3O1UA

Iron-catalyzed oxidation intermediates captured in a dna repair dioxygenase
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
202
structure length
202
Chain Sequence
EPLAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMSVAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLCQRAATAAGYPDFQPDACLINRYAPGAKLCLHQDKDEPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGIQPLKAGFHPLTIDCRYNLTFRQAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-ketoglutarate-dependent dioxygenase AlkB
publication title Iron-catalysed oxidation intermediates captured in a DNA repair dioxygenase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 50
structure length 202
sequence length 202
ec nomenclature ec 1.14.11.33: DNA oxidative demethylase.
pdb deposition date 2010-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 3o1uA00
4IDZA 3T3YA 4CXXA 3O1SA 3BTYA 3H8OA 4NPLA 3RZLA 3KHBA 3LFMA 4QKFA 4MG2A 4NRQA 4JHTA 4NJ4A 4QKNA 4IE7A 4O61A 4NPMA 3BTZA 4O7XA 2FDJA 3BU0A 4QKDA 3H8RA 3RZKA 3I49A 3O1VA 3O1OA 3RZHA 3I3QA 4QHOA 3S5AA 4ZHNA 4IE0A 4IE6A 3O1PA 2FDHA 3BTXA 3O1RA 4OCTA 4MGTA 2FD8A 3RZJA 4IE4A 3RZMA 4ZS3A 4NIGA 2FDIA 3I2OA 4NROA 2IUWA 3I3MA 4NIHA 2FDKA 4QKBA 4CXWA 3RZGA 4NIDA 4NIIA 4CXYA 3BUCA 4NRPA 3KHCA 3H8XA 4ZS2A 3BI3A 3BKZA 2FDGA 3O1UA 3S57A 5DABA 3T4HB 5F8PA 4RFRB 3O1TA 3O1MA 2FDFA 3BIEA 4NRMA 4IE5A 3T4VA
chains in the Genus database with same CATH superfamily
3FHIB 4XQ4A 5JMOA 5FXXA 1CVNA 3O1SA 3AL6A 2ZAHA 2J1AA 3VD7A 4Q4V1 1BYHA 1MEC2 4O65A 5C3RA 5JPMB 3MYXA 1BXHA 4BQYA 3SH3A 4BLIA 3TN93 4MADA 4NRQA 4K21A 2UURA 2WWSA 2VZTA 4C8DA 1RUC3 1PX4A 3ZN4A 1N1SA 1HRV1 1JZ3A 2EXKA 4H14A 4QU2A 4GWNA 5LASA 2WZEA 1PMJX 3H7YA 1W6MA 5IK5A 3MF6A 3U14A 3CMGA 2ADDA 1HB3A 2XLGA 2Z69A 4MH0E 4BOWA 1JXNA 1T6BX 2ZX1A 2QE3A 1KD7A 4CDXC 1YQCA 3OG2A 2QTWB 4CU6A 3O1VA 3WP5A 2FZ2A 2ZEZA 1N3QA 3WF3A 3ELNA 4JGZC 5JOYA 2CSGA 5A70A 1UX7A 2D5FA 1GZCA 4M3CA 1ULPA 3GF6A 2XR4A 1PNFA 2W1SA 4BZ4A 1W9WA 1YQ8A 3GM8A 5FY5A 4SBVA 5C6CA 1GSLA 2V73A 4Y1YA 1NYWA 4WM7A 5B2GB 1UXXX 3ACFA 4AZZA 5BV6A 1DQ2A 1OA3A 4I01A 1REDA 1PK6B 2VC9A 2WZPP 3UK9A 2PHLA 3CBNA 4FAGA 1AYN1 4PIXA 1UZ0A 3HNBM 4HK8A 2JDKA 2ZBJA 4XJ9A 2Q30A 4DPNA 3D0SA 3RJRA 3CNAA 4WZFA 1RUF1 3ZXFA 4RHV1 1RUJ3 2WINB 3VKNA 1MQTA 1EUUA 3AMQA 3LPFA 2G19A 3VDDA 2Q1FA 2WAOA 3BPSA 4AL9A 3I2OA 4BWOA 2GC3A 3FHQA 2X29A 4YW2A 5H9RA 3RYKA 2ETEA 4UAPA 3USUA 2BUKA 2NLRA 4AGVA 2VOXA 4W4ZA 2XKOA 4AQTA 4Y22A 5F37A 4M4RA 3D4KA 5F2WA 3TN91 5I8TA 4XIKA 2B5HA 4A7ZA 2PFWA 2A6YA 2ZGQA 4FPOB 5GKAC 4E2GA 1ULEA 1ZZCA 3HQXA 4CUGA 2Q1MA 4EYUA 3DV8A 2XH6A 4B29A 3MO4A 1J84A 1JYTA 4I3PA 3VBUB 3NMBA 3SC7X 1Q56A 5HCHA 4J6GA 2XUMA 4L99A 4FPYA 3C7OA 3E5UA 4CEWB 1E5IA 1HXS3 1LNSA 1ZBE2 2Y60A 3W9AA 4DNYA 4XF4A 1DZRA 3K48A 1HB4A 3GJAA 5DZFA 3A22A 3I4IA 1L7QA 1KS4A 3OGRA 4KWUA 1LCLA 1SHWB 1DZQA 1GP5A 2WFPA 3WQ0A 1ND2A 2DU0A 4J1XA 4UFKA 1HQLA 4EQVA 1O3RA 4XHBA 2D3SA 4ES9A 5CZKA 1AX0A 2Y6FA 2W39A 2MEV1 1LTEA 2P5BA 3VGIA 4BJ0A 1XRUA 3AKTA 5GZCA 1DQ5A 4YZ5A 4YYOA 3VHNA 4ASLA 4YFZA 5IK4A 5AVAA 2VMEA 4FPEA 4W6YA 1M4WA 5T3NA 3ZFGC 3HAGA 2RHPA 5GLTA 5DDJ1 2ZGNA 3E6BA 5BPXA 1O5UA 3LEIA 4Q1PA 4CPBD 3HJRA 3R0RA 3LFMA 1NA1B 3MIEA 2VR4A 2RM22 1DQ4A 1YO8A 2Y6LA 1VBA2 1WBFA 5DQ0A 1ZBA1 1TME2 2OIIA 3WF1A 1FMD1 2CAUA 4HOOA 1U5ZA 3OBZA 5BYNA 3LE0A 4LA3A 4AOCA 4AEDB 4XFCA 4TN7A 3WNOA 2R043 4A6SA 2B9UA 2D6LX 1TZOA 2WBKA 4O7XA 1TMF3 2ZX2A 4NUBA 4RGKA 2Q8DA 4QX1A 4HN1A 1ENRA 4GALA 3RJ2X 2C9KA 3O1OA 2KA3A 2VVFA 1OLQA 3SMHA 2JDZA 3CJXA 1BEV2 3MLKA 2V5DA 1D4M3 4PLNA 5C4WB 2PQQA 1ZRFA 1HXS1 3WQBA 3HD8B 2E51A 3N36A 1JZ8A 3Q8FA 1PIV1 4UT5A 4P5HA 2ZGRA 5EYYA 3WNPA 4QD2A 4IERA 5FYIA 4OCTA 2PLV3 4MGTA 3VLBB 1JTZX 1NT0A 1SCRA 1PGSA 1YUDA 2VMFA 3BN6A 3PVEA 4NHLA 4P9GA 1X7NA 1OOPA 2K2SA 1NY72 3AMPA 4JDMA 4Q0PA 4ZS3A 3VBRB 1XC6A 2C24A 4LA2A 2WA3A 1BMV2 3WQ7A 2BFUL 2JG8A 3W20A 1FATA 2PAKA 3WNXA 1REFA 4QXCA 4N43C 3PUQA 3ZFFB 2IUWA 4UFJA 1ZA7A 1TVGA 1MVEA 1S0GA 1K5JA 1OSGA 4XMAA 1LRHA 4XUNA 1QJY1 1LB2A 2Q5TA 3NW4A 5FZDA 1SCSA 2D97A 2UYBA 4WM8C 2XVLA 2FMYA 1RUG3 1DQ6A 4CDQA 5C3OA 4LBQB 2ZHKA 4B4QA 4AVBA 4OVEA 1SQ4A 3R4DB 2WN3A 1PO22 2ZGMA 1PZ9A 3CJIA 5CFCA 4LKEA 4UBGA 1Q8VA 4QT6A 2R041 1CQ9A 2XONA 1Y7BA 3H9AA 2V72A 3AYEA 2VMGA 3T09A 5CIRA 1XU1A 1O4YA 4IW3A 4NO4A 4NWVA 1US3A 3HT2A 1LJ7A 4RR3C 2HWF3 5DAWA 3SH4A 4TTGA 1XU2A 1ND3C 4HLTA 4CDWC 4IGOA 4AVAA 1ZZ6A 1AR71 1AL23 3HR9A 2XDVA 2YC0A 2IXCA 5A3UA 1OFNA 1V6NA 4D8MA 1G9AA 1Z0HA 4XTMA 1D4M1 3NNMA 3K4AA 1CJPA 1HDKA 4D69A 2SBAA 3MFAA 1SDDB 5FR3A 4KWJA 4EE2A 1YYNA 3OGGA 1LECA 4FPHA 1F4AA 1DHKB 1I5PA 2HWE2 3MBWA 3PU8A 3J8F3 1F8VA 4UFHA 4OI4A 3VBFC 4LKFA 3EXUA 1C1LA 1AYM1 2TEPA 2ZKLA 2XB6C 2HKXA 3EHKA 3N9PA 4NHYA 4XABA 5G04L 3VKLA 3HN3A 2RS33 4HSJA 1VRH3 3MIDA 4GWIA 3PVNA 4Y4RA 4PCRA 1UW8A 5CFDA 2PHUA 3AP7A 3LIHA 4CEYB 3RS6A 3FUOA 1CZTA 4JGYB 3MIFA 4M3CF 3WCRA 1W3VA 1JHNA 3NO8A 3WZ1A 1G8WA 5BNOB 2RJ2A 3KMHA 5GZGA 1LOAA 4QHZA 4EWEA 5J96B 1H8TA 2K0GA 1F15A 2PTMA 2YXSA 5A6QA 2EAKA 2Q4SA 2W87A 4AK3A 4FFGA 1QKQA 3N7KA 4FVVA 4QXBA 1GZ9A 4V1PA 4COVA 4WVVA 3QOPA 2RDNA 1QXRA 4LBNA 2JIJA 1UU4A 1NAEA 3A4UA 2LROA 3SKVA 3URFA 1CZVA 3OPWA 5CG8A 5FP3A 4B7EA 3FC0A 4QB6A 2XL7A 3LDRA 3ZDVA 2EF6A 2JG9C 1FAYA 3WDWA 1URXA 3GJBA 3I59B 2HWF1 5FZOB 5KXBA 4PDWA 2BP6A 2HBTA 3RMXA 5FLHA 2XJSA 2IVJA 4IE0A 1AL21 3T2OA 1WLDA 4QX0A 3KWVA 5JVVA 3UJOA 4LR4A 1EUTA 3IDCB 3WDVA 2IVIB 1HQWA 1RUE1 2PELA 4FPKA 1WWYA 5LB6A 1V0AA 2W3JA 5A32B 1UYZA 1K3IA 5IUQA 1T6GC 1ZA4A 2G4IA 2YYOA 3IDBB 3K2OA 3J8F1 4AE2A 2GNTA 4Y5Z0 2CU5A 1POV1 1UF2C 3CO2A 3EQEA 3WNKA 3ZN6A 4BH9A 5K8SA 3ATGA 3GGLA 3DEMA 4JQTA 5CKMA 2VCMA 3ROUA 3I3MA 2Y6GA 1R1A2 1YCIA 4M4PA 1UZVA 2BWCA 4KI5M 1OKQA 2ADEA 2JE7A 5IVJA 4Y20B 1UZZA 3LPGA 3VZNA 5FMDA 3B02A 2BU9A 2DBIA 1LHOA 1WUVA 2D6PA 1OUXA 2P6HA 4N53A 4YGEA 1S2EA 1B35C 1NOVA 1DQ1A 3AC0A 4GD4A 4RFT0 4QPIB 3WDXA 4K1ZA 4JKKA 1RUJ2 4KBZA 5IAVA 1GQPA 2VCBA 4NRPA 3ZLIA 3KVAA 1RMU3 4IV1A 2PAMA 1JZ2A 5JZGC 2I45A 3QBQA 2XPJA 5B4NA 1LR5A 2VCAA 2KR2A 5FFOC 1NCQB 5FRAA 5GLUA 5I0RA 4CP1A 5JIAA 4X6RB 4CEWC 1YI9A 2R32A 3WEZA 4IEQA 1AR61 5A7SA 1C57A 4QPGC 3OBRA 3BKZA 1SFYA 1CONA 3OUHA 3K51A 1OBNA 5F39A 4LMFA 5KR7A 1KITA 1YQ2A 2H0BA 1NCRC 3M8LA 4ATFA 1XQNA 1KGYA 1SLCA 5IVYA 3O1MA 2X09A 2W91A 3TBDA 5A3NA 1JMUB 2ZCWA 5LZ6A 2R30A 1VBD2 2OPKA 1QGLA 4LOTA 1VB4A 1IS5A 4RN5A 1RB8G 4QDSA 2VE1A 5H9QA 3VBSB 1CWPA 1O4ZA 1BLZA 2ZGSA 2GU9A 1JYCA 1O6UA 2Q0AA 2VZUA 2Z2SB 3OYWB 4MGQA 4ATEA 4DY3A 4ZKTB 4RS5C 5C7GA 2ZGKA 1VR3A 4Q29A 4XF9A 3POWA 5F1RA 4FFFA 1UMZA 1QOTA 2WS93 1UY0A 2X5IC 4L8QA 2AGSA 1AXYA 4OZXA 1OXCA 1E5RA 4D7TA 4YW3A 1V00A 4LBOA 4O61A 2AACA 3AL5A 3KS7A 2WUHA 5FZAA 2E26A 5C71A 2QQUA 5FJHA 2VUJA 1GZWA 2YY1A 4LKSA 1WGPA 2A6VA 3KQ4B 4BMBA 3RYRA 1VMJA 4WVWA 3NJXA 4X8NA 1WCSA 3NVCA 1NXD1 4MGSA 5ABJC 5IT6A 5FOBB 4CRQA 5G05L 4NPRA 1QJU3 3VKMA 1WLWA 1ZREA 4I0AA 2YFUA 3ZSLA 2ATFA 4QX2A 1RMU1 4AG4A 4EWDA 2XJRA 2MHFA 4AXOA 4F7ZA 2YGLA 2W46A 2H6CA 1F35A 4AFAA 2WR9A 1IS3A 1H2LA 5D8AC 3ENRA 2QKDA 5T52A 2WNVC 2PXJA 4FTEA 2QVSB 3IPVB 1LHVA 4YZ2A 3MPPG 4W8JA 3M70A 1TMF2 3POJA 3ZPYA 2YUEA 4CDXB 2GMMA 3RZMA 1COV3 4YVSC 4AFCA 2BVBA 3IMMA 3ZSMA 3ZYPA 5FMOL 1S55A 2E32A 1BVP1 2GP3A 2Y0OA 4BMEA 1W2AX 1UU6A 2GH2A 4C0HA 4NAOA 5KC6A 2YHJA 3GCWA 1PK6A 4L9BA 1K45A 3UGFA 4QKBA 4KU8A 2PHRA 5A3TA 1MEC1 1RHI1 1S0BA 4FP2A 4BQ1A 3RWKX 4UW6A 1XXNA 4DEQA 3IAQA 4D6SA 3BALA 3W5MA 2PLV2 1YFYA 4ZZ8A 1QY4A 2Q8EA 5L9VA 4OUEA 1AJOA 1VAVA 2VZPA 1FPN2 2XHNA 3A0NA 5C3QA 5J09A 4NIDA 2FQPA 4JQRA 4P9LA 1WA6X 4YW5A 5JAXA 1VAKA 4G3YC 3C3VA 1RUH1 4IV3A 4R9DA 3FX3A 1M06G 1SLBA 3AJYA 1W3XA 3KT7A 3POIA 3IIAA 3I7DA 4MVTA 4PI2A 1VAMA 3KM5A 5HXVA 4FTSA 1W8WA 3T08A 4WVMB 2XHKA 3OTFA 4QX8A 4GMP3 5GM0A 3B5LB 4FXGB 3ZXEA 3SCHA 3LSDA 2BNOA 1W9FA 1ZBE3 5FZCA 1RUD3 4YM0A 2QZ3A 4JDNA 3AJZA 4YG0A 5FYCA 1IPKA 1EY2A 1RUI3 5K4LA 2G9GA 3O14A 1NG0A 2PA7A 4KGQA 1QXPA 1RUG2 5FZEA 2FDGA 2VW2A 2DVGA 1UMIA 4N8MA 3AP9A 4Q5OA 1GOFA 4YG3A 1YFWA 3WW4A 3GYDA 3GCXA 1MZFA 5F8PA 4I09A 5M0TA 4XE9A 3VBHA 4GKXA 4QAWA 3U4SA 4AGGA 1NE6A 2Y6JA 2DFCA 2W0XA 3HPNA 4LLOA 2J22A 2YC4A 1CIWA 1LULA 1MS9A 1H1IA 2IXLA 2VVDA 2ZMNA 4IDZA 4E2SA 4KBBA 1EYBA 3PIGA 1VJ2A 1V9U3 3KLSA 3TEYA 3KF5A 3U75A 1XSQA 1UPSA 2GMEA 2R0FA 4NMIA 2BBVA 3JQWA 1AX1A 2DFBA 2JD9A 1CIYA 4Q0QA 3VDAA 3WNLA 4LHNA 2WNUA 4JAAA 5FIXA 4JHTA 1XYOA 2DCTA 5DG1A 1TME3 1FXZA 3HT1A 5HCFA 1RC6A 5LBEA 2VNGA 3H1WA 2LS6A 3ZKUA 4LT5A 2G9ZA 4YW1A 4HKOA 1IG0A 2QQIA 5A7NA 3L2YA 5A7PA 2P17A 2XJPA 3TRSB 4RD7A 1UU5A 1PHMA 4R4XA 3ZFGB 5F5IA 1HV0A 3VZLA 5LA1A 5ACA3 3H8RA 3RZKA 3NRUA 2ARAA 2OUJA 1IOAA 2RS32 4UFLA 1VRH2 1O4TA 2RDRA 5I0TA 3NAPA 4YGCA 5AC93 4W65A 