3AKSA 5GZDA 4CEWC 2AUYA 2W3JA 2XGXA 2R30A 3LPFA 3N9PA 3ATGA 3T08A 1RHI1 1RUJ1 2PHUA 1H1MA 4MVTA 4BXSV 3FFZA 1UYXA 3NV2A 2WNUC 4CUGA 1JZ5A 5A3NA 2ARBA 2WYFA 5DUUA 4ZPIA 2Z5WA 2EIDA 3I3BA 2B42B 3J4UH 4XUTA 4F7ZA 3AMHA 3K48A 4UYBA 1C1FA 2IWGB 2NN8A 4EZHA 1F15A 3KB5A 1NX9A 1ZBA1 3VBOA 1YHFA 3VBHB 2XVLA 4JHZA 4YVSC 2WFF3 3U4SA 1H6XA 4PDWB 4QB2A 5FZDA 1C8M2 1W99A 3PJQA 4FAGA 5BNQA 4DY5A 1JHNA 1CAXA 2QQLA 3VHOA 1TME3 2PELA 3LAGA 4N53C 1RUD3 1W2NA 2XUMA 2D7FA 2XBO1 1H6YA 3R4SA 3KGLA 2ENRA 1X8EA 2OPWA 1HRV1 5CIRA 2Y38A 3HNBM 1REEA 3VZLA 4R9DA 5GLVA 4LNVA 2ZKLA 3ORJA 5IAVA 2EIBA 2WO1A 4MZUA 4XJUA 4LBQB 4KBZA 3M2MA 4LORA 1AYN2 4ZHNA 3ROUA 5FO8B 4BDVB 1RUH3 3OY8B 3EQEA 4EE2A 1ND2B 4BA6A 2ZCWA 1OQ1A 4PI2A 4XBNA 1AYM3 2Y34A 1FOD3 1QOTA 4XDOA 5F3IA 5JXJA 3GZAA 3JB8A 3KCYA 1QDOA 2GNDA 4JHTA 4CU9A 4Q26A 5LASA 1GBGA 2DCKA 2ZX1A 1JU4A 2RMU2 5BXXA 1OFNA 3D0SA 1O3QA 1OD3A 5IK7A 4I30A 1Q8QA 5LB6A 3WDYA 3VKMA 1AL0G 4QAWA 5C9AC 2CWMA 1JUHA 2QQPA 3J7MA 1QJEA 3H42B 2B7YA 5L7OB 3F95A 1MPXA 1MACA 2WS91 4XF9A 2OPKA 2LW8A 1UX7A 5JMCA 5FYCA 1QJY2 1RUG2 4I0WB 4FI9A 3VHPA 4YFZA 1ZX5A 4GMP0 1GZ9A 3V56A 1MVEA 2JD4A 3JZVA 4XILA 1W8ZA 1K42A 3H0OA 2ID4A 2PN5A 2VNVA 2A3XA 1PM7A 3MIBA 4GWIA 4J6GA 5FO9B 3FHQA 4Z92B 2IUWA 5FREA 2ZEYA 1O3RA 3ZSMA 4ES8A 1OVPA 3ZSKA 2UU8A 4JGZA 3ST7A 2D40A 2WNVB 3BI3A 4XURA 1MS1A 2ZACA 3J8F3 1W05A 3OPZA 3PLQA 2WDBA 3BTYA 4Q27A 1AL23 3B94A 4HBNA 5JI9A 4LKSA 2NMNA 1K5MA 2R043 3AMNA 2JG8B 5AVAA 2VU9A 3EHKA 4Y22A 2KA3A 1STMA 5DZEA 3Q8FA 4MH0E 2EXKA 5FP3A 1JW6A 3C7FA 2KM2A 2ZGQA 4MXWB 4QQLA 1RUOA 2PHDA 2AEYA 1UU5A 1QJU3 2Z79A 2ATFA 3JQWA 3ACFA 1W8NA 2W1QA 4HN1A 3SNMA 4RR3B 3Q8AA 5FLIA 1YIFA 1DQ1A 3AXDA 5CG8A 5FZGA 1AR73 3VL8A 1O8SA 5A3TA 2DUOA 2VOXA 3CHXA 3P3PA 1APNA 4Q4V3 3B9IA 1B35C 1R082 5CBLA 4K9SA 4LQRA 1UY4A 1WCUA 1ZBE2 4YARA 1XE8A 1H4HA 3T0DA 2HWB3 2ZBJA 3UK9A 3POIA 2Q8DA 4CDWB 1VLNA 1SCRA 1YFWA 1VBA3 5A1FA 3WSOA 4HKOA 3WNMA 3OSDA 2BGOA 4QX0A 2X5IA 2BWAA 2DWRA 1W6QB 2AEZA 1IQDC 3C7OA 3E5UA 1POV3 1GWLA 3T2OA 1BCXA 4OQ9A 2O8OA 3EB7A 3ZYGA 2BU9A 1VRBA 4COUA 1R092 1RIRA 4QPYA 5LEKA 1WCDJ 3TN92 1ST8A 2VUJA 4GMP1 1RGSA 5DN2A 4OI2A 4LA3A 4UOJA 4BQ5A 3BALA 4I0AA 5AVPA 1NCRA 1JU3A 5LATA 3U10A 1QH7A 3ZFEC 3ELNA 5HXMA 1GWMA 1JYWA 2JWPA 3ZIXA 5JVVA 4OHVA 3MIHA 4QKNA 1NXMA 3RI9A 3AK0A 4HPKB 2UWBA 1UF2C 2PHWA 4IW3A 4H14A 4QPGA 5FZ9A 3OYWA 4QGNA 3VZKA 2WT0A 4OHYA 1SFPA 3D3AA 1DHKB 1XSRA 3H50A 4WVMA 1PIV1 4YSFA 5C3OA 4EN9B 3HT2A 1CAWB 1WCKA 3JBG3 1UPSA 2ARCA 2HEVF 1S0BA 3NJVA 3PTRB 4M3CA 4FAHA 1K3IA 5LA0A 5ERLA 3PVBB 4E4SA 1UW8A 1SMVA 2R061 5B4XA 1TMF1 5JUVA 1NCQB 5F6KA 2YDEA 3KHCA 1PO21 1QXJA 3NNFA 3S5QA 4LBNA 3EO6A 4OUEA 