1BYHA

Molecular and active-site structure of a bacillus (1-3,1-4)-beta-glucanase
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
214
structure length
214
Chain Sequence
b'QTGGSFFEPFNSYNSGTWEKADGYSNGGVFNCTWRANNVNFTNDGKLKLGLTSSAYNKFDCAEYRSTNIYGYGLYEVSMKPAKNTGIVSSFFTYTGPAHGTQWDEIDIEFLGKDTTKVQFNYYTNGVGGHEKVISLGFDASKGFHTYAFDWQPGYIKWYVDGVLKHTATANIPSTPGKIMMNLWNGTGVDDWLGSYNGANPLYAEYDWVKYTSN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYBRID
publication title Molecular and active-site structure of a Bacillus 1,3-1,4-beta-glucanase.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Hydrolase
total genus 50
structure length 214
sequence length 214
ec nomenclature ec 3.2.1.73: Licheninase.
pdb deposition date 1992-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1byhA00
4LBMA 1LOGA 1MS9A 1DGLA 2BQPA 3WG4A 3ZXLA 2GMPA 2XG3A 3POYA 1MACA 1V6LA 3D5OA 4FPEA 4FPJA 3UJQA 3DGTA 3WDWA 2A6ZA 2CTVA 3M3OA 1N3PA 2PELA 2AREA 2ZHNA 2A71A 1QNWA 1GKBA 2UWCA 1S0IA 1S0CA 1MR5A 2R49A 3NV1A 4GKYA 2DUOA 2ZZJA 2ZAAA 4XYXA 5DG1A 1V6MA 1OQ1A 3AXEA 5CB7A 1N3QA 4ISQA 3WDTA 5KXBA 1UZYA 5AVAA 1HQLA 1GANA 3FLPA 5GLWA 4FPOB 4JCKA 5KXEA 2A6YA 2P34A 4YZ4A 5JOYA 3WHUA 2DVAA 3N7JA 5GZCA 4Q27A 4YGEA 1LGCA 5T5LA 4R9BA 3T2TA 1LENA 5BYNA 2PHRA 3ATGA 3OBRA 1W6OB 2UURA 4ZXKA 1Z78A 4U2AA 3W58A 3I4IA 4K21A 1W0OA 4Q26A 4Y20B 2LTNA 1VIWB 1W6QB 1JUIA 2FMDA 3SITA 2A3XA 1AJKA 2ZBJA 4P14A 2NM1A 2A75A 4BMEA 1RIRA 1PZ7A 1EPWA 3POWA 3VKMA 1JN2P 2A5ZA 4UW6A 4LBJA 3N7MA 4XJ9A 1S0GA 3AP9A 2ZMNA 3WDYA 1BYHA 1SLBA 2DWRA 3OPZA 4XTPA 4XHXA 3ZXEA 4BOWA 5HCBA 3MEPA 3V65A 1GZCA 1WW7A 1YXWA 1UN1A 4P9XA 4RA0A 2W52A 4K20A 3AJZA 2R1BA 3N35A 3C2UA 3V0AB 1WUVA 1YRZA 4DFSA 1LEMA 1LHNA 3ILNA 2WLQA 4WZFA 1LOFC 2E53A 3ZYPA 4U36A 2D44A 1LHUA 2HYKA 1WW6A 4YZ2A 5GZEA 2W08A 4FPYA 3IN9A 2E6VA 1ZA4A 1SLCA 1YIFA 3O0VA 1S0DA 2ZMLA 3ZSLA 2SBAA 1LEDA 4YGCA 2GDFA 2JE7A 1W6NB 1W6MA 4YG6A 1SBFA 1LTEA 4Y1VA 1MVQA 3ILRA 1WD3A 4YLZA 4FQZA 1GZWB 1F9KA 3JUUA 1AXYA 2ENRA 1SLAA 4NO4A 2YZ4A 2C5DA 5GJ6A 3JU9A 4Q8LA 5CA6A 1SLIA 2RHPA 4ITCA 2GALA 2D6KA 3O12A 2CWSA 2YXSA 4H55A 5EXOA 1MVEA 3IKWA 4AGGA 4DRRA 2DUPA 2B7YA 3WZ1A 3AP4A 3V64A 1Q56A 2DU0A 5FREA 3WUDA 3ZYRA 3WG3A 1C57A 2NP0A 1LJ7A 2DYCA 3ZXJA 3KQRA 1B09A 1V6IA 3OYWB 3TAYA 3VV1A 1OKQA 4YGDA 3R4UA 3NV3A 4KBBA 4M3CB 3AYEA 4FQ4A 1LOBA 4K1YA 4XIOA 2Z42A 1BJQA 5EYYA 1SACA 2CWMA 2DTYA 2JD4A 4TYSA 4YG0A 3LCPA 1QGLA 1C1FA 1MS1A 4F83A 4YW2A 1GZ9A 2VH9A 2AR6A 4YM0A 3N7KA 4Y22B 1SLLA 5E88A 3OY8A 2ZGPA 3V0BB 1Z0HA 1ULGA 2D3PA 2ZA9A 4LBKA 1LU1A 1WLDA 4LBOA 3FLTA 1ONAA 1C1LA 2ZABA 2SLIA 4Y1UA 1WLCA 1WBLA 4XJZA 2EIGA 4YM3A 5DUUA 1V6JA 2ARBA 5IK5A 2D6MA 3Q9OA 4XBLA 4ATEA 2DUQA 3FLRA 4XXPA 4FPHA 4CTEA 2D6LX 4JRAA 2TEPA 4GWMA 3RS6A 2ZACA 1VAVA 3T1LA 3B01A 2ZGUA 5DG2A 3PVEA 2JKBA 3MPPG 5DUXA 2ZHLA 3SNMA 3AYDA 1N47A 2D6OX 2ZGMA 2EALA 1FAYA 1W6PA 3BTAA 1OFSA 2AH2A 1NLSA 3OJBA 1SLTA 1O4YA 4GWNA 1RINA 1I3HA 3KM5A 2DURA 4XMAA 1GBGA 4HANA 3A0KA 5DUWA 1MS8A 3TB0A 3N36A 1CVNA 2PHFA 3POSA 3M3EA 1UAIA 1O4ZA 4IQPA 1R1ZA 1Q8SA 5KXDA 2P37A 2GNDA 4FP3A 1F31A 1BZWA 3IPVA 3H0OA 1JW6A 3INAA 5IK4A 3QCWA 4UW4A 1I1EA 4FPFA 4L8QA 2D3RA 4WVWA 3N7LA 3NWKA 3DUIA 4DRVA 3RRDA 2ZKNA 4YM1A 4XBQA 4XJ8A 1Q8VA 4LBQA 3SH3A 5H9SA 2NN8A 3RMYA 3U4XA 5IK7A 4FOVA 3UL2A 2D7FA 5DXDA 1UL9A 5JLVA 3O0WA 1LOEA 3A0NA 3MW2A 4M3CF 3ZVXA 1S0EA 2A70A 1GNHA 4XILA 1W6OA 1HLCA 1UZZA 3AZWA 4XMIA 5GLZA 2XB6C 2GMEA 4YW3A 2AENA 1ULCA 1AVBA 5GZFA 5GM0A 4CZSA 3IM0A 2GNTA 4M00A 4Y20A 3WDUA 1G86A 1URXA 3GNEA 1W6QA 2E51A 4YZ1A 1QOOA 5CBLA 2VXRA 2DV9A 4YM2A 3HR9A 3VKLA 1IS4A 1AXZA 1A8DA 1N1TA 2A7AA 1LODA 1DYPA 4PQ9A 1ULFA 5JVVA 1V6OA 5T55A 2Q5TA 4AGVA 2P3IA 4FPGA 2DVGA 5CNAA 3ZSMA 5GLTA 5DZGA 4Q8KA 1ULDA 2ZGOA 5L73A 1HDKA 2A6WA 3HN1A 3VKFC 4D69A 1TEIA 4UW5A 1MS0A 2R0HA 1ULEA 4GA9A 3ZPYA 4M3CE 3L2YA 3MW4A 5FRAA 5LK5A 4LBLA 1UPSA 5H9RA 4R9DA 4AYUA 2ZGNA 4R9CA 1X50A 1LOFA 3N3HA 2CL2A 3AJYA 4XDQA 2VY0A 3O0XA 5JMCA 3V0AA 1A3KA 1YYNA 2JJ6A 2GMMA 3OGGA 1DQ2A 1MS3A 1V6KA 2C9AA 3FFZA 2GN3A 1GSLA 1GNZA 3AZYA 4AVTA 1CJPA 1LESA 5EYXA 2JE9A 1DIWA 4LBNA 3ZSJA 4M01A 5JOZA 2P3KA 3B69A 4FPKA 3USUA 4NOTA 2VW2A 1SBEA 2ES3A 1W6NA 2H0BA 2WT2A 4Q1RA 1QKQA 1CR7A 1KQRA 2ZGSA 1AX1A 4GKXA 1FV3A 1F5FA 4W65A 2D6NA 2WJSA 4ISRA 2ZGQA 5DZEA 1Q8QA 5HCFA 5IUQA 2A3WA 3SLIA 2WSUA 4LBQD 2FHRA 1MS5A 1DQ4A 1S1AA 4ZKTB 1DYKA 4ATFA 3PJQA 3B3QE 4WVVA 1XQNA 4YW5A 3ASIA 4YW4A 5GLVA 3MW3A 2CYFA 3WDXA 2GNBA 1AX2A 1HKDA 3AX4A 4FPLA 1IS5A 1LOAA 2OUHA 1QOTA 4BMBA 4FOYA 1LULA 2D3SA 3B00A 4FPCA 1H9WA 2A3YA 3BODA 3FBYA 4CRQA 4M3CA 3FUQA 4XIKA 3AP5A 4XJWA 1Y7BA 4YFWA 4TZDA 1WCSA 4XBNA 3M3CA 2AYHA 2EXHA 2WKKA 5IT6A 1LECA 1LHWA 3AP6A 2A6VA 5DZFA 4PCRA 4Y22A 2VW0A 4PBPA 5H9PA 1NXD1 5JOWA 3CNAA 2R16A 5HCAA 2OUJA 4BLJA 2CNAA 1IKPA 2ZHKA 2YMZA 3SISA 1DHKB 4C1WA 1LHOA 1KRIA 2VUAA 3A4UA 4XE9A 1LGNA 1FATA 4Q1PA 5JOXA 5GLUA 2WNEA 2WT0A 5E8AA 3AP7A 2ARXA 3RQ0A 1CPMA 1BKZA 2AGSA 1DZQA 3NV4A 3VUOA 2P2KA 1PZ8A 1A78A 1YI7A 1G8WA 2VU9A 3WV6A 1DQ1A 3BOPA 1AF9A 3W59A 3WOGA 1BXHA 1AX0A 1QNYA 1WBFA 2R0FA 2PHTA 2WT1A 3ZXKA 2W68A 4Y26A 3R05A 1Q8PA 