5FP9A 5GZEA 4KNCA 4FPJA 4IQPA 3THTA 4CDUA 1OMIA 1BEV3 4GMP1 2PHWA 4AHXA 2W9XA 1ZBE1 5HXMA 4IEVA 2FMDA 3WG2A 5CKNA 4IE6A 4ES8A 4CCMA 4S2FA 5L9BA 1V6KA 2FDHA 2VNOA 3R4SA 4IEXA 3BTXA 1TNRA 4FQZA 4CU9A 4A44A 3NNJA 4CCNA 4AW7A 4CCLA 1HN1A 1OT5A 4QQLA 4IE4A 4FO9A 1GU3A 4AAPA 2CGNA 1SZBA 4XCBA 5C4WA 5K0UC 1OA2A 5F3CA 3HBKA 5JI9A 1C8M3 2L9LA 3J7MA 4QGNA 3FHAA 2R072 2WLQA 2BGCA 1AZDA 1BBT2 2HWB1 5JOXA 4HZFA 2YB7A 1CN1A 1H30A 2EALA 2FDKA 3H50A 1SFPA 4X8PA 4Y1UA 4CP9B 3VBRA 3VHOA 2WZR1 3FFZA 1LU1A 3N9QA 2JENA 3POFA 5KC5A 2VY0A 3ON7A 2RM21 1W6OB 1VBA1 3HVDA 5LK5A 1GBGA 1NZIA 3AP4A 1PO23 5A1LA 2WT2A 2PN5A 5FXWA 2ID4A 3B69A 4L2NA 5FZHA 1REEA 1ZRDA 4N43B 2FBEA 3WR0A 1SLAA 4C1WA 2HEWF 2GC0A 4P02B 2VMCA 1LEDA 4LBQA 3QCWA 3AZWA 5FUNA 4WM8B 5T50A 3C7FA 3AXEA 1QJEA 2W1WA 1L7LA 1LKNA 3NSTA 4CSWA 2OT7A 1BEV1 1MQTC 3K4ZA 5IWFA 3SCGA 2DYCA 1VBE1 3POSA 5D21A 5FPXA 3O1UA 4HVRA 3O1TA 2ARXA 2Y34A 4LHLA 4Q4X3 1IPSA 2Y0IA 2HWE3 3T0AA 3ILNA 1W0NA 2GNMA 1YEWA 3LEKA 4XDQA 5FYZA 4XMIA 1X36A 3AKQA 3WP4A 4RR3B 1ACCA 2GSYA 5FPLA 1W03A 1ND3B 2XKPA 1NY71 4LUMA 2ZTNA 1BMV1 4HANA 2VU9A 1KXGA 2UWBA 3KCYA 3D0JA 3RZLA 4QHBA 5FY1A 5JXGA 2Y38A 1WA4A 4PF1A 1QQP1 1W39A 1JHJA 5JMCA 4BXFA 2Y64A 2YBKA 2VZOA 2WO3A 5ISLA 3J7HA 4QKNA 3RQ0A 1V6LA 3VBFB 1YC61 2Y33A 3ZXJA 2QNKA 4GH4A 4YNIA 5FTTC 5FPVA 5IAXA 2VULA 1UIKA 2ZA9A 3B94A 3KV4A 2C9AA 5IVCA 1STMA 3AFGA 5EPAA 4OHZA 4CEYA 3I49A 1ND2C 1BK0A 4FOWA 1UZWA 4H7LA 2A70A 4LBKA 4LIUA 5LY2A 3AXDA 1RVF3 2GC2A 1POV0 3SHRA 2WQ8A 3BPZA 5AVPA 1OVPA 3E5QA 2Q1ZB 3N7JA 5T55A 1ODMA 1C8NA 1S0FA 5C9AC 3RWNA 4WZCA 1IPJA 2QQOA 3PNAA 1AR83 1H2NA 1QHDA 4Q0SA 2WS92 3AP5A 1SLTA 3J7NA 2OZ6A 4GA9A 5JSOA 5F2SA 1MS0A 2F17A 2QBXA 3FLPA 1W9TA 1Z7S2 2CYFA 1W8FA 1DGLA 1PVC3 2EXHA 3VL8A 4E27A 5FY7A 4K40A 4A3ZA 3CIHA 4MV2A 1O59A 5A7OA 4B7KA 2XQRA 3LF7A 2JB4A 4XETA 1UO9A 2D5HA 1SACA 5FZOA 4OLLA 1QIQA 2C26A 4X6QB 4B4RA 1VBB3 1QJU2 2XUEA 2JG9B 2V4AA 4XUQA 2CWMA 3N9NA 5IJRA 2ZX3A 1W0PA 1WCQA 1LOFC 4BE3A 2Q8OA 3H8UA 4OHWA 3BOPA 3RZZA 3WDUA 4FPGA 4LO6B 2CDPA 3JCIA 3ETQA 1R1A3 2LRPA 1GV9A 3RYPA 4A3XA 5IK7A 2JDMA 4LULA 2ZX4A 3UNPA 1IGOA 3RZGA 1EAH2 3AKPA 3H3LA 2ET7A 3HMYA 4Y5TA 1COV2 4CP2A 2AZ5A 3LAGA 3Q8AA 4TWTA 2WC2A 3FWEA 3UESA 3M3EA 1CZSA 2A3WA 1CGPA 3O12A 1C5HA 3IIIA 1IKQA 1UZYA 4RL7A 2RJLA 2HWC1 4Y20A 3SEPA 1ENSA 2XOMA 4DUXA 1YRZA 4DXZA 3JD73 4AAXA 4DMIA 3S0MA 3MUY1 4QXHA 1FT9A 2GALA 5A80A 1J3QA 3AZYA 3ZXLA 4WVZA 3S5QA 2XLAA 2JG8C 3LSEA 1U5XA 5F7UA 1CPMA 1JN2P 3ORJA 1B35B 2XBO2 1ENXA 2F4PA 2XJQA 1JYVA 1RUC1 4XXAA 4LE4A 1ODNA 1CAVB 3LCPA 3CHXA 4Z2WA 1W28A 1SPPB 1ZRCA 2P3KA 4PQ9A 4XBQA 1LOGA 1W6QB 2VUDA 5A7QA 5FZ3A 3S30A 4CDQC 5JZGB 2A3XA 3MV11 1AR93 5KHIA 1VBD3 4ASKA 3RRDA 3SKJE 2A6ZA 2HWD2 2DWRA 2WRAA 3IBMA 4XUOA 1RUD2 1YXWA 1W05A 1S0DA 4IETA 4ZU5A 2DCJA 4QPGB 3ECQA 1RUI2 3MPBA 1GP4A 1DU3D 3J9SA 2R16A 5F5QA 3LIGA 4HL0A 3E1F1 2VZ3A 1WW7A 2B7YA 1R1A1 1NCRB 2E31A 3PTRB 5C8CA 1F31A 2DVFA 3N9OA 3OGSA 4MHRA 2Y8KA 4PIZA 1ASJ2 5JWPA 5KHJA 4K1YA 2DTYA 3SEEA 3VBSA 2OQ6A 4LKDA 2ZZJA 2YMZA 5FV3A 5HCBA 3G6JB 4MHUA 4Z1VA 3DKQA 3THPA 4CU7A 1V9U2 2LUWA 4GWJA 5GZFA 1RUJ1 3F95A 3LQCA 3H1MA 3VZOA 2RDQA 1AX2A 3MW4A 4RS5B 4COYA 1ZZ9A 1BZWA 3MGUA 3H42B 4HFSA 4JX0A 1BJQA 2X5IB 1DQ0A 5FZLA 4ZZ5A 3VBOC 1PGW1 1H2KA 4TZDA 2DBNA 4HXCA 3JZVA 3MHZA 5C70A 1LENA 1PZ8A 1NLQA 4L97A 4Y1XA 3M2MA 5KXCA 4BM8A 1XE0A 3RZJA 3N9MA 3E97A 1OF3A 2JDYA 3HOBA 5ABJB 3HEIA 4LO4B 4LNVA 1VB2A 3GBWA 3HN1A 5CYYA 5DN2A 4K6BA 5ACA2 5AC92 3FLRA 3CL1A 3AVRA 2VUCA 4M0NA 1H8TC 4ZPIA 5FZMA 5T5LA 5AFBA 2OKXA 3WXPA 5EJZB 2OUHA 3A0KA 3UKNA 3FE5A 3ZFEC 3LD8A 1GNYA 3IPVA 1Q43A 5DPNA 1XOYA 3B9CA 4MSVA 5D8AB 4CDXA 4O9EA 4YM2A 3THCA 4DFSA 2WNVB 1PGL2 5FPUA 2GNDA 1S1AA 1JOBA 1Z78A 2RJKA 3IB3A 4TLGA 5FYUA 4JGZA 4G4FA 1WZXA 3TYJA 4YVSB 4KWLA 1Q8OA 2F6BA 3VZJA 1FPN3 4K7JA 4Y33A 1EPZA 1IG3A 4OMCA 3MIHA 3MZHA 3PVOA 3ZXAC 4XJUA 4YM3A 1Y9QA 3O0XA 5LRSA 4E9KA 1JOPA 4AGRA 4CCOA 1C8M2 2JDAA 3RNSA 4NR1A 4IEUA 1IQAA 4B1LA 4ZS2A 5L7OA 4Q8KA 2VBPA 2YPDA 1PO12 1V6MA 3OEAA 4DB5A 5DZGA 3R6SA 1W2NA 3ZXDA 3AZZA 3MIGA 1W8HA 4DOUA 1HJFA 3WV6A 1DIWA 3T1MA 2GNBA 2CV6A 3KV5A 4RFRB 3CLPA 4O9GA 4WVMA 4R8HA 4GQ7A 3QACA 4C1XA 4RGAA 4LBJA 3ZYGA 2BBAA 3FL7A 1MZ6A 4IL7A 1DGWA 4XPVA 5JOZA 1LU2A 3VZMA 1GQHA 1TMF1 4QQOA 4N53C 1DLCA 3DL3A 3RVHA 4QX7A 3EB7A 1J59A 4W6WA 2A6XA 2JB8A 2WWUA 2JKBA 3T0DA 1GKBA 4GMP0 5I93A 1EV12 1HB2A 3Q8CA 2EIGA 4IESA 5FLIA 4E4DX 4Q0UA 3MI8A 1RTVA 4C0BA 2W68A 2WIIB 3NKTA 4XACA 5KHHA 1PNGA 1Q8QA 2D6MA 3D8CA 4Q4X2 1UAIA 3ZYIB 1JZ7A 2FCUA 5JSPA 4F3JA 4BB3A 5FYSA 4QXKA 4A41A 2HYKA 2PLV1 3S6PA 3BU0A 4CPBA 4OQ8A 2JICA 1QXJA 3RFRA 5JLVA 1UY4A 4EN7B 2E6VA 1S2BA 5A7WA 3IT8A 3WF2A 1HRV2 1HJGA 4FOYA 5LBCA 3OPZA 2C4XA 2R6QA 5KHKA 4NE9A 4AFBA 2V5YA 4QHOA 4GXLA 2RDSA 4Y24A 3OD4A 3ZFGA 2BDRA 2VXJA 4LORA 3AVSA 1C5IA 3A23A 3ZMOA 3O1RA 5FZ9A 1D4VB 2VOWA 1MS3A 4CCKA 1CAUA 1RUG1 1W04A 1YI7A 3I97A 3NV2A 3U07A 1DG6A 4XAAA 5FZKA 3Q8EA 3UV9A 1H9PA 1LAJA 3VD9A 5L19A 4BISA 4NIGA 1XPWA 2ZABA 3WT3A 2JDNA 1A34A 3T30A 4CUAA 3DYPA 3ZIWA 2A5ZA 1RVF2 3FBMA 2RG4A 3IN9A 3W5NA 3WW2A 5IW0A 2PHTA 2WYSA 1WD3A 3P6BA 5FZ1A 2R073 2BOIA 3Q9OA 4INDA 1AR82 1BBT3 4AFDA 2VNVA 3WUCA 1A3KA 1AYN2 1IHMA 2RS53 3MDPA 4UFMA 1YQ6A 3NNGA 2D6KA 1C28A 1FV2A 1ZYBA 4RHV2 2J1SA 1PVC2 2A3YA 3M3OA 3ALQA 3B7MA 1UWWA 2NQYA 5K0UB 4URAA 4Q4Y3 4YVWA 2ZX0A 3WG4A 2HJIA 3M4FA 2ZGLA 4XFIA 5SV5A 4FFHA 1LEMA 3OY8B 1KDMA 1VBB2 1NZCA 2QCSB 4PBPA 5FYMA 2VNRA 2WFF3 2Z5WA 3WP6A 4QQ2A 1UOFA 2W2IA 3H7JA 1UX6A 4KL1A 4B4PA 3H8XA 3WG1A 5F9TA 1W6OA 4MXWA 5ANQA 2RS31 3AZXA 1WCDJ 1VRH1 5CBLA 2VAUA 1Q8SA 1K5MC 3QD6A 4YSFA 3C8XA 4LEJA 4RQPC 2BVVA 5FQ0B 2AH2A 3W58A 4AHZA 5FZFA 3PMEA 1CESA 3O0WA 4YZ1A 1CX1A 4OI0A 1LGCA 1X9TA 2IXJA 4B1MA 2XWJB 1C1FA 2AENA 1VLNA 4OHXA 4COUA 4KG0A 4LIVA 1UOGA 5FK8A 3ZPOA 3ACLA 2O8QA 4YZ4A 4IGPA 5C3SA 3OPTA 3KSCA 5CEHA 4R9AA 4WM8A 4CCCA 3K77A 4S2HA 2D93A 2D6NA 3FBYA 4IEPA 5A3MA 3BU7A 3BTYA 3JD72 3H8OA 1GYKA 2DF7A 2I07B 5FUPA 4P9JA 4PQQA 1MQTB 5H9PA 4DIQA 1SDWA 4G9SB 3I3BA 4Q26A 4AEKA 1KFUL 1DFQA 2R071 1VE0A 1O7FA 1BBT1 2MEV2 1WMFA 2RMU3 3DPRC 4HPKB 3D82A 4NJ4A 1UY2A 2HH9A 4RR3A 3USUB 5C3PA 5KXEA 3DUIA 2YBSA 1ND3A 3EMRA 4CDWA 2GP5A 3BTZA 1SEFA 1L7RA 5FLJA 2IXHA 5T54A 3K4DA 4ZXKA 2Z79A 4LUKA 4EV0A 1W6NB 1H1MA 4AEMA 3VDBA 1JH5A 1AR92 1RIRA 1SBDA 3B01A 4BU2A 1WBLA 1FMD2 1CAXB 5FZIA 1KRIA 2LALA 3VBFA 4M00A 4EWAA 1BVVA 4GJZA 2TNFA 3D5OA 1HRI3 1SLLA 5BNNC 2VZRA 2XVKA 1I6XA 3N35A 5E16A 1R093 4ZHNA 4CP0A 2YDEA 1QH6A 2DUQA 3O1PA 4K3UA 5BXXA 4I0BA 1IQDC 2A71A 3J4UH 3PL0A 1Z7S3 3SITA 5I0DA 2VUAA 3H0OA 4R4ZA 4RSUA 3WX5A 4DRRA 4C91A 1ND2B 1UCXA 5J98B 2BEOA 1X9PA 1DCSA 2W1UA 5E88A 4A42A 2VL4A 1KS5A 4W50A 4E4SA 4LITA 2EXJA 5FY0A 5FKCA 4CVUA 1AXKA 1CD3G 2BWAA 5C9AB 2E7QA 4HVOA 4NROA 3JB4C 2BZDA 3WNMA 2IFWA 4NIHA 3DGTA 2C1FA 1W2OA 1YQ5A 2P6CA 3B93A 1QEXA 4BK5A 1AXZA 2I74A 1J3PA 3KCCA 2R1BA 1XYNA 3NAPC 4NOTA 4D94A 2UWCA 4XJZA 1X50A 3OB8A 5JR7B 3ZDSA 2D6OX 3H1YA 3O5SA 4RGGA 1VBC2 5AFEA 5IVEA 4YFWA 4CDUC 4MGYE 2D43A 2JG9A 4BQ2A 3SQOA 3JBG2 1EAH3 2VTXJ 5JXJA 1RYYA 1WW6A 1HB1A 1JZ6A 1Q3EA 5HPOA 2X53S 1QJY2 1WMXA 5DAQA 4C90A 2AUYA 3KHCA 1OQDA 1PM7A 4CA9A 5CADA 3L9JT 1OKOA 5CVRA 5LRRA 5FXZA 3ETPA 4LBLA 4XQWA 4H7MA 1ZZ7A 1R083 5KHGA 4BYYA 1MVQA 4UYBA 1WW4A 5DAVA 4CCJA 3EBRA 3JUUA 5IFPA 2YV8A 2YROA 4LHKA 4TSVA 4E8DA 4NHMA 2WS91 1RXGA 2XBO3 4ISRA 1OC1A 5E6HA 1SG3A 1XNDA 3ZYBA 4P00B 2RV9A 1Z7S1 1U5YA 5DUWA 5FO9B 3ZN5A 2ES3A 3APBA 1A8MA 3T4VA 2JD4A 4CXXA 4DXSA 3KV6A 1B35A 5I8YA 3WDYA 5BNPC 4RA0A 3HBZA 4AHWA 1QOSA 2HWD3 4AQ2A 4FQ4A 1QJU1 2GDFA 2JG8B 2ZPXA 4QKFA 1CAVA 1QJX3 3LEGA 4HSLA 2R062 4PT6A 1DLLA 3KV9A 1KQRA 3BYWA 3OBAA 4DRVA 1W6QA 3VBUA 5JZGA 1NKGA 2RR13 2QDNA 1GNHA 3ZYFA 4Y26A 2H6BA 2ZJCA 3KCXA 3GBGA 4GWMA 1ASJ3 2YBPA 1GFF2 4CEWA 5LW9A 2ZHLA 4CTEA 3LGRA 4HVQA 4CDQB 3ACGA 1OLME 1EAH1 2GH8A 3RI9A 5IYYA 2NP0A 1OQEA 4LO8A 4XDOA 1COV1 2VQ0A 4R9BA 1MACA 1PVXA 4XOGA 5I91A 2X10A 3WD5A 1NCRA 3H3ZA 3I54A 3SH5A 3HIFA 3ZSKA 4XIOA 3RZHA 3VD5A 1MS1A 4JDOA 4LOSA 1CR7A 5CAZA 5EIYB 4YM1A 1VIWB 3TEXA 2A7AA 3LDKA 1QDOA 1O3TA 3NL1A 5EQUA 2QQLA 5FY9A 2BGOA 2XG3A 3DYOA 1R1ZA 5GLVA 4XJWA 5I0UA 1WLTA 4XF3A 3WF4A 1FX5A 5C5UA 3MICA 5FZGA 3GBFA 3L2HA 2WSUA 1BK1A 2BV4A 5HBAA 2DUOA 2GZWA 2XBO1 3N9LA 4OYUA 2X5IA 3PTYA 4H3WA 4MOAA 3C7HA 1NA1A 3JU9A 2WT1A 1HN0A 1ULOA 4Z2AA 1OUSA 2YC2A 3LEMA 1GWKA 3T2PA 4A6OA 1OH3A 1ZVFA 1ZZBA 2WL1A 2CGPA 3EYPA 4GH4C 3RGBA 5JSRA 4BQ5A 4F8AA 2WWJA 2Z4FA 4Q1RA 3VBOB 4AEDA 3CU7A 2VPVA 3GALA 4EJRA 4OULA 2VW0A 2NMOA 3ILRA 1POQA 3M1HA 2QUOA 3EJKA 2ORXA 4XF0A 4OFGA 3LB9A 2W47A 4MLOA 1G9CA 1RUD1 3OJBA 1N1VA 3UGHA 5FYTA 4HK9A 3S7EA 1RUI1 3ZKYA 2DUPA 5EJ3A 