3O1UA

Iron-catalyzed oxidation intermediates captured in a dna repair dioxygenase
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
202
structure length
202
Chain Sequence
b'EPLAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMSVAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLCQRAATAAGYPDFQPDACLINRYAPGAKLCLHQDKDEPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGIQPLKAGFHPLTIDCRYNLTFRQAGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-ketoglutarate-dependent dioxygenase AlkB
publication title Iron-catalysed oxidation intermediates captured in a DNA repair dioxygenase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 50
structure length 202
sequence length 202
ec nomenclature ec 1.14.11.33: DNA oxidative demethylase.
pdb deposition date 2010-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 3o1uA00
3H8OA 3RZLA 5DABA 3BTYA 4ZS2A 3RZMA 4CXWA 2FDIA 4NJ4A 4IE6A 4JHTA 4IE5A 3O1MA 4NIGA 4QKBA 4RFRB 4NRPA 3KHCA 3BKZA 4IE0A 3KHBA 4CXXA 5F8PA 3S57A 3H8RA 3O1PA 2FDGA 3BI3A 4IDZA 3BU0A 4QKNA 4IE7A 4NRQA 3T3YA 3O1OA 4NPMA 4O61A 2FDJA 3O1SA 3T4VA 3BUCA 3RZGA 4NPLA 3O1VA 3LFMA 4O7XA 4NIIA 3RZJA 2FDHA 4NIHA 3RZHA 2FDFA 4ZS3A 3I2OA 3I3MA 3S5AA 4OCTA 4QKFA 3I3QA 4QHOA 3O1TA 3I49A 3O1RA 3H8XA 4MGTA 4NRMA 4MG2A 4IE4A 3BTZA 4CXYA 2FDKA 4NROA 4NIDA 3RZKA 2IUWA 2FD8A 4ZHNA 3O1UA 3BIEA 4QKDA 3T4HB 3BTXA
chains in the Genus database with same CATH superfamily
3UT0A 4CEWA 3HR9A 3F95A 4CP1A 3I2GA 4CP0A 1WLWA 1MZ5A 1SBDA 2EXKA 4ITCA 3TAYA 3MV01 4Y1ZA 5KHIA 3KV9A 4IV3A 2X5IB 1ZVFA 4N53C 4YLZA 4OZXA 2CU5A 2WS91 1PGW1 4PF1A 1S0EA 4FFHA 3T0AA 4E27A 2ZGNA 1SPPA 4Q4X1 3PTYA 1QJY2 1DYPA 3CO2A 1LHWA 1ZBE3 3VBHA 5FZFA 2R072 4CDUA 3NNJA 3AVRA 4EZ4A 1OA3A 1W05A 3D4KA 4Q4V1 1F5JA 4LLFA 4XDQA 5GLWA 3KHCA 1S0JA 3PUSA 4FPGA 1RMU2 4COVA 4KU8A 1SLAA 1EY2A 1V6IA 4E2GA 1HRV3 3ASIA 1FNYA 2VMEA 2JKXA 3AC0A 4C0BA 1BVVA 4DEQA 4EWDA 1RUH3 4TLFA 1K5JA 2VZSA 4ES8A 1ZRFA 2JE9A 4AI0A 3PNAA 2WNOA 4XFCA 4NMIA 3LDKA 5D21A 1C8M1 5ERLA 2QQKA 2ZHMA 3ZYRA 5A3MA 4ASMB 4HVQA 3VBUA 1OPOA 1REDA 2D44A 1VBC3 1MS9A 4M4RA 3B01A 4N9HA 4B4RA 4DZGA 1E5SA 2XVGA 2PHLA 3ZOIA 2EICA 2ZEWA 3P1IA 3VD9A 2J42A 3VBSB 5IFPA 3POSA 5I0DA 5JIUA 4UW5A 2GMEA 1H9PA 1OH3A 2WINB 4BQ1A 4PF5A 1DGWA 1RUE1 5EP9A 2VZUA 2W68A 4Q29A 3IBMA 3I3EA 4ONUA 2F17A 2RDNA 4SBVA 1DG6A 5FYHA 5GZGA 3O1VA 2BBVA 1LHUA 2WAAA 4QDQA 5FUPA 3U78A 4OMCA 1D0GA 2E9QA 4NR1A 4PCRA 4CYDA 1S0BA 2B9UA 5F5QA 2JIGA 1W39A 3N3HA 2A73B 3ZYIB 1UX6A 4AFAA 1GLHA 1DGLA 1AR73 1LOCA 1OF4A 3EJKA 3LZZA 4UFMA 5F2WA 4CCEA 1J59A 3R4UA 1C8M2 1NCRB 2ET1A 2W9XA 3J8F2 3VKOA 4QDRA 2I74A 4IEOA 5C8CA 1H2NA 3NVCA 2C9KA 2Z5WA 5JMCA 2VCBA 2A6YA 4DEVA 2GU9A 2GAUA 4H14A 3R4DB 5C9AC 3SCHA 1W8NA 5EJZB 1DLCA 3WR0A 2UWAA 2BDRA 2JICA 3ILRA 5T55A 4AEKA 4CXYA 5A7NA 5LY1A 2QDNA 1VBE1 1ZX5A 2N7GA 1YJLA 2VZRA 2G9ZA 5D1IA 4JKKA 4PJYA 5FY8A 2HEWF 4WZFA 4E8DA 4JHZA 3AMQA 4HL0A 5LBBA 4TZDA 1V9U1 2QQNA 4CEWB 1I5PA 3IAQA 5FXVA 1RXGA 5GJ6A 2YBPA 2GH8A 1LTEA 2DV9A 4IV3B 4Y3OA 3I54A 1I1EA 3POYA 1LENA 4WV8A 4YGCA 4BIFA 5ANQA 3P5BA 5DQ0A 1RUC2 2GZWA 4JC1A 1SPPB 4RGGA 2ZX2A 5JMOA 2MEV1 4ZS2A 2KM2A 3AKRA 4XTPA 1MVEA 3VBHB 5FYCA 2BNNA 4CDUB 4GD4A 4WVWA 3I2JA 4YG0A 1YQ6A 1AL22 1OVPA 4QXKA 4ARXA 5FFOC 1CR7A 2ARBA 5FZEA 5FAXA 4B4PA 2R7EB 4Y5Z0 4CDXB 3QD6A 3ITQA 4NJ4A 1A8DA 4JGYC 2AACA 4RQPC 1JZ5A 1LJ7A 1UPIA 5LY2A 5JXJA 2RM21 3KCXA 4IE0A 1X9PA 5EV7A 4QGNA 4EWEA 3GALA 4FPHA 3WP3A 4EZHA 1F4HA 2C5DA 1V9U2 3H42B 4WZCA 4BDVB 1NA1C 2XL7A 3JXSA 1RTVA 2ZJCA 2DF7A 3E97A 4UYBA 4BK5A 1CAVA 2YGMA 4ISQA 4DNYA 5M0TA 2C0ZA 1O91A 3AKTA 1NUKA 4IW3A 1PO22 3VBUB 3ZXEA 4CDWC 4LEJA 1OKQA 1H1AA 1WMEA 3THTA 1GP4A 3WZ1A 1QNYA 4Y22A 1YCIA 2CAUA 5K4LA 1J1LA 2P3KA 4QT6A 4CP2A 1WKYA 4QPIB 3LDRA 4L97A 1ULEA 4YZ3A 5D2AA 1QJU1 2RS33 3USSA 1VMFA 3Q8EA 1Q8PA 5E16A 1RUD2 1JZ4A 3S30A 1PGSA 2JDUA 4P9GA 1LKNA 3AZWA 4DY5A 2VBDA 2YYOA 2UYAA 1UAIA 4OUMA 1CQ9A 1YIFA 3SXWA 3ZKUA 4B4QA 2D3SA 4NPRA 5HCHA 4XCBA 4UFIA 5T50A 3T4VA 2JDAA 3O7OA 4EN7B 3ABZA 2GN3A 4XILA 3LFMA 1MQTB 3J7NA 4YM3A 1XYPA 2NMNA 2WC2A 1IQDC 4MGIE 4CP9A 5C8CB 2RMU2 1DYKA 3WINE 1DHKB 2WNVC 4FAGA 1BMV1 2XDVA 4EE2A 4XF3A 2X8KA 5TSWA 5CKNA 4JZRA 4OHZA 2ZMLA 1HB1A 1OD3A 3JBG2 4FOWA 5A3PA 1JYCA 3QBQA 4QKFA 4ATEA 2X05A 4FPFA 4RGKA 2XJSA 4QHOA 5AFBA 3ES1A 4OI1A 2VQAA 1AR91 1S2KA 3FHAA 1G7YA 5ANNA 1TMF3 2R1BA 3MIGA 3O1TA 4OI0A 5GKAC 1EYBA 1ZZ6A 3NJZA 5KR7A 2J22A 4GMP1 4JDNA 4FAHA 2HYKA 1GZ9A 1XYOA 4W6XA 4Q0SA 4YZ1A 1Y4WA 3BIEA 2OZ6A 2VCCA 1QQP2 3KCYA 5GALA 2YUEA 4P14A 3RS6A 4I3PA 1R093 4BU2A 2IVJA 4ORFA 3RI8A 3WG2A 2XL9A 4D8MA 4NAMA 2PLV3 3NNLA 1MS0A 1PNFA 2NMOA 5FY5A 2BPA2 4GMP0 3SCGA 1N1SA 5C3OA 4OUEA 5KXEA 3LSDA 2GC1A 2HWB3 4UWDA 4WM8B 2HWC1 1W03A 5AC91 3D0SA 2ZHKA 5JI7A 2XONA 2Z42A 3KSCA 3RWKX 2ZX4A 4M3CF 1IGOA 2YB7A 1PX3A 3ZXFA 1D4VB 1UXXX 2B9VA 3ELNA 1GOHA 1PIV1 5H9SA 3M2MA 3WNKA 5A1FA 2Y60A 4MV2A 1SLIA 1X50A 1U5YA 3AP6A 4LBQA 1DZRA 4MYEA 1YFYA 2AUYA 4S2DA 1T2XA 5CG8A 3KGLA 2Y6LA 2YZ4A 2HWD3 5B2GB 5FUNA 3TEZA 3FUQA 1QDCA 2PELA 3GF6A 2RJKA 3A23A 4QQ2A 1IQAA 5F39A 4A6SA 5DZEA 4LE3A 1CZVA 3WQ0A 4A3XA 4CEYA 1YFWA 3DYPA 5I0SA 3WF4A 2QQWA 4D7SA 3MFAA 2WSUA 1H0BA 5F3EA 1GFF2 4Q5OA 1IPSA 3H1MA 4YFWA 5FK7A 3VHNA 3U14A 4AHWA 1AR63 2HWF3 2JDYA 3AK0A 4YW7A 4BZ4A 1W90A 5A3UA 5C5UA 5K0UA 1EV13 4IEQA 3RYRA 4DUXA 3I2DA 4XHBA 1PGL2 2FZ2A 3BALA 4K40A 4WVMA 3HWJA 2B8MA 2PYTA 5FKBA 4A6OA 5CIRA 2VVEA 1VPHA 1RUI1 1KJRA 5FOJB 4XUQA 4AVSA 1FV2A 2VL4A 2W95A 3FLRA 1COV3 1R1A1 4AAPA 4AI9A 4QPGC 2NM1A 2XVLA 1JUIA 2ZGOA 2CDOA 3LA2A 3AP9A 1ZBA3 4Q4Y1 3VBRC 1YXWA 4LBJA 2EIEA 1D4M1 4FQZA 4GA9A 2YHJA 1BK1A 3F2ZA 3LEMA 1QJX3 4LLOA 1OKOA 1IS4A 3ZXJA 4CP9B 5IK4A 3EBRA 2IXIA 2J7MA 3MPPG 4Q2FA 3WCRA 4R8HA 3RVHA 4XE9A 4A41A 4IEUA 1KDKA 2A6WA 3N7KA 4L11A 1I5ZA 4Q26A 3BN6A 4FPEA 5A6YA 1QJY3 3VDDC 1Z0HA 1OOPC 3OOXA 5A6ZA 4UW6A 1W9TA 3HMYA 5BYNA 5KHGA 1NZCA 1U5IA 4L0PA 4GJZA 4XW3A 1AF9A 2RE9A 2DVAA 2QQIA 4D3WA 2RS53 3B7MA 3VDAA 1POV0 2WR9A 1ENRA 1OHFA 2XLFA 2WN2A 3ZR6A 4BK4A 1ZNPA 4I0AA 2XR4A 4XF9A 4YWAA 5FYSA 3RZKA 4C1XA 2NN8A 1IOAA 3IDBB 5FPAA 3H7YA 5ACA2 3MGUA 1FYUA 1Y9MA 4M3CA 2WJSA 1D4M2 3N35A 4KG8A 3VZOA 2BQPA 1MEC2 4OUSA 1NZIA 4RN5A 1NCQB 4ASKA 1ND3A 1DLLA 1UMIA 1C3HA 3BTAA 1L3JA 1UY4A 4KG0A 5DDJ2 5EZWA 4Y1XA 3C8XA 1F4AA 5DAVA 3ZXAC 1A8MA 3SH4A 4PLOA 5FK8A 4LO8A 2IXKA 1VBC1 1LCLA 3DEMA 2VUAA 4JKMA 3TNPB 5DABA 1FOD3 4AG4A 5F5AA 3CHXA 4AEDB 5IATA 1H2KA 2QZ2A 5A70A 1K5MC 1SEFA 1XSRA 2Q5TA 4FTBA 1ENSA 4QM8A 2OS2A 1CIWA 1UKRA 3USUA 1JZ7A 2Q1FA 2A3WA 3WHTA 2DTYA 1CVNA 1QOTA 2H0VA 4QGLA 5IK8A 4GWNA 1GOFA 1G9CA 3ECQA 4ZONA 1VBD1 1UYXA 5FZ7A 2R041 5CISA 1JOPA 1PO11 2P3JA 1HN1A 4LIUA 1OLMA 3CZJA 4PDWC 5E1RA 1UYPA 1WW7A 1UQXA 5FXWA 4CEYB 1BBT2 1V6MA 4B8EA 4Z8BA 1YWKA 5IFTA 1GANA 1UU5A 4QQHA 3GNEA 3KHBA 3PJQA 2BRTA 1JXNA 3OGSA 4KWLA 3J8F3 4QMAA 4AI2A 1IPJA 1H9WA 2CYFA 5FXZA 1ZZ7A 5K0UB 1UF2C 4JKLA 4XF4A 3BOPA 1BEV1 4YW6A 2GMPA 3E5XA 3HVDA 5FP4A 3OGGA 5CAZA 3M1HA 2HWE1 4WVMB 4QPGA 2DUPA 4X8PA 5FYUA 4XUNA 3MUZ1 1YEWA 2WQZC 4XF0A 2JG9B 3SEPA 1N47A 3VBRA 4AFDA 3IZOA 4AQTA 1GSLA 1J1TA 2DCYA 2PHUA 4KL1A 3BU0A 3ETPA 2J1RA 2BFUL 1NAEA 3H3ZA 3LSEA 4IUGA 5CVRA 2PHFA 5I0RA 5KXCA 2X5IC 3KF3A 4I2OA 4MH0E 4LK7A 4QX0A 3WW4A 4BQWA 2CNAA 1JN2P 4H3WA 4IEYA 2RJ2A 3G7DA 5GLUA 4E9KA 4KBZA 2R062 3UK9A 1ACCA 1RUC3 4RA0A 4RD7A 4Q1PA 1V00A 3U75A 2DU1A 2VUJA 3SISA 4AK3A 2ZEXA 3SKJE 4DINB 2XKOA 3ENRA 3ZKYA 1XNCA 1XOYA 4R9DA 4W65A 1FPN2 1AL23 4N7IA 2IXJA 3HBKA 1PZ8A 1UCXA 3L2YA 1BCXA 3D3AA 4Q4W2 3VKNA 4AI1A 2E32A 2Q8OA 4RS5A 2YC4A 5CFDA 2DU0A 3O0WA 1CAXA 3A21A 2VBPA 2VVDA 3L2HA 4CUGA 1RHI3 3VD5A 1F2NA 2ZEYA 5F2SA 1MS3A 4UFKA 2B45X 2D5FA 3BVCA 5JDBA 4M3CB 5C4WB 4NIDA 2ZMKA 2ES3A 2YFUA 4YGEA 2VOWA 4W6YA 2R1DA 2Y0IA 4F83A 1ND3B 5DG1A 2ZAHA 3VBSC 1PO23 5GLZA 4F3JA 3KQRA 2ZHNA 4I09A 4YW2A 1UOBA 1K5MA 4NE9A 3WUCA 2DCJA 4A3ZA 4X6QB 3T2OA 5T5PA 1B35B 5EYXA 1BZWA 2VD7A 1REEA 1SZBA 3HBZA 1NY71 5FLJA 1RUF3 1H8TA 1SMVA 4OYUA 5A7PA 1LESA 1QH6A 3RMYA 1NXD1 3J4UH 1RUD3 