3NV3A 2K46A 5CB7A 4AZZA 1J59A 4RN5A 4QPIB 2XL9A 5KHIA 2CAUA 1DZQA 2UYAA 1NA1C 1US3A 2R071 1G9AA 3A21A 3MW2A 1L7QA 2MPFA 4XTMA 2CGOA 1YQ5A 4DB5A 4IV1A 1QJX2 4IEZA 4KWKA 4H3WA 1QY4A 5A3MA 5FJHA 2XJTA 1A6CA 5KHHA 3APBA 3FE5A 4CDQA 1AX1A 3RRDA 3IB3A 1PMHX 4Q4Y3 1Q56A 5DUWA 1N1TA 2ZMNA 5FZ3A 1ENSA 4OI0A 2R32A 1N3OA 5FAXA 3VBSB 5J37A 4OI4A 4QM8A 4IV3A 5E88A 5EQUA 3LA3A 4LO5B 2Y6HA 2VCAA 1PGL1 3AJYA 2GMEA 1LOEA 1UZVA 5FZIA 1XE7A 5E89A 4HONA 1WZXA 1XRUA 1HRI3 4FPCA 4EV0A 1BEV3 3CU7A 3LD8A 5FLJA 1AJOA 1H2NA 2DFBA 4A41A 2E33A 5BYNA 5JXHA 1WMDA 2DTYA 2JENA 1FMD1 2YXSA 5A3PA 4ASMB 4Q4W2 4AI2A 1Y4WA 4E4ZA 3KGZA 4BZ4A 1CPMA 1RB8G 1GICA 5H9RA 1KGYA 3CJXA 1AR83 1UOFA 4NPMA 1ALYA 4I02A 2DVFA 1VALA 2YFZA 4CP2A 1JZ4A 3ZFFC 2XR4A 3NNJA 3S7EA 1VE0A 4JGYC 3OCPA 2VTXA 2P17A 1LU2A 1RC6A 3DYMA 5ACA2 5JPNB 3DPRB 3H1MA 3WVJA 4NN0A 4Y1VA 3HIFA 3VKNA 2ZEWA 3KD4A 3V0BB 1UO9A 3V0AB 1F9KA 5DAWA 1JYTA 2QZ3A 2WAOA 1EV11 3B02A 3N7LA 2DTWA 1I5PA 1RUC1 2JDUA 3T30A 4RA0A 2OKXA 3VBUB 3T09A 3WQ7A 2UURA 3KF5A 1SFYA 3MIEA 4CU7A 4OCTA 3O0VA 2VO5A 4JTNA 1R1ZA 1CQ9A 4YG0A 4DQAA 3NVCA 5CKQA 1FYUA 2PA7A 2LALA 4N7UA 5D2AA 4XAEA 1AYN3 3UT0A 2VNOA 1VBB1 2A1XA 4BQ3A 1VBD2 4NO4A 2LTNA 2Y6GA 5FZOA 5FYSA 1V6OA 1ULFA 4L9BA 5L9BA 1H8VA 1NYWA 5FUPA 2Q30A 1HXS1 2VM9A 4CCJA 4YYOA 3MFCA 2Q4SA 1IS4A 1UKRA 1HQWA 5I0DA 2CDPA 3D82A 3K46A 5D8AB 2VCCA 5DAVA 1W04A 4GKYA 4NIDA 2LS6A 1QOOA 2XLAA 4OFGA 1AHSA 3VD9A 3VZOA 1QIQA 2VPVA 1O4TA 3PU3A 3KLSA 2DYCA 5FPUA 3WNLA 2JB8A 4V2WA 2VZQA 4CEWA 2WRAA 2XJSA 3T1MA 1DP0A 2CL2A 2RS32 4WM8B 3HNMA 4AGVA 4AVVA 3NJYA 5FJKA 1AR61 1WW5A 4RGAA 3RZZA 2RDSA 4FFFA 3U4XA 3FBYA 4Q5OA 5A6ZA 4UFJA 1GYKA 2XONA 2WFPA 1XNTA 3FLTA 3I59B 3UV9A 3ZXKA 2Z2SB 2WAAA 4YGEA 4Z2AA 1O4ZA 1PO11 3O1OA 1V9U2 3MYXA 1J3PA 1V6JA 1XOYA 4GULA 2MEV2 1GQPA 5A1LA 1X7NA 2XDVA 1UMIA 3HEIA 3MF9A 1RUI3 4GJZA 5FP4A 5JOWA 1D0HA 2V73A 2P34A 4PQQA 3RG0A 2LM3A 2WL1A 2WZ8A 1XNAA 2VGDA 2YMZA 3NKGA 3WDWA 4NR1A 4P5YA 4PCRA 5IVVA 4CDWC 3JCIA 1RJ8A 5LCWL 1TNRA 1J3QA 1W9YA 3D4KA 4WZFA 4FOWA 4QU1A 3N7JA 3S5AA 4A44A 3LA7A 1U5ZA 4IE5A 3SH4A 3NQHA 3VD5A 3GBGA 4L99A 2AREA 5FY7A 4OUSA 2GNMA 3FLRA 4AWDA 5F2SA 2PHRA 4Y5TA 2WSVA 2B4KA 2HWF1 4Y1ZA 1VAVA 4AI3A 1RVF2 3ZN6B 3IAPA 5FZ0A 4IE6A 4CCLA 5FZFA 1VBC3 4FQZA 5ABJC 1MEC1 1WLDA 1WWYA 1ZA4A 4HANA 1NQJA 1GNZA 5FYBA 4AI9A 1QWRA 2A73B 3U11A 5JOXA 2VUDA 1XC6A 1R083 5IVFA 4PI0A 4LLOA 2V72A 1NLSA 4BWOA 1K5JA 3N35A 3NO8A 4BQYA 1LHNA 2P3IA 5FZ4A 4FFHA 2WZR1 2Y0IA 1OBNA 3MV01 5IUQA 2GSYA 3T3YA 2BBAA 3H1YA 4S2DA 1XJAA 1NOVA 4XQWA 3SXWA 3SEPA 4EN6B 4M0HA 1A34A 4CE8A 1LAJA 1V6IA 5IK5A 4N7IA 5CFCA 5DUVA 2D6MA 1S1AA 5C4WB 1R093 1RUE3 5KXEA 2RM22 