1JYNA 3MLLA 4EN6B 1ULGA 2FCTA 3QH6A 5CKQA 3CDZB 4JHZA 1H8TB 1J58A 1ASJ1 3BTAA 5CB7A 1UYPA 5D8AA 2JX9A 2O8OA 3S7IA 2WNVA 3J7LA 3U1XA 5FO8B 3D6EA 3LFIA 3ZFEB 5FWJA 2DV9A 2LM3A 1JYIA 2I2SA 2DCYA 2NYYA 2NM1A 3PMSA 5C33A 4XZUG 5JPNB 1U0AA 3I2GA 4S2GA 4YVSA 1V9U1 3VV1A 1PO13 2RS52 5IFTA 3V0BB 1VRBA 1E5HA 1ST8A 3MIBA 3BI3A 2R7EB 5DUUA 2B45X 5JXIA 1D2QA 4XFHA 3VD4A 5DABA 2XLFA 1GUIA 1X8MA 1DGRN 1W8NA 4ISQA 1RUOA 4Q4Y2 1TG7A 1JI6A 1TME1 3O7OA 1KFXL 3ZFFA 2MPFA 2JDPA 1PMHX 2MNGA 4D7SA 2BTVC 3C7EA 3ES4A 5F5CA 4WM7C 2WFF2 2A75A 1AR62 4AVVA 1V6IA 1W0OA 1VMHA 2GN7A 4LPLA 4ZY9A 4BIFA 3DN7A 3PJQA 5ACA1 5HI0A 5AC91 4XJ8A 3VDCA 3ZN6B 3DXUA 4EZ4A 5SV8A 4AI3A 4MG2A 2IC1A 4OI2A 3JQXA 4HG6B 3T2QA 3WG3A 5HCAA 3TEZA 3UT0A 2D3RA 2UYAA 3VDDC 2VJXA 1EV13 2ZAAA 1F9KA 3WLUA 4IE7A 4BQWA 5FP8A 5FZ7A 5GZDA 4IXLA 5EJ1B 4I30A 2QQMA 4XFGA 2YU2A 4Z82A 4NHXA 5K7PA 1PGL1 5FP7A 3Q8BA 3U78A 5A33B 4H55A 3PU3A 4Y1ZA 4QKDA 4Q4V3 2QQJA 2EIDA 3I2JA 3POYA 4N53B 4AF9A 4HBNA 4JZRA 5FKBA 3CF6E 4CUBA 1QJZA 4OMDA 1TQ5A 4CYDA 4QDRA 1GWLA 2E33A 1HRV3 1C8M1 2ZGOA 4XVHA 4XZPA 4XXPA 3WINE 4PLMA 5IVFA 1R64A 2RMU2 3MV01 1I1EA 2G1MA 4L11A 3FZ3A 3WSOA 2VZVA 4CE8A 3V0AB 4OUSA 2R0HA 3ITQA 1HLCA 4XUPA 4Q4W2 4QWNA 5FAXA 2ZXQA 3DF0A 3AYDA 2ARBA 2R1DA 3OEBA 1J1TA 4YPJA 5E89A 1W99A 5FY4A 2J1VA 4EN0A 1H0BA 4HKLA 1PO21 1F2NA 3ZYRA 1GWMA 3THDA 1QU0A 4JGYA 5DG2A 3USSA 5C8CC 5FZ4A 4JKLA 2J1RA 1OF4A 5BNOA 1FNYA 2ZOEB 3KGZA 1HRI2 4LTAA 3I8TA 2A6WA 4MX3A 1R092 1TEIA 5KBFA 3K75B 1D2SA 2QQNA 3DYMA 1I3HA 4JTNA 1AYN3 4K8RB 1YFUA 4NHKA 5A3WA 5IHRA 1QH7A 4LK6A 1LHNA 5ANNA 5EFUA 1KEXA 1NLSA 1JYXA 1RUF3 5I0SA 2EA7A 4RHV3 1EV11 3NNLA 4PI0A 4K9SA 2Y6KA 3BODA 3R05A 4Q27A 3SXWA 4AVCA 4Q0VA 3I59A 4Q4X1 1LOCA 5GLWA 4UXAA 2HWE1 5F3GA 1JYWA 1ZNPA 4BQXA 2PHDA 1GZWB 1RHI2 1SBFA 3K3NA 1K12A 1S0EA 2CGOA 1VPHA 4GZ9A 3C7GA 3ZM8A 1OLMA 4QB2A 3TNPB 5K0UA 2TBVA 2PAEA 2VZSA 3VHRA 3T0BA 2ZEWA 2HEVF 5A32A 3GDBA 1WMEA 4TXWA 2PMWB 3CKHA 3WQ1A 3ASIA 2ZEYA 3GZAA 4HONA 4LK7A 4YW4A 3VB9A 1MS5A 1RUH2 2KM2A 3OY8A 2CWSA 1HV1A 3T4HB 4ZU7A 3LA7A 1E5SA 4AQSA 1BHGA 1UNBA 4FP3A 2WO2A 4OHYA 4PLOA 3NJYA 1IS6A 2J1TA 2JKXA 4I3GA 3ZYHA 2HEYF 4FOQA 3I2DA 1QWRA 2E9QA 4LLFA 5FQ0A 4ASMB 2D44A 3WW3A 1HX6A 2J42A 1H9WA 3FMGA 1K5MB 3OD0A 1Q8PA 4RQPB 5KXDA 4E4ZA 4EN8B 1OOPC 1RVF1 1R082 4A4AA 4FSJA 4ORFA 5F6KA 1F4HA 5BUVA 4QPIA 1XNTA 2GMPA 2WLPA 1SBEA 1OA4A 3N3HA 3GZEA 4V2WA 1F5JA 1AR81 2ILMA 2MEV3 3AKRA 1FOD2 2ZHMA 2P1BA 4AHYA 5L7OC 2WO1A 1JS9A 4NPMA 1LHUA 1SLIA 5J1XA 2EIEA 4GJYA 1LOBA 3NV1A 2YZ4A 1PVC1 5DDJ3 4XCAA 3SLIA 1NCQA 4KH9A 3VZKA 4EZHA 2YFZA 1OFSA 5BY5A 1AVBA 2IFRA 2W95A 3GHNA 4HPKA 5J7MA 2WKKA 1IZ3A 4JRLA 4IV3B 1E57A 1ZBA3 3CJIC 5CFCC 1FMD3 1RGSA 1VBB1 4BPZA 1QJX2 4A45A 3DPRB 3I3QA 4UOJA 3VL9A 3S5AA 5K9YA 4TYSA 2VMHA 3CEWA 5LCWL 2E7AA 4B8EA 4UBHA 2D98A 3RDIA 4BIOA 1W6NA 1QDCA 3TB0A 2WDBA 2RR12 2CTVA 3GXUA 2DDUA 3N7LA 2WQZC 1CAXA 4OUMA 4AI1A 1TNFA 4GULA 5LY1A 5FPBA 3OYWA 1JUIA 3TOJA 5JI7A 3PJYA 2XGXA 3ZMNA 3UKTA 3VBHB 2OVUA 2BPA2 2AYHA 3ZYJB 4MYEA 4Q2FA 4YRDA 1PIV3 3ZVXA 5BNNB 5C8WA 1UPIA 4FI9A 4QDQA 1YLLA 4META 5CA6A 3FFQA 1XNCA 5LA2A 4IEZA 2VMDA 1CAWB 2VD7A 2OYZA 3JD71 3QH7A 5L9RA 5GALA 1IS4A 3E6CC 4U36A 2RS12 4QX5A 3N4MA 4MGZE 4ZU4A 5C9AA 5I8SA 1VBC3 2WNUB 1JOJA 1HKDA 5CFDC 3JBG3 1L3JA 4L0PA 2HWB2 4CXYA 1WW5A 1LGNA 2VM9A 1UYXA 1XE8A 2WZR2 1DP0A 1DGRA 4GAZA 4XQDA 1QJY3 5A3LA 1W2TA 1MS8A 4GB32 5FZ8A 2EICA 3ZXGA 1AR91 3VHPA 1H6YA 3KT1A 1NQJA 1CJDA 1VBD1 3NAPB 5KWRA 1G9BA 1C4RA 1ZZ8A 2DVBA 5DXDA 1S2KA 3P3PA 1AHSA 2P2KA 4CDUB 5A1AA 5JDBA 3S57A 1NQDA 1DBNA 1PZ7A 1LOFA 4XTPA 2C6SA 3KB5A 2W52A 1PX3A 3EO6A 4E4HA 1N47A 5JUVA 1OHFA 1OD3A 3WCSA 5D2AA 1UYYA 4PDWC 4XC9A 2WAAA 3BIWE 1OURA 2AEZA 3ES1A 1W6PB 3PUSA 4LQRA 4I0WB 1AR73 4FOVA 3WVJA 4BQ3A 1UOJA 5FYHA 5JCTA 1NLRA 2CNAA 3QLQA 4MGIE 5EV7A 1O3QA 5LEKA 4AI9A 1VBE2 1XSRA 3I2FA 4YVWC 3KHBA 4ARYA 4LO5B 4D0QA 4NVPA 4E2QA 1ULCA 4FPCA 5EHDA 1DDLA 2VOVA 3WUDA 3OUJA 4P9IA 2R063 4UF0B 5JIUA 4I2OA 2W5FA 1Q5OA 4QGLA 1A8DA 3U4XA 1Y4WA 5CNAA 1AYM3 1YIFA 2WQ4A 4GKYA 1UXZA 4PIYA 4U2AA 1QNWA 2W92A 3X29B 4FAHA 1VBC1 1RJ8A 1QQP2 3JBG1 4NN0A 5A6YA 1J83A 2QJVA 3KF3A 3AK0A 4LHSA 4AEJA 5BNPB 4AI8A 2HLEA 1I9RA 2J1UA 4QM8A 4COWA 4XJAA 1DYKA 1MZ5A 3AP6A 3ZSEA 1ONAA 5J36A 1FI2A 5FXVA 1DGWX 3UJQA 4XW3A 1V6OA 1W8OA 3KZ4C 1AF9A 4XILA 4HKWA 4QPWA 4JKMA 5JOWA 5LATA 2VQAA 3AYCA 4IV1C 5FCCA 2B8MA 3BOWA 4DZGA 1BCXA 5J48A 2K9ZA 3AMNA 3A7QA 5EP9A 2XWBB 1RINA 2XMLA 4M0HA 1EPWA 3ME2A 1N1YA 2G9FA 4Q4V2 4YW7A 3UYJA 2FDIA 1OI6A 2QDRA 2WABA 4S2DA 4ZONA 3WDTA 4OI1A 1FPN1 3KT4A 3ACIA 1XJAA 2QFEA 1H8VA 2PHXA 2VG9A 3V56A 1D0GA 2O14A 2Y26A 2JEMA 1W9YA 4XFAA 4Y1VA 2ZEXA 4Y4YA 3FLTA 2ZHNA 3POGA 2EXIA 5FZBA 3INAA 3BB6A 5F3IA 3LA3A 2W94A 1RUE3 2BJSA 3POEA 4LO7A 3FJSA 2J7MA 4MO3M 2DTWA 3SCFA 4CCEA 2WA4A 4PJYA 3V65A 4FTBA 3NNFA 4N9HA 2R061 4HT1T 3POBA 2WSVA 1S0JA 1POV3 3N7MA 3ZO0B 3WF0A 4IEYA 3VBOA 2OW4A 1F5FA 2IZWA 2C0ZA 4N7UA 5FJKA 4GH4B 1O8SA 4Y5SA 3DCQA 4N9IA 3T2TA 1X82A 2ERFA 3LDBA 3OSDA 4YGDA 4B3NA 4D7YA 2VQTA 4CU8A 1GP6A 2JE9A 3I2HA 1US2A 1ZM1A 4LXLA 5FOJB 2BW8A 2P3JA 5D1IA 1X33A 2OXBA 3WW1A 1GQGA 1MZEA 4XHXA 5FP4A 3ABZA 1ZRIA 2V4VA 1FNZA 1RUF2 2D7FA 2VECA 2Y6HA 1UKRA 2NPIA 3KGLA 4IUGA 5FYVA 5LK7B 5C5TA 4DXTA 2HWC2 4QPYA 2X05A 3ZFEA 1LODA 5FMCA 2JIGA 5APAA 1UMHA 2JE8A 3T1LA 4DXRA 2ZGTA 4NRMA 3HNYM 4DEVA 2OZJA 1YHFA 2ZKNA 2QQWA 4JVAA 4M01A 4CP9A 2DCKA 3V0BA 3NWKA 4EN9B 1W6MB 2Z42A 2OS2A 2CHHA 3G7DA 4D3WA 5A6ZA 5J3UA 5FZ6A 2WO7A 1AR63 1GANA 3PUAA 3TN92 1RJ7A 2VCCA 5FMBA 5FPZA 3ZXKA 2ORZA 1XYPA 1RUC2 1PM4A 4LBMA 5A3OA 4NIAA 3BVCA 3ZSJA 2KD7A 4I02A 1I5ZA 4DUVA 4AI2A 2DCZA 2VH9A 1RXFA 1GNZA 2NMNA 1H2MA 4JTOA 1W8UA 2SLIA 3E5XA 1K42A 4M3CB 4N43A 4COZA 2B39A 1MS4A 2RE9A 2XQXA 3OBTA 3NQHA 4YZ3A 1QNYA 5DMYA 1PK6C 2EIBA 2GAUA 5EXOA 2FDJA 3W59A 3U11A 2NN8A 1XE7A 2YG0A 3F2ZA 4FT8A 4WM7B 4NWWA 1VMFA 3AMHA 3ZR5A 5F32A 1G9DA 1BKZA 2XVGA 3B00A 2FZ1A 1WMDA 1PMIA 2X8KA 1QJFA 4EROA 1UL9A 3ZR6A 1AUYA 1GOHA 2B42B 3LWCA 3AMMA 3JXSA 4IV3C 3H3UA 5E8AA 2P37A 5A33A 1SMVA 3VDDB 4Z92B 1DF0A 1OQ1A 3ZX7A 4MGKE 5F6LB 2HBUA 3NJVA 4JRAA 3J26N 2R49A 1W90A 2H0VA 3KVBA 2RS51 3LOIA 5CU1A 1U5IA 2BERA 2FD8A 4J25A 4JCKA 5FWEA 1NUKA 3P1IA 4Q4W3 4Y22B 5DZEA 1YJLA 2BQPA 3FN9A 2EVXA 4PF5A 2IXIA 2GN3A 5DDJ2 5B4XA 5T5OA 1AJKA 4KU7A 4A7YA 1ULDA 2RVAA 4ITCA 4OHVA 4IEOA 1YFXA 2E63A 4Q4Y1 4UI9L 1MR5A 3KD4A 3VBUC 4OQ9A 3RSJA 1PGW2 3HQRA 3V0AA 4DY5A 1ZBA2 2J1EA 4BCUA 1WCUA 4P14A 2AREA 3GHMA 5TSWA 1LGBA 2Q8CA 3VBHC 4A2UA 2WFF1 4LJHA 5JR2A 1W8TA 3OF1A 3OGJA 3C2UA 3K3OA 4FXKB 1NE4A 5GLZA 3VN4A 4K8FA 2GC1A 3WY6A 1D7PM 4URTA 3DKWA 2UY9A 1VALA 5LBFA 5LWBA 2BFUS 1JZ5A 3PVBB 2WT0A 4NIIA 2JWPA 3I3EA 2UU8A 4DQAA 4HMZA 4IGQA 5F3EA 5C8CB 2QQPA 2PQSA 3GZTB 1UIJA 2WNUC 1Y9GA 1OPMA 2QQVA 1HXS2 1YWKA 2ZMKA 4WBBA 1P8JA 1PIV2 4AVTA 1H4HA 2VTFA 1MEC3 3MLJA 1RHI3 1WD4A 2WZ8A 3VKOA 1O3SA 5E1RA 4AI0A 1BQPA 4AYUA 2P3YA 3UL2A 4FFIA 1NA1C 4Y3OA 4NAMA 5LA9A 3TWIA 3W21A 2DU1A 2CDOA 3OOXA 4OZOA 4BK4A 4Z07A 1QOOA 2JDHA 1TE1B 5LEJA 1RUH3 3PURA 2VZQA 2RMU1 4AEDC 5DAPA 3AFKA 1SFNA 2C5DA 2JECA 4XAEA 2JJ6A 2YGMA 4Q4W1 1GICA 1JODA 1XNKA 1LHWA 4P9WA 1KJLA 2QQKA 3T3YA 4MXVA 1GOGA 1NXMA 2PYTA 3RG0A 5HV0A 4YARA 1DYPA 4NPLA 1RITA 2W1QA 2TUNA 2D40A 2E53A 4KQ7A 5HV4A 4A7KA 1Y43B 2YPJA 2WNOA 3MUZ1 4P9YA 5EWSA 3VD3A 4CUCA 3U37A 3BCWA 2A1XA 5C4WC 5LA0A 1FYUA 4SLIA 1LOEA 3A21A 4AFMA 5FUIA 1HRI1 3PLQA 1QMJA 2R042 3WHUA 1YJKA 4ARXA 1R091 4RYDA 2VXRA 4KGGA 4QU1A 1FOD3 3U10A 3IMNA 4UWDA 1K5MA 3WP3A 4PHZA 3AB0A 1YIPA 2XJVA 4QMAA 4RQPA 3GZUC 4XFFA 3VBRC 2UY8A 3D3AA 3UKVA 4HN0A 1O91A 4JGZB 1AR72 5BNQA 2CY6A 3PHMA 4LE3A 1CPNA 1WLCA 4KMQA 5JXHA 1D4M2 1O5LA 4DO0A 1OOPB 1N1TA 5CG9A 2VBBA 5FO7B 2B9VA 1GMMA 3LA2A 1XNBA 2B4KA 1DYOA 1FV3A 1UN1A 2VW1A 3ACHA 4XF1A 4V2VA 1GZTA 3ZFFC 1YNAA 2DVAA 2ZGUA 4R9CA 4PBOA 4TLFA 2K46A 1SPPA 4L92A 3AX4A 4N90A 5L7OB 5L73A 1EP0A 2AEYA 1AYM2 4BQ4A 3LKJA 5DUVA 4FPFA 2BNMA 2ZMLA 5FDBA 2D3PA 4Z8BA 1OPOA 3M7AA 1V6JA 1UY1A 3M3QA 3PIJA 4DINB 2BOJA 1S4CA 1IKPA 3IDAA 5FBZA 3CQOA 1UQXA 2WN2A 3DPRA 3B3QE 4QPGA 5IVVA 3P3NA 3CJIB 5J37A 5CFCB 4AR2A 1GR3A 2WJSA 2VOKA 2BNNA 3V64A 3GNEA 3ZIXA 1T2XA 2AR6A 1MPXA 2VQUA 3IM0A 4JV4A 4Q8LA 3HQUA 5IVBA 2ZS6B 4LBQD 2XJUA 1R081 4YWAA 4UW4A 2DURA 2RS13 5GJ6A 4P9XA 4E8CA 4GIQA 4FBFA 5EYXA 4QB1A 4UW5A 4BA6A 5BNNA 1G9FA 3DXTA 1UD1A 4RS5A 1FOD1 4M3CE 4JC1A 4F83A 2KXLA 3PUIA 4YLZA 1CAWA 3TNQA 2VTXA 2HWB3 5T5JA 2HWF2 5L36A 3BUCA 3ST7A 4J1WA 4P5YA 1J1LA 5IK8A 1AL22 3KQRA 1LESA 2WZR3 3M3CA 1G6NA 1N3OA 4GB33 2RM23 1RUE2 1D0HA 1VBA3 4QQPA 4BLJA 5FYYA 4CEYC 5ABJA 2HWD1 4UW3A 4JGYC 5T5PA 1DZTA 1JW6A 2VBDA 1QJX1 5BNOC 3J8F2 5CFDB 3HWJA 3MW3A 