1F5FA 4LTAA 4AEMA 4CUCA 2QCSB 2NQYA 1W8HA 2RV9A 4K1YA 4XPVA 5C4WC 1U0AA 4XYXA 1ULPA 2JEMA 1OA4A 1LULA 2VUDA 1K12A 3N7JA 1QU0A 1HXS2 1NCRC 2RS13 3OBRA 4L8QA 1UOGA 3VBOB 4AFBA 3RZMA 3PU8A 1VBA2 5FMOS 4CA9A 2E51A 4LHNA 3TN93 1JTZX 4XJUA 3ZXDA 5FPXA 1DDLA 3ZFFB 1BVP1 1RITA 2RMU3 5DG2A 1BKZA 3B00A 1A34A 3L9JT 1UZ0A 1JZ3A 1CONA 3RNSA 2JX9A 1UNBA 2WO2A 3GM8A 1TE1B 4AYUA 1OQDA 5LRSA 1MS5A 1H4HA 4ZZ5A 2E6VA 3PL0A 4GH4B 4HONA 4OZOA 1JBCA 1HKDA 4FSJA 3POGA 1DGWX 1R083 2X5IA 3KS7A 1SACA 1TMF1 4GAZA 4G9SB 4CEWC 1E5IA 4Q0UA 1GR3A 1POQA 1VAVA 2WT1A 4FPLA 4I0BA 1R1ZA 1VE0A 3NKGA 2SBAA 4LUMA 4UBHA 2E53A 5T54A 2QE3A 3WNMA 2QQUA 4IV3C 4M4PA 3VZLA 2A5ZA 1ENXA 1BLZA 2ARAA 1HQNA 1WLDA 4XQDA 5AFEA 1O4YA 2VU9A 3RPQA 1AYN2 3VBFA 3VBHC 1OPMA 1UY1A 3O0VA 4AWDA 4CDUC 5F37A 1XSQA 3C7GA 3UYJA 4EN8B 2G1MA 1RINA 2QDRA 2AZ5A 4GIQA 5L73A 2HWB1 2LW8A 2V5YA 4FCAA 4CDXC 4Y5TA 3O12A 4IGQA 1RB8G 1YQ5A 3WG4A 2WT0A 4ES9A 1QWRA 2LTNA 2JENA 3DCQA 3UL2A 4RS5B 1GV9A 2FMDA 3ACLA 4NIAA 5CFDB 2GC0A 1CN1A 1HRI3 1RC6A 1KS5A 1LOEA 3AFGA 4FPKA 2QQJA 3UNPA 1VBB2 3CU7A 4XABA 3INAA 3JB4C 3ME2A 2EA7A 1JS9A 4QDSA 5D8AA 5H9QA 3VBSA 1AYM2 1VIWB 1W6MB 5LBEA 2XHKA 1UO9A 3VBUC 4AHYA 3VKFC 2RR11 3OUJA 4C90A 1OVSA 4OHVA 3CJIA 3LWCA 2UYBA 1ST8A 1S0GA 1KFXL 3ZYJB 3ZSLA 4NHYA 2CL2A 1G8WA 3JD72 1MS1A 4LT5A 1FMD2 4QPIC 4JRAA 5JIAA 2EXIA 1ENQA 3U4SA 2Q0AA 2ZZQA 3I59A 2ZTNA 4G4FA 4PI2A 1MZEA 1BJQA 2JIJA 4AEJA 5FREA 4GQ7A 4EN0A 2HWF1 1LODA 3N36A 5AVPA 4KWKA 1GNYA 1PM7A 1EV11 1PK6B 4DUVA 3TNQA 5C4WA 4Y4RA 2XUEA 4EJRA 3R05A 1Q43A 4HK8A 5ISLA 4K7JA 4QAWA 3MIBA 3BIWE 5FYTA 4GB31 3MW2A 4ZU5A 3POEA 1ALYA 1WMXA 2ZS6B 4BH9A 1MQTC 3BODA 4Y24A 2BNMA 4B3NA 3GBWA 1COV1 1KQRA 3PHMA 3OB8A 4XFIA 3WQBA 3NV3A 5C8CC 1Y7BA 3N9QA 1XQNA 2ZPXA 1UIKA 2EAKA 1WD3A 4QQPA 4K20A 3MIHA 2P2KA 5IJRA 2OW4A 2XOMA 1D2SA 2J1AA 4FPOB 5JOZA 2F4LA 1JYNA 2C24A 4IE6A 2XPJA 3JUUA 1TME1 3RJ2X 1G6NA 3EB7A 1GBGA 3EQEA 3KB5A 3BKZA 1YYNA 3SMHA 2CGOA 1HB4A 1G9AA 1US3A 3ZYBA 2DWRA 4KU7A 5DUVA 3B9IA 3RSJA 3PTRB 2B5HA 2BOIA 1HB3A 5IYYA 1J3PA 1PVC2 2VNVA 3JCIA 1WA4A 4OI2A 1VLNA 4E2QA 1UYYA 2XGXA 2RS51 2Y38A 1C8NA 5T5LA 2BVVA 2LM3A 2O1QA 5BNNB 2PAEA 3AP5A 1H6YA 5ACA3 1XNDA 3FLTA 4WM8C 2GALA 1OQ1A 1Q5OA 4PQ9A 3WP5A 5JXIA 2OT7A 1MEC3 4OFGA 1MZ6A 1IG0A 5BPXA 3VBFB 2OQ7A 4CDXA 3KV5A 4XIOA 1S4CA 3IPVA 3MI8A 4BXSV 4GWIA 4K6BA 1JZ8A 5FXXA 2GMMA 3P6BA 1DCSA 1LOAA 2K2SA 2WFF2 3HT2A 1RVF2 3ZM8A 5JUVA 4HSJA 2QQPA 2BGCA 1L7LA 5I0UA 5LA2A 1ASJ2 1E57A 4PLMA 1HV0A 5IK7A 2AH2A 1GQGA 3GZAA 3PVEA 4AAXA 1CZSA 3N9PA 4LBQD 1FOD1 2PN5A 4META 3THCA 3VHPA 3T2PA 1XNKA 3HN3A 3I3DA 5FZ4A 5A3TA 3A7QA 3QH7A 2WS92 3ZYGA 4YFZA 1OUXA 1PGW2 1EPWA 4UT5A 5C6CA 2JWPA 1IKQA 3AJZA 4Q4X2 5D8AB 3WF1A 4CDQA 5IVBA 1OLRA 2J1VA 3I3BA 3OBTA 4XHXA 1OF3A 1BBT3 4QPIA 4YNIA 3CJIB 1AX1A 4Q4V2 3MW3A 4Z82A 1GP6A 3LD8A 3MLJA 4LE4A 4LOTA 5DAXA 3O1RA 5LBCA 4HBNA 1AR83 1OFNA 2E26A 2D97A 2AEZA 4M01A 2O8OA 3RGBA 3I59B 2RDRA 1ZM1A 1C57A 1X8EA 3DECA 2FD8A 2D43A 1NG0A 3VL9A 2AC1A 5JPMB 1ZA4A 3CF6E 4FXKB 5JLVA 3FLPA 1VMHA 2WUHA 4X8NA 5DZFA 5GLTA 4BCUA 2XUMA 1MQTA 2J1SA 3H1WA 4MVTA 1RIRA 1JU4A 2WN3A 5E6HA 3THPA 1V6OA 4XAEA 3AZXA 5C71A 1LOBA 2VZPA 1NE4A 3IKWA 5CFCA 4PQQA 4QM9A 1S2EA 3J9SA 3VZMA 2Q8CA 3ROUA 2C4XA 5FJKA 1Z7S3 4AQSA 3KVAA 4QWNA 2YPJA 1VP6A 3J7LA 1CIYA 1FI2A 2ZX0A 3WNLA 3VZKA 2R32A 3PMEA 1RUE2 4TSVA 4CZSA 2W08A 4AXOA 4MGYE 2P3YA 1MVQA 2W46A 5BNPA 4WVVA 2FDIA 1IS3A 3ZN4A 2W1WA 5FPLA 5F5IA 4AVBA 1KDMA 2WRAA 3AB0A 2RVAA 2W92A 3MF6A 4O65A 3WP6A 1JHNA 1FPN3 4DOUA 1VRH3 1O3SA 4DUWA 4H55A 4Q4W3 5FZAA 5FPVA 3TBDA 1NXMA 2OUJA 4WM8A 4LBLA 3ZN5A 1EAH1 2QVSB 3MDPA 5HPOA 3O1PA 1DF0A 3H1YA 4XBNA 5FZGA 3JU9A 3N9OA 1ZREA 1NCQC 2XBO1 3K4ZA 4YM2A 2R0HA 3UKVA 5CBLA 1RHI1 1X36A 3VZNA 4YW5A 4MUVA 1DGRA 3JQXA 4CCMA 4L92A 4MSVA 3IPVB 1WLTA 1V6NA 1VBE2 2HBTA 1Y43B 4YM0A 4HXCA 4B1LA 2VMDA 3PDQA 4AEDC 3A4UA 4YW1A 4FOYA 2FDJA 1QXJA 1DYOA 4P02B 2FMYA 3GBGA 2D6MA 2NPIA 2W47A 4HZFA 4HSLA 2OYZA 2CGPA 2D7FA 2D6KA 2E63A 2D6LX 1ULFA 3CZUA 4CEYC 4Y5SA 4L2NA 4GWJA 1TNFA 1WCUA 2OPWA 3QACA 1YC61 4LR4A 3WDWA 4CDQB 2MEV2 3GGLA 4TXWA 1VBA3 4FP2A 2RS11 1C28A 5F6LB 2ADEA 3I2OA 1CX4A 2NYYA 2VZ1A 5K0UC 4C1WA 5HCBA 2UURA 2VQ0A 4P9JA 3I3QA 2OIIA 3TN91 3FMGA 1QOSA 1PVXA 3H8XA 4MGTA 3OD4A 4EROA 1Q8OA 3PUQA 2RM22 1I3HA 4Y4YA 3BTZA 1Q56A 2VZOA 1ZZCA 4FTEA 3OTFA 3MW4A 2A71A 2JG9C 2IUWA 2XJPA 2FCTA 2VTFA 3LGRA 5FY7A 2HH9A 1ULCA 1RUG3 3ATGA 2WLPA 5I91A 3O5SA 2VUCA 3U37A 3GZEA 2JJ6A 2EIGA 1GQPA 3H50A 1H2LA 5LRRA 2J1TA 2WNEA 3FHQA 1IPKA 1RUJ3 5CFCB 1R081 1QGLA 1U12A 1ZRCA 2WNUA 1KXGA 3LEGA 1XRUA 5FY0A 1O7FA 1XJAA 2ZGUA 2ZGRA 3VHOA 1QJU2 2W39A 2MPFA 3PURA 3KZ4C 4AVTA 4XMIA 5T5OA 3MO4A 3QCWA 2DVDA 4MHRA 5BNPB 5BNOA 2CV6A 2VG9A 1HB2A 1LEDA 5APAA 3HNBM 5FY9A 1NYWA 4BLIA 4QB1A 5J3UA 5F7UA 3NJXA 4NUBA 1RYYA 2A6XA 3S6PA 1N3PA 4LIVA 3WNOA 2X10A 2DYCA 2ZX1A 3FL7A 3K3OA 5IHRA 3ZMOA 2QJVA 1WGPA 2V09A 3DPRB 1FV3A 2GH2A 1NCQA 4GWMA 1PHMA 3UETA 4YVSA 1BMV2 4J1WA 1VBB3 4AHXA 5JSOA 1HRI1 4V2VA 1BK0A 4HFSA 3MHZA 1ND3C 4K21A 1AYM3 5L9VA 3LPGA 1B09A 2VE1A 5FCCA 4AEDA 1H1MA 3EYPA 1AR92 4CTEA 1UYZA 2QQVA 2QNKA 1GWKA 5T3NA 2ZA9A 1BQPA 1GZTA 1MACA 4LUKA 2YY1A 4AFMA 5J48A 5JZGA 3AL5A 2BBAA 4PIZA 3LE0A 4DMIA 3V0AA 1GU3A 3ZXKA 2B7YA 3VUOA 1YO8A 1HJGA 2W1UA 1W3XA 4IE7A 5H9RA 5L9BA 3T3YA 4HVOA 4UW3A 4BISA 1MZFA 2OX0A 3ILFA 5LK7B 3O1OA 2Y34A 5J36A 4INDA 2JG8A 4HMZA 4M3CE 4C91A 4WM7A 2WQ4A 3UKTA 2VY0A 2XJRA 2OPKA 4IXLA 4JV4A 3VBOC 3BUCA 3POJA 1SLCA 4YVWB 4J1XA 4ARYA 1QJFA 2QTWB 3AP4A 2HWC2 4LA2A 4EQVA 5AC92 4QU2A 5JPNB 3SQOA 4UFJA 4O7XA 1GZCA 4CU6A 1OT5A 5K9YA 4MHUA 2HJIA 1V70A 2W3JA 2FCVA 1ZRIA 3OGRA 3QH6A 1GQHA 4D7TA 3RZJA 3UESA 3S7IA 4QXCA 1L7QA 4D7YA 4RGAA 1PIV2 2A70A 1VAKA 3WF2A 1O5UA 5FYIA 4RFT0 4AGVA 4MGZE 2JG9A 1GKBA 2WZR1 4XFGA 4EN9B 3MFCA 4GH4C 1S0FA 3NV2A 1UL9A 2BP6A 3IMNA 4DRRA 3CNAA 4QPYA 1CWPA 4LITA 4DPNA 1O6UA 3OF1A 4NRMA 1C5HA 1XNBA 5JVVA 1JU3A 1OLME 2FZ1A 3KLSA 3WOGA 1EUUA 3H7JA 1J3QA 3AFKA 1X9TA 3U1XA 3WQ7A 5C7GA 4BA6A 3IN9A 3LA3A 3I97A 1SFNA 4QKDA 1KD7A 2IFRA 2ZABA 4XXAA 3CBNA 5FMCA 2AREA 3T4HB 3WEZA 1SLTA 4JQTA 5JXGA 1W8WA 2WNUB 1FT9A 5E89A 1W8FA 4TN7A 3SC7X 4HN1A 4AW7A 2WZEA 5J98B 3C7EA 2R073 5FMOL 4BQYA 3DYOA 3PIJA 3IWZA 5LEJA 1UXZA 5EJ1B 1ZBE1 3H8OA 4YG6A 5FZ1A 5BY5A 2ADDA 3SHRA 3MZHA 3SNMA 1OC1A 2WZPP 1W6OA 1RUI2 3EMRA 3NSTA 5I0TA 5BNOB 1PMJX 1RMU3 2WZR2 2Z79A 1R1A2 5A33B 3NO8A 5I8SA 4Y26A 5K7PA 4V2WA 4AFCA 2WFF3 2LALA 3NAPB 1RVF3 5FUIA 1W9SA 3WD5A 1WCKA 4MOAA 5DUUA 3TWIA 1Y9QA 2IXCA 4RS5C 4JQRA 1HRV1 4ASLA 5CFDC 1SCRA 4Q4Y2 1WCSA 1YRZA 2GC2A 2W1SA 2VECA 3AKPA 1RUH1 3H0OA 1AXZA 4IE5A 2YBSA 3ZDSA 1F9KA 2VULA 5HBAA 3AJYA 4Z1VA 3AZZA 1Y3TA 2D6NA 5CYYA 4YVSB 4NRPA 1JHJA 3VDCA 5GZCA 2UY8A 2IXHA 2WS93 3GHNA 4CXXA 2EIDA 4H2AA 4IL7A 2IZWA 1XNTA 2O14A 1D7PM 1W6PA 5FP8A 4E2SA 1V6LA 1B35A 4CCOA 4B7EA 2Y6HA 4P9YA 4JRLA 4Q4V3 2BERA 4PIXA 4XEZA 2WKKA 2JDPA 4PIYA 5JZGB 2VNRA 3ZLIA 3U11A 1H8TC 2CY6A 4FPJA 4Y1UA 3POBA 3SEEA 1PK6C 3V0AB 5FKCA 1AR81 5IK5A 1QIQA 3VBOA 1UIJA 2ZMNA 3FBYA 2ILMA 4COYA 3AM2A 1YUDA 3RZZA 3WXPA 2JG8B 1AVBA 5FRAA 3HN1A 3RG0A 4JGYB 1M06G 2BNOA 4JVAA 4WM7B 4TWTA 1C8M3 2LUWA 2EAAA 1AR71 1W06A 3A0KA 3AX4A 3LB9A 2VMCA 3K77A 2BZDA 2VOVA 1PM4A 3OEAA 3G6JB 3VV1A 2V73A 3UGHA 3GBFA 3M70A 2EVXA 1KGYA 2ZHLA 3HJRA 1VBC2 3IMMA 2VCAA 3PIGA 4HETA 1IKPA 1DP0A 1DZQA 1UOFA 3O14A 4P00B 1Z7S1 3HIFA 4GH4A 2Y64A 4ZXEA 2G19A 2GP5A 3LDBA 1DQ2A 1RUE3 1W9FA 3B5LB 4AVVA 1RGSA 3NJYA 4LA3A 1ZRDA 1DQ0A 3O0XA 2WA3A 5FPBA 3AMHA 1IS5A 1DQ6A 1VBD2 4ZS3A 1G9FA 5DMYA 2R042 3CMGA 3K4AA 1PO12 4LO6B 4N43A 3MPBA 4AHZA 3B02A 4LBNA 4KI5M 4CPBA 1K3IA 4MZUA 3TYJA 3ZFEA 2Q8DA 4AI3A 3HNMA 2VW2A 4GXLA 1AX2A 4NHXA 5BNNC 3OD0A 4JGZA 1VRH1 2PA7A 1ZZBA 5LA1A 2ARXA 2L9LA 4YZ5A 2W52A 4YGBA 1LGNA 4CCLA 4NAOA 3VBFC 1LHVA 2XKPA 3ST7A 3VB9A 2BEOA 4QX3A 4IEZA 1BEV2 4FXGB 3E5QA 2LROA 3GJBA 5LATA 1AHSA 2D93A 2HWE2 2PHTA 4RR3B 3RYPA 3T30A 2KD7A 4FT8A 1CGPA 1W6OB 3E6DA 1QY4A 2MHFA 2YROA 1VBE3 2GP3A 2WAOA 2TEPA 2DDUA 2XLAA 3ZFFA 3AMNA 3R0RA 4PI0A 