3O1UA

Iron-catalyzed oxidation intermediates captured in a dna repair dioxygenase
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
202
structure length
202
Chain Sequence
EPLAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMSVAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLCQRAATAAGYPDFQPDACLINRYAPGAKLCLHQDKDEPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGIQPLKAGFHPLTIDCRYNLTFRQAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Iron-catalysed oxidation intermediates captured in a DNA repair dioxygenase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords Alpha-ketoglutarate-dependent dioxygenase AlkB
total genus 50
structure length 202
sequence length 202
ec nomenclature ec 1.14.11.33: DNA oxidative demethylase.
pdb deposition date 2010-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 3o1uA00
3S57A 4RFRB 5F8PA 4JHTA 2FDJA 3O1OA 4ZS3A 4NPLA 3O1MA 3T4HB 4IDZA 3RZLA 2FD8A 4QKFA 4IE0A 3I3QA 4IE6A 2IUWA 4ZS2A 4OCTA 3H8XA 3BTYA 3BTZA 3BIEA 4QHOA 3BU0A 4MG2A 4IE4A 4NJ4A 4NRQA 3T4VA 2FDHA 3BI3A 3RZMA 4MGTA 4NIGA 4NIDA 3RZJA 3RZKA 4NROA 4CXXA 3BTXA 4QKNA 4NRMA 3O1UA 4NPMA 4O61A 3KHCA 3BUCA 3O1SA 3I2OA 5DABA 4IE5A 3BKZA 4O7XA 4NRPA 3O1RA 4CXYA 3H8RA 3S5AA 3I3MA 3H8OA 4ZHNA 3I49A 3RZHA 3O1TA 4QKDA 2FDGA 3O1PA 3KHBA 3O1VA 4IE7A 3LFMA 3RZGA 2FDKA 2FDFA 4NIIA 4NIHA 2FDIA 3T3YA 4QKBA 4CXWA
chains in the Genus database with same CATH superfamily
4K8FA 4CCEA 3O1MA 1FV3A 3NL1A 3OEAA 1DGRA 2IVJA 1V70A 2JIJA 1O7FA 1XNDA 3WNNA 1LESA 3IPVB 3UYJA 4BYYA 4CDXA 4DXTA 3BU0A 1CWPA 2JWPA 1PVC3 5EYXA 2QBXA 4CDQC 1RINA 3U0ZA 2XUEA 1K12A 1MS8A 3DPRA 2GH2A 4AOCA 3N35A 4XFAA 1I9RA 1NCRC 3ATGA 4GB31 1H6YA 1Y9MA 4BWOA 3UGGA 3FLPA 5FJKA 5JR7B 5FIXA 1RVF1 4XUTA 5CB7A 3ZYPA 1UZVA 1W39A 4A4AA 3M3EA 1H2LA 1EPWA 1UZZA 1K3IA 4I02A 1LHOA 1W9WA 1KFXL 3ZFFB 2VOXA 3RJ2X 3ZM8A 3T30A 4JQRA 1VBA3 4WVVA 5BNNC 2QDRA 4QHOA 2SBAA 4FI9A 4AK3A 2VL4A 3GBFA 3P5BA 4AI8A 1MQTC 4RN5A 1WMEA 1LRHA 1SLLA 2V4AA 5JAXA 5CKMA 4QKNA 4NRMA 1DFQA 5FZKA 3KT4A 5GZGA 5CG8A 4EJRA 1ZBE3 2Z4FA 4OHVA 2R7EB 3I2KA 2VD7A 4LLOA 4F83A 2WWUA 2EF6A 4KG8A 1AYM3 3OY8A 1SFPA 1GWLA 2PAEA 1OF3A 3GBGA 3IB3A 4AVBA 5GLUA 4E9KA 3VBSA 5KXEA 1Y7BA 2GC2A 1UZYA 1KJRA 1OD5A 3MV11 2W91A 4LMFA 4MX3A 4QPGC 4QX1A 3J26N 5FZLA 4OHZA 4B4RA 1A34A 4J1XA 4B3NA 1BMV1 4XXPA 1CAXB 1R081 3VKOA 3ECQA 2JE8A 2W87A 1CQ9A 3RZKA 2NYYA 3I59A 5FY5A 1S55A 5EJ3A 3UK9A 2VZTA 4ATFA 1O3TA 3T0DA 1RHI1 1LECA 2ZGNA 4NR1A 1MZEA 1DLLA 2WN3A 4Q4Y2 4QX7A 3T2TA 3SCGA 1B35B 3CHXA 3BPSA 2WR9A 3O0XA 3LA7A 3BTAA 5G04L 2GMEA 1IKQA 5E16A 3JZVA 2D5FA 2J1RA 3I2IA 3O14A 4XF4A 4MLOA 5C7GA 4RD7A 1PGL2 2QFEA 2QQPA 1LGCA 2RS31 3VKLA 4RL7A 4XZUG 2EICA 3M8LA 3DGTA 4IL7A 5FYVA 1AL22 1GZWB 2AACA 1LOFC 2GSYA 2EXIA 3AK0A 3PVEA 2PLV1 2CAUA 4R8HA 3VD9A 4JKLA 2J1TA 1EUTA 5KHKA 2YBKA 2ZGUA 3WCSA 4X6RB 5IK7A 4GULA 5GZFA 1COV3 3HNYM 5K8SA 4E4SA 4WZCA 3RZJA 4DS0A 1W8ZA 1ZZ8A 1ZRCA 4LLFA 1TVGA 4FBFA 5K7PA 3EJKA 1EY2A 1C28A 1PK6B 5LCWL 3H7YA 2BBAA 1WUVA 1PO21 3VZLA 5DXDA 4CDUA 4G4FA 5K4LA 2ETEA 3B9CA 3TN93 2VOVA 2WFF1 4XHXA 2JX9A 1GWMA 1P8JA 3K77A 3F2ZA 4CCMA 5L19A 1O5UA 3OTFA 1UYPA 1RUJ2 4N7IA 1HB2A 1AXYA 1SDDB 4P5YA 1UZWA 1ZRIA 2JD9A 3AFGA 4R9BA 3AB0A 4HN1A 4CUBA 2FZ2A 3O1OA 2FDJA 1EUUA 4GWNA 3NQHA 4AI9A 4Y5SA 3AC0A 5CAZA 5CFCC 3NJVA 1QJX2 4OUSA 3MEPA 1WLTA 3HNMA 3WG4A 2XJSA 2RS11 2XJTA 1IGOA 2XH6A 3T4VA 3ZLIA 2AEZA 1OT5A 5KXBA 2CSGA 2V5DA 5FY8A 5FZ0A 2XWJB 3FHAA 1JXNA 4Y3OA 4CXXA 1BKZA 4CCCA 2G1MA 4IEOA 3ZKYA 4FPJA 4O7XA 4AW7A 3VBFC 4M0NA 3K4AA 4ZXEA 1VBE1 1K5MA 2VTXJ 1X8EA 3E5XA 2D6OX 2HYXA 1VRH2 3HBZA 4IV3B 3FE5A 4Q1PA 1E5SA 2BJSA 1T2XA 1PNGA 2ID4A 4PT6A 3QOPA 4XW3A 3CQOA 3ROUA 4CEWA 3FJSA 4PIZA 5IK5A 3MW3A 3RMXA 1W8HA 3SEPA 4AEJA 3WF0A 4PIXA 3Q8FA 3BIEA 2Y6FA 1WCDJ 4MGZE 1AYN1 1ZZCA 2OA2A 1DZRA 1GZTA 2QQOA 3I2FA 1B09A 3PIJA 4HXCA 4Y5Z0 3WT3A 2VNGA 5JIAA 1JZ8A 4ITCA 4AEDA 4O61A 1I6XA 2RM23 1QKQA 2VOKA 4NE9A 1GANA 2ZGMA 2VBBA 4I01A 4IEUA 5DPNA 3ES1A 1UOJA 2B4KA 3NV4A 3ZXKA 2DUQA 4TSVA 2XQRA 5T50A 2CNAA 2DFBA 2VZSA 2H0VA 5E89A 2WT2A 2DVFA 2DCYA 2YC0A 3NNMA 4IDZA 4JAAA 3RMYA 4LR4A 1UY2A 3PJQA 3TRSB 2OXBA 2ARCA 5FZBA 4CPBD 4GD4A 4AAPA 4K21A 2WBKA 2Y6KA 2YC4A 4GWMA 2XLGA 3S5QA 4B29A 5LEKA 3VBOC 3WXPA 5DUXA 4IERA 1PGW2 4XDOA 1MEC2 3CO2A 5JVVA 4LUMA 3ZXGA 3KV9A 3RPQA 3MLKA 2VBDA 2RDQA 2G4IA 4WM7A 4CZSA 4XQDA 4JX0A 4FVVA 5FFOC 4CDUB 4IV1A 2WO3A 2N7GA 1TZOA 4XQWA 2WNEA 2C26A 5E88A 1ODMA 4DXRA 5DAXA 1NY72 1TE1B 3DYPA 2WWSA 1W2AX 3W9AA 3KT1A 5A3WA 5ABJC 2HWC1 5DDJ3 2ARBA 1YFYA 4QKFA 1GP4A 5C4WA 1UY4A 3NV2A 1VE0A 2XGXA 2XXZA 3GZEA 4QD2A 2K46A 3KWVA 2R49A 1ZZ6A 1W8NA 1EAH3 2VMFA 2CV6A 5LBEA 2JENA 3SMHA 4COYA 1JW6A 5F3EA 1WMXA 4F3JA 5FYIA 2VQ0A 4J6GA 5FOJB 3WP4A 4BISA 4QDQA 1AYM2 5I0TA 3NSTA 1OD3A 1ULGA 5FPUA 4PHZA 1WBFA 2Q1FA 4M01A 4B4QA 3TNQA 1PO13 3OEBA 4R4XA 5JMOA 1OLRA 1NLSA 2AR6A 1S1AA 2ES3A 1D4M3 2WT0A 3C7EA 4NIAA 3KVAA 5H9RA 1TNFA 5A6QA 3UL2A 2B46X 4HETA 5D8AC 3ZN6B 3VGIA 3V0BA 1WWYA 3WNLA 1RUD3 5FZ7A 3VBHB 3I7DA 5H9QA 3AMPA 1RUF3 1J1TA 1O8PA 3ASIA 3W58A 1SQ4A 3LEIA 4N53B 3A4UA 1VBC2 1DCSA 3PVOA 1VBC3 4LPLA 3T1MA 2ET1A 1KD7A 3KS7A 1G9FA 1POV1 4Y1XA 2E9QA 3BVCA 5T54A 2ZAAA 3H3LA 1OLQA 3MIDA 1O3SA 5GZEA 1E5HA 2GC0A 2WRAA 2VU9A 3KV4A 4A2UA 4XQ4A 1C8NA 3OBTA 3CEWA 3OJBA 4NHLA 1HRI2 1N47A 2RR11 1Y4WA 2ZHLA 2XL7A 5FXZA 4JV4A 3MW4A 2O1QA 4QB6A 2EIBA 5ABJB 2YROA 2ZEWA 5FJHA 2W52A 4IEZA 2NQYA 3HJRA 2RS53 4I3PA 1GNZA 1F5FA 1VBD3 4LQRA 5FZ6A 5I0RA 1OQDA 3I3QA 1ZNPA 4MG2A 4OVEA 4JGZB 1Z7S3 2BZDA 3NKGA 3KV5A 3H3UA 4YVWC 1C4RA 4LOTA 1V6IA 3PU8A 4EZ4A 2A6XA 2OW4A 1KGYA 3WQ0A 5A3MA 2BV4A 5BNPB 3S7EA 3WF4A 4RS5A 5J09A 2E7AA 3RWNA 1ZBA1 4LO8A 1YI9A 5BNQA 1FOD3 4DB5A 2JJ6A 3NJXA 1PIV2 1NCQA 1COV2 1XNAA 3BU7A 3PURA 3P3NA 4N90A 4WVMB 1E57A 1HN1A 4IE7A 3VZOA 3WD5A 4C8DA 3LIGA 4WV8A 4Q0QA 5FXVA 1ZX5A 4W4ZA 1KEXA 4CEYB 4ZZ8A 1RL3A 1YQ2A 5FK7A 3PUHA 1UX6A 3LE0A 1BVVA 3O5SA 3H1WA 4HFSA 2G9GA 1YHFA 1REDA 3GF6A 1U5YA 1QOSA 2HWD1 2YGMA 4C1XA 2IFWA 2BVBA 2WT1A 2YZ4A 2ZA9A 2W9XA 1CAUB 1BEV1 3PUAA 5HCAA 1QH6A 5GLZA 5B4XA 5DAWA 3DEMA 5JMCA 2BW8A 2WQ4A 3U1XA 5L7OC 4BU2A 4QGLA 1NCRB 2D93A 4IEQA 3MFAA 4YZ5A 1HDKA 4XIKA 1ZRDA 4CCDA 4QB1A 2VZOA 3LEKA 3D8CA 1VAMA 1XNBA 2DCZA 2CDOA 2QE3A 3NAPC 1AR82 2WO1A 4FPOB 2JE7A 4OZOA 3L2HA 1FMD2 1JHJA 4CU6A 1ZYBA 1YEWA 4D8MA 2D7FA 5FP9A 1U0AA 3ZXLA 5C3OA 1AR61 1SDWA 1WLCA 1BJQA 2QQIA 4C1WA 1RUG1 3K3OA 1PGSA 3GGLA 1VALA 5BNPC 5L9VA 4QGNA 3BTXA 2P4EA 2VG9A 5C8CA 2YU1A 3PTYA 2OIIA 4Q4W3 2C5DA 4ZPIA 3FHQA 2RS52 3NJYA 4AEMA 3RS6A 5DAVA 3VN4A 2P3YA 2J1VA 4LULA 2DDUA 1S0FA 1K42A 2RVAA 1IOAA 1AYN2 3P6BA 4FOVA 4LBJA 1ZREA 4HK8A 3OPWA 1NE6A 2CGPA 1UU6A 1LGBA 5CEHA 4OI2A 1UAIA 1REEA 4LHKA 3CMGA 4ZU5A 1UXXX 4X6QB 2GC3A 3QD6A 4QHZA 1OH3A 2D3PA 1RITA 5I91A 3UETA 5FZ9A 2VAUA 4Y1VA 4YZ4A 1E5IA 1OH4A 4GZ9A 3ZFEA 4ASLA 2QZ2A 5L7OB 3Q8BA 1SBDA 4M0HA 1UMIA 4MSVA 4QX5A 2DV9A 2ZEYA 4ZU4A 3WZ1A 4BQWA 2ZKNA 4HVQA 4AFAA 4YW2A 4ZZ5A 1QY4A 2YB7A 4MXVA 4AEDC 1NCQB 4WVMA 5DG2A 2RMU2 1US3A 3OBAA 3WV6A 1MS1A 2B45X 2C4XA 2PYTA 3U10A 1S0GA 3UV9A 2X5IA 1SZBA 4Y4RA 2QQKA 2R32A 2H0BA 2XONA 3EXUA 3LGRA 5JOZA 4KI5M 3WDYA 1X50A 3HMYA 2FCTA 5FZCA 4NIGA 1BK0A 1OLME 2MNGA 5IATA 4MVTA 1MS5A 5AC93 2GC1A 4NROA 4HKOA 2WKKA 4M3CF 3VHPA 1IKPA 2ZCWA 4M4RA 4OQ8A 2WN2A 3NJZA 4TLGA 2XQXA 2C6SA 3RI8A 3UT0A 5KWRA 1KITA 1TMF3 3I97A 5KC6A 2VMHA 2QZ3A 5C3RA 2BPA2 3I2JA 5FZ4A 4XCAA 5A7QA 4DIQA 3ZYFA 3KD4A 2WZ8A 3PJYA 3ZVXA 5IVJA 5C9AA 4E4HA 3LDBA 3ACIA 4CXWA 5FYUA 2P6CA 1OVSA 1LODA 2X09A 1OQ1A 1U5ZA 4YWAA 2FCUA 2P37A 3KM5A 2QUOA 1RJ8A 4N43B 2WUHA 3RYKA 4IV1C 1ULEA 1H8VA 1SLBA 3VZMA 4V2WA 5L9RA 1WKYA 3E5UA 5JZGA 3I3EA 4CDWC 3KCXA 2FBEA 1W9YA 2VULA 3H8UA 4ES8A 4A3XA 1DGLA 1UY0A 3VBFB 4XILA 3ES4A 4YW7A 5IFPA 1UO9A 4JKMA 4BB3A 3AZYA 4DNYA 4HSJA 1LU1A 1IQDC 1JYVA 1HXS2 2J1AA 2QQUA 4HKWA 5BXXA 3ZYJB 2BBVA 1DHKB 1UPIA 4XFIA 3B94A 3UESA 3I8TA 1DYPA 2VM9A 3IZOA 3MIEA 4QQHA 2Y0IA 4A42A 1WCSA 3Q9OA 3WP3A 2JICA 1WA6X 4INDA 4ES9A 2ZZQA 3HOBA 4LBOA 4OHYA 1B35A 4NWWA 1TMF1 4XUOA 1JI6A 3RYPA 4BJ0A 4I3GA 1VBD2 4LXLA 4UFMA 3ZFFC 3K48A 1H30A 5FP4A 2PELA 5AC91 3JU9A 3H7JA 3VDDB 5HI0A 2X29A 3PUQA 4WVWA 3O1VA 4LO4B 3OB8A 5FZIA 2I2SA 1ULFA 1MQTB 4IEPA 3R0RA 4D6QA 4AI0A 4NMIA 4NPLA 2EIDA 1LEDA 4GA9A 3B69A 4U2AA 3A0NA 4WM8C 3TN92 5KHJA 1WW5A 4FPHA 1C5HA 1W2TA 3ETQA 1PIV3 3T0BA 2XWBB 1PHMA 2XMLA 1QJFA 4I09A 4K8RB 1FNZA 4MHUA 2P6HA 4Q4V1 1R64A 3W5NA 3PMEA 1ST8A 1ND2B 1NA1A 4GB32 3ZX7A 2RJ2A 5ACA3 5LY1A 2HWF3 1AHSA 4NWVA 4XOGA 1HJFA 5A33A 1AR72 4B1MA 5A70A 3DXTA 5HXMA 2GNDA 3Q8AA 5J48A 4BLJA 1SBFA 3HAGA 4FPGA 4JGYB 2FDFA 5EQUA 1IS4A 3ZR6A 1S2BA 5A32B 1MZ5A 