3I2IA 2LTNA 3U0ZA 3UGGA 2B46X 3MEPA 3AYAA 3R4UA 4ET7A 2RR11 2OA2A 5FYBA 2F4LA 3NV3A 2ZZQA 1XB9A 3HNMA 2ENRA 1CAUB 2OPWA 3IDEA 5EZWA 5F5AA 2VGDA 3WNNA 5A1FA 1O8PA 3CZJA 3JB8A 2OX0A 4IEWA 4K20A 1XBFA 1VBE3 4KG8A 1S0IA 2DVDA 4XYXA 4AVSA 1U12A 3NV4A 3PUHA 4YG6A 4DS0A 4XFBA 2ET1A 1XNAA 1W6PA 3RPQA 1RL3A 1H1AA 3IZOA 4FPLA 4MUVA 4R52A 4XURA 3OUIA 1OVSA 1KDKA 1J3RA 2O1QA 4CZSA 4PDWB 2QZ2A 2CAVA 1CX4A 1WKYA 2CL2A 1X8EA 2ZACA 2RS11 5FBJA 3TEWA 1OH4A 2BYVE 4XEZA 1W8ZA 5FPAA 1JU4A 1QQP3 5CISA 4XBLA 1UY3A 4YVWB 4UF0A 3LZZA 3I3DA 1ZRRA 2EAAA 4H2AA 2XXZA 4HETA 4D6RA 4ONUA 1W9SA 2WYFA 5LBBA 4BDVB 2ARCA 3LOBA 1W2UA 2FCVA 4FCAA 5FK7A 4GB31 2OQ7A 1ALYA 3IWZA 3AZVA 4MXWB 3CZUA 2XJTA 1JU3A 2BGPA 2VMIA 2P3IA 2LW8A 5BNPA 2HYXA 2IXKA 2VOTA 1G7YA 3ZOIA 1A6CA 4N7IA 1HQNA 1ULFA 3VKFC 1H4GA 3NKGA 2VO5A 4BXSV 3RMYA 1JZ4A 2O0OA 1UKGA 4QPIC 3SISA 5FREA 5A6XA 2P34A 2PHFA 3VUOA 1KJRA 1QF3A 2A73B 3FUQA 1Y9MA 5IATA 3M3IA 5DUXA 4YGBA 1WCKA 2E7TA 3SNMA 3BGAA 2VVEA 4CXWA 4XUTA 1NCQC 1H6XA 2ZGPA 2AC1A 2BRTA 3MFCA 3E6DA 4IV1B 4QX3A 1RUNA 1Y3TA 1ENQA 1OD5A 2UWAA 3IAPA 3P5BA 1PO11 5DAXA 5A3PA 2P4EA 3AM2A 3OGVA 4WV8A 4XDPA 1B09A 3MF9A 3O0VA 5FMOS 4P08A 3RI8A 2FHRA 4QGMA 1ZX5A 1S0CA 4BHPA 1HW5A 4AWDA 1UOBA 4KWKA 1VP6A 3I2KA 2NZ9A 2JDUA 4CDWB 5FZ0A 2IWGB 1APNA 1RMU2 2W08A 1JBCA 4QQHA 5A7WB 3WHTA 2VZ1A 5FY8A 1HIXA 3UETA 4D6QA 3VBSC 1AL0G 4XBNA 3DECA 3TAYA 2XL9A 4CCDA 3K46A 1NX9A 3IKWA 2WNEA 4YW6A 4ZXEA 3B9IA 4UFIA 1G86A 1OLRA 4QM9A 3PDQA 1GLHA 2YU1A 3MW2A 3ILFA 5ERLA 2JXAA 4AQ6A 4W6XA 1W06A 4MZUA 3NJZA 4DUWA 1V70A 2HWC3 1A78A 2N7GA 3WOGA 3BIEA 2FDFA 1C3HA 2V09A 4IE5A 1N3PA 3AKSA 1JUHA 5H9SA 3OCPA
chains in the Genus database with same CATH topology
4IDZA 3T3YA 4CXXA 3O1SA 3BTYA 3H8OA 4NPLA 3RZLA 3KHBA 3LFMA 4QKFA 4MG2A 4NRQA 4JHTA 4NJ4A 4QKNA 4IE7A 4O61A 4NPMA 3BTZA 4O7XA 2FDJA 3BU0A 4QKDA 3H8RA 3RZKA 3I49A 3O1VA 3O1OA 3RZHA 3I3QA 4QHOA 3S5AA 4ZHNA 4IE0A 4IE6A 3O1PA 2FDHA 3BTXA 3O1RA 4OCTA 4MGTA 2FD8A 3RZJA 4IE4A 3RZMA 4ZS3A 4NIGA 2FDIA 3I2OA 4NROA 2IUWA 3I3MA 4NIHA 2FDKA 4QKBA 4CXWA 3RZGA 4NIDA 4NIIA 4CXYA 3BUCA 4NRPA 3KHCA 3H8XA 4ZS2A 3BI3A 3BKZA 2FDGA 3O1UA 3S57A 5DABA 3T4HB 5F8PA 4RFRB 3O1TA 3O1MA 2FDFA 3BIEA 4NRMA 4IE5A 3T4VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IDZ A;  3T3Y A;  4CXX A;  3O1S A;  3BTY A;  3H8O A;  4NPL A;  3RZL A;  3KHB A;  3LFM A;  4QKF A;  4MG2 A;  4NRQ A;  4JHT A;  4NJ4 A;  4QKN A;  4IE7 A;  4O61 A;  4NPM A;  3BTZ A;  4O7X A;  2FDJ A;  3BU0 A;  4QKD A;  3H8R A;  3RZK A;  3I49 A;  3O1V A;  3O1O A;  3RZH A;  3I3Q A;  4QHO A;  3S5A A;  4ZHN A;  4IE0 A;  4IE6 A;  3O1P A;  2FDH A;  3BTX A;  3O1R A;  4OCT A;  4MGT A;  2FD8 A;  3RZJ A;  4IE4 A;  3RZM A;  4ZS3 A;  4NIG A;  2FDI A;  3I2O A;  4NRO A;  2IUW A;  3I3M A;  4NIH A;  2FDK A;  4QKB A;  4CXW A;  3RZG A;  4NID A;  4NII A;  4CXY A;  3BUC A;  4NRP A;  3KHC A;  3H8X A;  4ZS2 A;  3BI3 A;  3BKZ A;  2FDG A;  3O1U A;  3S57 A;  5DAB A;  3T4H B;  5F8P A;  4RFR B;  3O1T A;  3O1M A;  2FDF A;  3BIE A;  4NRM A;  4IE5 A;  3T4V A; 
#chains in the Genus database with same CATH topology
 3FHI B;  4XQ4 A;  5JMO A;  5FXX A;  1CVN A;  3O1S A;  3AL6 A;  2ZAH A;  2J1A A;  3VD7 A;  4Q4V 1;  1BYH A;  1MEC 2;  4O65 A;  5C3R A;  5JPM B;  3MYX A;  1BXH A;  4BQY A;  3SH3 A;  4BLI A;  3TN9 3;  4MAD A;  4NRQ A;  4K21 A;  2UUR A;  2WWS A;  2VZT A;  4C8D A;  1RUC 3;  1PX4 A;  3ZN4 A;  1N1S A;  1HRV 1;  1JZ3 A;  2EXK A;  4H14 A;  4QU2 A;  4GWN A;  5LAS A;  2WZE A;  1PMJ X;  3H7Y A;  1W6M A;  5IK5 A;  3MF6 A;  3U14 A;  3CMG A;  2ADD A;  1HB3 A;  2XLG A;  2Z69 A;  4MH0 E;  4BOW A;  1JXN A;  1T6B X;  2ZX1 A;  2QE3 A;  1KD7 A;  4CDX C;  1YQC A;  3OG2 A;  2QTW B;  4CU6 A;  3O1V A;  3WP5 A;  2FZ2 A;  2ZEZ A;  1N3Q A;  3WF3 A;  3ELN A;  4JGZ C;  5JOY A;  2CSG A;  5A70 A;  1UX7 A;  2D5F A;  1GZC A;  4M3C A;  1ULP A;  3GF6 A;  2XR4 A;  1PNF A;  2W1S A;  4BZ4 A;  1W9W A;  1YQ8 A;  3GM8 A;  5FY5 A;  4SBV A;  5C6C A;  1GSL A;  2V73 A;  4Y1Y A;  1NYW A;  4WM7 A;  5B2G B;  1UXX X;  3ACF A;  4AZZ A;  5BV6 A;  1DQ2 A;  1OA3 A;  4I01 A;  1RED A;  1PK6 B;  2VC9 A;  2WZP P;  3UK9 A;  2PHL A;  3CBN A;  4FAG A;  1AYN 1;  4PIX A;  1UZ0 A;  3HNB M;  4HK8 A;  2JDK A;  2ZBJ A;  4XJ9 A;  2Q30 A;  4DPN A;  3D0S A;  3RJR A;  3CNA A;  4WZF A;  1RUF 1;  3ZXF A;  4RHV 1;  1RUJ 3;  2WIN B;  3VKN A;  1MQT A;  1EUU A;  3AMQ A;  3LPF A;  2G19 A;  3VDD A;  2Q1F A;  2WAO A;  3BPS A;  4AL9 A;  3I2O A;  4BWO A;  2GC3 A;  3FHQ A;  2X29 A;  4YW2 A;  5H9R A;  3RYK A;  2ETE A;  4UAP A;  3USU A;  2BUK A;  2NLR A;  4AGV A;  2VOX A;  4W4Z A;  2XKO A;  4AQT A;  4Y22 A;  5F37 A;  4M4R A;  3D4K A;  5F2W A;  3TN9 1;  5I8T A;  4XIK A;  2B5H A;  4A7Z A;  2PFW A;  2A6Y A;  2ZGQ A;  4FPO B;  5GKA C;  4E2G A;  1ULE A;  1ZZC A;  3HQX A;  4CUG A;  2Q1M A;  4EYU A;  3DV8 A;  2XH6 A;  4B29 A;  3MO4 A;  1J84 A;  1JYT A;  4I3P A;  3VBU B;  3NMB A;  3SC7 X;  1Q56 A;  5HCH A;  4J6G A;  2XUM A;  4L99 A;  4FPY A;  3C7O A;  3E5U A;  4CEW B;  1E5I A;  1HXS 3;  1LNS A;  1ZBE 2;  2Y60 A;  3W9A A;  4DNY A;  4XF4 A;  1DZR A;  3K48 A;  1HB4 A;  3GJA A;  5DZF A;  3A22 A;  3I4I A;  1L7Q A;  1KS4 A;  3OGR A;  4KWU A;  1LCL A;  1SHW B;  1DZQ A;  1GP5 A;  2WFP A;  3WQ0 A;  1ND2 A;  2DU0 A;  4J1X A;  4UFK A;  1HQL A;  4EQV A;  1O3R A;  4XHB A;  2D3S A;  4ES9 A;  5CZK A;  1AX0 A;  2Y6F A;  2W39 A;  2MEV 1;  1LTE A;  2P5B A;  3VGI A;  4BJ0 A;  1XRU A;  3AKT A;  5GZC A;  1DQ5 A;  4YZ5 A;  4YYO A;  3VHN A;  4ASL A;  4YFZ A;  5IK4 A;  5AVA A;  2VME A;  4FPE A;  4W6Y A;  1M4W A;  5T3N A;  3ZFG C;  3HAG A;  2RHP A;  5GLT A;  5DDJ 1;  2ZGN A;  3E6B A;  5BPX A;  1O5U A;  3LEI A;  4Q1P A;  4CPB D;  3HJR A;  3R0R A;  3LFM A;  1NA1 B;  3MIE A;  2VR4 A;  2RM2 2;  1DQ4 A;  1YO8 A;  2Y6L A;  1VBA 2;  1WBF A;  5DQ0 A;  1ZBA 1;  1TME 2;  2OII A;  3WF1 A;  1FMD 1;  2CAU A;  4HOO A;  1U5Z A;  3OBZ A;  5BYN A;  3LE0 A;  4LA3 A;  4AOC A;  4AED B;  4XFC A;  4TN7 A;  3WNO A;  2R04 3;  4A6S A;  2B9U A;  2D6L X;  1TZO A;  2WBK A;  4O7X A;  1TMF 3;  2ZX2 A;  4NUB A;  4RGK A;  2Q8D A;  4QX1 A;  4HN1 A;  1ENR A;  4GAL A;  3RJ2 X;  2C9K A;  3O1O A;  2KA3 A;  2VVF A;  1OLQ A;  3SMH A;  2JDZ A;  3CJX A;  1BEV 2;  3MLK A;  2V5D A;  1D4M 3;  4PLN A;  5C4W B;  2PQQ A;  1ZRF A;  1HXS 1;  3WQB A;  3HD8 B;  2E51 A;  3N36 A;  1JZ8 A;  3Q8F A;  1PIV 1;  4UT5 A;  4P5H A;  2ZGR A;  5EYY A;  3WNP A;  4QD2 A;  4IER A;  5FYI A;  4OCT A;  2PLV 3;  4MGT A;  3VLB B;  1JTZ X;  1NT0 A;  1SCR A;  1PGS A;  1YUD A;  2VMF A;  3BN6 A;  3PVE A;  4NHL A;  4P9G A;  1X7N A;  1OOP A;  2K2S A;  1NY7 2;  3AMP A;  4JDM A;  4Q0P A;  4ZS3 A;  3VBR B;  1XC6 A;  2C24 A;  4LA2 A;  2WA3 A;  1BMV 2;  3WQ7 A;  2BFU L;  2JG8 A;  3W20 A;  1FAT A;  2PAK A;  3WNX A;  1REF A;  4QXC A;  4N43 C;  3PUQ A;  3ZFF B;  2IUW A;  4UFJ A;  1ZA7 A;  1TVG A;  1MVE A;  1S0G A;  1K5J A;  1OSG A;  4XMA A;  1LRH A;  4XUN A;  1QJY 1;  1LB2 A;  2Q5T A;  3NW4 A;  5FZD A;  1SCS A;  2D97 A;  2UYB A;  4WM8 C;  2XVL A;  2FMY A;  1RUG 3;  1DQ6 A;  4CDQ A;  5C3O A;  4LBQ B;  2ZHK A;  4B4Q A;  4AVB A;  4OVE A;  1SQ4 A;  3R4D B;  2WN3 A;  1PO2 2;  2ZGM A;  1PZ9 A;  3CJI A;  5CFC A;  4LKE A;  4UBG A;  1Q8V A;  4QT6 A;  2R04 1;  1CQ9 A;  2XON A;  1Y7B A;  3H9A A;  2V72 A;  3AYE A;  2VMG A;  3T09 A;  5CIR A;  1XU1 A;  1O4Y A;  4IW3 A;  4NO4 A;  4NWV A;  1US3 A;  3HT2 A;  1LJ7 A;  4RR3 C;  2HWF 3;  5DAW A;  3SH4 A;  4TTG A;  1XU2 A;  1ND3 C;  4HLT A;  4CDW C;  4IGO A;  4AVA A;  1ZZ6 A;  1AR7 1;  1AL2 3;  3HR9 A;  2XDV A;  2YC0 A;  2IXC A;  5A3U A;  1OFN A;  1V6N A;  4D8M A;  1G9A A;  1Z0H A;  4XTM A;  1D4M 1;  3NNM A;  3K4A A;  1CJP A;  1HDK A;  4D69 A;  2SBA A;  3MFA A;  1SDD B;  5FR3 A;  4KWJ A;  4EE2 A;  1YYN A;  3OGG A;  1LEC A;  4FPH A;  1F4A A;  1DHK B;  1I5P A;  2HWE 2;  3MBW A;  3PU8 A;  3J8F 3;  1F8V A;  4UFH A;  4OI4 A;  3VBF C;  4LKF A;  3EXU A;  1C1L A;  1AYM 1;  2TEP A;  2ZKL A;  2XB6 C;  2HKX A;  3EHK A;  3N9P A;  4NHY A;  4XAB A;  5G04 L;  3VKL A;  3HN3 A;  2RS3 3;  4HSJ A;  1VRH 3;  3MID A;  4GWI A;  3PVN A;  4Y4R A;  4PCR A;  1UW8 A;  5CFD A;  2PHU A;  3AP7 A;  3LIH A;  4CEY B;  3RS6 A;  3FUO A;  1CZT A;  4JGY B;  3MIF A;  4M3C F;  3WCR A;  1W3V A;  1JHN A;  3NO8 A;  3WZ1 A;  1G8W A;  5BNO B;  2RJ2 A;  3KMH A;  5GZG A;  1LOA A;  4QHZ A;  4EWE A;  5J96 B;  1H8T A;  2K0G A;  1F15 A;  2PTM A;  2YXS A;  5A6Q A;  2EAK A;  2Q4S A;  2W87 A;  4AK3 A;  4FFG A;  1QKQ A;  3N7K A;  4FVV A;  4QXB A;  1GZ9 A;  4V1P A;  4COV A;  4WVV A;  3QOP A;  2RDN A;  1QXR A;  4LBN A;  2JIJ A;  1UU4 A;  1NAE A;  3A4U A;  2LRO A;  