5T54A 1ENSA 1MZ5A 2JECA 3PMEA 3IPVB 1JOJA 3M3QA 2D43A 1GYKA 4P9YA 2ZGRA 2D6PA 5H9QA 3RMXA 1DBNA 1H30A 1LOCA 1H9PA 2WSVA 4XZPA 3T1MA 4AVSA 2GNMA 4Z8BA 4Q2FA 4AGRA 4XOGA 3AFKA 4Y1YA 1G9DA 3QLQA 1QOSA 2UWBA 4LBQB 1G9BA 1JYCA 2NYYA 4HL0A 1JYIA 3WG2A 2NZ9A 1JHNA 1SCSA 1G9FA 1QDOA 1DQ5A 5T5PA 1SCRA 4GALA 1GV9A 1VAMA 1ZM1A 2W39A 3OBTA 1DQ0A 1AJOA 1YO8A 4FP2A 2PHUA 5T5OA 1FNZA 1IS3A 3ILFA 3VKOA 1HQWA 1KJLA 4UW3A 4YFZA 3VKNA 5F9TA 3AZVA 2ERFA 2V73A 3AZZA 4K1ZA 4WV8A 3M1HA 1CONA 1LGBA 1SBDA 3SH4A 3UJOA 4BQ1A 2GN7A 3FUOA 1UX6A 2JDZA 2YV8A 4XJAA 1FX5A 3ZSKA 1CESA 4XHBA 4FOWA 3LSDA 1MS4A 4YG3A 1VALA 2CY6A 2DU1A 1IOAA 1PZ9A 1D2SA 2OVUA 3O5SA 1ENRA 4Y1XA 2UWAA 3WNXA 2A6XA 2E7TA 1W0PA 3WG1A 2DVDA 5CAZA 1G9AA 1WW4A 4XTMA 4DQAA 1QU0A 3ENRA 3GALA 1S0BA 4BPZA 3WUCA 4Y1ZA 1IS6A 2DTWA 5IK8A 1N3OA 1W6MB 4AVVA 3HMYA 3WLUA 4YZ5A 4XJUA 1KITA 4DPNA 1VLNA 1Q8OA 3APBA 3WCRA 4ASMB 3PVOA 4AWDA 4JC1A 2WQZC 3PVNA 1N1YA 1WLWA 1IKQA 4XXAA 5GZGA 1JXNA 1CN1A 1UKGA 3USUB 1N1VA 5GZDA 2EXKA 2YY1A 4OZXA 2PHXA 1GZWA 5DUVA 3WDVA 3AZXA 1KJRA 3BIWE 2AUYA 3WCSA 1AZDA 3UK9A 3D4KA 2NMNA 1LHVA 1J1TA 3B9CA 2UU8A 2ZHMA 5F5QA 5SV8A 3NV2A 1RITA 2NMOA 1N1SA 1CIWA 2EXJA 2R1DA 3AYCA 2V5YA 1V6NA 5T50A 1LU2A 4RL7A 1GLHA 1CPNA 1KDKA 5E89A 3SH5A 1APNA 2ZGLA 4SLIA 3AK0A 4YZ3A 2PHWA 4PF5A 1DLLA 1LCLA 3WHTA 1SFYA 1AXKA 3LSEA 3R4SA 2P3JA 5T52A 1FYUA 1U0AA 3OYWA 4R9AA 3ZXFA 1G9CA 5T5JA 1GICA 2LALA 4BLIA 4C1XA 2OW4A 3OY8B 2YROA 1CQ9A 1FNYA 1ENQA 4DS0A 1FV2A 5KXCA 1MZ6A 2EAKA 2KM2A 1S0FA 1BQPA 3AYAA 2E7QA 1D0HA 2G4IA 1G7YA 3V0BA 1KDMA 5EWSA 2VW1A 1UMZA 2EF6A 3AXDA 3M2MA 1DQ6A 4Y24A 1C4RA 2ZGTA 3RSJA 4BM8A 1DFQA 1WW5A 1QMJA 3RG0A 2I2SA 4FOQA 5GALA 1QF3A 3I8TA 1W6PB 2ZMKA 1WD4A 3IMNA 1V00A 2DVFA 4FVVA 1QDCA 1JBCA 1S0JA 2EXIA 4GXLA 4YGBA 4YW1A 5JDBA 4P9WA 3WVJA 4I30A 4PBOA 4MYEA 2ZGKA 3D6EA 2DVBA
chains in the Genus database with same CATH superfamily
4LBMA 3QBQA 4NIIA 3EJKA 2BQPA 4BHPA 2JDAA 1YNAA 2GMPA 1UWWA 3UGGA 3KV6A 2JG8B 1TVGA 1V6LA 3D5OA 2YG0A 2HEYF 4LORA 5IFTA 5I0UA 3UJQA 3WDWA 1WMXA 2A6ZA 2VVEA 3DCQA 5A3WA 5I91A 2JG8C 2XL9A 4X6QB 3OB8A 1QNWA 3VDAA 2VQTA 1S0CA 2MNGA 4YWAA 5JI7A 4A42A 1UYZA 2ZAAA 4ASKA 3POBA 5K8SA 3NW4A 4CCLA 4CU9A 4CCOA 1RMU2 3EMRA 5CB7A 5KHGA 1UZYA 1ST8A 4CCMA 4Y4YA 4NN0A 2IXLA 1NZCA 3N7JA 3HIFA 5C4WB 1ASJ1 4PLNA 1X7NA 3CU7A 4HVOA 2VOTA 2XWJB 3ZYIB 3T2TA 4Q4X1 4FXKB 5C4WC 5LEJA 4YVWA 2R32A 5EZWA 3U1XA 1JS9A 3BU7A 1VBD2 2HWB2 1XSQA 4L0PA 1T2XA 2HJIA 4AVBA 1E5SA 1QQP3 3H3LA 4Q26A 2LTNA 4JGZA 3ALQA 2E33A 1VIWB 2FMDA 1JUIA 3I2HA 2JICA 4J1WA 4ONUA 4HKLA 4QU2A 3SITA 2AACA 5FMOS 3AL6A 4E2SA 1CGPA 1ZBA3 3ZFGB 3OUJA 5LA1A 2MEV2 3B93A 4L92A 2ZTNA 5LW9A 1AUYA 1R1A1 5HV4A 5AFBA 1NA1C 3PU8A 4YYOA 3N7MA 3POIA 1AR92 5BNOB 3O1UA 1OH4A 1VBA1 1UIKA 1D4M3 2HLEA 3S5QA 2ZMNA 2Z4FA 1BYHA 4BQYA 1SLBA 1POV0 2DWRA 4EWAA 1MQTB 4NHMA 2LM3A 3LFMA 4JHTA 5HCBA 3CHXA 4P02B 1X33A 2WS92 1UN1A 3T4VA 1HJFA 1MQTC 1VAKA 2VZPA 3B9IA 5D8AA 5FUPA 2PLV1 4LT5A 2TUNA 1O8PA 2R1BA 2YYOA 2TBVA 3V0AB 1YRZA 3RZMA 3ILNA 2YUEA 4WM8B 4I02A 2W47A 4I2OA 3ZYPA 3I3DA 4QX2A 3VBUB 4A2UA 4WM8C 1RUJ2 4YZ2A 2R063 4XVHA 2PYTA 4JAAA 5KHIA 2Z2SB 1ZZ8A 1OLQA 5A7NA 3OUIA 3VBUC 3WQ7A 3IN9A 1PK6A 2E6VA 3PTRB 5JZGA 1SLCA 3C8XA 1AHSA 3O0VA 3CF6E 1BBT1 2ZMLA 3K51A 2MPFA 4LO7A 5FYSA 3U4SA 3ZSLA 2GDFA 2XPJA 2JE7A 1M06G 1SBFA 1LTEA 1MVQA 4QKBA 4ASLA 1F9KA 1NT0A 2Y0IA 4IEUA 1NUKA 2ENRA 4WVMA 1U5IA 2WFF2 2WNVC 4AZZA 3OEAA 2B4KA 3JU9A 4FFFA 3WP4A 4AQSA 3ST7A 2ORXA 4ITCA 2XDVA 3O12A 2CWSA 4JQTA 4ZU7A 3S7IA 1PGSA 3MF6A 5AC91 2B7YA 4FSJA 3AP4A 2I45A 1EV11 2VTXJ 2G9GA 3VHPA 3WUDA 3ZYRA 3VDBA 1O3SA 1EUTA 1WCKA 4OHVA 1LJ7A 1CAVB 2BU9A 3AMQA 4XABA 4BU2A 1B09A 1KGYA 2B8MA 2J1RA 2LS6A 2R043 2BFUS 1JOPA 2XBO3 4JHZA 4LTAA 4YGDA 4C0BA 1UXZA 2J42A 2RV9A 4E27A 3AYEA 5F8PA 1LOBA 4CEWA 5FLHA 3RJ2X 1VRH3 4XAEA 3MIDA 1MS1A 1WZXA 2RDQA 3WP6A 3PIGA 4YW2A 3SCGA 2RS33 1E5HA 4A3XA 4QX5A 1W05A 3RZLA 1A34A 4OUMA 3V0BB 2OA2A 2JDHA 5J98B 3NRUA 3HQRA 4A7ZA 1LU1A 3FLTA 1ONAA 2EIDA 2ET7A 1C1LA 4EQVA 2IUWA 5FXXA 1WLCA 2OIIA 2VZSA 4XAAA 4XJZA 4OQ9A 3RPQA 1JMUB 1V6JA 2VOKA 3RYRA 1AYN2 3MIFA 2D6MA 4NHKA 4X8NA 4XBLA 2PMWB 4FPHA 4CTEA 1AR61 1AL23 2D6LX 4JRAA 1ALYA 1U12A 2TEPA 4GWMA 3RS6A 2VUDA 1VAVA 2XJPA 3B01A 3KF5A 5DG2A 4AQ6A 4KWJA 4NPRA 4B29A 2ZHLA 2HKXA 3AYDA 3ZMOA 3ZM8A 3D82A 1Z7S1 4GWNA 3OJBA 5FQ0B 1O4YA 3RZGA 5DAWA 4LO5B 1RINA 3KM5A 1AR71 3WX5A 1GBGA 4S2FA 2IVIB 5ERLA 3TB0A 3J8F3 3N36A 4V1PA 4C91A 4KQ7A 3BPZA 1UY0A 2XVLA 4XCBA 2VMDA 4GB31 1VBB2 4B1MA 2GNDA 5FMCA 2IXCA 3ZN5A 5A32A 1H6YA 3SCHA 3H0OA 3HN3A 1JW6A 4D0QA 3O1RA 3QCWA 1GP5A 3HVDA 4XF0A 2FZ1A 3N7LA 3NWKA 3ON7A 4GMP0 1UOFA 1US3A 4DRVA 1O4TA 2YGLA 3ZXAC 5LZ6A 3I54A 3SH3A 3ECQA 2NN8A 4A7YA 1XU2A 2D7FA 2Y0OA 4AL9A 5C6CA 5DXDA 2W91A 4ORFA 1LOEA 5A6ZA 2CGNA 4KWKA 4ZU5A 3KWVA 2A70A 3B5LB 1HLCA 1UZZA 1WA6X 2CDPA 3GGLA 2GMEA 5A3MA 1AVBA 2F17A 3M3IA 3RJRA 3IM0A 3ES1A 3X29B 4O65A 4M00A 4Y20A 5C9AC 1G86A 1UMHA 5FUNA 2E51A 1COV3 2XUEA 1QOOA 2VXRA 2VZQA 1JZ5A 3HR9A 5A7WB 1JYNA 1AYM2 1N1TA 2YB7A 2A7AA 2YFZA 4XURA 5FYBA 1ULFA 3USSA 1V6OA 1VBE1 2Q5TA 4H2AA 3PJYA 5CNAA 