1BYHA

Molecular and active-site structure of a bacillus (1-3,1-4)-beta-glucanase
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
214
structure length
214
Chain Sequence
QTGGSFFEPFNSYNSGTWEKADGYSNGGVFNCTWRANNVNFTNDGKLKLGLTSSAYNKFDCAEYRSTNIYGYGLYEVSMKPAKNTGIVSSFFTYTGPAHGTQWDEIDIEFLGKDTTKVQFNYYTNGVGGHEKVISLGFDASKGFHTYAFDWQPGYIKWYVDGVLKHTATANIPSTPGKIMMNLWNGTGVDDWLGSYNGANPLYAEYDWVKYTSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords HYBRID
publication title Molecular and active-site structure of a Bacillus 1,3-1,4-beta-glucanase.
pubmed doi rcsb
source organism Synthetic construct
total genus 50
structure length 214
sequence length 214
ec nomenclature ec 3.2.1.73: Licheninase.
pdb deposition date 1992-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1byhA00
4W65A 1RINA 3USUB 3NV4A 3WG2A 2R0FA 2EIGA 3HR9A 3LCPA 1OQ1A 1LOFC 1WD4A 4BOWA 5CNAA 4ZKTB 3QCWA 5IT6A 2E51A 5JDBA 3OY8A 3AXEA 1QGLA 5IK7A 1BJQA 3UJOA 3PVOA 1V6JA 3AP7A 3O5SA 1SBEA 1C4RA 4DPNA 4PCRA 3A0NA 3ZSJA 4Y1ZA 1HKDA 4NO4A 2DTYA 1PZ8A 3ZYRA 1FAYA 2YY1A 4Y22A 1QDCA 2AR6A 3WCRA 2DUQA 2DU0A 4Q26A 1XQNA 5AVAA 3KQRA 3OJBA 2DVAA 4XYXA 5DZEA 1SLTA 2WT2A 2R49A 1WLDA 2YZ4A 3AP5A 3IN9A 3FUQA 1KDKA 5T52A 2DUOA 5DZGA 4L8QA 1ULCA 2ZGKA 2ZGOA 1DQ1A 4YZ2A 1LOCA 2ZGSA 3GALA 3RSJA 1YI7A 2YV8A 2D6LX 4YW3A 2PHXA 4YW1A 2P3IA 3T1LA 1J1TA 1CR7A 1W6PB 1YRZA 2DVDA 4ITCA 2D6NA 5E8AA 5GLUA 5T5OA 3WLUA 2NN8A 2C5DA 3N7LA 1CVNA 4U36A 5FRAA 1A78A 4YM2A 3ZXFA 3B00A 2CL2A 1V6IA 2JJ6A 5GJ6A 2ZBJA 1MZ5A 1A8DA 3WVJA 1MACA 1W0OA 4XIKA 2UWCA 5BYNA 1UKGA 1AX0A 1URXA 4AYUA 1CJPA 3B3QE 2DUPA 4DRRA 2DURA 2R0HA 2ARXA 3SNMA 1JW6A 3AP4A 1V6MA 2XB6C 5GALA 3WHTA 1LHUA 2GNDA 5KXBA 5SV8A 3FLRA 2RHPA 1LENA 2D7FA 5GLTA 5KXEA 1G9DA 2WSUA 1G9AA 1FYUA 4GKYA 4ATEA 2AREA 3IPVB 3H0OA 2E7TA 2JE7A 1LU1A 1LGNA 5EYXA 3NV2A 1KITA 4YGEA 1GZWA 4I30A 5DG2A 1MS5A 2ARBA 1F9KA 3ZVXA 5T50A 1W6NB 2ZHKA 3POYA 1QMJA 2VY0A 1AVBA 5T55A 2DWRA 4PBPA 3O0VA 5GZGA 2D6KA 1UZYA 2CWMA 2GMEA 4XJZA 2A3WA 2LTNA 4XE9A 3T2TA 1V6OA 2EAKA 3WUCA 5IK4A 1N1SA 3WG3A 4BLJA 3OBRA 1CPMA 1LEMA 3RMXA 1N1TA 2UURA 4RA0A 4FPLA 1GNHA 2DVFA 4YZ4A 1DZQA 1UL9A 1WBLA 2A6WA 4YZ3A 2ZAAA 2PHWA 1GZ9A 2ZA9A 1DYKA 4FOYA 3WDTA 1UPSA 2VUAA 3WNXA 4P9XA 1ENQA 2AUYA 1WLWA 2EALA 1Q56A 5GZFA 2V5YA 1KJRA 3NV3A 4ATFA 1G7YA 1Q8QA 5T5LA 1LGCA 3MW4A 4M3CA 4AVSA 4HANA 4WVVA 3SH3A 4YW4A 3ASIA 4DS0A 4ISRA 2ZABA 2P34A 4FPCA 1AF9A 2P2KA 4FQZA 4LBQD 3ZXJA 4XHXA 3Q9OA 4GALA 1YO8A 4YGDA 4CZSA 2WT1A 1LHVA 1SCRA 1R1ZA 1H9PA 3V0BB 2A75A 1SLIA 3JUUA 2ZMKA 1FV3A 3WDYA 4DFSA 4AVVA 5F9TA 2ZHMA 4PF5A 3A4UA 4LBMA 3PJQA 3HN1A 1A3KA 1LOAA 4FPFA 3IM0A 4GA9A 4YW2A 3WDVA 4C1WA 3V65A 1QOTA 5HCAA 3AZZA 1S0FA 1TEIA 4AGRA 1ENSA 5E88A 1JXNA 2GNBA 4BM8A 3ZXEA 2CNAA 1OKQA 5JOXA 5T5JA 5DUVA 3N3HA 3ZSLA 1H9WA 1QDOA 2NM1A 2ZHLA 2ZMNA 1I1EA 3ZSKA 4XMAA 3ZYPA 4XBLA 1Y7BA 2EF6A 3ZSMA 2AGSA 2P37A 2ZGLA 1QU0A 1QNWA 3V0AA 3AFKA 5T5PA 1MZ6A 2EXJA 3OYWB 4GWNA 2VH9A 1H30A 5DUUA 5T54A 3UL2A 5KXCA 2WKKA 1JYCA 3DGTA 3M3CA 1SLCA 2CTVA 1V00A 1CPNA 3VKMA 2A71A 3D6EA 1PZ7A 2VW0A 1V6LA 1VIWB 1VLNA 2ZGPA 3WCSA 4FPKA 1LHNA 3WOGA 1RITA 1GICA 2AYHA 4XMIA 4FP3A 4C1XA 1GLHA 3AYDA 4PQ9A 2PHFA 2H0BA 3SH4A 2A6VA 3WHUA 1SACA 3U4XA 2CWSA 4PBOA 4FPJA 2ZACA 3I4IA 4YM3A 2WSVA 4HL0A 3VV1A 5LK5A 2Z42A 3JU9A 4M3CE 1ZM1A 2A70A 1W6OB 3LSDA 1C1LA 1CIWA 1LHWA 2ENRA 3VKNA 4JC1A 3MEPA 1S1AA 1OFSA 2ZGNA 4OZXA 5H9RA 1WW5A 5IK8A 5DG1A 1IS4A 5H9PA 2JDZA 5GZCA 1W6QB 4K1ZA 2R16A 4U2AA 1LODA 1S0JA 3L2YA 4YG3A 5DZFA 1QNYA 1DFQA 3B9CA 3M1HA 2JE9A 1D2SA 1BXHA 4Y1XA 1Q8OA 4H55A 4LBJA 4XBQA 3AYCA 4YGBA 1YIFA 1AJOA 2GMPA 2R1BA 1CESA 2ZKNA 4Y20A 3IMNA 2JECA 2A3YA 4LBKA 1LCLA 1SCSA 4IQPA 3SLIA 1VALA 1DGLA 2JKBA 1ULEA 3O0WA 4YM0A 2ZGMA 4K21A 3WDXA 1N1YA 3RQ0A 2PHRA 4Q1PA 4SLIA 4Y1VA 2FMDA 3RMYA 3IPVA 2WLQA 1WD3A 4UW5A 1WBFA 1S0DA 4MYEA 1GZWB 1UAIA 3N35A 4ASMB 1MS3A 4Y1YA 1N3PA 1PZ9A 4XDQA 4BMEA 3POSA 1KDMA 3PVNA 4K1YA 2WT0A 2NMOA 1W6NA 2A6YA 3NV1A 3AXDA 3ZPYA 1W6MA 3ILNA 5JVVA 1F5FA 1V6NA 1KRIA 1S0IA 5CAZA 5GZEA 1G9FA 4FP2A 4XJ9A 4Q8LA 1WLCA 2YROA 4XJWA 1CN1A 4ZXKA 4YW5A 1YXWA 1JHNA 2NYYA 4JCKA 2VU9A 1RIRA 4YFZA 5DUXA 1MS4A 1APNA 1ULFA 2D44A 2DYCA 4F83A 1QKQA 2B7YA 3WG4A 3SH5A 4YGCA 1MS1A 2GNTA 2OVUA 3O12A 4BLIA 3PMEA 1AXZA 3WUDA 1AXYA 4YG6A 4K20A 3N7KA 5F5QA 1QOOA 1JBCA 1UX6A 1S0CA 1DYPA 1GSLA 4UW6A 5EXOA 1MVEA 2ZMLA 5GLVA 2EXHA 1EPWA 1BYHA 3WG1A 3AYAA 3R05A 1JYIA 1AXKA 1ENRA 2ZGUA 3R4SA 2KM2A 2D43A 5EYYA 3N36A 3W59A 1QOSA 4FVVA 4TYSA 4UW4A 1N1VA 3WDWA 4Q8KA 5JMCA 2VW1A 1IKQA 1CONA 2XG3A 2CY6A 2E53A 3OBTA 2UU8A 4R9AA 4M00A 3MW3A 2OUHA 2ZGQA 2C9AA 4R9BA 3AJZA 5DXDA 2GDFA 4WZFA 3POWA 1DQ6A 4FPEA 2PHUA 1NLSA 3ILFA 5GM0A 5JOWA 4Y1UA 4RL7A 3MW2A 4M3CF 2GNMA 4XBNA 1BZWA 3BTAA 1DHKB 1N47A 4YG0A 4BMBA 1IOAA 1DBNA 4R9CA 4BPZA 1GKBA 2SBAA 1AX2A 2D6MA 4AGVA 4LBQA 1CQ9A 1Q8VA 1SBFA 2W52A 3D4KA 1YYNA 4KBBA 4P14A 1C1FA 3FLTA 3M3OA 3M3QA 4XTPA 3USUA 1C57A 2NZ9A 2PHTA 3OY8B 1LU2A 1GZCA 4FOVA 3UK9A 4XJ8A 3M2MA 1Q8SA 1IS3A 1LECA 2W68A 4GWMA 3TB0A 1SLLA 3VKOA 3AX4A 1AX1A 1DQ5A 4YZ5A 2CYFA 2ZGTA 2P3KA 1HDKA 4Y22B 3V0AB 