3MEPA 1S0DA 3LCPA 1TME2 3SKJE 1UNBA 2IFWA 2UY9A 5FMOS 5F7UA 2W39A 2TEPA 1OPMA 2DU0A 3INAA 3ON7A 2JDZA 4QPIC 3USUA 4BB3A 3POFA 1PK6A 2QDNA 2QJVA 3I3EA 3RFRA 3LPGA 4Y26A 2WNUB 4Z82A 2DVGA 3ITQA 3RYRA 5DZFA 2PHTA 2VW1A 3O0WA 1IHMA 5TSWA 5LZ6A 4M01A 4LJHA 1OOPA 1VBE3 3AVSA 3AP7A 4JAAA 1S0IA 3H7JA 2ZAAA 3IM0A 3R6SA 1FT9A 2X10A 3K3NA 2QDRA 3BPSA 4YVSB 5L73A 5I91A 2ORXA 4X6RB 1CAUA 2HWD1 4CU8A 1LHUA 4GD4A 1MZEA 2WWJA 4HKWA 4JQTA 4GWJA 5FPZA 1XNKA 3EBRA 5C3PA 5JMOA 4N53B 2QCSB 5FZMA 4JDOA 4UFLA 1COV3 1FATA 2QQVA 5A32A 2EIEA 5FPXA 4XAAA 3M3OA 4KI5M 4K20A 1UOJA 1Y9GA 3OEBA 1RUJ2 4A4AA 1VB4A 3SISA 3GM8A 4DRRA 5JOYA 4C91A 4YZ3A 4Y3OA 4ZS3A 3SCHA 1QJX3 5IJRA 2GC3A 4GZ9A 3VBFB 4NHXA 1D0GA 5CA6A 4CCCA 3H8XA 5FZ7A 3EYPA 4TYSA 5F5CA 2RDRA 5FP9A 1KXGA 4Q8KA 1YI7A 3X29B 3ACLA 4XFGA 4AFBA 1ONAA 3WW4A 4W65A 1PM4A 3LWCA 2O0OA 1PGW1 4KWUA 4A7KA 1UD1A 4EZ4A 4O65A 4BOWA 2WYSA 4MUVA 3ZM8A 5FZAA 1TZOA 5C9AB 1AF9A 3J8F2 2JD9A 1WW4A 1LU1A 4XTPA 1Q8SA 5IK8A 1AL22 4U36A 3T2TA 3GXUA 3AFGA 3ZYPA 1RJ7A 3P5BA 1DQ5A 2NMOA 2AH2A 4QX5A 2Q5TA 1CIWA 4C1WA 1HX6A 1W6MB 2J7MA 1LEDA 1ULGA 4Q4W3 4B1MA 1WMFA 3LOIA 1WCSA 1J1LA 2UWAA 1RMU1 4Q4X1 5EP9A 1DIWA 1LOFC 3RVHA 3WP5A 2RV9A 1C4RA 2WA3A 4AQSA 3M3EA 3MGUA 4ONUA 2IXIA 5C8WA 3GGLA 2FD8A 1BJQA 2VZTA 2Q0AA 2F6BA 4LITA 1US2A 4M00A 4YVWC 5CYYA 5GZGA 5LRSA 5BNNA 4QD2A 3BTXA 1SLTA 5GLTA 1CESA 2QQOA 4EN7B 3Q8BA 4MGSA 4FT8A 4CCOA 5ACA3 4IEUA 4D94A 5FBZA 3ZXEA 1X9PA 2HWE1 2HWB2 5A7OA 1MQTC 3H9AA 2ZHNA 4EN0A 2VMIA 3WINE 1VBA2 4MSVA 3GBWA 4XPVA 4XDPA 3WDTA 4Y20B 2A5ZA 2ZMKA 5K8SA 2VXJA 4YFWA 4OMCA 4YZ4A 1D4M3 2CGPA 1DBNA 1XXNA 2QQNA 2FDGA 3ZXJA 3LF7A 3VUOA 5K0UB 2ZHLA 5T55A 1YRZA 3BTAA 1NT0A 3WHUA 4EROA 3GCWA 4V2VA 3OOXA 4HSLA 1K45A 4QDQA 3JXSA 2VQTA 3ME2A 4IEVA 4Q0PA 2VMDA 2ZX4A 5BNOC 3VLBB 2GN3A 3WG4A 1B35B 4KBBA 3VBRC 5DAQA 4GXLA 4QHOA 4K6BA 2O1QA 4TTGA 4X6QB 3VN4A 3S57A 3AMPA 3GZEA 5FZEA 1W2TA 1ZZ6A 3VBHA 1W6PB 3LGRA 4PDWA 5F3EA 3WR0A 5C33A 2GP3A 2WQ8A 3SCGA 1LJ7A 5C8CB 3JBG2 4LE4A 3IDCB 1TG7A 4XVHA 5F5IA 5LBBA 1LODA 4IETA 3IIAA 5AFEA 5K7PA 3VDCA 4QQHA 3SKVA 3A4UA 3K4DA 4NRPA 5T5PA 3K4ZA 3WNXA 3AZXA 1UQXA 1EAH3 5D21A 2RR13 1W8OA 1I1EA 3N9OA 3PMSA 2R1BA 4CDXB 3QCWA 1KJRA 3HN3A 1OKQA 4LBQA 1IPJA 4LLFA 3ZFEB 4IE0A 4BIOA 3CLPA 2JB4A 4KG8A 2H0VA 5DQ0A 1ZRRA 3OY8A 3OGJA 4A6SA 1OQDA 1ND2A 1ULOA 5FZKA 5GLZA 4M3CE 3NMBA 2MEV3 1CONA 2QQUA 1DYKA 4MOAA 1G6NA 4YM3A 2D98A 2YBPA 1CIYA 2JDAA 1Q8VA 2BVBA 2FHRA 2Y0OA 4NVPA 1VRH3 1NE6A 5FY0A 5CAZA 4Q4Y2 1F35A 2E63A 3ZN5A 3D8CA 4KL1A 3WW3A 3GZUC 2G9ZA 1GKBA 5DDJ3 4P9LA 4WM7C 5DG2A 5JSPA 4BQ1A 2QE3A 2WFF1 5L7OA 3UESA 3AZZA 3URFA 4E8CA 4CUAA 5HCAA 2BJSA 1C28A 2P3JA 3CEWA 