5I8SA

Structure of mouse acireductone dioxygenase with ni2+ ion and pentanoic acid in the active site
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
179
structure length
179
Chain Sequence
MVQAWYMDESTADPRKPHRAQPDRPVSLEQLRTLGVLYWKLDADKYENDPELEKIRKMRNYSWMDIITICKDTLPNYEEKIKMFFEEHLHLDEEIRYILEGSGYFDVRDKEDKWIRISMEKGDMITLPAGIYHRFTLDEKNYVKAMRLFVGEPVWTPYNRPADHFDARVQYMSFLEGTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase
publication title Metal-Dependent Function of a Mammalian Acireductone Dioxygenase.
pubmed doi rcsb
source organism Mus musculus
total genus 48
structure length 179
sequence length 179
ec nomenclature ec 1.13.11.54: Acireductone dioxygenase (Fe(2+)-requiring).
pdb deposition date 2016-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03079 ARD ARD/ARD' family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5i8sA00
4LA2A 2IXKA 4LUKA 1UD1A 2Z2SB 4N9HA 1YWKA 2PAEA 2P17A 2B9UA 5I8SA 2PFWA 4MGIE 1OI6A 3HIFA 4E2SA 3LA7A 3ZDSA 4XF1A 1XE8A 3EO6A 4IEQA 4KWKA 1TQ5A 2PAMA 3KMHA 3E5QA 3I54A 4Q0UA 5JSPA 2D5HA 5EFUA 4PJYA 1O3RA 3RYRA 1QWRA 1CAXB 5F1RA 1SEFA 5CU1A 3RDIA 1NXMA 2FMYA 3ACLA 4FAHA 4KL1A 4HLTA 2XL7A 3LA2A 4IEZA 2MPFA 4UXAA 3I59A 1UPIA 1O5LA 3RZZA 3D82A 4A2UA 2Z69A 4IESA 2H6CA 1OMIA 2BNOA 4HMZA 2ETEA 3IDBB 4MV2A 1RGSA 1DZRA 1LR5A 1WGPA 3FFQA 3SCGA 3PNAA 3CF6E 4O9GA 1XE7A 1ZZCA 3DN7A 5FPZA 4X6QB 1H1IA 4MZUA 3S0MA 2N7GA 3CL1A 3SCHA 1VR3A 3H1WA 2QJVA 2H6BA 4QMAA 3FWEA 5LRRA 5BY5A 4XFFA 4EV0A 3H7JA 5BUVA 3SCFA 2HJIA 1PMIA 2QDRA 1O3TA 2XKOA 1EPZA 2MNGA 3E5UA 2UYBA 2UYAA 2PA7A 3ES4A 3WW1A 1O3SA 1X8EA 2D40A 1WA4A 3H50A 1QY4A 4IEVA 5E1RA 2OYZA 2DCTA 4D7TA 2VPVA 1ZRRA 3GBFA 2PHDA 4R52A 3KSCA 4ZU7A 2Y0OA 3NKTA 3OD0A 3HT1A 2EVXA 4HN0A 2ZCWA 2XGXA 3TNQA 3U11A 4J1XA 5FPXA 5FQ0A 1EY2A 4HZFA 4YNIA 3LA3A 1J3PA 4KU7A 4YRDA 1J58A 2ET1A 4KU8A 1CX4A 1CAVA 5J48A 5FLJA 4LEJA 4MUVA 3OGJA 3E6DA 2QNKA 4ORFA 2CV6A 4FT8A 3RNSA 2BEOA 2O8QA 1RC6A 4OLLA 4MX3A 1G6NA 2XKPA 4XF4A 5HI0A 3OF1A 4YARA 4JV4A 1ZZ6A 1V70A 3EBRA 1LB2A 4KWJA 4BIFA 4EWEA 2UY9A 4HVOA 5CVRA 2PTMA 3BB6A 4F8AA 1ZZ7A 2IC1A 3FZ3A 1WLTA 5KBFA 4HBNA 4MGKE 4I2OA 4P9GA 4XFCA 1J3QA 2K9ZA 4YSFA 2XLFA 2BGCA 5I93A 2XLGA 4OFGA 1HW5A 1IPKA 1ZX5A 3TNPB 4WZCA 4Z82A 4BHPA 1X7NA 1JUHA 5BPXA 2IXJA 3R6SA 4JTNA 2WC2A 4HSLA 5BXXA 3NL1A 3I59B 5AVPA 4XFHA 4XF9A 3DL3A 1NZCA 1Y9QA 2E9QA 4D7SA 3DV8A 5K8SA 2CAVA 3LWCA 1UCXA 5LRSA 1Q5OA 3MYXA 3E6CC 4AQ6A 4QX5A 3UKNA 2KXLA 4HSJA 2Q30A 4I0AA 3S7EA 3UKVA 2IXHA 3OTFA 4ZU5A 4HVQA 3QOPA 3FE5A 1FT9A 4NVPA 1X82A 4Q0QA 3MZHA 3OCPA 2F4PA 4HN1A 5I91A 4XF3A 3U0ZA 5C6CA 1SQ4A 4LA3A 1CAWB 5JSOA 1UW8A 3FHIB 4YYOA 4JTOA 2IXIA 3RYKA 2PAKA 1OFNA 2VQAA 5KHKA 4O9EA 4ONUA 4Q0SA 2EAAA 5KHHA 5I0TA 1CAWA 2Q1ZB 3DKWA 2IXLA 5I8YA 4IEUA 5C8WA 3NSTA 3IIAA 5I0UA 5KHGA 4Z07A 3I7DA 1DZTA 1L3JA 2OZ6A 3CLPA 1U12A 5FCCA 5FQ0B 3JZVA 4BH9A 3EHKA 3SHRA 1YUDA 2I45A 3CJXA 1NYWA 4R8HA 2O1QA 4EROA 3ST7A 2WFPA 5FDBA 1IPJA 3FJSA 1CAVB 3KGLA 3H1YA 5T3NA 4QGNA 1FI2A 3ES1A 2C0ZA 2PYTA 3IWZA 2D93A 3RYPA 1Q43A 2B8MA 1DGWA 4I02A 4XF0A 2Q4SA 1O5UA 1J1LA 2GU9A 1YFXA 3D0JA 2VECA 1VP6A 2OPKA 2K0GA 3SMHA 1GQHA 1RTVA 5I0SA 2CGPA 3KGZA 5LEKA 5EZWA 2PHLA 4N9IA 2HKXA 3NVCA 4CYDA 5CADA 5FLHA 3WW2A 3H9AA 4X6RB 1UIKA 1EP0A 1XRUA 1YFWA 1CAUA 4MH0E 4MGZE 5D1IA 1RUOA 1RUNA 1X8MA 3MDPA 4E2GA 1YHFA 3CEWA 5J3UA 1YFUA 4Q0PA 3U10A 1DGRA 4K8FA 1O7FA 4AVCA 3M3IA 4L11A 2MHFA 3RPQA 4UBHA 2PQQA 2BYVE 4Q0VA 4QGLA 2BNMA 2OZJA 3VHRA 5FLIA 4I3PA 3EQEA 4L2NA 3IBMA 3BALA 3ETQA 4PIZA 3S7IA 3E97A 4B29A 3LOIA 1Q3EA 1I5ZA 5J7MA 1CGPA 1UIJA 3HQXA 3KCCA 2XLAA 3FX3A 1ZVFA 2GC2A 4XEZA 4AQ2A 4XFAA 4AVBA 4LUMA 2ET7A 2H0VA 4WBBA 3H3UA 3G7DA 3GYDA 1ZNPA 2EA7A 2Q0AA 3H3ZA 4LLOA 3L2HA 3ROUA 2CAUA 3EJKA 1QXJA 2V09A 5JSRA 5JR7B 4HVRA 5KHIA 2GC0A 4AXOA 3H1MA 1NE6A 3M70A 1EYBA 2QVSB 2BNNA 2OA2A 4F7ZA 1CAXA 4MGYE 1PM7A 4I0BA 1I6XA 1YFYA 1J3RA 4QXKA 2GZWA 2ZKLA 1ZZ8A 1FXZA 2GC3A 2GAUA 3QACA 4ZU4A 4QM8A 3E5XA 2D5FA 4I09A 4IEPA 3BCWA 4GULA 1ZRDA 4WVZA 1VJ2A 1O3QA 4IEYA 4LTAA 5I8TA 4UBGA 4QM9A 4E2QA 4IEXA 3BU7A 2B5HA 3H8UA 5KHJA 4RD7A 4LULA 5I0RA 4AVAA 1OD5A 4KWLA 1YLLA 3WW3A 1ZZBA 4XFGA 3LAGA 3UKTA 1ZZ9A 5LEJA 1ZREA 4XFBA 2GH2A 4DINB 2GC1A 1GQGA 4TLFA 3HT2A 4BYYA 1Y3TA 5E16A 3USSA 4EWDA 5BV6A 4XFIA 4Q29A 1J59A 2ATFA 3WW4A 1NE4A 3PVBB 3B02A 4IEOA 3NJZA 1SFNA 3O14A 3D0SA 4I01A 4PIXA 1CAUB 1ZRFA 1ZRCA 3CO2A 2FQPA 3H7YA 3PLQA 3N4MA 1LRHA 3LZZA 4JVAA 2QCSB 2IXCA 1H1MA 1LKNA 3ELNA 3E6BA 4IERA 1O4TA 3IDCB 4IEWA 4J1WA 3C3VA 4FBFA 4FAGA 3SXWA 2UY8A 5JCTA 4PIYA 1RL3A 4QGMA 2XHKA 3MPBA 4H7LA 4EWAA 1QXRA 2XL9A 4XETA 3BPZA 4META 3NW4A 4IETA 5JAXA
chains in the Genus database with same CATH superfamily