2DVGA 3Q8AA 3ZSMA 4CDQB 2L9LA 4L99A 1ULDA 1STMA 2ZGOA 3H9AA 2A6WA 2QCSB 3F95A 3HN1A 2Y34A 2JG9A 5TSWA 5IAXA 2C4XA 2PQSA 1J3PA 4CDQC 4N43B 1TEIA 5JXHA 4I0WB 1MS0A 2XJRA 4CXWA 5KBFA 5A33B 3UT0A 4PLOA 3CBNA 4Q4V1 4AF9A 2RS13 2RS51 3ETQA 1CAXB 3L2YA 4N43C 5CEHA 1UPSA 2BUKA 4AEDA 4P9GA 2WNOA 4Q0VA 4XUPA 4CP1A 4I0AA 4R9DA 4Z07A 4XDQA 3AJYA 3ZXGA 5A1LA 2C26A 2RVAA 2VNRA 2XUMA 1YYNA 4FCAA 5A1FA 3ZDVA 4GWIA 4CDXB 3H8RA 1I5PA 3D3AA 5I8SA 1DQ2A 1O91A 2WZR3 3AZYA 4CDXC 3OEBA 1Q3EA 1CJPA 5A1AA 2JE9A 1DIWA 4WVZA 5JOZA 2P3KA 4FPKA 3MLKA 1LR5A 2RM22 2Z69A 3RWNA 2R30A 1FOD2 2AEZA 2W9XA 4NWWA 2ZXQA 4AVCA 1AX1A 1F5FA 5IVEA 3V56A 4EE2A 4EN0A 1QY4A 3HT2A 1QXPA 4IE5A 4OI1A 4Y5SA 4Z2WA 1QJZA 5JIUA 1W9SA 3EHKA 4FFIA 4GAZA 1LAJA 2VZ3A 1XNCA 2GH2A 2FHRA 3HEIA 4B7EA 2LRPA 2DCZA 4ZKTB 4RFRB 1HW5A 2ILMA 1XBFA 3JBG3 4R8HA 4YW5A 5GLVA 3VBRB 3VHRA 5BNNB 4IEYA 5JXJA 4D94A 1AX2A 4FPLA 3WF0A 1LOAA 4HMZA 1QJU1 5IVVA 1H8VA 1QOTA 3VBRC 4TSVA 2FCTA 2R6QA 2AEYA 4MGTA 2JE8A 3KT7A 4XEZA 4XJWA 4TZDA 5A3PA 4UI9L 3OGRA 4XBNA 3M3CA 5ABJB 2EXHA 2WKKA 3CQOA 5FPLA 5J96B 1ZZBA 4BQ5A 4BISA 3VD9A 4PBPA 5ABJC 3BU0A 1ASJ2 1OQDA 2VD7A 3NJXA 3ORJA 4XC9A 1XU1A 5JOWA 5ISLA 2HWD2 4Q4X2 2BERA 4XFIA 1ULPA 4CXYA 1IKPA 2JEMA 2C24A 5FPBA 3U0ZA 4HBNA 4LHLA 2BW8A 1LHOA 5FMDA 1K3IA 5A6YA 5I0DA 1KRIA 1YIPA 4Q1PA 5JOXA 2OZ6A 2J1EA 2WNEA 4CUCA 1ZBE1 3S57A 1OUSA 1ZYBA 3AP7A 4RQPB 4FTBA 5HCHA 3IAPA 2J1SA 3R0RA 2P2KA 4QPWA 2W92A 3VUOA 4RQPC 3BOPA 4FI9A 5SV5A 3WOGA 1AX0A 1QNYA 1TG7A 5I8TA 3A7QA 1H2MA 4E9KA 4BIFA 1PO11 3R05A 1ZZ9A 4Q4W2 2ETEA 3DEMA 4OMDA 4CU8A 1JOJA 1POV1 5FZ9A 1QJX1 1R082 2D43A 4ZZ5A 1GR3A 1QJY3 4P9YA 3M7AA 4AVSA 2G1MA 4YARA 4XZPA 2BYVE 1R1A3 1RVF1 2GC1A 5FZ6A 5C4WA 4Q2FA 5JUVA 1YLLA 3VD4A 2FDFA 1K42A 1F15A 3B94A 1QOSA 1ZZ7A 4KG8A 4SBVA 1M4WA 1VBA3 2C0ZA 1OPOA 2QNKA 2NZ9A 5CVRA 1C28A 1SCSA 3LEMA 1G9FA 1HV0A 4JZRA 1JU4A 3POFA 4GALA 2VBBA 3OBTA 1VAMA 4I01A 2W39A 3B02A 2YGMA 4QHBA 1YO8A 3ZYJB 5A70A 2PLV3 3GF6A 5T5OA 1FNZA 4UW3A 2JXAA 2YPJA 3VGIA 1NA1A 5FYMA 5F3GA 3ZKUA 3P3PA 4UFIA 2Y64A 3AZZA 4RGKA 2VNGA 1RUF1 2LW8A 5F5CA 1W2UA 2JIGA 4WV8A 1LGBA 1SBDA 4LO8A 4AI0A 1ZRRA 4AFCA 2VTXA 1BBT3 2YV8A 1JZ6A 4MOAA 2OQ6A 3I2IA 1PO21 3LSDA 1SQ4A 1E5RA 4D6RA 1IOAA 1PZ9A 1QH7A 2DBIA 1D2SA 5AFEA 1MEC3 1HXS1 3WNXA 3HPNA 2A6XA 5HBAA 4CP2A 2XVKA 4W6WA 5KC5A 3MUY1 1G9AA 1JOBA 1XNTA 4URTA 3GALA 3P3NA 1AL0G 1IS6A 1NCQA 1VMFA 2DTWA 3I2FA 1N3OA 2O0OA 5AC93 2QBXA 4YZ5A 3TWIA 4QD2A 3MYXA 2OQ7A 4LUMA 4S2HA 1VLNA 1Q8OA 1JUHA 3S30A 3VZMA 2XQXA 3PVOA 4WVMB 4AAPA 4AWDA 2HWF2 1PNGA 2HH9A 3J9SA 1EPZA 3KS7A 1N1YA 1OLME 3PVNA 4M4PA 1RJ7A 1XNKA 4N8MA 4XXAA 5F5IA 1UKGA 3U14A 4CCNA 3H8OA 2WNVA 3ZKYA 1X8MA 2QZ3A 1H2NA 5FYZA 2R061 1UO9A 1W2NA 1AZDA 4UOJA 1LHVA 1J1TA 3NNGA 2ZHMA 4R4XA 1BHGA 5SV8A 1HB3A 1RITA 2CAUA 1W8FA 1N1SA 4OLLA 4YVSB 2QQJA 2B5HA 4RR3A 4N7UA 3AYCA 5T50A 5FZ7A 1GLHA 1REDA 1OSGA 2HWE3 5FZ1A 4YVSC 1Y9MA 1AR62 2PHWA 3KCXA 4MHUA 1UKRA 1BLZA 2HBTA 1RUC2 3E6CC 3NJYA 2W1UA 1JYXA 1U0AA 1WLTA 1G9CA 4GH4A 4PHZA 3WF3A 3KVAA 3OGSA 1GICA 2OW4A 1LRHA 4M0NA 2YROA 4S2DA 4K7JA 3O1SA 3GBFA 1MPXA 1W2OA 5LK7B 5FZCA 4JDOA 1Z7S3 4LKFA 1L3JA 5J36A 2E7QA 3C7OA 2G4IA 2XBO1 3J7HA 3LF7A 4GB32 4C90A 2XWBB 3V0BA 3DYMA 4RS5A 1QIQA 5EWSA 1EAH3 3GBWA 3NVCA 5JXGA 1RUI1 1UIJA 1JH5A 1GP4A 1VRH1 4GMP1 4BM8A 1WW5A 2FCVA 4CCKA 1W2TA 5DPNA 2ZMKA 1WD4A 1X9TA 1H4HA 4YGBA 1W28A 1Q5OA 4Q4Y2 4P9WA 3WVJA 3MF9A 4I30A 1O5UA 1GOHA 1C3HA 2W1WA 2X09A 4UFJA 5IWFA 3WG4A 4NVPA 1MACA 4FPEA 3IWZA 1GU3A 3BPSA 3OTFA 4FPJA 3M3OA 5A32B 5JR7B 1GKBA 2XLGA 3OCPA 1S0IA 2G9ZA 4LJHA 1CX4A 3EBRA 4V2WA 4B8EA 5C5TA 1UYPA 2K46A 1PIV2 2JDMA 3AXEA 3NSTA 3WDTA 4CUAA 4LOSA 3GYDA 1HQLA 1J58A 2XKOA 2QVSB 1V70A 1OPMA 5JOYA 5KXEA 2DCTA 2VBDA 3WHUA 3CL1A 4MGIE 3A23A 4YGEA 1LGCA 5FPVA 5T5LA 1VBC1 2XVGA 4D3WA 1JYVA 1LENA 2XJSA 3ZYHA 5FDBA 3AMHA 1OH3A 1GUIA 1VBE3 1S2BA 5EHDA 2RS52 1WKYA 3ELNA 1UY1A 2DCYA 3N9PA 3NKGA 1Z78A 1PM7A 4U2AA 1O3QA 1W0OA 3M4FA 4Y20B 4IE4A 5I0TA 1O5LA 1WMFA 3OUHA 4A3ZA 4Q4V3 2JENA 4E4SA 1RUOA 3HBKA 3ZN4A 2NM1A 2YFUA 2D97A 1YC61 3H8UA 2ZEXA 1PVC3 1RIRA 3I3QA 4JV4A 3UESA 1JHJA 3AB0A 3BN6A 1ODNA 4QWNA 4LK6A 1CAWA 4XFFA 3URFA 2JG9B 5A7WA 2IFRA 1ZRCA 2BBAA 2XQRA 3ZXEA 1C5IA 2X8KA 2JG9C 3LIHA 4BOWA 2VTFA 4LE4A 1W90A 4CDQA 5IATA 2WZEA 3DF0A 1UZ0A 1XJAA 2PHLA 4FFHA 3BUCA 3AJZA 1BMV2 3IBMA 3J7LA 3VDCA 1WUVA 3THDA 5A7SA 2OS2A 1HB2A 4U36A 4IEXA 3VZKA 1WW6A 4YW6A 2QDRA 3DXTA 5GZEA 1ZRIA 3WNMA 1Y43B 1W04A 4CCJA 1ZA4A 4CDXA 1AR81 1NX9A 1YIFA 1GWLA 2SBAA 1LEDA 2RS11 3JD73 5HV0A 2WO2A 5J3UA 3ILRA 3ABZA 4J6GA 4YLZA 4OHXA 1GZWB 5FYYA 4QM9A 1I6XA 3JUUA 3OPTA 4LIVA 4O61A 5IVCA 2BNOA 1H2KA 2BVBA 3PL0A 3RGBA 1QJU3 5GJ6A 3Q8FA 2RHPA 5KHJA 5JWPA 4IL7A 2MHFA 5EXOA 3ZN6B 1OUXA 3GBGA 4DRRA 2BBVA 4QXCA 2PFWA 4LIUA 3AC0A 5JAXA 1HRI2 2XHNA 1C57A 2NP0A 3NKTA 2C9KA 1DP0A 3BYWA 4AHXA 1OFNA 1PM4A 1W99A 3OYWB 2OXBA 3TAYA 5L9RA 4EZ4A 1OKQA 4CSWA 1ZBE2 1US2A 2YBKA 4HZFA 4KBBA 3RZZA 3TN92 3T2PA 1HB1A 3VBRA 2E26A 4EN8B 4XIOA 1BJQA 2JD4A 2W3JA 4OI4A 2VE1A 3LCPA 4QDQA 2KR2A 2VVFA 2D5FA 4DO0A 1GZ9A 4A6SA 2AZ5A 4COUA 2VXJA 1UPIA 3G6JB 4XACA 