4I09A 4FPHA 3WOGA 4HOOA 1OUXA 1HV1A 4CA9A 1HRI2 1OSGA 4AEMA 4DINB 1UAIA 1BEV2 1NA1B 1RUD1 4W6XA 3ZFGB 1RVF3 2QTWB 4LKDA 2ETEA 4J1XA 4P08A 1QQP3 3CJIC 3KF3A 1OH3A 1UIKA 2B46X 2ZEXA 1YLLA 3TOJA 4YW1A 3RZGA 1W03A 4PHZA 1UZWA 2VW0A 2YBSA 1H1IA 3OBZA 3OBTA 2SLIA 3WG1A 4TLGA 1XSQA 1WLWA 3M7AA 4FPYA 4UF0B 1AR82 4ZONA 4IL7A 5FYUA 2WNVA 1U0AA 2HEYF 2ZOEB 2EALA 2X53S 1RUH1 1VPHA 3FHIB 1GOFA 3ZSLA 4KWJA 2VMCA 5EFUA 3E6CC 1AYM1 2RS53 3ZDSA 3AX4A 3LSEA 3WG3A 2XVGA 5A7PA 3A0NA 1PVC1 3HWJA 1LR5A 4OHZA 2JG8A 5DABA 5JXGA 1UN1A 5FP8A 4BPZA 4ZU7A 4QGMA 1SCSA 2GAUA 2W52A 2GC2A 1FV2A 4XQ4A 4LKFA 3H7YA 2EXJA 4D7SA 1RYYA 3RGBA 2RM23 2OX0A 5GZCA 1YJLA 1YFXA 2PLV3 3GJBA 4A7YA 3MZHA 1XQNA 2XLGA 1R1A3 4Q0SA 4FBFA 3J7NA 3DF0A 4RR3A 4UFMA 2ZHKA 4JX0A 1POV0 5FUIA 1IPKA 5AC93 2BWCA 4CCMA 2XLFA 3VGIA 4LOTA 5D1IA 2D5FA 4P14A 3O1UA 2GH8A 1JZ8A 1X82A 3A23A 4QKFA 4TWTA 1EPZA 2VQ0A 1SBEA 3ZFFB 5KHJA 4DXRA 1JTZX 4KH9A 2VULA 4JGYB 2W0XA 3VBFC 3ZYHA 1WA4A 2Y64A 3GHNA 4CDWA 4URTA 4S2HA 1LHOA 2A6XA 2HEWF 1BBT2 2OQ7A 1NZCA 4CPBA 2Q1FA 1UY1A 1IS3A 1BVP1 2EAAA 5FPAA 1W6QA 3UJOA 4XZPA 3E97A 3AP6A 2Y8KA 1CZTA 4N8MA 3WZ1A 4AFAA 1EYBA 4YWAA 2YGMA 2ZGSA 2WQ4A 4TSVA 5F9TA 4QT6A 3PNAA 4COWA 2R041 3DUIA 3FUQA 4WVZA 5FYZA 4UFKA 4OHXA 2XWJB 3MIGA 5FCCA 4GA9A 5T52A 2ZXQA 1RHI3 1RUJ3 5FFOC 3GBFA 2ZGLA 2OUHA 4M4RA 2DU1A 3ZXAC 3U1XA 5HV4A 1QH6A 2XOMA 4UW3A 1HN0A 3VZJA 2BGCA 4KQ7A 5FOJB 1T6BX 1BZWA 1AR91 3MF6A 4HKLA 3CO2A 4HPKA 2B45X 2JIJA 3AKPA 1ZBA3 3MIFA 5GLWA 1F5JA 3TYJA 1UOGA 1CX1A 1AR71 1J3RA 2F4LA 2JECA 1W9FA 1N1YA 1CAWA 4XJWA 5LRRA 1Y43B 4LHKA 4Q4V1 2DBIA 4LTAA 2SBAA 2C4XA 3MUY1 4K7JA 4UFIA 3NAPB 2OUJA 2WA4A 3O1VA 1JYIA 1VR3A 4BCUA 1XU2A 1H1AA 3OEAA 4L92A 4QXHA 2OZ6A 2C5DA 3HR9A 5HCBA 1BQPA 1NCQA 1RUI2 2XBO3 2YV8A 5SV8A 3ZPOA 4SBVA 3OBRA 3ILRA 1HRV3 3KSCA 1YQ6A 1E5SA 4ZS2A 4P9GA 4QPIA 1F4HA 4Q8LA 3RZLA 4YM1A 1POV1 1CZSA 2EIGA 2RS12 4Z8BA 1WLCA 2WUHA 2DDUA 1VBB2 4NHKA 3W21A 1HLCA 3C7GA 4CEYC 5BV6A 1DGRA 3HOBA 3ZMOA 4W4ZA 4A6OA 3AMMA 3IDEA 5K0UC 4QDRA 4I01A 1FAYA 3E5QA 4PF1A 2BPA2 3EMRA 1VBC2 4G9SB 1UYZA 2KR2A 3WD5A 1UX6A 3VBSA 4GH4C 3FMGA 4FXKB 3ZN4A 3RYKA 2XWBB 5J36A 1DCSA 2YBKA 1GV9A 2I2SA 4QPWA 3IN9A 2HBTA 3DXUA 5J1XA 1XNDA 1OHFA 4RQPC 1FXZA 1QJZA 2BNOA 1OLMA 2W2IA 4O9EA 4AQTA 3HPNA 5A3LA 1GZTA 1QF3A 2ARAA 2CYFA 2WJSA 3MIDA 4RS5C 4XDQA 3T2PA 3AYCA 3WUDA 4QX7A 3RNSA 1B09A 4AOCA 2VZOA 4E4DX 5C8CC 3N9NA 3TEXA 1WBFA 4MGQA 2ADDA 2EXIA 2WKKA 2FCVA 3VD7A 1RXFA 1RUE2 2I74A 3HT1A 3NJZA 3WNOA 4RL7A 5L19A 4XHBA 5FMCA 3WCSA 4LIVA 3I2IA 5ABJB 3ZXGA 4DMIA 1NXD1 4S2GA 2JDMA 1LTEA 4NE9A 4CDXC 1SEFA 1L7LA 3IIIA 4Y1UA 2P1BA 3W20A 4WVWA 1GMMA 2B9VA 2RDNA 5APAA 