1D0HA 2HYKA 2ZZJA 5CBLA 1B09A 3HMYA 1DQ2A 3DUIA 3VUOA 1Z0HA 5E89A 4P9YA 4LBLA 3OYWA 3ZXLA 1DQ0A 1ONAA 1ULGA 4Q1RA 3B69A 5CB7A 3MPPG 3OGGA 1LULA 4FPOB 1G8WA 2I2SA 1BQPA 2SLIA 2GMMA 3OPZA 2EXIA 3FBYA 3BOPA 4ISQA 4Q2FA 1MR5A 1X50A 2Q5TA 1AZDA 4YZ1A 1LHOA 1W6PA 3AZWA 4R9DA 1LTEA 2A6ZA 4FPHA 4XJAA 5H9SA 2ERFA 2YXSA 4XTMA 1BKZA 4FOWA 1S0BA 3ATGA 2E6VA 5H9QA 4YFWA 4XIOA 3BODA 2WNEA 1LESA 1HLCA 1W6OA 1SFYA 1G86A 2NMNA 1NXD1 3QLQA 3AK0A 1GNZA 2G4IA 3O0XA 1JN2P 3C2UA 2OW4A 3LSEA 3A0KA 3AZXA 1FV2A 3PVEA 5GLWA 5HCBA 1W6QA 2ES3A 4P9WA 1G9CA 2A3XA 1LEDA 2D6OX 3M3EA 1S0GA 1SBDA 3APBA 3KM5A 4FQ4A 1JUIA 2DV9A 1DIWA 3AZVA 4Y20B 4WVWA 1SLBA 5EWSA 4AWDA 3RRDA 1O4ZA 1Z78A 5GZDA 1GANA 2WQZC 3BIWE 4LBNA 2P3JA 2GN7A 2DVGA 5IUQA 4NOTA 1UMZA 3SITA 3I8TA 2E7QA 3TAYA 3WDUA 2R1DA 2A7AA 2UWBA 4Y24A 4XXAA 3WV6A 2NP0A 3ILRA 4JRAA 1ZA4A 3R4UA 3NWKA 4BQ1A 1MS9A 2D6PA 2VW2A 3FFZA 4LBOA 3GNEA 4FPGA 4CRQA 2AENA 1LJ7A 3INAA 1DQ4A 2ZGRA 3SISA 1W6MB 3IKWA 1DLLA 1KJLA 1U0AA 2WJSA 4FPYA 4YM1A 3FLPA 3ZXKA 2DVBA 2BQPA 2EXKA 3VKFC 2GN3A 3WZ1A 2ZHNA 4AVTA 2JD4A 3FUOA 2TEPA 3UJQA 4CTEA 2A5ZA 1WCSA 1LOGA 4Z8BA 1W0PA 1WUVA 2UWAA 1FATA 2OUJA 5JOYA 1HQLA 1I3HA 1UN1A 2PELA 5KXDA 2YMZA 4M3CB 1Q8PA 2D3RA 4AGGA 4D69A 1WW6A 2V73A 1AJKA 3AZYA 4FOQA 1IKPA 1LOFA 4XHBA 4Q27A 1LOBA 1N3OA 4Y26A 2AH2A 2LALA 1MS8A 3B01A 1SLAA 2DU1A 1WW4A 3AP9A 1VAMA 1MS0A 1LGBA 4DQAA 4M01A 1WW7A 1G9BA 1HQWA 1S0EA 4XILA 3RS6A 1JOJA 5CA6A 1N3QA 1IS5A 5L73A 3V0BA 2D3SA 1ULDA 4WV8A 4XOGA 3T1MA 1MVQA 2W08A 1GV9A 2DTWA 3N7JA 5JOZA 3D5OA 1UZZA 4XJUA 1FX5A 2D3PA 1FNYA 2FHRA 4DRVA 5HCFA 1KQRA 3AP6A 2GALA 2W39A 4XXPA 5DUWA 1FNZA 1V6KA 3AJYA 3CNAA 4TZDA 2VXRA 1QF3A 4UW3A 1GBGA 3VKLA 1F31A 1O4YA 5GLZA 4GXLA 4XZPA 5JLVA 4GKXA 3RG0A 3V64A 4YLZA 1GYKA 1LOEA 5IK5A 3AYEA 3ENRA 4LBQB 3N7MA 1IS6A 2A6XA 5FREA 1VAVA 3W58A
chains in the Genus database with same CATH superfamily
3WSOA 1ZZBA 4TSVA 1UOJA 3WG2A 2ZEYA 2R0FA 2EIGA 3WW1A 3ZR6A 4ZHNA 3LCPA 1OQ1A 4COYA 1LOFC 3O1OA 1WD4A 2QQLA 4ES9A 5FZIA 1NAEA 3ON7A 3OY8A 1OD3A 2RS52 4AXOA 5IK7A 4XF3A 4CEWA 2JDKA 1KFXL 3AP7A 4GB31 1Y43B 4NPMA 3O5SA 2OYZA 3CHXA 4DPNA 1CD3G 1Z7S1 3A0NA 1O91A 3WXPA 4NO4A 5C8CC 2ILMA 1UYZA 2WC2A 3ZYRA 2YY1A 4LOSA 1X36A 4LO4B 4JX0A 4ARXA 1PM4A 2VTXA 2VCMA 3KQRA 4MG2A 3OJBA 2XBO2 4QPYA 5DZEA 1OF4A 3M3IA 3WY6A 1WLDA 4ASLA 3PNAA 3VBOC 2Q1FA 4E9KA 4UFLA 2P1BA 1NCQA 2EIBA 2ZGSA 2YV8A 4Q4X2 2D6LX 4YW3A 5FYBA 3T1LA 5F9TA 5JPNB 5T5OA 1VBB3 4ITCA 5E8AA 3OTFA 1UPIA 3I3BA 2NN8A 1W9YA 5F6LB 2J7MA 5LEKA 4RHV1 1QQP3 3N7LA 4XUTA 4NMIA 4RFT0 4YWAA 3ETQA 1EY2A 2JJ6A 4EQVA 3AVSA 2ZBJA 1MACA 3FMGA 4J6GA 3VB9A 4E2GA 3NL1A 4WM7A 4B7EA 4HFSA 4OHYA 4CEYC 1CJPA 1R083 2DURA 2R0HA 3B7MA 2B8MA 3AP4A 3SNMA 1V6MA 2XB6C 3IDBB 2RJKA 4CCDA 1PGL2 1LHUA 2JG8A 2XLAA 3OBZA 1GU3A 1G6NA 1J84A 3CJIA 4H7LA 3ME2A 4IEUA 2DBIA 1JHJA 3PU3A 4GQ7A 5FY5A 3LEKA 2WSUA 3HNBM 3W20A 2VAUA 4AI2A 1G9AA 2AREA 5FKCA 2ORXA 3ZM8A 2E7TA 1LU1A 3IDCB 5FYVA 4LO6B 4OI1A 4C0BA 5FAXA 1KITA 1WMDA 2W5FA 3PU8A 1DGRN 4XUOA 4FSJA 4I30A 3QOPA 2PQSA 1IQAA 2Q4SA 2R061 4LA3A 1H8TC 5C3QA 2CGOA 1QMJA 1VPHA 5F7UA 3E5QA 2DWRA 5CG8A 5GZGA 1BBT3 2Y26A 2N7GA 3KV5A 5BNPA 4FTSA 1YFWA 4OHVA 3ZN4A 4YVSC 4DEVA 3NNGA 4AVBA 4BLJA 5FYHA 5FZ3A 1IPKA 2IXHA 1LEMA 3LPFA 4XF4A 3RMXA 4A6SA 4CSWA 1XYPA 5K4LA 1N1TA 4XFGA 4D6RA 3PIGA 1GNHA 5FQ0B 4CP1A 5ABJB 1WBLA 2A6WA 1YHFA 3NJXA 1CWPA 1T2XA 1DYKA 4FOYA 1QEXA 4JGZA 1UPSA 1W8WA 2VUAA 5LRSA 2E33A 2EALA 5IVBA 5KHKA 4D94A 4NJ4A 4M3CA 4FXKB 3SH3A 3B5LB 3ASIA 1VRH3 1PO23 2XJSA 4DZGA 1UIJA 3THCA 4UBGA 4FPCA 1EAH1 2RMU2 3ZFFA 2W47A 4XHXA 3O1SA 4CCEA 5FZHA 5F1RA 2QQPA 3SMHA 2FMYA 1ULOA 4Q0QA 5I0DA 2C24A 1H9PA 2RV9A 4AVAA 5C8CB 3GJBA 1VMFA 3V0BB 4UWDA 2A75A 3CZUA 4RQPC 2RJ2A 3VZMA 1C8M1 5DABA 3UKVA 3H3ZA 3KSCA 1RHI2 5JAXA 1FI2A 3U78A 4AVVA 3CZJA 1RUH1 4FFIA 3ZMOA 1WWYA 4DNYA 1SQ4A 2HJIA 5EJ3A 1RMU1 2VECA 5FZ6A 3VBFA 1UU5A 4GB33 3UGGA 3AMPA 4FPFA 4C1WA 3IM0A 2UYAA 1Z7S3 1AL22 3VBOB 3U1XA 1OH3A 4DXRA 5HCAA 1WA6X 3RZGA 2PLV2 1ENSA 2YFZA 1R1A1 3DYPA 2GNBA 4LOTA 2WAAA 3ZXEA 1RUJ1 1YI9A 2CNAA 4BYYA 1OKQA 1OF3A 1RUC1 4KQ7A 5T5JA 1H9WA 1W2AX 4CDQA 5FZ0A 5A80A 5JR7B 1DZTA 3Q8AA 3H8RA 2JB4A 4CP2A 4XFFA 4FTBA 4YW6A 4XMAA 3U14A 1RUG2 4K8FA 1YC61 3MF6A 3C8XA 3WNNA 2JDYA 2VNGA 1TE1B 3AFKA 3I2JA 4CEYB 2EXJA 2IVIB 2XQRA 4DOUA 2VH9A 1H30A 5T54A 1GMMA 2RJLA 4IEOA 2QQOA 4RHV3 5L9BA 3FHAA 1JUHA 4K9SA 3DGTA 2XUMA 4QPGC 1BK1A 4HVQA 5GKAC 1S4CA 5EFUA 1BEV1 3D6EA 1PZ7A 1V6LA 2NLRA 1ZBA2 4Q5OA 3WCSA 4RN5A 3GCXA 1LHNA 4FPKA 1RITA 2P6CA 4A3XA 1NA1C 1GLHA 1NQJA 1JOPA 2G9FA 3DYOA 4QX5A 5LBFA 2WZR1 1OMIA 1YQ5A 3WHUA 3BIEA 2PMWB 1OFNA 4QGMA 1H8TB 3RYRA 4CDWA 3HQUA 5BPXA 2Z42A 5FV3A 2JKXA 1W6OB 4N43C 2FDGA 4I2OA 5A3WA 4IEZA 4OZXA 1OFSA 5FY8A 4YVSB 2BFUS 2QQWA 4NHYA 5EPAA 2WFF1 1IS4A 5JIUA 4W6WA 5AC91 2JDZA 1W6QB 1OVPA 2R16A 2YGLA 3M8LA 4U2AA 1ST8A 3L2YA 1R091 1YQ2A 4AQ6A 3B9CA 2ZXQA 4PF1A 3I59A 1Q8OA 1QJU2 4BIFA 3VZJA 3H3UA 1YIFA 4IV1C 2VJXA 3ACIA 2C26A 5BNOC 1DDLA 2JWPA 5CYYA 5BNNC 2BBAA 1LCLA 1SFNA 1S2BA 3SLIA 4YM0A 4Q4Y2 1ULEA 4TTGA 4I02A 2Y33A 1QHDA 2ZGMA 1UU6A 1N1YA 1V9U1 