3BALA 1NCRA 4AFAA 1YFUA 3RZJA 1XNAA 3DYPA 3WW1A 3N9MA 1BK0A 4Y1UA 1H2LA 1OLMA 4YM3A 1K12A 5LBCA 3WQ1A 4AEKA 1BEV1 1PO13 2ARBA 2RDRA 4MZUA 3OSDA 1W39A 2GSYA 3Q9OA 4I0BA 3FLRA 2DFBA 4FAHA 2ZEYA 1POV3 1QJX3 4IEPA 5IJRA 2ZACA 4KGGA 5C70A 3BVCA 4JTNA 4P9LA 2JKBA 3KCCA 1RVF3 3MPPG 4NRMA 1JYIA 1N47A 2O8QA 4IE6A 3BB6A 3BTAA 4HLTA 1OFSA 4NPLA 1NLSA 1Q43A 1SLTA 1FMD3 5FXWA 3WW4A 3O1OA 4RQPA 2DURA 5FCCA 1OKOA 2I74A 3A0KA 2Z79A 5FJHA 4P9JA 2JIJA 4N7IA 3POSA 4QKFA 4QPGC 5FPUA 5FAXA 4DB5A 1O4ZA 4QQ2A 1R1ZA 2P37A 4HSJA 1QQP2 4I09A 1RUG1 3UV9A 1F31A 4AQTA 4DXTA 4PLMA 3INAA 3ACLA 4UW4A 2Q1MA 1XOYA 4A44A 4QQPA 5FYIA 4WVWA 1ZBA2 2FCUA 3DUIA 3MV01 4HONA 4QDSA 1RUF3 4LR4A 3JQXA 2HWC1 4XJ8A 1YEWA 5CKQA 4B4RA 1GMMA 1XRUA 5CIRA 3RMYA 5FY0A 3U4XA 5IK7A 2J1AA 1REEA 3O0WA 3S5AA 1HV1A 2BZDA 1D4M2 2Y6GA 1PO23 3MW2A 2XKPA 2KA3A 1NA1B 5HPOA 4GD4A 1QJY1 3LDBA 4NIGA 4AI2A 2VUCA 4QX7A 5A6XA 1PVXA 4XILA 2XLAA 4LKEA 3ACHA 1HXS3 2AENA 4MGKE 5GZFA 3U11A 2WBKA 4UF0B 4CZSA 2X10A 2GNTA 4UWDA 2V72A 1URXA 3GNEA 1W6QA 3IIIA 3UKVA 5F2WA 1PX3A 3AM2A 1OVSA 3WNOA 2BNMA 3IIAA 3PUAA 3VKLA 2RR11 5FY9A 2DCKA 2HEVF 1OF4A 1DYPA 5JVVA 2PXJA 5T55A 1BK1A 5FK8A 4AGVA 1V9U3 4FPGA 3W5MA 3RVHA 4EZHA 4XDOA 5GLTA 5DZGA 2R062 5FO7B 2OX0A 3IT8A 1HDKA 3VKFC 4D69A 3MIHA 2R0HA 1ULEA 2E63A 1OI6A 1NCQB 3CZUA 5FRAA 1SFPA 4HPKA 4A45A 2ZKLA 1EP0A 5FZKA 5H9RA 5CFDB 1NCQC 2MEV3 3AMNA 2ZGNA 4OHZA 4Q29A 4BQ2A 1X50A 1LOFA 2ZX2A 4Q0UA 3U37A 1W8TA 2VY0A 3GZUC 4HN0A 1A3KA 1MZEA 1AR93 5CFDC 2JJ6A 4BQXA 2W2IA 3BTZA 1RHI1 2WNVB 2XJUA 2XJVA 2RMU1 3WNLA 1CJDA 1F8VA 3THCA 2GN3A 1EUUA 2IXIA 1MEC1 1W8OA 3HQXA 1W8WA 4P9IA 4JRLA 2R073 3B69A 4PT6A 1J3QA 1JYWA 3GZEA 3IMMA 4RR3B 1MZFA 1YQ6A 2VW2A 2XBO2 4EN7B 1W6NA 2R042 4P5HA 4JDMA 4Q1RA 5FLJA 2BTVC 5FV3A 1CR7A 2VMEA 1KQRA 2ZGSA 4RR3C 4W65A 1DGRA 2IVJA 3ZFEB 4BE3A 1VRH2 3GZAA 1ZA7A 4ISRA 4RYDA 4YVSA 5GKAC 1D0GA 4N90A 1OC1A 5BPXA 1Q8QA 5DDJ1 3MDPA 5HCFA 3ZFEC 5IUQA 2VOXA 1GFF2 2RS32 2WSUA 4GH4B 3ZO0B 1MS5A 4LPLA 1RUI3 1S1AA 5D21A 1DYKA 4ATFA 4GMP3 1YWKA 4GH4C 3PJQA 3B3QE 5IAVA 4G3YC 3WR0A 5L36A 4WVVA 5CFCA 4X8PA 3K48A 2CYFA 4YW7A 1X36A 2GNBA 4LOTA 1HKDA 3AX4A 3H8XA 1IS5A 4MGZE 4BMBA 1LULA 2D3SA 2HWE1 3B00A 3NNLA 4FPCA 4RS5B 2Q8CA 4QKNA 1AL22 3ZLIA 3FBYA 4MX3A 4E8CA 4CRQA 4M3CA 3VD7A 3FUQA 4FT8A 4RS5C 4ARXA 4Y5Z0 5T3NA 3T0BA 2WUHA 2Y6FA 5APAA 3WEZA 5FTTC 2ORZA 4ZONA 5DZFA 5CG8A 4AE2A 4Y22A 4NE9A 2VW0A 4RHV1 5DAXA 1XB9A 1ULOA 5BNPB 2R16A 4ZS2A 3J8F2 5FOBB 2OUJA 1DGWA 3AVRA 3KQ4B 5BNPC 1SEFA 1PGL1 1ND2B 1IHMA 3DL3A 3QH7A 5FZDA 4L97A 3FC0A 3FX3A 1VBC3 4K6BA 5GLUA 3N9LA 1EAH1 1ND2C 3FHIB 2QQKA 5EPAA 3LQCA 2ARXA 2VMCA 5C3OA 3FWEA 2NLRA 3NV4A 3LB9A 1FXZA 1PZ8A 5CKMA 2VU9A 3WV6A 1AF9A 2VOWA 3W59A 2WT1A 3RI9A 2PHTA 3T0AA 2W68A 3CJIA 4UFKA 1ENSA 5B2GB 4BA6A 1WCUA 3PMEA 3IPVB 3FHAA 4QDRA 1XNDA 2ZGRA 5A7PA 2D6PA 5EJ3A 5H9QA 3RMXA 1H30A 2WSVA 4E4ZA 3T1MA 2ZEWA 5LB6A 1OHFA 3J26N 1DZRA 3VHNA 1W2AX 4XOGA 1X82A 3AFKA 4CCDA 3H1MA 3QLQA 2KXLA 2UWBA 2DCJA 1BVVA 1C8M1 1JYCA 2CHHA 1GQPA 1V0AA 3A22A 4O9GA 5LRRA 1WMEA 4LITA 1COV2 1JHNA 4Z92B 2Q8DA 2OKXA 5J48A 1SCRA 1GV9A 2H6BA 2WZPP 4AI9A 3LEIA 1DQ0A 1PGW1 2ARCA 4NHLA 4XFBA 1CAWB 1CD3G 3TNPB 3VKOA 1KJLA 5FXVA 4NHXA 4PIZA 1SPPA 3MV11 1GP6A 3AZVA 3JZVA 3MI8A 3NQHA 2X5IB 3BOWA 3VDDA 2V73A 3FJSA 4MGSA 4XCAA 4OQ8A 1ACCA 4K1ZA 1F4AA 2ID4A 4J25A 3M1HA 2X5IC 4IE0A 4XUOA 3SH4A 4BQ1A 1AR83 4AHWA 4LO4B 3QH6A 4QAWA 1RUD1 4O7XA 5F37A 1MS4A 1IG0A 2DU1A 2RDSA 2WIIB 1PVC1 1P8JA 1ENRA 1TE1B 2WZR2 4Y1XA 4H7LA 2BP6A 2UWAA 4IETA 4G9SB 5CG9A 1YHFA 4B4PA 2QQMA 4KL1A 2ADEA 3MPBA 1WW4A 4K9SA 5F6KA 3ENRA 3NAPA 4DQAA 2B9UA 1S0BA 4QB1A 1YJKA 4EROA 3D8CA 2FD8A 2VGDA 5CYYA 3HMYA 4IEZA 3GM8A 2W94A 3LIGA 2VM9A 4XJUA 4QX3A 4DPNA 1GOGA 1RUH1 2CAVA 1KXGA 2IFWA 2WQZC 4AOCA 5GZGA 3WXPA 3USUB 2P6CA 1N1VA 4GWJA 2EXKA 2OT7A 4OZXA 3ZFFB 1R093 3VZLA 1GZWA 5DUVA 5EFUA 4AQ2A 4IEWA 2AUYA 3WCSA 1W9TA 2UYBA 2V4VA 3AKRA 2NMNA 2VMFA 3D4KA 1JI6A 3JBG2 3ZFFC 1IPSA 4QQLA 1PNFA 1X8EA 4JTOA 1PHMA 2NMOA 1GOFA 3JD71 3ZN6A 2VQ0A 2V5YA 1V6NA 2IC1A 1LU2A 3SH5A 1KDKA 1APNA 3LDKA 3AK0A 4YZ3A 4PF5A 4QXKA 4EN9B 1ZX5A 1LCLA 4CXXA 3DYOA 3R4SA 3HD8B 3ZX7A 3SXWA 1FYUA 1BEV3 5FK7A 3OYWA 5CU1A 1HRV1 5LA9A 5FO8B 2VMHA 5K4LA 5T5JA 4BZ4A 2LALA 4BLIA 1NCRB 3JCIA 4DS0A 1FNYA 1SZBA 4QX0A 1FV2A 1QXRA 4LKSA 5KXCA 1MZ6A 2EAKA 3PIJA 3I2OA 2KM2A 1PMIA 5A3UA 1NCRC 3SHRA 4CDWA 5LEKA 4O9EA 4LMFA 3AYAA 1Y3TA 1G7YA 1NY71 3N4MA 1KDMA 2VW1A 1UMZA 3M2MA 4KG0A 3LA2A 4QKDA 4XF4A 4TLGA 4BB3A 2GC2A 5JIAA 3RSJA 4OCTA 3HNYM 2Q8OA 5LA2A 4HK8A 4FOQA 5GALA 1L7RA 1RTVA 2V4AA 5DAQA 1D7PM 4IE7A 5EJZB 1V00A 4GXLA 4YW1A 1RUG3 1JBCA 3IAQA 1B35B 2EXIA 4BYYA 3BTYA 4HKWA 4PBOA 3IDEA 3PUHA 2ZGKA 4MADA 5F32A 3WQ0A 5C3SA 1B35C 1GQGA 4Z2AA 3ZXLA 3POYA 1QJY2 1TNRA 2HWC3 3G7DA 1WWYA 4CUGA 1SG3A 1R1A2 3EO6A 5A80A 2Y26A 3MLJA 3FHQA 4B1LA 2J1TA 4E8DA 4NIDA 2ZHNA 4QPGA 4AVAA 1VBA2 3H50A 2Y8KA 2UWCA 2Y60A 2R49A 2DUOA 3OGJA 5C8WA 3QD6A 4XYXA 2QJVA 5DG1A 2VNVA 5KXBA 1N3QA 2HWD3 4ISQA 3H1WA 1TNFA 1GANA 3FLPA 3CLPA 4FPOB 3U75A 3VZNA 2PLV2 1FMD1 2A6YA 2P34A 4JCKA 4KU8A 4OUSA 2DVAA 4YZ4A 5F3CA 1IQDC 