4D6RA 1JZ2A 4AHWA 1H9WA 1RINA 4UBGA 3DPRA 1YFUA 1ULDA 1LGCA 4HK8A 5CISA 5I0RA 4GALA 1FPN1 3I8TA 3V0BA 3V0AA 3FN9A 1VBE2 3ZXDA 2EA7A 2YB7A 5JZGC 1A8MA 2VZ1A 4XF4A 1W9SA 2A7AA 2ZGTA 3Q9OA 2NLRA 4E2SA 2GALA 3N36A 4NPRA 3VHRA 4UFHA 5DPNA 3VBUA 1JZ6A 2HWC2 4P9JA 4DUVA 2F4PA 2QZ2A 2WT1A 4IXLA 2PAKA 2ZS6B 3BGAA 5J3UA 5LW9A 4HVQA 3CZJA 3IPVB 1COV2 1GU3A 4RHV1 2VZRA 2IXCA 4XUNA 3S30A 4LIUA 2CHHA 3WX5A 4AVAA 5HI0A 4FOYA 4JC1A 2G9FA 4FSJA 3ES1A 4U2AA 1GOHA 2BRTA 2VMGA 4IESA 3ZFGC 3KMHA 3OF1A 3B3QE 4HXCA 1SLBA 1W90A 2Y6LA 4K21A 4MHRA 3P1IA 1IOAA 1OA2A 3KVAA 1V6LA 3JB4C 1XB9A 4IEXA 3ZKUA 3ZSEA 2HJIA 4JRLA 4ASKA 4CP9B 1OXCA 3ACIA 4YM2A 3SHRA 1CZVA 5D8AA 5JR2A 1XPWA 1ZYBA 2W94A 2IVJA 4XETA 1BLZA 5FY4A 2W87A 1PZ9A 3WF2A 1W39A 3MBWA 5H9SA 2QQWA 2ZMLA 2O8QA 3FC0A 4AEDC 1G7YA 3POYA 2Q8CA 2HH9A 3WDVA 5KR7A 3GDBA 4QXCA 4WVVA 1H8TB 4JQRA 4GMP3 1C8M1 2D6LX 2YY1A 3ACGA 2W1SA 3JD71 2JDHA 1YNAA 3ALQA 1W9TA 1D7PM 1E57A 3PVEA 4KNCA 4WM8A 2E31A 4LUMA 4B4PA 1GQGA 1GP5A 1QDCA 4TN7A 5F37A 1Z0HA 1OC1A 2Q8EA 2I07B 4AAPA 3RZKA 2YFUA 1WW6A 3AP4A 5C3RA 1ENQA 1NKGA 2XJUA 3EXUA 3NSTA 3I59A 2JKXA 4QKDA 5EZWA 4EYUA 4GKXA 1PIV3 3VKLA 4YGDA 1L3JA 2IXHA 2PHXA 4BQ2A 3TEZA 2VH9A 5LBCA 5EHDA 4LHNA 1EPWA 1AYN1 3LEIA 4FCAA 4QDSA 2R063 1T6GC 1D4VB 1VAKA 3MDPA 1TMF3 4UW5A 4Z07A 4UBHA 3LDBA 4TLFA 1ZVFA 5T5JA 4Q1PA 1YC61 1PO23 2G1MA 4N9HA 1FI2A 2X05A 3THDA 3LOBA 3DV8A 5CVRA 1OVSA 1CVNA 2VOTA 4L97A 4LT5A 2R0FA 2RMU1 3O14A 2WC2A 2VBPA 4YW3A 1WUVA 3ZYRA 4LPLA 3FZ3A 2ZZJA 2R073 2ZPXA 5EWSA 5A3UA 1G8WA 4EJRA 4BMEA 5LY1A 5F3GA 3MPBA 1PGSA 1KFXL 1JYVA 1PZ7A 1QEXA 3ZN6A 4AEJA 3IBMA 4FQ4A 4AI1A 3RMXA 1BK1A 2K2SA 4PQ9A 4COYA 4LBMA 1D4M2 3QH6A 3N4MA 1E5HA 1QJY1 1RUG1 2OS2A 3W9AA 1XBFA 2HYXA 2XJVA 1YYNA 4Q29A 3C2UA 3U14A 4YVWB 3RJRA 3TNPB 3PMEA 3T4HB 1PGW2 4JV4A 2PQSA 3UJQA 5BNPB 4BQXA 1VMFA 4EWAA 2BYVE 2DV9A 4WVMB 4XF0A 4P9XA 4ORFA 3I2KA 2ADEA 3KV4A 1BBT3 2FMDA 2ARXA 2WO3A 1IPSA 4HFSA 5DAPA 5IVBA 4MGKE 4Q0VA 1MQTB 1CGPA 2A6WA 5JI7A 4F83A 5FWJA 3PJYA 3H8OA 4SLIA 3NAPC 1S0JA 1OUSA 1FMD3 4E27A 5CEHA 3LFMA 1DQ6A 5FYVA 5A33B 4RYDA 5C4WA 2GN7A 3BOPA 4CUBA 3NV4A 5GLUA 3K51A 4YZ1A 4TXWA 3VHNA 1DZTA 4IDZA 5F8PA 2GC0A 1J83A 3KM5A 4HN0A 1DYPA 4KGGA 1IKQA 3TEWA 2CDOA 1TNFA 1EAH2 2G9GA 1AJKA 2RR12 4AQ6A 2R0HA 1DZRA 2WNUA 1EP0A 4R9AA 4AR2A 5DG1A 1S2KA 4AW7A 5T5OA 5BNOB 1AX2A 1QU0A 4B8EA 4EWEA 4AF9A 1PHMA 3VBRB 4CDQB 3FWEA 4AAXA 4XFAA 5EPAA 5SV5A 3LB9A 2JDYA 2WWUA 2OYZA 2PFWA 2VTXJ 4YW7A 4YVSA 1R081 5LK5A 1EV13 1N1VA 4IGPA 1MS8A 3WEZA 1ZBE1 4YW6A 1RUC3 2ZX2A 4X8NA 3DYOA 1FV3A 2WZEA 1V0AA 3N3HA 1VRH2 2VOVA 4N53A 3VBOC 2RVAA 2RHPA 1BMV2 1MS4A 1O5UA 3ZIWA 5DDJ2 1UYPA 4W6YA 3MUZ1 5GKAC 1F5FA 4FPGA 4MGIE 4COVA 2RS13 3POWA 5FO7B 3AKRA 4DOUA 1S2BA 5FBJA 4XJ8A 3SCFA 1ASJ2 1VBB3 1R091 2E7TA 3LZZA 3THCA 2D5HA 3UGFA 1CPNA 4QQOA 3TN91 4YM0A 4NRMA 4FOQA 3VBFA 4AGGA 1U5IA 2PTMA 4QQPA 4DXZA 1XNCA 1UZZA 1HXS3 4H2AA 3GYDA 3OGGA 4XF1A 1CJPA 1Z7S2 1QQP2