1N3OA 1KITA 3RI9A 1W0OA 3OJBA 3BTYA 2CDPA 1SBFA 5HCFA 2HEVF 4BWOA 1V9U3 1W6MA 3LF7A 3WV6A 1KJLA 2C9AA 3ZMNA 4J25A 4A2UA 1WBFA 1O8PA 2ZKNA 3M3CA 2YC2A 4FOVA 4G3YC 5D8AC 5G05L 5FYVA 3D5OA 4EWAA 4JHTA 1O8SA 2PQQA 1TQ5A 4ZZ8A 3CJIC 1TVGA 1RJ7A 1M4WA 2FBEA 3U10A 4COZA 1KS4A 1W6PB 2VZVA 3DL3A 4Q1RA 1O3RA 1SDDB 4ZPIA 1F31A 2EIBA 4A7YA 4OHWA 2YU1A 5F8PA 3TEXA 4BQ5A 3Q8CA 1PK6A 4QX2A 3WT3A 1JH5A 3OYWB 4M0HA 1WD4A 1WWYA 3S57A 2RS31 4QU1A 5EFUA 3WDVA 5GZDA 3ZSKA 2DVGA 4UAPA 3T08A 1VAMA 5FZ6A 1A6CA 3N9NA 4R9AA 3HPNA 3T0DA 3LOIA 4OLLA 4IV1A 3WX5A 4RSUA 3M3IA 5A3NA 2XWJB 3NJVA 2J1UA 5EIYB 2Z4FA 5I8TA 4I02A 3RQ0A 3IIIA 3WVJA 1HIXA 2UY9A 4IEWA 5FZBA 1RUG1 3TEWA 3FFZA 4P9WA 4LBMA 3DF0A 4BQ3A 4BM8A 2JB8A 1WCDJ 3WW2A 3R6SA 1CX1A 1H6XA 4P9LA 4EN6B 2PFWA 4O61A 1SDWA 4LOSA 5J7MA 4CUAA 1RUJ1 2E7TA 5SV5A 1J83A 3J7HA 3JBG3 4LJHA 5FZMA 2ZXQA 2Z69A 1CAUA 1GP5A 2CTVA 1NY72 4NVPA 1Y9GA 5EQUA 1QJU3 1UWWA 3HQRA 2VXJA 4L99A 5A80A 1NE6A 4R9CA 4ISRA 3POWA 4CSWA 2QQLA 4GZ9A 4XZUG 5KC6A 1V6JA 1RL3A 2SLIA 2RG4A 4A4AA 5FLIA 3LKJA 1NKGA 1OD5A 2YXSA 4QXHA 4E4ZA 4N43B 1WW5A 2A7AA 5BNNA 5JXHA 3RZHA 1C4RA 3AP7A 1QQP3 1U5ZA 3OUHA 4LULA 3ZYFA 3ZFEB 4M0NA 2VNGA 1YLLA 1T6GC 1W8TA 1OFSA 2A3YA 1R091 4JGZB 2QKDA 5F3IA 2PLV1 2P5BA 2JDHA 2Y6FA 2EALA 2OUHA 3IM0A 1W6QA 3B3QE 4L9BA 3W21A 3WQ1A 4AGGA 2FDKA 2WQ8A 1MS4A 1HX6A 1X82A 4MX3A 2OZJA 1XNAA 4XTMA 1JW6A 1BXHA 3AXDA 2VOTA 5E8AA 4NN0A 4MXWA 4XQ4A 2DVFA 4WBBA 1CAWB 3OY8A 2G9GA 1SFYA 1X7NA 3D0JA 3VDBA 1OURA 4BIOA 2UU8A 2DUOA 3P3PA 4W4ZA 4RHV1 1LOFA 1TMF2 1UMZA 2BOJA 2D5HA 1LHOA 2JD9A 3HAGA 4GMP3 4IGOA 4BQ4A 3ES4A 1N1YA 1UW8A 5LW9A 1VRBA 4MGSA 1URXA 2HWD1 4E4DX 2D40A 1HLCA 3ZIXA 1GWMA 3NV4A 5BXXA 1V0AA 1CJPA 1WW6A 4BQ2A 2GNMA 2IVIB 5IVVA 5FMDA 5J09A 3FN9A 4Y1YA 2FCUA 2Y8KA 2WA4A 4CDQC 1EUTA 5DAQA 2OQ6A 1X33A 2BUKA 3VGIA 1VB4A 2AYHA 4K3UA 1BYHA 1ODMA 4MLOA 4COUA 5AC93 2H6BA 5JCTA 3IB3A 2HWB2 2P3IA 1FXZA 4AR2A 4NIGA 1AR61 5FYBA 3B9CA 4QX5A 2PMWB 1XC6A 2R6QA 4FI9A 3UGGA 4IEVA 2ZGSA 3VD7A 3K51A 3WW3A 2ETEA 3Q8BA 3DN7A 2ZX3A 4Q27A 4RL7A 5IW0A 1PZ9A 2YG0A 4QB6A 5A7SA 2Z2SB 5A6QA 1ULGA 2GNTA 3WG1A 4IV1B 1S1AA 1NLQA 3HT1A 1LOGA 1UPSA 4QPWA 3JQWA 1UOJA 3VKLA 2UWBA 2RR12 4W50A 5CFCC 4D0QA 5C3RA 1N1VA 1ZBA1 2JXAA 3WP4A 3NQHA 1GMMA 3E6BA 1BHGA 2VOXA 2GC3A 1PX4A 1QJX1 5FZCA 1NX9A 1YHFA 2WYFA 2G9FA 1QMJA 4XBQA 2OA2A 4TYSA 1JUHA 4NRQA 3X29B 4BMBA 1SHWB 3FFQA 1CAUB 4XC9A 5CU1A 4BYYA 4P9IA 2HWF2 3K48A 4KWUA 5BNPC 1AR62 3W9AA 4LKEA 2ORXA 1EV12 3LAGA 1QJY1 4QQLA 3RZGA 2CHHA 5FZHA 4NPLA 1JYWA 3M3QA 4CE8A 2JDZA 1RUI3 4HPKA 4AZZA 3POIA 5J96B 4FOQA 4GB32 5FWEA 4GULA 1R1A3 2Y33A 3MICA 3NWKA 1NQJA 2Q4SA 1RMU1 1COV2 4JDOA 3UJQA 3DPRC 3A22A 3NL1A 1H2MA 1PZ7A 3QOPA 2P6HA 2ZGKA 1ONAA 1XXNA 3W58A 3WNXA 2P34A 5LASA 5GZFA 3ZXLA 1D4M3 1FAYA 1YQCA 3ZSEA 4URAA 5A7WA 2HEYF 1QXRA 4QX1A 3SITA 4NHLA 5FIXA 2A6ZA 2XQXA 1TME2 1W6QB 5DDJ3 1QJX2 3VKMA 2YU2A 2R49A 3D6EA 3VN4A 4ZXKA 3TEYA 1AUYA 2GNDA 1POV3 4A7ZA 2VJXA 4NROA 2VAUA 3OPTA 4MXWB 4RYDA 3M3OA 1SFPA 3OY8B 3WDUA 5IAVA 5BNQA 2YGLA 4LORA 5A6XA 5CEHA 2P4EA 1GNHA 3ZFGB 4S2HA 3PJYA 2WO1A 4XJ8A 3MV11 5JOXA 4K1ZA 2A75A 4CCCA 4F7ZA 5LB6A 1W9WA 2XJTA 1H30A 4KMQA 2RS52 5CB7A 5L19A 4LK6A 3VZJA 1ND2A 3ZDVA 4YVWC 5FP7A 2XB6C 5AVAA 3HNYM 2WWSA 1UZYA 4SLIA 4B1MA 4GKXA 4UXAA 4XJ9A 3LPFA 2JE7A 1N3QA 1FX5A 4Q0PA 4XFFA 1US2A 3HQXA 5A32A 2DCZA 1PNGA 5ABJA 1YFUA 2QQMA 1QF3A 1IS6A 3J8F1 1JOJA 4R9BA 4JTOA 4PBPA 4CXWA 2XMLA 4DY3A 5C8WA 4FO9A 3SCFA 1APNA 2IXLA 1W2TA 2Y6JA 1FOD2 1PMIA 2Q1ZB 2W0XA 2XJVA 4H7MA 4O9GA 1QOOA 3VHRA 1F15A 3I2HA 4W6WA 1XB9A 1ZZ9A 2ATFA 2H6CA 3OGJA 4TLGA 4XQWA 3ZN6B 3D82A 5FLHA 3FE5A 1VBD3 3MBWA 2R043 2VZ3A 1PO13 3WF3A 4OQ9A 5FZOA 2PHXA 1ZYBA 4C8DA 2G4IA 5I8YA 3M3EA 1RJ8A 2YMZA 3GZTB 4A45A 2FDGA 2WNUC 4BXFA 3GDBA 4KWJA 2PHRA 1LEMA 1GICA 4I0WB 1K42A 3KGZA 1AJKA 2R063 3FHIB 1ODNA 3W20A 1O4TA 4YZ2A 3BPSA 3KCCA 1X8MA 5IWFA 5CKQA 1WBLA 1IG3A 1RUC1 2K46A 1HW5A 5FJHA 5FV3A 5FYYA 3WNPA 5FWJA 1BEV3 3T2TA 3THDA 2Q8EA 4D6SA 3EO6A 5A1LA 2D6OX 4W8JA 5BNOC 1J58A 2IWGB 5L7OA 4NPMA 2HWE3 4JAAA 3NAPC 4BLJA 4BMEA 2OXBA 2XJQA 4OI4A 1AL21 3UGFA 2V5DA 1GNZA 1O4ZA 2Q1MA 2NZ9A 1I9RA 3DPRA 1YQ2A 4HPKB 1DFQA 2XHNA 2OKXA 2R16A 1IHMA 3OSDA 1CZTA 2TBVA 1GOGA 3CKHA 4B7KA 4OHXA 4ZY9A 4YW4A 5FQ0A 2JKBA 3H3LA 2D3PA 4CU9A 3WUDA 2AR6A 4YVSC 5FDBA 4NIIA 4LNVA 2VXRA 4A42A 1XPWA 3BGAA 3PVOA 4RHV3 5A7WB 4N53A 5FZDA 3ZR5A 2I2SA 2DCKA 2AENA 4LBOA 3WF0A 3M4FA 2XVKA 4GJYA 3I3MA 1P8JA 1W3VA 1UY3A 4MADA 1PO21 4AI8A 4M00A 4AGRA 3MEPA 3CLPA 3FBMA 4WVZA 2C6SA 2VW1A 3DKQA 3AMPA 5DAWA 3LA7A 3ZIWA 2BJSA 2ZZJA 5JZGC 3OGVA 5JOWA 3PLQA 3AYCA 1JZ2A 1LNSA 1CESA 4CCNA 1UY2A 2WIIB 2YFZA 4QHBA 5FY4A 1JOBA 2FHRA 4LHLA 1RUF1 5EXOA 4ZU4A 2NLRA 3VL8A 1G9DA 1RUD1 2ERFA 2ZBJA 1SG3A 2AEYA 4CUBA 4YVWA 4FFGA 4ZHNA 3O1UA 2VMHA 2JG8C 1EAH2 1OI6A 3OCPA 4LO4B 1ASJ1 5DUXA 4WM7C 1WMDA 1OH4A 1HXS3 4YPJA 3SLIA 3WDYA 1ND2B 4XXPA 5JAXA 2XBO2 2KR2A 1RHI2 2YPDA 3GZUC 2VGDA 1S55A 2I07B 4LKSA 3V65A 4I30A 3BOWA 5A32B 3K2OA 5ABJB 3CL1A 3MYXA 4Y33A 4UFLA 2E7AA 2Q30A 3OBZA 1F35A 2RMU1 4NOTA 5C3QA 4Z07A 1JI6A 3W59A 4Q0VA 4NHKA 4IEXA 1STMA 2JDMA 4AVAA 2DVBA 4EYUA 5KBFA 2B39A 2RDQA 2NP0A 2Y0OA 5EYYA 1PMHX 3JBG1 1QJZA 2ZACA 3SH5A 5JWPA 1V6KA 3ZPOA 4DS0A 4NHMA 2D98A 3I2IA 2BVBA 5LEKA 4N90A 1RUF2 4BOWA 1S2BA 4I01A 5C70A 3N7LA 1LAJA 4FPYA 4PHZA 3ZSMA 2I45A 1YFXA 2JB4A 5LA9A 3UKNA 2F4PA 5IAXA 4X6RB 5CG9A 3TB0A 5FZ9A 4XDPA 5FZOB 4LKFA 4CPBD 3I2FA 3NNFA 5H9PA 4AQ6A 5FR3A 1LECA 3HOBA 4IESA 5F9TA 2ZKLA 5F1RA 5CNAA 2DBNA 2RS12 2B4KA 4XBLA 1QQP1 2WLQA 1QHDA 3NW4A 2R30A 4HKWA 4XF1A 5T52A 1AYN3 3FUOA 3TN92 1LGCA 5CZKA 3Q9OA 4QQOA 5A33A 5C9AA 4YGDA 4RR3C 1HQLA 3EXUA 1LR5A 3NAPA 5LBFA 4Q8LA 3CIHA 3MIEA 3S7EA 3J26N 3ACFA 5K8SA 2CWSA 2VW0A 3E1F1 3RDIA 1OMIA 1DZTA 5L7OB 4LQRA 1VR3A 2IC1A 2LRPA 2AGSA 3PUIA 4YW3A 3UV9A 3PUAA 4QGMA 2OVUA 5FBJA 1E5HA 1UMHA 1RXFA 3CEWA 4E4SA 1W9YA 1R082 2QBXA 4I3GA 5FQ0B 3U4XA 1AXKA 1OQEA 2ZGLA 1LB2A 4AOCA 1DQ1A 4CU7A 2ET7A 3KQ4B 4LBKA 3T1LA 3RYKA 5CA6A 2O8QA 4N53B 2PAKA 4LKDA 3NRUA 5DZGA 2HLEA 2VZTA 1B35C 3JD73 3IDEA 5B4XA 2WDBA 4XMAA 2FDHA 1FMD3 2ENRA 1O5LA 1WLCA 5GLVA 2VNOA 3ZFGA 4YZ4A 4XUTA 1UD1A 2XJUA 3T09A 4CVUA 5C3SA 3V0BA 4NIHA 2W91A 1CPMA 2BW8A 5GZEA 1A78A 1XU2A 1HDKA 3Q8AA 1DQ4A 3R4SA 2W94A 4IEPA 4JGYA 4P5YA 4PT6A 5DUWA 5F5CA 1PGL1 4RQPA 5A3OA 1JYTA 3I49A 4D69A 4OULA 1UKGA 3TOJA 3AXEA 2P6CA 5FMBA 2TNFA 5L9RA 4DO0A 2GDFA 1HRI2 4URTA 1QXPA 3MIFA 2WL1A 2WO7A 1NA1A 3AYDA 1XE8A 1LU1A 4MXVA 2YDEA 4UBGA 3KD4A 4DRVA 1O3TA 2RR13 3KWVA 1J3RA 1SLLA 5KHKA 2EXJA 1RUNA 1HJFA 3MF9A 4ET7A 3WCSA 1GUIA 1U5XA 4CDWA 4Z2WA 5J37A 1CAVB 3M7AA 2VBBA 4CU8A 1UZZA 3ALQA 5FOBB 2VMIA 2LS6A 1NQDA 3PVBB 3B94A 3DKWA 3K46A 4TTGA 3ZVXA 1AJOA 1J84A 4Y22B 3C7HA 4JTNA 1OBNA 4CCDA 5CKMA 3BCWA 1S0DA 2WBKA 4N43C 2XH6A 5C5TA 3ACIA 3GHMA 3H9AA 4GALA 1QH7A 4LHKA 1PVC3 2X09A 4GB33 3ZFEC 2V4AA 2XG3A 5FZ8A 3WLUA 2VOKA 1C1LA 3C3VA 3C7FA 3ON7A 1W2AX 4KNCA 4JGZC 5JSPA 4AVCA 2BGOA 5KWRA 3BU7A 3I4IA 4ZKTB 3WNNA 4K8RB 2YBKA 2WYSA 2GNBA 3MIDA 2ZEZA 4FTSA 2V72A 1WCQA 2DCTA 1K45A 3OPZA 4RR3A 5ACA1 4V1PA 3H8RA 2WNVA 3IDAA 4P9XA 1MEC1 1TME3 1XE0A 5C9AB 1ULOA 4YRDA 1W8OA 1UU4A 4UOJA 4XUPA 3BI3A 2VVFA 4FP3A 5DDJ1 4CCJA 4LHSA 3N9LA 2DFCA 3KT7A 3RJRA 5KXDA 2VM9A 5C3PA 1ASJ3 2VH9A 3ORJA 3AYAA 1HN0A 2DUQA 3ZFFC 1POV1 3DGTA 4E4HA 1QEXA 1MPXA 5HI0A 3FZ3A 3FJSA 3ZO0B 1LRHA 5FY1A 2WABA 3WHUA 1UU6A 2PTMA 1CD3G 4F8AA 3IIAA 2Y6GA 4CCKA 2VR4A 2A3XA 3E5UA 1W0NA 5A7OA 1C5IA 1W2UA 1GZWA 1NOVA 5IVJA 4Q4X3 3JZVA 2ID4A 2W5FA 4R4XA 4D6RA 4DIQA 3PU3A 1F8VA 1VMJA 2JECA 3RMXA 4XFHA 5FPZA 5KXBA 4ZU7A 4HG6B 5BV6A 5FO8B 5FZ3A 1ZBE2 1S0CA 5HXVA 3OYWA 1BBT1 1OUSA 3MUY1 4HOOA 3LIHA 3W5MA 4P5HA 5KC5A 4IQPA 5FP3A 4UFHA 1JYVA 3V0BB 1W2OA 5FZLA 3PVNA 3HD8B 4A44A 5JR2A 1XBFA 4U2AA 5IVCA 1O3QA 3H8UA 5LCWL 3OPWA 3RWNA 3ACGA 3N7MA 4AQ2A 2P37A 1HRV2 2W2IA 2J1EA 5EPAA 3IDCB 3SH3A 4OCTA 3N9MA 1AZDA 4KQ7A 1RUH2 1AL0G 1W8ZA 3V64A 4RQPB 4IV1C 3AKSA 4C0HA 1WW4A 2XLGA 3CQOA 4D94A 4LBQB 2DTWA 2JE8A 1W99A 4MO3M 2ZGPA 