1HJGA 1TME1 2BVVA 2D93A 4D7TA 2VZVA 4R9BA 3CO2A 4CCCA 2RR13 2WA3A 3ATGA 3OBRA 1YFXA 3AKSA 2K0GA 2UURA 2RDNA 1O7FA 4Q5OA 4ZXKA 4AHYA 1CWPA 2BGCA 4NIAA 1KS5A 2WO7A 3W58A 1VP6A 3I4IA 4K21A 2FMYA 5CADA 1FPN1 2P5BA 3LWCA 1W6QB 4OUEA 1BBT2 1A6CA 4R4ZA 2P4EA 1AJKA 2ZBJA 2BOJA 3LA3A 4P14A 2A75A 3HNBM 4BMEA 1H8TA 1F2NA 2WO1A 4UF0A 3POWA 3VKMA 4NJ4A 3S7EA 1MEC2 5LBFA 4QXHA 4XJ9A 2X29A 1L7LA 4LLOA 1S0GA 3AP9A 2BWCA 3WDYA 3OBZA 1RHI3 1UU6A 3E6BA 4XHXA 2RMU3 3QACA 4N53A 4V2VA 3KMHA 3MEPA 4HPKB 1RMU1 1GZCA 5AC92 4IV3B 1LNSA 1Y4WA 3NL1A 4HG6B 1EV12 2YC0A 4P9XA 4RA0A 3R4DB 3OGVA 4LHNA 1NLQA 2EA7A 3N35A 4IV3C 1YJLA 1HB4A 4DFSA 3T2OA 3RZHA 3D0JA 4WZFA 1LOFC 4HVQA 3P1IA 1SFNA 2QQWA 3MFAA 1V9U1 5ANQA 5CFDA 1VBD1 2HWB1 5FZAA 4D7YA 3MFCA 2W08A 3F2ZA 4K3UA 5DDJ3 5C8CB 4ES8A 3M70A 2ZPXA 3I2JA 4MGQA 3I3BA 4MSVA 3K3OA 4YGCA 1W6NB 5C8CC 3LOIA 2HWE2 4UFHA 4LO6B 3OBAA 4KH9A 2FDGA 2MEV1 3T08A 1S2KA 2OZJA 2H6CA 1AXYA 5CKNA 2ZS6B 4NO4A 2YZ4A 4XDPA 5F2SA 1AR91 5CZKA 2C5DA 1IPJA 4Q8LA 5JPNB 5CA6A 1SLIA 2Z5WA 4ET7A 2GALA 2D6KA 3WF2A 4MUVA 3ZFEA 3PLQA 3KCYA 2DUPA 3SCFA 3KVBA 3WZ1A 2PN5A 3V64A 2JDKA 2WS91 5CFCB 2R071 4DMIA 1Q56A 3N9QA 4QPIA 4F3JA 1EY2A 1Z7S2 3EYPA 3H7JA 2DYCA 5CFCC 3PUQA 2B39A 3I59A 1AR72 3KQRA 4RHV3 4AI8A 1V6IA 3VV1A 3K4DA 3KF3A 4BK5A 5FWEA 1XYNA 4NPMA 5FPAA 1EAH2 4M3CB 3ZR6A 3ACGA 4GQ7A 1RUJ1 2PHDA 5EYYA 1SACA 2DTYA 4OULA 4COWA 3LDRA 1UW8A 1C1FA 4COZA 4CU6A 2VH9A 5G05L 1C5HA 3K75B 4Y22B 1OVPA 5FPZA 4IERA 3OY8A 2ZEZA 2D3PA 2ZA9A 1VB4A 4PDWB 4AI3A 1OT5A 1WLDA 4LBOA 2WYFA 1OBNA 2SLIA 2WFF1 2EIGA 2VVDA 4PDWC 5FMBA 3L2HA 5IK5A 5BNPA 3HNMA 2AC1A 2DUQA 5DQ0A 4XXPA 4EN6B 4ES9A 3W5NA 4QMAA 2ARAA 3KZ4C 3ZSEA 2WQ8A 2A73B 3UYJA 1WA4A 3T1LA 3WP5A 5D1IA 3O1MA 5FPXA 1ND2A 4MV2A 2PA7A 5DUXA 3SNMA 2ZGMA 1FAYA 1SMVA 5C33A 1WGPA 1C8M3 4MXWB 2O1QA 2YBPA 3CJIB 3E6DA 3ZOIA 1I3HA 5LY1A 4XMAA 5A3NA 1SHWB 3EQEA 3MHZA 3PMSA 4QXBA 3O1TA 5DUWA 3CJIC 3TNQA 1CVNA 2PHFA 5IYYA 3MZHA 1VBE2 3MLLA 3ZYFA 4W6XA 4W6YA 5A6QA 3LPGA 5IVFA 4COYA 1H1AA 3KHBA 3O14A 1BZWA 4NRPA 3IPVA 4JKKA 3IDBB 3AMMA 5FP8A 5IK4A 4ZPIA 2QQOA 5C9AB 1I1EA 4FPFA 5JR2A 1YQCA 4Q4V2 5BUVA 3SQOA 2D3RA 1DDLA 3H7YA 4UFMA 4W8JA 3LEGA 5K0UA 1PVC2 2QQVA 2ZKNA 3RRDA 4P08A 2YBSA 4XBQA 4YM1A 4LBQA 1VMHA 1W3XA 4TTGA 5IW0A 2ZZQA 1IG3A 3UL2A 1KD7A 2WC2A 2ZX4A 4GIQA 4ZHNA 1D4VB 2Q0AA 2VO5A 4MH0E 1UL9A 1AYN1 1RUD3 3NMBA 3ZPOA 1SPPB 1U5XA 5JLVA 2WO3A 1S0EA 1BVP1 5FO9B 3VDDB 2RJ2A 1W6OA 2DDUA 3RFRA 4XMIA 4YW3A 2BJSA 4IEVA 5GM0A 3VDDC 5FKBA 4OHWA 3WDUA 4Z1VA 1W8NA 3TEXA 3BKZA 4YZ1A 1D2QA 1DG6A 1WCDJ 2X5IA 2DV9A 3I97A 3KV5A 1IS4A 1AXZA 1E57A 4J1XA 1S2EA 4PQ9A 2VG9A 1RUNA 5FYCA 3VBSA 1J3RA 2P3IA 3BI3A 1RUH3 2VC9A 4WM7B 5L73A 4K8RB 1UX7A 3P5BA 1CAUB 2F6BA 4WM7C 4DZGA 4I3GA 5IVBA 1E5IA 3MIGA 3NAPB 4GA9A 4MG2A 4G4FA 4CP9A 4M3CE 4IGOA 1QXJA 1YQ5A 2Y6JA 3VBHA 5JXIA 3ZDSA 3NAPC 4Y33A 2GH8A 3GHMA 1TMF3 2QE3A 2CL2A 2B9VA 5EJ1B 1QJU2 5L19A 4OYUA 4LA2A 4X6RB 1XC6A 2GMMA 2LUWA 3OGGA 5ACA3 2C9AA 2LROA 3FFZA 1GSLA 1GNZA 4NRQA 4AVTA 1OF3A 4BQWA 5BY5A 1W03A 3JB8A 2QKDA 4DY3A 3OD0A 2JX9A 5IVYA 3USUA 1HRV3 4ZZ8A 3ZFFA 5J1XA 3I2KA 1RGSA 1UYXA 4NOTA 4YPJA 1OMIA 2HBUA 2H0BA 2N7GA 2JDUA 2WFPA 3FMGA 1AYM1 3O7OA 1QWRA 2J1UA 5FZ8A 2WAAA 2VMIA 4GKXA 1FV3A 1IZ3A 1RUE3 2XR4A 3FZ3A 2WJSA 5HI0A 1XXNA 3NNMA 2ZGQA 3SEPA 3ZMNA 3GJAA 4NWVA 4UXAA 5FP9A 4QGNA 4EJRA 1OQEA 4BQ4A 4DUVA 2W5FA 4RN5A 2A3WA 2QZ2A 2VMGA 4Y3OA 1TZOA 1H6XA 1R091 2VNOA 1DQ4A 4JGYB 3NJZA 4UYBA 2WLPA 3HJRA 3O1PA 4R52A 4BXFA 2VZ1A 1UY4A 3BIEA 1XQNA 4H3WA 3ASIA 4JGYC 4YW4A 4CVUA 4CDWB 3K4ZA 2XONA 2EAAA 4NMIA 4BQ3A 1PO12 2OUHA 2JB4A 4CDWC 4E2QA 4BWOA 4FOYA 1H9WA 2A3YA 4QGLA 3BODA 1QJX2 2PAMA 2WDBA 1CIYA 2VOVA 3WNNA 4NAOA 2O8OA 4QB6A 1RVF2 2B45X 2IXHA 3WNPA 1DGWX 1JYTA 5IT6A 2RM21 2VL4A 1LHWA 1FMD2 2OPWA 4PIXA 5F3IA 5KC6A 1NXD1 2WL1A 1FOD1 4HSLA 5AVPA 5BNQA 3U78A 4B7KA 4BLJA 5C5UA 2CNAA 1SDWA 2ATFA 3TN93 2ZHKA 2YMZA 2XGXA 1B35A 4CPBA 4KI5M 2VUAA 1NLRA 3A4UA 4LNVA 5JSRA 1ZNPA 1YFWA 4DXRA 5LCWL 1TME3 1CX1A 1FATA 3FL7A 4QPGB 1KEXA 4XUQA 2Y6LA 1REFA 4MHRA 4XPVA 2Q1ZB 2YHJA 5JCTA 3DN7A 3RQ0A 2F4PA 2IXKA 1DZQA 4NHYA 3O1VA 1YI7A 1ZZCA 1G8WA 1QJEA 1RUF2 2PAEA 4KBZA 4BCUA 5GZCA 2UY9A 1BXHA 2ET1A 1WBFA 4BH9A 4FBFA 1FPN3 4PI0A 4QHZA 5D2AA 4L11A 4DINB 4ZS3A 2IXJA 5T54A 1MZ5A 3Q8EA 4QGMA 3KT4A 1PO22 2WN3A 3B7MA 2ZAHA 4CEYB 1RXGA 3LGRA 3WF1A 2BPA2 1LOCA 1GWMA 2GNMA 1HXS2 4Z8BA 3IDAA 3GXUA 4AGRA 2VZUA 4CEYC 4Y1YA 1G9DA 2K9ZA 1G9BA 3WG2A 4TLFA 3SMHA 2EIBA 2E7AA 2D98A 2Q1FA 1DQ5A 3BGAA 4INDA 5T5PA 2HWD1 1RMU3 4KU7A 1JZ8A 1H8TB 4L2NA 2Y6HA 3DECA 3KSCA 5FXZA 3CDZB 1V9U2 3HAGA 4LLFA 4KWUA 4QX1A 4FP2A 4L9BA 4IEQA 4XFGA 4E4HA 3U10A 4D6QA 1H8TC 1IS3A 5F6LB 4RGAA 1VPHA 5FZ3A 3VKNA 2P17A 2Y6KA 3MUZ1 4Z82A 5KHHA 5F9TA 4E2GA 1U5YA 4N53B 2ERFA 4DY5A 3RYPA 1VBD3 2ZOEB 4YNIA 2C6SA 3HWJA 2HWB3 4WBBA 3ROUA 2QFEA 2XLFA 5C3QA 3CKHA 5C71A 3IZOA 4N53C 1CONA 2QQNA 2VQAA 3PURA 5FZMA 3UJOA 5FZFA 2GN7A 3FUOA 3VD3A 2JDZA 4COVA 5HXVA 3ZSKA 4XJAA 4AFBA 1CESA 3ZFGC 4Q4W1 3NJVA 2OPKA 4PI2A 2CY6A 1R081 1VALA 4W50A 1ND3A 1OA2A 4IV3A 4A7KA 5FR3A 2G19A 3I49A 5BNOC 3O5SA 5L7OA 2D5HA 