3WDXA 3RQ0A 4LHSA 3DEMA 4HMZA 3CU7A 2FMDA 3M4FA 3RMYA 4BQXA 3UGHA 2OX0A 2B5HA 3WP4A 1ND3A 5CEHA 3FE5A 4BMEA 5IFTA 1KDMA 1W99A 5FZLA 1JYWA 3NV1A 4RQPB 5IAVA 1QJY1 1W6MA 5HV4A 3ILNA 1F5FA 1MZEA 1V6NA 4N53C 1O8SA 3GF6A 1KRIA 1AR81 1VP6A 2IXLA 2VZSA 1EAH3 3I3QA 3KS7A 4QXCA 5FYIA 4FP2A 1HB1A 4Q8LA 4X6RB 4XJ9A 4RGGA 1W04A 2BOJA 4XJWA 1SPPB 1HIXA 4ZXKA 3SHRA 1JHNA 2NYYA 2XPJA 2X5IC 4YFZA 2ETEA 1GOFA 4JV4A 1ULFA 2DYCA 4V2VA 3TYJA 5FWEA 1W3XA 1C8M3 5FQ0A 4YGCA 2ZX4A 4P9JA 4KWLA 4IESA 1K12A 1GNYA 2PAKA 2HWD2 4IE0A 4R52A 2ET1A 3ZPOA 1RMU3 3AL5A 1L7RA 2LROA 3VBSB 5F5QA 2HWF1 3KF3A 1S0CA 4LXLA 4HN1A 4EZ4A 1TMF1 4FXGB 1H6YA 3T2QA 3ZYBA 5JSOA 2VUDA 4CP9B 5GLVA 1BVVA 1EPWA 1BYHA 1R1A3 4Y5SA 1QJX2 4A6OA 4NIIA 1OOPC 1RUJ3 1AXKA 4I0WB 4Q4V2 2E7AA 1CAVB 1W8UA 1K5JA 5JIAA 3WQ7A 4Q8KA 3LA2A 4FVVA 4TYSA 4QQOA 3IWZA 4MX3A 2XG3A 2CY6A 3OB8A 1SMVA 1XE0A 1CX4A 4EZHA 3WF1A 3VBSC 3CEWA 2BGCA 4QPGB 2CV6A 5A3LA 5C8CA 3HT1A 4W50A 5F3EA 5LA9A 4IGPA 1UOFA 2YUEA 4PIXA 4WZFA 4COZA 1NLSA 1X33A 3CDZB 4Y1UA 2R072 2PTMA 2GNMA 1NA1B 4XBNA 1BZWA 3G6JB 5F5CA 1DHKB 3TNQA 4O65A 4B7KA 3WR0A 2HWB2 3TEWA 4R9CA 5JDBA 3B02A 5BNQA 5HPOA 4AGVA 4BXFA 2PYTA 5F2WA 1PGW1 1SBFA 4XFHA 3OD0A 1L7LA 3VBOA 2YU2A 1UY3A 4KBBA 2ZX0A 2EA7A 3FLTA 3M3QA 4XTPA 3USUA 3WT3A 4QB2A 4N43B 3RZKA 4E4HA 1O6UA 4UAPA 2VZVA 1LU2A 4FOVA 3IB3A 1Q8SA 5JCTA 1IPJA 1JZ6A 3K3NA 1DQ5A 2WZR3 3IAPA 4Z92B 4IW3A 1O3SA 3V0AB 1ACCA 2HYKA 5CBLA 2FDIA 2J1RA 5EJ1B 4MXWB 4IV1B 3SQOA 1CAWB 2XUEA 3BU0A 1AR72 4HETA 3ZXLA 2XL9A 3H9AA 2C0ZA 1ONAA 5EHDA 5BNOB 3X29B 1BMV2 3VBUC 5BNNB 3GBWA 5AC93 3LEIA 1OPMA 1LULA 4CPBD 1G8WA 5G04L 3WX5A 3OPZA 3B9IA 4JKLA 4XDOA 4I3PA 1K3IA 3JCIA 1X50A 2Q5TA 2YG0A 4XCBA 3POIA 1ASJ1 3MIEA 1XNBA 3AZWA 2JG9C 4UFKA 5FMDA 1H6XA 2ZCWA 2A6ZA 1SZBA 2ERFA 1S0BA 2E6VA 3K51A 5H9QA 1H8TA 4C90A 1LNSA 2OPKA 2FQPA 1EUUA 4N53B 1LESA 1RYYA 1KS5A 3HD8B 3H8XA 1W6OA 3ZX7A 1XXNA 4AFDA 1UOBA 4AE2A 3H8OA 2JDNA 3AK0A 1GNZA 3NNJA 4DY5A 3W5NA 2G4IA 3O0XA 5ACA2 2RE9A 1SFPA 2QTWB 1U5XA 2X5IB 3M7AA 4HG6B 4OCTA 5DAPA 1W6QA 4BHPA 3JZVA 2HWE2 4LUMA 4MGSA 4XURA 2ARAA 3GJAA 4KNCA 2W1WA 3AZVA 4QDRA 4XDPA 3RVHA 2NQYA 1SLBA 1X8EA 5EWSA 2W1UA 1JZ8A 4PLMA 4CYDA 5GZDA 5IVCA 1GANA 3BIWE 1XB9A 5FZ4A 3ZR5A 2WS93 3RZHA 1H0BA 1YFYA 2WNVC 3B93A 2DVGA 2RS13 4HKWA 4Q4W3 5FLHA 5IUQA 4D0QA 1OOPB 1VBC1 2E31A 4LO8A 3ROUA 3ZOIA 3ILRA 1VBA1 1ZA4A 2NP0A 4XCAA 5FZOA 3EYPA 2Y38A 4DUVA 3GNEA 2P6HA 2JIGA 1XE8A 1GOHA 1PVC2 1LJ7A 2HWF3 1DQ4A 2JB8A 2RDSA 3AL6A 2WS92 4QAWA 1PIV2 1DLLA 1TMF3 1U0AA 3LE0A 5FZ8A 4A42A 1WKYA 5HV0A 4RQPA 3LIGA 2IFWA 3ZXKA 4JGYC 5C4WC 5KC6A 1YWKA 1C28A 4AQTA 2TEPA 4YG3A 3UJQA 4L92A 2A5ZA 2GH2A 1WCSA 2KXLA 4Z07A 3VD7A 4AFAA 1JZ5A 2WWUA 2UWAA 4F8AA 1FATA 2J42A 5JOYA 1HQLA 1I3HA 1SPPA 1UN1A 5JXJA 5KXDA 1PO13 4ZZ8A 2YBPA 4HSLA 1FPN1 1AJKA 4HBNA 1QH6A 1FMD1 4XHBA 1LOBA 4Q0VA 1W9WA 5JPMB 2LALA 5FIXA 2HH9A 3VN4A 2VMFA 3LDBA 1X82A 1X9PA 4HVOA 4CU7A 4WBBA 4NHXA 3I97A 3IT8A 3ZXAC 2Y6FA 1WW7A 4RGKA 1JOJA 1ZZCA 5L73A 4GWJA 2PAMA 2D3SA 1ULDA 3KVAA 4WV8A 5FP3A 1CAVA 3VL9A 1MZFA 4LKFA 4QHBA 5JOZA 3DXUA 3OPWA 1FX5A 2FHRA 1FNYA 1Y3TA 3FHIB 3KV4A 3LKJA 3MIFA 5HCFA 2GALA 2WZPP 3VBUB 5IVJA 4IV3A 3RWKX 5CVRA 3O1VA 4N9HA 4QPGA 4UXAA 2OKXA 3BPZA 1O3RA 2PXJA 1F31A 2RM22 1RUI1 3RJ2X 1O4YA 3QH6A 5D8AC 4XQ4A 4QX0A 3T30A 5JLVA 2WL1A 1GYKA 3GZUC 3PTRB 4JHZA 1H2LA 2FBEA 4BCUA 5JSPA 1NA1A 3ENRA 1XU1A 3IAQA 3R4DB 2JG9B 2XWJB 3N7MA 1IS6A 4XZUG 4AHZA 3D0SA 5J09A 2A6XA 3VHNA 1VAVA 2PHDA 3HT2A 4W65A 4ONUA 4EWEA 3AVRA 1A34A 3KQ4B 3E97A 1ZBE1 3I49A 3POFA 5J48A 2G9ZA 3JD73 4N43A 3QCWA 5FO8B 3R6SA 3ZN6B 3GHMA 4F3JA 3AXEA 5A3NA 3W21A 4CCMA 3POBA 1ASJ3 1NE6A 3JBG3 2RS51 2CGNA 1V6JA 1JZ4A 4PCRA 4MLOA 3DPRC 4Y1ZA 1RL3A 2D97A 5A1AA 2Y6GA 2I45A 4AFMA 2DUQA 2DU0A 3MO4A 4Q26A 5AVAA 3LF7A 1AYN3 1MEC3 4P5HA 1XJAA 4WVMA 5DAWA 1AR62 4DUXA 4IV1A 1CAWA 1SLTA 1E5IA 2R49A 2WT2A 2YZ4A 5T52A 5FZ1A 3FUQA 1KDKA 2DUOA 2VOVA 4JQTA 1JZ7A 1ULCA 2WNVB 4K6BA 4P9LA 4QD2A 5FMOL 5LBEA 2YFUA 1DQ1A 3RYKA 3ZKUA 3OEBA 3RSJA 4B8EA 2FZ2A 1Q5OA 2PHXA 4YW1A 4TZDA 1J1TA 1CR7A 2JDAA 2UY8A 3WLUA 2VZ3A 3DECA 1US3A 3TBDA 1DGRA 4LUKA 1J3PA 1OURA 1CVNA 3RFRA 2WR9A 3B00A 5LATA 3ZXDA 2RS32 1X7NA 2HWC2 1MZ5A 4XABA 3WVJA 4JGYB 4CPBA 5C4WB 1RUOA 1VBC3 3MIDA 4N53A 2RDRA 2UWCA 1EV12 5AFEA 2J1VA 2W9XA 3SKJE 3N9OA 5BXXA 1GZTA 3B3QE 2VO5A 4XFAA 2R6QA 4S2HA 4SBVA 5GALA 3WHTA 4D3WA 2XHKA 1PGL1 3F2ZA 5SV8A 3T4VA 3ES1A 3PUIA 1NY72 2RHPA 2X5IA 5IVVA 2BP6A 1LENA 4AI9A 2D7FA 5KXEA 3WW4A 4MGZE 4N9IA 2I07B 4NHLA 4A7ZA 3S7IA 4PLNA 5JI7A 3LWCA 1QJZA 2XLGA 2QNKA 5E1RA 1QXJA 3K4ZA 1LGNA 3NV2A 5DAQA 1D0GA 4QKFA 4CCKA 4YGEA 1F8VA 1GZWA 3MLKA 4LEJA 1MS5A 5DG2A 3NAPA 1F9KA 1YNAA 3ZVXA 2ZHKA 1J1LA 1HXS2 2AC1A 1AVBA 2JDUA 2VY0A 1FPN3 2VZQA 3J7MA 4XF9A 3S6PA 4PBPA 3O0VA 1OOPA 4UBHA 4DY3A 1OBNA 1FMD3 2LTNA 1V6OA 4LLFA 2QQKA 3A21A 4OUMA 3WUCA 4CDXC 2GC2A 3OBRA 4NUBA 4QPWA 1CX1A 3S7EA 2XJPA 4AZZA 4CVUA 2ET7A 5FY7A 5JR2A 4RA0A 5IW0A 1U5ZA 2XQXA 1DZQA 1UL9A 5D8AB 3KD4A 4NIAA 3RJRA 2X8KA 5JXGA 4LHLA 2A73B 1GZ9A 4Y5Z0 1H1MA 2Q8CA 2X05A 1OKOA 5IJRA 2LRPA 1Q56A 5GZFA 2V5YA 4ATFA 1Q8QA 5T5LA 