3SEEA 3N9NA 4RYDA 2Y64A 1IG0A 4LUKA 5DUXA 3ZXEA 1VMFA 1UD1A 5T5JA 1A3KA 3T3YA 1UZVA 4AEKA 2VZOA 1UAIA 5FYCA 1NQJA 1IOAA 4MGIE 1PX3A 1QJX1 4CXYA 4FFGA 3ACFA 2KD7A 2ZBJA 3LA7A 4URTA 1D4M1 4XF1A 3ZDSA 3VHOA 4PQ9A 3BIEA 1H8TA 5FZ4A 2JDAA 4OUMA 4XBNA 1ONAA 4H14A 4QXHA 4UFHA 3DGTA 3DYMA 4CDXB 1GANA 2JIGA 3CNAA 1YYNA 5EFUA 5FZ3A 4PJYA 1TVGA 2WINB 4C0HA 1O3RA 1S0GA 5CA6A 1BBT2 1R1A2 5FJKA 5FWJA 2P34A 2JKXA 3KHBA 2HWD1 2RS13 3CZUA 3K4DA 5F1RA 1W2AX 1SEFA 1SLIA 1NA1A 3ACLA 4AEDC 2ZPXA 5JXGA 5L36A 1LHVA 3PHMA 5JI7A 1TMF2 1W6PA 2WNUB 3UGFA 3J26N 3WCRA 4HKOA 2VE1A 5FYHA 2XJVA 1GZ9A 4NHLA 4P9JA 5ACA1 2P6HA 4GALA 5AFEA 1QJX3 1UX6A 3VUOA 2CL2A 4OMDA 5ABJC 1JZ7A 1D4M3 4QPIC 1BZWA 1MQTA 3LCPA 3M3CA 4V2VA 4HMZA 5H9QA 1C8M1 4OYUA 1REDA 1C5HA 4QB6A 4MV2A 4CCEA 5L73A 1IS5A 1DZRA 2Y6HA 2ZX0A 3GZUC 1LR5A 4CDQA 1NOVA 4OI1A 3PURA 1PX4A 3B7MA 2EALA 1SACA 3GALA 3DN7A 1N3QA 3A23A 2PHFA 4A42A 1AYN1 4LHSA 4QXCA 5FUIA 1H2KA 3OD4A 1RINA 3HBZA 1KFUL 4FPYA 2HWD3 4NOTA 1PK6C 5JMCA 4QPWA 4QMAA 2H6BA 3WQ1A 4AG4A 3EB7A 2VUCA 1RITA 2X8KA 1RUF2 3I2FA 4EV0A 4S2DA 5GJ6A 1D2QA 4NHKA 3SCFA 2VW1A 2HJIA 3KVBA 3MICA 5CFDC 2SBAA 5GZGA 1O3TA 4E27A 1EPZA 4DEVA 3LDRA 3MLKA 5FYBA 2Q8OA 1BKZA 5ACA3 3C7HA 1OVPA 3FHQA 5HCAA 1JS9A 2GP3A 1D0GA 4QXBA 1T6BX 1X36A 2J1UA 1QY4A 5E1RA 2ZHLA 1T6GC 4UFKA 1ZRRA 2ZGUA 3WF1A 2PHDA 4K9SA 4R52A 3KSCA 2VAUA 2RMU2 1QJY1 1AYN3 4HN0A 3U11A 2W5FA 4J1XA 1FAYA 4KBZA 1EY2A 4HK9A 4HZFA 4YNIA 5FJHA 1F35A 1IZ3A 4KGQA 1LOGA 3DF0A 3RQ0A 5A32A 1ULOA 4YRDA 2HLEA 1AX2A 1J58A 3HQRA 1KRIA 1AXZA 4KU8A 1JW6A 3OJBA 1JHJA 3G6JB 3NNLA 5C8CC 1JYWA 4LO7A 5FLJA 1IQAA 4LEJA 1RUI2 4MUVA 2F4LA 3RG0A 2G9FA 2DURA 4C1WA 2NN8A 5ABJA 4IE0A 5C3RA 5JDBA 1HB2A 3P3NA 1AJKA 1ALYA 4IGPA 5JI9A 2BEOA 2X5IA 2ZGLA 1EUTA 4P02B 3ZR6A 2DVBA 4TXWA 4OLLA 5FO8B 1G6NA 4YGEA 5F5IA 3CQOA 4JV4A 1R091 1ZZ6A 2R041 1BLZA 2YXSA 5GZFA 2CSGA 4KWJA 5FWEA 4AVVA 4AYUA 5C5UA 3N9PA 1UZ0A 1GUIA 3WP6A 2PTMA 1PO12 1ZZ7A 1QJY3 2IC1A 3TN91 3OPZA 3FZ3A 1GP4A 1G8WA 4FPGA 2C26A 2D6PA 3D3AA 1KXGA 4HBNA 5F5QA 5H9SA 3PMSA 4Q1PA 1D2SA 5AVAA 3HAGA 5IK4A 4GMP3 2RHPA 2VVEA 4XFCA 1J3QA 3J7NA 5DXDA 1Z0HA 4QHZA 3POYA 1S0JA 2BGCA 3WNOA 1TEIA 4JDOA 2E31A 4JZRA 4MHUA 3WF2A 5I93A 2WFF1 4CRQA 2GMPA 2D3SA 4OFGA 2GNDA 5LB6A 3WXPA 1GKBA 1AVBA 1VMHA 4QQOA 3J7MA 4WZCA 3AMQA 4NHMA 1OA2A 3SEPA 5FZ9A 3J8F2 2IXJA 3ZFFB 2RG4A 5D2AA 5A33B 1R093 2R043 1W6OB 3PUQA 3RVHA 5BXXA 2KR2A 1NLRA 3I59B 4JDMA 1SFPA 1OF3A 2E9QA 1GZCA 2VMIA 3TN93 1DQ1A 1W9SA 1PMHX 3I49A 1UCXA 5KXEA 4C0BA 1MR5A 4OHWA 4FOVA 3VD5A 1GNZA 1PHMA 2PHWA 4AQ6A 4CXWA 3IPVB 3S30A 2KXLA 4ZXKA 3ZXJA 1XNTA 2WYFA 2GNMA 4I0AA 4COZA 2B42B 2BWCA 5DN2A 2TNFA 1Q8PA 5FIXA 3VDAA 5GZEA 4CTEA 3VBHB 3LIHA 3NV3A 3UT0A 4C8DA 2WFF3 4IV1A 1XOYA 2ZGQA 4JRAA 4UW3A 2PHXA 5FZOA 3OUIA 1OHFA 4HN1A 4CUBA 2WNOA 3U0ZA 3VBOB 3ON7A 3POIA 3QBQA 1W6MA 5FZAA 1OPMA 1SQ4A 3T1LA 1CAWB 4U36A 5JSOA 2WZR3 2EXHA 1WW4A 3WR0A 4YYOA 4K1ZA 1HDKA 2TEPA 2Z79A 2R16A 1RVF2 1UY2A 1DU3D 1OFNA 2ENRA 2VQAA 5KHKA 1SDDB 1NX9A 1UKGA 1MACA 5LK5A 3OGVA 3WDUA 3TWIA 5DAPA 2BBAA 5FYMA 4GWIA 2P37A 5LATA 4UI9L 5I8YA 4Q8LA 3MBWA 2ZGTA 5FYSA 1OQDA 1H6YA 1C8M2 3OBTA 3IIAA 5I0UA 1T2XA 3I7DA 3N35A 2ZS6B 2FCTA 4LE3A 4M3CE 1CWPA 1GBGA 3OYWA 3AK0A 1NCQB 2WA3A 1H8VA 4HANA 4BQ5A 4LORA 5FPUA 4YZ5A 1XNCA 3H8XA 1TZOA 1SLLA 4HETA 3OBZA 4BH9A 2WAAA 3EHKA 4R9CA 1GWLA 4LHKA 1ENQA 1QMJA 3CJXA 2YGMA 4R8HA 4A7KA 5F37A 1HRV1 1IPJA 1W8UA 3QH6A 4L8QA 3V0AB 1CAVB 1UL9A 1KJLA 2YPJA 5T3NA 4DXZA 2LW8A 4CP1A 1K5JA 1V9U1 2AZ5A 2DBIA 2WNVB 2XXZA 4M4PA 4O65A 1IPSA 5DAQA 3RGBA 2B8MA 1O5UA 4K40A 1DQ4A 1YFXA 1KJRA 3BIWE 1VP6A 5C9AA 5IT6A 1GZWB 4BOWA 4MLOA 1WBFA 1QJEA 1Q8SA 3RI8A 3AXEA 3OEAA 4CEWC 3UK9A 1L7RA 5A7NA 4CUGA 1AR82 2E6VA 4HPKA 5IYYA 3UGHA 1QJY2 2PHLA 4N9IA 4CDXC 3AP6A 4OHVA 4BK4A 3ETPA 1UU4A 2RDRA 5CADA 1SLBA 3UV9A 1XU1A 3N7JA 5FLHA 2QQPA 1HRV3 1UQXA 3T0DA 4ZZ5A 3MFAA 4DY3A 1RUC2 1S0BA 1UIKA 1H9PA 2WNEA 4PDWB 1AUYA 5FMCA 1DCSA 1W8OA 1YFWA 1YI9A 2VMCA 1EV11 1RUJ1 2YY1A 2Y6FA 3HEIA 4MH0E 1V9U3 4MGZE 2UU8A 4D6SA 1RUNA 1WD3A 1X8MA 3KV4A 4IL7A 5FY5A 1LU1A 1BHGA 4AAXA 4RQPC 2VMDA 1W8NA 1JYIA 3U10A 3MW3A 1DGRA 4FQZA 1O7FA 1L7LA 2RDSA 4L11A 4AVCA 2CU5A 1LULA 2V72A 4CDUC 3IAQA 3WDTA 1S2EA 2VQ0A 4AAPA 1QQP1 3VHRA 5IK5A 1FNYA 3FUOA 5FLIA 5IWFA 4B1MA 3EQEA 1QU0A 2UWAA 3PJQA 3IBMA 2AACA 3U4XA 4ZKTB 1UXZA 3ETQA 4CPBA 2R063 4QU1A 1UY3A 5FAXA 1O8SA 4AI1A 2YYOA 4LO5B 2JG9B 1B35B 3KF5A 2E7QA 1KEXA 3KS7A 1FV3A 5IFPA 5F5CA 1RIRA 5IHRA 1PVC1 3VZMA 5J7MA 2MEV1 4WV8A 3HQXA 4ASLA 4YVWB 5FZBA 1EV13 1RUJ3 4HKLA 4IW3A 2XLAA 3GZTB 1K12A 1ZVFA 2UURA 5JR2A 1UOFA 2Q5TA 1A78A 1RXFA 4XEZA 3UYJA 4NWWA 1CESA 4LUMA 2R7EB 3ORJA 1IS6A 4LIUA 4WBBA 3NJYA 2DWRA 3GYDA 2XJTA 4A6OA 2BBVA 3ZR5A 1OOPC 1Z7S1 1TNFA 1DZQA 2YHJA 3H3ZA 1OA3A 2JDHA 2JE8A 5DUWA 5DUVA 1IKPA 3ROUA 1ULDA 3D8CA 1QQP3 1ND2C 4XBLA 1YQ5A 2JEMA 4NIAA 1QXJA 2V09A 5JSRA 2ZMNA 4CDXA 5DZGA 3UL2A 2WT1A 4MHRA 4QPGB 3M7AA 3H1MA 3HWJA 5IK8A 1OF4A 3VBFB 1NE6A 3M70A 5F9TA 4EJRA 1CQ9A 3INAA 2BNNA 4V2WA 4CEYB 2VMFA 3SH5A 2FCVA 1PIV1 4D3WA 5IVBA 1I1EA 4BJ0A 2DDUA 2WA4A 4K3UA 4Y1VA 1I5PA 4I0BA 1PVC3 1UXXX 3BN6A 5FY7A 2MEV3 3NV2A 3U1XA 4HT1T 2VM9A 3M3QA 4MXVA 1VBB2 2D44A 1D4VB 2JG8B 2V73A 1S2KA 4BA6A 2WNUA 3QACA 3NWKA 4AFAA 2D5FA 4YG0A 4GB31 4FPLA 5LA2A 4IEPA 4PBOA 1LHWA 4WVZA 1Z7S3 4Y1UA 1ZRDA 4CDUA 4NROA 1PZ9A 4AR2A 4XUNA 1XQNA 4E2QA 1MVEA 2DF7A 5J98B 3CU7A 2W1WA 3WF4A 2FDFA 3LSEA 4TZDA 2B5HA 4RD7A 5I0RA 3WEZA 4AVAA 2EXJA 1CR7A 3BOPA 1YLLA 1EPWA 2AH2A 3WW3A 4CUAA 1QNWA 2P4EA 2Z4FA 4XFGA 2O8OA 3AJZA 