3FMGA 3OBZA 3M3CA 3H1MA 4XCBA 4FP3A 5A3NA 3VZNA 2HH9A 3AL5A 1A3KA 1MPXA 4P9WA 1QQP2 4GJYA 1NLQA 2XUMA 4AGGA 1HIXA 1HRI3 1C3HA 4UXAA 1GNYA 4UOJA 1URXA 3EQEA 4P9LA 3K51A 3VD4A 1RIRA 1W6OA 3T08A 4WM7C 4Q4W1 2R1DA 1I5PA 2Y64A 1V6LA 4YGDA 1O5LA 3W21A 1HQNA 3Q8EA 1UMHA 3AZVA 2VJXA 1DQ2A 2BERA 3VDDC 1RUG3 4IV3A 3WNKA 1W8TA 2ZX2A 4D7TA 4Q0PA 2E7TA 4HPKB 1JYTA 3T3YA 4GWJA 2BYVE 3OYWB 4FXGB 5LEJA 5L36A 4A41A 4QDRA 3JUUA 4BIOA 2WNVB 4URTA 3VBHC 1ENQA 3HN1A 2IXIA 2PHWA 3HQRA 1TG7A 4KNCA 2FDHA 3RFRA 4H3WA 4N7UA 4W6WA 1CZVA 4AEKA 1J59A 1AR71 1PNFA 1IS6A 3WNOA 4Q26A 1XYNA 4AVAA 1MVQA 3O7OA 5BY5A 1BEV3 1L7QA 1ODNA 5FPLA 4HVRA 2JDAA 2AYHA 2HWD3 2P2KA 4XF9A 4Z2AA 5KC5A 2BOJA 5ISLA 3RZGA 1QXJA 3N7JA 5F5CA 5J98B 4L0PA 2PTMA 2F17A 5DDJ2 3HQXA 3VV1A 2ZGLA 1H9PA 3M70A 1MS3A 3EB7A 4IXLA 2NPIA 4Q4V2 4FAHA 2UY9A 4F8AA 4QXCA 3MW2A 2OYZA 3ZSKA 2UU8A 3K75B 4RYDA 2DFCA 5A7WB 2VCCA 2A1XA 2XG3A 1VRH3 2W0XA 2H6CA 3AZWA 3F95A 3DV8A 4LBMA 1FOD1 4RA0A 4WM7B 2Q8EA 3IDAA 4MXWB 4CP9A 1PO22 3T1LA 4L97A 3O1RA 5JXJA 3OCPA 4EV0A 1LCLA 4PLMA 4AXOA 5GM0A 4JDMA 4P02B 4ATEA 2FCVA 2WDBA 3DKQA 4DY5A 5A33B 3JBG1 4NN0A 3GZAA 3VBRA 3RGBA 4Z1VA 5LRSA 1Z7S1 4UT5A 5C70A 1ASJ2 1DZQA 3BPZA 4UW4A 3CU7A 1VBD1 1GBGA 5C4WB 3MLJA 3CF6E 4HKLA 2RS51 1RUC2 4Q4W2 3VB9A 5FO8B 4IE0A 5IK8A 1VP6A 5DAQA 1RUC3 1YQ6A 2DVDA 2Z2SB 3DUIA 5FCCA 5FRAA 5FO9B 5LATA 3TB0A 1L7LA 1BBT2 1X36A 2PHLA 2RR13 5CG9A 1C8M3 1BBT3 4XHBA 4Q0UA 1RUNA 4MV2A 3J9SA 4HONA 4W65A 1SHWB 2WA3A 3POYA 1FPN3 4XTPA 1ZVFA 2BWAA 2LALA 4A7KA 3ZXDA 5C33A 1W6OB 1X9PA 4LUKA 4XJWA 5FZ3A 1POV3 2Q30A 2BUKA 4TWTA 2ORXA 1PM4A 5FXWA 3NNJA 2I45A 3AKQA 3WUCA 2JDHA 4BQYA 4FPKA 1LKNA 2UYBA 5E1RA 5T5LA 5EIYB 4HPKA 4AZZA 5F39A 4G9SB 1JZ2A 2V5YA 2ZKLA 4Y20B 5FAXA 4BM8A 4CUCA 2VH9A 3USUB 2AC1A 2KD7A 2W5FA 1D4M1 3LEMA 2WNVA 5E8AA 2D44A 1PO11 4XFCA 1LOAA 2Y60A 5F2SA 3C8XA 3THTA 1OBNA 1G9AA 2LUWA 1WD4A 3ACLA 1HXS3 1X33A 4B7KA 1CZTA 1QJEA 3ZXJA 4YW5A 4LKDA 1UKRA 4PLNA 3GZUC 4YW3A 1QWRA 1YUDA 2E31A 5B2GB 2UURA 1FYUA 4IESA 3MICA 1U12A 3VD5A 4YARA 4XJZA 2ZXQA 1HRV3 2HWC3 1GZWA 3QCWA 2AENA 2Q8DA 1W8UA 3ME2A 3V64A 4JGZA 5BYNA 1YIFA 1KRIA 4CCOA 4NVPA 5FP8A 3FHIB 3UKVA 1UCXA 4MGSA 4UAPA 4P9IA 1VRBA 3GYDA 5AVAA 1LR5A 1SCRA 3SEEA 1PK6C 2A73B 2HLEA 3ILFA 4NPMA 1F31A 1XU1A 2VXJA 1JU4A 3AMHA 3VHRA 4QPGB 3OUHA 2WSUA 4W6XA 4DO0A 4CP9B 1Z0HA 2TBVA 5D8AB 1N1TA 4RSUA 4EQVA 3R4DB 2R062 2AGSA 1QOTA 3WQ1A 4JCKA 2VNRA 2RR12 1HW5A 1AF9A 4N53C 1JYNA 1F9KA 2WYSA 2ZJCA 2VMDA 4QMAA 4K20A 1G86A 5FY7A 3FN9A 5HCBA 2ZABA 3OGGA 1H8TC 1PX3A 2PXJA 3RWKX 1A78A 2WABA 3CNAA 3LKJA 3I2GA 3DN7A 2BNNA 4YG0A 4MGTA 3FWEA 3AXEA 1R1A3 2F4LA 2DF7A 1CX1A 3M2MA 4CU7A 4CCNA 1PMHX 1NXD1 2HWE2 1DQ4A 2E6VA 4AFCA 4TTGA 1AL23 3T09A 3ZYGA 1NCRA 3G6JB 4N9IA 2XKOA 2RM21 3PNAA 3N9OA 3LB9A 5GLTA 1CAWB 3QH6A 4IV3C 4LHSA 4AR2A 1RUOA 2VBPA 1J3RA 4QHBA 1NQJA 4AVTA 1S0EA 3OGJA 1K45A 1QDCA 5D21A 3U11A 4CEWB 1UQXA 5A3TA 2W2IA 4I0AA 4ORFA 4AF9A 1RUG2 1GFF2 4XAEA 4IGOA 4LIVA 2X8KA 2LTNA 4OUEA 5FO7B 4LBQB 5GKAC 1G6NA 5LBFA 1UW8A 2YY1A 1FT9A 3EMRA 3U07A 4CDWB 4UFIA 3AJZA 4B1LA 1A8DA 3D82A 4HLTA 4YVSA 1NAEA 1OUXA 3LSEA 4JZRA 1UYXA 2VPVA 2ZEXA 1QF3A 4QXHA 2EXJA 5DN2A 3WQ7A 4BQ3A 1CVNA 2EXHA 4FPCA 4KQ7A 2W3JA 3MO4A 4P9GA 1BLZA 4ZS3A 4BK4A 1DLCA 3MDPA 4LKFA 3O12A 4V1PA 2XVGA 3VL9A 2QDNA 4CSWA 1J3QA 1JMUB 2WFF3 4OHXA 3TN91 5LA1A 2X05A 1PO23 4QXBA 3ZOIA 1D0HA 5DZFA 4DQAA 5GZCA 2W1SA 5K0UB 4L11A 4EZHA 1OOPA 1VBA2 4AQ6A 5C8CC 4QB2A 1S0BA 1YNAA 1DYKA 4XFHA 2YMZA 1HV0A 3ZPOA 1COV1 5T55A 4GH4A 1DG6A 5CFDB 3MHZA 5KHIA 5ANQA 2HWE3 2RM22 4QX3A 1FNYA 1NXMA 1YJLA 2PLV3 3INAA 2IUWA 1RC6A 4XE9A 4Y22A 5APAA 3ZFEC 4AAXA 1TME3 3BTZA 4KG0A 2J1UA 5IVYA 3AKPA 2RS32 5A3UA 3MBWA 2WWJA 1W0NA 1W9SA 4IETA 2LM3A 1AXZA 3DPRC 4MO3M 1QMJA 1RHI3 1XU2A 1ND2C 2QTWB 2QQJA 3FL7A 4E2GA 1N1SA 3NWKA 3PMSA 1DGWA 1NQDA 1LHWA 2CWMA 4JVAA 1W6PA 1HJGA 1MEC3 4QWNA 4QX0A 3RJRA 4KL1A 2W46A 1W6NB 3NMBA 2B42B 2P1BA 2VCBA 1DGWX 3POJA 5LA9A 4EWDA 1LJ7A 2VUDA 3ZPYA 2RG4A 2BGCA 3CDZB 3AKSA 3WDWA 3SITA 2JDPA 4W6YA 4YNIA 4EN0A 5K0UC 4TXWA 4YZ3A 2WZR2 4XABA 4M3CE 2W08A 2BTVC 2AEYA 2WQZC 1H2NA 2XB6C 5LK5A 4BDVB 4QKDA 1UU4A 1O4YA 2A75A 2ZX4A 3JBG2 1F35A 2KR2A 5AFBA 3TAYA 1VBA1 5IVEA 2UY8A 1SFYA 5F5IA 3NO8A 5CNAA 2WJSA 5DUWA 3S0MA 3CIHA 4AFMA 2QQMA 4Y1ZA 2NLRA 1Q56A 4LJHA 5HXVA 3LDKA 1CIYA 5I8SA 1FOD2 5LK7B 4AFBA 2JDZA 5IVVA 4AI3A 5FK8A 5JI9A 3MZHA 1O91A 1VJ2A 2WIIB 5F1RA 1UKGA 2B9UA 2QJVA 3KQRA 1RVF3 3H9AA 5KHHA 5C4WC 1AX2A 3PLQA 3CBNA 1WA4A 3VBUB 4BMEA 1OOPC 1DU3D 3KT7A 4GB33 5T52A 1Q3EA 5LWBA 3WNMA 1S2KA 2EIGA 4FPEA 1AX1A 4PQQA 4LE3A 2RDNA 4AI2A 5FYYA 3K4ZA 5FYCA 3OBRA 1UU5A 2ZMNA 1U5IA 1PO12 1MQTA 1IHMA 3W5MA 2ZPXA 4QM8A 3THPA 2BNOA 1F15A 5LA2A 2BRTA 4GH4B 2G9FA 1JYWA 5A7OA 2VCAA 3IWZA 4BQ2A 1F4AA 3A21A 4HZFA 4Q4Y1 4CDXB 1DP0A 1MEC1 1PZ7A 2HBUA 4PJYA 3SKJE 4BQ4A 3IAQA 5JIUA 4OFGA 1DQ1A 3CJIA 4C0HA 3GALA 2Q8CA 1O4ZA 2R042 4FT8A 2VZPA 4QM9A 4UFHA 5J37A 4WZFA 5D2AA 3WHUA 5IAVA 4I30A 5A1FA 5C3SA 2MEV3 4A45A 1POQA 2VVFA 1J58A 2DBNA 4KU8A 5EFUA 5I0UA 5AVPA 3U37A 1WBLA 1W28A 5FZMA 1YC61 1QJU2 1HV1A 4R52A 1CPNA 3PL0A 4B8EA 4CCKA 4D0QA 1WW6A 1D2QA 2GP3A 4CUGA 1RTVA 1TME1 1N3OA 5EJZB 1IPSA 3EHKA 5FBZA 3PUIA 4B4PA 3ZFGC 4AGRA 4AVCA 5KBFA 1QGLA 1GKBA 4AYUA 1W6NA 3M7AA 3UJOA 2A70A 2HWE1 1GQGA 1ASJ1 3BB6A 1UY1A 4NJ4A 4YGEA 1WLWA 1STMA 1Z7S2 5GZDA 3WOGA 4C91A 1IS5A 5HCFA 1M06G 2JE9A 4A3ZA 4LK6A 2CL2A 2FHRA 4Q2FA 2JDMA 2BFUL 1WCUA 4YZ2A 1UF2C 1JOPA 3TEXA 1BYHA 2G19A 1GQPA 4GXLA 1RUH3 5A6XA 1DDLA 4OULA 1HB4A 2ZX1A 4MZUA 3N9QA 4O65A 2RMU1 1TNRA 1XYOA 3HD8B 2DCJA 1X82A 3OF1A 3VKMA 2YBSA 3OYWA 4YGBA 4KU7A 3TEWA 2R0FA 3J7LA 1CGPA 1UD1A 1WCQA 3FZ3A 1UX7A 3SH4A 1I5ZA 3DF0A 3SNMA 3I59B 4BE3A 4DRVA 3IT8A 4YM0A 1VBB2 5FPAA 3C2UA 3ZKUA 3D0SA 1POV0 4CE8A 3FBMA 3KGZA 1AR93 2W92A 4YSFA 4ZHNA 3I49A 5ERLA 1AR92 2TEPA 1UL9A 1YIPA 2BEOA 1WW7A 1PZ8A 3OPZA 1ALYA 2Y33A 4FOYA 3POSA 1V6NA 1R092 4WM8A 2QNKA 4DXSA 1Q43A 1ACCA 3RDIA 1TMF2 3ILNA 4K6BA 3WW1A 2DVGA 1JODA 2JG8C 4W8JA 1VB4A 2B9VA 4XZPA 4EE2A 1J1LA 4JQTA 1UY3A 2Y38A 4W50A 4Y4YA 4NIDA 2O8OA 2YPJA 1GP5A 1H1IA 2C9KA 4Q27A 1QJU1 2W39A 4KBZA 1PGL1 3ACGA 4RHV2 3CJXA 3RYRA 4YG3A 1ENSA 3MUY1 3OSDA 4YLZA 4NRPA 1W2UA 4NO4A 5FKCA 1JZ6A 1VAVA 3IIAA 5CVRA 1AL21 1GMMA 4U36A 5L73A 4YM1A 5KXDA 4TZDA 3VBRB 3B93A 4LNVA 4MGIE 4DRRA 4ZU7A 3MPPG 4GALA 4LA3A 2XBO2 5JR2A 1C5IA 1OHFA 1AXKA 3LFMA 4COZA 1H6XA 2VZRA 3B7MA 4UBHA 1R1A1 2A3XA 2YPDA 2ZGOA 1HQWA 2DU0A 2Y8KA 2YBPA 2YFUA 3GNEA 5JOXA 4QX2A 1W04A 1SLAA 2RDSA 3VKFC 5CKNA 3POGA 1WZXA 1BEV2 1GOGA 2Z69A 3KCYA 4XC9A 2O0OA 3PU3A 4HG6B 2A6WA 3GCXA 4IW3A 2LW8A 3WCRA 1NUKA 3DKWA 3HT1A 3OGSA 5J1XA 2VNOA 3KHCA 3SH3A 4ZKTB 3NNFA 1YQ8A 5FZOB 4YW1A 1D7PM 1K5MB 2QQWA 4OZXA 4R9DA 4K7JA 5JZGB 1UIJA 4JRAA 1ND3B 2PAMA 4CTEA 1MR5A 1HB1A 4ET7A 1MS4A 3VKNA 1RMU1 3WW2A 5A6YA 4LORA 5JSRA 4I0WB 1LTEA 4E8DA 4EWEA 1QXRA 2X53S 2VVDA 4Y20A 5F3CA 2OS2A 3WP5A 3WINE 1RB8G 1N3PA 4PI0A 3USUA 2JG8B 3VD7A 3WNPA 4AL9A 4Q4X3 1EYBA 1HRV1 3ZYIB 5DZEA 4OMDA 4AFDA 5JDBA 3ZSLA 3ZFGA 3C7GA 4D6SA 5A6ZA 3RZMA 5C9AC 1R1ZA 5FUPA 3ZDVA 5FPZA 4JHZA 2WSVA 3WDXA 5LBBA 4FPLA 1YLLA 5F3IA 3I2OA 5FY9A 4FTEA 4D3WA 1SMVA 1W03A 3LQCA 1KJLA 3JQXA 1HXS1 4HK9A 4LA2A 2R063 1H1AA 1H4HA 2WZEA 2PAKA 4KWKA 2PQQA 2ZAHA 2HWB3 4FQZA 4LKEA 2JDUA 5KHGA 1D4M2 4RGKA 4XETA 1PX4A 4AVVA 5J7MA 4L9BA 4OLLA 1I3HA 4BQ1A 2DYCA 4QU2A 4CUAA 5CFCB 4WM8B 2HEWF 2BVVA 4G3YC 4OCTA 4ZY9A 5D1IA 3VUOA 1R1A2 1T6BX 5K9YA 2EALA 2ZBJA 3JD73 5EPAA 2FZ1A 2Y6LA 2DU1A 4GMP1 4HT1T 1UYYA 4QAWA 4IE5A 5FZ1A 5EP9A 1W6QB 3RNSA 4AQ2A 3M1HA 3X29B 4CXYA 3AFKA 1CJDA 1ND3C 2L9LA 3J7HA 1FPN1 1NA1B 3QH7A 1VLNA 3AMQA 2ATFA 4D69A 4QPYA 1YFUA 5T5JA 2GZWA 1QU0A 1BBT1 4ARYA 4D7SA 1C8M1 4H2AA 3KLSA 4YVWB 5H9SA 4A44A 1YCIA 2VZVA 3A7QA 3JB4C 1NX9A 1RUC1 2DVBA 2EVXA 2WFPA 2Y34A 5A32A 4Y33A 4PIYA 3FUOA 4CVUA 3EO6A 4EWAA 4QXKA 1F5JA 2Q1ZB 2VQAA 2XL9A 3TOJA 4UFLA 3VDBA 1UIKA 2QQLA 1F8VA 3JBG3 4IGPA 5FWEA 1U5XA 1ZRFA 2DWRA 2NM1A 2OUHA 3OOXA 4LHLA 2VC9A 3AYEA 4KBBA 2K9ZA 2V4VA 2J1EA 1S4CA 4O9EA 5LW9A 5BNOA 1CAWA 5FZOA 4GKXA 3ZSJA 4DEQA 2XLFA 5FYBA 1ZZ7A 1VRH1 4FFIA 2QVSB 3VBUC 4COWA 1GP6A 4META 3OY8B 4Z82A 3A0KA 3ZN6A 3V0BB 3DYOA 2JKBA 3WF3A 2LROA 3VBHA 1A8MA 1CX4A 2WNVC 2B5HA 2CWSA 2R30A 3AL6A 3H50A 4DFSA 3MYXA 5DUVA 4DMIA 3UKTA 1DGRN 5FYMA 2E51A 3VBOB 2NMNA 1VBB3 2Q8OA 2D6NA 5ANNA 2XHNA 1CAXA 1Q8SA 2PQSA 4LBQD 2HWB2 4K40A 4GWIA 5HV4A 2C24A 2JEMA 2VNVA 3BN6A 4FXKB 5F2WA 3RSJA 5I8YA 2JKXA 1NA1C 3N36A 2IVIB 4QPWA 1AR73 4D94A 1H8TB 4UWDA 3IN9A 3OUIA 4BK5A 4P08A 2ADEA 2YDEA 1OMIA 2ZS6B 4XUQA 4NIIA 2D43A 5I93A 4ARXA 5J96B 1QH7A 2XDVA 3AP5A 4UI9L 1ZBA2 1KXGA 2QQNA 2OZJA 2X10A 2YGLA 