3SKV A;  3URF A;  1CZV A;  3OPW A;  5CG8 A;  5FP3 A;  4B7E A;  3FC0 A;  4QB6 A;  2XL7 A;  3LDR A;  3ZDV A;  2EF6 A;  2JG9 C;  1FAY A;  3WDW A;  1URX A;  3GJB A;  3I59 B;  2HWF 1;  5FZO B;  5KXB A;  4PDW A;  2BP6 A;  2HBT A;  3RMX A;  5FLH A;  2XJS A;  2IVJ A;  4IE0 A;  1AL2 1;  3T2O A;  1WLD A;  4QX0 A;  3KWV A;  5JVV A;  3UJO A;  4LR4 A;  1EUT A;  3IDC B;  3WDV A;  2IVI B;  1HQW A;  1RUE 1;  2PEL A;  4FPK A;  1WWY A;  5LB6 A;  1V0A A;  2W3J A;  5A32 B;  1UYZ A;  1K3I A;  5IUQ A;  1T6G C;  1ZA4 A;  2G4I A;  2YYO A;  3IDB B;  3K2O A;  3J8F 1;  4AE2 A;  2GNT A;  4Y5Z 0;  2CU5 A;  1POV 1;  1UF2 C;  3CO2 A;  3EQE A;  3WNK A;  3ZN6 A;  4BH9 A;  5K8S A;  3ATG A;  3GGL A;  3DEM A;  4JQT A;  5CKM A;  2VCM A;  3ROU A;  3I3M A;  2Y6G A;  1R1A 2;  1YCI A;  4M4P A;  1UZV A;  2BWC A;  4KI5 M;  1OKQ A;  2ADE A;  2JE7 A;  5IVJ A;  4Y20 B;  1UZZ A;  3LPG A;  3VZN A;  5FMD A;  3B02 A;  2BU9 A;  2DBI A;  1LHO A;  1WUV A;  2D6P A;  1OUX A;  2P6H A;  4N53 A;  4YGE A;  1S2E A;  1B35 C;  1NOV A;  1DQ1 A;  3AC0 A;  4GD4 A;  4RFT 0;  4QPI B;  3WDX A;  4K1Z A;  4JKK A;  1RUJ 2;  4KBZ A;  5IAV A;  1GQP A;  2VCB A;  4NRP A;  3ZLI A;  3KVA A;  1RMU 3;  4IV1 A;  2PAM A;  1JZ2 A;  5JZG C;  2I45 A;  3QBQ A;  2XPJ A;  5B4N A;  1LR5 A;  2VCA A;  2KR2 A;  5FFO C;  1NCQ B;  5FRA A;  5GLU A;  5I0R A;  4CP1 A;  5JIA A;  4X6R B;  4CEW C;  1YI9 A;  2R32 A;  3WEZ A;  4IEQ A;  1AR6 1;  5A7S A;  1C57 A;  4QPG C;  3OBR A;  3BKZ A;  1SFY A;  1CON A;  3OUH A;  3K51 A;  1OBN A;  5F39 A;  4LMF A;  5KR7 A;  1KIT A;  1YQ2 A;  2H0B A;  1NCR C;  3M8L A;  4ATF A;  1XQN A;  1KGY A;  1SLC A;  5IVY A;  3O1M A;  2X09 A;  2W91 A;  3TBD A;  5A3N A;  1JMU B;  2ZCW A;  5LZ6 A;  2R30 A;  1VBD 2;  2OPK A;  1QGL A;  4LOT A;  1VB4 A;  1IS5 A;  4RN5 A;  1RB8 G;  4QDS A;  2VE1 A;  5H9Q A;  3VBS B;  1CWP A;  1O4Z A;  1BLZ A;  2ZGS A;  2GU9 A;  1JYC A;  1O6U A;  2Q0A A;  2VZU A;  2Z2S B;  3OYW B;  4MGQ A;  4ATE A;  4DY3 A;  4ZKT B;  4RS5 C;  5C7G A;  2ZGK A;  1VR3 A;  4Q29 A;  4XF9 A;  3POW A;  5F1R A;  4FFF A;  1UMZ A;  1QOT A;  2WS9 3;  1UY0 A;  2X5I C;  4L8Q A;  2AGS A;  1AXY A;  4OZX A;  1OXC A;  1E5R A;  4D7T A;  4YW3 A;  1V00 A;  4LBO A;  4O61 A;  2AAC A;  3AL5 A;  3KS7 A;  2WUH A;  5FZA A;  2E26 A;  5C71 A;  2QQU A;  5FJH A;  2VUJ A;  1GZW A;  2YY1 A;  4LKS A;  1WGP A;  2A6V A;  3KQ4 B;  4BMB A;  3RYR A;  1VMJ A;  4WVW A;  3NJX A;  4X8N A;  1WCS A;  3NVC A;  1NXD 1;  4MGS A;  5ABJ C;  5IT6 A;  5FOB B;  4CRQ A;  5G05 L;  4NPR A;  1QJU 3;  3VKM A;  1WLW A;  1ZRE A;  4I0A A;  2YFU A;  3ZSL A;  2ATF A;  4QX2 A;  1RMU 1;  4AG4 A;  4EWD A;  2XJR A;  2MHF A;  4AXO A;  4F7Z A;  2YGL A;  2W46 A;  2H6C A;  1F35 A;  4AFA A;  2WR9 A;  1IS3 A;  1H2L A;  5D8A C;  3ENR A;  2QKD A;  5T52 A;  2WNV C;  2PXJ A;  4FTE A;  2QVS B;  3IPV B;  1LHV A;  4YZ2 A;  3MPP G;  4W8J A;  3M70 A;  1TMF 2;  3POJ A;  3ZPY A;  2YUE A;  4CDX B;  2GMM A;  3RZM A;  1COV 3;  4YVS C;  4AFC A;  2BVB A;  3IMM A;  3ZSM A;  3ZYP A;  5FMO L;  1S55 A;  2E32 A;  1BVP 1;  2GP3 A;  2Y0O A;  4BME A;  1W2A X;  1UU6 A;  2GH2 A;  4C0H A;  4NAO A;  5KC6 A;  2YHJ A;  3GCW A;  1PK6 A;  4L9B A;  1K45 A;  3UGF A;  4QKB A;  4KU8 A;  2PHR A;  5A3T A;  1MEC 1;  1RHI 1;  1S0B A;  4FP2 A;  4BQ1 A;  3RWK X;  4UW6 A;  1XXN A;  4DEQ A;  3IAQ A;  4D6S A;  3BAL A;  3W5M A;  2PLV 2;  1YFY A;  4ZZ8 A;  1QY4 A;  2Q8E A;  5L9V A;  4OUE A;  1AJO A;  1VAV A;  2VZP A;  1FPN 2;  2XHN A;  3A0N A;  5C3Q A;  5J09 A;  4NID A;  2FQP A;  4JQR A;  4P9L A;  1WA6 X;  4YW5 A;  5JAX A;  1VAK A;  4G3Y C;  3C3V A;  1RUH 1;  4IV3 A;  4R9D A;  3FX3 A;  1M06 G;  1SLB A;  3AJY A;  1W3X A;  3KT7 A;  3POI A;  3IIA A;  3I7D A;  4MVT A;  4PI2 A;  1VAM A;  3KM5 A;  5HXV A;  4FTS A;  1W8W A;  3T08 A;  4WVM B;  2XHK A;  3OTF A;  4QX8 A;  4GMP 3;  5GM0 A;  3B5L B;  4FXG B;  3ZXE A;  3SCH A;  3LSD A;  2BNO A;  1W9F A;  1ZBE 3;  5FZC A;  1RUD 3;  4YM0 A;  2QZ3 A;  4JDN A;  3AJZ A;  4YG0 A;  5FYC A;  1IPK A;  1EY2 A;  1RUI 3;  5K4L A;  2G9G A;  3O14 A;  1NG0 A;  2PA7 A;  4KGQ A;  1QXP A;  1RUG 2;  5FZE A;  2FDG A;  2VW2 A;  2DVG A;  1UMI A;  4N8M A;  3AP9 A;  4Q5O A;  1GOF A;  4YG3 A;  1YFW A;  3WW4 A;  3GYD A;  3GCX A;  1MZF A;  5F8P A;  4I09 A;  5M0T A;  4XE9 A;  3VBH A;  4GKX A;  4QAW A;  3U4S A;  4AGG A;  1NE6 A;  2Y6J A;  2DFC A;  2W0X A;  3HPN A;  4LLO A;  2J22 A;  2YC4 A;  1CIW A;  1LUL A;  1MS9 A;  1H1I A;  2IXL A;  2VVD A;  2ZMN A;  4IDZ A;  4E2S A;  4KBB A;  1EYB A;  3PIG A;  1VJ2 A;  1V9U 3;  3KLS A;  3TEY A;  3KF5 A;  3U75 A;  1XSQ A;  1UPS A;  2GME A;  2R0F A;  4NMI A;  2BBV A;  3JQW A;  1AX1 A;  2DFB A;  2JD9 A;  1CIY A;  4Q0Q A;  3VDA A;  3WNL A;  4LHN A;  2WNU A;  4JAA A;  5FIX A;  4JHT A;  1XYO A;  2DCT A;  5DG1 A;  1TME 3;  1FXZ A;  3HT1 A;  5HCF A;  1RC6 A;  5LBE A;  2VNG A;  3H1W A;  2LS6 A;  3ZKU A;  4LT5 A;  2G9Z A;  4YW1 A;  4HKO A;  1IG0 A;  2QQI A;  5A7N A;  3L2Y A;  5A7P A;  2P17 A;  2XJP A;  3TRS B;  4RD7 A;  1UU5 A;  1PHM A;  4R4X A;  3ZFG B;  5F5I A;  1HV0 A;  3VZL A;  5LA1 A;  5ACA 3;  3H8R A;  3RZK A;  3NRU A;  2ARA A;  2OUJ A;  1IOA A;  2RS3 2;  4UFL A;  1VRH 2;  1O4T A;  2RDR A;  5I0T A;  3NAP A;  4YGC A;  5AC9 3;  4W65 A;  5FP9 A;  5GZE A;  4KNC A;  4FPJ A;  4IQP A;  3THT A;  4CDU A;  1OMI A;  1BEV 3;  4GMP 1;  2PHW A;  4AHX A;  2W9X A;  1ZBE 1;  5HXM A;  4IEV A;  2FMD A;  3WG2 A;  5CKN A;  4IE6 A;  4ES8 A;  4CCM A;  4S2F A;  5L9B A;  1V6K A;  2FDH A;  2VNO A;  3R4S A;  4IEX A;  3BTX A;  1TNR A;  4FQZ A;  4CU9 A;  4A44 A;  3NNJ A;  4CCN A;  4AW7 A;  4CCL A;  1HN1 A;  1OT5 A;  4QQL A;  4IE4 A;  4FO9 A;  1GU3 A;  4AAP A;  2CGN A;  1SZB A;  4XCB A;  5C4W A;  5K0U C;  1OA2 A;  5F3C A;  3HBK A;  5JI9 A;  1C8M 3;  2L9L A;  3J7M A;  4QGN A;  3FHA A;  2R07 2;  2WLQ A;  2BGC A;  1AZD A;  1BBT 2;  2HWB 1;  5JOX A;  4HZF A;  2YB7 A;  1CN1 A;  1H30 A;  2EAL A;  2FDK A;  3H50 A;  1SFP A;  4X8P A;  4Y1U A;  4CP9 B;  3VBR A;  3VHO A;  2WZR 1;  3FFZ A;  1LU1 A;  3N9Q A;  2JEN A;  3POF A;  5KC5 A;  2VY0 A;  3ON7 A;  2RM2 1;  1W6O B;  1VBA 1;  3HVD A;  5LK5 A;  1GBG A;  1NZI A;  3AP4 A;  1PO2 3;  5A1L A;  2WT2 A;  2PN5 A;  5FXW A;  2ID4 A;  3B69 A;  4L2N A;  5FZH A;  1REE A;  1ZRD A;  4N43 B;  2FBE A;  3WR0 A;  1SLA A;  4C1W A;  2HEW F;  2GC0 A;  4P02 B;  2VMC A;  1LED A;  4LBQ A;  3QCW A;  3AZW A;  5FUN A;  4WM8 B;  5T50 A;  3C7F A;  3AXE A;  1QJE A;  2W1W A;  1L7L A;  1LKN A;  3NST A;  4CSW A;  2OT7 A;  1BEV 1;  1MQT C;  3K4Z A;  5IWF A;  3SCG A;  2DYC A;  1VBE 1;  3POS A;  5D21 A;  5FPX A;  3O1U A;  4HVR A;  3O1T A;  2ARX A;  2Y34 A;  4LHL A;  4Q4X 3;  1IPS A;  2Y0I A;  2HWE 3;  3T0A A;  3ILN A;  1W0N A;  2GNM A;  1YEW A;  3LEK A;  4XDQ A;  5FYZ A;  4XMI A;  1X36 A;  3AKQ A;  3WP4 A;  4RR3 B;  1ACC A;  2GSY A;  5FPL A;  1W03 A;  1ND3 B;  2XKP A;  1NY7 1;  4LUM A;  2ZTN A;  1BMV 1;  4HAN A;  2VU9 A;  1KXG A;  2UWB A;  3KCY A;  3D0J A;  3RZL A;  4QHB A;  5FY1 A;  5JXG A;  2Y38 A;  1WA4 A;  4PF1 A;  1QQP 1;  1W39 A;  1JHJ A;  5JMC A;  4BXF A;  2Y64 A;  2YBK A;  2VZO A;  2WO3 A;  5ISL A;  3J7H A;  4QKN A;  3RQ0 A;  1V6L A;  3VBF B;  1YC6 1;  2Y33 A;  3ZXJ A;  2QNK A;  4GH4 A;  4YNI A;  5FTT C;  5FPV A;  5IAX A;  2VUL A;  1UIK A;  2ZA9 A;  3B94 A;  3KV4 A;  2C9A A;  5IVC A;  1STM A;  3AFG A;  5EPA A;  4OHZ A;  4CEY A;  3I49 A;  1ND2 C;  1BK0 A;  4FOW A;  1UZW A;  4H7L A;  2A70 A;  4LBK A;  4LIU A;  5LY2 A;  3AXD A;  1RVF 3;  2GC2 A;  1POV 0;  3SHR A;  2WQ8 A;  3BPZ A;  5AVP A;  1OVP A;  3E5Q A;  2Q1Z B;  3N7J A;  5T55 A;  1ODM A;  1C8N A;  1S0F A;  5C9A C;  3RWN A;  4WZC A;  1IPJ A;  2QQO A;  3PNA A;  1AR8 3;  1H2N A;  1QHD A;  4Q0S A;  2WS9 2;  3AP5 A;  1SLT A;  3J7N A;  2OZ6 A;  4GA9 A;  5JSO A;  5F2S A;  1MS0 A;  2F17 A;  2QBX A;  3FLP A;  1W9T A;  1Z7S 2;  2CYF A;  1W8F A;  1DGL A;  1PVC 3;  2EXH A;  3VL8 A;  4E27 A;  5FY7 A;  4K40 A;  4A3Z A;  3CIH A;  4MV2 A;  1O59 A;  5A7O A;  4B7K A;  2XQR A;  3LF7 A;  2JB4 A;  4XET A;  1UO9 A;  2D5H A;  1SAC A;  5FZO A;  4OLL A;  1QIQ A;  2C26 A;  4X6Q B;  4B4R A;  1VBB 3;  1QJU 2;  2XUE A;  2JG9 B;  2V4A A;  4XUQ A;  2CWM A;  3N9N A;  5IJR A;  2ZX3 A;  1W0P A;  1WCQ A;  1LOF C;  4BE3 A;  2Q8O A;  3H8U A;  4OHW A;  3BOP A;  3RZZ A;  3WDU A;  4FPG A;  4LO6 B;  2CDP A;  3JCI A;  3ETQ A;  1R1A 3;  2LRP A;  1GV9 A;  3RYP A;  4A3X A;  5IK7 A;  2JDM A;  4LUL A;  2ZX4 A;  3UNP A;  1IGO A;  3RZG A;  1EAH 2;  3AKP A;  3H3L A;  2ET7 A;  3HMY A;  4Y5T A;  1COV 2;  4CP2 A;  2AZ5 A;  3LAG A;  3Q8A A;  4TWT A;  2WC2 A;  3FWE A;  3UES A;  3M3E A;  1CZS A;  2A3W A;  1CGP