1VJ2A 4JVAA 2QQIA 3HQUA 4AFDA 4XQWA 3VN4A 2R072 5FP3A 1XPWA 2E7TA 3POJA 4IGPA 1U5ZA 1DYOA 2HYXA 4AR2A 5CAZA 4XTMA 1QU0A 5DN2A 3WUCA 3VD5A 3HOBA 5IK8A 4IUGA 1ODMA 4AVVA 3WLUA 4OI0A 2WS93 3E97A 4CU7A 2EICA 3TOJA 3APBA 5C8CA 4ASMB 3WCRA 5HXMA 4JC1A 3AMPA 1HIXA 3RWKX 2GC0A 4MLOA 4YSFA 1IKQA 4XFHA 1CN1A 3TBDA 1VR3A 3KLSA 1JTZX 2YY1A 5FFOC 1RUI2 2PHXA 4XW3A 3HBZA 3AZXA 3CMGA 3CEWA 3POEA 1RUJ3 1KJRA 4IDZA 3BIWE 5F1RA 4OZOA 3UK9A 3GCWA 3AFGA 1XE7A 3B9CA 3Q8BA 4QPIB 5FZIA 2CGPA 4CE8A 1OD3A 1CIWA 2EXJA 3I59B 2W46A 2R1DA 4HETA 4QPIC 4TWTA 3GHNA 4RL7A 1CPNA 5E89A 3P6BA 1RC6A 5C7GA 4AXOA 4SLIA 1LB2A 3AKQA 2H0VA 1J1LA 1PMHX 3EXUA 1DLLA 1NZIA 2WNUB 3WHTA 5L9VA 4IESA 2P3JA 2WFF3 4R9AA 3E5UA 4OI2A 1G6NA 2WNUC 3ZXFA 2P1BA 2GP5A 1KS4A 1NQDA 2WWJA 2GAUA 4C1XA 3J4UH 3OY8B 2VZRA 3PUIA 1UNBA 2VAUA 2VQUA 2BRTA 3DPRB 1HN0A 3H1YA 4XF1A 3S0MA 1FT9A 1XE8A 1UD1A 2HWF1 1YI9A 3DPRC 2QUOA 2W87A 3ZYBA 4A6OA 3BTXA 1VBC2 2Q8EA 3CIHA 5IFPA 4EYUA 4PDWA 4CYDA 4HK9A 1UZWA 1NYWA 4FXGB 4Y24A 2VCBA 2BV4A 2ZGTA 5DAPA 4BIOA 1WCQA 1DFQA 4YRDA 1QMJA 1RJ8A 3RG0A 5JPMB 2UYAA 4KWLA 4AEJA 4B4QA 2JB8A 5FY1A 1ZRDA 2DVFA 1QDCA 1S0JA 2QQPA 3LD8A 5LASA 4MYEA 2VCCA 3UGHA 1LOGA 1MS9A 1DGLA 3FE5A 5FY7A 2WWUA 2XG3A 1K5JA 1DCSA 3HT1A 3EB7A 1UXXX 2WRAA 4LQRA 4MXWA 4DEQA 3SEEA 3DGTA 3T09A 1RUC1 2VBPA 2CTVA 4LA3A 4M4RA 1N3PA 5E16A 2PELA 1AYN3 2GP3A 4CA9A 2AREA 2A71A 1DLCA 4QM8A 1XNBA 1ZVFA 2F4LA 1MR5A 2FQPA 3NV1A 4GKYA 2ZZJA 1H0BA 2X53S 4GJYA 3VZJA 4HOOA 5JI9A 1V6MA 1OQ1A 5EV7A 5LATA 1W9WA 5K0UB 2BDRA 4XFCA 4BJ0A 5AVAA 1XYOA 5GLWA 1RB8G 5DMYA 5F5AA 5K0UC 4Q27A 2ZX0A 5FYTA 5C9AA 2J7MA 2C1FA 5G04L 4AG4A 5BYNA 4LULA 2PHRA 2CSGA 5FZGA 4DOUA 1UMIA 5KWRA 1VRBA 1W6OB 3JXSA 1OOPA 1NG0A 4XFAA 3AKPA 5J37A 4RSUA 1W9FA 1L7QA 1VBB3 4Q0SA 1EYBA 4LBQB 4WZCA 2VCAA 2QDNA 4Q4Y1 3VZOA 1AR82 1ZREA 3OOXA 4QQOA 1JU3A 2RS12 3LAGA 3I3EA 3T2QA 2A3XA 5I0SA 4NUBA 1YQ2A 1PZ7A 1YQ8A 3VBSB 3WD5A 1EPWA 4P5YA 5LA0A 1T6BX 2FZ2A 4KMQA 1JN2P 1T6GC 4FO9A 1K5MB 4CDUA 2A5ZA 4UW6A 4LBJA 1DGRN 3WINE 4D6SA 3VBSC 3PUSA 1JZ2A 1UCXA 1K5MC 5FP7A 4XTPA 2XJTA 3CZJA 3OPZA 4I3PA 5A7OA 4CP9B 3VL8A 1PIV1 4DEVA 1UF2C 3AKTA 4WM7A 3V65A 2DFCA 3GJBA 1WW7A 1YXWA 3PNAA 3VBHB 1DZTA 3ZR5A 4ZU4A 2W52A 4K20A 3UNPA 1FI2A 3LE0A 1DF0A 1CAUA 3WSOA 2GU9A 3TYJA 3VBHC 3T30A 1H1MA 3TRSB 3C2UA 4IV1B 1NKGA 3K2OA 1LEMA 1LHNA 2K2SA 2WLQA 4QQHA 5FYVA 5FZOB 2E53A 1AYM3 3THTA 3PVBB 4CP0A 1R092 3K3NA 4IV1C 2D44A 1LHUA 2HYKA 5FOJB 3WQBA 4XUTA 3N9OA 4META 3DKWA 4ZY9A 4FPYA 1QH6A 3N9NA 1NOVA 3K4AA 1RL3A 4Y5TA 1S0DA 3I3MA 5E1RA 1QEXA 2XXZA 4KGQA 2RJLA 1W06A 1W6MA 4YG6A 4P00B 4JX0A 4Y1VA 1WD3A 4FQZA 1TMF1 2BWAA 2VR4A 3ME2A 3VBOA 3W9AA 4PIYA 3ACIA 5FYUA 3ZYGA 1SLAA 3H3UA 1BEV2 1UY3A 2V09A 1DU3D 2EVXA 5ACA1 4H55A 2YXSA 1W8ZA 1MVEA 4NAMA 3IKWA 4AGGA 2WZ8A 3MBWA 3PU3A 1JZ3A 4XQDA 3LEKA 3SKJE 1UOGA 5FIXA 2DU0A 3KB5A 5FREA 4UAPA 2RM23 2FDHA 3WG3A 1BMV1 2NQYA 5IVJA 1KFXL 3ZXJA 1O3RA 4JGYA 4AW7A 4OFGA 5FLIA 3R4UA 1FOD3 3VBFA 3NV3A 5LRSA 4DXZA 1RUE1 4FQ4A 4K1YA 2Z42A 2CWMA 1VB2A 3IB3A 4TYSA 4YG0A 3QOPA 5JMOA 1QGLA 2RG4A 3LZZA 4F83A 1RUG2 2AR6A 3KV4A 4YM0A 2BGOA 3N7KA 3KHCA 1HX6A 1I5ZA 1SLLA 5E88A 2J22A 2ZGPA 3I2DA 5BNNC 1Z0HA 1ULGA 4LBKA 3WY6A 2E32A 2HWC2 1QHDA 2ZABA 1WBLA 3C7EA 5A3LA 5DUUA 4H7MA 5A3OA 1XE0A 4ATEA 1BCXA 1ZZ6A 5FMOL 2W1SA 4LE3A 2B42B 2ZGUA 2VJXA 3PVEA 2XHKA 5FUIA 2DBNA 5M0TA 2D6OX 2EALA 2WQ4A 2XMLA 1W6PA 1HRI1 2AH2A 1HQNA 2IZWA 4Q0QA 4DNYA 1ASJ3 1OD5A 4LKDA 3T3YA 4A4AA 1YUDA 4HANA 1MS8A 2RR12 4Q4X3 3R6SA 2Y33A 3TN91 3T0DA 1IGOA 2JG8A 3M3EA 1NAEA 3MIBA 1PX4A 1UAIA 4IQPA 3WW3A 2WAOA 4C8DA 1NE6A 1Q8SA 2JKXA 2YC2A 3ITQA 3JQWA 4LXLA 5KXDA 4FP3A 2YPDA 4JDNA 3TEWA 5I0RA 5FBJA 1O59A 5FZ4A 3PDQA 4CEYA 4L8QA 2BGPA 3I2GA 4IW3A 4K40A 4QT6A 4QX8A 1S4CA 4YVWB 1Q8VA 5H9SA 2B46X 4FOVA 4AEMA 1UOJA 1PMJX 3KT1A 4OVEA 4A41A 1VMJA 4YVWC 2XH6A 4TXWA 4Q4W3 2Q4SA 4AHZA 3A0NA 4JGZB 4HVRA 4LK7A 4M3CF 1R083 3ZVXA 1WMDA 1RHI2 3NO8A 3ETPA 5LBBA 2RMU2 2O14A 1GNHA 3AZWA 4JGZC 5GLZA 2XB6C 2XL7A 1ULCA 2GC3A 3JB4C 4JKLA 4UBGA 1CZVA 3MIEA 4E4DX 4KNCA 3UETA 5CISA 5E6HA 5I93A 5F7UA 5B4XA 5CBLA 3SC7X 4YM2A 1A8DA 1ND3B 4EWDA 1LODA 1F5JA 3WW2A 3ZFGA 5L7OB 3T4HB 2NPIA 4Q8KA 4XQ4A 1ENXA 1ND3C 4IEOA 5FZEA 3UKTA 5EIYB 1QQP1 5BNOA 2WYSA 5D8AB 5DDJ2 5L7OC 4RGGA 3CJXA 4UW5A 2FBEA 2WR9A 2OYZA 3W21A 3VB9A 1IPKA 1TQ5A 1MQTA 2BFUL 5D8AC 3ZPYA 5LK5A 3MW4A 1ZBA1 3ZIWA 4LBLA 1OXCA 2VUJA 4AYUA 2BEOA 2PAKA 5LBEA 2J1VA 4R9CA 3N3HA 1RXFA 2VZOA 2RJKA 4GJZA 4UT5A 2V5DA 3O0XA 2KD7A 5JMCA 3V0AA 5JZGB 1D4M1 1PK6B 2WINB 3KD4A 4WM8A 3ES4A 2CDOA 1JZ4A 2QTWB 1V6KA 1MS3A 3RDIA 5FZLA 3SKVA 5JZGC 3VBUA 1GQHA 1PK6C 2G9FA 1X9PA 4NROA 1UU5A 4PJYA 1LESA 4NR1A 4LBNA 5EYXA 3ZSJA 1W8HA 3LFIA 4M01A 1EV13 4D7SA 4AFMA 2FDKA 2DF7A 4N9IA 4XETA 5FYHA 3VHOA 4RHV2 1SBEA 5B4NA 5J7MA 2ES3A 2VPVA 2WT2A 3S6PA 4OMCA 4DUWA 4HFSA 1QKQA 3J7MA 4XZUG 1ZRFA 2D6NA 3BCWA 3FBMA 3MICA 4MXVA 2FDIA 1YFYA 3OG2A 4OHYA 5DZEA 1PGL2 1KFUL 2HWF3 2VECA 4DIQA 2W1QA 3SLIA 1LKNA 4LBQD 5JSPA 4N9HA 3L9JT 3K46A 1H1IA 1POQA 3OPWA 2WNUA 2CU5A 2D40A 4UFLA 2Q30A 4HT1T 1CZTA 4CEWB 3AL5A 3C7GA 2VZTA 2W0XA 3MW3A 3WDXA 