4GIQA 3OUJA 4Q8KA 3WQBA 1PMIA 5FMOL 3FC0A 4Q0SA 1VAKA 2WO7A 3ZXAC 4AGVA 3EYPA 5FLHA 1NYWA 1EAH2 4RHV3 5BNPA 3CLPA 4LO7A 2VUCA 1WGPA 1TQ5A 3BODA 5EYYA 5FZHA 4N8MA 3ETPA 2KXLA 2DTWA 2EAKA 3BKZA 3GXUA 1OOPB 3WY6A 2PLV2 1PK6A 4UF0A 2OZ6A 2IXHA 2Y26A 1AR81 1FATA 1SLIA 2Q4SA 1JYXA 3MF9A 3RZHA 1JTZX 2ILMA 4BH9A 4CEWC 2WO2A 1V6OA 4TYSA 4BPZA 5KR7A 2RE9A 1BXHA 1OUSA 4RR3C 1VMFA 2ARXA 1HRI1 1OQEA 2P34A 1AR62 5FUIA 1RYYA 3G7DA 3N9LA 1AX0A 1KS5A 4Y22B 1IG0A 4HOOA 3WDUA 1UZ0A 2JDYA 3AX4A 1HQLA 3QACA 2ZACA 1ULCA 5FQ0A 2A7AA 4H7LA 2Y6JA 3VLBB 3CJIC 3GM8A 1CAUA 4COUA 2VO5A 3ZXEA 4FOQA 4BXFA 1FXZA 4KWUA 4FO9A 4YVSC 3ORJA 2HWF1 3R6SA 5FOBB 2YC2A 5ACA1 4ZXKA 3S5AA 1XE0A 1H1MA 3ABZA 3MIGA 1JUHA 1ONAA 1RXFA 2BOIA 4Q4V3 2LS6A 5IJRA 1O3QA 2R16A 3IIIA 3AJYA 5SV5A 3O0WA 4IQPA 4XJUA 2RJLA 4GKYA 1LOGA 1XQNA 4L92A 4LIUA 4DXZA 1PIV1 3DCQA 4N9HA 3MFCA 1NKGA 3ZSEA 3WW3A 1I1EA 4XBNA 4L2NA 4RGGA 1IPKA 4PBPA 4FPFA 4BIFA 1ZZBA 5A80A 1RUE2 4DEVA 4RQPC 3VBOA 5AC92 5C8CB 3O1UA 4ONUA 1E5RA 4D6RA 3KQ4B 1SPPA 3JCIA 1Y9GA 3PVBB 4K3UA 4LT5A 4BXSV 5FZDA 1JZ5A 4M00A 4Q4X2 3LEGA 2OPKA 3B3QE 2G9ZA 5DAPA 4YZ1A 2A5ZA 2XJRA 5F37A 3K2OA 2PHTA 2ZGKA 1QIQA 2WS93 3UGFA 4FPYA 4JKKA 3HEIA 4DOUA 5EWSA 3KF3A 2HEVF 4XXAA 5LASA 4J25A 4OYUA 3KGLA 1JOBA 2ZX0A 3FFZA 1SACA 2RDRA 3JD72 4OQ9A 1HKDA 3SQOA 1XYPA 2V72A 2WZPP 1UN1A 4KWLA 1OA3A 4Y1UA 2HKXA 1WLDA 3T0AA 3AP7A 4QPGA 3BCWA 1QJY1 3OD0A 3KSCA 3H8OA 3POIA 1O59A 4LK7A 5D8AA 2CAVA 1FX5A 4AVSA 3M3QA 2CGOA 2P3IA 1K5MC 1QOOA 1EV11 4YPJA 2P5BA 4KH9A 4UYBA 2P17A 3AKRA 2R073 1OSGA 1XC6A 1RUI3 2ZGQA 5FV3A 2OUJA 2GNTA 1N1YA 5FQ0B 2E32A 4OI0A 4HN0A 2XJPA 3V0AB 1S2EA 2PHRA 1NZIA 2VOWA 5FWJA 3D4KA 3VBSC 1GNHA 4UBGA 3USSA 4Z07A 3DYMA 4V2VA 4WVZA 3WG2A 2YU2A 2JG9A 2UWAA 1LGNA 3LIHA 5JSOA 5HBAA 3VBRC 3WG1A 2GMPA 1IQAA 5IVFA 1YWKA 2MHFA 1A6CA 1VBE2 1BCXA 1HLCA 1GZCA 4QKBA 1XB9A 4S2DA 2C0ZA 4XUPA 4YFZA 2YFZA 5JXGA 1Q5OA 4PI2A 4A6OA 4ISRA 4XURA 4JDNA 2YXSA 3AVSA 5IW0A 2XPJA 3ZIWA 4CEYC 2W68A 3LPGA 3NAPA 1OI6A 1W8WA 2NZ9A 3BTYA 5JWPA 1NY71 1UMZA 3S7IA 1JS9A 3C7FA 2XOMA 4PDWB 1GICA 3PUSA 2OKXA 1H9WA 4A6SA 1LHVA 4CDQA 1QJX1 3WSOA 1H4GA 3LF7A 2OX0A 4LBQA 4PCRA 1CN1A 3WG3A 3RVHA 3VZJA 3HN3A 5IHRA 1SPPB 1DYOA 2WINB 3WF1A 4CP0A 4JC1A 4L99A 1N1VA 4XF0A 3A22A 1XNTA 4CDWA 2Y6GA 1SLCA 2GDFA 5FZ8A 3THCA 2D97A 1MS9A 2AREA 2C1FA 4TN7A 1R093 4QPIB 4XFBA 5CBLA 2CHHA 3HQUA 1T6GC 4IEVA 4XDPA 3SISA 3NVCA 2HBTA 1US2A 2R6QA 4JDOA 1BVP1 1UPSA 4XAAA 5G05L 3IDBB 2PA7A 3ZYBA 1DQ0A 3I3BA 2VUAA 4XJ8A 2XHKA 1YQ5A 3AP9A 4BLIA 5HPOA 4EROA 3MIFA 1W3XA 4B7EA 4RS5B 3FUQA 5DQ0A 1JZ3A 1OURA 2RHPA 5CZKA 2IXJA 2VECA 4RFT0 5FP7A 4FAGA 1W3VA 4O9GA 2ZGTA 2GNMA 4UW5A 2QKDA 3UKNA 4I2OA 1H2MA 4FTSA 1AR63 3HVDA 4CA9A 1FMD1 3H3ZA 4E4DX 4EYUA 1XJAA 2DCKA 4EN9B 1GUIA 4CEYA 2ZMLA 3IPVA 1EV12 1NE4A 3C7OA 3IAPA 5JUVA 2E53A 1V9U2 4PDWC 1OXCA 1QEXA 5FXXA 4CP1A 1R082 1MS0A 1ZRRA 5LRRA 3ILRA 3DPRB 3FLRA 3LCPA 1OKQA 2I07B 4PBOA 4ZONA 4DPNA 1FPN2 4NAOA 4H14A 3N3HA 5HCHA 2B8MA 2AH2A 1RUJ1 1ZA7A 4XFFA 1DZTA 2O8QA 5IUQA 3ENRA 3I2HA 3H8XA 4UFKA 1SLTA 1JYCA 3AP6A 3D0JA 3NV1A 4JHTA 4FFGA 4BA6A 1GR3A 4IE6A 5FPBA 2ORZA 4XTMA 2VZ3A 5DZGA 2E26A 4XPVA 1XXNA 2ZGPA 1BZWA 4FFHA 5F6KA 5CFDC 3W20A 5LA0A 3ACHA 2VZ1A 3PVNA 4CP2A 2ZZJA 5A3PA 1XOYA 5IYYA 2V73A 2VW0A 2Y6HA 3QLQA 4M3CB 2HWC2 1AVBA 1ZBA3 2ZHMA 4S2FA 1ND3A 1UNBA 2VZQA 5JXIA 1LB2A 1JHNA 3ZYRA 2VTXA 4LHNA 3VL8A 3WLUA 2FDGA 3OG2A 3E6BA 5FYZA 4XMAA 2W1WA 4IEXA 4XF3A 1RVF2 1QNYA 1VB2A 3ELNA 5LBCA 4Z2WA 5FREA 3GDBA 4QPIA 1PMJX 3CZJA 1HRV2 1X8MA 3GBWA 5FLJA 5GJ6A 1OPMA 3KZ4C 5A7NA 3LFIA 4TLFA 1N3QA 3ZN5A 3I3DA 2GU9A 3ITQA 3S30A 2BFUS 1W0PA 1QHDA 5B4NA 1RUJ3 4A7ZA 3L9JT 3JXSA 4J1WA 1GSLA 1LOCA 3BOPA 3O1SA 1KS4A 4QT6A 4UW6A 1RUD2 5FBJA 1XNCA 1APNA 2HWF2 2NMOA 4GQ7A 5L7OA 3P3PA 3GZTB 3V56A 3LAGA 1AUYA 4IEYA 2JIGA 3POWA 1VBC1 4XMIA 5T5OA 1KFUL 3T2PA 2ZOEB 1J83A 2FDIA 3R05A 4XF1A 1YYNA 4NAMA 5IVCA 1RUF1 4NHYA 4P9XA 2W47A 3SKVA 2MEV2 1FMD3 1FV2A 1RUD1 2DBIA 3E1F1 4P9JA 4LE4A 1KDMA 4NHKA 4FFFA 1S0JA 3BI3A 1WMDA 3R4SA 2KA3A 2XJQA 2J1SA 4H55A 4MHRA 4MXWA 3SXWA 3WVJA 1W6QA 3E5QA 1J84A 4FOWA 5FR3A 4CU8A 5DABA 2D5HA 1CJPA 1F2NA 3WUDA 2JDNA 2R072 4FP2A 5JLVA 3D3AA 3POFA 3QBQA 1EAH1 1GOHA 1QJZA 2E63A 1YRZA 3ZSMA 2PFWA 4BOWA 5M0TA 1BHGA 4QQ2A 5FY0A 3SH5A 5C9AB 2CDPA 4XBQA 3VDCA 1JBCA 1LU2A 1LHUA 3LA3A 2XKPA 4SBVA 2GMMA 1LNSA 3J8F2 1CZSA 5DDJ1 2AZ5A 4XACA 1JH5A 1DQ5A 1R091 3EBRA 4EN8B 1CD3G 2PHXA 3HPNA 2PHUA 4N43A 2JD4A 4BMBA 4XDQA 1SCSA 2BP6A 4YM3A 4NOTA 3BUCA 2YYOA 1ULPA 2HEYF 3MUZ1 3Q8CA 4CDXC 2GN3A 4PLOA 4FSJA 1X9TA 2OQ6A 2CY6A 4XBLA 5BNOB 3E6DA 2GN7A 2X5IC 4P5HA 5FMBA 5FUNA 1QJX3 5C71A 1QXPA 2W1QA 3WDTA 1PVC2 3DL3A 2ZEZA 5FZEA 1SFNA 3PHMA 2XLAA 1H0BA 2VGDA 3AMMA 3HWJA 4S2HA 3S57A 3OGRA 1AJKA 1EPZA 3U4SA 2WQ8A 2O14A 4FTBA 2A6VA 1W8OA 1ZZ9A 5CIRA 3E6CC 1G7YA 2HYKA 2IXLA 4XVHA 4XJ9A 1XSQA 1G9DA 4Z92B 1O3RA 3B00A 5FMDA 2WNUA 3O0VA 4LO6B 1FAYA 2AUYA 4E8CA 4AHXA 2GP5A 3H1YA 2OPWA 2DVAA 1HX6A 4KMQA 2DUPA 2Q0AA 1H8TA 5FMCA 3GJBA 1PVXA 3FFQA 4E2SA 3HR9A 5TSWA 3LOBA 3NV3A 5A3OA 1GWKA 2IFRA 3O1PA 4CRQA 1LULA 1VR3A 4C90A 1D4VB 3LD8A 4Y26A 3VDDA 1RUI1 1AYN3 4F7ZA 2R071 3CKHA 5EXOA 5EZWA 4D7YA 1UOGA 1EV13 3AXDA 2VW2A 4AHWA 2FMDA 1KDKA 2RJKA 1UOBA 4NRQA 2GNBA 4BQXA 5LY2A 2OVUA 3K4DA 4QQPA 3THDA 1ENRA 2A6YA 3M3IA 2Z5WA 5T3NA 4YFWA 4AE2A 1G8WA 5CA6A 1L3JA 1QJY3 5BNOC 1C57A 2VW1A 1VBE3 2CGNA 3NRUA 3AYAA 1GYKA 4UF0B 2VOTA 3WX5A 1KQRA 1RGSA 4IV1B 4XIOA 2W95A 1W05A 2H6BA 3B01A 2A6ZA 1WMFA 2KM2A 1ZA4A 3ALQA 2ET7A 4UFJA 1K5JA 2W1UA 4HVOA 4LITA 2RS13 3MIHA 1IZ3A 5EV7A 2D6MA 1JOJA 4BZ4A 2XVLA 5FPVA 3ZFFA 4LBNA 2D6LX 1LOFA 1SBEA 2WS91 3MPBA 4MOAA 3T2OA 1FI2A 4DUVA 3U4XA 3KVBA 1Y3TA 2F4PA 1YI7A 4QDSA 2E7QA 2WFF2 1REFA 1RJ7A 3AZXA 5FZAA 4ISQA 2VMEA 5JZGC 3I54A 5F5QA 3B5LB 2OT7A 2WNOA 5CYYA 3AYCA 5J3UA 3FLTA 1YO8A 5JI7A 2WLPA 3P1IA 1GV9A 1W9TA 2B39A 1GOFA 2IXKA 3T2QA 1G9CA 4QX8A 1NLRA 4X8NA 2NP0A 2JECA 3T4HB 2NN8A 2FD8A 4CU9A 5FZGA 1M4WA 4S2GA 1JZ4A 1S0IA 3RRDA 4YW4A 1OVPA 5C3QA 4ASMB 2RS33 2Z42A 3WEZA 4BHPA 1RMU2 3K3NA 1CIWA 1PZ9A 2ZMKA 1C1LA 1CAVA 1W6MA 2WNUB 3IDCB 3JQWA 3PIGA 2J22A 2OQ7A 4Q29A 1IS3A 2VTFA 2XVKA 2JB8A 5FTTC 3ZXFA 5C5TA 5HV0A 3UNPA 4MH0E 1RHI2 1RUF2 2JXAA 5I0DA 4FCAA 4XFGA 2GH8A 5EJ1B 4K9SA 3TWIA 1EP0A 2R0HA 3JB8A 5J36A 1V6KA 2ZGRA 3WDVA 1R083 2W94A 1BMV2 2VMCA 5IT6A 4RFRB 1NG0A 1G9BA 3RZZA 4DZGA 2UWBA 3MI8A 5CFCA 3FX3A 4QQLA 4LEJA 4LTAA 3LA2A 2JDKA 3POBA 2F6BA 5DUUA 4XYXA 5FZFA 1XRUA 1O6UA 1OF4A 1AR83 1AYM1 1MACA 5A7WA 2P3KA 2BQPA 1UYZA 3ZMNA 5BV6A 5JPNB 1LEMA 4P00B 2YHJA 1ZBE1 3A23A 4LKSA 1D0GA 2E33A 3AP4A 4R9AA 4RHV1 1X7NA 1W90A 2GALA 4RS5C 4YG6A 3O1TA 1S0DA 2TNFA 1Q8OA 3LSDA 4SLIA 5CFDA 3PDQA 4UW3A 4YVWA 3AM2A 3C3VA 4I0BA 3WNXA 3W59A 1V0AA 4EN6B 1RUH2 1L7RA 3M3OA 3FBYA 1AZDA 2WYFA 3V0AA 1OLMA 1VPHA 1AJOA 1NOVA 2VVEA 3DECA 3GCWA 3AZZA 4AWDA 5BPXA 4QGMA 3IMMA 3MLLA 4Q0VA 1CR7A 3RG0A 5KXCA 1JU3A 3RQ0A 2PMWB 2PHFA 5IAXA 4GH4C 3H0OA 1ULOA 2WLQA 4OHWA 4CCJA 1LENA 1ULDA 2VCMA 2ZGSA 3HIFA 1VBB1 3DXUA 1OKOA 3U78A 1PVC1 5JOWA 1O8SA 4JTNA 5JCTA 5JSPA 2TUNA 1WW4A 1J3PA 4A7YA 4AQSA 4MYEA 3D6EA 2YUEA 4AI1A 2Z79A 2IXCA 2D3RA 3NAPB 5ACA2 2D6PA 1OA2A 4CCLA 2DUOA 3E97A 5JXHA 2A3YA 1QQP3 3KCCA 2IC1A 4LBKA 1VIWB 1MVEA 2BWCA 3N9MA 1GLHA 1V9U1 4JTOA 3NKTA 4DY3A 4ASKA 4AEDB 4IUGA 1CAVB 1SG3A 1W6MB 2MPFA 5CU1A 5LB6A 5A1AA 1RXGA 4YRDA 2FQPA 4E2QA 1NZCA 3MF6A 1W0OA 2VE1A 3ST7A 5BNNB 4C0BA 3PTRB 3B9IA 1WD3A 3N7MA 4NUBA 2ENRA 1XE7A 2A71A 3N9NA 4Q8LA 3SCFA 3KMHA 4KGGA 1W9FA 1HN0A 1W2OA 2QQVA 1XBFA 2ZHKA 1V6MA 3APBA 1YFWA 3GHMA 3J7MA 5IWFA 4URAA 3OPTA 5H9PA 3MGUA 5FY4A 3AYDA 4YM2A 1C8M2 5A1LA 1QNWA 3VBUA 4DUWA 4K1YA 2Q1MA 2XJVA 5CISA 4NPRA 4MGQA 2WAAA 3H42B 2EA7A 2D98A 4LOSA 1Z78A 3M4FA 4NHXA 4LO5B 5CADA 4GJZA 3IM0A 2VMIA 3OD4A 1SEFA 4GMP3 1C1FA 3J8F3 2PHDA 2J42A 5GLWA 4H7MA 3V65A 2R041 5DMYA 2IWGB 2HWD2 3AKTA 3GJAA 3JD71 4OI4A 4RGAA 1GQHA 2HJIA 1S0CA 2X5IB 3CL1A 1NCQC 5F5AA 2J7MA 3CZUA 3I2DA 4ZS2A 4JRLA 3VZKA 1MZFA 3VDAA 4BCUA 3CJIB 2B7YA 2RV9A 1DIWA 1B35C 3I4IA 2HWB1 4E4ZA 2BDRA 4PF1A 5FKBA 5L9BA 5LZ6A 1GU3A 3R4UA 5C3PA 2D3SA 1Y9QA 2EAAA 5JOYA 2R061 1OC1A 1UOFA 4HANA 4GMP0 3TBDA 4QPIC 4JGZC 3B02A 4XEZA 5E6HA 3NNGA 1MZ6A 4LBLA 4MADA 3UJQA 2VUJA 1V00A 3GHNA 1Q8QA 3OGVA 4AHYA 3BGAA 2BU9A 2ZX3A 2I74A 2FDKA 3N7KA 4Y1YA 2YV8A 1LOEA 4Q4X1 2BNMA 1O4TA 3MIBA 5EHDA 3J7NA 4BQ5A 3RZLA 2ZTNA 5FPXA 4RR3B 2IZWA 4RQPB 3MV01 4YW6A 5C8WA 4MGYE 2DTYA 3SHRA 1RMU3 4N43C 4GAZA 3U14A 3VHNA 4N53A 1RUE1 4PQ9A 1DQ6A 4M3CA 1IPJA 1LHNA 1ZBE2 3LDRA 3SC7X 2CU5A 1WCKA 2WZR1 2XR4A 4L8QA 4M4PA 3VBFA 1JYIA 3K46A 2WA4A 4HSLA 5BUVA 3L2YA 2DURA 4KWJA 3LWCA 2XBO3 5IFTA 2R1BA 