5EHDA 5A3WA 5CADA 1ZA7A 1UX7A 5F3CA 1W28A 3K75B 3ILNA 5E88A 3AL6A 1NA1B 2A6VA 3TRSB 4YG3A 4HKLA 3K4DA 4HLTA 4LPLA 2EF6A 4FBFA 4DXTA 2VCMA 5FP9A 1KRIA 1DQ5A 1Q8VA 1TEIA 2K0GA 4CDWB 3BB6A 1S0IA 3H3UA 3GXUA 1I6XA 3VD4A 1R64A 2ZOEB 3DXUA 3GJAA 1AR82 2R061 2YC0A 3I2KA 3ACHA 2WSVA 2BWAA 3RZLA 1CPNA 2WFPA 2V4VA 3QLQA 5HCAA 1YNAA 1TZOA 3UJOA 3MLLA 5DAPA 3RFRA 4AL9A 3NNMA 1FPN1 3KM5A 4Q8KA 3IT8A 4S2GA 2D3RA 4KBBA 5KHHA 1AR72 2DURA 4ATFA 2YV8A 4Q4W1 1OA2A 2KXLA 1OXCA 5DPNA 4FQ4A 3DXTA 5FZKA 2DFBA 3WW1A 1QKQA 4OVEA 4YM1A 4DXRA 1WMFA 1REFA 4NWWA 3FC0A 1JMUB 3Q8FA 4XETA 1Z7S2 3APBA 5HV0A 2VMFA 1CAWA 3CDZB 2PHDA 2WNVB 4LO5B 2XXZA 5IVFA 2BYVE 2ZGQA 1KFUL 4LMFA 4OHYA 4N9IA 2GSYA 4Q0QA 4U36A 4XURA 4E8CA 3VDDA 3LEKA 4GKYA 1OOPA 3HEIA 3ZFGC 4UW4A 1LOFC 1G86A 1SQ4A 1W2NA 1A3KA 4HKOA 1EP0A 4K8FA 4UI9L 5F3GA 3WDTA 2VZQA 1HQWA 2XQRA 3NKTA 5F32A 3ZYPA 2VTXJ 1Q3EA 5FTTC 4XJAA 3LQCA 2XWBB 2BV4A 4IDZA 1VRH2 4NO4A 3B93A 3RRDA 3I7DA 5JI9A 4HANA 3N4MA 3AVSA 1EAH3 4QKNA 4XFBA 1GZWB 2E31A 3WDXA 5KHJA 3ZXGA 4DB5A 4PLNA 4R4ZA 2MEV3 4XCAA 2XBO3 3ZX7A 4HVRA 2R0FA 1W6NA 4UF0A 3OBAA 1HXS1 5HXMA 3OG2A 1WUVA 2WT2A 4KGQA 4XJWA 1WZXA 1VBA1 2HYXA 2IFWA 4Z2AA 1G9BA 2ARCA 4PBOA 2ORZA 4N7UA 4BJ0A 1GYKA 1C1FA 3DYMA 5J1XA 2B46X 2ZAAA 2RM23 4XFAA 2BU9A 2F6BA 1JYIA 1MR5A 4N8MA 2ZCWA 1DGRN 1VJ2A 2HKXA 5FPUA 4Y20A 2RDSA 1LHNA 4R52A 1UN1A 3S0MA 3NMBA 1DIWA 2CSGA 1YI9A 2FDFA 4FFIA 4NWVA 4XACA 4IGPA 5G04L 1UZVA 1XU1A 5I93A 4XOGA 3USUB 2FQPA 3KF5A 4QD2A 1JYXA 4DQAA 1VALA 4PDWA 5BUVA 1ZRRA 2RHPA 3FX3A 4MGQA 4IE4A 4MG2A 2Y6KA 3C2UA 2X29A 1AX0A 4LO7A 1HV1A 3K3NA 3OEBA 1CJDA 3KT4A 3BYWA 5DXDA 2HBUA 2CAVA 4FVVA 4D6QA 5IVEA 5LA0A 4BE3A 1MS8A 3S5QA 1EPZA 5LZ6A 2RS32 3SKVA 3J7MA 1SBEA 3NV1A 4XDOA 2BWCA 1Z78A 1W04A 2A1XA 1AYN1 4FPCA 3OUIA 4XJZA 5FO7B 1Q8QA 2VPVA 3MLKA 4HT1T 5B4NA 4XAAA 5FBZA 1SCSA 2BGPA 2D6PA 1QJEA 1AXYA 4YSFA 5A3LA 3KV4A 5FO9B 3GCXA 4FFFA 3KT1A 1W8UA 2KA3A 3AZVA 3EHKA 3POFA 3P3NA 3ZSJA 3JB8A 3LEIA 1RUG2 2WWUA 4QPGB 5IUQA 4HN0A 1RUOA 4BQXA 2PAMA 3AYEA 3KMHA 4OMDA 1XYNA 2W87A 2Y26A 1N1TA 3VBRB 5L36A 3VLBB 5FZ0A 1RUJ2 3W5NA 5JR7B 1E5RA 1OSGA 3I8TA 1VBB1 5FZIA 3PUHA 1JODA 1TG7A 4QX8A 4QHZA 4HK9A 2MNGA 1AYM1 3O1MA 1AR93 1KEXA 1IZ3A 4QKBA 3U0ZA 4RFRB 2K9ZA 2PHWA 3U07A 5HV4A 5FYMA 3D8CA 2VMGA 5F6KA 3JD71 3AMMA 3FWEA 2CGNA 4KGGA 1NLSA 4S2FA 1FMD1 4H7LA 4QB2A 5A7QA 3VDDB 1OOPB 3WSOA 4B29A 2QFEA 2H0BA 4IERA 4XIKA 5FYZA 3ZYHA 4Y1VA 5LK5A 4QX7A 3URFA 3WG3A 2C26A 3V56A 4K9SA 4XZPA 5T5JA 4O9EA 2GN7A 1R092 1ND2C 5GM0A 3GCWA 2UWCA 2PLV2 3KVBA 4AE2A 2C1FA 3AZYA 1H8VA 1ULDA 3T1MA 1T6BX 3A0NA 2X53S 2VTXA 2HWC3 4XVHA 1D2QA 2BTVC 3IAPA 1NT0A 1QNWA 1CAXB 1OLQA 1W6NB 4UF0B 5ABJC 5EWSA 4BPZA 1W0PA 4LXLA 5JSRA 5LWBA 1PIV3 1VB2A 2VO5A 3PMSA 3GYDA 3T0BA 2JDKA 3M8LA 4IETA 1YQ8A 1H1IA 1O59A 3O1SA 1YIPA 2TUNA 3NNGA 1UZWA 3AKQA 2WZ8A 4RHV2 3ZN6A 3LOBA 2W1QA 3VD3A 4BB3A 3DV8A 3C7OA 2HWD2 2QUOA 4DFSA 1K5MB 2VQUA 4AF9A 4Y20B 4MGKE 2BFUS 2E33A 3ETQA 2DBIA 1SLBA 5C33A 5IT6A 1H4GA 3E6CC 3LIGA 2PQSA 1H8TB 2RJLA 1L7RA 2B42B 5SV8A 1FNZA 1WA6X 2QZ3A 4JX0A 4EV0A 1YI7A 5EJ3A 2ZGMA 1QDOA 2EXHA 2P17A 4A7KA 3S5AA 3HQUA 1NCRA 4J6GA 1DBNA 1PVC1 2JDNA 4PDWB 4XUOA 1D0HA 1ZZ8A 3KV6A 4JDMA 4QXBA 1FATA 2CWMA 2QQOA 1LU2A 4JCKA 4YYOA 4OQ8A 2O0OA 4YARA 4P08A 4Z92B 4COWA 1LGBA 2R071 1TNRA 2E7QA 2JD4A 3WY6A 4BHPA 4CRQA 4DXZA 2WWJA 4DXSA 5A1AA 5JOYA 2P1BA 2WZR3 2WO3A 5L7OC 1UY0A 1DU3D 2VC9A 2ZGTA 1NLRA 2PXJA 4KH9A 3DUIA 3LFIA 3B69A 3BPZA 5IVYA 1GWLA 2VQTA 3LCPA 1XE7A 2WFF1 4Q4Y3 3T2QA 1RVF1 3ZPYA 1JZ6A 5DN2A 1Q8SA 3BTXA 3CJXA 1YJKA 1ZBA2
chains in the Genus database with same CATH topology
3H8OA 3RZLA 5DABA 3BTYA 4ZS2A 3RZMA 4CXWA 2FDIA 4NJ4A 4IE6A 4JHTA 4IE5A 3O1MA 4NIGA 4QKBA 4RFRB 4NRPA 3KHCA 3BKZA 4IE0A 3KHBA 4CXXA 5F8PA 3S57A 3H8RA 3O1PA 2FDGA 3BI3A 4IDZA 3BU0A 4QKNA 4IE7A 4NRQA 3T3YA 3O1OA 4NPMA 4O61A 2FDJA 3O1SA 3T4VA 3BUCA 3RZGA 4NPLA 3O1VA 3LFMA 4O7XA 4NIIA 3RZJA 2FDHA 4NIHA 3RZHA 2FDFA 4ZS3A 3I2OA 3I3MA 3S5AA 4OCTA 4QKFA 3I3QA 4QHOA 3O1TA 3I49A 3O1RA 3H8XA 4MGTA 4NRMA 4MG2A 4IE4A 3BTZA 4CXYA 2FDKA 4NROA 4NIDA 3RZKA 2IUWA 2FD8A 4ZHNA 3O1UA 3BIEA 4QKDA 3T4HB 3BTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H8O A;  3RZL A;  5DAB A;  3BTY A;  4ZS2 A;  3RZM A;  4CXW A;  2FDI A;  4NJ4 A;  4IE6 A;  4JHT A;  4IE5 A;  3O1M A;  4NIG A;  4QKB A;  4RFR B;  4NRP A;  3KHC A;  3BKZ A;  4IE0 A;  3KHB A;  4CXX A;  5F8P A;  3S57 A;  3H8R A;  3O1P A;  2FDG A;  3BI3 A;  4IDZ A;  3BU0 A;  4QKN A;  4IE7 A;  4NRQ A;  3T3Y A;  3O1O A;  4NPM A;  4O61 A;  2FDJ A;  3O1S A;  3T4V A;  3BUC A;  3RZG A;  4NPL A;  3O1V A;  3LFM A;  4O7X A;  4NII A;  3RZJ A;  2FDH A;  4NIH A;  3RZH A;  2FDF A;  4ZS3 A;  3I2O A;  3I3M A;  3S5A A;  4OCT A;  4QKF A;  3I3Q A;  4QHO A;  3O1T A;  3I49 A;  3O1R A;  3H8X A;  4MGT A;  4NRM A;  4MG2 A;  4IE4 A;  3BTZ A;  4CXY A;  2FDK A;  4NRO A;  4NID A;  3RZK A;  2IUW A;  2FD8 A;  4ZHN A;  3O1U A;  3BIE A;  4QKD A;  3T4H B;  3BTX A; 
#chains in the Genus database with same CATH topology
 3UT0 A;  4CEW A;  3HR9 A;  3F95 A;  4CP1 A;  3I2G A;  4CP0 A;  1WLW A;  1MZ5 A;  1SBD A;  2EXK A;  4ITC A;  3TAY A;  3MV0 1;  4Y1Z A;  5KHI A;  3KV9 A;  4IV3 A;  2X5I B;  1ZVF A;  4N53 C;  4YLZ A;  4OZX A;  2CU5 A;  2WS9 1;  1PGW 1;  4PF1 A;  1S0E A;  4FFH A;  3T0A A;  4E27 A;  2ZGN A;  1SPP A;  4Q4X 1;  3PTY A;  1QJY 2;  1DYP A;  3CO2 A;  1LHW A;  1ZBE 3;  3VBH A;  5FZF A;  2R07 2;  4CDU A;  3NNJ A;  3AVR A;  4EZ4 A;  1OA3 A;  1W05 A;  3D4K A;  4Q4V 1;  1F5J A;  4LLF A;  4XDQ A;  5GLW A;  3KHC A;  1S0J A;  3PUS A;  4FPG A;  1RMU 2;  4COV A;  4KU8 A;  1SLA A;  1EY2 A;  1V6I A;  4E2G A;  1HRV 3;  3ASI A;  1FNY A;  2VME A;  2JKX A;  3AC0 A;  4C0B A;  1BVV A;  4DEQ A;  4EWD A;  1RUH 3;  4TLF A;  1K5J A;  2VZS A;  4ES8 A;  1ZRF A;  2JE9 A;  4AI0 A;  3PNA A;  2WNO A;  4XFC A;  4NMI A;  3LDK A;  5D21 A;  1C8M 1;  5ERL A;  2QQK A;  2ZHM A;  3ZYR A;  5A3M A;  4ASM B;  4HVQ A;  3VBU A;  1OPO A;  1RED A;  2D44 A;  1VBC 3;  1MS9 A;  4M4R A;  3B01 A;  4N9H A;  4B4R A;  4DZG A;  1E5S A;  2XVG A;  2PHL A;  3ZOI A;  2EIC A;  2ZEW A;  3P1I A;  3VD9 A;  2J42 A;  3VBS B;  5IFP A;  3POS A;  5I0D A;  5JIU A;  4UW5 A;  2GME A;  1H9P A;  1OH3 A;  2WIN B;  4BQ1 A;  4PF5 A;  1DGW A;  1RUE 1;  5EP9 A;  2VZU A;  2W68 A;  4Q29 A;  3IBM A;  3I3E A;  4ONU A;  2F17 A;  2RDN A;  4SBV A;  1DG6 A;  5FYH A;  5GZG A;  3O1V A;  2BBV A;  1LHU A;  2WAA A;  4QDQ A;  5FUP A;  3U78 A;  4OMC A;  1D0G A;  2E9Q A;  4NR1 A;  4PCR A;  4CYD A;  1S0B A;  2B9U A;  5F5Q A;  2JIG A;  1W39 A;  3N3H A;  2A73 B;  3ZYI B;  1UX6 A;  4AFA A;  1GLH A;  1DGL A;  1AR7 3;  1LOC A;  1OF4 A;  3EJK A;  3LZZ A;  4UFM A;  5F2W A;  4CCE A;  1J59 A;  3R4U A;  1C8M 2;  1NCR B;  2ET1 A;  2W9X A;  3J8F 2;  3VKO A;  4QDR A;  2I74 A;  4IEO A;  5C8C A;  1H2N A;  3NVC A;  2C9K A;  2Z5W A;  5JMC A;  2VCB A;  2A6Y A;  4DEV A;  2GU9 A;  2GAU A;  4H14 A;  3R4D B;  5C9A C;  3SCH A;  1W8N A;  5EJZ B;  1DLC A;  3WR0 A;  2UWA A;  2BDR A;  2JIC A;  3ILR A;  5T55 A;  4AEK A;  4CXY A;  5A7N A;  5LY1 A;  2QDN A;  1VBE 1;  1ZX5 A;  2N7G A;  1YJL A;  2VZR A;  2G9Z A;  5D1I A;  4JKK A;  4PJY A;  5FY8 A;  2HEW F;  4WZF A;  4E8D A;  4JHZ A;  3AMQ A;  4HL0 A;  5LBB A;  4TZD A;  1V9U 1;  2QQN A;  4CEW B;  1I5P A;  3IAQ A;  5FXV A;  1RXG A;  5GJ6 A;  2YBP A;  2GH8 A;  1LTE A;  2DV9 A;  4IV3 B;  4Y3O A;  3I54 A;  1I1E A;  3POY A;  1LEN A;  4WV8 A;  4YGC A;  4BIF A;  5ANQ A;  3P5B A;  5DQ0 A;  1RUC 2;  2GZW A;  4JC1 A;  1SPP B;  4RGG A;  2ZX2 A;  5JMO A;  2MEV 1;  4ZS2 A;  2KM2 A;  3AKR A;  4XTP A;  1MVE A;  3VBH B;  5FYC A;  2BNN A;  4CDU B;  4GD4 A;  4WVW A;  3I2J A;  4YG0 A;  1YQ6 A;  1AL2 2;  1OVP A;  4QXK A;  4ARX A;  5FFO C;  1CR7 A;  2ARB A;  5FZE A;  5FAX A;  4B4P A;  2R7E B;  4Y5Z 0;  4CDX B;  3QD6 A;  3ITQ A;  4NJ4 A;  1A8D A;  4JGY C;  2AAC A;  4RQP C;  1JZ5 A;  1LJ7 A;  1UPI A;  5LY2 A;  5JXJ A;  2RM2 1;  3KCX A;  4IE0 A;  1X9P A;  5EV7 A;  4QGN A;  4EWE