A;  3O12 A;  1C5H A;  3III A;  1IKQ A;  1UZY A;  4RL7 A;  2RJL A;  2HWC 1;  4Y20 A;  3SEP A;  1ENS A;  2XOM A;  4DUX A;  1YRZ A;  4DXZ A;  3JD7 3;  4AAX A;  4DMI A;  3S0M A;  3MUY 1;  4QXH A;  1FT9 A;  2GAL A;  5A80 A;  1J3Q A;  3AZY A;  3ZXL A;  4WVZ A;  3S5Q A;  2XLA A;  2JG8 C;  3LSE A;  1U5X A;  5F7U A;  1CPM A;  1JN2 P;  3ORJ A;  1B35 B;  2XBO 2;  1ENX A;  2F4P A;  2XJQ A;  1JYV A;  1RUC 1;  4XXA A;  4LE4 A;  1ODN A;  1CAV B;  3LCP A;  3CHX A;  4Z2W A;  1W28 A;  1SPP B;  1ZRC A;  2P3K A;  4PQ9 A;  4XBQ A;  1LOG A;  1W6Q B;  2VUD A;  5A7Q A;  5FZ3 A;  3S30 A;  4CDQ C;  5JZG B;  2A3X A;  3MV1 1;  1AR9 3;  5KHI A;  1VBD 3;  4ASK A;  3RRD A;  3SKJ E;  2A6Z A;  2HWD 2;  2DWR A;  2WRA A;  3IBM A;  4XUO A;  1RUD 2;  1YXW A;  1W05 A;  1S0D A;  4IET A;  4ZU5 A;  2DCJ A;  4QPG B;  3ECQ A;  1RUI 2;  3MPB A;  1GP4 A;  1DU3 D;  3J9S A;  2R16 A;  5F5Q A;  3LIG A;  4HL0 A;  3E1F 1;  2VZ3 A;  1WW7 A;  2B7Y A;  1R1A 1;  1NCR B;  2E31 A;  3PTR B;  5C8C A;  1F31 A;  2DVF A;  3N9O A;  3OGS A;  4MHR A;  2Y8K A;  4PIZ A;  1ASJ 2;  5JWP A;  5KHJ A;  4K1Y A;  2DTY A;  3SEE A;  3VBS A;  2OQ6 A;  4LKD A;  2ZZJ A;  2YMZ A;  5FV3 A;  5HCB A;  3G6J B;  4MHU A;  4Z1V A;  3DKQ A;  3THP A;  4CU7 A;  1V9U 2;  2LUW A;  4GWJ A;  5GZF A;  1RUJ 1;  3F95 A;  3LQC A;  3H1M A;  3VZO A;  2RDQ A;  1AX2 A;  3MW4 A;  4RS5 B;  4COY A;  1ZZ9 A;  1BZW A;  3MGU A;  3H42 B;  4HFS A;  4JX0 A;  1BJQ A;  2X5I B;  1DQ0 A;  5FZL A;  4ZZ5 A;  3VBO C;  1PGW 1;  1H2K A;  4TZD A;  2DBN A;  4HXC A;  3JZV A;  3MHZ A;  5C70 A;  1LEN A;  1PZ8 A;  1NLQ A;  4L97 A;  4Y1X A;  3M2M A;  5KXC A;  4BM8 A;  1XE0 A;  3RZJ A;  3N9M A;  3E97 A;  1OF3 A;  2JDY A;  3HOB A;  5ABJ B;  3HEI A;  4LO4 B;  4LNV A;  1VB2 A;  3GBW A;  3HN1 A;  5CYY A;  5DN2 A;  4K6B A;  5ACA 2;  5AC9 2;  3FLR A;  3CL1 A;  3AVR A;  2VUC A;  4M0N A;  1H8T C;  4ZPI A;  5FZM A;  5T5L A;  5AFB A;  2OKX A;  3WXP A;  5EJZ B;  2OUH A;  3A0K A;  3UKN A;  3FE5 A;  3ZFE C;  3LD8 A;  1GNY A;  3IPV A;  1Q43 A;  5DPN A;  1XOY A;  3B9C A;  4MSV A;  5D8A B;  4CDX A;  4O9E A;  4YM2 A;  3THC A;  4DFS A;  2WNV B;  1PGL 2;  5FPU A;  2GND A;  1S1A A;  1JOB A;  1Z78 A;  2RJK A;  3IB3 A;  4TLG A;  5FYU A;  4JGZ A;  4G4F A;  1WZX A;  3TYJ A;  4YVS B;  4KWL A;  1Q8O A;  2F6B A;  3VZJ A;  1FPN 3;  4K7J A;  4Y33 A;  1EPZ A;  1IG3 A;  4OMC A;  3MIH A;  3MZH A;  3PVO A;  3ZXA C;  4XJU A;  4YM3 A;  1Y9Q A;  3O0X A;  5LRS A;  4E9K A;  1JOP A;  4AGR A;  4CCO A;  1C8M 2;  2JDA A;  3RNS A;  4NR1 A;  4IEU A;  1IQA A;  4B1L A;  4ZS2 A;  5L7O A;  4Q8K A;  2VBP A;  2YPD A;  1PO1 2;  1V6M A;  3OEA A;  4DB5 A;  5DZG A;  3R6S A;  1W2N A;  3ZXD A;  3AZZ A;  3MIG A;  1W8H A;  4DOU A;  1HJF A;  3WV6 A;  1DIW A;  3T1M A;  2GNB A;  2CV6 A;  3KV5 A;  4RFR B;  3CLP A;  4O9G A;  4WVM A;  4R8H A;  4GQ7 A;  3QAC A;  4C1X A;  4RGA A;  4LBJ A;  3ZYG A;  2BBA A;  3FL7 A;  1MZ6 A;  4IL7 A;  1DGW A;  4XPV A;  5JOZ A;  1LU2 A;  3VZM A;  1GQH A;  1TMF 1;  4QQO A;  4N53 C;  1DLC A;  3DL3 A;  3RVH A;  4QX7 A;  3EB7 A;  1J59 A;  4W6W A;  2A6X A;  2JB8 A;  2WWU A;  2JKB A;  3T0D A;  1GKB A;  4GMP 0;  5I93 A;  1EV1 2;  1HB2 A;  3Q8C A;  2EIG A;  4IES A;  5FLI A;  4E4D X;  4Q0U A;  3MI8 A;  1RTV A;  4C0B A;  2W68 A;  2WII B;  3NKT A;  4XAC A;  5KHH A;  1PNG A;  1Q8Q A;  2D6M A;  3D8C A;  4Q4X 2;  1UAI A;  3ZYI B;  1JZ7 A;  2FCU A;  5JSP A;  4F3J A;  4BB3 A;  5FYS A;  4QXK A;  4A41 A;  2HYK A;  2PLV 1;  3S6P A;  3BU0 A;  4CPB A;  4OQ8 A;  2JIC A;  1QXJ A;  3RFR A;  5JLV A;  1UY4 A;  4EN7 B;  2E6V A;  1S2B A;  5A7W A;  3IT8 A;  3WF2 A;  1HRV 2;  1HJG A;  4FOY A;  5LBC A;  3OPZ A;  2C4X A;  2R6Q A;  5KHK A;  4NE9 A;  4AFB A;  2V5Y A;  4QHO A;  4GXL A;  2RDS A;  4Y24 A;  3OD4 A;  3ZFG A;  2BDR A;  2VXJ A;  4LOR A;  3AVS A;  1C5I A;  3A23 A;  3ZMO A;  3O1R A;  5FZ9 A;  1D4V B;  2VOW A;  1MS3 A;  4CCK A;  1CAU A;  1RUG 1;  1W04 A;  1YI7 A;  3I97 A;  3NV2 A;  3U07 A;  1DG6 A;  4XAA A;  5FZK A;  3Q8E A;  3UV9 A;  1H9P A;  1LAJ A;  3VD9 A;  5L19 A;  4BIS A;  4NIG A;  1XPW A;  2ZAB A;  3WT3 A;  2JDN A;  1A34 A;  3T30 A;  4CUA A;  3DYP A;  3ZIW A;  2A5Z A;  1RVF 2;  3FBM A;  2RG4 A;  3IN9 A;  3W5N A;  3WW2 A;  5IW0 A;  2PHT A;  2WYS A;  1WD3 A;  3P6B A;  5FZ1 A;  2R07 3;  2BOI A;  3Q9O A;  4IND A;  1AR8 2;  1BBT 3;  4AFD A;  2VNV A;  3WUC A;  1A3K A;  1AYN 2;  1IHM A;  2RS5 3;  3MDP A;  4UFM A;  1YQ6 A;  3NNG A;  2D6K A;  1C28 A;  1FV2 A;  1ZYB A;  4RHV 2;  2J1S A;  1PVC 2;  2A3Y A;  3M3O A;  3ALQ A;  3B7M A;  1UWW A;  2NQY A;  5K0U B;  4URA A;  4Q4Y 3;  4YVW A;  2ZX0 A;  3WG4 A;  2HJI A;  3M4F A;  2ZGL A;  4XFI A;  5SV5 A;  4FFH A;  1LEM A;  3OY8 B;  1KDM A;  1VBB 2;  1NZC A;  2QCS B;  4PBP A;  5FYM A;  2VNR A;  2WFF 3;  2Z5W A;  3WP6 A;  4QQ2 A;  1UOF A;  2W2I A;  3H7J A;  1UX6 A;  4KL1 A;  4B4P A;  3H8X A;  3WG1 A;  5F9T A;  1W6O A;  4MXW A;  5ANQ A;  2RS3 1;  3AZX A;  1WCD J;  1VRH 1;  5CBL A;  2VAU A;  1Q8S A;  1K5M C;  3QD6 A;  4YSF A;  3C8X A;  4LEJ A;  4RQP C;  2BVV A;  5FQ0 B;  2AH2 A;  3W58 A;  4AHZ A;  5FZF A;  3PME A;  1CES A;  3O0W A;  4YZ1 A;  1CX1 A;  4OI0 A;  1LGC A;  1X9T A;  2IXJ A;  4B1M A;  2XWJ B;  1C1F A;  2AEN A;  1VLN A;  4OHX A;  4COU A;  4KG0 A;  4LIV A;  1UOG A;  5FK8 A;  3ZPO A;  3ACL A;  2O8Q A;  4YZ4 A;  4IGP A;  5C3S A;  3OPT A;  3KSC A;  5CEH A;  4R9A A;  4WM8 A;  4CCC A;  3K77 A;  4S2H A;  2D93 A;  2D6N A;  3FBY A;  4IEP A;  5A3M A;  3BU7 A;  3BTY A;  3JD7 2;  3H8O A;  1GYK A;  2DF7 A;  2I07 B;  5FUP A;  4P9J A;  4PQQ A;  1MQT B;  5H9P A;  4DIQ A;  1SDW A;  4G9S B;  3I3B A;  4Q26 A;  4AEK A;  1KFU L;  1DFQ A;  2R07 1;  1VE0 A;  1O7F A;  1BBT 1;  2MEV 2;  1WMF A;  2RMU 3;  3DPR C;  4HPK B;  3D82 A;  4NJ4 A;  1UY2 A;  2HH9 A;  4RR3 A;  3USU B;  5C3P A;  5KXE A;  3DUI A;  2YBS A;  1ND3 A;  3EMR A;  4CDW A;  2GP5 A;  3BTZ A;  1SEF A;  1L7R A;  5FLJ A;  2IXH A;  5T54 A;  3K4D A;  4ZXK A;  2Z79 A;  4LUK A;  4EV0 A;  1W6N B;  1H1M A;  4AEM A;  3VDB A;  1JH5 A;  1AR9 2;  1RIR A;  1SBD A;  3B01 A;  4BU2 A;  1WBL A;  1FMD 2;  1CAX B;  5FZI A;  1KRI A;  2LAL A;  3VBF A;  4M00 A;  4EWA A;  1BVV A;  4GJZ A;  2TNF A;  3D5O A;  1HRI 3;  1SLL A;  5BNN C;  2VZR A;  2XVK A;  1I6X A;  3N35 A;  5E16 A;  1R09 3;  4ZHN A;  4CP0 A;  2YDE A;  1QH6 A;  2DUQ A;  3O1P A;  4K3U A;  5BXX A;  4I0B A;  1IQD C;  2A71 A;  3J4U H;  3PL0 A;  1Z7S 3;  3SIT A;  5I0D A;  2VUA A;  3H0O A;  4R4Z A;  4RSU A;  3WX5 A;  4DRR A;  4C91 A;  1ND2 B;  1UCX A;  5J98 B;  2BEO A;  1X9P A;  1DCS A;  2W1U A;  5E88 A;  4A42 A;  2VL4 A;  1KS5 A;  4W50 A;  4E4S A;  4LIT A;  2EXJ A;  5FY0 A;  5FKC A;  4CVU A;  1AXK A;  1CD3 G;  2BWA A;  5C9A B;  2E7Q A;  4HVO A;  4NRO A;  3JB4 C;  2BZD A;  3WNM A;  2IFW A;  4NIH A;  3DGT A;  2C1F A;  1W2O A;  1YQ5 A;  2P6C A;  3B93 A;  1QEX A;  4BK5 A;  1AXZ A;  2I74 A;  1J3P A;  3KCC A;  2R1B A;  1XYN A;  3NAP C;  4NOT A;  4D94 A;  2UWC A;  4XJZ A;  1X50 A;  3OB8 A;  5JR7 B;  3ZDS A;  2D6O X;  3H1Y A;  3O5S A;  4RGG A;  1VBC 2;  5AFE A;  5IVE A;  4YFW A;  4CDU C;  4MGY E;  2D43 A;  2JG9 A;  4BQ2 A;  3SQO A;  3JBG 2;  1EAH 3;  2VTX J;  5JXJ A;  1RYY A;  1WW6 A;  1HB1 A;  1JZ6 A;  1Q3E A;  5HPO A;  2X53 S;  1QJY 2;  1WMX A;  5DAQ A;  4C90 A;  2AUY A;  3KHC A;  1OQD A;  1PM7 A;  4CA9 A;  5CAD A;  3L9J T;  1OKO A;  5CVR A;  5LRR A;  5FXZ A;  3ETP A;  4LBL A;  4XQW A;  4H7M A;  1ZZ7 A;  1R08 3;  5KHG A;  4BYY A;  1MVQ A;  4UYB A;  1WW4 A;  5DAV A;  4CCJ A;  3EBR A;  3JUU A;  5IFP A;  2YV8 A;  2YRO A;  4LHK A;  4TSV A;  4E8D A;  4NHM A;  2WS9 1;  1RXG A;  2XBO 3;  4ISR A;  1OC1 A;  5E6H A;  1SG3 A;  1XND A;  3ZYB A;  4P00 B;  2RV9 A;  1Z7S 1;  1U5Y A;  5DUW A;  5FO9 B;  3ZN5 A;  2ES3 A;  3APB A;  1A8M A;  3T4V A;  2JD4 A;  4CXX A;  4DXS A;  3KV6 A;  1B35 A;  5I8Y A;  3WDY A;  5BNP C;  4RA0 A;  3HBZ A;  4AHW A;  1QOS A;  2HWD 3;  4AQ2 A;  4FQ4 A;  1QJU 1;  2GDF A;  2JG8 B;  2ZPX A;  4QKF A;  1CAV A;  1QJX 3;  3LEG A;  4HSL A;  2R06 2;  4PT6 A;  1DLL A;  3KV9 A;  1KQR A;  3BYW A;  3OBA A;  4DRV A;  1W6Q A;  3VBU A;  5JZG A;  1NKG A;  2RR1 3;  2QDN A;  1GNH A;  3ZYF A;  4Y26 A;  2H6B A;  2ZJC A;  3KCX A;  3GBG A;  4GWM A;  1ASJ 3;  2YBP A;  1GFF 2;  4CEW A;  5LW9 A;  2ZHL A;  4CTE A;  3LGR A;  4HVQ A;  4CDQ B;  3ACG A;  1OLM E;  1EAH 1;  2GH8 A;  3RI9 A;  5IYY A;  2NP0 A;  1OQE A;  4LO8 A;  4XDO A;  1COV 1;  2VQ0 A;  4R9B A;  1MAC A;  1PVX A;  4XOG A;  5I91 A;  2X10 A;  3WD5 A;  1NCR A;  3H3Z A;  3I54 A;  3SH5 A;  3HIF A;  3ZSK A;  4XIO A;  3RZH A;  3VD5 A;  1MS1 A;  4JDO A;  4LOS A;  1CR7 A;  5CAZ A;  5EIY B;  4YM1 