1C5IA 2WA4A 1LGCA 3MW4A 3RZMA 1UY0A 4DS0A 4C8DA 1UMIA 3H50A 5FJHA 1STMA 2P2KA 4FQZA 1XNTA 4LBQD 3ZXJA 1XNAA 2XWBB 3Q9OA 2RMU1 2RVAA 1YO8A 4YGDA 2FCTA 5F5AA 1S55A 5F6KA 1OA4A 4TWTA 3DPRB 1CAXB 2K46A 3NKTA 1ND2C 1PK6C 3OEAA 5LRRA 3VHPA 1NZIA 2BJSA 1VRH1 4A4AA 3WDYA 2XJRA 4IEXA 3A22A 1RHI1 1TME2 1JOBA 2RS53 2ZHMA 4PF5A 3SCGA 4YW2A 3CKHA 3HN1A 4GA9A 1F35A 3V65A 1HB2A 5L9RA 3I2OA 5I0SA 4AGRA 4COUA 1OT5A 1JXNA 2JICA 4QHOA 2V4VA 3BI3A 2H6CA 2Q1MA 3WNKA 5JOXA 4KGGA 3GBFA 3ZSLA 2XBO3 1QDOA 2JG9A 5E16A 1UYYA 1OVSA 1PVXA 1E5HA 2WABA 3QACA 5KR7A 3ZYPA 1NKGA 5LASA 1B35C 3AKSA 2VQTA 1UX7A 1VBE2 1FOD2 3ZO0B 2AGSA 2P37A 2ZGLA 1QU0A 1K5MA 1RUG1 4HOOA 1ZZ6A 5T5PA 4Q4X3 2QJVA 2PN5A 1HRI2 2UYBA 3L9JT 4RS5C 5DUUA 1DU3D 3ZN6A 1L3JA 4B4RA 5LBBA 2WKKA 2WLPA 1JYCA 3UV9A 1OLMA 1SLCA 2CTVA 2R30A 3CL1A 5FOJB 4B1MA 1CPNA 4BK4A 3LFMA 4LIVA 3HVDA 2VUCA 3RI8A 1GICA 1KEXA 1ZBA1 2AYHA 2P17A 4LKSA 2H0BA 2YC0A 4D8MA 4M4RA 4EJRA 3NJZA 1JYNA 4FPJA 2WNVA 2ZACA 2WSVA 4HL0A 3MIBA 3U37A 3JU9A 3DKQA 3OSDA 5B2GB 2VZ1A 2DFBA 2OPWA 4XAAA 5LB6A 4JC1A 5FLJA 3MUY1 4JQRA 1D2QA 2ZX2A 3MLLA 4I01A 4CDXB 2YYOA 4PDWC 2WAOA 5IK8A 1J3RA 1VBD2 3ELNA 1S2EA 2Y6LA 4CUCA 1W2TA 1POQA 1QNYA 1BHGA 1X8MA 3WQBA 4AFCA 1RUF2 4BQWA 3AMNA 2JE9A 3T08A 1BXHA 4JGYA 4LBJA 4XBQA 1E5SA 3E6BA 2WN2A 3MLJA 1ALYA 3C3VA 1MQTC 1IPSA 2GMPA 2R1BA 4E4SA 1AYM2 1NYWA 2JKBA 4GD4A 1EP0A 5KHHA 2VOTA 3V56A 4Q4Y1 5LY2A 4K21A 5I0RA 1HJFA 2PHRA 2ZEWA 1ZRIA 4Q1PA 4PHZA 4V1PA 3I2IA 4QM9A 1F5JA 4UW5A 4MADA 3Q8FA 3VHRA 1UAIA 4BE3A 1DGWA 1MS3A 1PZ9A 4XDQA 5CFCC 4GULA 3VDBA 2ZEZA 4MGKE 5L7OC 1ND2B 1PK6B 3KCXA 4WM8C 3AMHA 1D4M2 3I3EA 5JVVA 2VL4A 4A7YA 4UYBA 4XFIA 2WWSA 1BK0A 5CAZA 1U5YA 1K45A 2VMGA 5GZEA 3J8F2 2VD7A 3HEIA 1HB4A 4KWUA 4ZU7A 1CGPA 2RMU3 2VVFA 4P00B 1NLRA 4YW5A 3L2HA 2Q8DA 1XBFA 2B46X 2EVXA 4H3WA 1MS4A 2Z5WA 1YEWA 3WG4A 1BVP1 4O61A 5D8AA 4AEDC 4NROA 1GP4A 3ZLIA 2VQ0A 3BN6A 3PMEA 4LHKA 3WUDA 1W0NA 1RHI3 2FDJA 2HWD1 2YB7A 3H42B 4GAZA 4IEQA 4IDZA 4YW7A 4J1WA 3VDDC 5J37A 4EN9B 2VTFA 1JBCA 1UX6A 3OGRA 1DYPA 4QKDA 4DIQA 1H2NA 4W8JA 3H8UA 5M0TA 1MVEA 1AL23 1B35B 3RI9A 2EXHA 4YVWC 2ARCA 2PLV3 2X53S 2WN3A 1GQHA 1IQDC 3AKRA 3ZYFA 5EYYA 2D43A 4DXTA 4Q4V1 5LWBA 4RS5B 1DZRA 4RSUA 3P5BA 1NUKA 1IKQA 1PX3A 4MHRA 1RC6A 2ID4A 1O7FA 4M00A 4R9AA 4TLFA 3TEXA 3AKQA 2WNUA 2C9AA 3J7LA 3UYJA 3AJZA 2XDVA 1IG3A 2JX9A 2WDBA 3POWA 3I3MA 1RUG3 2PHUA 3FFQA 4GH4A 3ILFA 5JOWA 4IGOA 5FP7A 4MXVA 5FZFA 3MW2A 1O5LA 1RUD2 4M3CF 3OBAA 4V2WA 1IOAA 1RVF2 3JB4C 4YARA 2SBAA 2HWB1 4LBQA 3IDAA 1V70A 4IEVA 2H6BA 1HX6A 1A8MA 1YYNA 5A33B 5FPUA 4P14A 4XEZA 3HAGA 3VZKA 4QQ2A 1C57A 5FUNA 1FXZA 1ZBA3 2OIIA 4OYUA 1ZRDA 4MGTA 4AHXA 1IS3A 5A3PA 1LECA 4AI8A 4PDWB 3VKOA 3ACGA 1CAUB 1LKNA 5FP4A 2AEYA 5IVYA 1AX1A 3URFA 1UIKA 3J9SA 2ZGTA 4TXWA 1HDKA 2ZZJA 2ZPXA 3ACFA 1B09A 2VNVA 1DQ2A 3HMYA 3KVBA 3VUOA 2WYSA 3U10A 1NZCA 5JXIA 2OA2A 4P9YA 5JMOA 2W92A 1MQTB 4HK9A 1VRBA 2F4LA 3HIFA 5LA1A 3WW3A 1AR71 1ULGA 1WLTA 3GGLA 1GWLA 2JE8A 3U4SA 3MPPG 3OGGA 4I3GA 4KBZA 5LCWL 1BMV1 2VZPA 4ZU4A 3KLSA 2OZJA 4D7YA 5DN2A 3NVCA 4N90A 2SLIA 2GMMA 2RG4A 4HSJA 2EXIA 1NLQA 2DFCA 1LB2A 1EUTA 4ISQA 3RGBA 1QJU3 4DMIA 1MR5A 5F3CA 1AZDA 4G3YC 4YZ1A 1RJ7A 3K4DA 1XSRA 2TUNA 5CFCB 1LTEA 2DCZA 3HOBA 1CZSA 4PIZA 5A3OA 1AR92 2G19A 5H9SA 1QXPA 1W9TA 2YXSA 1BKZA 4QB6A 4FOWA 5KWRA 2IUWA 5L7OB 2BBVA 4WM8B 3MI8A 4Q4Y3 2YGMA 2HBUA 3BODA 2L9LA 2WNEA 3Q8EA 4CCLA 5F5IA 1G86A 3AM2A 1VE0A 4LNVA 3QLQA 1H2MA 4JZRA 3WP5A 4DB5A 4CDXA 3BGAA 3NW4A 3LSEA 5FDBA 5ACA1 2VMDA 3KGLA 1FV2A 3PVEA 1NQDA 3FX3A 5HCBA 5HXVA 1G9CA 1UO9A 3LB9A 3FL7A 2A3XA 1LEDA 4NWVA 3U07A 2D6OX 2DCTA 1SBDA 1OQDA 1JUIA 2HWE1 4RYDA 4AEDB 4KL1A 4Y20B 4WVWA 3VHOA 3OUIA 3J4UH 1Z78A 3PDQA 1W90A 3CQOA 2WQZC 3VDDB 1NE4A 1YFXA 4HKLA 3DXTA 5LA2A 4QQHA 4LBNA 4P5YA 1UZWA 4QB1A 4FAHA 1OA3A 5FBZA 4FT8A 4IL7A 5CU1A 4YVWB 5LEJA 5CG9A 1UMZA 4D7TA 4JKMA 4D7SA 3S5QA 4XQDA 2VZOA 4Y24A 2Y6KA 3UNPA 1W8HA 4C0HA 1TZOA 3ETPA 5C8WA 1J83A 4QGLA 1MS9A 2HWD3 4LBOA 3RZZA 3UETA 4A2UA 2BVVA 3KMHA 2J1UA 2R062 3OPTA 4MUVA 4YPJA 1PVC1 2WJSA 2Y64A 4LE4A 3NNLA 4LKDA 2WS91 3FLPA 1ND2A 2RS11 2Z69A 2DVBA 4Q4W1 1ENXA 4JDMA 1QJX3 1W05A 2PHLA 2V4AA 2ZHNA 3WF2A 2JD4A 1TNFA 3FUOA 4Q4V3 1JTZX 1OD5A 4CTEA 2AACA 3AMMA 1UD1A 3FJSA 2VE1A 4OQ9A 4B3NA 5K7PA 4ZPIA 2J1SA 2W46A 1W8NA 4LK6A 1UXXX 1W0PA 3VBRA 3KT1A 5J7MA 1YJLA 1SHWB 5FZGA 4AI0A 4O7XA 5A6ZA 5A6XA 2F17A 2F4PA 2V73A 3AZYA 2VZTA 1HQNA 4QMAA 1LOFA 4HPKB 1O3QA 3KT7A 4Y26A 2AH2A 1FT9A 3WF4A 2R073 3MV11 1MS8A 5DMYA 1SLAA 4BQ2A 3MDPA 5HXMA 2HWB3 3O1UA 5APAA 2BZDA 3OG2A 3H3LA 2J1EA 3CIHA 4DQAA 1B35A 1PO11 3JXSA 4I0AA 1HQWA 4XILA 3RS6A 4AEMA 5FZ7A 2XKPA 5FK7A 3V0BA 3ECQA 4H14A 3N7JA 2DTWA 2HYXA 5FZ9A 3WNOA 2O8QA 3D5OA 4RS5A 2W1QA 3GBGA 4XJUA 4ZS2A 3TRSB 4AVCA 5LY1A 1W8TA 1YUDA 2J1AA 4P9IA 3AJYA 2W2IA 4CUAA 4PIYA 3VKLA 1RUH2 1XNDA 2R7EB 3POGA 2RM21 2ZJCA 3QH7A 4Y3OA 4FCAA 1IG0A 2HKXA 1LOEA 5IK5A 3AYEA 2WUHA 2B42B 1AR73 3AB0A 4OQ8A 2LW8A 4GIQA 1C8NA 3NV4A 1W2OA 5A33A 3WP6A 4AAXA 1RUC2 2BOIA 2QKDA 5IT6A 2EIDA 1JODA 3GZTB 2WO1A 3H1WA 4CEYA 5A7SA 2HEYF 4H7MA 1SBEA 1C4RA 3O1RA 1CIYA 4P9GA 4Z82A 