A;  3GAL A;  4FPH A;  3WP3 A;  4EZH A;  1F4H A;  2C5D A;  1V9U 2;  3H42 B;  4WZC A;  4BDV B;  1NA1 C;  2XL7 A;  3JXS A;  1RTV A;  2ZJC A;  2DF7 A;  3E97 A;  4UYB A;  4BK5 A;  1CAV A;  2YGM A;  4ISQ A;  4DNY A;  5M0T A;  2C0Z A;  1O91 A;  3AKT A;  1NUK A;  4IW3 A;  1PO2 2;  3VBU B;  3ZXE A;  4CDW C;  4LEJ A;  1OKQ A;  1H1A A;  1WME A;  3THT A;  1GP4 A;  3WZ1 A;  1QNY A;  4Y22 A;  1YCI A;  2CAU A;  5K4L A;  1J1L A;  2P3K A;  4QT6 A;  4CP2 A;  1WKY A;  4QPI B;  3LDR A;  4L97 A;  1ULE A;  4YZ3 A;  5D2A A;  1QJU 1;  2RS3 3;  3USS A;  1VMF A;  3Q8E A;  1Q8P A;  5E16 A;  1RUD 2;  1JZ4 A;  3S30 A;  1PGS A;  2JDU A;  4P9G A;  1LKN A;  3AZW A;  4DY5 A;  2VBD A;  2YYO A;  2UYA A;  1UAI A;  4OUM A;  1CQ9 A;  1YIF A;  3SXW A;  3ZKU A;  4B4Q A;  2D3S A;  4NPR A;  5HCH A;  4XCB A;  4UFI A;  5T50 A;  3T4V A;  2JDA A;  3O7O A;  4EN7 B;  3ABZ A;  2GN3 A;  4XIL A;  3LFM A;  1MQT B;  3J7N A;  4YM3 A;  1XYP A;  2NMN A;  2WC2 A;  1IQD C;  4MGI E;  4CP9 A;  5C8C B;  2RMU 2;  1DYK A;  3WIN E;  1DHK B;  2WNV C;  4FAG A;  1BMV 1;  2XDV A;  4EE2 A;  4XF3 A;  2X8K A;  5TSW A;  5CKN A;  4JZR A;  4OHZ A;  2ZML A;  1HB1 A;  1OD3 A;  3JBG 2;  4FOW A;  5A3P A;  1JYC A;  3QBQ A;  4QKF A;  4ATE A;  2X05 A;  4FPF A;  4RGK A;  2XJS A;  4QHO A;  5AFB A;  3ES1 A;  4OI1 A;  2VQA A;  1AR9 1;  1S2K A;  3FHA A;  1G7Y A;  5ANN A;  1TMF 3;  2R1B A;  3MIG A;  3O1T A;  4OI0 A;  5GKA C;  1EYB A;  1ZZ6 A;  3NJZ A;  5KR7 A;  2J22 A;  4GMP 1;  4JDN A;  4FAH A;  2HYK A;  1GZ9 A;  1XYO A;  4W6X A;  4Q0S A;  4YZ1 A;  1Y4W A;  3BIE A;  2OZ6 A;  2VCC A;  1QQP 2;  3KCY A;  5GAL A;  2YUE A;  4P14 A;  3RS6 A;  4I3P A;  1R09 3;  4BU2 A;  2IVJ A;  4ORF A;  3RI8 A;  3WG2 A;  2XL9 A;  4D8M A;  4NAM A;  2PLV 3;  3NNL A;  1MS0 A;  1PNF A;  2NMO A;  5FY5 A;  2BPA 2;  4GMP 0;  3SCG A;  1N1S A;  5C3O A;  4OUE A;  5KXE A;  3LSD A;  2GC1 A;  2HWB 3;  4UWD A;  4WM8 B;  2HWC 1;  1W03 A;  5AC9 1;  3D0S A;  2ZHK A;  5JI7 A;  2XON A;  2Z42 A;  3KSC A;  3RWK X;  2ZX4 A;  4M3C F;  1IGO A;  2YB7 A;  1PX3 A;  3ZXF A;  1D4V B;  1UXX X;  2B9V A;  3ELN A;  1GOH A;  1PIV 1;  5H9S A;  3M2M A;  3WNK A;  5A1F A;  2Y60 A;  4MV2 A;  1SLI A;  1X50 A;  1U5Y A;  3AP6 A;  4LBQ A;  1DZR A;  4MYE A;  1YFY A;  2AUY A;  4S2D A;  1T2X A;  5CG8 A;  3KGL A;  2Y6L A;  2YZ4 A;  2HWD 3;  5B2G B;  5FUN A;  3TEZ A;  3FUQ A;  1QDC A;  2PEL A;  3GF6 A;  2RJK A;  3A23 A;  4QQ2 A;  1IQA A;  5F39 A;  4A6S A;  5DZE A;  4LE3 A;  1CZV A;  3WQ0 A;  4A3X A;  4CEY A;  1YFW A;  3DYP A;  5I0S A;  3WF4 A;  2QQW A;  4D7S A;  3MFA A;  2WSU A;  1H0B A;  5F3E A;  1GFF 2;  4Q5O A;  1IPS A;  3H1M A;  4YFW A;  5FK7 A;  3VHN A;  3U14 A;  4AHW A;  1AR6 3;  2HWF 3;  2JDY A;  3AK0 A;  4YW7 A;  4BZ4 A;  1W90 A;  5A3U A;  5C5U A;  5K0U A;  1EV1 3;  4IEQ A;  3RYR A;  4DUX A;  3I2D A;  4XHB A;  1PGL 2;  2FZ2 A;  3BAL A;  4K40 A;  4WVM A;  3HWJ A;  2B8M A;  2PYT A;  5FKB A;  4A6O A;  5CIR A;  2VVE A;  1VPH A;  1RUI 1;  1KJR A;  5FOJ B;  4XUQ A;  4AVS A;  1FV2 A;  2VL4 A;  2W95 A;  3FLR A;  1COV 3;  1R1A 1;  4AAP A;  4AI9 A;  4QPG C;  2NM1 A;  2XVL A;  1JUI A;  2ZGO A;  2CDO A;  3LA2 A;  3AP9 A;  1ZBA 3;  4Q4Y 1;  3VBR C;  1YXW A;  4LBJ A;  2EIE A;  1D4M 1;  4FQZ A;  4GA9 A;  2YHJ A;  1BK1 A;  3F2Z A;  3LEM A;  1QJX 3;  4LLO A;  1OKO A;  1IS4 A;  3ZXJ A;  4CP9 B;  5IK4 A;  3EBR A;  2IXI A;  2J7M A;  3MPP G;  4Q2F A;  3WCR A;  4R8H A;  3RVH A;  4XE9 A;  4A41 A;  4IEU A;  1KDK A;  2A6W A;  3N7K A;  4L11 A;  1I5Z A;  4Q26 A;  3BN6 A;  4FPE A;  5A6Y A;  1QJY 3;  3VDD C;  1Z0H A;  1OOP C;  3OOX A;  5A6Z A;  4UW6 A;  1W9T A;  3HMY A;  5BYN A;  5KHG A;  1NZC A;  1U5I A;  4L0P A;  4GJZ A;  4XW3 A;  1AF9 A;  2RE9 A;  2DVA A;  2QQI A;  4D3W A;  2RS5 3;  3B7M A;  3VDA A;  1POV 0;  2WR9 A;  1ENR A;  1OHF A;  2XLF A;  2WN2 A;  3ZR6 A;  4BK4 A;  1ZNP A;  4I0A A;  2XR4 A;  4XF9 A;  4YWA A;  5FYS A;  3RZK A;  4C1X A;  2NN8 A;  1IOA A;  3IDB B;  5FPA A;  3H7Y A;  5ACA 2;  3MGU A;  1FYU A;  1Y9M A;  4M3C A;  2WJS A;  1D4M 2;  3N35 A;  4KG8 A;  3VZO A;  2BQP A;  1MEC 2;  4OUS A;  1NZI A;  4RN5 A;  1NCQ B;  4ASK A;  1ND3 A;  1DLL A;  1UMI A;  1C3H A;  3BTA A;  1L3J A;  1UY4 A;  4KG0 A;  5DDJ 2;  5EZW A;  4Y1X A;  3C8X A;  1F4A A;  5DAV A;  3ZXA C;  1A8M A;  3SH4 A;  4PLO A;  5FK8 A;  4LO8 A;  2IXK A;  1VBC 1;  1LCL A;  3DEM A;  2VUA A;  4JKM A;  3TNP B;  5DAB A;  1FOD 3;  4AG4 A;  5F5A A;  3CHX A;  4AED B;  5IAT A;  1H2K A;  2QZ2 A;  5A70 A;  1K5M C;  1SEF A;  1XSR A;  2Q5T A;  4FTB A;  1ENS A;  4QM8 A;  2OS2 A;  1CIW A;  1UKR A;  3USU A;  1JZ7 A;  2Q1F A;  2A3W A;  3WHT A;  2DTY A;  1CVN A;  1QOT A;  2H0V A;  4QGL A;  5IK8 A;  4GWN A;  1GOF A;  1G9C A;  3ECQ A;  4ZON A;  1VBD 1;  1UYX A;  5FZ7 A;  2R04 1;  5CIS A;  1JOP A;  1PO1 1;  2P3J A;  1HN1 A;  4LIU A;  1OLM A;  3CZJ A;  4PDW C;  5E1R A;  1UYP A;  1WW7 A;  1UQX A;  5FXW A;  4CEY B;  1BBT 2;  1V6M A;  4B8E A;  4Z8B A;  1YWK A;  5IFT A;  1GAN A;  1UU5 A;  4QQH A;  3GNE A;  3KHB A;  3PJQ A;  2BRT A;  1JXN A;  3OGS A;  4KWL A;  3J8F 3;  4QMA A;  4AI2 A;  1IPJ A;  1H9W A;  2CYF A;  5FXZ A;  1ZZ7 A;  5K0U B;  1UF2 C;  4JKL A;  4XF4 A;  3BOP A;  1BEV 1;  4YW6 A;  2GMP A;  3E5X A;  3HVD A;  5FP4 A;  3OGG A;  5CAZ A;  3M1H A;  2HWE 1;  4WVM B;  4QPG A;  2DUP A;  4X8P A;  5FYU A;  4XUN A;  3MUZ 1;  1YEW A;  2WQZ C;  4XF0 A;  2JG9 B;  3SEP A;  1N47 A;  3VBR A;  4AFD A;  3IZO A;  4AQT A;  1GSL A;  1J1T A;  2DCY A;  2PHU A;  4KL1 A;  3BU0 A;  3ETP A;  2J1R A;  2BFU L;  1NAE A;  3H3Z A;  3LSE A;  4IUG A;  5CVR A;  2PHF A;  5I0R A;  5KXC A;  2X5I C;  3KF3 A;  4I2O A;  4MH0 E;  4LK7 A;  4QX0 A;  3WW4 A;  4BQW A;  2CNA A;  1JN2 P;  4H3W A;  4IEY A;  2RJ2 A;  3G7D A;  5GLU A;  4E9K A;  4KBZ A;  2R06 2;  3UK9 A;  1ACC A;  1RUC 3;  4RA0 A;  4RD7 A;  4Q1P A;  1V00 A;  3U75 A;  2DU1 A;  2VUJ A;  3SIS A;  4AK3 A;  2ZEX A;  3SKJ E;  4DIN B;  2XKO A;  3ENR A;  3ZKY A;  1XNC A;  1XOY A;  4R9D A;  4W65 A;  1FPN 2;  1AL2 3;  4N7I A;  2IXJ A;  3HBK A;  1PZ8 A;  1UCX A;  3L2Y A;  1BCX A;  3D3A A;  4Q4W 2;  3VKN A;  4AI1 A;  2E32 A;  2Q8O A;  4RS5 A;  2YC4 A;  5CFD A;  2DU0 A;  3O0W A;  1CAX A;  3A21 A;  2VBP A;  2VVD A;  3L2H A;  4CUG A;  1RHI 3;  3VD5 A;  1F2N A;  2ZEY A;  5F2S A;  1MS3 A;  4UFK A;  2B45 X;  2D5F A;  3BVC A;  5JDB A;  4M3C B;  5C4W B;  4NID A;  2ZMK A;  2ES3 A;  2YFU A;  4YGE A;  2VOW A;  4W6Y A;  2R1D A;  2Y0I A;  4F83 A;  1ND3 B;  5DG1 A;  2ZAH A;  3VBS C;  1PO2 3;  5GLZ A;  4F3J A;  3KQR A;  2ZHN A;  4I09 A;  4YW2 A;  1UOB A;  1K5M A;  4NE9 A;  3WUC A;  2DCJ A;  4A3Z A;  4X6Q B;  3T2O A;  5T5P A;  1B35 B;  5EYX A;  1BZW A;  2VD7 A;  1REE A;  1SZB A;  3HBZ A;  1NY7 1;  5FLJ A;  1RUF 3;  1H8T A;  1SMV A;  4OYU A;  5A7P A;  1LES A;  1QH6 A;  3RMY A;  1NXD 1;  3J4U H;  1RUD 3;  1F5F A;  4LTA A;  4AEM A;  4CUC A;  2QCS B;  2NQY A;  1W8H A;  2RV9 A;  4K1Y A;  4XPV A;  5C4W C;  1U0A A;  4XYX A;  1ULP A;  2JEM A;  1OA4 A;  1LUL A;  2VUD A;  1K12 A;  3N7J A;  1QU0 A;  1HXS 2;  1NCR C;  2RS1 3;  3OBR A;  4L8Q A;  1UOG A;  3VBO B;  4AFB A;  3RZM A;  3PU8 A;  1VBA 2;  5FMO S;  4CA9 A;  2E51 A;  4LHN A;  3TN9 3;  1JTZ X;  4XJU A;  3ZXD A;  5FPX A;  1DDL A;  3ZFF B;  1BVP 1;  1RIT A;  2RMU 3;  5DG2 A;  1BKZ A;  3B00 A;  1A34 A;  3L9J T;  1UZ0 A;  1JZ3 A;  1CON A;  3RNS A;  2JX9 A;  1UNB A;  2WO2 A;  3GM8 A;  1TE1 B;  4AYU A;  1OQD A;  5LRS A;  1MS5 A;  1H4H A;  4ZZ5 A;  2E6V A;  3PL0 A;  4GH4 B;  4HON A;  4OZO A;  1JBC A;  1HKD A;  4FSJ A;  3POG A;  1DGW X;  1R08 3;  2X5I A;  3KS7 A;  1SAC A;  1TMF 1;  4GAZ A;  4G9S B;  4CEW C;  1E5I A;  4Q0U A;  1GR3 A;  1POQ A;  1VAV A;  2WT1 A;  4FPL A;  4I0B A;  1R1Z A;  1VE0 A;  3NKG A;  2SBA A;  4LUM A;  4UBH A;  2E53 A;  5T54 A;  2QE3 A;  3WNM A;  2QQU A;  4IV3 C;  4M4P A;  3VZL A;  2A5Z A;  1ENX A;  1BLZ A;  2ARA A;  1HQN A;  1WLD A;  4XQD A;  5AFE A;  1O4Y A;  2VU9 A;  3RPQ A;  1AYN 2;  3VBF A;  3VBH C;  1OPM A;  1UY1 A;  3O0V A;  