A;  1VIW B;  3TEX A;  2A7A A;  3LDK A;  1QDO A;  1O3T A;  3NL1 A;  5EQU A;  2QQL A;  5FY9 A;  2BGO A;  2XG3 A;  3DYO A;  1R1Z A;  5GLV A;  4XJW A;  5I0U A;  1WLT A;  4XF3 A;  3WF4 A;  1FX5 A;  5C5U A;  3MIC A;  5FZG A;  3GBF A;  3L2H A;  2WSU A;  1BK1 A;  2BV4 A;  5HBA A;  2DUO A;  2GZW A;  2XBO 1;  3N9L A;  4OYU A;  2X5I A;  3PTY A;  4H3W A;  4MOA A;  3C7H A;  1NA1 A;  3JU9 A;  2WT1 A;  1HN0 A;  1ULO A;  4Z2A A;  1OUS A;  2YC2 A;  3LEM A;  1GWK A;  3T2P A;  4A6O A;  1OH3 A;  1ZVF A;  1ZZB A;  2WL1 A;  2CGP A;  3EYP A;  4GH4 C;  3RGB A;  5JSR A;  4BQ5 A;  4F8A A;  2WWJ A;  2Z4F A;  4Q1R A;  3VBO B;  4AED A;  3CU7 A;  2VPV A;  3GAL A;  4EJR A;  4OUL A;  2VW0 A;  2NMO A;  3ILR A;  1POQ A;  3M1H A;  2QUO A;  3EJK A;  2ORX A;  4XF0 A;  4OFG A;  3LB9 A;  2W47 A;  4MLO A;  1G9C A;  1RUD 1;  3OJB A;  1N1V A;  3UGH A;  5FYT A;  4HK9 A;  3S7E A;  1RUI 1;  3ZKY A;  2DUP A;  5EJ3 A;  1JYN A;  3MLL A;  4EN6 B;  1ULG A;  2FCT A;  3QH6 A;  5CKQ A;  3CDZ B;  4JHZ A;  1H8T B;  1J58 A;  1ASJ 1;  3BTA A;  5CB7 A;  1UYP A;  5D8A A;  2JX9 A;  2O8O A;  3S7I A;  2WNV A;  3J7L A;  3U1X A;  5FO8 B;  3D6E A;  3LFI A;  3ZFE B;  5FWJ A;  2DV9 A;  2LM3 A;  1JYI A;  2I2S A;  2DCY A;  2NYY A;  2NM1 A;  3PMS A;  5C33 A;  4XZU G;  5JPN B;  1U0A A;  3I2G A;  4S2G A;  4YVS A;  1V9U 1;  3VV1 A;  1PO1 3;  2RS5 2;  5IFT A;  3V0B B;  1VRB A;  1E5H A;  1ST8 A;  3MIB A;  3BI3 A;  2R7E B;  5DUU A;  2B45 X;  5JXI A;  1D2Q A;  4XFH A;  3VD4 A;  5DAB A;  2XLF A;  1GUI A;  1X8M A;  1DGR N;  1W8N A;  4ISQ A;  1RUO A;  4Q4Y 2;  1TG7 A;  1JI6 A;  1TME 1;  3O7O A;  1KFX L;  3ZFF A;  2MPF A;  2JDP A;  1PMH X;  2MNG A;  4D7S A;  2BTV C;  3C7E A;  3ES4 A;  5F5C A;  4WM7 C;  2WFF 2;  2A75 A;  1AR6 2;  4AVV A;  1V6I A;  1W0O A;  1VMH A;  2GN7 A;  4LPL A;  4ZY9 A;  4BIF A;  3DN7 A;  3PJQ A;  5ACA 1;  5HI0 A;  5AC9 1;  4XJ8 A;  3VDC A;  3ZN6 B;  3DXU A;  4EZ4 A;  5SV8 A;  4AI3 A;  4MG2 A;  2IC1 A;  4OI2 A;  3JQX A;  4HG6 B;  3T2Q A;  3WG3 A;  5HCA A;  3TEZ A;  3UT0 A;  2D3R A;  2UYA A;  3VDD C;  2VJX A;  1EV1 3;  2ZAA A;  1F9K A;  3WLU A;  4IE7 A;  4BQW A;  5FP8 A;  5FZ7 A;  5GZD A;  4IXL A;  5EJ1 B;  4I30 A;  2QQM A;  4XFG A;  2YU2 A;  4Z82 A;  4NHX A;  5K7P A;  1PGL 1;  5FP7 A;  3Q8B A;  3U78 A;  5A33 B;  4H55 A;  3PU3 A;  4Y1Z A;  4QKD A;  4Q4V 3;  2QQJ A;  2EID A;  3I2J A;  3POY A;  4N53 B;  4AF9 A;  4HBN A;  4JZR A;  5FKB A;  3CF6 E;  4CUB A;  1QJZ A;  4OMD A;  1TQ5 A;  4CYD A;  4QDR A;  1GWL A;  2E33 A;  1HRV 3;  1C8M 1;  2ZGO A;  4XVH A;  4XZP A;  4XXP A;  3WIN E;  4PLM A;  5IVF A;  1R64 A;  2RMU 2;  3MV0 1;  1I1E A;  2G1M A;  4L11 A;  3FZ3 A;  3WSO A;  2VZV A;  4CE8 A;  3V0A B;  4OUS A;  2R0H A;  3ITQ A;  1HLC A;  4XUP A;  4Q4W 2;  4QWN A;  5FAX A;  2ZXQ A;  3DF0 A;  3AYD A;  2ARB A;  2R1D A;  3OEB A;  1J1T A;  4YPJ A;  5E89 A;  1W99 A;  5FY4 A;  2J1V A;  4EN0 A;  1H0B A;  4HKL A;  1PO2 1;  1F2N A;  3ZYR A;  1GWM A;  3THD A;  1QU0 A;  4JGY A;  5DG2 A;  3USS A;  5C8C C;  5FZ4 A;  4JKL A;  2J1R A;  1OF4 A;  5BNO A;  1FNY A;  2ZOE B;  3KGZ A;  1HRI 2;  4LTA A;  3I8T A;  2A6W A;  4MX3 A;  1R09 2;  1TEI A;  5KBF A;  3K75 B;  1D2S A;  2QQN A;  3DYM A;  1I3H A;  4JTN A;  1AYN 3;  4K8R B;  1YFU A;  4NHK A;  5A3W A;  5IHR A;  1QH7 A;  4LK6 A;  1LHN A;  5ANN A;  5EFU A;  1KEX A;  1NLS A;  1JYX A;  1RUF 3;  5I0S A;  2EA7 A;  4RHV 3;  1EV1 1;  3NNL A;  4PI0 A;  4K9S A;  2Y6K A;  3BOD A;  3R05 A;  4Q27 A;  3SXW A;  4AVC A;  4Q0V A;  3I59 A;  4Q4X 1;  1LOC A;  5GLW A;  4UXA A;  2HWE 1;  5F3G A;  1JYW A;  1ZNP A;  4BQX A;  2PHD A;  1GZW B;  1RHI 2;  1SBF A;  3K3N A;  1K12 A;  1S0E A;  2CGO A;  1VPH A;  4GZ9 A;  3C7G A;  3ZM8 A;  1OLM A;  4QB2 A;  3TNP B;  5K0U A;  2TBV A;  2PAE A;  2VZS A;  3VHR A;  3T0B A;  2ZEW A;  2HEV F;  5A32 A;  3GDB A;  1WME A;  4TXW A;  2PMW B;  3CKH A;  3WQ1 A;  3ASI A;  2ZEY A;  3GZA A;  4HON A;  4LK7 A;  4YW4 A;  3VB9 A;  1MS5 A;  1RUH 2;  2KM2 A;  3OY8 A;  2CWS A;  1HV1 A;  3T4H B;  4ZU7 A;  3LA7 A;  1E5S A;  4AQS A;  1BHG A;  1UNB A;  4FP3 A;  2WO2 A;  4OHY A;  4PLO A;  3NJY A;  1IS6 A;  2J1T A;  2JKX A;  4I3G A;  3ZYH A;  2HEY F;  4FOQ A;  3I2D A;  1QWR A;  2E9Q A;  4LLF A;  5FQ0 A;  4ASM B;  2D44 A;  3WW3 A;  1HX6 A;  2J42 A;  1H9W A;  3FMG A;  1K5M B;  3OD0 A;  1Q8P A;  4RQP B;  5KXD A;  4E4Z A;  4EN8 B;  1OOP C;  1RVF 1;  1R08 2;  4A4A A;  4FSJ A;  4ORF A;  5F6K A;  1F4H A;  5BUV A;  4QPI A;  1XNT A;  2GMP A;  2WLP A;  1SBE A;  1OA4 A;  3N3H A;  3GZE A;  4V2W A;  1F5J A;  1AR8 1;  2ILM A;  2MEV 3;  3AKR A;  1FOD 2;  2ZHM A;  2P1B A;  4AHY A;  5L7O C;  2WO1 A;  1JS9 A;  4NPM A;  1LHU A;  1SLI A;  5J1X A;  2EIE A;  4GJY A;  1LOB A;  3NV1 A;  2YZ4 A;  1PVC 1;  5DDJ 3;  4XCA A;  3SLI A;  1NCQ A;  4KH9 A;  3VZK A;  4EZH A;  2YFZ A;  1OFS A;  5BY5 A;  1AVB A;  2IFR A;  2W95 A;  3GHN A;  4HPK A;  5J7M A;  2WKK A;  1IZ3 A;  4JRL A;  4IV3 B;  1E57 A;  1ZBA 3;  3CJI C;  5CFC C;  1FMD 3;  1RGS A;  1VBB 1;  4BPZ A;  1QJX 2;  4A45 A;  3DPR B;  3I3Q A;  4UOJ A;  3VL9 A;  3S5A A;  5K9Y A;  4TYS A;  2VMH A;  3CEW A;  5LCW L;  2E7A A;  4B8E A;  4UBH A;  2D98 A;  3RDI A;  4BIO A;  1W6N A;  1QDC A;  3TB0 A;  2WDB A;  2RR1 2;  2CTV A;  3GXU A;  2DDU A;  3N7L A;  2WQZ C;  1CAX A;  4OUM A;  4AI1 A;  1TNF A;  4GUL A;  5LY1 A;  5FPB A;  3OYW A;  1JUI A;  3TOJ A;  5JI7 A;  3PJY A;  2XGX A;  3ZMN A;  3UKT A;  3VBH B;  2OVU A;  2BPA 2;  2AYH A;  3ZYJ B;  4MYE A;  4Q2F A;  4YRD A;  1PIV 3;  3ZVX A;  5BNN B;  5C8W A;  1UPI A;  4FI9 A;  4QDQ A;  1YLL A;  4MET A;  5CA6 A;  3FFQ A;  1XNC A;  5LA2 A;  4IEZ A;  2VMD A;  1CAW B;  2VD7 A;  2OYZ A;  3JD7 1;  3QH7 A;  5L9R A;  5GAL A;  1IS4 A;  3E6C C;  4U36 A;  2RS1 2;  4QX5 A;  3N4M A;  4MGZ E;  4ZU4 A;  5C9A A;  5I8S A;  1VBC 3;  2WNU B;  1JOJ A;  1HKD A;  5CFD C;  3JBG 3;  1L3J A;  4L0P A;  2HWB 2;  4CXY A;  1WW5 A;  1LGN A;  2VM9 A;  1UYX A;  1XE8 A;  2WZR 2;  1DP0 A;  1DGR A;  4GAZ A;  4XQD A;  1QJY 3;  5A3L A;  1W2T A;  1MS8 A;  4GB3 2;  5FZ8 A;  2EIC A;  3ZXG A;  1AR9 1;  3VHP A;  1H6Y A;  3KT1 A;  1NQJ A;  1CJD A;  1VBD 1;  3NAP B;  5KWR A;  1G9B A;  1C4R A;  1ZZ8 A;  2DVB A;  5DXD A;  1S2K A;  3P3P A;  1AHS A;  2P2K A;  4CDU B;  5A1A A;  5JDB A;  3S57 A;  1NQD A;  1DBN A;  1PZ7 A;  1LOF A;  4XTP A;  2C6S A;  3KB5 A;  2W52 A;  1PX3 A;  3EO6 A;  4E4H A;  1N47 A;  5JUV A;  1OHF A;  1OD3 A;  3WCS A;  5D2A A;  1UYY A;  4PDW C;  4XC9 A;  2WAA A;  3BIW E;  1OUR A;  2AEZ A;  3ES1 A;  1W6P B;  3PUS A;  4LQR A;  4I0W B;  1AR7 3;  4FOV A;  3WVJ A;  4BQ3 A;  1UOJ A;  5FYH A;  5JCT A;  1NLR A;  2CNA A;  3QLQ A;  4MGI E;  5EV7 A;  1O3Q A;  5LEK A;  4AI9 A;  1VBE 2;  1XSR A;  3I2F A;  4YVW C;  3KHB A;  4ARY A;  4LO5 B;  4D0Q A;  4NVP A;  4E2Q A;  1ULC A;  4FPC A;  5EHD A;  1DDL A;  2VOV A;  3WUD A;  3OUJ A;  4P9I A;  2R06 3;  4UF0 B;  5JIU A;  4I2O A;  2W5F A;  1Q5O A;  4QGL A;  1A8D A;  3U4X A;  1Y4W A;  5CNA A;  1AYM 3;  1YIF A;  2WQ4 A;  4GKY A;  1UXZ A;  4PIY A;  4U2A A;  1QNW A;  2W92 A;  3X29 B;  4FAH A;  1VBC 1;  1RJ8 A;  1QQP 2;  3JBG 1;  4NN0 A;  5A6Y A;  1J83 A;  2QJV A;  3KF3 A;  3AK0 A;  4LHS A;  4AEJ A;  5BNP B;  4AI8 A;  2HLE A;  1I9R A;  2J1U A;  4QM8 A;  4COW A;  4XJA A;  1DYK A;  1MZ5 A;  3AP6 A;  3ZSE A;  1ONA A;  5J36 A;  1FI2 A;  5FXV A;  1DGW X;  3UJQ A;  4XW3 A;  1V6O A;  1W8O A;  3KZ4 C;  1AF9 A;  4XIL A;  4HKW A;  4QPW A;  4JKM A;  5JOW A;  5LAT A;  2VQA A;  3AYC A;  4IV1 C;  5FCC A;  2B8M A;  3BOW A;  4DZG A;  1BCX A;  5J48 A;  2K9Z A;  3AMN A;  3A7Q A;  5EP9 A;  2XWB B;  1RIN A;  2XML A;  4M0H A;  1EPW A;  3ME2 A;  1N1Y A;  2G9F A;  4Q4V 2;  4YW7 A;  3UYJ A;  2FDI A;  1OI6 A;  2QDR A;  2WAB A;  4S2D A;  4ZON A;  3WDT A;  4OI1 A;  1FPN 1;  3KT4 A;  3ACI A;  1XJA A;  2QFE A;  1H8V A;  2PHX A;  2VG9 A;  3V56 A;  1D0G A;  2O14 A;  2Y26 A;  2JEM A;  1W9Y A;  4XFA A;  4Y1V A;  2ZEX A;  4Y4Y A;  3FLT A;  2ZHN A;  3POG A;  2EXI A;  5FZB A;  3INA A;  3BB6 A;  5F3I A;  3LA3 A;  2W94 A;  1RUE 3;  2BJS A;  3POE A;  4LO7 A;  3FJS A;  2J7M A;  4MO3 M;  2DTW A;  3SCF A;  4CCE A;  2WA4 A;  4PJY A;  3V65 A;  4FTB A;  3NNF A;  4N9H A;  2R06 1;  4HT1 T;  3POB A;  2WSV A;  1S0J A;  1POV 3;  3N7M A;  3ZO0 B;  3WF0 A;  4IEY A;  3VBO A;  2OW4 A;  1F5F A;  2IZW A;  2C0Z A;  4N7U A;  5FJK A;  4GH4 B;  1O8S A;  4Y5S A;  3DCQ A;  4N9I A;  3T2T A;  1X82 A;  2ERF A;  3LDB A;  3OSD A;  4YGD A;  4B3N A;  4D7Y A;  2VQT A;  4CU8 A;  1GP6 A;  2JE9 A;  3I2H A;  1US2 A;  1ZM1 A;  4LXL A;  5FOJ B;  2BW8 A;  2P3J A;  5D1I A;  1X33 A;  2OXB A;  3WW1 A;  1GQG A;  1MZE A;  4XHX A;  