1XNKA 3VD7A 1JZ2A 1ZZ9A 4UW5A 5CZKA 3THDA 5LEJA 3GBWA 3BUCA 1MPXA 4MOAA 2W0XA 5DABA 4DINB 1MVQA 2WO2A 4FO9A 1S4CA 3AXDA 2DCKA 2ZOEB 4OI2A 5A3UA 3ZXGA 4NN0A 4GAZA 5BNNB 2F6BA 2R071 5BV6A 5KXBA 4XUQA 4GB33 4QX2A 1X50A 4LHLA 4AHYA 2OUJA 4JDNA 4JRLA 4YW3A 1W99A 4GWNA 4DIQA 3POSA 3MLLA 5FZKA 3I2OA 3F2ZA 3O14A 5FXWA 1C1FA 2D6MA 4A3ZA 1AX1A 1FMD1 5SV5A 3D0SA 3KHCA 1CAUB 1LJ7A 5FY1A 4BMBA 3BU0A 2ARAA 1ZRCA 1PO21 5JPNB 2JE9A 2QZ2A 1XJAA 4NAMA 1HV1A 1VPHA 1Y4WA 2D43A 4GH4B 1GICA 5FK7A 5FZIA 1YQ8A 5A3WA 2VTFA 1G9CA 2PHRA 1QJFA 3O1UA 4RR3B 1CZSA 3MV01 4OUSA 3DCQA 3I3DA 5T5OA 1NCRC 1O4TA 3OY8A 4FOQA 4IEWA 2JXAA 4J1WA 4PBPA 4AK3A 3C3VA 4WM8B 1KDKA 3I3BA 5HPOA 4G3YC 4CU9A 1YJKA 5G04L 2R073 5LBEA 5IW0A 3LD8A 4PIYA 1DHKB 1RL3A 2W91A 3AP9A 2B46X 3MO4A 3MPPG 4H7MA 2J1AA 1AXYA 4ASKA 1BVVA 2XL9A 3I8TA 5FP8A 2WYSA 3NW4A 1FMD3 4JC1A 3LEIA 5FPZA 3LIGA 1ST8A 1IKQA 1N3OA 1R1A1 1UU6A 1PO23 2IXKA 3N3HA 4KBBA 4YW6A 4AHZA 4BISA 5CEHA 4GKYA 1VAMA 1DFQA 5A3NA 5I8SA 2PFWA 2YBSA 3HIFA 2CGOA 4WVMB 5FY8A 4E2SA 1CJPA 4E4ZA 1QH7A 1XE8A 4QB2A 1GSLA 1TQ5A 2XH6A 3AYAA 4XBQA 4BE3A 4Z8BA 2AEZA 2XG3A 5FMOL 1V6NA 2PHTA 4CCDA 5CG9A 1JHNA 4JKLA 2DTWA 3E5QA 4H2AA 4Q0UA 2BVBA 2X10A 2ADEA 3I2KA 4SLIA 4D8MA 5JSPA 2D5HA 4WZFA 3NNGA 4GZ9A 1O8PA 4N43B 5EIYB 1VE0A 1QWRA 2XBO2 1ULPA 3H3LA 5FKCA 5FPVA 1S1AA 5GLZA 3DKQA 5F32A 5K0UB 1JYVA 1HQNA 5BNPC 2WJSA 3H8RA 4XUOA 3WUDA 2YB7A 1PVC2 2JICA 4P5HA 1UWWA 3ZFFA 1RUD1 4HLTA 1BBT3 1R1A3 2EICA 4XMAA 5A33A 3MIHA 3RWKX 4IEZA 3I59A 2BOJA 2BUKA 3AVSA 1MS8A 1UYZA 1UPIA 1WCKA 1O5LA 3SNMA 2HWF1 4TSVA 5A7OA 2EF6A 4A2UA 5KC6A 1TG7A 2W39A 1RUF1 3RFRA 2H6CA 2R49A 3UGGA 1OH3A 1DQ0A 4L97A 5L9RA 3U37A 3NQHA 3PTRB 2VZ1A 3P1IA 2ARXA 3IDBB 3IPVA 3KQ4B 3E1F1 1RMU2 1R1ZA 4J6GA 2PLV2 4UFMA 5C7GA 3ZIWA 3ACGA 3FFQA 4OZOA 3SCGA 3PNAA 1H30A 3VBHA 4LT5A 1KS5A 1CZVA 3DXTA 1ZZCA 3BTAA 4RFT0 1YO8A 3F95A 2A73B 1W28A 2R30A 1HKDA 5ERLA 1H1IA 4MZUA 3LPGA 3VBOA 2N7GA 3CL1A 5K7PA 1PIV2 3H1WA 4UFJA 3VZLA 2QJVA 1W0PA 4YWAA 1JYNA 2XJUA 3WNKA 1GOFA 4I0WB 4XFFA 2ZA9A 1VBA2 5FBJA 1RUD3 5BUVA 5HV4A 4DB5A 1H2LA 3FHAA 1BJQA 4EN8B 4NHXA 3T4VA 1UYPA 3E5UA 3C7FA 4RHV1 1IS3A 2D6KA 3O5SA 1RUF3 3NMBA 3PVNA 3HQUA 4YFWA 2PA7A 5FUNA 3LF7A 3ES4A 3X29B 2VCAA 3N9MA 5A6YA 1W3VA 5LBFA 3VL9A 1RUI1 2NMOA 3JB4C 5FOBB 2X09A 1ODNA 1S0FA 3JD71 3IMNA 4D7TA 1C4RA 1LECA 3CBNA 2VPVA 2FCUA 3EYPA 3PJYA 2HEWF 4W6WA 4X8NA 4BU2A 5F3IA 3TRSB 4Z2WA 1LODA 1Q8QA 4J25A 4ZU7A 3WSOA 3KCYA 1AYM1 1NCQA 1NT0A 2HBTA 3LB9A 2ZHKA 4CCKA 2EVXA 2XGXA 3THPA 4W4ZA 3RSJA 1RHI2 1W2NA 3ZSJA 1HN1A 4QX1A 4FOYA 2LRPA 3LA3A 4KU7A 4CE8A 3GCXA 2RMU3 1PO11 2VJXA 3TEXA 1ENSA 4D94A 1PGL2 4XTMA 1GOHA 3V0AA 4P14A 1CAVA 3BKZA 2XUMA 4N53C 2XJPA 2AUYA 3K3NA 3E6DA 4RHV3 5IAVA 3THTA 5C70A 1OVSA 2WNVA 5ISLA 4YM2A 4IE4A 1FPN1 2Y6LA 5CNAA 1E5SA 2VMGA 4PI2A 3JBG1 5DZEA 2Z42A 2O8QA 1RUI3 5HI0A 1GZWA 1POV1 2JENA 3FL7A 4FI9A 4YARA 4IV3C 3T2TA 1V70A 2A75A 2FDJA 3N7MA 4HONA 4BIFA 4EWEA 1V00A 1PO22 2FDGA 1DDLA 2CTVA 2A3YA 2WR9A 2V4AA 5CVRA 5IVCA 1AYM3 2Y6KA 3BB6A 3J8F1 3AYCA 3K75B 3MHZA 4I3GA 3FN9A 4QT6A 4PCRA 5T55A 4MYEA 2R1DA 1WLTA 3W20A 1OUSA 2DU1A 1QEXA 3ZSMA 3WY6A 4DOUA 2Y6GA 3ALQA 1PO13 3GM8A 4CEYC 4R4XA 4YSFA 2XLFA 3TAYA 2JX9A 1H6XA 1QOSA 2JDUA 4LK6A 1DF0A 2VZSA 5JMOA 3NV4A 3ZXLA 1HW5A 3QD6A 1W8ZA 1UKRA 2AEYA 3AL5A 2IFRA 4FVVA 2W68A 4YZ3A 1V6LA 1X7NA 2YBPA 3SKVA 3T1MA 1DYKA 4N7UA 5BPXA 1W90A 2ZMKA 3UNPA 1POV3 4JTNA 4XYXA 1DYOA 4B4PA 3NL1A 2NMNA 2BP6A 4NHYA 2VNOA 4PI0A 3DL3A 1MS3A 2FHRA 1Y9QA 3J8F3 4QX7A 3DV8A 5K8SA 2CAVA 4QKDA 3LWCA 5L19A 1RVF1 4WM7C 1Y7BA 3B93A 3MF6A 1NQDA 3MYXA 5LWBA 3E6CC 4QX5A 1EAH2 1BK1A 3L9JT 5IVEA 2Y34A 4ZY9A 2FZ2A 3NJVA 5F3GA 3WDVA 5BNQA 4NMIA 4N53A 1AR61 4O7XA 3VBSC 3WDXA 4ZU5A 3FE5A 1FT9A 3MZHA 1LOBA 4Y33A 4YVWA 2VO5A 2F4PA 3OCPA 4XJZA 1US2A 2X5IC 4W50A 4GMP0 3WLUA 2A5ZA 1IGOA 4LXLA 1AF9A 4TYSA 3VBRB 3ZSKA 2YC2A 1UW8A 1WUVA 4HG6B 4IV3A 3KVAA 2G1MA 3RYKA 1S0CA 1RUD2 1X9TA 2JDYA 3Q8FA 3VDDB 4YW2A 4Q0SA 1Y43B 2EAAA 5FOJB 4BWOA 2FMDA 4LBNA 2HWF2 1JZ8A 1RVF3 5FRAA 3DKWA 2GMMA 2EIGA 5EV7A 4IEUA 2G19A 3VBFA 4AE2A 5HCHA 4CEYA 1U5XA 5F6KA 1OPOA 1H4HA 1AR63 1K45A 1UMHA 4BXSV 2OZ6A 3S5QA 4E4HA 2BV4A 5LW9A 4FPEA 1UOBA 3SQOA 3T0AA 2JD9A 2WS91 4G4FA 1C8M3 5FCCA 5FQ0B 4GQ7A 2B7YA 2OW4A 4A7YA 4XCAA 4AI8A 2WT0A 3DYPA 2VW2A 5FZ1A 5KXCA 4FTEA 5C5TA 4B3NA 3VKFC 4NE9A 3ZSEA 5JXIA 3ASIA 1NYWA 5E6HA 3LFMA 4EROA 2DCYA 2WFPA 4DUXA 1AR81 1ZM1A 3HR9A 5FDBA 5KC5A 4CXXA 3IMMA 2JIJA 4QQPA 5D21A 3EXUA 4QGNA 1FI2A 3HPNA 2C0ZA 5LBBA 5J37A 4MXWB 3APBA 3IWZA 4WM7A 5FZHA 5DDJ1 4RHV2 3ZXFA 1Q43A 5C3PA 3H8OA 1DGWA 4I02A 4XF0A 2Q4SA 5EP9A 2DU0A 1RUC1 1WMEA 1J1LA 1XPWA 4DPNA 4H3WA 1GV9A 3D0JA 1CZTA 2OPKA 2EIDA 1KGYA 2Y33A 1L7QA 3MLJA 4RL7A 3HBKA 3O1RA 2XVKA 3VBSA 3RZMA 1JOBA 3JD72 4A41A 1AXKA 5FPAA 4COVA 4WVWA 1RTVA 4IV1C 3GZAA 1XNDA 2D98A 3OEBA 4JHTA 1VBC1 4YGCA 3ACIA 4K20A 3O0XA 2ZEXA 3WUCA 3KGZA 1AYM2 5EZWA 3ZFEC 5IK7A 4OI0A 1IHMA 2VULA 3VHNA 2G9ZA 4BPZA 5BNNA 2A7AA 4CYDA 2VW0A 4QWNA 4DFSA 1QJU1 1K42A 4NPLA 1LTEA 4W65A 4HL0A 2ZXQA 3WW2A 3LDBA 4MADA 1AR83 1ODMA 2VXJA 2AC1A 4P08A 3ZYJB 4X6RB 4CDWB 4ES9A 3LFIA 