4AWD A;  4CDU C;  5F37 A;  1XSQ A;  3C7G A;  3UYJ A;  4EN8 B;  2G1M A;  1RIN A;  2QDR A;  2AZ5 A;  4GIQ A;  5L73 A;  2HWB 1;  2LW8 A;  2V5Y A;  4FCA A;  4CDX C;  4Y5T A;  3O12 A;  4IGQ A;  1RB8 G;  1YQ5 A;  3WG4 A;  2WT0 A;  4ES9 A;  1QWR A;  2LTN A;  2JEN A;  3DCQ A;  3UL2 A;  4RS5 B;  1GV9 A;  2FMD A;  3ACL A;  4NIA A;  5CFD B;  2GC0 A;  1CN1 A;  1HRI 3;  1RC6 A;  1KS5 A;  1LOE A;  3AFG A;  4FPK A;  2QQJ A;  3UNP A;  1VBB 2;  3CU7 A;  4XAB A;  3INA A;  3JB4 C;  3ME2 A;  2EA7 A;  1JS9 A;  4QDS A;  5D8A A;  5H9Q A;  3VBS A;  1AYM 2;  1VIW B;  1W6M B;  5LBE A;  2XHK A;  1UO9 A;  3VBU C;  4AHY A;  3VKF C;  2RR1 1;  3OUJ A;  4C90 A;  1OVS A;  4OHV A;  3CJI A;  3LWC A;  2UYB A;  1ST8 A;  1S0G A;  1KFX L;  3ZYJ B;  3ZSL A;  4NHY A;  2CL2 A;  1G8W A;  3JD7 2;  1MS1 A;  4LT5 A;  1FMD 2;  4QPI C;  4JRA A;  5JIA A;  2EXI A;  1ENQ A;  3U4S A;  2Q0A A;  2ZZQ A;  3I59 A;  2ZTN A;  4G4F A;  4PI2 A;  1MZE A;  1BJQ A;  2JIJ A;  4AEJ A;  5FRE A;  4GQ7 A;  4EN0 A;  2HWF 1;  1LOD A;  3N36 A;  5AVP A;  4KWK A;  1GNY A;  1PM7 A;  1EV1 1;  1PK6 B;  4DUV A;  3TNQ A;  5C4W A;  4Y4R A;  2XUE A;  4EJR A;  3R05 A;  1Q43 A;  4HK8 A;  5ISL A;  4K7J A;  4QAW A;  3MIB A;  3BIW E;  5FYT A;  4GB3 1;  3MW2 A;  4ZU5 A;  3POE A;  1ALY A;  1WMX A;  2ZS6 B;  4BH9 A;  1MQT C;  3BOD A;  4Y24 A;  2BNM A;  4B3N A;  3GBW A;  1COV 1;  1KQR A;  3PHM A;  3OB8 A;  4XFI A;  3WQB A;  3NV3 A;  5C8C C;  1Y7B A;  3N9Q A;  1XQN A;  2ZPX A;  1UIK A;  2EAK A;  1WD3 A;  4QQP A;  4K20 A;  3MIH A;  2P2K A;  5IJR A;  2OW4 A;  2XOM A;  1D2S A;  2J1A A;  4FPO B;  5JOZ A;  2F4L A;  1JYN A;  2C24 A;  4IE6 A;  2XPJ A;  3JUU A;  1TME 1;  3RJ2 X;  1G6N A;  3EB7 A;  1GBG A;  3EQE A;  3KB5 A;  3BKZ A;  1YYN A;  3SMH A;  2CGO A;  1HB4 A;  1G9A A;  1US3 A;  3ZYB A;  2DWR A;  4KU7 A;  5DUV A;  3B9I A;  3RSJ A;  3PTR B;  2B5H A;  2BOI A;  1HB3 A;  5IYY A;  1J3P A;  1PVC 2;  2VNV A;  3JCI A;  1WA4 A;  4OI2 A;  1VLN A;  4E2Q A;  1UYY A;  2XGX A;  2RS5 1;  2Y38 A;  1C8N A;  5T5L A;  2BVV A;  2LM3 A;  2O1Q A;  5BNN B;  2PAE A;  3AP5 A;  1H6Y A;  5ACA 3;  1XND A;  3FLT A;  4WM8 C;  2GAL A;  1OQ1 A;  1Q5O A;  4PQ9 A;  3WP5 A;  5JXI A;  2OT7 A;  1MEC 3;  4OFG A;  1MZ6 A;  1IG0 A;  5BPX A;  3VBF B;  2OQ7 A;  4CDX A;  3KV5 A;  4XIO A;  1S4C A;  3IPV A;  3MI8 A;  4BXS V;  4GWI A;  4K6B A;  1JZ8 A;  5FXX A;  2GMM A;  3P6B A;  1DCS A;  1LOA A;  2K2S A;  2WFF 2;  3HT2 A;  1RVF 2;  3ZM8 A;  5JUV A;  4HSJ A;  2QQP A;  2BGC A;  1L7L A;  5I0U A;  5LA2 A;  1ASJ 2;  1E57 A;  4PLM A;  1HV0 A;  5IK7 A;  2AH2 A;  1GQG A;  3GZA A;  3PVE A;  4AAX A;  1CZS A;  3N9P A;  4LBQ D;  1FOD 1;  2PN5 A;  4MET A;  3THC A;  3VHP A;  3T2P A;  1XNK A;  3HN3 A;  3I3D A;  5FZ4 A;  5A3T A;  3A7Q A;  3QH7 A;  2WS9 2;  3ZYG A;  4YFZ A;  1OUX A;  1PGW 2;  1EPW A;  4UT5 A;  5C6C A;  2JWP A;  1IKQ A;  3AJZ A;  4Q4X 2;  5D8A B;  3WF1 A;  4CDQ A;  5IVB A;  1OLR A;  2J1V A;  3I3B A;  3OBT A;  4XHX A;  1OF3 A;  1BBT 3;  4QPI A;  4YNI A;  3CJI B;  1AX1 A;  4Q4V 2;  3MW3 A;  4Z82 A;  1GP6 A;  3LD8 A;  3MLJ A;  4LE4 A;  4LOT A;  5DAX A;  3O1R A;  5LBC A;  4HBN A;  1AR8 3;  1OFN A;  2E26 A;  2D97 A;  2AEZ A;  4M01 A;  2O8O A;  3RGB A;  3I59 B;  2RDR A;  1ZM1 A;  1C57 A;  1X8E A;  3DEC A;  2FD8 A;  2D43 A;  1NG0 A;  3VL9 A;  2AC1 A;  5JPM B;  1ZA4 A;  3CF6 E;  4FXK B;  5JLV A;  3FLP A;  1VMH A;  2WUH A;  4X8N A;  5DZF A;  5GLT A;  4BCU A;  2XUM A;  1MQT A;  2J1S A;  3H1W A;  4MVT A;  1RIR A;  1JU4 A;  2WN3 A;  5E6H A;  3THP A;  1V6O A;  4XAE A;  3AZX A;  5C71 A;  1LOB A;  2VZP A;  1NE4 A;  3IKW A;  5CFC A;  4PQQ A;  4QM9 A;  1S2E A;  3J9S A;  3VZM A;  2Q8C A;  3ROU A;  2C4X A;  5FJK A;  1Z7S 3;  4AQS A;  3KVA A;  4QWN A;  2YPJ A;  1VP6 A;  3J7L A;  1CIY A;  1FI2 A;  2ZX0 A;  3WNL A;  3VZK A;  2R32 A;  3PME A;  1RUE 2;  4TSV A;  4CZS A;  2W08 A;  4AXO A;  4MGY E;  2P3Y A;  1MVQ A;  2W46 A;  5BNP A;  4WVV A;  2FDI A;  1IS3 A;  3ZN4 A;  2W1W A;  5FPL A;  5F5I A;  4AVB A;  1KDM A;  2WRA A;  3AB0 A;  2RVA A;  2W92 A;  3MF6 A;  4O65 A;  3WP6 A;  1JHN A;  1FPN 3;  4DOU A;  1VRH 3;  1O3S A;  4DUW A;  4H55 A;  4Q4W 3;  5FZA A;  5FPV A;  3TBD A;  1NXM A;  2OUJ A;  4WM8 A;  4LBL A;  3ZN5 A;  1EAH 1;  2QVS B;  3MDP A;  5HPO A;  3O1P A;  1DF0 A;  3H1Y A;  4XBN A;  5FZG A;  3JU9 A;  3N9O A;  1ZRE A;  1NCQ C;  2XBO 1;  3K4Z A;  4YM2 A;  2R0H A;  3UKV A;  5CBL A;  1RHI 1;  1X36 A;  3VZN A;  4YW5 A;  4MUV A;  1DGR A;  3JQX A;  4CCM A;  4L92 A;  4MSV A;  3IPV B;  1WLT A;  1V6N A;  1VBE 2;  2HBT A;  1Y43 B;  4YM0 A;  4HXC A;  4B1L A;  2VMD A;  3PDQ A;  4AED C;  3A4U A;  4YW1 A;  4FOY A;  2FDJ A;  1QXJ A;  1DYO A;  4P02 B;  2FMY A;  3GBG A;  2D6M A;  2NPI A;  2W47 A;  4HZF A;  4HSL A;  2OYZ A;  2CGP A;  2D7F A;  2D6K A;  2E63 A;  2D6L X;  1ULF A;  3CZU A;  4CEY C;  4Y5S A;  4L2N A;  4GWJ A;  1TNF A;  1WCU A;  2OPW A;  3QAC A;  1YC6 1;  4LR4 A;  3WDW A;  4CDQ B;  2MEV 2;  3GGL A;  4TXW A;  1VBA 3;  4FP2 A;  2RS1 1;  1C28 A;  5F6L B;  2ADE A;  3I2O A;  1CX4 A;  2NYY A;  2VZ1 A;  5K0U C;  4C1W A;  5HCB A;  2UUR A;  2VQ0 A;  4P9J A;  3I3Q A;  2OII A;  3TN9 1;  3FMG A;  1QOS A;  1PVX A;  3H8X A;  4MGT A;  3OD4 A;  4ERO A;  1Q8O A;  3PUQ A;  2RM2 2;  1I3H A;  4Y4Y A;  3BTZ A;  1Q56 A;  2VZO A;  1ZZC A;  4FTE A;  3OTF A;  3MW4 A;  2A71 A;  2JG9 C;  2IUW A;  2XJP A;  2FCT A;  2VTF A;  3LGR A;  5FY7 A;  2HH9 A;  1ULC A;  1RUG 3;  3ATG A;  2WLP A;  5I91 A;  3O5S A;  2VUC A;  3U37 A;  3GZE A;  2JJ6 A;  2EIG A;  1GQP A;  3H50 A;  1H2L A;  5LRR A;  2J1T A;  2WNE A;  3FHQ A;  1IPK A;  1RUJ 3;  5CFC B;  1R08 1;  1QGL A;  1U12 A;  1ZRC A;  2WNU A;  1KXG A;  3LEG A;  1XRU A;  5FY0 A;  1O7F A;  1XJA A;  2ZGU A;  2ZGR A;  3VHO A;  1QJU 2;  2W39 A;  2MPF A;  3PUR A;  3KZ4 C;  4AVT A;  4XMI A;  5T5O A;  3MO4 A;  3QCW A;  2DVD A;  4MHR A;  5BNP B;  5BNO A;  2CV6 A;  2VG9 A;  1HB2 A;  1LED A;  5APA A;  3HNB M;  5FY9 A;  1NYW A;  4BLI A;  4QB1 A;  5J3U A;  5F7U A;  3NJX A;  4NUB A;  1RYY A;  2A6X A;  3S6P A;  1N3P A;  4LIV A;  3WNO A;  2X10 A;  2DYC A;  2ZX1 A;  3FL7 A;  3K3O A;  5IHR A;  3ZMO A;  2QJV A;  1WGP A;  2V09 A;  3DPR B;  1FV3 A;  2GH2 A;  1NCQ A;  4GWM A;  1PHM A;  3UET A;  4YVS A;  1BMV 2;  4J1W A;  1VBB 3;  4AHX A;  5JSO A;  1HRI 1;  4V2V A;  1BK0 A;  4HFS A;  3MHZ A;  1ND3 C;  4K21 A;  1AYM 3;  5L9V A;  3LPG A;  1B09 A;  2VE1 A;  5FCC A;  4AED A;  1H1M A;  3EYP A;  1AR9 2;  4CTE A;  1UYZ A;  2QQV A;  2QNK A;  1GWK A;  5T3N A;  2ZA9 A;  1BQP A;  1GZT A;  1MAC A;  4LUK A;  2YY1 A;  4AFM A;  5J48 A;  5JZG A;  3AL5 A;  2BBA A;  4PIZ A;  3LE0 A;  4DMI A;  3V0A A;  1GU3 A;  3ZXK A;  2B7Y A;  3VUO A;  1YO8 A;  1HJG A;  2W1U A;  1W3X A;  4IE7 A;  5H9R A;  5L9B A;  3T3Y A;  4HVO A;  4UW3 A;  4BIS A;  1MZF A;  2OX0 A;  3ILF A;  5LK7 B;  3O1O A;  2Y34 A;  5J36 A;  4IND A;  2JG8 A;  4HMZ A;  4M3C E;  4C91 A;  4WM7 A;  2WQ4 A;  3UKT A;  2VY0 A;  2XJR A;  2OPK A;  4IXL A;  4JV4 A;  3VBO C;  3BUC A;  3POJ A;  1SLC A;  4YVW B;  4J1X A;  4ARY A;  1QJF A;  2QTW B;  3AP4 A;  2HWC 2;  4LA2 A;  4EQV A;  5AC9 2;  4QU2 A;  5JPN B;  3SQO A;  4UFJ A;  4O7X A;  1GZC A;  4CU6 A;  1OT5 A;  5K9Y A;  4MHU A;  2HJI A;  1V70 A;  2W3J A;  2FCV A;  1ZRI A;  3OGR A;  3QH6 A;  1GQH A;  4D7T A;  3RZJ A;  3UES A;  3S7I A;  4QXC A;  1L7Q A;  4D7Y A;  4RGA A;  1PIV 2;  2A70 A;  1VAK A;  3WF2 A;  1O5U A;  5FYI A;  4RFT 0;  4AGV A;  4MGZ E;  2JG9 A;  1GKB A;  2WZR 1;  4XFG A;  4EN9 B;  3MFC A;  4GH4 C;  1S0F A;  3NV2 A;  1UL9 A;  2BP6 A;  3IMN A;  4DRR A;  3CNA A;  4QPY A;  1CWP A;  4LIT A;  4DPN A;  1O6U A;  3OF1 A;  4NRM A;  1C5H A;  1XNB A;  5JVV A;  1JU3 A;  1OLM E;  2FZ1 A;  3KLS A;  3WOG A;  1EUU A;  3H7J A;  1J3Q A;  3AFK A;  1X9T A;  3U1X A;  3WQ7 A;  5C7G A;  4BA6 A;  3IN9 A;  3LA3 A;  3I97 A;  1SFN A;  4QKD A;  1KD7 A;  2IFR A;  2ZAB A;  4XXA A;  3CBN A;  5FMC A;  2ARE A;  3T4H B;  3WEZ A;  1SLT A;  4JQT A;  5JXG A;  1W8W A;  2WNU B;  1FT9 A;  