5EP9A 4URAA 2UY8A 1CAVA 1NQJA 5K7PA 3E1F1 1J83A 1NE4A 1Y9GA 2VCMA 4HKOA 4CEWC 2WABA 1XYPA 2WA4A 2YU2A 4LHSA 4DUXA 1AR63 3DPRA 2TNFA 4XIKA 3AP5A 1A8MA 4YFWA 1Y7BA 2EIEA 1WCSA 1RUC3 2AYHA 4FFGA 1LECA 4FAGA 4BDVB 1C8M2 3AP6A 3FN9A 2A6VA 2QQLA 3GDBA 4PCRA 4NIHA 2CGOA 4LHKA 4QB2A 1AR73 5H9PA 2R041 1RYYA 5FWJA 3CNAA 5HCAA 4DXSA 3RNSA 3LKJA 3OD4A 3PTYA 3WP3A 1I9RA 3SISA 4AI1A 1DHKB 1PGW2 4C1WA 5KR7A 4QPYA 1W9YA 2VULA 4XE9A 1LGNA 3E5QA 4GB33 4RFT0 3DXUA 2W95A 3MO4A 2RS31 3RI8A 2WT0A 5E8AA 3C7HA 5DABA 4H14A 4PF1A 5EQUA 3Q8CA 2WN2A 1CPMA 3LA7A 1BKZA 2AGSA 5ANNA 3RZKA 1A78A 4XF3A 5FY8A 5A3TA 1DQ1A 3IDCB 3ZXKA 4GULA 2R0FA 5FQ0A 1JODA 4Q4Y3 3PHMA 5FKCA 3U07A 4ARYA 2CV6A 4MO3M 1Q8PA 3KV9A 4XUNA 4Y26A 1RUD2 4FTSA 2E31A 2JECA 1Y9QA 4IXLA 1AL21 3I7DA 3M3QA 4TN7A 5I8YA 1H4GA 1GYKA 3H3ZA 4MVTA 1DBNA 2JDYA 4K8FA 1H9PA 1OOPB 2P6HA 3WNKA 2I07B 2ZJCA 4XF9A 1IQAA 2NYYA 3J7NA 1OOPC 4HL0A 1R64A 4W4ZA 3KGZA 3LPFA 1SDDB 1GWKA 1QDOA 1W8UA 4MGYE 5F39A 1PIV3 2BOIA 1GZTA 4EWEA 3J8F1 2QQUA 1ZM1A 3UKNA 1O3TA 3WF4A 4EV0A 1AJOA 2XJQA 4F7ZA 4CDUB 2PHUA 1RUH2 2RE9A 5LY2A 4C0HA 4QU1A 1OLRA 3ILFA 1HQWA 5A7QA 4S2GA 5KHKA 4CDUC 4YFZA 2JWPA 3DKQA 5DAVA 3NNFA 2RS53 1K5MA 3GCXA 1VBB1 4AAXA 2JD9A 1TMF2 5FJKA 3DV8A 1UQXA 2YDEA 1UX6A 2HEWF 4AK3A 1FX5A 3JD72 1W0NA 4XHBA 4FOWA 1CZSA 4YG3A 1UZVA 3A21A 3C7FA 3NNJA 3THPA 5FBZA 5ACA2 2OVUA 3TEYA 2Y38A 1J84A 2E9QA 2WWSA 1UYYA 2ZX1A 4AEDB 1F4HA 1W3VA 2A1XA 3GZTB 4IV1A 5IHRA 2PQQA 4JKMA 1W0PA 1HRV2 4N43A 5FZOA 2IWGB 2DVDA 3WG1A 4D8MA 4CPBD 1COV1 4Y4RA 5A33A 4AEDC 4BXSV 1OA3A 3OF1A 4Y1ZA 4BPZA 2X05A 5C3RA 1CAXA 2GZWA 1W6MB 5FZ0A 2JDPA 2ZX3A 4CCEA 5L9BA 1YCIA 1QJFA 2R7EB 3ZIXA 1KITA 1RUE2 3VBOB 4Q0PA 4RD7A 4B3NA 2YU1A 1VE0A 1WLWA 1O6UA 3VBOC 1JXNA 1NY72 4LUKA 5GZDA 5FZBA 5JSOA 2JDNA 4CUBA 2XOMA 3K77A 3WDVA 4QHOA 1J59A 4F8AA 3VLBB 1C8NA 2PTMA 1NXMA 2ADDA 5FZHA 3D0SA 2UU8A 4JQRA 5F5QA 5FY4A 3E5XA 5BV6A 2ZCWA 3NV2A 1GNYA 5FY5A 3WT3A 2BNNA 3VL9A 3POGA 1O8SA 3FFQA 3C3VA 1HN1A 5BXXA 1F35A 3VBFB 1OURA 2ZGLA 4FTEA 1UU4A 3H42B 2WZR1 3ZXDA 1S55A 1SFYA 1AXKA 3ACFA 3LSEA 5T52A 4ZXEA 3VBFC 5J09A 4LEJA 5FP4A 1UOBA 2YC4A 3W20A 4BK4A 4HXCA 1CQ9A 1ENQA 4GZ9A 1K45A 1UY2A 5BNNA 3AVSA 1HRI3 5LWBA 1S0FA 1BQPA 4M0HA 2FDJA 1D0HA 1OA4A 1TME2 5K9YA 3RYKA 3AXDA 2EF6A 3KGLA 2P3YA 3LOBA 1ZBE3 3MGUA 1DQ6A 3UGFA 5C3PA 1C4RA 1XSRA 3TEZA 4UBHA 2I2SA 3M8LA 3JBG1 1QF3A 4IGQA 5F3EA 3I8TA 1JZ7A 5ABJA 1W6PB 3IMNA 4FVVA 5JDBA 1FPN2 4HN1A 4PQQA 3D6EA 2DVBA
chains in the Genus database with same CATH topology
4LBMA 3QBQA 3EJKA 2BQPA 4BHPA 1YNAA 2GMPA 2JG8B 1V6LA 3D5OA 2HEYF 5I0UA 3UJQA 3WDWA 2A6ZA 2VVEA 5I91A 2JG8C 2XL9A 4X6QB 1QNWA 1S0CA 2MNGA 5JI7A 2ZAAA 5K8SA 3NW4A 1RMU2 5CB7A 5KHGA 1UZYA 4Y4YA 4NN0A 2IXLA 1NZCA 3N7JA 3HIFA 5C4WB 1ASJ1 4PLNA 1X7NA 3CU7A 4HVOA 2XWJB 3ZYIB 3T2TA 4Q4X1 4FXKB 5C4WC 5LEJA 4YVWA 2R32A 5EZWA 3BU7A 1VBD2 2HWB2 2HJIA 4AVBA 1QQP3 4Q26A 2LTNA 4JGZA 3ALQA 1VIWB 2FMDA 1JUIA 2JICA 4J1WA 4ONUA 4HKLA 4QU2A 3SITA 5FMOS 4E2SA 1CGPA 1ZBA3 3ZFGB 2MEV2 3B93A 4L92A 2ZTNA 1AUYA 1R1A1 5AFBA 1NA1C 4YYOA 3N7MA 1AR92 5BNOB 1VBA1 1UIKA 1D4M3 2ZMNA 1BYHA 1SLBA 1POV0 2DWRA 4EWAA 1MQTB 4NHMA 2LM3A 5HCBA 1X33A 2WS92 1UN1A 1MQTC 1VAKA 4LT5A 3B9IA 5D8AA 2PLV1 2TUNA 2R1BA 2YYOA 2TBVA 3V0AB 1YRZA 3ILNA 2YUEA 4WM8B 4I02A 4I2OA 3ZYPA 4A2UA 3VBUB 4WM8C 1RUJ2 4YZ2A 2R063 2PYTA 4JAAA 5KHIA 2Z2SB 1ZZ8A 1OLQA 3VBUC 3WQ7A 5JZGA 3IN9A 1PK6A 2E6VA 1SLCA 1AHSA 3O0VA 3CF6E 1BBT1 2ZMLA 3K51A 2MPFA 4LO7A 3ZSLA 2GDFA 2XPJA 2JE7A 1M06G 1SBFA 1LTEA 1MVQA 4ASLA 1F9KA 2Y0IA 4IEUA 2ENRA 4WVMA 1U5IA 2WFF2 2WNVC 3JU9A 3WP4A 4AQSA 3ST7A 4ITCA 3O12A 2CWSA 4ZU7A 3S7IA 1PGSA 3MF6A 5AC91 2B7YA 4FSJA 3AP4A 2I45A 1EV11 2G9GA 3VHPA 3WUDA 3ZYRA 1O3SA 1WCKA 4OHVA 1LJ7A 1CAVB 3AMQA 1B09A 2B8MA 2XBO3 2R043 2BFUS 4LTAA 4YGDA 4C0BA 4E27A 3AYEA 4CEWA 1LOBA 5FLHA 3RJ2X 1VRH3 3MIDA 1MS1A 3WP6A 4YW2A 3SCGA 2RS33 4A3XA 4QX5A 4OUMA 3V0BB 2OA2A 5J98B 4A7ZA 1LU1A 3FLTA 1ONAA 2ET7A 1C1LA 1WLCA 2OIIA 4XJZA 3RPQA 1V6JA 2VOKA 3RYRA 1AYN2 3MIFA 2D6MA 4NHKA 4X8NA 4XBLA 4FPHA 4CTEA 1AR61 1AL23 2D6LX 4JRAA 1ALYA 1U12A 2TEPA 4GWMA 3RS6A 2XJPA 1VAVA 4AQ6A 3B01A 5DG2A 4KWJA 4NPRA 4B29A 2ZHLA 2HKXA 3AYDA 3ZMOA 3D82A 1Z7S1 4GWNA 3OJBA 5FQ0B 1O4YA 4LO5B 1RINA 3KM5A 1AR71 3WX5A 1GBGA 4S2FA 3TB0A 3J8F3 3N36A 4V1PA 4C91A 4KQ7A 3BPZA 2XVLA 4GB31 1VBB2 2GNDA 3ZN5A 2IXCA 5A32A 3SCHA 3H0OA 1JW6A 3QCWA 4XF0A 2FZ1A 3N7LA 3NWKA 4GMP0 4DRVA 1O4TA 2YGLA 3ZXAC 3I54A 3SH3A 3ECQA 2NN8A 4A7YA 1XU2A 2D7FA 2Y0OA 5C6CA 5DXDA 4ORFA 1LOEA 2CGNA 4KWKA 4ZU5A 2A70A 3B5LB 1HLCA 1UZZA 2GMEA 5A3MA 1AVBA 3M3IA 3RJRA 3IM0A 3ES1A 3X29B 4M00A 4Y20A 1G86A 2E51A 1COV3 1QOOA 2VXRA 3HR9A 1AYM2 1N1TA 2A7AA 1ULFA 3USSA 1V6OA 1VBE1 2Q5TA 3PJYA 5CNAA 2DVGA 3ZSMA 4CDQB 4L99A 1ULDA 2ZGOA 3H9AA 5TSWA 2A6WA 2QCSB 3HN1A 2JG9A 1J3PA 4CDQC 4N43B 1TEIA 4I0WB 1MS0A 2XJRA 5KBFA 5A33B 4PLOA 4Q4V1 4AF9A 2RS13 2RS51 3ETQA 1CAXB 3L2YA 4N43C 1UPSA 2BUKA 4AEDA 4P9GA 4Q0VA 4CP1A 4I0AA 4R9DA 4Z07A 4XDQA 3AJYA 3ZXGA 2XUMA 2VNRA 4FCAA 1YYNA 4CDXB 5I8SA 1DQ2A 1O91A 2WZR3 3AZYA 4CDXC 1Q3EA 1CJPA 2JE9A 1DIWA 4WVZA 5JOZA 2P3KA 4FPKA 