4CCMA 5JPMB 4XUPA 5DZFA 4XC9A 1XYOA 4OHXA 2QQWA 3GNEA 4P9XA 1CAUA 5F2WA 1WKYA 4KMQA 5FBZA 4MO3M 5BNOB 1JZ3A 4M0HA 4E2GA 4W6YA 1VRH2 5AFBA 5EXOA 1RUC3 2W87A 4GH4A 3ITQA 1UOGA 1FPN2 4Q0PA 1V6KA 1ZBA2 4B1LA 1JZ4A 4K6BA 3JBG2 4AQSA 1M06G 4DQAA 2QUOA 3ZFGB 2RS32 4RR3A 1AL21 4UBHA 2O0OA 3QH7A 3TYJA 2BYVE 2A3WA 2JDNA 4RS5B 4WVVA 1CJDA 4I3PA 1N47A 1NAEA 2ZX3A 2EIBA 4L2NA 4AEJA 3AZYA 3HD8B 3PUSA 3S7IA 3Q8AA 1QJU3 2VU9A 5C4WC 1OBNA 3LOIA 3K46A 4ZS3A 1DP0A 5HCBA 4BDVB 1Q3EA 4IXLA 2XPJA 1Q56A 3A7QA 3V0BB 1CGPA 4AEMA 1UIJA 4XZPA 4Y24A 1S0EA 2YFUA 3FX3A 1C5IA 2BFUL 4UFLA 3IAPA 5I0DA 1QDCA 1XB9A 4XFAA 2FBEA 5A1FA 5C9AC 2ET7A 4JKKA 5JZGB 4WVMA 3G7DA 4AW7A 4NRQA 2EA7A 1VBB1 2ZMLA 3WT3A 3L2HA 4TLGA 2DVGA 3O12A 4R9BA 3P3PA 3ENRA 2VZUA 3ZFEA 4E8DA 4Z92B 2BGOA 1R082 4RN5A 5KHIA 2QBXA 4M0NA 2GC0A 3HN3A 3NJXA 5GZDA 1GWKA 2YU1A 4N43A 1EYBA 5IVVA 2QQUA 1KS4A 4K7JA 4QDSA 4B4QA 2ZGMA 3ZIXA 2QQMA 3ILNA 5FYVA 3NRUA 1E57A 4S2HA 5F3CA 3RZGA 2YG0A 1CD3G 2VZTA 1YFYA 2BWAA 4QXKA 2ZX1A 1AR62 2ZKLA 2IFWA 4ZS2A 5D8AB 2WBKA 3CHXA 3Q8EA 5B4NA 5FMDA 4LJHA 2PELA 2GNTA 3E5XA 1R64A 1US3A 5FZ8A 3WQBA 3DXUA 5FYTA 1BMV1 5IVJA 3KF3A 1IS4A 1YQ2A 4GULA 1VBB3 1HQLA 3ZOIA 1O3QA 3K48A 3KWVA 4IEYA 4XHXA 4LTAA 2QE3A 1K5MC 1ZBE2 1QDOA 2J42A 1YJLA 3AZXA 1U5ZA 1H2NA 3CJIB 3QCWA 4UBGA 5F2SA 2XB6C 1OURA 1DGRN 3H8UA 5KHJA 2VOTA 4LULA 5C4WA 4B7EA 3ILFA 1MEC1 3T2OA 4GD4A 1SDWA 4E9KA 4MGTA 1F4AA 4UW6A 1N1YA 1ZREA 2HWB1 3AMNA 4KG8A 2WSUA 1XBFA 1GMMA 4Y5SA 3O7OA 1GQGA 1S0IA 5FZCA 2WS92 3VDBA 3HT2A 3OUJA 5EJ3A 5LA9A 4A4AA 3USSA 4EWDA 4CU6A 1W9TA 1G86A 1WW7A 2ZJCA 4Q29A 4QKNA 2ZGOA 5DPNA 3O1TA 3ZYRA 2CY6A 2GSYA 1MS1A 3K4ZA 1GOGA 2BOIA 4LPLA 3OBAA 4PIXA 4BQ2A 3O1SA 3WINE 5IJRA 5CG8A 1W8TA 4QHBA 2BZDA 2E32A 3MIBA 4JGYB 2XUEA 3H7YA 3K2OA 2AREA 4EZ4A 1LRHA 2ZTNA 5DDJ2 1SBFA 3LZZA 3POGA 1OD3A 5FXVA 2ID4A 2QCSB 3O0VA 4A44A 4XQDA 1W6NB 2ORXA 3PMEA 1MEC3 1H1MA 2WZ8A 2QQNA 1CPMA 5CISA 4PF5A 3E6BA 3VBUB 4YGBA 3ZN4A 2HWB3 3GZEA 4AI3A 1VBC2 4F83A 2WNUC 1HJGA 4Q4Y1 1W2OA 2ZX2A 5K9YA 5FREA 2Y38A 3ZMNA 2ADDA 2DVFA 3I97A 4FPHA 4B4RA 1QJU2 2EXIA 4Y3OA 4EWAA 1QXRA 4JGZB 4JCKA 4YGDA 1K5MA 3ZVXA 3BPZA 2VCCA 4META 5L7OB 3KT7A 5EJZB 3IT8A 2XBO1 4LA2A 4YW5A 3IB3A 1OLRA 4Y20B 2Z2SB 3B00A 2D7FA 3HVDA 4AI2A 5LA0A 5FY4A 4EN7B 2PAEA 2P17A 3ZX7A 2WLQA 5ANNA 3VDDC 4HFSA 4F3JA 3TBDA 4PLNA 5EYYA 5FZFA 2W9XA 4LHNA 4IEQA 1UO9A 3N7LA 1DGLA 1TNRA 4QX0A 2PAMA 2JDPA 3S5AA 1AL22 3LEMA 4YPJA 3B5LB 3ZMOA 3BI3A 2A6VA 2E51A 4EYUA 3T2QA 1NA1B 4QQHA 1HJFA 2XVLA 5L9BA 2KM2A 2VNRA 3WD5A 4ET7A 1RMU1 2PLV1 1IQDC 2QDNA 3BTYA 3RDIA 4NRMA 5CU1A 3GCWA 3I2GA 1NXMA 3RJRA 4NJ4A 4FAHA 2A6XA 3MEPA 1SMVA 2Q1MA 3AP7A 2XL7A 1C1LA 2XBO3 2XDVA 2VOXA 1DQ6A 3NV1A 4UOJA 2MPFA 4UXAA 4BB3A 1A8DA 1RUG1 4IE5A 4KNCA 4XDOA 5A7WB 3D82A 5A3LA 1VBA1 1PNFA 3NNJA 5K4LA 4XQWA 5IAXA 3VDCA 2NQYA 4LLFA 1HXS2 1JI6A 2A71A 3ZYFA 1WLCA 4KH9A 2OIIA 3N7KA 1RGSA 4OHYA 2ARBA 2HBUA 4Q2FA 4GJYA 5FYIA 4LKSA 1D0HA 1HRI1 1WGPA 2IZWA 1S2BA 4DXSA 5HXMA 1JTZX 3MFCA 1HLCA 1XE7A 4K1YA 4R9DA 2P6CA 2W1SA 3C7GA 4QHOA 4Y22B 1LOEA 3NAPB 3U07A 4L92A 4LOTA 2CDPA 1F2NA 1QH6A 1U5IA 4MGQA 1RMU3 2PLV3 3A0NA 5A1LA 1VAVA 3SCHA 1OUXA 1VR3A 3ZN6B 1WCUA 1PM4A 4XVHA 3C7EA 3VBRA 5LRRA 1RJ7A 3N9OA 3A0KA 3WQ0A 2JB4A 3VKLA 3H7JA 5FY9A 1VMJA 2VOKA 2RDNA 2CWSA 1MS4A 1PIV3 1RHI1 1RUG3 2Y26A 2WKKA 3VDDA 4COWA 4YZ4A 2MNGA 2GALA 3N9LA 2GMEA 5F39A 1VBA3 5GKAC 1UY4A 1KFXL 2HWE2 3SC7X 1BMV2 3KB5A 1HB4A 2A6WA 2PQSA 4IEVA 5CIRA 2OYZA 2ES3A 4FXKB 4AEDB 5A32B 1LU2A 5LCWL 4CCOA 1JZ6A 4LBLA 3P5BA 3WNPA 2WRAA 2ZZJA 1XC6A 2Y0OA 1AR91 3OD0A 4N8MA 5CAZA 1AZDA 2ZCWA 4KGGA 5FPXA 5FQ0A 4Q4W1 5FZLA 1MEC2 4XCBA 2EIEA 2VNGA 3HNBM 2J7MA 2ZX4A 4QPIB 5ABJB 3ZFFC 4LBMA 3V56A 1S55A 2HWB2 2VZVA 2ET1A 5IFTA 2ZHMA 5J48A 1YRZA 1OLMA 1RHI3 2F17A 3SKJE 2JB8A 3VZNA 3OGJA 5A6ZA 4FFFA 5FMOS 2QNKA 3FUQA 4MXWA 1LGCA 2OS2A 4K21A 1B09A 2RM21 4AF9A 1PK6B 2AGSA 4OQ8A 3OF1A 2WWSA 4IQPA 2BVVA 1SHWB 3VBHC 1GP5A 2YZ4A 3ZN5A 3RZJA 5JOZA 2WO1A 4ISQA 2HYXA 2UY9A 5A6XA 1AR93 1SPPB 1XNAA 4HVOA 4Y1ZA 4YVSB 5CFDB 2E26A 3VBOC 4YW1A 2WUHA 2VGDA 1HB1A 2A6ZA 2BDRA 4AL9A 2HH9A 4MGKE 2GP5A 2JDKA 4GJZA 2OUHA 1LGNA 1GU3A 3V64A 1LEDA 4E4SA 4FOWA 2LM3A 2VBPA 3N36A 4CDWA 5FTTC 4MGSA 3WNXA 4GKXA 4Q4Y2 1COV1 3AB0A 2Q8CA 1EAH1 2XLGA 1IPKA 2R32A 1ZX5A 1FNZA 1UX7A 5D8AC 3ZSLA 3WNMA 1VLNA 1SCRA 1ND3B 4Z82A 3CKHA 4UF0B 1JUHA 2RM23 4L9BA 3TEYA 2HEYF 2P5BA 3ZFGA 4HSLA 5AVPA 1NCQC 4D7YA 1MS9A 4XFHA 5C8CB 2G9GA 2XR4A 1PGW1 4GWMA 5FP7A 1F5JA 3AMMA 4RS5A 4D7SA 5JIAA 1LOFC 1Q5OA 1QGLA 2QQOA 5FZOB 5HV0A 4FFIA 4OHZA 4XW3A 3UKNA 1W6OA 1O59A 1W6MB 2VCBA 3WF3A 1MS5A 2Q30A 1STMA 4Y1YA 5APAA 2VCMA 2P3JA 1LESA 3UKVA 3OTFA 4HVQA 5A3OA 3V0BA 1J83A 2WABA 3GBGA 1COV3 1JZ5A 1YC61 2YBKA 2WNVC 4XILA 1EAH3 1YNAA 5I91A 4XF3A 1MZEA 2I07B 2Y8KA 1LHNA 5JWPA 4RGAA 4LA3A 1IG3A 4CA9A 5F6LB 3FC0A 4RSUA 3ZXKA 1JUIA 5C3OA 5JZGA 3VLBB 2PN5A 4JTOA 3VZKA 2PAKA 3PU3A 3CMGA 2ZHNA 3FLPA 4CPBD 2LUWA 4O9EA 1UOJA 3S57A 1RUG2 5I0TA 1CAWA 2BTVC 1W9WA 3OYWB 3B01A 4QDRA 2Q1ZB 4XXPA 2IXLA 4JGYC 4XIKA 4ZPIA 2Y0IA 5C8WA 5DAVA 4AI9A 1W2TA 2OXBA 1MS0A 3B9CA 3WCSA 2YC0A 5J09A 