chains in the Genus database with same CATH topology
3MW4A 2GDFA 3WT3A 5J7MA 3OD0A 4BLJA 4BLIA 2ET7A 1OA3A 4R4ZA 1N1SA 1Q43A 2H6BA 1RUF2 5C9AA 1QGLA 4WM7B 2EVXA 1WMEA 2RS52 4GB31 1YXWA 2VNRA 4RGGA 1AR63 4Z1VA 4D3WA 4FPJA 3VZMA 1Y9QA 4IEOA 4XMAA 2BTVC 3FX3A 4UW6A 1NY72 1W6MA 3M3CA 4HL0A 3GNEA 3ENRA 1KDMA 1PO13 1W0OA 3CJIB 3WV6A 2PLV2 3MICA 2D6PA 1HV0A 2PHFA 1W6OB 5FQ0B 4DFSA 1R1A2 2LUWA 4A3XA 2H6CA 3ZVXA 4FTSA 5AC92 1QJX1 5JWPA 1LULA 3H1WA 1DFQA 2CV6A 1AUYA 5KXBA 2XHKA 2MNGA 4ZKTB 1REDA 5H9QA 4TZDA 3UKTA 5GM0A 4JGZC 1BYHA 1NE4A 1ZM1A 4Y20A 3TBDA 1DG6A 5T5LA 2VVEA 2BEOA 2HWC3 1K5MC 4LEJA 3SH3A 1YIPA 1LKNA 1H8TC 1MEC3 4OI1A 2NM1A 1FNYA 5K0UA 3BPZA 2B9UA 4BH9A 1Y3TA 3SMHA 4ZU4A 2JX9A 1H4GA 3BODA 4Q4W1 4GQ7A 1RHI2 2NP0A 1IZ3A 3NW4A 1KQRA 4FXGB 2CNAA 4Y5Z0 5T54A 3CF6E 1B35A 1YI9A 3AM2A 4DRVA 3B00A 1YWKA 2A71A 2WLQA 2QNKA 4Y4YA 4YGBA 2E9QA 3J26N 1W6PA 2DCJA 2XJPA 1ZBA2 1QNWA 1W6NB 1DGWX 4B4QA 1WD4A 5C8CA 2GMPA 3ASIA 1CN1A 3BU7A 1S0GA 4YW2A 3MFAA 5ACA1 1KD7A 1JH5A 1ULEA 5C6CA 3AB0A 3L2HA 3KZ4C 4ISRA 3WW2A 2X5IC 5JSRA 2XBO2 1AXKA 4OHWA 1HRV2 3ZYIB 1DGRN 2CAVA 4CDXA 1QKQA 1VIWB 3ZFEA 2BW8A 2WT2A 4B7KA 4CYDA 5FDBA 4AFMA 5GJ6A 2HYKA 4LULA 3H8UA 1LENA 2I45A 4CP0A 5FRAA 3DGTA 1LHWA 1QXPA 4YG6A 2EXHA 1J1TA 2WQZC 3M4FA 2HWD3 1V6NA 1VBD1 1GZWB 4PJYA 1OLRA 2ZGPA 1O91A 1WLTA 4QPGC 4CTEA 3AZVA 5BNPC 3QACA 3ETQA 1U12A 4PBPA 3S7IA 1C3HA 4W6WA 4XBQA 2VVDA 2UYBA 1ND3B 2WS92 3AZYA 4I0BA 1MS5A 4JDMA 1URXA 1NA1A 2C1FA 1S0CA 3AYAA 2A6ZA 3ZPYA 2IZWA 2RS31 4CEYB 3RDIA 2CGNA 1FX5A 2XB6C 2A6YA 4ITCA 5DXDA 4LBLA 1CAVB 4IV1C 2OZJA 4FPKA 2Q1ZB 3L2YA 1ZZ9A 4GH4B 4YFZA 2P2KA 1LOAA 4XFHA 1V9U1 4Q0UA 4CDQC 2ERFA 2E53A 3ZX7A 3THPA 4IQPA 2GMMA 4RQPB 2VW2A 3SITA 5FLHA 2V5YA 2D97A 1J58A 4IV3C 4ASLA 4RS5B 2VMHA 3G6JB 1RMU3 4Q4X3 4AFDA 5KXCA 5JLVA 1Q8OA 3USSA 4Y1XA 3PTYA 1LECA 4ATEA 2IC1A 4QXKA 3PHMA 1RVF1 2PAEA 5I93A 3AXEA 3ZFFA 1V6MA 2E51A 4UW4A 4B29A 4JGYA 4XMIA 4AG4A 5T50A 1GANA 4OZXA 4AHXA 2DUPA 4XBLA 3RMYA 4PIZA 3OD4A 5JZGB 3B5LB 3POSA 1DQ4A 4K1ZA 1AXZA 4YGCA 1ZNPA 4I3GA 4AXOA 4KU8A 1UZYA 1SLCA 1OFSA 5J98B 4BE3A 4AYUA 5EYYA 3TWIA 4NOTA 2D6NA 3UKVA 1ASJ3 3RWNA 1DDLA 1SLAA 2QVSB 2RM21 3AMQA 4OVEA 5FMOL 1TME1 4FPEA 3NWKA 3PVOA 1Z7S3 2C9AA 1WGPA 1CX4A 3BIWE 2XKPA 1V70A 4ISQA 1BKZA 2JG9B 1PIV2 5DUXA 5GALA 3WLUA 3HBZA 3NAPA 4H7MA 1NLRA 4K40A 2AR6A 3HN1A 2X8KA 3N7MA 1RUF3 5CFDB 2UY8A 