3MLKA 1LR5A 2RM22 2Z69A 3RWNA 2R30A 1FOD2 4NWWA 4AVCA 1AX1A 1F5FA 3V56A 4EN0A 1QY4A 3HT2A 1QXPA 4OI1A 4Z2WA 1QJZA 5JIUA 3EHKA 1XNCA 2GH2A 2FHRA 4B7EA 2DCZA 4ZKTB 1HW5A 2ILMA 3JBG3 4R8HA 4YW5A 5GLVA 3VHRA 3VBRB 5BNNB 4IEYA 4D94A 1AX2A 4FPLA 1LOAA 4HMZA 1QJU1 1H8VA 1QOTA 3VBRC 4TSVA 2R6QA 3KT7A 4XEZA 4XJWA 4TZDA 4XBNA 3M3CA 5ABJB 2EXHA 2WKKA 5J96B 1ZZBA 4PBPA 5ABJC 1ASJ2 1OQDA 1XU1A 5JOWA 2HWD2 4Q4X2 4XFIA 1IKPA 2JEMA 3U0ZA 4HBNA 4LHLA 2BW8A 1LHOA 1KRIA 1YIPA 4Q1PA 5JOXA 2OZ6A 2WNEA 1ZBE1 1ZYBA 3AP7A 4RQPB 4FTBA 3VUOA 3R0RA 2P2KA 4RQPC 3BOPA 3WOGA 5SV5A 1AX0A 1QNYA 5I8TA 1H2MA 4E9KA 4BIFA 1PO11 3R05A 1ZZ9A 4Q4W2 2ETEA 1JOJA 1POV1 1QJX1 1R082 2D43A 1GR3A 1QJY3 4P9YA 3M7AA 4AVSA 4YARA 4XZPA 2BYVE 1R1A3 1RVF1 2GC1A 5C4WA 4Q2FA 1YLLA 3B94A 1QOSA 1ZZ7A 4KG8A 4SBVA 1M4WA 1VBA3 2C0ZA 1OPOA 2QNKA 2NZ9A 5CVRA 1C28A 1SCSA 1G9FA 1HV0A 4GALA 4I01A 3OBTA 1VAMA 2W39A 3B02A 2YGMA 4QHBA 1YO8A 3ZYJB 2PLV3 3GF6A 5T5OA 1FNZA 4UW3A 2JXAA 2YPJA 3VGIA 1NA1A 3P3PA 3AZZA 2VNGA 1RUF1 1W2UA 4WV8A 1LGBA 1SBDA 4LO8A 4AI0A 1ZRRA 4AFCA 1BBT3 2YV8A 1PO21 3LSDA 1SQ4A 1IOAA 1PZ9A 1QH7A 1D2SA 5AFEA 1MEC3 1HXS1 3WNXA 2A6XA 5HBAA 4CP2A 2XVKA 4W6WA 5KC5A 1G9AA 4URTA 3GALA 3P3NA 1AL0G 1IS6A 1NCQA 2DTWA 1N3OA 2O0OA 5AC93 4YZ5A 3TWIA 4QD2A 3MYXA 4LUMA 4S2HA 1VLNA 1Q8OA 1JUHA 3S30A 3VZMA 3PVOA 4WVMB 4AWDA 1PNGA 2HWF2 3J9SA 3KS7A 1EPZA 3PVNA 1N1YA 1RJ7A 1XNKA 4XXAA 1UKGA 2WNVA 1X8MA 2QZ3A 1H2NA 2R061 1AZDA 1LHVA 1J1TA 2ZHMA 4R4XA 5SV8A 1RITA 2CAUA 4OLLA 1N1SA 4YVSB 2B5HA 4RR3A 4N7UA 3AYCA 5T50A 1GLHA 1REDA 1OSGA 2HWE3 4YVSC 1AR62 2PHWA 3KCXA 1UKRA 1RUC2 3E6CC 1U0AA 1WLTA 1G9CA 4GH4A 1GICA 2OW4A 1LRHA 4M0NA 2YROA 4S2DA 4K7JA 3GBFA 5LK7B 4JDOA 1Z7S3 1L3JA 5J36A 2E7QA 2G4IA 2XBO1 4GB32 4C90A 3V0BA 2XWBB 4RS5A 5EWSA 1EAH3 3GBWA 3NVCA 1RUI1 1UIJA 1JH5A 1VRH1 4GMP1 4BM8A 1WW5A 2ZMKA 1WD4A 1H4HA 4YGBA 1Q5OA 4Q4Y2 4P9WA 3WVJA 3MF9A 4I30A 1O5UA 1C3HA 3WG4A 4NVPA 1MACA 4FPEA 3IWZA 3OTFA 4FPJA 3M3OA 5A32B 5JR7B 1GKBA 2XLGA 3OCPA 1S0IA 1CX4A 3EBRA 4B8EA 1PIV2 3AXEA 3NSTA 3WDTA 3GYDA 1HQLA 1J58A 2XKOA 2QVSB 1V70A 1OPMA 5JOYA 5KXEA 2DCTA 3WHUA 3CL1A 4MGIE 4YGEA 1LGCA 5T5LA 1VBC1 2XVGA 4D3WA 1LENA 2XJSA 5FDBA 3AMHA 1VBE3 1S2BA 2RS52 3ELNA 2DCYA 3NKGA 1O3QA 1Z78A 1PM7A 4U2AA 1W0OA 3M4FA 4Y20B 5I0TA 1O5LA 1WMFA 4Q4V3 2JENA 4E4SA 1RUOA 3ZN4A 2NM1A 2D97A 3H8UA 1PVC3 1RIRA 4JV4A 3AB0A 4XFFA 3URFA 1CAWA 2JG9B 2IFRA 1ZRCA 3ZXEA 1C5IA 2X8KA 2JG9C 4BOWA 4LE4A 4CDQA 3DF0A 2PHLA 3AJZA 1BMV2 3IBMA 1WUVA 4U36A 4IEXA 3VZKA 1WW6A 2QDRA 5GZEA 1Y43B 1ZA4A 4CDXA 1AR81 1YIFA 2SBAA 1LEDA 2RS11 3JD73 5J3UA 3ILRA 4J6GA 4YLZA 4OHXA 1GZWB 4QM9A 1I6XA 3JUUA 2BNOA 1H2KA 2BVBA 1QJU3 5GJ6A 2RHPA 5KHJA 5JWPA 4IL7A 2MHFA 5EXOA 3ZN6B 3GBGA 4DRRA 2BBVA 2PFWA 5JAXA 1HRI2 1C57A 2NP0A 3NKTA 4AHXA 1OFNA 3OYWB 3TAYA 1OKQA 1ZBE2 4HZFA 4KBBA 3RZZA 3TN92 3VBRA 4EN8B 4XIOA 1BJQA 2JD4A 4OI4A 3LCPA 2VVFA 2D5FA 1GZ9A 2AZ5A 4COUA 1UPIA 3G6JB 3BALA 1NCRA 4AFAA 1YFUA 3WW1A 4Y1UA 1H2LA 4YM3A 4AEKA 3WQ1A 1BEV1 1PO13 2ARBA 4MZUA 4I0BA 1W39A 2GSYA 3Q9OA 3FLRA 2DFBA 4FAHA 1POV3 1QJX3 4IEPA 2ZACA 4KGGA 4JTNA 4P9LA 2JKBA 3KCCA 1RVF3 3MPPG 1N47A 2O8QA 3BB6A 3BTAA 4HLTA 1OFSA 3WW4A 1NLSA 1Q43A 1SLTA 1FMD3 4RQPA 2DURA 5FCCA 2I74A 3A0KA 2Z79A 4P9JA 4N7IA 3POSA 4QPGC 5FAXA 4DB5A 1O4ZA 4QQ2A 1R1ZA 2P37A 4HSJA 1QQP2 4I09A 1RUG1 3UV9A 1F31A 4AQTA 4PLMA 3INAA 3ACLA 4UW4A 2Q1MA 4QQPA 4WVWA 1ZBA2 3DUIA 1RUF3 4LR4A 3JQXA 2HWC1 4XJ8A 5IK7A 4B4RA 3RMYA 1XRUA 5CIRA 3U4XA 1REEA 3O0WA 1HV1A 1D4M2 3MW2A 1PO23 2XKPA 2KA3A 1NA1B 1QJY1 4AI2A 1PVXA 4XILA 2XLAA 1HXS3 2AENA 4MGKE 5GZFA 3U11A 4CZSA 2GNTA 1URXA 3GNEA 1W6QA 3UKVA 3AM2A 2BNMA 3IIAA 3VKLA 2RR11 2DCKA 2HEVF 1DYPA 5JVVA 5T55A 1BK1A 4AGVA 1V9U3 4FPGA 5GLTA 5DZGA 2R062 5FO7B 3IT8A 1HDKA 3VKFC 4D69A 3MIHA 2R0HA 1ULEA 2E63A 1OI6A 1NCQB 5FRAA 4HPKA 2ZKLA 1EP0A 5H9RA 5CFDB 1NCQC 2MEV3 3AMNA 2ZGNA 4OHZA 4Q29A 1X50A 1LOFA 2ZX2A 4Q0UA 2VY0A 3GZUC 4HN0A 1A3KA 1MZEA 1AR93 5CFDC 2JJ6A 1RHI1 2WNVB 2XJUA 2XJVA 2RMU1 1F8VA 1CJDA 2GN3A 2IXIA 3HQXA 1MEC1 4P9IA 4JRLA 2R073 3B69A 1J3QA 4RR3B 1MZFA 2VW2A 2XBO2 4EN7B 1W6NA 2R042 4P5HA 4JDMA 4Q1RA 5FLJA 2BTVC 1CR7A 1KQRA 2ZGSA 4RR3C 4W65A 1DGRA 3ZFEB 4BE3A 1VRH2 3GZAA 4ISRA 4YVSA 5GKAC 1D0GA 4N90A 5BPXA 1Q8QA 5DDJ1 3MDPA 5HCFA 3ZFEC 5IUQA 2VOXA 1GFF2 2RS32 2WSUA 4GH4B 3ZO0B 1MS5A 1RUI3 1S1AA 1DYKA 4ATFA 4GMP3 1YWKA 4GH4C 3PJQA 3B3QE 3WR0A 4G3YC 5L36A 4WVVA 5CFCA 4X8PA 3K48A 2CYFA 1X36A 2GNBA 1HKDA 3AX4A 1IS5A 4MGZE 4BMBA 1LULA 2D3SA 2HWE1 3B00A 4FPCA 4RS5B 1AL22 3FBYA 4MX3A 4CRQA 4M3CA 3FUQA 4FT8A 4RS5C 4Y5Z0 5T3NA 5FTTC 5DZFA 5CG8A 4AE2A 4Y22A 2VW0A 4RHV1 5BNPB 2R16A 3J8F2 5FOBB 2OUJA 1DGWA 5BNPC 1SEFA 1PGL1 1ND2B 1IHMA 3DL3A 3QH7A 4L97A 3FC0A 3FX3A 1VBC3 4K6BA 5GLUA 1EAH1 1ND2C 3FHIB 2ARXA 3FWEA 2NLRA 3NV4A 3LB9A 1FXZA 1PZ8A 2VU9A 3WV6A 1AF9A 2VOWA 3W59A 2WT1A 3RI9A 2PHTA 2W68A 3CJIA 1ENSA 5B2GB 4BA6A 3PMEA 3IPVB 1XNDA 2ZGRA 2D6PA 5EJ3A 5H9QA 3RMXA 1H30A 2WSVA 4E4ZA 3T1MA 1OHFA 3J26N 1DZRA 3VHNA 4XOGA 1X82A 3AFKA 3H1MA 3QLQA 2KXLA 2UWBA 2DCJA 1BVVA 1C8M1 1JYCA 4LBQB 4O9GA 1JYIA 5LRRA 1WMEA 1COV2 1JHNA 4Z92B