3USUB 3ECQA 3CIHA 5A3MA 1DZTA 4PDWC 1L3JA 2HWF3 3VKMA 3I2JA 1HRI2 4X8PA 3WDYA 1LNSA 1ZA4A 1W3XA 3CLPA 4DY5A 5D8AA 2O14A 1LCLA 3MI8A 1U12A 1BCXA 2C5DA 2IVIB 3HOBA 1S0DA 4UWDA 3WP3A 2W1UA 3JZVA 4XIOA 3SHRA 3OSDA 1C8NA 1SBEA 3BTXA 2A70A 2J1TA 4D0QA 1DLLA 1HB3A 3VL8A 3ST7A 1BEV1 4C91A 3AMHA 3WV6A 3RZHA 1UN1A 3WOGA 1WLDA 3AYEA 1AX0A 3AMPA 3OGGA 3WG2A 3AKTA 3H1YA 4JGZC 3PVEA 5J96B 3R05A 3QLQA 4ITCA 3ES1A 1C28A 2QTWB 3IIIA 3RS6A 3CJIA 1LOFA 2PYTA 3CDZB 4XACA 3WP5A 3B94A 3ZYIB 1MZFA 4ASMB 4SBVA 5DQ0A 2VC9A 1VAKA 2OPWA 2R0HA 2ZAHA 2JG9C 1B35C 1GP6A 3U78A 3SMHA 4BZ4A 2FDHA 3C8XA 2ZEWA 1N3PA 2ZKNA 1Q8VA 3B3QE 2XMLA 4YVWC 1VRH1 1JYXA 1E5RA 1W8HA 2CGPA 1ZBA1 2YDEA 1AR92 2VG9A 1X33A 1WWYA 3JD73 2RS31 4Q4W2 2J1EA 5CB7A 5FUPA 1PVXA 5IUQA 4XJUA 5AC91 1CVNA 1BEV3 2RJLA 2XHNA 3IDEA 2DVDA 3H9AA 2XJSA 1QJZA 5H9RA 3WNNA 1EP0A 2DVAA 5GLVA 1UYYA 2GNBA 2K46A 5D1IA 4EN9B 4QPGC 4M00A 4EN6B 4JGYA 2BPA2 3KCXA 4LKEA 3VBFC 1YHFA 2VMEA 5J3UA 1FX5A 2XWJB 1W6NA 2RM22 4K8FA 4PDWA 1HIXA 4FXGB 1DBNA 3M3IA 3IN9A 2WZEA 4YG6A 3VBUA 1POQA 3ZLIA 1VRH3 1N1TA 2OVUA 4PF1A 4PT6A 3PDQA 1FPN3 2JG8C 1ZBA3 2BGPA 2OZJA 2RS11 2XJQA 5J1XA 3JBG3 4AQTA 1E5IA 1UU5A 5LY1A 3RMYA 1HV0A 5H9PA 5A7PA 3BALA 2RS33 5FYZA 2WQZC 4L99A 4ZXEA 2JD4A 3M1HA 4GA9A 4I30A 4LBQD 5AC93 5GALA 2GN7A 3NAPC 3VZOA 3BGAA 4CZSA 4Q8KA 1OFSA 2RE9A 2RR11 4M3CB 4V1PA 1R081 4JGZA 2DV9A 3S6PA 4IGQA 5L7OA 3D5OA 4CEWB 1COV2 4JQRA 4RA0A 1VALA 2DUQA 2WIIB 3GXUA 2GC2A 4Y20A 2P2KA 1LOCA 2JG9A 4U2AA 3ZYGA 1B35A 2H0VA 3ILRA 3I2HA 1XNBA 3LQCA 5EWSA 4LO4B 3GF6A 4KI5M 3BPSA 4XURA 4AGGA 1ZNPA 3JQWA 3T30A 1LENA 2LS6A 1OH4A 4AVSA 3T08A 2BW8A 1YIPA 2DCJA 2CAUA 1KQRA 3EJKA 3C2UA 5BNNC 1PGW2 3AFGA 3B9IA 4HVRA 5CFCB 2ZAAA 4HKWA 4BMEA 4S2GA 4AXOA 1I3HA 3PUAA 2J22A 1Y9GA 2RS52 3HJRA 3PU8A 4NWVA 2QVSB 4RQPB 1RJ8A 1ZBE1 2OA2A 4F7ZA 1X9PA 5F8PA 2RR13 1PM7A 4MGYE 1UPSA 1R083 1I6XA 2XOMA 2B45X 2G4IA 3FMGA 4MVTA 4ZONA 2GZWA 4NAOA 1Q8OA 1ULFA 3BOWA 4CDUB 4QPGA 1ZZ8A 4QKFA 5EHDA 4LQRA 4GH4C 2R1BA 2QKDA 1VIWB 3HNYM 4ZU4A 3MIDA 4JHZA 4QM8A 1HN0A 5A7WA 3VZJA 3ZDVA 3LEKA 1XSRA 1GNHA 1JYTA 1QKQA 1VB4A 3W58A 4CP0A 4RR3C 4OZXA 1W06A 5M0TA 2J1SA 2JG8A 2XQXA 3HMYA 4WM8C 4HK8A 4LIVA 1WA6X 3I2IA 1ULEA 4QM9A 1XYNA 4YM1A 5FKBA 2NZ9A 4IEXA 4QAWA 5T5PA 1ENXA 1YQCA 4ATFA 3BU7A 4D6QA 2W1QA 2B4KA 3FBYA 2W3JA 4Y22A 2WO7A 3NAPA 1UZWA 1CIWA 1ZBE3 4NR1A 1VBE1 4YVSC 1P8JA 1ZZBA 1AR71 1W9YA 4YZ1A 3UJQA 4BXFA 5FO9B 3ZN6A 1OOPB 1G9BA 1O91A 2WN3A 3B69A 4HXCA 4XFBA 2QFEA 2GH2A 3T2PA 1ENRA 5FZ7A 1VRBA 1XSQA 4B7KA 4CU8A 4ES8A 1N1SA 1ND2B 4TLFA 3VV1A 3LPFA 3PUIA 2HWC2 4BYYA 4LBQB 4TN7A 1BXHA 2ILMA 1G7YA 3ZKUA 3MIEA 3AZWA 2OX0A 3N9QA 1DLCA 3AP5A 3VHPA 1TME2 2ATFA 2VL4A 3R4UA 1UF2C 1H0BA 1NE4A 1YXWA 2DBNA 3B02A 2YFZA 3JQXA 3PVBB 3V65A 1BEV2 3AVRA 2IUWA 4IEOA 3DPRB 4OMCA 2WS93 2P1BA 1ND3C 2JE7A 1N1VA 3JUUA 3RMXA 2TBVA 4QX3A 4AEDA 3OY8B 2C6SA 2FQPA 1F5FA 2VZPA 4AFBA 3PLQA 1KITA 2VTXA 4GMP1 2I2SA 4OI4A 1RUE2 4N43C 4A45A 4DZGA 3PVOA 1JYCA 2CWMA 1BK0A 1LHUA 4JVAA 5C71A 1W6QB 3EMRA 5CBLA 5KR7A 2P3YA 4BLJA 3VD9A 1J84A 4UYBA 5K0UC 5FXXA 1VBE3 1LKNA 4GIQA 1AR73 3ELNA 4LE4A 4RGKA 3MV11 2BFUS 2BQPA 4XQ4A 4QPIA 2D3RA 4W8JA 4FTBA 3IDCB 5DDJ3 5FP4A 4QQ2A 5GLUA 4FTSA 1ASJ2 4EN0A 4MG2A 4FBFA 4Q5OA 5CKQA 2EXKA 2H0BA 2WDBA 5GM0A 2ZABA 4FAGA 5A1AA 3SXWA 3SLIA 3M2MA 2UY8A 2X53S 4QGMA 3IKWA 4CCJA 3AX4A 4CEWA 5AC92 1VBC3 3AFKA 4WM8A 1GYKA 4XETA 5LBCA 1QF3A 2NP0A 2QQLA 1PK6A 4IETA 5JAXA 5FMBA 2R6QA 2W46A 2W47A 2X05A 3ZYPA 4FPKA 4N9HA 1YWKA 2E7AA 1C57A 1QNYA 1SPPA 3K3OA 2B9UA 1CONA 4Q26A 4Y5Z0 4YVSA 5CFDA 1OI6A 2DTYA 1DYPA 1ACCA 2D6LX 3RRDA 1F15A 2R0FA 1QIQA 4OUEA 5EYXA 4QDQA 1WCQA 3EO6A 4KWKA 3FLTA 3MW4A 3KMHA 4KQ7A 5F5AA 1F8VA 3J4UH 3A22A 2BJSA 3I54A 4YG3A 2WZR1 2RS12 3IZOA 4QD2A 2VY0A 5F3EA 2ZZQA 4DO0A 1HXS1 1RUH1 1GWMA 4CP9B 3RYRA 1AL23 2YROA 4N7IA 1KD7A 4E4DX 1CAXB 3W5NA 2CGNA 3MF9A 4QB1A 4LITA 1ND3A 3O1PA 2RJ2A 3I2DA 2RR12 2QZ3A 2Q8DA 3ATGA 4UF0A 4AFDA 4ZHNA 1OSGA 1QHDA 2FMYA 1QJX2 2LALA 4XDPA 1NCRB 2WL1A 4KL1A 2YGLA 4L0PA 1OQEA 1D4M2 3LA2A 4NPRA 4P5YA 4GXLA 4DEQA 4QQLA 1AHSA 2YPDA 3M3EA 3OPTA 5C8CA 5K0UA 4GWJA 3RZZA 2OQ6A 1JODA 1ULGA 4G9SB 2Z69A 4IESA 1OMIA 3D6EA 5FR3A 2BNOA 3Q8BA 3K77A 2QQJA 2ZEYA 1F4HA 2ETEA 2WQ8A 3ZPYA 3PIGA 3R0RA 2JDZA 4Y4YA 5C3QA 1NKGA 3WF0A 2HWD2 3M3OA 2C9KA 3K51A 5FO7B 3CF6E 4O9GA 1H1AA 2HWE1 2W08A 2GN3A 1HXS3 1RUH3 5FPLA 2W95A 1I9RA 3POEA 4YFZA 2UWCA 3IDAA 4X6QB 4XPVA 1URXA 4DUVA 3S0MA 4C90A 5A80A 2VOWA 1VBD1 1W05A 2YC4A 5LZ6A 2CDOA 1YQ6A 3FWEA 1HQWA 5DAWA 4B8EA 5ACA2 5BY5A 2X29A 2WAOA 3FLRA 2QQIA 4NPMA 3RI9A 1JN2P 4OCTA 4Z1VA 1PMIA 2QDRA 4XJ8A 4DS0A 3JXSA 4DUWA 2XKOA 3H0OA 2VD7A 2OKXA 2B9VA 5E8AA 4IUGA 2UYBA 2VR4A 4CP2A 5JOXA 2UYAA 2WWUA 1PZ8A 2RVAA 3AKSA 3FBMA 1E5HA 3WW1A 3OB8A 3POWA 4XOGA 1V6MA 4COUA 5BNPB 1O3SA 1AYN2 1X8EA 2D40A 3BVCA 1O4ZA 1SLCA 1WA4A 3H50A 3AKRA 1OC1A 2DCTA 4M01A 3USUA 3NNFA 2JECA 2QQVA 5CKMA 2NLRA 3DYOA 3MUZ1 3ZM8A 3GBFA 2HWE3 4NIDA 1FYUA 3NKTA 2WQ4A 5KXDA 3HT1A 4YZ2A 1GQPA 1PZ7A 4BQ3A 3TNQA 3W9AA 2TUNA 1W0OA 1H2MA 5LK7B 2WO3A 3T4HB 1PGSA 1VBE2 2WN2A 1VBD3 1AR72 1QOOA 3NNMA 1J3PA 3WDWA 5JVVA 