4YVSB 5BNNA 4NIHA 2JG9C 3J4UH 4R9CA 2JB4A 2V09A 4QU1A 3TEZA 5C5UA 5ABJA 1QJY2 4WBBA 1W99A 5A7PA 5F32A 1OFNA 1TEIA 4CPBA 3U75A 4Q5OA 2WC2A 3ZIXA 3ZN4A 2DCTA 2UYAA 2XBO1 4KGQA 2SLIA 2UWCA 4Q1RA 3C7HA 5FMOS 2FMYA 4JGYC 1DBNA 5F6LB 3WHTA 4R4ZA 3N9PA 5IVBA 1IG3A 1Q8PA 2ADDA 1QDOA 2EXKA 2WZR3 2VQUA 3NW4A 4OUMA 3ZDSA 4CDUC 4DINB 5GLVA 1RUI2 1UXZA 5K0UA 1QJU3 4X8PA 3TNPB 5SV8A 1W06A 1RUE3 3KHBA 4XUNA 3ZO0B 4E27A 1W8FA 5I8TA 4OI1A 4AHZA 3NNLA 1OA4A 3IKWA 4NHMA 5FYSA 5FP3A 1YFXA 1AL0G 2GAUA 3IBMA 2ARAA 3LZZA 4AQTA 3VD3A 5F3GA 5JPMB 4IE4A 4MUVA 3SLIA 3WR0A 1W2NA 2BGPA 4IEWA 5AFEA 4YYOA 1AR91 3D5OA 5A3LA 2YG0A 4FQ4A 1ND2A 2VQTA 3ACFA 5FY1A 4COVA 3ZR5A 2K2SA 3H8RA 3BALA 3HNBM 1VMJA 3POEA 3I3MA 5I0SA 1LOBA 1PGW1 1PM7A 2Q5TA 4JGYA 4K1ZA 1JUIA 4MGKE 2WNUC 3ON7A 5F9TA 2JG9B 2Y0OA 3URFA 5IK4A 3BIWE 3N4MA 5FYTA 1DF0A 1UWWA 2WS92 5FLIA 1HB3A 3KV6A 2VZUA 5F8PA 3IMNA 1W6PB 1Y43B 4IGQA 1JN2P 2ZHNA 2P3JA 4HL0A 4YGCA 3RI9A 2LRPA 3N7LA 3TYJA 1H2KA 1ENXA 4RR3A 4RQPA 4HMZA 4XJAA 2RMU3 1XNKA 4Z8BA 2VXRA 1F4HA 1OFSA 2R043 2PN5A 1RUH1 2D6KA 3IDEA 4PDWA 4PF5A 4CDQB 3J8F1 1CESA 1YQCA 3TEYA 2ERFA 2VR4A 3ZYHA 3HBKA 1OPOA 1XE8A 1JZ7A 3UGHA 2C9AA 1CPMA 5DG1A 4P14A 5C6CA 1GZ9A 2WL1A 5F7UA 4Y24A 3AMNA 1ASJ3 2CYFA 2CTVA 3VBSB 1V6JA 2EIEA 3LPFA 2JG8A 2XJUA 3BYWA 4HBNA 4P9YA 4Y5TA 4EN7B 3VHOA 3KF5A 2D40A 5FDBA 1Q8VA 1VMHA 3WW4A 3ZFGB 4QQOA 1TME2 2QCSB 4AG4A 4OMCA 3WF2A 2K0GA 1YXWA 3SCHA 1NT0A 4DUXA 5GALA 2A3WA 2WAOA 1XSRA 5FYHA 1CONA 1LAJA 3LOIA 1YJKA 2MEV1 3AVRA 5T5PA 3S6PA 1ZM1A 3ZFEB 4CYDA 2VY0A 1XPWA 5CKQA 2BGOA 3BOWA 5A7SA 1D2SA 3HT2A 1V9U3 3WP6A 1BK1A 3KB5A 2RS12 2VMGA 3ZMOA 1BQPA 4Q4Y3 1QQP1
chains in the Genus database with same CATH topology
3S57A 4RFRB 5F8PA 4JHTA 2FDJA 3O1OA 4ZS3A 4NPLA 3O1MA 3T4HB 4IDZA 3RZLA 2FD8A 4QKFA 4IE0A 3I3QA 4IE6A 2IUWA 4ZS2A 4OCTA 3H8XA 3BTYA 3BTZA 3BIEA 4QHOA 3BU0A 4MG2A 4IE4A 4NJ4A 4NRQA 3T4VA 2FDHA 3BI3A 3RZMA 4MGTA 4NIGA 4NIDA 3RZJA 3RZKA 4NROA 4CXXA 3BTXA 4QKNA 4NRMA 3O1UA 4NPMA 4O61A 3KHCA 3BUCA 3O1SA 3I2OA 5DABA 4IE5A 3BKZA 4O7XA 4NRPA 3O1RA 4CXYA 3H8RA 3S5AA 3I3MA 3H8OA 4ZHNA 3I49A 3RZHA 3O1TA 4QKDA 2FDGA 3O1PA 3KHBA 3O1VA 4IE7A 3LFMA 3RZGA 2FDKA 2FDFA 4NIIA 4NIHA 2FDIA 3T3YA 4QKBA 4CXWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S57 A;  4RFR B;  5F8P A;  4JHT A;  2FDJ A;  3O1O A;  4ZS3 A;  4NPL A;  3O1M A;  3T4H B;  4IDZ A;  3RZL A;  2FD8 A;  4QKF A;  4IE0 A;  3I3Q A;  4IE6 A;  2IUW A;  4ZS2 A;  4OCT A;  3H8X A;  3BTY A;  3BTZ A;  3BIE A;  4QHO A;  3BU0 A;  4MG2 A;  4IE4 A;  4NJ4 A;  4NRQ A;  3T4V A;  2FDH A;  3BI3 A;  3RZM A;  4MGT A;  4NIG A;  4NID A;  3RZJ A;  3RZK A;  4NRO A;  4CXX A;  3BTX A;  4QKN A;  4NRM A;  3O1U A;  4NPM A;  4O61 A;  3KHC A;  3BUC A;  3O1S A;  3I2O A;  5DAB A;  4IE5 A;  3BKZ A;  4O7X A;  4NRP A;  3O1R A;  4CXY A;  3H8R A;  3S5A A;  3I3M A;  3H8O A;  4ZHN A;  3I49 A;  3RZH A;  3O1T A;  4QKD A;  2FDG A;  3O1P A;  3KHB A;  3O1V A;  4IE7 A;  3LFM A;  3RZG A;  2FDK A;  2FDF A;  4NII A;  4NIH A;  2FDI A;  3T3Y A;  4QKB A;  4CXW A; 
#chains in the Genus database with same CATH topology
 4K8F A;  4CCE A;  3O1M A;  1FV3 A;  3NL1 A;  3OEA A;  1DGR A;  2IVJ A;  1V70 A;  2JIJ A;  1O7F A;  1XND A;  3WNN A;  1LES A;  3IPV B;  3UYJ A;  4BYY A;  4CDX A;  4DXT A;  3BU0 A;  1CWP A;  2JWP A;  1PVC 3;  5EYX A;  2QBX A;  4CDQ C;  1RIN A;  3U0Z A;  2XUE A;  1K12 A;  1MS8 A;  3DPR A;  2GH2 A;  4AOC A;  3N35 A;  4XFA A;  1I9R A;  1NCR C;  3ATG A;  4GB3 1;  1H6Y A;  1Y9M A;  4BWO A;  3UGG A;  3FLP A;  5FJK A;  5JR7 B;  5FIX A;  1RVF 1;  4XUT A;  5CB7 A;  3ZYP A;  1UZV A;  1W39 A;  4A4A A;  3M3E A;  1H2L A;  1EPW A;  1UZZ A;  1K3I A;  4I02 A;  1LHO A;  1W9W A;  1KFX L;  3ZFF B;  2VOX A;  3RJ2 X;  3ZM8 A;  3T30 A;  4JQR A;  1VBA 3;  4WVV A;  5BNN C;  2QDR A;  4QHO A;  2SBA A;  4FI9 A;  4AK3 A;  2VL4 A;  3GBF A;  3P5B A;  4AI8 A;  1MQT C;  4RN5 A;  1WME A;  1LRH A;  1SLL A;  2V4A A;  5JAX A;  5CKM A;  4QKN A;  4NRM A;  1DFQ A;  5FZK A;  3KT4 A;  5GZG A;  5CG8 A;  4EJR A;  1ZBE 3;  2Z4F A;  4OHV A;  2R7E B;  3I2K A;  2VD7 A;  4LLO A;  4F83 A;  2WWU A;  2EF6 A;  4KG8 A;  1AYM 3;  3OY8 A;  1SFP A;  1GWL A;  2PAE A;  1OF3 A;  3GBG A;  3IB3 A;  4AVB A;  5GLU A;  4E9K A;  3VBS A;  5KXE A;  1Y7B A;  2GC2 A;  1UZY A;  1KJR A;  1OD5 A;  3MV1 1;  2W91 A;  4LMF A;  4MX3 A;  4QPG C;  4QX1 A;  3J26 N;  5FZL A;  4OHZ A;  4B4R A;  1A34 A;  4J1X A;  4B3N A;  1BMV 1;  4XXP A;  1CAX B;  1R08 1;  3VKO A;  3ECQ A;  2JE8 A;  2W87 A;  1CQ9 A;  3RZK A;  2NYY A;  3I59 A;  5FY5 A;  1S55 A;  5EJ3 A;  3UK9 A;  2VZT A;  4ATF A;  1O3T A;  3T0D A;  1RHI 1;  1LEC A;  2ZGN A;  4NR1 A;  1MZE A;  1DLL A;  2WN3 A;  4Q4Y 2;  4QX7 A;  3T2T A;  3SCG A;  1B35 B;  3CHX A;  3BPS A;  2WR9 A;  3O0X A;  3LA7 A;  3BTA A;  5G04 L;  2GME A;  1IKQ A;  5E16 A;  3JZV A;  2D5F A;  2J1R A;  3I2I A;  3O14 A;  4XF4 A;  4MLO A;  5C7G A;  4RD7 A;  1PGL 2;  2QFE A;  2QQP A;  1LGC A;  2RS3 1;  3VKL A;  4RL7 A;  4XZU G;  2EIC A;  3M8L A;  3DGT A;  4IL7 A;  5FYV A;  1AL2 2;  1GZW B;  2AAC A;  1LOF C;  2GSY A;  2EXI A;  3AK0 A;  3PVE A;  2PLV 1;  2CAU A;  4R8H A;  3VD9 A;  4JKL A;  2J1T A;  1EUT A;  5KHK A;  2YBK A;  2ZGU A;  3WCS A;  4X6R B;  5IK7 A;  4GUL A;  5GZF A;  1COV 3;  3HNY M;  5K8S A;  4E4S A;  4WZC A;  3RZJ A;  4DS0 A;  1W8Z A;  1ZZ8 A;  1ZRC A;  4LLF A;  1TVG A;  4FBF A;  5K7P A;  3EJK A;  1EY2 A;  1C28 A;  1PK6 B;  5LCW L;  3H7Y A;  2BBA A;  1WUV A;  1PO2 1;  3VZL A;  5DXD A;  4CDU A;  4G4F A;  5K4L A;  2ETE A;  3B9C A;  3TN9 3;  2VOV A;  2WFF 1;  4XHX A;  2JX9 A;  1GWM A;  1P8J A;  3K77 A;  3F2Z A;  4CCM A;  5L19 A;  1O5U A;  3OTF A;  1UYP A;  1RUJ 2;  4N7I A;  1HB2 A;  1AXY A;  1SDD B;  4P5Y A;  1UZW A;  1ZRI A;  2JD9 A;  3AFG A;  4R9B A;  3AB0 A;  4HN1 A;  4CUB A;  2FZ2 A;  3O1O A;  2FDJ A;  1EUU A;  4GWN A;  3NQH A;  4AI9 A;  4Y5S A;  3AC0 A;  5CAZ A;  5CFC C;  3NJV A;  1QJX 2;  4OUS A;  3MEP A;  1WLT A;  3HNM A;  3WG4 A;  2XJS A;  2RS1 1;  2XJT A;  1IGO A;  2XH6 A;  3T4V A;  3ZLI A;  2AEZ A;  1OT5 A;  5KXB A;  2CSG A;  2V5D A;  5FY8 A;  5FZ0 A;  2XWJ B;  3FHA A;  1JXN A;  4Y3O A;  4CXX A;  1BKZ A;  4CCC A;  2G1M A;  4IEO A;  3ZKY A;  4FPJ A;  4O7X A;  4AW7 A;  3VBF C;  4M0N A;  3K4A A;  4ZXE A;  1VBE 1;  1K5M A;  2VTX J;  1X8E A;  3E5X A;  2D6O X;  2HYX A;  1VRH 2;  3HBZ A;  4IV3 B;  3FE5 A;  4Q1P A;  1E5S A;  2BJS A;  1T2X A;  1PNG A;  2ID4 A;  4PT6 A;  3QOP A;  4XW3 A;  3CQO A;  3ROU A;  4CEW A;  3FJS A;  4PIZ A;  5IK5 A;  3MW3 A;  3RMX A;  1W8H A;  3SEP A;  4AEJ A;  3WF0 A;  4PIX A;  3Q8F A;  3BIE A;  2Y6F A;  1WCD J;  4MGZ E;  1AYN 1;  1ZZC A;  2OA2 A;  1DZR A;  1GZT A;  2QQO A;  3I2F A;  1B09 A;  3PIJ A;  4HXC A;  4Y5Z 0;  3WT3 A;  2VNG A;  5JIA A;  1JZ8 A;  4ITC A;  4AED A;  4O61 A;  1I6X A;  2RM2 3;  1QKQ A;  2VOK A;  4NE9 A;  1GAN A;  2ZGM A;  2VBB A;  4I01 A;  4IEU A;  5DPN A;  3ES1 A;  1UOJ A;  2B4K A;  3NV4 A;  3ZXK A;  2DUQ A;  4TSV A;  2XQR A;  5T50 A;  2CNA A;  2DFB A;  2VZS A;  2H0V A;  5E89 A;  2WT2 A;  2DVF A;  2DCY A;  2YC0 A;  3NNM A;  4IDZ A;  4JAA A;  3RMY A;  4LR4 A;  1UY2 A;  3PJQ A;  3TRS B;  2OXB A;  2ARC A;  5FZB A;  4CPB D;  4GD4 A;  4AAP A;  4K21 A;  2WBK A;  2Y6K A;  2YC4 A;  4GWM A;  2XLG A;  3S5Q A;  4B29 A;  5LEK A;  3VBO C;  3WXP A;  5DUX A;  4IER A;  1PGW 2;  4XDO A;  1MEC 2;  3CO2 A;  5JVV A;  4LUM A;  3ZXG A;  3KV9 A;  3RPQ A;  3MLK A;  2VBD A;  2RDQ A;  2G4I A;  4WM7 A;  4CZS A;  4XQD A;  4JX0 A;  4FVV A;  5FFO C;  4CDU B;  4IV1 A;  2WO3 A;  2N7G A;  1TZO A;  4XQW A;  2WNE A;  2C26 A;  5E88 A;  1ODM A;  4DXR A;  5DAX A;  1NY7 2;  1TE1 B;  3DYP A;  2WWS A;  1W2A X;  3W9A A;  3KT1 A;  5A3W A;  5ABJ C;  2HWC 1;  5DDJ 3;  2ARB A;  1YFY A;  4QKF A;  1GP4 A;  5C4W A;  1UY4 A;  3NV2 A;  1VE0 A;  2XGX A;  2XXZ A;  3GZE A;  4QD2 A;  2K46 A;  3KWV A;  2R49 A;  1ZZ6 A;  1W8N A;  1EAH 3;  2VMF A;  2CV6 A;  5LBE A;  2JEN A;  3SMH A;  4COY A;  1JW6 A;  5F3E A;  1WMX A;  4F3J A;  5FYI A;  2VQ0 A;  4J6G A;  5FOJ B;  3WP4 A;  4BIS A;  4QDQ A;  1AYM 2;  5I0T A;  3NST A;  1OD3 A;  1ULG A;  5FPU A;  4PHZ A;  1WBF A;  2Q1F A;  4M01 A;  4B4Q A;  3TNQ A;  1PO1 3;  3OEB A;  4R4X A;  5JMO A;  1OLR A;  1NLS A;  2AR6 A;  1S1A A;  2ES3 A;  1D4M 3;  2WT0 A;  3C7E A;  4NIA A;  3KVA A;  5H9R A;  1TNF A;  5A6Q A;  3UL2 A;  2B46 X;  4HET A;  5D8A C;  3ZN6 B;  3VGI A;  3V0B A;  1WWY A;  3WNL A;  1RUD 3;  5FZ7 A;  3VBH B;  3I7D A;  5H9Q A;  3AMP A;  1RUF 3;  1J1T A;  1O8P A;  3ASI A;  3W58 A;  1SQ4 A;  3LEI A;  4N53 B;  3A4U A;  1VBC 2;  1DCS A;  3PVO A;  1VBC 3;  4LPL A;  3T1M