4BB3A 4BQ3A 1YQ8A 4COVA 1PX4A 2DCKA 1FAYA 4IETA 1QDCA 1D4VB 2AR6A 5HI0A 5FP8A 1NX9A 5FXWA 1F2NA 1EPZA 3JD71 4XYXA 5CKMA 1AR61 1MQTA 3AP5A 4EN8B 1ZNPA 3FZ3A 1BEV2 3JBG1 2Q8OA 5ACA3 1K42A 4L8QA 3GXUA 2Z2SB 2ZGKA 3GZEA 1RJ8A 2ZGOA 4PQQA 2EAAA 4Q0UA 4YZ2A 5L36A 4OI0A 1JYVA 2IC1A 3GALA 2HWE3 1YI7A 2P3IA 1W6PB 2DVDA 1AYN1 1MEC1 5GLUA 4XUPA 2RR12 4AOCA 4RFRB 5CADA 2YPDA 1NXMA 4BU2A 3C7HA 4U36A 2PFWA 5CFCA 3MBWA 4YVSA 1A78A 4Q0SA 3ZXFA 2CL2A 3G7DA 1V6IA 2D98A 5GJ6A 1M4WA 4WM8A 5KC5A 1A8DA 5I93A 1VB4A 2HWC1 2J22A 1W0OA 5EZWA 3TN92 4XETA 2IXIA 5BYNA 1UKGA 4QHZA 1URXA 2WFF2 4AYUA 3IBMA 4DRRA 2ARXA 1JW6A 3LAGA 1IHMA 1R092 5FYCA 2GNDA 5KXBA 2VULA 3FLRA 4DUWA 1LR5A 1PVC3 5FZCA 3VZLA 2VUJA 5GLTA 3Q8CA 4X6QB 2VVEA 1PIV3 2YU1A 3OCPA 1FYUA 3PTYA 4ATEA 1JMUB 3OGJA 5J96B 3VD4A 4HN0A 3H0OA 5FMOS 4G4FA 1XE7A 2JE7A 5EYXA 2VNOA 4NHMA 3VDDA 1GP5A 4GMP1 3LQCA 2ARBA 1ZRCA 4JTOA 1W6NB 2W1SA 3I7DA 3LIHA 2LM3A 3OGSA 4HXCA 4CUGA 4YVWA 5T55A 3WNMA 1HXS1 2K0GA 2P4EA 5FLIA 5FKBA 5E6HA 3ZYIB 3T2TA 2YDEA 2EAKA 4MGYE 2Y0IA 2VMIA 3WG3A 3NRUA 3PUAA 4YSFA 1QJY2 4GJZA 1CPMA 3VDAA 3ZDVA 3WNPA 4A45A 4RGAA 3NSTA 3O1TA 2P3YA 4AFBA 4TLGA 1ZA7A 1AR82 5FK8A 3UGFA 5A1FA 2DVFA 3AFGA 5FZAA 4AQSA 3THPA 4YZ4A 2FZ1A 4YZ3A 2RDNA 2A1XA 2I74A 2PHWA 2O0OA 5DQ0A 5IWFA 5C3OA 2JG8C 4P08A 3WNXA 1ENQA 1PHMA 2AUYA 1XYNA 1WLWA 3CJIC 2DCJA 4FI9A 3RWNA 4AVSA 5FO9B 4HANA 4WVVA 3ZKYA 4YW4A 5FY4A 4Z2WA 2JIJA 1COV2 4ISRA 2ZABA 2P34A 4CP9A 2RM23 2QCSB 4I09A 4LR4A 3H1YA 2WQ4A 4LT5A 1POV1 2VC9A 1P8JA 4HPKA 2Q8EA 3U11A 1ZYBA 1OI6A 4G9SB 4GALA 2ADEA 2WO2A 5C3PA 1Y9GA 4UFHA 4AI3A 4DO0A 4AEJA 5F3GA 2QUOA 5FY0A 3JUUA 1CZTA 1SLIA 3ORJA 2WZEA 2VMEA 3HQXA 4DEQA 2ZMKA 3HWJA 4M4PA 2FDFA 5FYMA 2KD7A 4AF9A 3A4UA 4LBMA 3F95A 4E4DX 1A3KA 2CAVA 3WDVA 1KXGA 5FPBA 3VZOA 4IGQA 4BXSV 5E88A 1WCKA 4XUNA 1XPWA 4COWA 5C3SA 3ZFGC 5FO7B 1PGSA 5F32A 2VNRA 1AR63 2NM1A 2ZS6B 5IYYA 3MIHA 3ZSKA 3E5XA 2BW8A 4S2GA 4XBLA 1RGSA 2EF6A 4O9GA 4IE5A 3ZSMA 1VBE1 3V0AA 1FOD1 4HONA 5A7WB 2W91A 2WWJA 2VR4A 1MZ6A 3OYWB 4LQRA 3UL2A 3WQ1A 5KXCA 4MXWA 1HRI1 3CBNA 2WIIB 2XBO1 1GP6A 5CFDC 4EROA 3M3CA 3BB6A 3GZAA 5BNOA 3QD6A 5BNNA 1V00A 4LIUA 4L2NA 2A71A 1W2NA 2E9QA 2RS33 1VIWB 2VOWA 4KMQA 3U75A 2HWC3 3WOGA 4IE7A 3VBRC 3PLQA 4QXKA 4Q29A 1EV13 4FP3A 4C1XA 4R8HA 1IGOA 4Q4X1 5IVFA 2VQAA 4YNIA 2Y60A 3SH4A 3KB5A 3VD9A 4NIHA 4WVZA 3DV8A 4QKBA 5A32B 2CGPA 1SACA 3U4XA 2ZOEB 2CWSA 4PBOA 1J59A 1GR3A 3VV1A 1SEFA 4M3CE 1ZM1A 3LSDA 1CIWA 4N7IA 1LHWA 2D5FA 1QJEA 2ZGNA 3C7OA 4OI4A 5H9RA 3ZYHA 4J1XA 1WW5A 1WMFA 4GMP3 5AFBA 5GZCA 4K1ZA 4OI2A 2VM9A 1LODA 3KHCA 1NG0A 1DFQA 5CISA 5DPNA 2CDPA 2MEV2 3M1HA 1D2SA 1HXS3 2Q1ZB 1RUF1 4Y1XA 1Q43A 3LPGA 3AMQA 4H55A 5CKQA 1M06G 3AYCA 1AJOA 2JG8B 2ZKNA 2KR2A 1OPOA 1OH4A 4GWIA 2ZTNA 3CJIB 4QDSA 1AYM1 5D2AA 2A3YA 5FFOC 1YIPA 4LBKA 1SCSA 2WBKA 4IQPA 3VBHC 5FP9A 1DGLA 3H1MA 3O0WA 4EWAA 3O1PA 1DLCA 4BQYA 2JEMA 3C7FA 2XKOA 4M0HA 4PLOA 4PI2A 1XYOA 4MYEA 2Y8KA 4ASKA 1UZVA 4ASMB 4Y1YA 2O14A 4QXBA 4CDWC 5A70A 3POSA 4QPIC 2W94A 3PVNA 2QQVA 3KV6A 3ZPYA 1W6NA 2A6YA 4OFGA 1VBA2 3AXDA 3VBSA 4FTEA 2QBXA 3PJYA 5KHIA 1W8FA 3RDIA 1RXGA 1GFF2 1S0IA 2BVBA 3BU7A 1POV3 3CO2A 3D3AA 4MV2A 4BZ4A 2QQNA 5C5UA 5IFPA 1IZ3A 5J98B 3J8F1 2XOMA 3D8CA 4RR3C 2K2SA 1CN1A 1HW5A 4ET7A 4JCKA 2CU5A 4GMP0 3JQXA 2D44A 3I2GA 5FMBA 4D6QA 2B4KA 4F83A 1QKQA 3P3NA 4F7ZA 3SH5A 3ZFGB 4P02B 3O12A 3NJVA 2FCVA 3A23A 4BLIA 1AXZA 4CDUC 3E1F1 1LRHA 1TME3 4K20A 3N7KA 5FZEA 5C71A 1GSLA 1NOVA 4XF0A 1W3VA 2ZMLA 2CDOA 3THTA 3WG1A 1DP0A 4NWWA 5FYTA 2JDHA 3ALQA 1U12A 4HZFA 2ZGUA 3R4SA 1O59A 2B45X 2JXAA 3W59A 5J1XA 1GQPA 4UW4A 1N1VA 3BTYA 1ND3C 5JMCA 3GDBA 1HV0A 4GZ9A 5K0UC 3J7NA 1UQXA 5D1IA 3ZDSA 5FYUA 2UU8A 5IHRA 5CFDB 2ZGQA 3E5UA 3VBUA 4A41A 4AHYA 5DAXA 3U0ZA 3K77A 2BNOA 5DXDA 1XNCA 3T0AA 3SEEA 1AL21 1U5IA 1VBE3 3FWEA 1FOD3 2PLV1 3MZHA 4JHTA 5EV7A 5GM0A 3NO8A 3VBRB 4RL7A 1YJKA 2EIEA 3BTAA 1REDA 1HB3A 1RUD1 1HRI3 1I6XA 1N47A 1V0AA 4YG0A 1GKBA 2D6MA 2W95A 1RVF1 1CQ9A 2XMLA 4R4ZA 3GYDA 4A3ZA 2VBPA 5EIYB 3D4KA 2CAUA 2WNOA 4XFCA 2R043 1C1FA 1AL0G 4LJHA 4LO5B 5C5TA 2QQIA 2VMHA 1W39A 1GZCA 3KCYA 2YC2A 3LZZA 4UFIA 5FZKA 3LDRA 2EICA 4BH9A 2BERA 2W3JA 4CXYA 1SLLA 3AX4A 2E63A 1ZBE2 2B9VA 4YZ5A 1HRV2 2CYFA 1H1AA 2P3KA 4Y22B 2YBSA 1W03A 5FY9A 5B4NA 2R042 5FY1A 5IATA 3DUIA 4AK3A 3BKZA 5E89A 5A7WA 2IXCA 4LTAA 3OGVA 3OYWA 2CHHA 4Q1RA 5CB7A 2AZ5A 2YPJA 3VBHB 4CXWA 3H7YA 1VBD3 4HVRA 4K8RB 1BQPA 2GU9A 1MPXA 3FC0A 4KU8A 5A3UA 5KHGA 3MV01 4CUBA 3FBYA 1RUF3 3BOPA 2DCYA 1RUE3 4E8CA 1O3TA 1ZZ9A 3B94A 2V09A 4URAA 2QE3A 1AHSA 2XH6A 5SV5A 1E57A 2KA3A 4LE3A 3SCFA 1RB8G 3WNLA 1I9RA 1AYM3 4QQPA 5FJKA 4CDWB 4QPIB 4FPHA 4UI9L 4XJAA 1H1IA 4XTMA 5DDJ3 5A32A 2BV4A 4IEWA 4TN7A 1AR91 1W9SA 3ATGA 4OHZA 2VOKA 4YFWA 3J26N 5JXHA 1HLCA 3I2KA 1RUE2 1SFYA 2NMNA 5C4WA 1NXD1 3HJRA 1QJU1 1UKRA 4RR3B 1JN2P 3C7EA 3C2UA 4S2FA 1VR3A 3A0KA 3AZXA 4Y33A 4DXSA 5GLWA 4D6SA 3EXUA 3MHZA 5DDJ2 4P9WA 3MGUA 5IAXA 1HJGA 1OHFA 3I59B 4JDNA 3JB8A 4XAEA 5LZ6A 4YRDA 3M3EA 3KM5A 2DF7A 4FQ4A 2FDKA 2YC4A 1WGPA 1D4M3 1VBB2 2DV9A 4OHXA 2XGXA 2XJUA 4BA6A 4GJYA 1UY2A 1REEA 2TBVA 2R32A 4CDUB 2MHFA 2Z79A 