1LHOA 4LKFA 2AR6A 3WX5A 1NZIA 2I74A 3ZXAC 4CCCA 1Z78A 1CX4A 2V4VA 1OKOA 4RFRB 2OT7A 4Y1XA 2WSVA 3D4KA 5A70A 5C33A 4EE2A 4IE6A 1RB8G 2DCZA 1FOD1 3J9SA 3L2YA 4P9WA 3WNLA 4AI0A 5CKNA 4ORFA 1GZTA 1V0AA 2CV6A 2ORZA 2BERA 4FT8A 3RNSA 3R4DB 5HBAA 1JBCA 5CYYA 1RC6A 4MX3A 2XKPA 5HXVA 4XF4A 5B2GB 1V6JA 2VXRA 2R061 3EBRA 3ZXDA 1LB2A 3ACHA 5IVYA 4NRPA 2J1RA 5FZ6A 3TOJA 2YMZA 4AFMA 1F9KA 1MZ6A 5LASA 1BYHA 3MIGA 3U75A 4F8AA 3Q9OA 1NUKA 2VBBA 5KBFA 5FXZA 3VBRC 5CFCC 3OG2A 4AHWA 4AVTA 2VMHA 1G9FA 1H8TB 2VH9A 1RYYA 3PUHA 2JKBA 3PIJA 1G9AA 4P9GA 2Z5WA 4I2OA 2K9ZA 3KV5A 2FD8A 4C1XA 1ULCA 1WLWA 1O4YA 2W52A 5DG2A 2XQRA 1OLME 3JCIA 1WMXA 3WG1A 1A34A 5J36A 1GNYA 1FOD3 3SH4A 1R092 4BQWA 5KWRA 3GJAA 5FP3A 2R042 3TNPB 5DUUA 4XHBA 5GLTA 3J7HA 2E63A 1GR3A 2EAKA 1V6OA 4BHPA 2LROA 5FZ0A 1XYPA 4Q4Y3 3R6SA 3TN92 3OGSA 1ZYBA 1TE1B 2VNVA 4FP2A 5BYNA 1W6PB 2PHUA 2WT2A 2WC2A 4COYA 4AZZA 1LAJA 4FQ4A 4FP3A 1YIFA 5A3PA 4XF9A 4Q4X1 3W5MA 1NZCA 4NO4A 4N53B 5DAXA 1OXCA 3ZO0B 1FV2A 1K3IA 3MUY1 5LRSA 1MQTB 4CCNA 3SH3A 1W8WA 2WFF2 5IVFA 4HSJA 4DRVA 1APNA 4Q27A 1VB2A 1Y9MA 2XVGA 4CDQB 1JOJA 3S7EA 4M3CA 2D3PA 2C9AA 3DECA 4IV3B 3T09A 2IXHA 2WZR2 4XAAA 3QOPA 5A7SA 1NLQA 1X82A 3LGRA 1SLAA 4NVPA 1RUH2 4Q0QA 1BVP1 3Q8CA 4LR4A 4Y4RA 2ZGKA 4AHXA 3W21A 3VD4A 2WWJA 4Y26A 5C6CA 4CCLA 3THCA 4FCAA 3AP4A 2YV8A 4BQ4A 3AKQA 4OQ9A 3NKGA 3FHIB 1DQ5A 1YCIA 4M3CF 4ARXA 4AOCA 5T54A 2IXIA 4TWTA 3J7LA 4PHZA 1SLTA 3BODA 4IDZA 3DPRC 4ONUA 4Q1RA 4Q4X3 4RGGA 5A6QA 2C1FA 4URAA 2BRTA 4QPYA 5FYUA 5KHHA 3OUHA 1CN1A 5HCFA 4IGOA 2W94A 5G05L 4XJAA 3UETA 5CFCA 4BK5A 5L9VA 1BQPA 2PXJA 2DUPA 3I3EA 3OPWA 4XTPA 5FK8A 5FZMA 3UESA 1EUUA 1NXD1 4RQPA 3NSTA 4LK7A 1UMZA 4CDWC 3BTZA 5KHGA 4LBJA 2ZEZA 4Z07A 3TEWA 3O1VA 1AJOA 3VKOA 2RV9A 1A8MA 3DEMA 5EQUA 2DYCA 1A6CA 3IM0A 3POBA 4K8RB 4R4ZA 1UZYA 5DG1A 2A6YA 5BNOC 4Q4V1 1W2UA 4FFHA 3U4SA 4BCUA 5JOWA 2XWBB 3SISA 4TTGA 1YUDA 4WM7B 1HRI3 3CZJA 1VBD2 4P00B 2I45A 4XXAA 4CU7A 4LBKA 2O1QA 4XZUG 5JUVA 1JH5A 4NUBA 2D97A 3ZFGC 1XU2A 1RXGA 3FJSA 3I3QA 3ZKYA 5F7UA 3KGLA 5JOYA 4FSJA 3RWNA 4AFCA 1YEWA 3VBSB 3LSDA 4RS5C 3UJOA 3H42B 2VVFA 5FZEA 4DXTA 3O1MA 2D93A 3RYPA 1UY0A 1U0AA 4KG0A 1WCDJ 3A21A 2X5IB 2GU9A 2VECA 2B39A 3LEGA 1O6UA 2K0GA 1U5YA 5GZCA 2HYKA 4E8CA 2Y60A 5JXHA 4LKDA 3HNMA 1OOPA 1GQHA 1SFYA 4H55A 1QXPA 4JX0A 5I0SA 2ZACA 3K4AA 1HRV2 1NY71 1UY1A 2ZGSA 5LEKA 1ND2A 3MW2A 3WG4A 4Q4V3 4ATEA 3R4SA 4BQXA 2HKXA 2XJRA 3NVCA 4LBQA 5JZGC 1DIWA 3JU9A 3RZKA 3GJBA 2NYYA 1V9U2 2AENA 2V5YA 2VUDA 3GDBA 4LO6B 2P3KA 4UT5A 3WHUA 4DMIA 1CX1A 1WMDA 4S2FA 4NIIA 1XXNA 1UNBA 4YW7A 3DPRA 4ISRA 4XE9A 1W0NA 4XMIA 2RDQA 3POFA 1XE0A 1XRUA 5SV8A 4Q4W3 1WMFA 2VOVA 4A6SA 2C4XA 4ZZ8A 4YLZA 1FOD2 5JXJA 4D69A 1WZXA 4QKBA 1RUOA 2GDFA 3MDPA 5TSWA 1CIYA 4Y5TA 3O1OA 4NIHA 2J1VA 1WD4A 2VZQA 1CPNA 3CEWA 1W04A 1YFUA 2DFCA 3GHMA 1W6QA 4Z2AA 4MSVA 1GFF2 1UYXA 4OVEA 4EQVA 4QU2A 4CUCA 3PTYA 3P6BA 3WHTA 4NIGA 2MHFA 2VQTA 3RPQA 2R062 2PQQA 1JXNA 2VUJA 4Q0VA 4QGLA 5BNOA 1G9DA 1H4GA 2JDMA 2BNMA 3WZ1A 4BQYA 3AZVA 3VN4A 1OLQA 4XUTA 3VGIA 4O61A 3T0BA 1BBT1 1OKQA 4BQ1A 4PIZA 1EV12 1FATA 1RUJ2 2WLPA 5FZGA 3E97A 3TB0A 4B29A 2OQ7A 2Q1FA 2E53A 4JAAA 5EPAA 3ZYBA 2RJKA 1I5ZA 3LOBA 1OT5A 2FZ1A 3CJIC 1W8FA 4IV1B 2ZGNA 3KCCA 2DUOA 2RS51 1TMF1 3WQ7A 2VTXJ 2D6NA 2VBDA 3AC0A 1SZBA 4D6RA 1UMIA 1NLSA 4AQ2A 3JB8A 3AL6A 3ZFEB 1WBLA 3NO8A 4AVBA 4OULA 4DXRA 3KQRA 5IATA 1QQP2 1WW5A 2A3XA 3W59A 1JMUB 3H3UA 2UWBA 4UFIA 1DQ2A 2DFBA 2Q0AA 4LLOA 5C3SA 4P9IA 4PLOA 2V5DA 5LY2A 2E7TA 1SCSA 1WCSA 2P3IA 4LOSA 4UAPA 4Q4X2 4XABA 2Y6JA 3WP4A 1C3HA 3M8LA 5JR7B 3AYDA 3KD4A 1OQ1A 2MEV2 3HN1A 3PL0A 5E88A 4CP9A 5FZDA 5ANQA 2SLIA 2FDIA 2BU9A 1V6IA 1NG0A 5FYYA 4W6XA 3ZPOA 1CAXA 4FPCA 1LOAA 4FPFA 5FP9A 1J3RA 3KV9A 2QQKA 1JOPA 4JKMA 3KV6A 1NCRA 1TMF3 2RS53 1POV0 3DUIA 1Z7S2 1FXZA 3I4IA 1PGL1 1W03A 4P9YA 1F31A 1REEA 2E33A 3AM2A 3MGUA 2GC3A 2GAUA 3MIFA 3OGRA 1SBDA 2ZGPA 5LA1A 2VZ3A 4PQQA 1GLHA 1MZ5A 3AKPA 4I09A 4QX8A 2JJ6A 1JU3A 3BCWA 5C4WB 3VBUC 1VJ2A 2HEVF 2IVJA 5T50A 4A3XA 2FDKA 1KDMA 2CNAA 2HWC1 4N90A 2NPIA 5E89A 5I8TA 1TME1 4YM3A 2JWPA 5FV3A 3OBRA 5EJ1B 2WZPP 1AL0G 4UW4A 2RMU1 2NM1A 4AWDA 1OD5A 4KWLA 4HOOA 3I3MA 3RZLA 5C9AB 3ABZA 3VKNA 3LAGA 3UKTA 1UZZA 2CHHA 3WVJA 1QOTA 5L7OC 1DGWX 3AJYA 5A7QA 1RUE1 3LDKA 4GB32 3SITA 5FPBA 1REFA 3GHNA 3KT4A 5JLVA 3KZ4C 1H8TC 4CVUA 1LEMA 2GC1A 2C24A 2XONA 3KT1A 4HPKB 4M4RA 4ARYA 2VQUA 4EZHA 2PMWB 1Y3TA 2LTNA 4Q4V2 5E16A 3VB9A 4XFIA 5FFOC 5A3TA 5GLWA 2VUAA 3AZZA 1J59A 1ASJ1 3WW4A 5FY0A 4R9AA 3VD3A 4DRRA 3O0WA 3NJZA 4BIOA 1SFNA 2VZRA 3URFA 2HWC3 2L9LA 4XJWA 2W2IA 5BNPA 3POJA 4I01A 4AGRA 2CYFA 1ZRFA 3GGLA 4XAEA 1NA1C 2ARCA 1TME3 1YI7A 2KA3A 2YU2A 1HX6A 3CO2A 1W9FA 3OOXA 4LO8A 4BLIA 4LMFA 5T52A 3WG3A 2Q8EA 4BM8A 4XDQA 5DMYA 3N4MA 1OA4A 4JQTA 1ZA7A 2VVDA 2IXCA 5JIUA 2ERFA 4DNYA 1J1TA 2K2SA 3LKJA 4PLMA 2ZGRA 4YW4A 1LGBA 1D7PM 3KM5A 2R072 4LNVA 4IERA 1DG6A 4LBOA 1MQTC 4IE7A 1RUE3 4YM0A 4AGVA 3FFZA 1PNGA 5T5LA 4CSWA 1K5MB 2W92A 4INDA 3RJ2X 1W39A 2A1XA 1NY72 4FPJA 4FPOB 4CDQC 3M4FA 1FMD2 1M4WA 1SG3A 5JCTA 3A4UA 1ZRIA 4XJ9A 5B4XA 2XHKA 3MPBA 3BYWA 4KWUA 1ASJ3 1WW6A 4H7LA 4P9LA 2D6OX 2YUEA 4A7ZA 3KLSA 1PMJX 3U14A 2IWGB 3C7OA 3LE0A 3ME2A 3ZYHA 3TEZA 1H9WA 2AYHA 2GH8A 1JU4A