A;  2ET1 A;  1KD7 A;  3KS7 A;  1G9F A;  1POV 1;  4Y1X A;  2E9Q A;  3BVC A;  5T54 A;  2ZAA A;  3H3L A;  1OLQ A;  3MID A;  1O3S A;  5GZE A;  1E5H A;  2GC0 A;  2WRA A;  2VU9 A;  3KV4 A;  4A2U A;  4XQ4 A;  1C8N A;  3OBT A;  3CEW A;  3OJB A;  4NHL A;  1HRI 2;  1N47 A;  2RR1 1;  1Y4W A;  2ZHL A;  2XL7 A;  5FXZ A;  4JV4 A;  3MW4 A;  2O1Q A;  4QB6 A;  2EIB A;  5ABJ B;  2YRO A;  2ZEW A;  5FJH A;  2W52 A;  4IEZ A;  2NQY A;  3HJR A;  2RS5 3;  4I3P A;  1GNZ A;  1F5F A;  1VBD 3;  4LQR A;  5FZ6 A;  5I0R A;  1OQD A;  3I3Q A;  1ZNP A;  4MG2 A;  4OVE A;  4JGZ B;  1Z7S 3;  2BZD A;  3NKG A;  3KV5 A;  3H3U A;  4YVW C;  1C4R A;  4LOT A;  1V6I A;  3PU8 A;  4EZ4 A;  2A6X A;  2OW4 A;  1KGY A;  3WQ0 A;  5A3M A;  2BV4 A;  5BNP B;  3S7E A;  3WF4 A;  4RS5 A;  5J09 A;  2E7A A;  3RWN A;  1ZBA 1;  4LO8 A;  1YI9 A;  5BNQ A;  1FOD 3;  4DB5 A;  2JJ6 A;  3NJX A;  1PIV 2;  1NCQ A;  1COV 2;  1XNA A;  3BU7 A;  3PUR A;  3P3N A;  4N90 A;  4WVM B;  1E57 A;  1HN1 A;  4IE7 A;  3VZO A;  3WD5 A;  4C8D A;  3LIG A;  4WV8 A;  4Q0Q A;  5FXV A;  1ZX5 A;  4W4Z A;  1KEX A;  4CEY B;  4ZZ8 A;  1RL3 A;  1YQ2 A;  5FK7 A;  3PUH A;  1UX6 A;  3LE0 A;  1BVV A;  3O5S A;  3H1W A;  4HFS A;  2G9G A;  1YHF A;  1RED A;  3GF6 A;  1U5Y A;  1QOS A;  2HWD 1;  2YGM A;  4C1X A;  2IFW A;  2BVB A;  2WT1 A;  2YZ4 A;  2ZA9 A;  2W9X A;  1CAU B;  1BEV 1;  3PUA A;  5HCA A;  1QH6 A;  5GLZ A;  5B4X A;  5DAW A;  3DEM A;  5JMC A;  2BW8 A;  2WQ4 A;  3U1X A;  5L7O C;  4BU2 A;  4QGL A;  1NCR B;  2D93 A;  4IEQ A;  3MFA A;  4YZ5 A;  1HDK A;  4XIK A;  1ZRD A;  4CCD A;  4QB1 A;  2VZO A;  3LEK A;  3D8C A;  1VAM A;  1XNB A;  2DCZ A;  2CDO A;  2QE3 A;  3NAP C;  1AR8 2;  2WO1 A;  4FPO B;  2JE7 A;  4OZO A;  3L2H A;  1FMD 2;  1JHJ A;  4CU6 A;  1ZYB A;  1YEW A;  4D8M A;  2D7F A;  5FP9 A;  1U0A A;  3ZXL A;  5C3O A;  1AR6 1;  1SDW A;  1WLC A;  1BJQ A;  2QQI A;  4C1W A;  1RUG 1;  3K3O A;  1PGS A;  3GGL A;  1VAL A;  5BNP C;  5L9V A;  4QGN A;  3BTX A;  2P4E A;  2VG9 A;  5C8C A;  2YU1 A;  3PTY A;  2OII A;  4Q4W 3;  2C5D A;  4ZPI A;  3FHQ A;  2RS5 2;  3NJY A;  4AEM A;  3RS6 A;  5DAV A;  3VN4 A;  2P3Y A;  2J1V A;  4LUL A;  2DDU A;  1S0F A;  1K42 A;  2RVA A;  1IOA A;  1AYN 2;  3P6B A;  4FOV A;  4LBJ A;  1ZRE A;  4HK8 A;  3OPW A;  1NE6 A;  2CGP A;  1UU6 A;  1LGB A;  5CEH A;  4OI2 A;  1UAI A;  1REE A;  4LHK A;  3CMG A;  4ZU5 A;  1UXX X;  4X6Q B;  2GC3 A;  3QD6 A;  4QHZ A;  1OH3 A;  2D3P A;  1RIT A;  5I91 A;  3UET A;  5FZ9 A;  2VAU A;  4Y1V A;  4YZ4 A;  1E5I A;  1OH4 A;  4GZ9 A;  3ZFE A;  4ASL A;  2QZ2 A;  5L7O B;  3Q8B A;  1SBD A;  4M0H A;  1UMI A;  4MSV A;  4QX5 A;  2DV9 A;  2ZEY A;  4ZU4 A;  3WZ1 A;  4BQW A;  2ZKN A;  4HVQ A;  4AFA A;  4YW2 A;  4ZZ5 A;  1QY4 A;  2YB7 A;  4MXV A;  4AED C;  1NCQ B;  4WVM A;  5DG2 A;  2RMU 2;  1US3 A;  3OBA A;  3WV6 A;  1MS1 A;  2B45 X;  2C4X A;  2PYT A;  3U10 A;  1S0G A;  3UV9 A;  2X5I A;  1SZB A;  4Y4R A;  2QQK A;  2R32 A;  2H0B A;  2XON A;  3EXU A;  3LGR A;  5JOZ A;  4KI5 M;  3WDY A;  1X50 A;  3HMY A;  2FCT A;  5FZC A;  4NIG A;  1BK0 A;  1OLM E;  2MNG A;  5IAT A;  4MVT A;  1MS5 A;  5AC9 3;  2GC1 A;  4NRO A;  4HKO A;  2WKK A;  4M3C F;  3VHP A;  1IKP A;  2ZCW A;  4M4R A;  4OQ8 A;  2WN2 A;  3NJZ A;  4TLG A;  2XQX A;  2C6S A;  3RI8 A;  3UT0 A;  5KWR A;  1KIT A;  1TMF 3;  3I97 A;  5KC6 A;  2VMH A;  2QZ3 A;  5C3R A;  2BPA 2;  3I2J A;  5FZ4 A;  4XCA A;  5A7Q A;  4DIQ A;  3ZYF A;  3KD4 A;  2WZ8 A;  3PJY A;  3ZVX A;  5IVJ A;  5C9A A;  4E4H A;  3LDB A;  3ACI A;  4CXW A;  5FYU A;  2P6C A;  1OVS A;  1LOD A;  2X09 A;  1OQ1 A;  1U5Z A;  4YWA A;  2FCU A;  2P37 A;  3KM5 A;  2QUO A;  1RJ8 A;  4N43 B;  2WUH A;  3RYK A;  4IV1 C;  1ULE A;  1H8V A;  1SLB A;  3VZM A;  4V2W A;  5L9R A;  1WKY A;  3E5U A;  5JZG A;  3I3E A;  4CDW C;  3KCX A;  2FBE A;  1W9Y A;  2VUL A;  3H8U A;  4ES8 A;  4A3X A;  1DGL A;  1UY0 A;  3VBF B;  4XIL A;  3ES4 A;  4YW7 A;  5IFP A;  1UO9 A;  4JKM A;  4BB3 A;  3AZY A;  4DNY A;  4HSJ A;  1LU1 A;  1IQD C;  1JYV A;  1HXS 2;  2J1A A;  2QQU A;  4HKW A;  5BXX A;  3ZYJ B;  2BBV A;  1DHK B;  1UPI A;  4XFI A;  3B94 A;  3UES A;  3I8T A;  1DYP A;  2VM9 A;  3IZO A;  3MIE A;  4QQH A;  2Y0I A;  4A42 A;  1WCS A;  3Q9O A;  3WP3 A;  2JIC A;  1WA6 X;  4IND A;  4ES9 A;  2ZZQ A;  3HOB A;  4LBO A;  4OHY A;  1B35 A;  4NWW A;  1TMF 1;  4XUO A;  1JI6 A;  3RYP A;  4BJ0 A;  4I3G A;  1VBD 2;  4LXL A;  4UFM A;  3ZFF C;  3K48 A;  1H30 A;  5FP4 A;  2PEL A;  5AC9 1;  3JU9 A;  3H7J A;  3VDD B;  5HI0 A;  2X29 A;  3PUQ A;  4WVW A;  3O1V A;  4LO4 B;  3OB8 A;  5FZI A;  2I2S A;  1ULF A;  1MQT B;  4IEP A;  3R0R A;  4D6Q A;  4AI0 A;  4NMI A;  4NPL A;  2EID A;  1LED A;  4GA9 A;  3B69 A;  4U2A A;  3A0N A;  4WM8 C;  3TN9 2;  5KHJ A;  1WW5 A;  4FPH A;  1C5H A;  1W2T A;  3ETQ A;  1PIV 3;  3T0B A;  2XWB B;  1PHM A;  2XML A;  1QJF A;  4I09 A;  4K8R B;  1FNZ A;  4MHU A;  2P6H A;  4Q4V 1;  1R64 A;  3W5N A;  3PME A;  1ST8 A;  1ND2 B;  1NA1 A;  4GB3 2;  3ZX7 A;  2RJ2 A;  5ACA 3;  5LY1 A;  2HWF 3;  1AHS A;  4NWV A;  4XOG A;  1HJF A;  5A33 A;  1AR7 2;  4B1M A;  5A70 A;  3DXT A;  5HXM A;  2GND A;  3Q8A A;  5J48 A;  4BLJ A;  1SBF A;  3HAG A;  4FPG A;  4JGY B;  2FDF A;  5EQU A;  1IS4 A;  3ZR6 A;  1S2B A;  5A32 B;  1MZ5 A;  3FMG A;  3OBZ A;  3M3C A;  3H1M A;  4XCB A;  4FP3 A;  5A3N A;  3VZN A;  2HH9 A;  3AL5 A;  1A3K A;  1MPX A;  4P9W A;  1QQP 2;  4GJY A;  1NLQ A;  2XUM A;  4AGG A;  1HIX A;  1HRI 3;  1C3H A;  4UXA A;  1GNY A;  4UOJ A;  1URX A;  3EQE A;  4P9L A;  3K51 A;  3VD4 A;  1RIR A;  1W6O A;  3T08 A;  4WM7 C;  4Q4W 1;  2R1D A;  1I5P A;  2Y64 A;  1V6L A;  4YGD A;  1O5L A;  3W21 A;  1HQN A;  3Q8E A;  1UMH A;  3AZV A;  2VJX A;  1DQ2 A;  2BER A;  3VDD C;  1RUG 3;  4IV3 A;  3WNK A;  1W8T A;  2ZX2 A;  4D7T A;  4Q0P A;  2E7T A;  4HPK B;  1JYT A;  3T3Y A;  4GWJ A;  2BYV E;  3OYW B;  4FXG B;  5LEJ A;  5L36 A;  4A41 A;  4QDR A;  3JUU A;  4BIO A;  2WNV B;  4URT A;  3VBH C;  1ENQ A;  3HN1 A;  2IXI A;  2PHW A;  3HQR A;  1TG7 A;  4KNC A;  2FDH A;  3RFR A;  4H3W A;  4N7U A;  4W6W A;  1CZV A;  4AEK A;  1J59 A;  1AR7 1;  1PNF A;  1IS6 A;  3WNO A;  4Q26 A;  1XYN A;  4AVA A;  1MVQ A;  3O7O A;  5BY5 A;  1BEV 3;  1L7Q A;  1ODN A;  5FPL A;  4HVR A;  2JDA A;  2AYH A;  2HWD 3;  2P2K A;  4XF9 A;  4Z2A A;  5KC5 A;  2BOJ A;  5ISL A;  3RZG A;  1QXJ A;  3N7J A;  5F5C A;  5J98 B;  4L0P A;  2PTM A;  2F17 A;  5DDJ 2;  3HQX A;  3VV1 A;  2ZGL A;  1H9P A;  3M70 A;  1MS3 A;  3EB7 A;  4IXL A;  2NPI A;  4Q4V 2;  4FAH A;  2UY9 A;  4F8A A;  4QXC A;  3MW2 A;  2OYZ A;  3ZSK A;  2UU8 A;  3K75 B;  4RYD A;  2DFC A;  5A7W B;  2VCC A;  2A1X A;  2XG3 A;  1VRH 3;  2W0X A;  2H6C A;  3AZW A;  3F95 A;  3DV8 A;  4LBM A;  1FOD 1;  4RA0 A;  4WM7 B;  2Q8E A;  3IDA A;  4MXW B;  4CP9 A;  1PO2 2;  3T1L A;  4L97 A;  3O1R A;  5JXJ A;  3OCP A;  4EV0 A;  1LCL A;  4PLM A;  4AXO A;  5GM0 A;  4JDM A;  4P02 B;  4ATE A;  2FCV A;  2WDB A;  3DKQ A;  4DY5 A;  5A33 B;  3JBG 1;  4NN0 A;  3GZA A;  3VBR A;  3RGB A;  4Z1V A;  5LRS A;  1Z7S 1;  4UT5 A;  5C70 A;  1ASJ 2;  1DZQ A;  3BPZ A;  4UW4 A;  3CU7 A;  1VBD 1;  1GBG A;  5C4W B;  3MLJ A;  3CF6 E;  4HKL A;  2RS5 1;  1RUC 2;  4Q4W 2;  3VB9 A;  5FO8 B;  4IE0 A;  5IK8 A;  1VP6 A;  5DAQ A;  1RUC 3;  1YQ6 A;  2DVD A;  2Z2S B;  3DUI A;  5FCC A;  5FRA A;  5FO9 B;  5LAT A;  3TB0 A;  1L7L A;  1BBT 2;  1X36 A;  2PHL A;  2RR1 3;  5CG9 A;  1C8M 3;  1BBT 3;  4XHB A;  4Q0U A;  1RUN A;  4MV2 A;  3J9S A;  4HON A;  4W65 A;  1SHW B;  2WA3 A;  3POY A;  1FPN 3;  4XTP A;  1ZVF A;  2BWA A;  2LAL A;  4A7K A;  3ZXD A;  5C33 A;  1W6O B;  1X9P A;  4LUK A;  4XJW A;  5FZ3 A;  1POV 3;  2Q30 A;  2BUK A;  4TWT A;  2ORX A;  1PM4 A;  5FXW A;  3NNJ A;  2I45 A;  3AKQ A;  3WUC A;  2JDH A;  4BQY A;  4FPK A;  1LKN A;  2UYB A;  5E1R A;  5T5L A;  5EIY B;  4HPK A;  4AZZ A;  5F39 A;  4G9S B;  1JZ2 A;  2V5Y A;  2ZKL A;  4Y20 B;  5FAX A;  4BM8 A;  4CUC A;  2VH9 A;  3USU B;  2AC1 A;  2KD7 A;  2W5F A;  1D4M 1;  3LEM A;  2WNV A;  5E8A A;  2D44 A;  1PO1 1;  4XFC A;  1LOA A;  2Y60 A;  5F2S A;  3C8X A;  3THT A;  1OBN A;  1G9A A;  2LUW A;  1WD4 A;  3ACL A;  1HXS 3;  1X33 A;  4B7K A;  1CZT A;  1QJE A;  3ZXJ A;  4YW5 A;  4LKD A;  1UKR A;  4PLN A;  3GZU C;  4YW3 A;  1QWR A;  1YUD A;  2E31 A;  5B2G B;  2UUR A;  1FYU A;  4IES A;  3MIC A;  1U12 A;  3VD5 A;  4YAR A;  4XJZ A;  2ZXQ A;  1HRV 3;  2HWC 3;  1GZW A;  3QCW A;  2AEN A;  2Q8D A;  1W8U A;  3ME2 A;  3V64 A;  4JGZ A;  5BYN A;  1YIF A;  1KRI A;  4CCO A;  4NVP A;  5FP8 A;  3FHI B;  3UKV A;  1UCX A;  4MGS A;  4UAP A;  4P9I A;  1VRB A;  3GYD A;  5AVA A;  1LR5 A;  1SCR A;  3SEE A;  1PK6 C;  2A73 B;  2HLE