5E89 A;  1W8F A;  4TN7 A;  3SC7 X;  4HN1 A;  4AW7 A;  2WZE A;  5J98 B;  3C7E A;  2R07 3;  5FMO L;  4BQY A;  3DYO A;  3PIJ A;  3IWZ A;  5LEJ A;  1UXZ A;  5EJ1 B;  1ZBE 1;  3H8O A;  4YG6 A;  5FZ1 A;  5BY5 A;  2ADD A;  3SHR A;  3MZH A;  3SNM A;  1OC1 A;  2WZP P;  1W6O A;  1RUI 2;  3EMR A;  3NST A;  5I0T A;  5BNO B;  1PMJ X;  1RMU 3;  2WZR 2;  2Z79 A;  1R1A 2;  5A33 B;  3NO8 A;  5I8S A;  4Y26 A;  5K7P A;  4V2W A;  4AFC A;  2WFF 3;  2LAL A;  3NAP B;  1RVF 3;  5FUI A;  1W9S A;  3WD5 A;  1WCK A;  4MOA A;  5DUU A;  3TWI A;  1Y9Q A;  2IXC A;  4RS5 C;  4JQR A;  1HRV 1;  4ASL A;  5CFD C;  1SCR A;  4Q4Y 2;  1WCS A;  1YRZ A;  2GC2 A;  2W1S A;  2VEC A;  3AKP A;  1RUH 1;  3H0O A;  1AXZ A;  4IE5 A;  2YBS A;  3ZDS A;  1F9K A;  2VUL A;  5HBA A;  3AJY A;  4Z1V A;  3AZZ A;  1Y3T A;  2D6N A;  5CYY A;  4YVS B;  4NRP A;  1JHJ A;  3VDC A;  5GZC A;  2UY8 A;  2IXH A;  2WS9 3;  3GHN A;  4CXX A;  2EID A;  4H2A A;  4IL7 A;  2IZW A;  1XNT A;  2O14 A;  1D7P M;  1W6P A;  5FP8 A;  4E2S A;  1V6L A;  1B35 A;  4CCO A;  4B7E A;  2Y6H A;  4P9Y A;  4JRL A;  4Q4V 3;  2BER A;  4PIX A;  4XEZ A;  2WKK A;  2JDP A;  4PIY A;  5JZG B;  2VNR A;  3ZLI A;  3U11 A;  1H8T C;  2CY6 A;  4FPJ A;  4Y1U A;  3POB A;  3SEE A;  1PK6 C;  3V0A B;  5FKC A;  1AR8 1;  5IK5 A;  1QIQ A;  3VBO A;  1UIJ A;  2ZMN A;  3FBY A;  2ILM A;  4COY A;  3AM2 A;  1YUD A;  3RZZ A;  3WXP A;  2JG8 B;  1AVB A;  5FRA A;  3HN1 A;  3RG0 A;  4JGY B;  1M06 G;  2BNO A;  4JVA A;  4WM7 B;  4TWT A;  1C8M 3;  2LUW A;  2EAA A;  1AR7 1;  1W06 A;  3A0K A;  3AX4 A;  3LB9 A;  2VMC A;  3K77 A;  2BZD A;  2VOV A;  1PM4 A;  3OEA A;  3G6J B;  3VV1 A;  2V73 A;  3UGH A;  3GBF A;  3M70 A;  2EVX A;  1KGY A;  2ZHL A;  3HJR A;  1VBC 2;  3IMM A;  2VCA A;  3PIG A;  4HET A;  1IKP A;  1DP0 A;  1DZQ A;  1UOF A;  3O14 A;  4P00 B;  1Z7S 1;  3HIF A;  4GH4 A;  2Y64 A;  4ZXE A;  2G19 A;  2GP5 A;  3LDB A;  1DQ2 A;  1RUE 3;  1W9F A;  3B5L B;  4AVV A;  1RGS A;  3NJY A;  4LA3 A;  1ZRD A;  1DQ0 A;  3O0X A;  2WA3 A;  5FPB A;  3AMH A;  1IS5 A;  1DQ6 A;  1VBD 2;  4ZS3 A;  1G9F A;  5DMY A;  2R04 2;  3CMG A;  3K4A A;  1PO1 2;  4LO6 B;  4N43 A;  3MPB A;  4AHZ A;  3B02 A;  4LBN A;  4KI5 M;  4CPB A;  1K3I A;  4MZU A;  3TYJ A;  3ZFE A;  2Q8D A;  4AI3 A;  3HNM A;  2VW2 A;  4GXL A;  1AX2 A;  4NHX A;  5BNN C;  3OD0 A;  4JGZ A;  1VRH 1;  2PA7 A;  1ZZB A;  5LA1 A;  2ARX A;  2L9L A;  4YZ5 A;  2W52 A;  4YGB A;  1LGN A;  4CCL A;  4NAO A;  3VBF C;  1LHV A;  2XKP A;  3ST7 A;  3VB9 A;  2BEO A;  4QX3 A;  4IEZ A;  1BEV 2;  4FXG B;  3E5Q A;  2LRO A;  3GJB A;  5LAT A;  1AHS A;  2D93 A;  2HWE 2;  2PHT A;  4RR3 B;  3RYP A;  3T30 A;  2KD7 A;  4FT8 A;  1CGP A;  1W6O B;  3E6D A;  1QY4 A;  2MHF A;  2YRO A;  1VBE 3;  2GP3 A;  2WAO A;  2TEP A;  2DDU A;  2XLA A;  3ZFF A;  3AMN A;  3R0R A;  4PI0 A;  1N3O A;  1KIT A;  3RI9 A;  1W0O A;  3OJB A;  3BTY A;  2CDP A;  1SBF A;  5HCF A;  2HEV F;  4BWO A;  1V9U 3;  1W6M A;  3LF7 A;  3WV6 A;  1KJL A;  2C9A A;  3ZMN A;  4J25 A;  4A2U A;  1WBF A;  1O8P A;  2ZKN A;  3M3C A;  2YC2 A;  4FOV A;  4G3Y C;  5D8A C;  5G05 L;  5FYV A;  3D5O A;  4EWA A;  4JHT A;  1O8S A;  2PQQ A;  1TQ5 A;  4ZZ8 A;  3CJI C;  1TVG A;  1RJ7 A;  1M4W A;  2FBE A;  3U10 A;  4COZ A;  1KS4 A;  1W6P B;  2VZV A;  3DL3 A;  4Q1R A;  1O3R A;  1SDD B;  4ZPI A;  1F31 A;  2EIB A;  4A7Y A;  4OHW A;  2YU1 A;  5F8P A;  3TEX A;  4BQ5 A;  3Q8C A;  1PK6 A;  4QX2 A;  3WT3 A;  1JH5 A;  3OYW B;  4M0H A;  1WD4 A;  1WWY A;  3S57 A;  2RS3 1;  4QU1 A;  5EFU A;  3WDV A;  5GZD A;  3ZSK A;  2DVG A;  4UAP A;  3T08 A;  1VAM A;  5FZ6 A;  1A6C A;  3N9N A;  4R9A A;  3HPN A;  3T0D A;  3LOI A;  4OLL A;  4IV1 A;  3WX5 A;  4RSU A;  3M3I A;  5A3N A;  2XWJ B;  3NJV A;  2J1U A;  5EIY B;  2Z4F A;  5I8T A;  4I02 A;  3RQ0 A;  3III A;  3WVJ A;  1HIX A;  2UY9 A;  4IEW A;  5FZB A;  1RUG 1;  3TEW A;  3FFZ A;  4P9W A;  4LBM A;  3DF0 A;  4BQ3 A;  4BM8 A;  2JB8 A;  1WCD J;  3WW2 A;  3R6S A;  1CX1 A;  1H6X A;  4P9L A;  4EN6 B;  2PFW A;  4O61 A;  1SDW A;  4LOS A;  5J7M A;  4CUA A;  1RUJ 1;  2E7T A;  5SV5 A;  1J83 A;  3J7H A;  3JBG 3;  4LJH A;  5FZM A;  2ZXQ A;  2Z69 A;  1CAU A;  1GP5 A;  2CTV A;  1NY7 2;  4NVP A;  1Y9G A;  5EQU A;  1QJU 3;  1UWW A;  3HQR A;  2VXJ A;  4L99 A;  5A80 A;  1NE6 A;  4R9C A;  4ISR A;  3POW A;  4CSW A;  2QQL A;  4GZ9 A;  4XZU G;  5KC6 A;  1V6J A;  1RL3 A;  2SLI A;  2RG4 A;  4A4A A;  5FLI A;  3LKJ A;  1NKG A;  1OD5 A;  2YXS A;  4QXH A;  4E4Z A;  4N43 B;  1WW5 A;  2A7A A;  5BNN A;  5JXH A;  3RZH A;  1C4R A;  3AP7 A;  1QQP 3;  1U5Z A;  3OUH A;  4LUL A;  3ZYF A;  3ZFE B;  4M0N A;  2VNG A;  1YLL A;  1T6G C;  1W8T A;  1OFS A;  2A3Y A;  1R09 1;  4JGZ B;  2QKD A;  5F3I A;  2PLV 1;  2P5B A;  2JDH A;  2Y6F A;  2EAL A;  2OUH A;  3IM0 A;  1W6Q A;  3B3Q E;  4L9B A;  3W21 A;  3WQ1 A;  4AGG A;  2FDK A;  2WQ8 A;  1MS4 A;  1HX6 A;  1X82 A;  4MX3 A;  2OZJ A;  1XNA A;  4XTM A;  1JW6 A;  1BXH A;  3AXD A;  2VOT A;  5E8A A;  4NN0 A;  4MXW A;  4XQ4 A;  2DVF A;  4WBB A;  1CAW B;  3OY8 A;  2G9G A;  1SFY A;  1X7N A;  3D0J A;  3VDB A;  1OUR A;  4BIO A;  2UU8 A;  2DUO A;  3P3P A;  4W4Z A;  4RHV 1;  1LOF A;  1TMF 2;  1UMZ A;  2BOJ A;  2D5H A;  1LHO A;  2JD9 A;  3HAG A;  4GMP 3;  4IGO A;  4BQ4 A;  3ES4 A;  1N1Y A;  1UW8 A;  5LW9 A;  1VRB A;  4MGS A;  1URX A;  2HWD 1;  4E4D X;  2D40 A;  1HLC A;  3ZIX A;  1GWM A;  3NV4 A;  5BXX A;  1V0A A;  1CJP A;  1WW6 A;  4BQ2 A;  2GNM A;  2IVI B;  5IVV A;  5FMD A;  5J09 A;  3FN9 A;  4Y1Y A;  2FCU A;  2Y8K A;  2WA4 A;  4CDQ C;  1EUT A;  5DAQ A;  2OQ6 A;  1X33 A;  2BUK A;  3VGI A;  1VB4 A;  2AYH A;  4K3U A;  1BYH A;  1ODM A;  4MLO A;  4COU A;  5AC9 3;  2H6B A;  5JCT A;  3IB3 A;  2HWB 2;  2P3I A;  1FXZ A;  4AR2 A;  4NIG A;  1AR6 1;  5FYB A;  3B9C A;  4QX5 A;  2PMW B;  1XC6 A;  2R6Q A;  4FI9 A;  3UGG A;  4IEV A;  2ZGS A;  3VD7 A;  3K51 A;  3WW3 A;  2ETE A;  3Q8B A;  3DN7 A;  2ZX3 A;  4Q27 A;  4RL7 A;  5IW0 A;  1PZ9 A;  2YG0 A;  4QB6 A;  5A7S A;  2Z2S B;  5A6Q A;  1ULG A;  2GNT A;  3WG1 A;  4IV1 B;  1S1A A;  1NLQ A;  3HT1 A;  1LOG A;  1UPS A;  4QPW A;  3JQW A;  1UOJ A;  3VKL A;  2UWB A;  2RR1 2;  4W50 A;  5CFC C;  4D0Q A;  5C3R A;  1N1V A;  1ZBA 1;  2JXA A;  3WP4 A;  3NQH A;  1GMM A;  3E6B A;  1BHG A;  2VOX A;  2GC3 A;  1PX4 A;  1QJX 1;  5FZC A;  1NX9 A;  1YHF A;  2WYF A;  2G9F A;  1QMJ A;  4XBQ A;  2OA2 A;  4TYS A;  1JUH A;  4NRQ A;  3X29 B;  4BMB A;  1SHW B;  3FFQ A;  1CAU B;  4XC9 A;  5CU1 A;  4BYY A;  4P9I A;  2HWF 2;  3K48 A;  4KWU A;  5BNP C;  1AR6 2;  3W9A A;  4LKE A;  2ORX A;  1EV1 2;  3LAG A;  1QJY 1;  4QQL A;  3RZG A;  2CHH A;  5FZH A;  4NPL A;  1JYW A;  3M3Q A;  4CE8 A;  2JDZ A;  1RUI 3;  4HPK A;  4AZZ A;  3POI A;  5J96 B;  4FOQ A;  4GB3 2;  5FWE A;  4GUL A;  1R1A 3;  2Y33 A;  3MIC A;  3NWK A;  1NQJ A;  2Q4S A;  1RMU 1;  1COV 2;  4JDO A;  3UJQ A;  3DPR C;  3A22 A;  3NL1 A;  1H2M A;  1PZ7 A;  3QOP A;  2P6H A;  2ZGK A;  1ONA A;  1XXN A;  3W58 A;  3WNX A;  2P34 A;  5LAS A;  5GZF A;  3ZXL A;  1D4M 3;  1FAY A;  1YQC A;  3ZSE A;  4URA A;  5A7W A;  2HEY F;  1QXR A;  4QX1 A;  3SIT A;  4NHL A;  5FIX A;  2A6Z A;  2XQX A;  1TME 2;  1W6Q B;  5DDJ 3;  1QJX 2;  3VKM A;  2YU2 A;  2R49 A;  3D6E A;  3VN4 A;  4ZXK A;  3TEY A;  1AUY A;  2GND A;  1POV 3;  4A7Z A;  2VJX A;  4NRO A;  2VAU A;  3OPT A;  4MXW B;  4RYD A;  3M3O A;  1SFP A;  3OY8 B;  3WDU A;  5IAV A;  5BNQ A;  2YGL A;  4LOR A;  5A6X A;  5CEH A;  2P4E A;  1GNH A;  3ZFG B;  4S2H A;  3PJY A;  2WO1 A;  4XJ8 A;  3MV1 1;  5JOX A;  4K1Z A;  2A75 A;  4CCC A;  4F7Z A;  5LB6 A;  1W9W A;  2XJT A;  1H30 A;  4KMQ A;  2RS5 2;  5CB7 A;  5L19 A;  4LK6 A;  3VZJ A;  1ND2 A;  3ZDV A;  4YVW C;  5FP7 A;  2XB6 C;  5AVA A;  3HNY M;  2WWS A;  1UZY A;  4SLI A;  4B1M A;  4GKX A;  4UXA A;  4XJ9 A;  3LPF A;  2JE7 A;  1N3Q A;  1FX5 A;  4Q0P A;  4XFF A;  1US2 A;  3HQX A;  5A32 A;  2DCZ A;  1PNG A;  5ABJ A;  1YFU A;  2QQM A;  1QF3 A;  1IS6 A;  3J8F 1;  1JOJ A;  4R9B A;  4JTO A;  4PBP A;  4CXW A;  2XML A;  4DY3 