chains in the Genus database with same CATH topology
4LUKA 5DUXA 3ZXEA 1UD1A 5T5JA 1A3KA 4AEKA 1UAIA 1NQJA 1IOAA 4MGIE 1QJX1 2ZBJA 4URTA 3LA7A 3ZDSA 1D4M1 4XF1A 3VHOA 4PQ9A 1H8TA 4OUMA 4XBNA 1ONAA 4H14A 3DGTA 4CDXB 1GANA 3CNAA 1YYNA 5EFUA 4PJYA 2WINB 4C0HA 1O3RA 1S0GA 5CA6A 1BBT2 1R1A2 2P34A 2HWD1 2RS13 5F1RA 1SEFA 1SLIA 1NA1A 3ACLA 4AEDC 2ZPXA 5L36A 1LHVA 3PHMA 5JI7A 1TMF2 1W6PA 2WNUB 3WCRA 3J26N 4HKOA 2XJVA 1GZ9A 4NHLA 4P9JA 5ACA1 4GALA 5AFEA 1QJX3 1UX6A 3VUOA 2CL2A 5ABJC 1D4M3 4QPIC 1BZWA 1MQTA 3LCPA 3M3CA 4HMZA 5H9QA 1C8M1 1REDA 1C5HA 4MV2A 5L73A 1IS5A 1DZRA 2ZX0A 3GZUC 1LR5A 4CDQA 1NOVA 4OI1A 3B7MA 2EALA 1SACA 3GALA 3DN7A 1N3QA 2PHFA 1AYN1 1H2KA 3OD4A 1RINA 3HBZA 1KFUL 4FPYA 2HWD3 4NOTA 1PK6C 5JMCA 4QMAA 2H6BA 3WQ1A 4AG4A 2X8KA 1RITA 4EV0A 1RUF2 4S2DA 5GJ6A 1D2QA 4NHKA 3SCFA 2VW1A 2HJIA 3MICA 5CFDC 1O3TA 2SBAA 5GZGA 4E27A 1EPZA 3MLKA 5ACA3 2Q8OA 1BKZA 5HCAA 1D0GA 1X36A 1QY4A 5E1RA 2ZHLA 1T6GC 1ZRRA 2ZGUA 2PHDA 4K9SA 4R52A 3KSCA 2RMU2 1QJY1 1AYN3 4HN0A 3U11A 4J1XA 1FAYA 1EY2A 4HK9A 4HZFA 4YNIA 1IZ3A 4KGQA 1LOGA 3DF0A 3RQ0A 5A32A 4YRDA 1AX2A 1J58A 1KRIA 1AXZA 4KU8A 1JW6A 3OJBA 3G6JB 5C8CC 4LO7A 5FLJA 1IQAA 4LEJA 1RUI2 4MUVA 3RG0A 2G9FA 2DURA 2NN8A 5ABJA 5JDBA 3P3NA 1AJKA 1ALYA 5JI9A 2BEOA 2X5IA 2ZGLA 2DVBA 4OLLA 5FO8B 1G6NA 4YGEA 4JV4A 1R091 1ZZ6A 2R041 2YXSA 5GZFA 4KWJA 4AVVA 4AYUA 3WP6A 2PTMA 1PO12 1ZZ7A 1QJY3 2IC1A 3TN91 3OPZA 3FZ3A 1G8WA 4FPGA 2D6PA 1KXGA 4HBNA 5F5QA 5H9SA 3PMSA 4Q1PA 1D2SA 5AVAA 3HAGA 5IK4A 4GMP3 2RHPA 2VVEA 4XFCA 1J3QA 5DXDA 1Z0HA 3POYA 1S0JA 2BGCA 1TEIA 4JDOA 5I93A 2WFF1 4CRQA 2GMPA 2D3SA 4OFGA 2GNDA 3WXPA 1GKBA 1AVBA 4QQOA 4WZCA 3AMQA 4NHMA 1OA2A 3J8F2 2IXJA 3ZFFB 5A33B 1R093 2R043 1W6OB 5BXXA 1NLRA 3I59B 4JDMA 2E9QA 1GZCA 2VMIA 3TN93 1DQ1A 1UCXA 5KXEA 4C0BA 1MR5A 4OHWA 4FOVA 1GNZA 1PHMA 2PHWA 4AQ6A 3IPVB 3S30A 2KXLA 4ZXKA 3ZXJA 5J37A 2GNMA 4I0AA 4COZA 2B42B 2BWCA 2TNFA 1Q8PA 5GZEA 4CTEA 3VBHB 3NV3A 2WFF3 4IV1A 2ZGQA 4JRAA 4UW3A 2PHXA 4HN1A 1OHFA 3U0ZA 3VBOB 3QBQA 1W6MA 1OPMA 1SQ4A 3T1LA 1CAWB 4U36A 5JSOA 2WZR3 2EXHA 1WW4A 3WR0A 4YYOA 4K1ZA 1HDKA 2TEPA 2Z79A 2R16A 1RVF2 1DU3D 1OFNA 2ENRA 2VQAA 5KHKA 1UKGA 1MACA 5LK5A 3WDUA 3TWIA 2P37A 5I8YA 4Q8LA 2ZGTA 1OQDA 3OBTA 1C8M2 3IIAA 5I0UA 3I7DA 3N35A 2ZS6B 4LE3A 4M3CE 1GBGA 3OYWA 3AK0A 1NCQB 2WA3A 1H8VA 4HANA 4YZ5A 1XNCA 1SLLA 4HETA 4BH9A 3EHKA 4R9CA 4LHKA 1ENQA 1QMJA 3CJXA 2YGMA 4R8HA 4A7KA 1HRV1 1IPJA 3QH6A 4L8QA 3V0AB 1CAVB 1UL9A 1KJLA 2YPJA 5T3NA 4DXZA 2AZ5A 1V9U1 2WNVB 2B8MA 1O5UA 4K40A 1DQ4A 1YFXA 1KJRA 3BIWE 1VP6A 5C9AA 5IT6A 1GZWB 4BOWA 4MLOA 1WBFA 1Q8SA 3RI8A 3AXEA 4CEWC 3UK9A 1AR82 2E6VA 4HPKA 1QJY2 2PHLA 4N9IA 4CDXC 3AP6A 4OHVA 1UU4A 5CADA 1SLBA 3UV9A 1XU1A 3N7JA 5FLHA 2QQPA 1HRV3 3MFAA 4DY3A 1RUC2 1S0BA 1UIKA 1H9PA 2WNEA 4PDWB 1AUYA 1YFWA 1YI9A 2YY1A 1EV11 1RUJ1 4MH0E 1V9U3 4MGZE 2UU8A 1RUNA 1WD3A 1X8MA 4IL7A 1LU1A 4RQPC 1JYIA 3U10A 3MW3A 1DGRA 4FQZA 1O7FA 4AVCA 4L11A 1LULA 4CDUC 3WDTA 2VQ0A 1QQP1 3VHRA 5IK5A 1FNYA 3FUOA 5FLIA 3EQEA 1QU0A 2UWAA 3PJQA 3IBMA 3U4XA 4ZKTB 3ETQA 2R063 5FAXA 4AI1A 2YYOA 4LO5B 2JG9B 1B35B 2E7QA 3KS7A 1FV3A 1RIRA 1PVC1 3VZMA 5J7MA 2MEV1 4WV8A 3HQXA 4ASLA 4YVWB 1EV13 1RUJ3 4HKLA 2XLAA 3GZTB 1ZVFA 2UURA 2Q5TA 1A78A 4XEZA 4NWWA 1CESA 4LUMA 1IS6A 4WBBA 2DWRA 3GYDA 2XJTA 2BBVA 1OOPC 1Z7S1 1TNFA 1DZQA 2YHJA 3H3ZA 1OA3A 5DUWA 5DUVA 1IKPA 3ROUA 1ULDA 3D8CA 1QQP3 1ND2C 4XBLA 2JEMA 1QXJA 2V09A 5JSRA 2ZMNA 4CDXA 5DZGA 3UL2A 2WT1A 4QPGB 3M7AA 3H1MA 3HWJA 5IK8A 3VBFB 1NE6A 3M70A 5F9TA 4EJRA 1CQ9A 3INAA 2BNNA 4CEYB 4D3WA 3SH5A 1PIV1 1I1EA 2WA4A 4K3UA 4Y1VA 4I0BA 1PVC3 2MEV3 3NV2A 4HT1T 3M3QA 4MXVA 1VBB2 2D44A 1D4VB 2JG8B 2V73A 1S2KA 4BA6A 2WNUA 3QACA 3NWKA 4AFAA 2D5FA 4YG0A 4GB31 4FPLA 4IEPA 4PBOA 1LHWA 4WVZA 1Z7S3 4Y1UA 1ZRDA 4CDUA 1PZ9A 1XQNA 4E2QA 1MVEA 2DF7A 5J98B 3CU7A 3LSEA 4TZDA 2B5HA 4RD7A 5I0RA 4AVAA 2EXJA 1CR7A 3BOPA 1YLLA 1EPWA 2AH2A 3WW3A 1QNWA 4XFGA 2O8OA 3AJZA 1XNKA 1ZZ9A 4UW5A 5LEJA 3GBWA 2W0XA 4DINB 1MVQA 4FO9A 3AXDA 2DCKA 2ZOEB 4OI2A 3ZXGA 4NN0A 5BNNB 2F6BA 2R071 5BV6A 5KXBA 4GB33 1X50A 4LHLA 4AHYA 2OUJA 4JDNA 4JRLA 4YW3A 4GWNA 3POSA 3MLLA 3O14A 1C1FA 2D6MA 1AX1A 1FMD1 5SV5A 3D0SA 1CAUB 1LJ7A 4BMBA 1ZRCA 1PO21 5JPNB 2JE9A 2QZ2A 1HV1A 4GH4B 2D43A 1GICA 1G9CA 2PHRA 4RR3B 4OUSA 5T5OA 1NCRC 1O4TA 3OY8A 4FOQA 4IEWA 2JXAA 4J1WA 4PBPA 4AK3A 3C3VA 4WM8B 1KDKA 4G3YC 1YJKA 2R073 4PIYA 1DHKB 1RL3A 3AP9A 2B46X 3MPPG 4H7MA 1AXYA 1BVVA 2XL9A 3I8TA 3NW4A 1FMD3 4JC1A 5FPZA 1IKQA 1N3OA 1R1A1 1UU6A 1PO23 2IXKA 3N3HA 4KBBA 4AHZA 4GKYA 1VAMA 1DFQA 5I8SA 2PFWA 3HIFA 2CGOA 4WVMB 4E2SA 1CJPA 4E4ZA 1QH7A 1XE8A 4Z8BA 1GSLA 1TQ5A 2XH6A 3AYAA 4XBQA 4BE3A 5FMOL 2XG3A 1V6NA 2PHTA 5CG9A 1JHNA 2DTWA 3E5QA 4Q0UA 2BVBA 5JSPA 4SLIA 2D5HA 4WZFA 4N43B 1QWRA 2XBO2 5GLZA 1S1AA 5K0UB 1HQNA 5BNPC 2WJSA 3WUDA 1PVC2 2JICA 4P5HA 3ZFFA 1RUD1 4HLTA 1BBT3 1R1A3 4XMAA 5A33A 3MIHA 4IEZA 3I59A 2BUKA 1MS8A 1UPIA 1WCKA 1O5LA 3SNMA 2HWF1 4TSVA 4A2UA 2EF6A 5KC6A 2W39A 1RUF1 2H6CA 2R49A 1DQ0A 4L97A 2ARXA 3IDBB 3IPVA 1RMU2 1R1ZA 