A;  3ILF A;  4NPM A;  1F31 A;  1XU1 A;  2VXJ A;  1JU4 A;  3AMH A;  3VHR A;  4QPG B;  3OUH A;  2WSU A;  4W6X A;  4DO0 A;  4CP9 B;  1Z0H A;  2TBV A;  5D8A B;  1N1T A;  4RSU A;  4EQV A;  3R4D B;  2R06 2;  2AGS A;  1QOT A;  3WQ1 A;  4JCK A;  2VNR A;  2RR1 2;  1HW5 A;  1AF9 A;  4N53 C;  1JYN A;  1F9K A;  2WYS A;  2ZJC A;  2VMD A;  4QMA A;  4K20 A;  1G86 A;  5FY7 A;  3FN9 A;  5HCB A;  2ZAB A;  3OGG A;  1H8T C;  1PX3 A;  2PXJ A;  3RWK X;  1A78 A;  2WAB A;  3CNA A;  3LKJ A;  3I2G A;  3DN7 A;  2BNN A;  4YG0 A;  4MGT A;  3FWE A;  3AXE A;  1R1A 3;  2F4L A;  2DF7 A;  1CX1 A;  3M2M A;  4CU7 A;  4CCN A;  1PMH X;  1NXD 1;  2HWE 2;  1DQ4 A;  2E6V A;  4AFC A;  4TTG A;  1AL2 3;  3T09 A;  3ZYG A;  1NCR A;  3G6J B;  4N9I A;  2XKO A;  2RM2 1;  3PNA A;  3N9O A;  3LB9 A;  5GLT A;  1CAW B;  3QH6 A;  4IV3 C;  4LHS A;  4AR2 A;  1RUO A;  2VBP A;  1J3R A;  4QHB A;  1NQJ A;  4AVT A;  1S0E A;  3OGJ A;  1K45 A;  1QDC A;  5D21 A;  3U11 A;  4CEW B;  1UQX A;  5A3T A;  2W2I A;  4I0A A;  4ORF A;  4AF9 A;  1RUG 2;  1GFF 2;  4XAE A;  4IGO A;  4LIV A;  2X8K A;  2LTN A;  4OUE A;  5FO7 B;  4LBQ B;  5GKA C;  1G6N A;  5LBF A;  1UW8 A;  2YY1 A;  1FT9 A;  3EMR A;  3U07 A;  4CDW B;  4UFI A;  3AJZ A;  4B1L A;  1A8D A;  3D82 A;  4HLT A;  4YVS A;  1NAE A;  1OUX A;  3LSE A;  4JZR A;  1UYX A;  2VPV A;  2ZEX A;  1QF3 A;  4QXH A;  2EXJ A;  5DN2 A;  3WQ7 A;  4BQ3 A;  1CVN A;  2EXH A;  4FPC A;  4KQ7 A;  2W3J A;  3MO4 A;  4P9G A;  1BLZ A;  4ZS3 A;  4BK4 A;  1DLC A;  3MDP A;  4LKF A;  3O12 A;  4V1P A;  2XVG A;  3VL9 A;  2QDN A;  4CSW A;  1J3Q A;  1JMU B;  2WFF 3;  4OHX A;  3TN9 1;  5LA1 A;  2X05 A;  1PO2 3;  4QXB A;  3ZOI A;  1D0H A;  5DZF A;  4DQA A;  5GZC A;  2W1S A;  5K0U B;  4L11 A;  4EZH A;  1OOP A;  1VBA 2;  4AQ6 A;  5C8C C;  4QB2 A;  1S0B A;  1YNA A;  1DYK A;  4XFH A;  2YMZ A;  1HV0 A;  3ZPO A;  1COV 1;  5T55 A;  4GH4 A;  1DG6 A;  5CFD B;  3MHZ A;  5KHI A;  5ANQ A;  2HWE 3;  2RM2 2;  4QX3 A;  1FNY A;  1NXM A;  1YJL A;  2PLV 3;  3INA A;  2IUW A;  1RC6 A;  4XE9 A;  4Y22 A;  5APA A;  3ZFE C;  4AAX A;  1TME 3;  3BTZ A;  4KG0 A;  2J1U A;  5IVY A;  3AKP A;  2RS3 2;  5A3U A;  3MBW A;  2WWJ A;  1W0N A;  1W9S A;  4IET A;  2LM3 A;  1AXZ A;  3DPR C;  4MO3 M;  1QMJ A;  1RHI 3;  1XU2 A;  1ND2 C;  2QTW B;  2QQJ A;  3FL7 A;  4E2G A;  1N1S A;  3NWK A;  3PMS A;  1DGW A;  1NQD A;  1LHW A;  2CWM A;  4JVA A;  1W6P A;  1HJG A;  1MEC 3;  4QWN A;  4QX0 A;  3RJR A;  4KL1 A;  2W46 A;  1W6N B;  3NMB A;  2B42 B;  2P1B A;  2VCB A;  1DGW X;  3POJ A;  5LA9 A;  4EWD A;  1LJ7 A;  2VUD A;  3ZPY A;  2RG4 A;  2BGC A;  3CDZ B;  3AKS A;  3WDW A;  3SIT A;  2JDP A;  4W6Y A;  4YNI A;  4EN0 A;  5K0U C;  4TXW A;  4YZ3 A;  2WZR 2;  4XAB A;  4M3C E;  2W08 A;  2BTV C;  2AEY A;  2WQZ C;  1H2N A;  2XB6 C;  5LK5 A;  4BDV B;  4QKD A;  1UU4 A;  1O4Y A;  2A75 A;  2ZX4 A;  3JBG 2;  1F35 A;  2KR2 A;  5AFB A;  3TAY A;  1VBA 1;  5IVE A;  2UY8 A;  1SFY A;  5F5I A;  3NO8 A;  5CNA A;  2WJS A;  5DUW A;  3S0M A;  3CIH A;  4AFM A;  2QQM A;  4Y1Z A;  2NLR A;  1Q56 A;  4LJH A;  5HXV A;  3LDK A;  1CIY A;  5I8S A;  1FOD 2;  5LK7 B;  4AFB A;  2JDZ A;  5IVV A;  4AI3 A;  5FK8 A;  5JI9 A;  3MZH A;  1O91 A;  1VJ2 A;  2WII B;  5F1R A;  1UKG A;  2B9U A;  2QJV A;  3KQR A;  1RVF 3;  3H9A A;  5KHH A;  5C4W C;  1AX2 A;  3PLQ A;  3CBN A;  1WA4 A;  3VBU B;  4BME A;  1OOP C;  1DU3 D;  3KT7 A;  4GB3 3;  5T52 A;  1Q3E A;  5LWB A;  3WNM A;  1S2K A;  2EIG A;  4FPE A;  1AX1 A;  4PQQ A;  4LE3 A;  2RDN A;  4AI2 A;  5FYY A;  3K4Z A;  5FYC A;  3OBR A;  1UU5 A;  2ZMN A;  1U5I A;  1PO1 2;  1MQT A;  1IHM A;  3W5M A;  2ZPX A;  4QM8 A;  3THP A;  2BNO A;  1F15 A;  5LA2 A;  2BRT A;  4GH4 B;  2G9F A;  1JYW A;  5A7O A;  2VCA A;  3IWZ A;  4BQ2 A;  1F4A A;  3A21 A;  4HZF A;  4Q4Y 1;  4CDX B;  1DP0 A;  1MEC 1;  1PZ7 A;  2HBU A;  4PJY A;  3SKJ E;  4BQ4 A;  3IAQ A;  5JIU A;  4OFG A;  1DQ1 A;  3CJI A;  4C0H A;  3GAL A;  2Q8C A;  1O4Z A;  2R04 2;  4FT8 A;  2VZP A;  4QM9 A;  4UFH A;  5J37 A;  4WZF A;  5D2A A;  3WHU A;  5IAV A;  4I30 A;  5A1F A;  5C3S A;  2MEV 3;  4A45 A;  1POQ A;  2VVF A;  1J58 A;  2DBN A;  4KU8 A;  5EFU A;  5I0U A;  5AVP A;  3U37 A;  1WBL A;  1W28 A;  5FZM A;  1YC6 1;  1QJU 2;  1HV1 A;  4R52 A;  1CPN A;  3PL0 A;  4B8E A;  4CCK A;  4D0Q A;  1WW6 A;  1D2Q A;  2GP3 A;  4CUG A;  1RTV A;  1TME 1;  1N3O A;  5EJZ B;  1IPS A;  3EHK A;  5FBZ A;  3PUI A;  4B4P A;  3ZFG C;  4AGR A;  4AVC A;  5KBF A;  1QGL A;  1GKB A;  4AYU A;  1W6N A;  3M7A A;  3UJO A;  2A70 A;  2HWE 1;  1GQG A;  1ASJ 1;  3BB6 A;  1UY1 A;  4NJ4 A;  4YGE A;  1WLW A;  1STM A;  1Z7S 2;  5GZD A;  3WOG A;  4C91 A;  1IS5 A;  5HCF A;  1M06 G;  2JE9 A;  4A3Z A;  4LK6 A;  2CL2 A;  2FHR A;  4Q2F A;  2JDM A;  2BFU L;  1WCU A;  4YZ2 A;  1UF2 C;  1JOP A;  3TEX A;  1BYH A;  2G19 A;  1GQP A;  4GXL A;  1RUH 3;  5A6X A;  1DDL A;  4OUL A;  1HB4 A;  2ZX1 A;  4MZU A;  3N9Q A;  4O65 A;  2RMU 1;  1TNR A;  1XYO A;  3HD8 B;  2DCJ A;  1X82 A;  3OF1 A;  3VKM A;  2YBS A;  3OYW A;  4YGB A;  4KU7 A;  3TEW A;  2R0F A;  3J7L A;  1CGP A;  1UD1 A;  1WCQ A;  3FZ3 A;  1UX7 A;  3SH4 A;  1I5Z A;  3DF0 A;  3SNM A;  3I59 B;  4BE3 A;  4DRV A;  3IT8 A;  4YM0 A;  1VBB 2;  5FPA A;  3C2U A;  3ZKU A;  3D0S A;  1POV 0;  4CE8 A;  3FBM A;  3KGZ A;  1AR9 3;  2W92 A;  4YSF A;  4ZHN A;  3I49 A;  5ERL A;  1AR9 2;  2TEP A;  1UL9 A;  1YIP A;  2BEO A;  1WW7 A;  1PZ8 A;  3OPZ A;  1ALY A;  2Y33 A;  4FOY A;  3POS A;  1V6N A;  1R09 2;  4WM8 A;  2QNK A;  4DXS A;  1Q43 A;  1ACC A;  3RDI A;  1TMF 2;  3ILN A;  4K6B A;  3WW1 A;  2DVG A;  1JOD A;  2JG8 C;  4W8J A;  1VB4 A;  2B9V A;  4XZP A;  4EE2 A;  1J1L A;  4JQT A;  1UY3 A;  2Y38 A;  4W50 A;  4Y4Y A;  4NID A;  2O8O A;  2YPJ A;  1GP5 A;  1H1I A;  2C9K A;  4Q27 A;  1QJU 1;  2W39 A;  4KBZ A;  1PGL 1;  3ACG A;  4RHV 2;  3CJX A;  3RYR A;  4YG3 A;  1ENS A;  3MUY 1;  3OSD A;  4YLZ A;  4NRP A;  1W2U A;  4NO4 A;  5FKC A;  1JZ6 A;  1VAV A;  3IIA A;  5CVR A;  1AL2 1;  1GMM A;  4U36 A;  5L73 A;  4YM1 A;  5KXD A;  4TZD A;  3VBR B;  3B93 A;  4LNV A;  4MGI E;  4DRR A;  4ZU7 A;  3MPP G;  4GAL A;  4LA3 A;  2XBO 2;  5JR2 A;  1C5I A;  1OHF A;  1AXK A;  3LFM A;  4COZ A;  1H6X A;  2VZR A;  3B7M A;  4UBH A;  1R1A 1;  2A3X A;  2YPD A;  2ZGO A;  1HQW A;  2DU0 A;  2Y8K A;  2YBP A;  2YFU A;  3GNE A;  5JOX A;  4QX2 A;  1W04 A;  1SLA A;  2RDS A;  3VKF C;  5CKN A;  3POG A;  1WZX A;  1BEV 2;  1GOG A;  2Z69 A;  3KCY A;  4XC9 A;  2O0O A;  3PU3 A;  4HG6 B;  2A6W A;  3GCX A;  4IW3 A;  2LW8 A;  3WCR A;  1NUK A;  3DKW A;  3HT1 A;  3OGS A;  5J1X A;  2VNO A;  3KHC A;  3SH3 A;  4ZKT B;  3NNF A;  1YQ8 A;  5FZO B;  4YW1 A;  1D7P M;  1K5M B;  2QQW A;  4OZX A;  4R9D A;  4K7J A;  5JZG B;  1UIJ A;  4JRA A;  1ND3 B;  2PAM A;  4CTE A;  1MR5 A;  1HB1 A;  4ET7 A;  1MS4 A;  3VKN A;  1RMU 1;  3WW2 A;  5A6Y A;  4LOR A;  5JSR A;  4I0W B;  1LTE A;  4E8D A;  4EWE A;  1QXR A;  2X53 S;  2VVD A;  4Y20 A;  5F3C A;  2OS2 A;  3WP5 A;  3WIN E;  1RB8 G;  1N3P A;  4PI0 A;  3USU A;  2JG8 B;  3VD7 A;  3WNP A;  4AL9 A;  4Q4X 3;  1EYB A;  1HRV 1;  3ZYI B;  5DZE A;  4OMD A;  4AFD A;  5JDB A;  3ZSL A;  3ZFG A;  3C7G A;  4D6S A;  5A6Z A;  3RZM A;  5C9A C;  1R1Z A;  5FUP A;  3ZDV A;  5FPZ A;  4JHZ A;  2WSV A;  3WDX A;  5LBB A;  4FPL A;  1YLL A;  5F3I A;  3I2O A;  5FY9 A;  4FTE A;  4D3W A;  1SMV A;  1W03 A;  3LQC A;  1KJL A;  3JQX A;  1HXS 1;  4HK9 A;  4LA2 A;  2R06 3;  1H1A A;  1H4H A;  2WZE A;  2PAK A;  4KWK A;  2PQQ A;  2ZAH A;  2HWB 3;  4FQZ A;  4LKE A;  2JDU A;  5KHG A;  1D4M 2;  4RGK A;  4XET A;  1PX4 A;  4AVV A;  5J7M A;  4L9B A;  4OLL A;  1I3H A;  4BQ1 A;  2DYC A;  4QU2 A;  4CUA A;  5CFC B;  4WM8 B;  2HEW F;  2BVV A;  4G3Y C;  4OCT A;  4ZY9 A;  5D1I A;  3VUO A;  1R1A 2;  1T6B X;  5K9Y A;  2EAL A;  2ZBJ A;  3JD7 3;  5EPA A;  2FZ1 A;  2Y6L A;  2DU1 A;  4GMP 1;  4HT1 T;  1UYY A;  4QAW A;  4IE5 A;  5FZ1 A;  5EP9 A;  1W6Q B;  3RNS A;  4AQ2 A;  3M1H A;  3X29 B;  4CXY A;  3AFK A;  1CJD A;  1ND3 C;  2L9L A;  3J7H A;  1FPN 1;  1NA1 B;  3QH7 A;  1VLN A;  3AMQ A;  2ATF A;  4D69 A;  4QPY A;  1YFU A;  5T5J A;  2GZW A;  1QU0 A;  1BBT 1;  4ARY A;  4D7S A;  1C8M 1;  4H2A A;  3KLS A;  4YVW B;  5H9S A;  4A44 A;  1YCI A;  2VZV A;  3A7Q A;  3JB4 C;  1NX9 A;  1RUC 1;  2DVB A;  2EVX A;  2WFP A;  2Y34 A;  5A32 A;  4Y33 A;  4PIY A;  3FUO A;  4CVU A;  3EO6 A;  4EWA A;  4QXK A;  1F5J A;  2Q1Z B;  2VQA A;  2XL9 A;  3TOJ A;  4UFL A;  3VDB A;  1UIK A;  2QQL A;  1F8V A;  3JBG 3;  4IGP A;  5FWE A;  1U5X A;  1ZRF A;  2DWR A;  2NM1 A;  2OUH A;  3OOX A;  4LHL A;  2VC9 A;  3AYE A;  4KBB A;  2K9Z A;  2V4V A;  2J1E A;  1S4C A;  4O9E A;  