2R062 3FBMA 4G3YC 4XHXA 4AEDB 1TMF2 1FOD1 1RITA 1EY2A 1QOSA 1PO22 3O0XA 3ZO0B 3JQXA 3WP4A 1V00A 2XH6A 3HD8B 1WW7A 4F8AA 5JAXA 3ZXFA 2R072 3GF6A 4L8QA 4E2GA 4MXWA 2AENA 1H30A 1ULCA 2ZGKA 2D3SA 1C57A 4AVSA 3VDDB 1UKGA 5KC6A 3HMYA 5KHKA 1O3TA 4HSJA 1UU4A 4Z2WA 4AI0A 1RTVA 5JCTA 4B3NA 5F1RA 2B5HA 2PQQA 5EYXA 2YC0A 3T1LA 2K0GA 2TUNA 4LBOA 1GLHA 1PGL2 3JD72 2JEMA 1ZZCA 1MZ6A 3M1HA 1M06G 3TNQA 2PHLA 4P5HA 4PBOA 1VP6A 3NL1A 5F5QA 5I8TA 3IWZA 4AHYA 3RI8A 2GU9A 3JUUA 3J8F1 3R05A 1FMD2 3RSJA 1AL21 4CDUB 2NPIA 1CR7A 4YW4A 2VQAA 3ZXLA 1H2LA 3D0JA 3W59A 4BHPA 5ABJA 2R1DA 3QOPA 1ZZBA 4OULA 2XG3A 4FVVA 1OA4A 4IERA 4N43B 5EXOA 3CL1A 1H2KA 3IDBB 5KHGA 3WW1A 1QJU1 4AE2A 3WHTA 1PVC3 2ZX3A 4GIQA 1UMZA 3VL9A 3VZNA 2ZGRA 1YJKA 4H7LA 1D2SA 2BFUS 5EV7A 3SH5A 2D3PA 1G9CA 2ES3A 4R8HA 3N7KA 1LB2A 5HXVA 4ES9A 2WINB 1EV12 2FZ2A 2W68A 2C0ZA 3M70A 1RUC2 3VKOA 2HWB1 4PLMA 1GNHA 1X36A 1UL9A 5KWRA 1VBA1 3UKNA 5T3NA 3IPVA 2OW4A 1AXYA 4MXVA 3B93A 5CFCC 1ND3C 4F3JA 1G9DA 1I9RA 1AZDA 1YCIA 1IKPA 1A78A 1HIXA 1PZ8A 4AEKA 1MVQA 1PK6C 1HXS2 1JXNA 1SLIA 4CZSA 4C0HA 3WP6A 4RSUA 4I3PA 4DS0A 1ZREA 1G9FA 1OOPC 4BYYA 2EAKA 2XL7A 4RFT0 1H8TA 3VBOB 1QXRA 4C0BA 4P9IA 4PLNA 4META 3RJ2X 4FO9A 2WS93 3V65A 3JBG1 4Y24A 4MX3A 1ZRCA 4BMBA 1CAXB 5E1RA 4XJAA 1AR62 1AR93 5GZEA 1I6XA 3AKTA 3A0KA 1U5YA 2DF7A 3OTFA 2P3KA 3WDXA 5JIAA 4FOVA 2A75A 4R52A 4Q2FA 2YHJA 1PO12 4LBKA 4IEPA 4B4RA 4KG0A 3UL2A 1QHDA 4UXAA 3TB0A 5JPMB 4LO7A 2RJLA 3P3NA 5GZFA 5LEJA 4MGZE 1KS5A 1KS4A 4NWVA 3G7DA 4D69A 2DCZA 2DUQA 1SFNA 2OA2A 4D7YA 4EN8B 3ECQA 2VXRA 2DVBA 4DNYA 1MZFA 3E6DA 4Q4Y1 2YGLA 1D2QA 1H0BA 2XPJA 2D43A 2VVFA 1DGLA 1Q3EA 2D44A 4NHMA 2ZGUA 3I54A 1UPIA 4E9KA 1F8VA 2HWF2 1OQEA 1LOFA 1N3QA 3M8LA 1G9BA 1C1LA 4LE3A 1GSLA 1LRHA 2N7GA 2DVDA 1HRI1 3KS7A 1MEC2 2YZ4A 1BEV1 3WG2A 4HK9A 4GWNA 4XE9A 5J09A 3WP3A 1O3SA 4YVWA 5I0TA 5DZGA 5FTTC 4FTEA 5BNPA 2A3WA 1XNBA 1BVVA 4KU7A 5JOZA 3FFQA 2WZR2 4GB32 2AYHA 1AR81 2KXLA 1HQLA 2R6QA 1MQTA 2JG9C 5BNNC 4YNIA 4JGZB 2A3YA 1G86A 3D5OA 5A33A 1YFYA 4C90A 1PVXA 1NQDA 5I8YA 2WWSA 5CFDC 4K1YA 1DQ0A 4FTBA 4K3UA 3MLKA 1K5MB 1LHVA 2P37A 4LBQD 2VNGA 4R9CA 2Z69A 4IEQA 4Y22B 5J96B 1HDKA 3FUOA 4NHLA 1W0PA 2GNBA 3M3QA 1REFA 2PAMA 5BNOA 4QGLA 3VBRA 4K8FA 1FPN3 4BM8A 2ZGMA 4IEYA 3W58A 3VDDC 2JJ6A 3KT4A 2NYYA 1OI6A 3U0ZA 2BBVA 2HWD2 4Q1RA 3AP9A 3KT7A 1BBT1 4HETA 3VBHC 1XYPA 4PDWC 4RHV3 1C8NA 1A8DA 2ZGOA 2X5IB 3GHMA 1PMIA 5EJ3A 1AVBA 2W08A 3GALA 4L11A 2NZ9A 2DCYA 1LOGA 4DZGA 3OJBA 3KQRA 5KBFA 3FJSA 4CDUC 3AP5A 1M4WA 1GZCA 3KT1A 4XYXA 1YO8A 1NCRB 2DFCA 2JICA 2WZPP 2BFUL 2R16A 4FP3A 1QNYA 1Q8PA 1RL3A 2BNNA 1ND2C 2WIIB 3PVNA 4N43C 4FP2A 3FLPA 5AFBA 4QPGB 3OYWB 