5FP4 A;  3ABZ A;  1ZRI A;  2V4V A;  1FNZ A;  1RUF 2;  2D7F A;  2VEC A;  2Y6H A;  1UKR A;  2NPI A;  3KGL A;  4IUG A;  5FYV A;  5LK7 B;  5C5T A;  4DXT A;  2HWC 2;  4QPY A;  2X05 A;  3ZFE A;  1LOD A;  5FMC A;  2JIG A;  5APA A;  1UMH A;  2JE8 A;  3T1L A;  4DXR A;  2ZGT A;  4NRM A;  3HNY M;  4DEV A;  2OZJ A;  1YHF A;  2ZKN A;  2QQW A;  4JVA A;  4M01 A;  4CP9 A;  2DCK A;  3V0B A;  3NWK A;  4EN9 B;  1W6M B;  2Z42 A;  2OS2 A;  2CHH A;  3G7D A;  4D3W A;  5A6Z A;  5J3U A;  5FZ6 A;  2WO7 A;  1AR6 3;  1GAN A;  3PUA A;  3TN9 2;  1RJ7 A;  2VCC A;  5FMB A;  5FPZ A;  3ZXK A;  2ORZ A;  1XYP A;  1RUC 2;  1PM4 A;  4LBM A;  5A3O A;  4NIA A;  3BVC A;  3ZSJ A;  2KD7 A;  4I02 A;  1I5Z A;  4DUV A;  4AI2 A;  2DCZ A;  2VH9 A;  1RXF A;  1GNZ A;  2NMN A;  1H2M A;  4JTO A;  1W8U A;  2SLI A;  3E5X A;  1K42 A;  4M3C B;  4N43 A;  4COZ A;  2B39 A;  1MS4 A;  2RE9 A;  2XQX A;  3OBT A;  3NQH A;  4YZ3 A;  1QNY A;  5DMY A;  1PK6 C;  2EIB A;  2GAU A;  5EXO A;  2FDJ A;  3W59 A;  3U11 A;  2NN8 A;  1XE7 A;  2YG0 A;  3F2Z A;  4FT8 A;  4WM7 B;  4NWW A;  1VMF A;  3AMH A;  3ZR5 A;  5F32 A;  1G9D A;  1BKZ A;  2XVG A;  3B00 A;  2FZ1 A;  1WMD A;  1PMI A;  2X8K A;  1QJF A;  4ERO A;  1UL9 A;  3ZR6 A;  1AUY A;  1GOH A;  2B42 B;  3LWC A;  3AMM A;  3JXS A;  4IV3 C;  3H3U A;  5E8A A;  2P37 A;  5A33 A;  1SMV A;  3VDD B;  4Z92 B;  1DF0 A;  1OQ1 A;  3ZX7 A;  4MGK E;  5F6L B;  2HBU A;  3NJV A;  4JRA A;  3J26 N;  2R49 A;  1W90 A;  2H0V A;  3KVB A;  2RS5 1;  3LOI A;  5CU1 A;  1U5I A;  2BER A;  2FD8 A;  4J25 A;  4JCK A;  5FWE A;  1NUK A;  3P1I A;  4Q4W 3;  4Y22 B;  5DZE A;  1YJL A;  2BQP A;  3FN9 A;  2EVX A;  4PF5 A;  2IXI A;  2GN3 A;  5DDJ 2;  5B4X A;  5T5O A;  1AJK A;  4KU7 A;  4A7Y A;  1ULD A;  2RVA A;  4ITC A;  4OHV A;  4IEO A;  1YFX A;  2E63 A;  4Q4Y 1;  4UI9 L;  1MR5 A;  3KD4 A;  3VBU C;  4OQ9 A;  3RSJ A;  1PGW 2;  3HQR A;  3V0A A;  4DY5 A;  1ZBA 2;  2J1E A;  4BCU A;  1WCU A;  4P14 A;  2ARE A;  3GHM A;  5TSW A;  1LGB A;  2Q8C A;  3VBH C;  4A2U A;  2WFF 1;  4LJH A;  5JR2 A;  1W8T A;  3OF1 A;  3OGJ A;  3C2U A;  3K3O A;  4FXK B;  1NE4 A;  5GLZ A;  3VN4 A;  4K8F A;  2GC1 A;  3WY6 A;  1D7P M;  4URT A;  3DKW A;  2UY9 A;  1VAL A;  5LBF A;  5LWB A;  2BFU S;  1JZ5 A;  3PVB B;  2WT0 A;  4NII A;  2JWP A;  3I3E A;  2UU8 A;  4DQA A;  4HMZ A;  4IGQ A;  5F3E A;  5C8C B;  2QQP A;  2PQS A;  3GZT B;  1UIJ A;  2WNU C;  1Y9G A;  1OPM A;  2QQV A;  1HXS 2;  1YWK A;  2ZMK A;  4WBB A;  1P8J A;  1PIV 2;  4AVT A;  1H4H A;  2VTF A;  1MEC 3;  3MLJ A;  1RHI 3;  1WD4 A;  2WZ8 A;  3VKO A;  1O3S A;  5E1R A;  4AI0 A;  1BQP A;  4AYU A;  2P3Y A;  3UL2 A;  4FFI A;  1NA1 C;  4Y3O A;  4NAM A;  5LA9 A;  3TWI A;  3W21 A;  2DU1 A;  2CDO A;  3OOX A;  4OZO A;  4BK4 A;  4Z07 A;  1QOO A;  2JDH A;  1TE1 B;  5LEJ A;  1RUH 3;  3PUR A;  2VZQ A;  2RMU 1;  4AED C;  5DAP A;  3AFK A;  1SFN A;  2C5D A;  2JEC A;  4XAE A;  2JJ6 A;  2YGM A;  4Q4W 1;  1GIC A;  1JOD A;  1XNK A;  1LHW A;  4P9W A;  1KJL A;  2QQK A;  3T3Y A;  4MXV A;  1GOG A;  1NXM A;  2PYT A;  3RG0 A;  5HV0 A;  4YAR A;  1DYP A;  4NPL A;  1RIT A;  2W1Q A;  2TUN A;  2D40 A;  2E53 A;  4KQ7 A;  5HV4 A;  4A7K A;  1Y43 B;  2YPJ A;  2WNO A;  3MUZ 1;  4P9Y A;  5EWS A;  3VD3 A;  4CUC A;  3U37 A;  3BCW A;  2A1X A;  5C4W C;  5LA0 A;  1FYU A;  4SLI A;  1LOE A;  3A21 A;  4AFM A;  5FUI A;  1HRI 1;  3PLQ A;  1QMJ A;  2R04 2;  3WHU A;  1YJK A;  4ARX A;  1R09 1;  4RYD A;  2VXR A;  4KGG A;  4QU1 A;  1FOD 3;  3U10 A;  3IMN A;  4UWD A;  1K5M A;  3WP3 A;  4PHZ A;  3AB0 A;  1YIP A;  2XJV A;  4QMA A;  4RQP A;  3GZU C;  4XFF A;  3VBR C;  2UY8 A;  3D3A A;  3UKV A;  4HN0 A;  1O91 A;  4JGZ B;  1AR7 2;  5BNQ A;  2CY6 A;  3PHM A;  4LE3 A;  1CPN A;  1WLC A;  4KMQ A;  5JXH A;  1D4M 2;  1O5L A;  4DO0 A;  1OOP B;  1N1T A;  5CG9 A;  2VBB A;  5FO7 B;  2B9V A;  1GMM A;  3LA2 A;  1XNB A;  2B4K A;  1DYO A;  1FV3 A;  1UN1 A;  2VW1 A;  3ACH A;  4XF1 A;  4V2V A;  1GZT A;  3ZFF C;  1YNA A;  2DVA A;  2ZGU A;  4R9C A;  4PBO A;  4TLF A;  2K46 A;  1SPP A;  4L92 A;  3AX4 A;  4N90 A;  5L7O B;  5L73 A;  1EP0 A;  2AEY A;  1AYM 2;  4BQ4 A;  3LKJ A;  5DUV A;  4FPF A;  2BNM A;  2ZML A;  5FDB A;  2D3P A;  4Z8B A;  1OPO A;  3M7A A;  1V6J A;  1UY1 A;  3M3Q A;  3PIJ A;  4DIN B;  2BOJ A;  1S4C A;  1IKP A;  3IDA A;  5FBZ A;  3CQO A;  1UQX A;  2WN2 A;  3DPR A;  3B3Q E;  4QPG A;  5IVV A;  3P3N A;  3CJI B;  5J37 A;  5CFC B;  4AR2 A;  1GR3 A;  2WJS A;  2VOK A;  2BNN A;  3V64 A;  3GNE A;  3ZIX A;  1T2X A;  2AR6 A;  1MPX A;  2VQU A;  3IM0 A;  4JV4 A;  4Q8L A;  3HQU A;  5IVB A;  2ZS6 B;  4LBQ D;  2XJU A;  1R08 1;  4YWA A;  4UW4 A;  2DUR A;  2RS1 3;  5GJ6 A;  4P9X A;  4E8C A;  4GIQ A;  4FBF A;  5EYX A;  4QB1 A;  4UW5 A;  4BA6 A;  5BNN A;  1G9F A;  3DXT A;  1UD1 A;  4RS5 A;  1FOD 1;  4M3C E;  4JC1 A;  4F83 A;  2KXL A;  3PUI A;  4YLZ A;  1CAW A;  3TNQ A;  2VTX A;  2HWB 3;  5T5J A;  2HWF 2;  5L36 A;  3BUC A;  3ST7 A;  4J1W A;  4P5Y A;  1J1L A;  5IK8 A;  1AL2 2;  3KQR A;  1LES A;  2WZR 3;  3M3C A;  1G6N A;  1N3O A;  4GB3 3;  2RM2 3;  1RUE 2;  1D0H A;  1VBA 3;  4QQP A;  4BLJ A;  5FYY A;  4CEY C;  5ABJ A;  2HWD 1;  4UW3 A;  4JGY C;  5T5P A;  1DZT A;  1JW6 A;  2VBD A;  1QJX 1;  5BNO C;  3J8F 2;  5CFD B;  3HWJ A;  3MW3 A;  3I2I A;  2LTN A;  3U0Z A;  3UGG A;  2B46 X;  3MEP A;  3AYA A;  3R4U A;  4ET7 A;  2RR1 1;  2OA2 A;  5FYB A;  2F4L A;  3NV3 A;  2ZZQ A;  1XB9 A;  3HNM A;  2ENR A;  1CAU B;  2OPW A;  3IDE A;  5EZW A;  5F5A A;  2VGD A;  3WNN A;  5A1F A;  1O8P A;  3CZJ A;  3JB8 A;  2OX0 A;  4IEW A;  4K20 A;  1XBF A;  1VBE 3;  4KG8 A;  1S0I A;  2DVD A;  4XYX A;  4AVS A;  1U12 A;  3NV4 A;  3PUH A;  4YG6 A;  4DS0 A;  4XFB A;  2ET1 A;  1XNA A;  1W6P A;  3RPQ A;  1RL3 A;  1H1A A;  3IZO A;  4FPL A;  4MUV A;  4R52 A;  4XUR A;  3OUI A;  1OVS A;  1KDK A;  1J3R A;  2O1Q A;  4CZS A;  4PDW B;  2QZ2 A;  2CAV A;  1CX4 A;  1WKY A;  2CL2 A;  1X8E A;  2ZAC A;  2RS1 1;  5FBJ A;  3TEW A;  1OH4 A;  2BYV E;  4XEZ A;  1W8Z A;  5FPA A;  1JU4 A;  1QQP 3;  5CIS A;  4XBL A;  1UY3 A;  4YVW B;  4UF0 A;  3LZZ A;  3I3D A;  1ZRR A;  2EAA A;  4H2A A;  2XXZ A;  4HET A;  4D6R A;  4ONU A;  1W9S A;  2WYF A;  5LBB A;  4BDV B;  2ARC A;  3LOB A;  1W2U A;  2FCV A;  4FCA A;  5FK7 A;  4GB3 1;  2OQ7 A;  1ALY A;  3IWZ A;  3AZV A;  4MXW B;  3CZU A;  2XJT A;  1JU3 A;  2BGP A;  2VMI A;  2P3I A;  2LW8 A;  5BNP A;  2HYX A;  2IXK A;  2VOT A;  1G7Y A;  3ZOI A;  1A6C A;  4N7I A;  1HQN A;  1ULF A;  3VKF C;  1H4G A;  3NKG A;  2VO5 A;  4BXS V;  3RMY A;  1JZ4 A;  2O0O A;  1UKG A;  4QPI C;  3SIS A;  5FRE A;  5A6X A;  2P34 A;  2PHF A;  3VUO A;  1KJR A;  1QF3 A;  2A73 B;  3FUQ A;  1Y9M A;  5IAT A;  3M3I A;  5DUX A;  4YGB A;  1WCK A;  2E7T A;  3SNM A;  3BGA A;  2VVE A;  4CXW A;  4XUT A;  1NCQ C;  1H6X A;  2ZGP A;  2AC1 A;  2BRT A;  3MFC A;  3E6D A;  4IV1 B;  4QX3 A;  1RUN A;  1Y3T A;  1ENQ A;  1OD5 A;  2UWA A;  3IAP A;  3P5B A;  1PO1 1;  5DAX A;  5A3P A;  2P4E A;  3AM2 A;  3OGV A;  4WV8 A;  4XDP A;  1B09 A;  3MF9 A;  3O0V A;  5FMO S;  4P08 A;  3RI8 A;  2FHR A;  4QGM A;  1ZX5 A;  1S0C A;  4BHP A;  1HW5 A;  4AWD A;  1UOB A;  4KWK A;  1VP6 A;  3I2K A;  2NZ9 A;  2JDU A;  4CDW B;  5FZ0 A;  2IWG B;  1APN A;  1RMU 2;  2W08 A;  1JBC A;  4QQH A;  5A7W B;  3WHT A;  2VZ1 A;  5FY8 A;  1HIX A;  3UET A;  4D6Q A;  3VBS C;  1AL0 G;  4XBN A;  3DEC A;  3TAY A;  2XL9 A;  4CCD A;  3K46 A;  1NX9 A;  3IKW A;  2WNE A;  4YW6 A;  4ZXE A;  3B9I A;  4UFI A;  1G86 A;  1OLR A;  4QM9 A;  3PDQ A;  1GLH A;  2YU1 A;  3MW2 A;  3ILF A;  5ERL A;  2JXA A;  4AQ6 A;  4W6X A;  1W06 A;  4MZU A;  3NJZ A;  4DUW A;  1V70 A;  2HWC 3;  1A78 A;  2N7G A;  3WOG A;  3BIE A;  2FDF A;  1C3H A;  2V09 A;  4IE5 A;  1N3P A;  3AKS A;  1JUH A;  5H9S A;  3OCP A; 
#chains in the Genus database with same CATH homology
 4IDZ A;  3T3Y A;  4CXX A;  3O1S A;  3BTY A;  3H8O A;  4NPL A;  3RZL A;  3KHB A;  3LFM A;  4QKF A;  4MG2 A;  4NRQ A;  4JHT A;  4NJ4 A;  4QKN A;  4IE7 A;  4O61 A;  4NPM A;  3BTZ A;  4O7X A;  2FDJ A;  3BU0 A;  4QKD A;  3H8R A;  3RZK A;  3I49 A;  3O1V A;  3O1O A;  3RZH A;  3I3Q A;  4QHO A;  3S5A A;  4ZHN A;  4IE0 A;  4IE6 A;  3O1P A;  2FDH A;  3BTX A;  3O1R A;  4OCT A;  4MGT A;  2FD8 A;  3RZJ A;  4IE4 A;  3RZM A;  4ZS3 A;  4NIG A;  2FDI A;  3I2O A;  4NRO A;  2IUW A;  3I3M A;  4NIH A;  2FDK A;  4QKB A;  4CXW A;  3RZG A;  4NID A;  4NII A;  4CXY A;  3BUC A;  4NRP A;  3KHC A;  3H8X A;  4ZS2 A;  3BI3 A;  3BKZ A;  2FDG A;  3O1U A;  3S57 A;  5DAB A;  3T4H B;  5F8P A;  4RFR B;  3O1T A;  3O1M A;  2FDF A;  3BIE A;  4NRM A;  4IE5 A;  3T4V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...