2WA3A 3TNPB 1QQP2 3J8F3 5KHJA 3LEGA 3DF0A 1F4HA 3TWIA 1F15A 3E6CC 2GN7A 4QDQA 4META 4K40A 4NOTA 2OXBA 3JQWA 4XC9A 4ZZ5A 3BVCA 3TAYA 2UWBA 4XXAA 1VMHA 1VMJA 3SC7X 4JRAA 1R082 2GC0A 4NRQA 3T4HB 1ND3B 5K0UB 2BGPA 2VW2A 2C6SA 2D6PA 3GCWA 2QQJA 3VDCA 3UKTA 4J25A 1W8ZA 3SISA 3INAA 3SXWA 1W6MB 4FO9A 3IKWA 1KJLA 3EJKA 1E5RA 3QBQA 3FBMA 1BCXA 4MVTA 2GAUA 4ZU5A 2BQPA 2IWGB 2EXKA 4NRPA 3VKFC 3WZ1A 1OQEA 3PMSA 1H4HA 3NKGA 1KFUL 1WMXA 4E27A 4Z8BA 1WUVA 3KZ4C 3N4MA 2PELA 3T0DA 2BNNA 4JRLA 4BISA 1Q8PA 4ZXEA 4NVPA 1OUSA 1WW6A 4I0BA 4BIOA 1BBT2 1UCXA 3ZFGA 4UOJA 5I91A 4L9BA 1N3OA 1QJX1 5I8TA 1RUD3 5HCHA 2C1FA 4XVHA 2OT7A 1JH5A 1XRUA 1RVF3 2DU1A 1WW4A 3AP9A 1BLZA 2PAEA 1PM7A 1DF0A 3DPRA 1CAXA 1G9BA 2HEWF 1S0EA 1N3QA 4AW7A 3BALA 2JD9A 3T1MA 5FPXA 1MVQA 2W08A 1GV9A 2F6BA 1JU4A 4MO3M 4DRVA 3BTXA 2R071 3AP6A 4XXPA 2W39A 5DUWA 5CFDA 1FNZA 1V6KA 3N9QA 5FZBA 1PMIA 3CNAA 3WP3A 1VRH2 1PO22 2G1MA 2O1QA 5GLZA 4AI1A 2WRAA 4XZPA 1ODNA 4OMCA 4ORFA 2O8OA 4GKXA 4LMFA 5JZGC 4YLZA 1Q3EA 1KD7A 2QZ3A 5JSRA 1UY4A 5LBCA 3NJYA 1N1SA 2ATFA 5FREA 4FFHA 3I2FA 1RINA 3USUB 1O5UA 4QT6A 5FYSA 3BUCA 3KGZA 3HR9A 2VOXA 5CNAA 4BOWA 4ZKTB 2E51A 4PT6A 2BNMA 2IVJA 1LAJA 5JI9A 1QGLA 4GB32 1BJQA 3UJOA 1NT0A 2Y6HA 4AG4A 3PVOA 4JDOA 1Z7S2 4BQ5A 4XPVA 3ZSJA 1HKDA 2VCBA 2DTYA 4PJYA 2C4XA 1AR93 1PZ8A 4JKKA 4Y22A 2VQUA 4ES8A 2XVKA 3WCRA 4K7JA 3TEZA 1XQNA 4MOAA 5A7QA 3BTZA 4NE9A 2W0XA 2DVAA 4OZOA 2OS2A 2WQ8A 4L0PA 4IV3C 4RD7A 3IN9A 3J7HA 3S0MA 5DZGA 5A6YA 2QFEA 2HEVF 3VBHA 2FDHA 3VL8A 2IFRA 4L97A 1LOCA 3KT4A 4FFGA 4X8PA 2X09A 3IMMA 1YRZA 4N7UA 2D6NA 3PUQA 2Q30A 4H2AA 4RHV2 2QDRA 2QDNA 1YQCA 2RR11 3K3OA 2C5DA 4PI0A 1XSQA 2J1TA 3I2DA 4INDA 3ITQA 4NRMA 5FRAA 1SG3A 3MPBA 4QPIA 4YM2A 4YYOA 1ZVFA 1YFUA 4IUGA 1F4AA 2OQ7A 3N9MA 4XIKA 3TN91 1QXRA 3K48A 2IXJA 1AX0A 1XC6A 3UKNA 2DUPA 4QU1A 4B4QA 1W9FA 4RR3A 2BYVE 4ARYA 2R063 2WYFA 3MIGA 1AUYA 1Y4WA 1RTVA 2B9UA 2VVDA 3ZN5A 3AKTA 1G9DA 3MUZ1 4NIDA 3ST7A 3UESA 4GKYA 3VD5A 4QX3A 3IPVB 5C9AC 3T09A 4CCCA 4EN6B 1PNFA 5I0UA 1PMJX 2FCUA 4CDUA 1JYXA 1D7PM 1KGYA 1QJFA 4FAGA 3CLPA 3THDA 1H4GA 2VBBA 3D82A 5T50A 3BCWA 1RXFA 1TVGA 5LW9A 5FUPA 3POYA 2XJVA 3HQRA 3PUSA 1PIV1 2VXJA 4HK8A 1PK6A 4UT5A 3WF3A 2D6KA 5FMCA 5FZOB 1SDDB 1UZYA 2CWMA 2GMEA 2WO3A 2A3WA 3HBKA 3KHBA 4XE9A 4XJZA 4BWOA 4DXZA 4Z2AA 5K0UA 4MH0E 1W2UA 2BGOA 3K46A 4CA9A 5IK4A 1OLRA 2GC3A 2OQ6A 3T2OA 4EE2A 4EYUA 5EJZB 3KCCA 1O4TA 1QWRA 4S2DA 4XW3A 4L11A 1JZ2A 2UURA 2XLFA 4UF0B 4FPLA 4DINB 5A1LA 3T0BA 2HBTA 5FPAA 2ZAAA 5JZGB 3T2PA 3ZYJB 1UMHA 2ZA9A 1C3HA 3WDTA 2XJTA 4P9XA 2ZEXA 1OC1A 1KJRA 3NV3A 1G7YA 1CZVA 1NCRC 4KWJA 3USSA 4EN0A 1W06A 1UU4A 3NMBA 3SKVA 2XL7A 5FPLA 2ZX1A 1COV1 1JS9A 1EAH2 1RUH3 4IE6A 2G9GA 2B39A 1AF9A 2V5DA 2ZX3A 5K9YA 3W9AA 3HN3A 4FFFA 3NAPC 4CZSA 2WT1A 1LHVA 1SCRA 1R1ZA 2BRTA 3N9PA 5BV6A 3LEMA 1GOGA 4LK7A 5C3RA 1C8M2 1H2KA 3P1IA 4KH9A 1RUC3 3OOXA 3HBZA 1XU2A 3Q8BA 1FV3A 3ZFEC 3EB7A 4DFSA 1RMU2 3I2HA 2QQMA 4IV3B 4NPRA 3PJQA 2WINB 1LOAA 3AC0A 1JU3A 4QWNA 2VMCA 3N9NA 4XF1A 1Y9MA 1QOTA 5FR3A 3AZZA 3MFAA 1S0FA 1R1A2 3WEZA 1TEIA 1ZREA 5C6CA 1RUJ2 4BM8A 2PQQA 1UOGA 5FPVA 1ZRRA 4Q0PA 4B29A 5DUVA 3N3HA 2BDRA 4QM8A 4ZY9A 1GWKA 4IEYA 3PURA 2ZHLA 3EO6A 3I3DA 2ZMNA 3P3PA 1I1EA 3S5AA 1OA2A 1UY1A 3DKWA 1BEV3 4PDWA 4IERA 2XVLA 4CXXA 5ABJA 1CAUA 1OUXA 2VZUA 3OUHA 4CU9A 1Y7BA 4Y4RA 5FZDA 1O8PA 3ZYGA 3RNSA 1OXCA 2BFUL 2GH8A 1QNWA 1I5PA 2X10A 1TNRA 3MYXA 4GWNA 4QU2A 4LPLA 3PIJA 4LITA 5G05L 3O14A 3BPSA 5FUIA 1PNGA 3RYPA 5J36A 2RR13 5EP9A 4QXHA 4MHUA 4KI5M 1VJ2A 3VKMA 3LDKA 4EV0A 4QX7A 2VW0A 4WVMB 1VLNA 2ZGPA 5CIRA 5A6QA 1EYBA 4W6YA 5C9AB 1WCQA 4XMIA 3S30A 2WFPA 2JDPA 3CF6E 3TN93 3W5MA 4X8NA 3AYDA 2WFF3 4PQ9A 2PHFA 1UNBA 2WZR2 2A6VA 3SCHA 2DBNA 1R093 2Z4FA 3IIIA 4C91A 3KV9A 1HN0A 2E32A 2NPIA 3I4IA 4YM3A 2W87A 1C5HA 5L7OA 1H8VA 5LK5A 5I0TA 2A70A 2RS31 1J3QA 1C1LA 2ENRA 3VKNA 3MEPA 1S1AA 2GSYA 4CEWC 5FXXA 1EV11 4KG8A 4FBFA 1ULPA 5AC92 3M70A 5DG1A 5FXVA 5J3UA 1UYXA 5H9PA 1S0JA 5DZFA 1V9U3 1K5MC 1DG6A 1NY71 4AAPA 1XNKA 2MEV1 2RDQA 4YGBA 4AEDA 3ZIXA 1T6GC 4HKOA 1CESA 1T6BX 1I5ZA 4LORA 2QQUA 4URTA 4Y20A 3IMNA 2H0VA 2JECA 5AVPA 3E6DA 1ZZ7A 1NCRB 1VALA 4XFBA 1QJY3 1V9U2 1UW8A 1NCQC 1AR83 5FYZA 4JVAA 4SLIA 5FWJA 2BUKA 4OHWA 4E4ZA 4Y1VA 2HLEA 3A7QA 2Y34A 3IPVA 2AEZA 2WLQA 1WD3A 1GQGA 1WBFA 1S0DA 1GZWB 3N35A 1W8OA 3NAPB 1N3PA 3PVBB 4LULA 2E26A 2VCAA 3NNMA 1QY4A 2DDUA 2Y6JA 1UWWA 4XUQA 4BJ0A 4K1YA 2WT0A 2C9KA 4QGNA 2NMOA 4LKEA 4UFMA 3T3YA 5A7OA 3LOBA 3EHKA 5BUVA 4WM7C 1COV3 3ZFEB 4ZS3A 3ZMNA 1G9FA 2GC1A 2XR4A 4NIGA 1WLCA 2YROA 3EQEA 1YXWA 3WQ0A 2RS12 2VU9A 4Q4W2 1RIRA 5DUXA 5CKNA 1APNA 1OLME 4UF0A 5FTTC 1S2KA 2B7YA 2WZ8A 3VD3A 1MS1A 2GNTA 2OVUA 5JZGA 3WW2A 5BY5A 1AXYA 3MICA 1PMHX 2XXZA 2ZAHA 3BOWA 5D21A 4YG6A 4B1LA 5C33A 1JI6A 2HWF2 3WD5A 4XQWA 3NNFA 2X29A 1QOOA 1TMF2 4UW6A 3K75B 5EXOA 3GM8A 5CZKA 3MF9A 2YBKA 3ABZA 2GP5A 3AYAA 3KF5A 3R05A 5F2SA 1JYIA 4BDVB 4EN7B 2VCCA 1ENRA 2Q0AA 1REFA 2KM2A 3N36A 4KG0A 1QOSA 3WDWA 1HV1A 3ZIWA 5BNPC 4LA2A 4CCNA 2VW1A 1CONA 3PHMA 4W4ZA 2E53A 3OBTA 1PO12 3N9LA 3MW3A 5LA0A 1TME1 2OUHA 5F39A 2ADDA 1KS4A 2XVGA 2BWAA 2JENA 4R9BA 