5LW9 A;  5BNO A;  1CAW A;  5FZO A;  4GKX A;  3ZSJ A;  4DEQ A;  2XLF A;  5FYB A;  1ZZ7 A;  1VRH 1;  4FFI A;  2QVS B;  3VBU C;  4COW A;  1GP6 A;  4MET A;  3OY8 B;  4Z82 A;  3A0K A;  3ZN6 A;  3V0B B;  3DYO A;  2JKB A;  3WF3 A;  2LRO A;  3VBH A;  1A8M A;  1CX4 A;  2WNV C;  2B5H A;  2CWS A;  2R30 A;  3AL6 A;  3H50 A;  4DFS A;  3MYX A;  5DUV A;  4DMI A;  3UKT A;  1DGR N;  5FYM A;  2E51 A;  3VBO B;  2NMN A;  1VBB 3;  2Q8O A;  2D6N A;  5ANN A;  2XHN A;  1CAX A;  1Q8S A;  2PQS A;  4LBQ D;  2HWB 2;  4K40 A;  4GWI A;  5HV4 A;  2C24 A;  2JEM A;  2VNV A;  3BN6 A;  4FXK B;  5F2W A;  3RSJ A;  5I8Y A;  2JKX A;  1NA1 C;  3N36 A;  2IVI B;  4QPW A;  1AR7 3;  4D94 A;  1H8T B;  4UWD A;  3IN9 A;  3OUI A;  4BK5 A;  4P08 A;  2ADE A;  2YDE A;  1OMI A;  2ZS6 B;  4XUQ A;  4NII A;  2D43 A;  5I93 A;  4ARX A;  5J96 B;  1QH7 A;  2XDV A;  3AP5 A;  4UI9 L;  1ZBA 2;  1KXG A;  2QQN A;  2OZJ A;  2X10 A;  2YGL A;  4GIQ A;  3OUJ A;  4Q8K A;  3WQB A;  1PMI A;  5FMO L;  3FC0 A;  4Q0S A;  1VAK A;  2WO7 A;  3ZXA C;  4AGV A;  3EYP A;  5FLH A;  1NYW A;  1EAH 2;  4RHV 3;  5BNP A;  3CLP A;  4LO7 A;  2VUC A;  1WGP A;  1TQ5 A;  3BOD A;  5EYY A;  5FZH A;  4N8M A;  3ETP A;  2KXL A;  2DTW A;  2EAK A;  3BKZ A;  3GXU A;  1OOP B;  3WY6 A;  2PLV 2;  1PK6 A;  4UF0 A;  2OZ6 A;  2IXH A;  2Y26 A;  1AR8 1;  1FAT A;  1SLI A;  2Q4S A;  1JYX A;  3MF9 A;  3RZH A;  1JTZ X;  2ILM A;  4BH9 A;  4CEW C;  2WO2 A;  1V6O A;  4TYS A;  4BPZ A;  5KR7 A;  2RE9 A;  1BXH A;  1OUS A;  4RR3 C;  1VMF A;  2ARX A;  1HRI 1;  1OQE A;  2P34 A;  1AR6 2;  5FUI A;  1RYY A;  3G7D A;  3N9L A;  1AX0 A;  1KS5 A;  4Y22 B;  1IG0 A;  4HOO A;  3WDU A;  1UZ0 A;  2JDY A;  3AX4 A;  1HQL A;  3QAC A;  2ZAC A;  1ULC A;  5FQ0 A;  2A7A A;  4H7L A;  2Y6J A;  3VLB B;  3CJI C;  3GM8 A;  1CAU A;  4COU A;  2VO5 A;  3ZXE A;  4FOQ A;  4BXF A;  1FXZ A;  4KWU A;  4FO9 A;  4YVS C;  3ORJ A;  2HWF 1;  3R6S A;  5FOB B;  2YC2 A;  5ACA 1;  4ZXK A;  3S5A A;  1XE0 A;  1H1M A;  3ABZ A;  3MIG A;  1JUH A;  1ONA A;  1RXF A;  2BOI A;  4Q4V 3;  2LS6 A;  5IJR A;  1O3Q A;  2R16 A;  3III A;  3AJY A;  5SV5 A;  3O0W A;  4IQP A;  4XJU A;  2RJL A;  4GKY A;  1LOG A;  1XQN A;  4L92 A;  4LIU A;  4DXZ A;  1PIV 1;  3DCQ A;  4N9H A;  3MFC A;  1NKG A;  3ZSE A;  3WW3 A;  1I1E A;  4XBN A;  4L2N A;  4RGG A;  1IPK A;  4PBP A;  4FPF A;  4BIF A;  1ZZB A;  5A80 A;  1RUE 2;  4DEV A;  4RQP C;  3VBO A;  5AC9 2;  5C8C B;  3O1U A;  4ONU A;  1E5R A;  4D6R A;  3KQ4 B;  1SPP A;  3JCI A;  1Y9G A;  3PVB B;  4K3U A;  4LT5 A;  4BXS V;  5FZD A;  1JZ5 A;  4M00 A;  4Q4X 2;  3LEG A;  2OPK A;  3B3Q E;  2G9Z A;  5DAP A;  4YZ1 A;  2A5Z A;  2XJR A;  5F37 A;  3K2O A;  2PHT A;  2ZGK A;  1QIQ A;  2WS9 3;  3UGF A;  4FPY A;  4JKK A;  3HEI A;  4DOU A;  5EWS A;  3KF3 A;  2HEV F;  4XXA A;  5LAS A;  4J25 A;  4OYU A;  3KGL A;  1JOB A;  2ZX0 A;  3FFZ A;  1SAC A;  2RDR A;  3JD7 2;  4OQ9 A;  1HKD A;  3SQO A;  1XYP A;  2V72 A;  2WZP P;  1UN1 A;  4KWL A;  1OA3 A;  4Y1U A;  2HKX A;  1WLD A;  3T0A A;  3AP7 A;  4QPG A;  3BCW A;  1QJY 1;  3OD0 A;  3KSC A;  3H8O A;  3POI A;  1O59 A;  4LK7 A;  5D8A A;  2CAV A;  1FX5 A;  4AVS A;  3M3Q A;  2CGO A;  2P3I A;  1K5M C;  1QOO A;  1EV1 1;  4YPJ A;  2P5B A;  4KH9 A;  4UYB A;  2P17 A;  3AKR A;  2R07 3;  1OSG A;  1XC6 A;  1RUI 3;  2ZGQ A;  5FV3 A;  2OUJ A;  2GNT A;  1N1Y A;  5FQ0 B;  2E32 A;  4OI0 A;  4HN0 A;  2XJP A;  3V0A B;  1S2E A;  2PHR A;  1NZI A;  2VOW A;  5FWJ A;  3D4K A;  3VBS C;  1GNH A;  4UBG A;  3USS A;  4Z07 A;  3DYM A;  4V2V A;  4WVZ A;  3WG2 A;  2YU2 A;  2JG9 A;  2UWA A;  1LGN A;  3LIH A;  5JSO A;  5HBA A;  3VBR C;  3WG1 A;  2GMP A;  1IQA A;  5IVF A;  1YWK A;  2MHF A;  1A6C A;  1VBE 2;  1BCX A;  1HLC A;  1GZC A;  4QKB A;  1XB9 A;  4S2D A;  2C0Z A;  4XUP A;  4YFZ A;  2YFZ A;  5JXG A;  1Q5O A;  4PI2 A;  4A6O A;  4ISR A;  4XUR A;  4JDN A;  2YXS A;  3AVS A;  5IW0 A;  2XPJ A;  3ZIW A;  4CEY C;  2W68 A;  3LPG A;  3NAP A;  1OI6 A;  1W8W A;  2NZ9 A;  3BTY A;  5JWP A;  1NY7 1;  1UMZ A;  3S7I A;  1JS9 A;  3C7F A;  2XOM A;  4PDW B;  1GIC A;  3PUS A;  2OKX A;  1H9W A;  4A6S A;  1LHV A;  4CDQ A;  1QJX 1;  3WSO A;  1H4G A;  3LF7 A;  2OX0 A;  4LBQ A;  4PCR A;  1CN1 A;  3WG3 A;  3RVH A;  3VZJ A;  3HN3 A;  5IHR A;  1SPP B;  1DYO A;  2WIN B;  3WF1 A;  4CP0 A;  4JC1 A;  4L99 A;  1N1V A;  4XF0 A;  3A22 A;  1XNT A;  4CDW A;  2Y6G A;  1SLC A;  2GDF A;  5FZ8 A;  3THC A;  2D97 A;  1MS9 A;  2ARE A;  2C1F A;  4TN7 A;  1R09 3;  4QPI B;  4XFB A;  5CBL A;  2CHH A;  3HQU A;  1T6G C;  4IEV A;  4XDP A;  3SIS A;  3NVC A;  2HBT A;  1US2 A;  2R6Q A;  4JDO A;  1BVP 1;  1UPS A;  4XAA A;  5G05 L;  3IDB B;  2PA7 A;  3ZYB A;  1DQ0 A;  3I3B A;  2VUA A;  4XJ8 A;  2XHK A;  1YQ5 A;  3AP9 A;  4BLI A;  5HPO A;  4ERO A;  3MIF A;  1W3X A;  4B7E A;  4RS5 B;  3FUQ A;  5DQ0 A;  1JZ3 A;  1OUR A;  2RHP A;  5CZK A;  2IXJ A;  2VEC A;  4RFT 0;  5FP7 A;  4FAG A;  1W3V A;  4O9G A;  2ZGT A;  2GNM A;  4UW5 A;  2QKD A;  3UKN A;  4I2O A;  1H2M A;  4FTS A;  1AR6 3;  3HVD A;  4CA9 A;  1FMD 1;  3H3Z A;  4E4D X;  4EYU A;  1XJA A;  2DCK A;  4EN9 B;  1GUI A;  4CEY A;  2ZML A;  3IPV A;  1EV1 2;  1NE4 A;  3C7O A;  3IAP A;  5JUV A;  2E53 A;  1V9U 2;  4PDW C;  1OXC A;  1QEX A;  5FXX A;  4CP1 A;  1R08 2;  1MS0 A;  1ZRR A;  5LRR A;  3ILR A;  3DPR B;  3FLR A;  3LCP A;  1OKQ A;  2I07 B;  4PBO A;  4ZON A;  4DPN A;  1FPN 2;  4NAO A;  4H14 A;  3N3H A;  5HCH A;  2B8M A;  2AH2 A;  1RUJ 1;  1ZA7 A;  4XFF A;  1DZT A;  2O8Q A;  5IUQ A;  3ENR A;  3I2H A;  3H8X A;  4UFK A;  1SLT A;  1JYC A;  3AP6 A;  3D0J A;  3NV1 A;  4JHT A;  4FFG A;  4BA6 A;  1GR3 A;  4IE6 A;  5FPB A;  2ORZ A;  4XTM A;  2VZ3 A;  5DZG A;  2E26 A;  4XPV A;  1XXN A;  2ZGP A;  1BZW A;  4FFH A;  5F6K A;  5CFD C;  3W20 A;  5LA0 A;  3ACH A;  2VZ1 A;  3PVN A;  4CP2 A;  2ZZJ A;  5A3P A;  1XOY A;  5IYY A;  2V73 A;  2VW0 A;  2Y6H A;  3QLQ A;  4M3C B;  2HWC 2;  1AVB A;  1ZBA 3;  2ZHM A;  4S2F A;  1ND3 A;  1UNB A;  2VZQ A;  5JXI A;  1LB2 A;  1JHN A;  3ZYR A;  2VTX A;  4LHN A;  3VL8 A;  3WLU A;  2FDG A;  3OG2 A;  3E6B A;  5FYZ A;  4XMA A;  2W1W A;  4IEX A;  4XF3 A;  1RVF 2;  1QNY A;  1VB2 A;  3ELN A;  5LBC A;  4Z2W A;  5FRE A;  3GDB A;  4QPI A;  1PMJ X;  3CZJ A;  1HRV 2;  1X8M A;  3GBW A;  5FLJ A;  5GJ6 A;  1OPM A;  3KZ4 C;  5A7N A;  3LFI A;  4TLF A;  1N3Q A;  3ZN5 A;  3I3D A;  2GU9 A;  3ITQ A;  3S30 A;  2BFU S;  1W0P A;  1QHD A;  5B4N A;  1RUJ 3;  4A7Z A;  3L9J T;  3JXS A;  4J1W A;  1GSL A;  1LOC A;  3BOP A;  3O1S A;  1KS4 A;  4QT6 A;  4UW6 A;  1RUD 2;  5FBJ A;  1XNC A;  1APN A;  2HWF 2;  2NMO A;  4GQ7 A;  5L7O A;  3P3P A;  3GZT B;  3V56 A;  3LAG A;  1AUY A;  4IEY A;  2JIG A;  3POW A;  1VBC 1;  4XMI A;  5T5O A;  1KFU L;  3T2P A;  2ZOE B;  1J83 A;  2FDI A;  3R05 A;  4XF1 A;  1YYN A;  4NAM A;  5IVC A;  1RUF 1;  4NHY A;  4P9X A;  2W47 A;  3SKV A;  2MEV 2;  1FMD 3;  1FV2 A;  1RUD 1;  2DBI A;  3E1F 1;  4P9J A;  4LE4 A;  1KDM A;  4NHK A;  4FFF A;  1S0J A;  3BI3 A;  1WMD A;  3R4S A;  2KA3 A;  2XJQ A;  2J1S A;  4H55 A;  4MHR A;  4MXW A;  3SXW A;  3WVJ A;  1W6Q A;  3E5Q A;  1J84 A;  4FOW A;  5FR3 A;  4CU8 A;  5DAB A;  2D5H A;  1CJP A;  1F2N A;  3WUD A;  2JDN A;  2R07 2;  4FP2 A;  5JLV A;  3D3A A;  3POF A;  3QBQ A;  1EAH 1;  1GOH A;  1QJZ A;  2E63 A;  1YRZ A;  3ZSM A;  2PFW A;  4BOW A;  5M0T A;  1BHG A;  4QQ2 A;  5FY0 A;  3SH5 A;  5C9A B;  2CDP A;  4XBQ A;  3VDC A;  1JBC A;  1LU2 A;  1LHU A;  3LA3 A;  2XKP A;  4SBV A;  2GMM A;  1LNS A;  3J8F 2;  1CZS A;  5DDJ 1;  2AZ5 A;  4XAC A;  1JH5 A;  1DQ5 A;  1R09 1;  3EBR A;  4EN8 B;  1CD3 G;  2PHX A;  3HPN A;  2PHU A;  4N43 A;  2JD4 A;  4BMB A;  4XDQ A;  1SCS A;  2BP6 A;  4YM3 A;  4NOT A;  3BUC A;  2YYO A;  1ULP A;  2HEY F;  3MUZ 1;  3Q8C A;  4CDX C;  2GN3 A;  4PLO A;  4FSJ A;  1X9T A;  2OQ6 A;  2CY6 A;  4XBL A;  5BNO B;  3E6D A;  2GN7 A;  2X5I C;  4P5H A;  5FMB A;  5FUN A;  1QJX 3;  5C71 A;  1QXP A;  2W1Q A;  3WDT A;  1PVC 2;  3DL3 A;  2ZEZ A;  5FZE A;  1SFN A;  3PHM A;  2XLA A;  1H0B A;  2VGD A;  3AMM A;  3HWJ A;  4S2H A;  3S57 A;  3OGR A;  1AJK A;  1EPZ A;  3U4S A;  2WQ8 A;  2O14 A;  4FTB A;  2A6V A;  1W8O A;  1ZZ9 A;  5CIR A;  3E6C C;  1G7Y A;  2HYK A;  2IXL A;  4XVH A;  4XJ9 A;  1XSQ A;  1G9D A;  4Z92 B;  1O3R A;  3B00 A;  5FMD A;  2WNU A;  3O0V A;  4LO6 B;  1FAY A;  2AUY A;  4E8C A;  4AHX A;  2GP5 A;  3H1Y A;  2OPW A;  2DVA A;  1HX6 A;  4KMQ A;  2DUP A;  2Q0A A;  1H8T A;  5FMC A;  3GJB A;  1PVX A;  3FFQ A;  4E2S A;  3HR9 A;  5TSW A;  3LOB A;  3NV3 A;  5A3O A;  1GWK A;  2IFR A;  3O1P A;  4CRQ A;  1LUL A;  1VR3 A;  4C90 A;  1D4V B;  3LD8 A;  4Y26 A;  3VDD A;  1RUI 1;  1AYN 3;  