4J6GA 2PLV2 3ZIWA 3FFQA 3SCGA 3VBHA 3PNAA 1H30A 4LT5A 1KS5A 1ZZCA 3BTAA 4RFT0 1YO8A 2A73B 2R30A 1HKDA 1H1IA 4MZUA 3VBOA 2N7GA 3CL1A 5K7PA 1PIV2 3H1WA 3VZLA 2QJVA 1W0PA 2XJUA 4XFFA 4I0WB 2ZA9A 1VBA2 1RUD3 5BUVA 4DB5A 1H2LA 1BJQA 4EN8B 3E5UA 4RHV1 1IS3A 2D6KA 3O5SA 1RUF3 4YFWA 3PVNA 2PA7A 3ES4A 3X29B 3VL9A 1RUI1 2NMOA 3JB4C 5FOBB 1S0FA 3JD71 3IMNA 4D7TA 1C4RA 1LECA 3PJYA 2VPVA 4W6WA 4X8NA 2HEWF 4Z2WA 3TRSB 4ZU7A 1LODA 1Q8QA 3KCYA 1AYM1 1NCQA 3LB9A 2ZHKA 2EVXA 2XGXA 3THPA 3RSJA 1RHI2 3ZSJA 4FOYA 3LA3A 4KU7A 2RMU3 1PO11 1ENSA 4D94A 4XTMA 3V0AA 4P14A 1CAVA 2XUMA 4N53C 2XJPA 2AUYA 3E6DA 4RHV3 3THTA 2WNVA 4YM2A 1FPN1 5CNAA 2VMGA 3JBG1 5DZEA 2Z42A 2O8QA 1RUI3 5HI0A 1GZWA 1POV1 2JENA 4YARA 4IV3C 3T2TA 1V70A 2A75A 3N7MA 4BIFA 4EWEA 1V00A 1PO22 1DDLA 2CTVA 2A3YA 5CVRA 1AYM3 3BB6A 3J8F1 3AYCA 4QT6A 4I3GA 4PCRA 5T55A 4MYEA 2R1DA 1WLTA 2DU1A 3ZSMA 3WY6A 4DOUA 3ALQA 1PO13 4CEYC 4R4XA 4YSFA 2XLFA 3TAYA 2JX9A 1QOSA 1DF0A 3NV4A 3ZXLA 1HW5A 3QD6A 1UKRA 2IFRA 4FVVA 2W68A 4YZ3A 1V6LA 1X7NA 3T1MA 1DYKA 4N7UA 5BPXA 2ZMKA 1POV3 4JTNA 4XYXA 4B4PA 3NL1A 2NMNA 2VNOA 3DL3A 1MS3A 2FHRA 1Y9QA 3J8F3 5K8SA 3DV8A 2CAVA 3LWCA 5L19A 1RVF1 4WM7C 1Y7BA 3B93A 3MF6A 1NQDA 3MYXA 3E6CC 4QX5A 1EAH2 1BK1A 3L9JT 2FZ2A 5BNQA 3WDVA 4N53A 1AR61 3VBSC 3WDXA 4ZU5A 3FE5A 1FT9A 3MZHA 1LOBA 4YVWA 3OCPA 2F4PA 4XJZA 2X5IC 4GMP0 3WLUA 2A5ZA 1IGOA 4TYSA 1AF9A 3VBRB 3ZSKA 1UW8A 1WUVA 4IV3A 3RYKA 1S0CA 1RUD2 3VDDB 4YW2A 4Q0SA 1Y43B 2EAAA 5FOJB 4BWOA 2FMDA 4LBNA 2HWF2 1RVF3 5FRAA 3DKWA 2GMMA 2EIGA 5EV7A 4IEUA 3VBFA 4AE2A 4CEYA 1U5XA 5F6KA 1OPOA 1H4HA 1AR63 2OZ6A 4FPEA 2WS91 4G4FA 1C8M3 5FCCA 5FQ0B 4GQ7A 2B7YA 2OW4A 4A7YA 4AI8A 5KXCA 2WT0A 4FTEA 2VW2A 4B3NA 3VKFC 3ZSEA 3ASIA 1NYWA 4EROA 2DCYA 2WFPA 1AR81 1ZM1A 3HR9A 5FDBA 5KC5A 4QQPA 3EXUA 4QGNA 1FI2A 2C0ZA 4MXWB 3APBA 3IWZA 4WM7A 3ZXFA 5DDJ1 4RHV2 1Q43A 1DGWA 4I02A 4XF0A 2Q4SA 1RUC1 1WMEA 2DU0A 1J1LA 4DPNA 4H3WA 1GV9A 3D0JA 2OPKA 3MLJA 4RL7A 2XVKA 3VBSA 3JD72 4COVA 1AXKA 4WVWA 1RTVA 4IV1C 3GZAA 1XNDA 2D98A 1VBC1 4YGCA 4K20A 3O0XA 3WUCA 3KGZA 1AYM2 5EZWA 3ZFEC 5IK7A 4OI0A 1IHMA 2VULA 3VHNA 5BNNA 2A7AA 4CYDA 2VW0A 4DFSA 1QJU1 1LTEA 4W65A 4HL0A 3WW2A 1AR83 4CDWB 4ES9A 3ZYJB 4X6RB 5JPMB 5DZFA 1XYOA 4OHXA 3GNEA 4P9XA 1CAUA 5FBZA 5BNOB 4M0HA 4E2GA 4W6YA 1VRH2 5AFBA 5EXOA 1RUC3 4GH4A 1FPN2 4Q0PA 1V6KA 1ZBA2 4K6BA 3JBG2 4AQSA 1M06G 4DQAA 2QUOA 3ZFGB 2RS32 4RR3A 1AL21 4UBHA 2O0OA 3QH7A 3TYJA 2BYVE 2A3WA 4RS5B 4WVVA 1CJDA 4I3PA 1N47A 2ZX3A 4L2NA 4AEJA 3AZYA 3HD8B 3S7IA 1QJU3 2VU9A 5C4WC 3LOIA 5HCBA 1Q3EA 4IXLA 2XPJA 1Q56A 3V0BB 1CGPA 4AEMA 1UIJA 4XZPA 4Y24A 1S0EA 3FX3A 1C5IA 2BFUL 1QDCA 4XFAA 2FBEA 5C9AC 2ET7A 5JZGB 4WVMA 3G7DA 4AW7A 2EA7A 1VBB1 2ZMLA 3WT3A 3L2HA 2DVGA 3O12A 4R9BA 3P3PA 3ENRA 3ZFEA 4Z92B 1R082 5KHIA 4M0NA 2GC0A 5GZDA 4N43A 1EYBA 1KS4A 4K7JA 4B4QA 2ZGMA 3ZIXA 3ILNA 1E57A 4S2HA 1CD3G 1YFYA 2BWAA 4QXKA 2ZX1A 1AR62 2ZKLA 2IFWA 5D8AB 2PELA 2GNTA 3E5XA 1BMV1 1IS4A 4GULA 1VBB3 1HQLA 1O3QA 3K48A 4IEYA 4XHXA 4LTAA 2QE3A 1K5MC 1ZBE2 1QDOA 3AZXA 1YJLA 1U5ZA 1H2NA 3CJIB 3QCWA 4UBGA 2XB6C 1DGRN 3H8UA 5KHJA 4LULA 5C4WA 4B7EA 3ILFA 1MEC1 1SDWA 4E9KA 4UW6A 1N1YA 1ZREA 2HWB1 3AMNA 4KG8A 2WSUA 3O7OA 1GQGA 1S0IA 2WS92 3HT2A 5EJ3A 3USSA 4EWDA 2ZJCA 1G86A 1WW7A 4Q29A 2ZGOA 3ZYRA 2CY6A 2GSYA 1MS1A 4PIXA 3WINE 5CG8A 4QHBA 3MIBA 4JGYB 3H7YA 2AREA 1LRHA 2ZTNA 5DDJ2 1SBFA 3LZZA 2QCSB 3O0VA 4XQDA 1W6NB 3PMEA 1MEC3 1H1MA 1CPMA 4PF5A 3E6BA 3VBUB 4YGBA 3ZN4A 2HWB3 4AI3A 1VBC2 4F83A 2WNUC 4Q4Y1 2ZX2A 5K9YA 5FREA 2Y38A 3ZMNA 2DVFA 4FPHA 4B4RA 1QJU2 2EXIA 4EWAA 1QXRA 4JGZB 4JCKA 4YGDA 1K5MA 3ZVXA 3BPZA 4META 5L7OB 3KT7A 3IT8A 2XBO1 4LA2A 4YW5A 1OLRA 4Y20B 2Z2SB 3B00A 2D7FA 4AI2A 4EN7B 2PAEA 2P17A 3ZX7A 2WLQA 3VDDC 4HFSA 4F3JA 3TBDA 4PLNA 5EYYA 4LHNA 4IEQA 3N7LA 1DGLA 1TNRA 2PAMA 1AL22 3B5LB 3ZMOA 2A6VA 2E51A 1NA1B 4QQHA 2XVLA 2KM2A 2VNRA 3WD5A 1RMU1 2PLV1 2QDNA 3RDIA 5CU1A 1NXMA 3RJRA 4FAHA 2A6XA 3MEPA 1SMVA 2Q1MA 3AP7A 2XL7A 1C1LA 2XBO3 3NV1A 2VOXA 1DQ6A 2MPFA 4UXAA 1A8DA 1RUG1 4KNCA 3D82A 5A3LA 1VBA1 1PNFA 4XQWA 2NQYA 4LLFA 1HXS2 2A71A 1WLCA 4KH9A 2OIIA 3N7KA 1RGSA 4OHYA 2ARBA 4Q2FA 1D0HA 1HRI1 1WGPA 2IZWA 1S2BA 1JTZX 3MFCA 1HLCA 1XE7A 4K1YA 4R9DA 4BPZA 4Y22B 3U07A 1LOEA 3NAPB 4L92A 1F2NA 1QH6A 1U5IA 1RMU3 2PLV3 3A0NA 1VAVA 3SCHA 3ZN6B 1VR3A 3VBRA 5LRRA 1RJ7A 3A0KA 3WQ0A 3VKLA 3H7JA 2VOKA 2CWSA 1MS4A 1PIV3 1RHI1 1RUG3 2Y26A 2WKKA 3VDDA 4COWA 4YZ4A 2MNGA 2GALA 2GMEA 1VBA3 5GKAC 1BMV2 1KFXL 2HWE2 3KB5A 2A6WA 4IEVA 5CIRA 2OYZA 2ES3A 4FXKB 4AEDB 5A32B 1LU2A 4LBLA 2ZZJA 2Y0OA 1AR91 3OD0A 5CAZA 1AZDA 2ZCWA 4KGGA 5FPXA 5FQ0A 4Q4W1 1MEC2 2VNGA 5ABJB 4QPIB 2ZX4A 3ZFFC 4LBMA 3V56A 1S55A 2HWB2 2ET1A 2ZHMA 5J48A 1YRZA 1RHI3 3VZNA 3OGJA 5FMOS 2QNKA 3FUQA 4MXWA 1LGCA 4K21A 1B09A 2RM21 4AF9A 1PK6B 2AGSA 3OF1A 2WWSA 4IQPA 2BVVA 3VBHC 2YZ4A 3ZN5A 5JOZA 4ISQA 2UY9A 1AR93 4HVOA 4Y1ZA 5CFDB 4YVSB 3VBOC 4YW1A 2VGDA 2A6ZA 4MGKE 2OUHA 1LGNA 3V64A 1LEDA 4E4SA 4FOWA 2LM3A 3N36A 4CDWA 5FTTC 3WNXA 4GKXA 4Q4Y2 1COV1 3AB0A 2XLGA 1EAH1 1IPKA 2R32A 1ZX5A 1FNZA 5D8AC 3ZSLA 1VLNA 1SCRA 1ND3B 4Z82A 1JUHA 2RM23 4L9BA 2HEYF 3ZFGA 4HSLA 5AVPA