1QH7A 2GDFA 3VGIA 1DQ6A 4FPEA 3FHQA 2XJQA 4WZCA 4JGZC 3DN7A 3LFIA 4AEKA 3LD8A 3EBRA 4CE8A 5I8YA 5ANQA 4BMBA 4Z1VA 1DBNA 4BPZA 1PGW2 5FZMA 1AX2A 1Q8VA 2V72A 4M0NA 2W52A 3BYWA 4LHNA 4NAMA 4R4XA 4N8MA 4O9EA 3M3OA 4NR1A 4BQ4A 2NZ9A 2PHTA 3OY8B 3UK9A 1XOYA 1YLLA 4HLTA 1TG7A 3ZFFC 4XJ8A 3K2OA 3M2MA 4CEWB 1ZX5A 2W68A 2BEOA 2ZKLA 4GWMA 1YQ6A 3PL0A 4MGIE 3TB0A 4E2QA 1RUNA 4E8DA 3LGRA 4JTNA 1X9TA 2GP3A 3I54A 4CCJA 1HRV1 5FPZA 1D0HA 1K5MB 1UXZA 3POEA 2ORZA 2R041 5FXZA 2JDMA 1Z0HA 5F8PA 1GWMA 4LBLA 5T3NA 1WMEA 2Y0OA 3POJA 3VBFC 1DQ0A 4OUEA 3B69A 3P6BA 1WCUA 2WNUC 4QX8A 3RZJA 4FPOB 3O7OA 4QKNA 1ODMA 3SEPA 2I2SA 5L9VA 1NCQB 4GH4C 3JD72 3AKPA 5B4XA 2PA7A 2MEV3 4Q2FA 1US2A 3EMRA 2LUWA 1ASJ2 5C9AA 3JBG2 3MFCA 2GZWA 4NAOA 4CDQC 1GUIA 1LHOA 1W6PA 1QIQA 2IZWA 4MZUA 4OLLA 5JWPA 4R9DA 4IE4A 3CMGA 3KWVA 5FOBB 3ES4A 5FBJA 4Y4YA 5ISLA 1VBD1 2CSGA 4XIOA 4AQ2A 1AYN2 1MEC2 2VPVA 3IIAA 4WM7B 2LS6A 1UF2C 5A7PA 2D93A 4CCOA 1RUE1 3S57A 1CJDA 2D5HA 2FD8A 4NHKA 4Y5TA 1YCIA 4CP0A 3TEYA 1ZZ8A 2OW4A 3PUHA 4LO7A 3DYMA 4K3UA 5K8SA 2ES3A 4KU7A 3VZNA 5DDJ1 1ZRFA 1S0GA 3APBA 2VTXJ 1VBA3 3WF0A 4CU6A 1DIWA 3IZOA 5C70A 1VBB1 1HN1A 5C7GA 1UYPA 4IXLA 4AWDA 2D40A 1O4ZA 3RRDA 2TNFA 3C7GA 2VG9A 3HNMA 1QQP1 3LA7A 4JAAA 4W6XA 1R64A 5KBFA 4A7KA 2P3JA 4AL9A 1NCRA 1A6CA 1VBC2 3SITA 1J58A 3I8TA 5HBAA 5L19A 2E7QA 3WDUA 3WV6A 2R1DA 2A7AA 4QQLA 3DCQA 4LLOA 3ZSEA 2UY9A 3ZXGA 3R4UA 3NWKA 1D4M1 3LA3A 5TSWA 4BQ1A 5BNPB 1R081 3FFZA 1WA4A 4FPGA 3OUJA 4B4PA 4CRQA 5ERLA 4E2SA 3HPNA 1L7QA 2AENA 4BK5A 5F37A 3ACHA 2ZGRA 2BWCA 2WO7A 4FPYA 4KGQA 4YM1A 1TQ5A 5A3TA 2OZ6A 4L99A 3ACLA 4OULA 2GN3A 4AVTA 4OUSA 4JGZB 3ZFEA 5ANNA 5DAVA 5A7NA 3RZLA 3FN9A 2VGDA 3GHNA 2MNGA 1LOGA 4NPLA 1WZXA 1W28A 5EQUA 2OUJA 1OLQA 4MGQA 1VB2A 5LK7B 2YMZA 4M3CB 4QX2A 2D3RA 2VZRA 3VLBB 4AGGA 1FPN2 4D69A 2P5BA 4ZONA 1FMD2 4AR2A 3HNYM 4FOQA 1BBT1 1IKPA 4Q27A 4OVEA 3ZFFB 3CJXA 1JYTA 2QVSB 4KWKA 5A3MA 1VAKA 1JZ3A 5FCCA 2YHJA 3B01A 2IXKA 4XACA 5I8SA 2ZZQA 2VBDA 1VAMA 1MS0A 5JUVA 1LGBA 1OSGA 1RUI3 4M01A 4QX1A 3UT0A 4UFJA 4CU8A 1SDWA 3WINE 5CA6A 1IS5A 2BPA2 4XOGA 4HT1T 4OMDA 1DCSA 2XONA 1UZ0A 4MSVA 1DYOA 2K9ZA 1UZZA 3TOJA 3VBFB 3O1MA 2D3PA 3R0RA 1KQRA 3H7JA 2WNUB 1POV0 2BU9A 2BTVC 5F3IA 3DL3A 5IVEA 1Y9QA 1WCDJ 3D0JA 1ZBE3 4EWDA 2VXRA 1HRV3 1QF3A 4UW3A 1RUI2 4GH4B 4IEPA 1GBGA 3RPQA 1PO21 5ABJC 4GXLA 3OD4A 5FYYA 3RG0A 4NN0A 3V64A 4A44A 2XHNA 2MPFA 3LOIA 2QZ2A 3OF1A 4AHWA 4LBQB 1DGWX 3IDEA 4CDQB 3NQHA 3K4AA 3W58A
chains in the Genus database with same CATH topology
1ZZBA 4TSVA 3WG2A 2R0FA 2EIGA 3WW1A 3LCPA 1OQ1A 4COYA 1LOFC 1WD4A 4ES9A 3OY8A 2RS52 4AXOA 5IK7A 4XF3A 4CEWA 1KFXL 3AP7A 4GB31 1Y43B 2OYZA 3O5SA 4DPNA 1CD3G 1Z7S1 3A0NA 1O91A 3WXPA 4NO4A 5C8CC 2ILMA 2WC2A 3ZYRA 2YY1A 4LO4B 1X36A 3KQRA 3OJBA 2XBO2 4QPYA 5DZEA 3M3IA 3WY6A 1WLDA 4ASLA 3PNAA 3VBOC 4E9KA 1NCQA 2ZGSA 2YV8A 4Q4X2 2D6LX 4YW3A 3T1LA 5F9TA 5JPNB 5T5OA 1VBB3 4ITCA 5E8AA 3OTFA 1UPIA 2NN8A 5F6LB 5LEKA 4RHV1 1QQP3 3N7LA 4RFT0 3ETQA 1EY2A 2JJ6A 2ZBJA 1MACA 3FMGA 4J6GA 4E2GA 3NL1A 4WM7A 4B7EA 4HFSA 4OHYA 4CEYC 1CJPA 1R083 2DURA 2R0HA 3B7MA 2B8MA 3AP4A 3SNMA 1V6MA 2XB6C 3IDBB 2RJKA 1PGL2 1LHUA 2JG8A 2XLAA 1G6NA 3CJIA 4H7LA 3ME2A 4IEUA 4GQ7A 2WSUA 4AI2A 1G9AA 2AREA 2E7TA 1LU1A 3IDCB 4LO6B 4OI1A 4C0BA 5FAXA 1KITA 1WMDA 4FSJA 1DGRN 4I30A 3QOPA 1IQAA 2Q4SA 2R061 4LA3A 1H8TC 2CGOA 1QMJA 3E5QA 2DWRA 5CG8A 5GZGA 1BBT3 2Y26A 2N7GA 5BNPA 4FTSA 1YFWA 4OHVA 3ZN4A 4YVSC 4AVBA 4BLJA 1IPKA 2IXHA 1LEMA 4XF4A 3RMXA 1XYPA 1N1TA 4XFGA 1GNHA 5FQ0B 4CP1A 5ABJB 1WBLA 2A6WA 1YHFA 1DYKA 4FOYA 4JGZA 1UPSA 2VUAA 5LRSA 2EALA 5KHKA 4D94A 4M3CA 4FXKB 3SH3A 3B5LB 3ASIA 1VRH3 1PO23 2XJSA 4DZGA 1UIJA 4UBGA 4FPCA 1EAH1 2RMU2 3ZFFA 4XHXA 5F1RA 2QQPA 3SMHA 2FMYA 4Q0QA 4AVAA 1H9PA 5C8CB 3V0BB 2A75A 4RQPC 3VZMA 1C8M1 3UKVA 3H3ZA 3KSCA 1RHI2 5JAXA 1FI2A 4AVVA 1RUH1 3ZMOA 4DNYA 1SQ4A 2HJIA 5EJ3A 1RMU1 2VECA 3VBFA 3VBRA 1UU5A 4GB33 3AMPA 4FPFA 4C1WA 3IM0A 2UYAA 1Z7S3 1AL22 3VBOB 5HCAA 2PLV2 1ENSA 1R1A1 2GNBA 3ZXEA 1RUJ1 1YI9A 2CNAA 4BYYA 1OKQA 1RUC1 4KQ7A 5T5JA 1H9WA 4CDQA 5JR7B 1DZTA 4CP2A 4FTBA 4XFFA 4XMAA 1RUG2 4K8FA 3MF6A 2VNGA 1TE1B 3AFKA 4DOUA 4CEYB 2EXJA 4FAHA 2VH9A 1H30A 5T54A 2RJLA 4IEOA 4RHV3 1JUHA 4K9SA 3DGTA 2XUMA 4QPGC 1BK1A 4HVQA 5GKAC 5EFUA 1BEV1 3D6EA 1PZ7A 1V6LA 2NLRA 1ZBA2 3WCSA 4FPKA 1LHNA 1RITA 4A3XA 1NA1C 1GLHA 1NQJA 2G9FA 4QX5A 2WZR1 1OMIA 3WHUA 1OFNA 4QGMA 1H8TB 3RYRA 4CDWA 5BPXA 2Z42A 1W6OB 4N43C 4I2OA 4IEZA 4OZXA 1OFSA 4YVSB 2BFUS 2WFF1 1IS4A 5JIUA 4W6WA 5AC91 2JDZA 1W6QB 2YGLA 2R16A 4U2AA 3M8LA 4YG3A 3L2YA 4AQ6A 1R091 3B9CA 3I59A 1Q8OA 1QJU2 4BIFA 3VZJA 3H3UA 1YIFA 4IV1C 5BNOC 1DDLA 5BNNC 1LCLA 1SFNA 1S2BA 3SLIA 4YM0A 4Q4Y2 1ULEA 4I02A 2ZGMA 1QHDA 1UU6A 1N1YA 1V9U1 3WDXA 3RQ0A 4HMZA 3CU7A 2FMDA 3M4FA 3RMYA 2B5HA 3WP4A 1ND3A 3FE5A 4BMEA 1KDMA 3NV1A 4RQPB 1QJY1 1W6MA 3ILNA 1F5FA 1MZEA 1V6NA 4N53C 3GF6A 1KRIA 1AR81 1VP6A 2IXLA 1EAH3 3KS7A 4FP2A 4X6RB 4Q8LA 4XJ9A 4RGGA 4XJWA 4ZXKA 1HIXA 3SHRA 1JHNA 2NYYA 2XPJA 2X5IC 4YFZA 2ETEA 4JV4A 1ULFA 2DYCA 3TYJA 1C8M3 5FQ0A 4YGCA 2ZX4A 4P9JA 4KWLA 4IESA 2PAKA 2HWD2 4R52A 2ET1A 1RMU3 5F5QA 