4F7Z A;  2R07 1;  3CKH A;  5EXO A;  5EZW A;  4D7Y A;  1UOG A;  1EV1 3;  3AXD A;  2VW2 A;  4AHW A;  2FMD A;  1KDK A;  2RJK A;  1UOB A;  4NRQ A;  2GNB A;  4BQX A;  5LY2 A;  2OVU A;  3K4D A;  4QQP A;  3THD A;  1ENR A;  2A6Y A;  3M3I A;  2Z5W A;  5T3N A;  4YFW A;  4AE2 A;  1G8W A;  5CA6 A;  1L3J A;  1QJY 3;  5BNO C;  1C57 A;  2VW1 A;  1VBE 3;  2CGN A;  3NRU A;  3AYA A;  1GYK A;  4UF0 B;  2VOT A;  3WX5 A;  1KQR A;  1RGS A;  4IV1 B;  4XIO A;  2W95 A;  1W05 A;  2H6B A;  3B01 A;  2A6Z A;  1WMF A;  2KM2 A;  1ZA4 A;  3ALQ A;  2ET7 A;  4UFJ A;  1K5J A;  2W1U A;  4HVO A;  4LIT A;  2RS1 3;  3MIH A;  1IZ3 A;  5EV7 A;  2D6M A;  1JOJ A;  4BZ4 A;  2XVL A;  5FPV A;  3ZFF A;  4LBN A;  2D6L X;  1LOF A;  1SBE A;  2WS9 1;  3MPB A;  4MOA A;  3T2O A;  1FI2 A;  4DUV A;  3U4X A;  3KVB A;  1Y3T A;  2F4P A;  1YI7 A;  4QDS A;  2E7Q A;  2WFF 2;  1REF A;  1RJ7 A;  3AZX A;  5FZA A;  4ISQ A;  2VME A;  5JZG C;  3I54 A;  5F5Q A;  3B5L B;  2OT7 A;  2WNO A;  5CYY A;  3AYC A;  5J3U A;  3FLT A;  1YO8 A;  5JI7 A;  2WLP A;  3P1I A;  1GV9 A;  1W9T A;  2B39 A;  1GOF A;  2IXK A;  3T2Q A;  1G9C A;  4QX8 A;  1NLR A;  4X8N A;  2NP0 A;  2JEC A;  3T4H B;  2NN8 A;  2FD8 A;  4CU9 A;  5FZG A;  1M4W A;  4S2G A;  1JZ4 A;  1S0I A;  3RRD A;  4YW4 A;  1OVP A;  5C3Q A;  4ASM B;  2RS3 3;  2Z42 A;  3WEZ A;  4BHP A;  1RMU 2;  3K3N A;  1CIW A;  1PZ9 A;  2ZMK A;  1C1L A;  1CAV A;  1W6M A;  2WNU B;  3IDC B;  3JQW A;  3PIG A;  2J22 A;  2OQ7 A;  4Q29 A;  1IS3 A;  2VTF A;  2XVK A;  2JB8 A;  5FTT C;  3ZXF A;  5C5T A;  5HV0 A;  3UNP A;  4MH0 E;  1RHI 2;  1RUF 2;  2JXA A;  5I0D A;  4FCA A;  4XFG A;  2GH8 A;  5EJ1 B;  4K9S A;  3TWI A;  1EP0 A;  2R0H A;  3JB8 A;  5J36 A;  1V6K A;  2ZGR A;  3WDV A;  1R08 3;  2W94 A;  1BMV 2;  2VMC A;  5IT6 A;  4RFR B;  1NG0 A;  1G9B A;  3RZZ A;  4DZG A;  2UWB A;  3MI8 A;  5CFC A;  3FX3 A;  4QQL A;  4LEJ A;  4LTA A;  3LA2 A;  2JDK A;  3POB A;  2F6B A;  5DUU A;  4XYX A;  5FZF A;  1XRU A;  1O6U A;  1OF4 A;  1AR8 3;  1AYM 1;  1MAC A;  5A7W A;  2P3K A;  2BQP A;  1UYZ A;  3ZMN A;  5BV6 A;  5JPN B;  1LEM A;  4P00 B;  2YHJ A;  1ZBE 1;  3A23 A;  4LKS A;  1D0G A;  2E33 A;  3AP4 A;  4R9A A;  4RHV 1;  1X7N A;  1W90 A;  2GAL A;  4RS5 C;  4YG6 A;  3O1T A;  1S0D A;  2TNF A;  1Q8O A;  3LSD A;  4SLI A;  5CFD A;  3PDQ A;  4UW3 A;  4YVW A;  3AM2 A;  3C3V A;  4I0B A;  3WNX A;  3W59 A;  1V0A A;  4EN6 B;  1RUH 2;  1L7R A;  3M3O A;  3FBY A;  1AZD A;  2WYF A;  3V0A A;  1OLM A;  1VPH A;  1AJO A;  1NOV A;  2VVE A;  3DEC A;  3GCW A;  3AZZ A;  4AWD A;  5BPX A;  4QGM A;  3IMM A;  3MLL A;  4Q0V A;  1CR7 A;  3RG0 A;  5KXC A;  1JU3 A;  3RQ0 A;  2PMW B;  2PHF A;  5IAX A;  4GH4 C;  3H0O A;  1ULO A;  2WLQ A;  4OHW A;  4CCJ A;  1LEN A;  1ULD A;  2VCM A;  2ZGS A;  3HIF A;  1VBB 1;  3DXU A;  1OKO A;  3U78 A;  1PVC 1;  5JOW A;  1O8S A;  4JTN A;  5JCT A;  5JSP A;  2TUN A;  1WW4 A;  1J3P A;  4A7Y A;  4AQS A;  4MYE A;  3D6E A;  2YUE A;  4AI1 A;  2Z79 A;  2IXC A;  2D3R A;  3NAP B;  5ACA 2;  2D6P A;  1OA2 A;  4CCL A;  2DUO A;  3E97 A;  5JXH A;  2A3Y A;  1QQP 3;  3KCC A;  2IC1 A;  4LBK A;  1VIW B;  1MVE A;  2BWC A;  3N9M A;  1GLH A;  1V9U 1;  4JTO A;  3NKT A;  4DY3 A;  4ASK A;  4AED B;  4IUG A;  1CAV B;  1SG3 A;  1W6M B;  2MPF A;  5CU1 A;  5LB6 A;  5A1A A;  1RXG A;  4YRD A;  2FQP A;  4E2Q A;  1NZC A;  3MF6 A;  1W0O A;  2VE1 A;  3ST7 A;  5BNN B;  4C0B A;  3PTR B;  3B9I A;  1WD3 A;  3N7M A;  4NUB A;  2ENR A;  1XE7 A;  2A71 A;  3N9N A;  4Q8L A;  3SCF A;  3KMH A;  4KGG A;  1W9F A;  1HN0 A;  1W2O A;  2QQV A;  1XBF A;  2ZHK A;  1V6M A;  3APB A;  1YFW A;  3GHM A;  3J7M A;  5IWF A;  4URA A;  3OPT A;  5H9P A;  3MGU A;  5FY4 A;  3AYD A;  4YM2 A;  1C8M 2;  5A1L A;  1QNW A;  3VBU A;  4DUW A;  4K1Y A;  2Q1M A;  2XJV A;  5CIS A;  4NPR A;  4MGQ A;  2WAA A;  3H42 B;  2EA7 A;  2D98 A;  4LOS A;  1Z78 A;  3M4F A;  4NHX A;  4LO5 B;  5CAD A;  4GJZ A;  3IM0 A;  2VMI A;  3OD4 A;  1SEF A;  4GMP 3;  1C1F A;  3J8F 3;  2PHD A;  2J42 A;  5GLW A;  4H7M A;  3V65 A;  2R04 1;  5DMY A;  2IWG B;  2HWD 2;  3AKT A;  3GJA A;  3JD7 1;  4OI4 A;  4RGA A;  1GQH A;  2HJI A;  1S0C A;  2X5I B;  3CL1 A;  1NCQ C;  5F5A A;  2J7M A;  3CZU A;  3I2D A;  4ZS2 A;  4JRL A;  3VZK A;  1MZF A;  3VDA A;  4BCU A;  3CJI B;  2B7Y A;  2RV9 A;  1DIW A;  1B35 C;  3I4I A;  2HWB 1;  4E4Z A;  2BDR A;  4PF1 A;  5FKB A;  5L9B A;  5LZ6 A;  1GU3 A;  3R4U A;  5C3P A;  2D3S A;  1Y9Q A;  2EAA A;  5JOY A;  2R06 1;  1OC1 A;  1UOF A;  4HAN A;  4GMP 0;  3TBD A;  4QPI C;  4JGZ C;  3B02 A;  4XEZ A;  5E6H A;  3NNG A;  1MZ6 A;  4LBL A;  4MAD A;  3UJQ A;  2VUJ A;  1V00 A;  3GHN A;  1Q8Q A;  3OGV A;  4AHY A;  3BGA A;  2BU9 A;  2ZX3 A;  2I74 A;  2FDK A;  3N7K A;  4Y1Y A;  2YV8 A;  1LOE A;  4Q4X 1;  2BNM A;  1O4T A;  3MIB A;  5EHD A;  3J7N A;  4BQ5 A;  3RZL A;  2ZTN A;  5FPX A;  4RR3 B;  2IZW A;  4RQP B;  3MV0 1;  4YW6 A;  5C8W A;  4MGY E;  2DTY A;  3SHR A;  1RMU 3;  4N43 C;  4GAZ A;  3U14 A;  3VHN A;  4N53 A;  1RUE 1;  4PQ9 A;  1DQ6 A;  4M3C A;  1IPJ A;  1LHN A;  1ZBE 2;  3LDR A;  3SC7 X;  2CU5 A;  1WCK A;  2WZR 1;  2XR4 A;  4L8Q A;  4M4P A;  3VBF A;  1JYI A;  3K46 A;  2WA4 A;  4HSL A;  5BUV A;  3L2Y A;  2DUR A;  4KWJ A;  3LWC A;  2XBO 3;  5IFT A;  2R1B A;  4YVS B;  5BNN A;  4NIH A;  2JG9 C;  3J4U H;  4R9C A;  2JB4 A;  2V09 A;  4QU1 A;  3TEZ A;  5C5U A;  5ABJ A;  1QJY 2;  4WBB A;  1W99 A;  5A7P A;  5F32 A;  1OFN A;  1TEI A;  4CPB A;  3U75 A;  4Q5O A;  2WC2 A;  3ZIX A;  3ZN4 A;  2DCT A;  2UYA A;  2XBO 1;  4KGQ A;  2SLI A;  2UWC A;  4Q1R A;  3C7H A;  5FMO S;  2FMY A;  4JGY C;  1DBN A;  5F6L B;  3WHT A;  4R4Z A;  3N9P A;  5IVB A;  1IG3 A;  1Q8P A;  2ADD A;  1QDO A;  2EXK A;  2WZR 3;  2VQU A;  3NW4 A;  4OUM A;  3ZDS A;  4CDU C;  4DIN B;  5GLV A;  1RUI 2;  1UXZ A;  5K0U A;  1QJU 3;  4X8P A;  3TNP B;  5SV8 A;  1W06 A;  1RUE 3;  3KHB A;  4XUN A;  3ZO0 B;  4E27 A;  1W8F A;  5I8T A;  4OI1 A;  4AHZ A;  3NNL A;  1OA4 A;  3IKW A;  4NHM A;  5FYS A;  5FP3 A;  1YFX A;  1AL0 G;  2GAU A;  3IBM A;  2ARA A;  3LZZ A;  4AQT A;  3VD3 A;  5F3G A;  5JPM B;  4IE4 A;  4MUV A;  3SLI A;  3WR0 A;  1W2N A;  2BGP A;  4IEW A;  5AFE A;  4YYO A;  1AR9 1;  3D5O A;  5A3L A;  2YG0 A;  4FQ4 A;  1ND2 A;  2VQT A;  3ACF A;  5FY1 A;  4COV A;  3ZR5 A;  2K2S A;  3H8R A;  3BAL A;  3HNB M;  1VMJ A;  3POE A;  3I3M A;  5I0S A;  1LOB A;  1PGW 1;  1PM7 A;  2Q5T A;  4JGY A;  4K1Z A;  1JUI A;  4MGK E;  2WNU C;  3ON7 A;  5F9T A;  2JG9 B;  2Y0O A;  3URF A;  5IK4 A;  3BIW E;  3N4M A;  5FYT A;  1DF0 A;  1UWW A;  2WS9 2;  5FLI A;  1HB3 A;  3KV6 A;  2VZU A;  5F8P A;  3IMN A;  1W6P B;  1Y43 B;  4IGQ A;  1JN2 P;  2ZHN A;  2P3J A;  4HL0 A;  4YGC A;  3RI9 A;  2LRP A;  3N7L A;  3TYJ A;  1H2K A;  1ENX A;  4RR3 A;  4RQP A;  4HMZ A;  4XJA A;  2RMU 3;  1XNK A;  4Z8B A;  2VXR A;  1F4H A;  1OFS A;  2R04 3;  2PN5 A;  1RUH 1;  2D6K A;  3IDE A;  4PDW A;  4PF5 A;  4CDQ B;  3J8F 1;  1CES A;  1YQC A;  3TEY A;  2ERF A;  2VR4 A;  3ZYH A;  3HBK A;  1OPO A;  1XE8 A;  1JZ7 A;  3UGH A;  2C9A A;  1CPM A;  5DG1 A;  4P14 A;  5C6C A;  1GZ9 A;  2WL1 A;  5F7U A;  4Y24 A;  3AMN A;  1ASJ 3;  2CYF A;  2CTV A;  3VBS B;  1V6J A;  2EIE A;  3LPF A;  2JG8 A;  2XJU A;  3BYW A;  4HBN A;  4P9Y A;  4Y5T A;  4EN7 B;  3VHO A;  3KF5 A;  2D40 A;  5FDB A;  1Q8V A;  1VMH A;  3WW4 A;  3ZFG B;  4QQO A;  1TME 2;  2QCS B;  4AG4 A;  4OMC A;  3WF2 A;  2K0G A;  1YXW A;  3SCH A;  1NT0 A;  4DUX A;  5GAL A;  2A3W A;  2WAO A;  1XSR A;  5FYH A;  1CON A;  1LAJ A;  3LOI A;  1YJK A;  2MEV 1;  3AVR A;  5T5P A;  3S6P A;  1ZM1 A;  3ZFE B;  4CYD A;  2VY0 A;  1XPW A;  5CKQ A;  2BGO A;  3BOW A;  5A7S A;  1D2S A;  3HT2 A;  1V9U 3;  3WP6 A;  1BK1 A;  3KB5 A;  2RS1 2;  2VMG A;  3ZMO A;  1BQP A;  4Q4Y 3;  1QQP 1; 
#chains in the Genus database with same CATH homology
 3S57 A;  4RFR B;  5F8P A;  4JHT A;  2FDJ A;  3O1O A;  4ZS3 A;  4NPL A;  3O1M A;  3T4H B;  4IDZ A;  3RZL A;  2FD8 A;  4QKF A;  4IE0 A;  3I3Q A;  4IE6 A;  2IUW A;  4ZS2 A;  4OCT A;  3H8X A;  3BTY A;  3BTZ A;  3BIE A;  4QHO A;  3BU0 A;  4MG2 A;  4IE4 A;  4NJ4 A;  4NRQ A;  3T4V A;  2FDH A;  3BI3 A;  3RZM A;  4MGT A;  4NIG A;  4NID A;  3RZJ A;  3RZK A;  4NRO A;  4CXX A;  3BTX A;  4QKN A;  4NRM A;  3O1U A;  4NPM A;  4O61 A;  3KHC A;  3BUC A;  3O1S A;  3I2O A;  5DAB A;  4IE5 A;  3BKZ A;  4O7X A;  4NRP A;  3O1R A;  4CXY A;  3H8R A;  3S5A A;  3I3M A;  3H8O A;  4ZHN A;  3I49 A;  3RZH A;  3O1T A;  4QKD A;  2FDG A;  3O1P A;  3KHB A;  3O1V A;  4IE7 A;  3LFM A;  3RZG A;  2FDK A;  2FDF A;  4NII A;  4NIH A;  2FDI A;  3T3Y A;  4QKB A;  4CXW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...