3ZYJB 4ZU5A 1C8M3 4WM7A 5CADA 3JD73 1SACA 1CJDA 4M3CB 1X33A 4XJZA 5F6LB 4AHZA 4C1XA 1RUI1 1C5HA 4QU2A 1JBCA 1X8MA 2DCTA 1NG0A 5KXDA 5L7OC 4HT1T 1RMU2 4MLOA 3CJIA 4Q4X2 4XXPA 1DQ2A 2EF6A 4Q0QA 3AYDA 2RS11 1W6OA 3I4IA 4HLTA 5FQ0A 2E7AA 4HMZA 4LHLA 5BPXA 5FOBB 2Z42A 1I5ZA 4IV1B 3HQXA 3KCCA 3AZWA 4XOGA 3NKTA 2RMU3 1VBC1 4RD7A 4B7EA 2XKOA 5LK7B 2HWE2 4LO4B 2WNVC 1H2MA 4M3CF 4XF3A 4G4FA 4IV3B 4YZ2A 2A70A 2ZX0A 2GC1A 4A7ZA 1N3PA 1O5LA 4HZFA 5J48A 4MV2A 5JR7B 4HVOA 1A3KA 2JG8C 4LR4A 1QJY3 1RUG3 1LEMA 2ZABA 3D6EA 5I8SA 3WY6A 4LO6B 2V09A 4QM9A 4L2NA 4AGRA 2QFEA 2R49A 4O9GA 1PNFA 1TQ5A 4JRAA 2D93A 1RUE1 3QH7A 2TBVA 4RR3C 1TEIA 1Y7BA 1ENXA 2E6VA 2DVAA 3BB6A 4JCKA 3O7OA 1KITA 2D6KA 4H55A 2OVUA 4A2UA 1AX0A 4LO8A 1GR3A 1W6NA 5JIUA 3KCXA 4IEWA 1OMIA 3U07A 4YW5A 3H3UA 2GNTA 1ENRA 3DN7A 4YLZA 2ZHMA 2ZGNA 3EJKA 1MS3A 1VBE1 3AFKA 3H3ZA 4COZA 1SQ4A 1VB2A 2NQYA 3O12A 3RS6A 2HWC1 1SLLA 4XEZA 1QMJA 2FMYA 2ZJCA 1UIJA 4INDA 3CNAA 2BNMA 1COV1 2CY6A 3LKJA 3WQ1A 1ZRDA 2G4IA 3C3VA 4KGQA 2FBEA 3AKQA 1IS6A 3VV1A 1ZBE3 2A6VA 4WZCA 5I0SA 1HKDA 2QUOA 1GZWA 1XYOA 5E8AA 3MW3A 1GQHA 3MLJA 4AI8A 3MLLA 3WUCA 3ES4A 3RPQA 4Y1YA 2WFF2 5HCFA 3DL3A 3THTA 1ND3A 5IT6A 5BUVA 2RE9A 2VECA 2QKDA 1NCQC 3TN93 5I0UA 2IXKA 2ZZQA 4YG3A 1RUD2 4CEWB 2HWF3 2D3RA 4HVRA 2FQPA 4CEYA 4QHBA 1GFF2 1RUNA 4R4XA 1O7FA 1CAVA 3R4UA 3WQ0A 3L9JT 2AGSA 3O5SA 2Y26A 3HAGA 4GH4A 4QQ2A 2VUAA 1RUH2 1WBLA 4CP1A 1YUDA 1WD3A 3I7DA 2FZ1A 4AVBA 1VJ2A 2WZR3 1AYM2 4GB33 1FOD2 2OIIA 5L36A 4X8PA 1F31A 3B9CA 4RQPA 1LCLA 1PVC2 5JSOA 1TE1B 3VBSC 4FPLA 4ATFA 4RS5A 3QBQA 4GWMA 3AYEA 1LOCA 4XFFA 2BUKA 4XQDA 1KJLA 1VAMA 2AZ5A 5IK4A 4AK3A 2XJRA 1Z78A 4M0NA 1OPOA 5CNAA 3VKFC 4E2QA 1DF0A 2K9ZA 3GZTB 1HQNA 1UCXA 1JUIA 3MI8A 1JYCA 3NV1A 4JVAA 4EWDA 3ZSJA 1Q5OA 1D4M1 2TNFA 3E5XA 1KRIA 1S0FA 4YZ5A 1X50A 2JE7A 3ILNA 4XXAA 5HBAA 1NCRC 3QLQA 2IFRA 5JZGA 1MZ5A 3DKWA 4D7TA 3DPRC 1ZZ7A 4QMAA 2GZWA 2Q1MA 2R042 3B01A 4NWWA 1JOJA 1PNGA 2YUEA 1I3HA 2JXAA 2ET1A 1OD5A 4LUKA 5CFCB 1BXHA 3VBUC 2UWCA 3BOWA 1MS9A 1XU1A 2ZAHA 4PIXA 4DPNA 3ZFGA 4OLLA 2HKXA 1AR92 1QJU2 2B39A 3R4DB 2YPJA 4BIFA 4PF5A 5CU1A 1F2NA 1EAH1 1O4YA 3J9SA 1DGWA 2RR11 3USUB 4CRQA 1AR72 2JG9A 1PK6B 4LA2A 1V6KA 1JN2P 4S2FA 5H9PA 3RQ0A 1LGNA 1LGBA 1KDKA 3AJZA 4Q4V2 5E16A 4JTOA 3MPPG 5CFDA 2Q8OA 5B2GB 1OOPB 1KFUL 4AEDA 2IXJA 3WDUA 2MEV1 3LSDA 5D8AC 4FPOB 1U5XA 1CAUB 2H0BA 5K9YA 1IQAA 1XYNA 1VRH1 2YYOA 4WBBA 1CD3G 2MHFA 1SBFA 1BMV1 3S0MA 2WSUA 5DDJ1 5A32B 1DU3D 3TAYA 3R0RA 4P9YA 3ZMNA 4WM8C 5CG9A 4R9BA 3I2DA 2JKBA 3WXPA 4FPFA 3LA2A 1FNZA 2VG9A 1ASJ1 4XW3A 3VDDA 1MS0A 4ZXKA 1VBD3 2JE9A 3JU9A 1H9PA 4PLOA 1MR5A 1S55A 2ZTNA 1Z7S1 1QQP1 3WCRA 4XIOA 1LOBA