2HWF1 1S0CA 4HN1A 1TMF1 4FXGB 5JSOA 5GLVA 1BVVA 1EPWA 1BYHA 1R1A3 1QJX2 1OOPC 1RUJ3 1AXKA 4I0WB 4Q4V2 2E7AA 1CAVB 5JIAA 3WQ7A 4Q8KA 3LA2A 4FVVA 4TYSA 4QQOA 3IWZA 4MX3A 2XG3A 2CY6A 1SMVA 1CX4A 3VBSC 3CEWA 2BGCA 4QPGB 2CV6A 5A3LA 5C8CA 3HT1A 2YUEA 4PIXA 4WZFA 4COZA 1NLSA 1X33A 4Y1UA 2R072 2PTMA 2GNMA 1NA1B 4XBNA 1BZWA 3G6JB 3TNQA 1DHKB 4B7KA 3WR0A 2HWB2 4R9CA 5JDBA 3B02A 5BNQA 4AGVA 2PYTA 1PGW1 1SBFA 4XFHA 3OD0A 3VBOA 4KBBA 2ZX0A 2EA7A 3FLTA 3M3QA 4XTPA 3USUA 3WT3A 4N43B 1LU2A 4FOVA 1Q8SA 5JCTA 1IPJA 1DQ5A 2WZR3 4Z92B 1O3SA 3V0AB 2HYKA 5CBLA 4MXWB 4IV1B 1CAWB 1AR72 4HETA 3ZXLA 2XL9A 3H9AA 2C0ZA 1ONAA 5BNOB 1BMV2 3VBUC 5BNNB 3GBWA 5AC93 1OPMA 1LULA 1G8WA 3WX5A 3OPZA 3B9IA 4I3PA 3JCIA 1X50A 2Q5TA 1ASJ1 3MIEA 1XNBA 3AZWA 2JG9C 2ZCWA 2A6ZA 2ERFA 1S0BA 2E6VA 3K51A 5H9QA 1H8TA 4C90A 2OPKA 2FQPA 4N53B 1LESA 3HD8B 1KS5A 1W6OA 3ZX7A 1XXNA 4AFDA 4AE2A 3AK0A 1GNZA 4DY5A 2G4IA 3O0XA 5ACA2 2RE9A 1U5XA 2X5IB 3M7AA 4BHPA 1W6QA 3JZVA 2HWE2 4LUMA 4KNCA 3AZVA 2NQYA 1SLBA 1X8EA 5EWSA 4PLMA 4CYDA 5GZDA 1GANA 3BIWE 2WS93 1H0BA 1YFYA 2WNVC 3B93A 2DVGA 2RS13 4HKWA 4Q4W3 5FLHA 5IUQA 1OOPB 1VBC1 4LO8A 3ROUA 2NP0A 3ILRA 1VBA1 1ZA4A 2Y38A 3GNEA 1XE8A 1PVC2 1LJ7A 2HWF3 1DQ4A 3VBSB 3X29B 2WS92 1PIV2 1DLLA 1TMF3 1U0AA 4RQPA 2IFWA 3ZXKA 4JGYC 5C4WC 5KC6A 1YWKA 1C28A 4AQTA 2TEPA 3UJQA 4L92A 2A5ZA 2GH2A 1WCSA 2KXLA 4Z07A 4AFAA 2UWAA 4F8AA 1FATA 5JOYA 1HQLA 1I3HA 1UN1A 5KXDA 1PO13 4HSLA 1FPN1 1AJKA 4HBNA 1QH6A 1FMD1 4XHBA 1LOBA 4Q0VA 5JPMB 2LALA 3VN4A 1X82A 4HVOA 4WBBA 3IT8A 3ZXAC 1WW7A 1JOJA 1ZZCA 5L73A 2PAMA 2D3SA 1ULDA 4WV8A 1CAVA 3VL9A 1MZFA 4QHBA 5JOZA 1FX5A 2FHRA 1FNYA 1Y3TA 3FHIB 3LKJA 3MIFA 5HCFA 2WZPP 2GALA 3VBUB 4IV3A 5CVRA 4N9HA 4QPGA 4UXAA 3BPZA 1O3RA 2RM22 1F31A 1RUI1 3RJ2X 1O4YA 3QH6A 5D8AC 4XQ4A 5JLVA 2WL1A 1GYKA 3GZUC 4BCUA 5JSPA 1H2LA 2FBEA 1NA1A 3ENRA 1XU1A 3R4DB 4AHZA 2JG9B 2XWJB 3N7MA 1IS6A 5J09A 3D0SA 2A6XA 3VHNA 1VAVA 2PHDA 3HT2A 4W65A 4ONUA 4EWEA 3E97A 1ZBE1 5J48A 3JD73 4N43A 3QCWA 5FO8B 3R6SA 3ZN6B 3GHMA 4F3JA 3AXEA 1ASJ3 1NE6A 3JBG3 2RS51 2CGNA 1V6JA 4PCRA 4MLOA 3DPRC 4Y1ZA 1RL3A 2D97A 4AFMA 2I45A 2DUQA 2DU0A 4Q26A 5AVAA 1AYN3 1MEC3 4P5HA 4WVMA 1AR62 4IV1A 1CAWA 1SLTA 2WT2A 2R49A 5T52A 2YZ4A 3FUQA 1KDKA 2DUOA 2VOVA 1ULCA 2WNVB 4K6BA 4P9LA 4QD2A 5FMOL 1DQ1A 3RYKA 3RSJA 4B8EA 2FZ2A 1Q5OA 2PHXA 4YW1A 4TZDA 1J1TA 1CR7A 3WLUA 2UY8A 3TBDA 1DGRA 4LUKA 1J3PA 1CVNA 3B00A 3ZXDA 2RS32 1X7NA 2HWC2 1MZ5A 3WVJA 4JGYB 5C4WB 1RUOA 1VBC3 3MIDA 4N53A 2UWCA 1EV12 5AFEA 5BXXA 3B3QE 4XFAA 2R6QA 4S2HA 4SBVA 5GALA 3WHTA 4D3WA 2XHKA 1PGL1 5SV8A 3ES1A 1NY72 2RHPA 2X5IA 1LENA 2D7FA 5KXEA 3WW4A 4MGZE 4N9IA 2I07B 4NHLA 4A7ZA 3S7IA 4PLNA 5JI7A 3LWCA 1QJZA 2XLGA 2QNKA 5E1RA 1QXJA 1LGNA 3NV2A 1D0GA 4YGEA 1F8VA 1GZWA 3MLKA 4LEJA 1MS5A 5DG2A 3NAPA 1F9KA 1YNAA 3ZVXA 2ZHKA 1J1LA 1HXS2 2VY0A 1AVBA 4XF9A 3S6PA 1FPN3 4DY3A 4PBPA 3O0VA 1OOPA 4UBHA 1FMD3 2LTNA 1V6OA 4LLFA 4OUMA 3WUCA 4CDXC 2GC2A 3OBRA 3S7EA 2XJPA 2ET7A 4RA0A 1U5ZA 1DZQA 1UL9A 5D8AB 3KD4A 3RJRA 2X8KA 4LHLA 2A73B 1GZ9A 4Y5Z0 1H1MA 1Q56A 5GZFA 2V5YA 4ATFA 1Q8QA 5T5LA 1C5IA 2WA4A 1LGCA 3MW4A 4DS0A 3H50A 2P2KA 4FQZA 4LBQD 3ZXJA 2XWBB 3Q9OA 2RMU1 1YO8A 4YGDA 5F6KA 1S55A 1OA4A 4TWTA 3DPRB 1CAXB 3NKTA 1ND2C 1PK6C 5LRRA 3VHPA 1VRH1 3WDYA 2XJRA 4IEXA 1RHI1 1TME2 2RS53 2ZHMA 4PF5A 3SCGA 4YW2A 3HN1A 4GA9A 3V65A 5I0SA 4AGRA 4COUA 1JXNA 2JICA 2H6CA 2Q1MA 5JOXA 4KGGA 3GBFA 3ZSLA 2XBO3 1QDOA 2JG9A 5E16A 1PVXA 3QACA 3ZYPA 1B35C 3AKSA 1VBE2 1FOD2 3ZO0B 2AGSA 2P37A 2ZGLA 1QU0A 1K5MA 1RUG1 1ZZ6A 5T5PA 4Q4X3 2QJVA 2PN5A 1HRI2 2UYBA 3L9JT 4RS5C 5DUUA 1DU3D 3ZN6A 1L3JA 4B4RA 2WKKA 2WLPA 1JYCA 3UV9A 1SLCA 2CTVA 2R30A 3CL1A 5FOJB 1CPNA 3RI8A 1GICA 1ZBA1 2AYHA 2P17A 2H0BA 2YC0A 4EJRA 3NJZA 4FPJA 2WNVA 2ZACA 2WSVA 4HL0A 3MIBA 3JU9A 5B2GB 2DFBA 4JC1A 5FLJA 4JQRA 1D2QA 2ZX2A 3MLLA 4I01A 4CDXB 2YYOA 4PDWC 5IK8A 1J3RA 1VBD2 3ELNA 1QNYA 1X8MA 4AFCA 1RUF2 3AMNA 2JE9A 1BXHA 4JGYA 4LBJA 4XBQA 3E6BA 3MLJA 1ALYA 3C3VA 1MQTC 2GMPA 4E4SA 2R1BA 1AYM2 1NYWA 2JKBA 1EP0A 5KHHA 3V56A 4Q4Y1 4K21A 5I0RA 2PHRA 4Q1PA 4V1PA 4QM9A 1F5JA 4UW5A 3VHRA 1UAIA 4BE3A 1DGWA 1MS3A 1PZ9A 4XDQA 5CFCC 4GULA 4MGKE 5L7OC 1ND2B 1PK6B 3KCXA 4WM8C 3AMHA 1D4M2 4A7YA 5JVVA 4XFIA 2WWSA 5CAZA 1U5YA 2VMGA 5GZEA 3J8F2 4ZU7A 1CGPA 2RMU3 2VVFA 1NLRA 4YW5A 3L2HA 2B46X 2EVXA 4H3WA 1MS4A 2Z5WA 3WG4A 1BVP1 5D8AA 4AEDC 2VQ0A 3PMEA 4LHKA 3WUDA 4IEQA 1RHI3 2HWD1 4J1WA 3VDDC 5J37A 4EN9B 1JBCA 1UX6A 1DYPA 1H2NA 3H8UA 1MVEA 1AL23 1B35B 3RI9A 2EXHA 4YVWC 2PLV3 2X53S 1GQHA 3AKRA 5EYYA 2D43A 4Q4V1 4RS5B 1DZRA 4RSUA 1IKQA 1RC6A 4R9AA 1O7FA 4M00A 4TLFA 3AKQA 2WNUA 2C9AA 3AJZA 2JX9A 3POWA 1RUG3 2PHUA 3FFQA 4GH4A 3ILFA 5JOWA 4MXVA 3MW2A 1O5LA 1RUD2 4M3CF 1IOAA 1RVF2 3JB4C 4YARA 2SBAA 2HWB1 4LBQA 1V70A 4IEVA 2H6BA 1HX6A 1A8MA 1YYNA 5A33B 4P14A 4XEZA 3HAGA 3VZKA 4QQ2A 1C57A 1FXZA 1ZBA3 2OIIA 1ZRDA 4AHXA 1IS3A 1LECA 4AI8A 4PDWB 3VKOA 1CAUB 1LKNA 3URFA 1AX1A 1UIKA 3J9SA 2ZGTA 1HDKA 2ZZJA 2ZPXA 1B09A 3HMYA 1DQ2A 3VUOA 3U10A 1NZCA 2OA2A 4P9YA 1MQTB 4HK9A 3HIFA 3WW3A 1AR71 1ULGA 1WLTA 3MPPG 3OGGA 4I3GA 1BMV1 4ZU4A 3KLSA 2OZJA 4D7YA 3NVCA 4N90A