A;  5C8W A;  4FO9 A;  3SCF A;  1APN A;  2IXL A;  1W2T A;  2Y6J A;  1FOD 2;  1PMI A;  2Q1Z B;  2W0X A;  2XJV A;  4H7M A;  4O9G A;  1QOO A;  3VHR A;  1F15 A;  3I2H A;  4W6W A;  1XB9 A;  1ZZ9 A;  2ATF A;  2H6C A;  3OGJ A;  4TLG A;  4XQW A;  3ZN6 B;  3D82 A;  5FLH A;  3FE5 A;  1VBD 3;  3MBW A;  2R04 3;  2VZ3 A;  1PO1 3;  3WF3 A;  4OQ9 A;  5FZO A;  2PHX A;  1ZYB A;  4C8D A;  2G4I A;  5I8Y A;  3M3E A;  1RJ8 A;  2YMZ A;  3GZT B;  4A45 A;  2FDG A;  2WNU C;  4BXF A;  3GDB A;  4KWJ A;  2PHR A;  1LEM A;  1GIC A;  4I0W B;  1K42 A;  3KGZ A;  1AJK A;  2R06 3;  3FHI B;  1ODN A;  3W20 A;  1O4T A;  4YZ2 A;  3BPS A;  3KCC A;  1X8M A;  5IWF A;  5CKQ A;  1WBL A;  1IG3 A;  1RUC 1;  2K46 A;  1HW5 A;  5FJH A;  5FV3 A;  5FYY A;  3WNP A;  5FWJ A;  1BEV 3;  3T2T A;  3THD A;  2Q8E A;  4D6S A;  3EO6 A;  5A1L A;  2D6O X;  4W8J A;  5BNO C;  1J58 A;  2IWG B;  5L7O A;  4NPM A;  2HWE 3;  4JAA A;  3NAP C;  4BLJ A;  4BME A;  2OXB A;  2XJQ A;  4OI4 A;  1AL2 1;  3UGF A;  2V5D A;  1GNZ A;  1O4Z A;  2Q1M A;  2NZ9 A;  1I9R A;  3DPR A;  1YQ2 A;  4HPK B;  1DFQ A;  2XHN A;  2OKX A;  2R16 A;  1IHM A;  3OSD A;  1CZT A;  2TBV A;  1GOG A;  3CKH A;  4B7K A;  4OHX A;  4ZY9 A;  4YW4 A;  5FQ0 A;  2JKB A;  3H3L A;  2D3P A;  4CU9 A;  3WUD A;  2AR6 A;  4YVS C;  5FDB A;  4NII A;  4LNV A;  2VXR A;  4A42 A;  1XPW A;  3BGA A;  3PVO A;  4RHV 3;  5A7W B;  4N53 A;  5FZD A;  3ZR5 A;  2I2S A;  2DCK A;  2AEN A;  4LBO A;  3WF0 A;  3M4F A;  2XVK A;  4GJY A;  3I3M A;  1P8J A;  1W3V A;  1UY3 A;  4MAD A;  1PO2 1;  4AI8 A;  4M00 A;  4AGR A;  3MEP A;  3CLP A;  3FBM A;  4WVZ A;  2C6S A;  2VW1 A;  3DKQ A;  3AMP A;  5DAW A;  3LA7 A;  3ZIW A;  2BJS A;  2ZZJ A;  5JZG C;  3OGV A;  5JOW A;  3PLQ A;  3AYC A;  1JZ2 A;  1LNS A;  1CES A;  4CCN A;  1UY2 A;  2WII B;  2YFZ A;  4QHB A;  5FY4 A;  1JOB A;  2FHR A;  4LHL A;  1RUF 1;  5EXO A;  4ZU4 A;  2NLR A;  3VL8 A;  1G9D A;  1RUD 1;  2ERF A;  2ZBJ A;  1SG3 A;  2AEY A;  4CUB A;  4YVW A;  4FFG A;  4ZHN A;  3O1U A;  2VMH A;  2JG8 C;  1EAH 2;  1OI6 A;  3OCP A;  4LO4 B;  1ASJ 1;  5DUX A;  4WM7 C;  1WMD A;  1OH4 A;  1HXS 3;  4YPJ A;  3SLI A;  3WDY A;  1ND2 B;  4XXP A;  5JAX A;  2XBO 2;  2KR2 A;  1RHI 2;  2YPD A;  3GZU C;  2VGD A;  1S55 A;  2I07 B;  4LKS A;  3V65 A;  4I30 A;  3BOW A;  5A32 B;  3K2O A;  5ABJ B;  3CL1 A;  3MYX A;  4Y33 A;  4UFL A;  2E7A A;  2Q30 A;  3OBZ A;  1F35 A;  2RMU 1;  4NOT A;  5C3Q A;  4Z07 A;  1JI6 A;  3W59 A;  4Q0V A;  4NHK A;  4IEX A;  1STM A;  2JDM A;  4AVA A;  2DVB A;  4EYU A;  5KBF A;  2B39 A;  2RDQ A;  2NP0 A;  2Y0O A;  5EYY A;  1PMH X;  3JBG 1;  1QJZ A;  2ZAC A;  3SH5 A;  5JWP A;  1V6K A;  3ZPO A;  4DS0 A;  4NHM A;  2D98 A;  3I2I A;  2BVB A;  5LEK A;  4N90 A;  1RUF 2;  4BOW A;  1S2B A;  4I01 A;  5C70 A;  3N7L A;  1LAJ A;  4FPY A;  4PHZ A;  3ZSM A;  2I45 A;  1YFX A;  2JB4 A;  5LA9 A;  3UKN A;  2F4P A;  5IAX A;  4X6R B;  5CG9 A;  3TB0 A;  5FZ9 A;  4XDP A;  5FZO B;  4LKF A;  4CPB D;  3I2F A;  3NNF A;  5H9P A;  4AQ6 A;  5FR3 A;  1LEC A;  3HOB A;  4IES A;  5F9T A;  2ZKL A;  5F1R A;  5CNA A;  2DBN A;  2RS1 2;  2B4K A;  4XBL A;  1QQP 1;  2WLQ A;  1QHD A;  3NW4 A;  2R30 A;  4HKW A;  4XF1 A;  5T52 A;  1AYN 3;  3FUO A;  3TN9 2;  1LGC A;  5CZK A;  3Q9O A;  4QQO A;  5A33 A;  5C9A A;  4YGD A;  4RR3 C;  1HQL A;  3EXU A;  1LR5 A;  3NAP A;  5LBF A;  4Q8L A;  3CIH A;  3MIE A;  3S7E A;  3J26 N;  3ACF A;  5K8S A;  2CWS A;  2VW0 A;  3E1F 1;  3RDI A;  1OMI A;  1DZT A;  5L7O B;  4LQR A;  1VR3 A;  2IC1 A;  2LRP A;  2AGS A;  3PUI A;  4YW3 A;  3UV9 A;  3PUA A;  4QGM A;  2OVU A;  5FBJ A;  1E5H A;  1UMH A;  1RXF A;  3CEW A;  4E4S A;  1W9Y A;  1R08 2;  2QBX A;  4I3G A;  5FQ0 B;  3U4X A;  1AXK A;  1OQE A;  2ZGL A;  1LB2 A;  4AOC A;  1DQ1 A;  4CU7 A;  2ET7 A;  3KQ4 B;  4LBK A;  3T1L A;  3RYK A;  5CA6 A;  2O8Q A;  4N53 B;  2PAK A;  4LKD A;  3NRU A;  5DZG A;  2HLE A;  2VZT A;  1B35 C;  3JD7 3;  3IDE A;  5B4X A;  2WDB A;  4XMA A;  2FDH A;  1FMD 3;  2ENR A;  1O5L A;  1WLC A;  5GLV A;  2VNO A;  3ZFG A;  4YZ4 A;  4XUT A;  1UD1 A;  2XJU A;  3T09 A;  4CVU A;  5C3S A;  3V0B A;  4NIH A;  2W91 A;  1CPM A;  2BW8 A;  5GZE A;  1A78 A;  1XU2 A;  1HDK A;  3Q8A A;  1DQ4 A;  3R4S A;  2W94 A;  4IEP A;  4JGY A;  4P5Y A;  4PT6 A;  5DUW A;  5F5C A;  1PGL 1;  4RQP A;  5A3O A;  1JYT A;  3I49 A;  4D69 A;  4OUL A;  1UKG A;  3TOJ A;  3AXE A;  2P6C A;  5FMB A;  2TNF A;  5L9R A;  4DO0 A;  2GDF A;  1HRI 2;  4URT A;  1QXP A;  3MIF A;  2WL1 A;  2WO7 A;  1NA1 A;  3AYD A;  1XE8 A;  1LU1 A;  4MXV A;  2YDE A;  4UBG A;  3KD4 A;  4DRV A;  1O3T A;  2RR1 3;  3KWV A;  1J3R A;  1SLL A;  5KHK A;  2EXJ A;  1RUN A;  1HJF A;  3MF9 A;  4ET7 A;  3WCS A;  1GUI A;  1U5X A;  4CDW A;  4Z2W A;  5J37 A;  1CAV B;  3M7A A;  2VBB A;  4CU8 A;  1UZZ A;  3ALQ A;  5FOB B;  2VMI A;  2LS6 A;  1NQD A;  3PVB B;  3B94 A;  3DKW A;  3K46 A;  4TTG A;  3ZVX A;  1AJO A;  1J84 A;  4Y22 B;  3C7H A;  4JTN A;  1OBN A;  4CCD A;  5CKM A;  3BCW A;  1S0D A;  2WBK A;  4N43 C;  2XH6 A;  5C5T A;  3ACI A;  3GHM A;  3H9A A;  4GAL A;  1QH7 A;  4LHK A;  1PVC 3;  2X09 A;  4GB3 3;  3ZFE C;  2V4A A;  2XG3 A;  5FZ8 A;  3WLU A;  2VOK A;  1C1L A;  3C3V A;  3C7F A;  3ON7 A;  1W2A X;  4KNC A;  4JGZ C;  5JSP A;  4AVC A;  2BGO A;  5KWR A;  3BU7 A;  3I4I A;  4ZKT B;  3WNN A;  4K8R B;  2YBK A;  2WYS A;  2GNB A;  3MID A;  2ZEZ A;  4FTS A;  2V72 A;  1WCQ A;  2DCT A;  1K45 A;  3OPZ A;  4RR3 A;  5ACA 1;  4V1P A;  3H8R A;  2WNV A;  3IDA A;  4P9X A;  1MEC 1;  1TME 3;  1XE0 A;  5C9A B;  1ULO A;  4YRD A;  1W8O A;  1UU4 A;  4UOJ A;  4XUP A;  3BI3 A;  2VVF A;  4FP3 A;  5DDJ 1;  4CCJ A;  4LHS A;  3N9L A;  2DFC A;  3KT7 A;  3RJR A;  5KXD A;  2VM9 A;  5C3P A;  1ASJ 3;  2VH9 A;  3ORJ A;  3AYA A;  1HN0 A;  2DUQ A;  3ZFF C;  1POV 1;  3DGT A;  4E4H A;  1QEX A;  1MPX A;  5HI0 A;  3FZ3 A;  3FJS A;  3ZO0 B;  1LRH A;  5FY1 A;  2WAB A;  3WHU A;  1UU6 A;  2PTM A;  1CD3 G;  4F8A A;  3IIA A;  2Y6G A;  4CCK A;  2VR4 A;  2A3X A;  3E5U A;  1W0N A;  5A7O A;  1C5I A;  1W2U A;  1GZW A;  1NOV A;  5IVJ A;  4Q4X 3;  3JZV A;  2ID4 A;  2W5F A;  4R4X A;  4D6R A;  4DIQ A;  3PU3 A;  1F8V A;  1VMJ A;  2JEC A;  3RMX A;  4XFH A;  5FPZ A;  5KXB A;  4ZU7 A;  4HG6 B;  5BV6 A;  5FO8 B;  5FZ3 A;  1ZBE 2;  1S0C A;  5HXV A;  3OYW A;  1BBT 1;  1OUS A;  3MUY 1;  4HOO A;  3LIH A;  3W5M A;  4P5H A;  5KC5 A;  4IQP A;  5FP3 A;  4UFH A;  1JYV A;  3V0B B;  1W2O A;  5FZL A;  3PVN A;  3HD8 B;  4A44 A;  5JR2 A;  1XBF A;  4U2A A;  5IVC A;  1O3Q A;  3H8U A;  5LCW L;  3OPW A;  3RWN A;  3ACG A;  3N7M A;  4AQ2 A;  2P37 A;  1HRV 2;  2W2I A;  2J1E A;  5EPA A;  3IDC B;  3SH3 A;  4OCT A;  3N9M A;  1AZD A;  4KQ7 A;  1RUH 2;  1AL0 G;  1W8Z A;  3V64 A;  4RQP B;  4IV1 C;  3AKS A;  4C0H A;  1WW4 A;  2XLG A;  3CQO A;  4D94 A;  4LBQ B;  2DTW A;  2JE8 A;  1W99 A;  4MO3 M;  2ZGP A;  5EHD A;  5A3W A;  5CAD A;  1ZA7 A;  1UX7 A;  5F3C A;  1W28 A;  3K75 B;  3ILN A;  5E88 A;  3AL6 A;  1NA1 B;  2A6V A;  3TRS B;  4YG3 A;  4HKL A;  3K4D A;  4HLT A;  4LPL A;  2EF6 A;  4FBF A;  4DXT A;  2VCM A;  5FP9 A;  1KRI A;  1DQ5 A;  1Q8V A;  1TEI A;  2K0G A;  4CDW B;  3BB6 A;  1S0I A;  3H3U A;  3GXU A;  1I6X A;  3VD4 A;  1R64 A;  2ZOE B;  3DXU A;  3GJA A;  1AR8 2;  2R06 1;  2YC0 A;  3I2K A;  3ACH A;  2WSV A;  2BWA A;  3RZL A;  1CPN A;  2WFP A;  2V4V A;  3QLQ A;  5HCA A;  1YNA A;  1TZO A;  3UJO A;  3MLL A;  5DAP A;  3RFR A;  4AL9 A;  3NNM A;  1FPN 1;  3KM5 A;  4Q8K A;  3IT8 A;  4S2G A;  2D3R A;  4KBB A;  5KHH A;  1AR7 2;  2DUR A;  4ATF A;  2YV8 A;  4Q4W 1;  1OA2 A;  2KXL A;  1OXC A;  5DPN A;  4FQ4 A;  3DXT A;  5FZK A;  2DFB A;  3WW1 A;  1QKQ A;  4OVE A;  4YM1 A;  4DXR A;  1WMF A;  1REF A;  4NWW A;  3FC0 A;  1JMU B;  3Q8F A;  4XET A;  1Z7S 2;  3APB A;  5HV0 A;  2VMF A;  1CAW A;  3CDZ B;  2PHD A;  2WNV B;  4LO5 B;  2XXZ A;  5IVF A;  2BYV E;  2ZGQ A;  1KFU L;  4LMF A;  4OHY A;  4N9I A;  2GSY A;  4Q0Q A;  4U36 A;  4XUR A;  4E8C A;  3VDD A;  3LEK A;  4GKY A;  1OOP A;  3HEI A;  3ZFG C;  4UW4 A;  1LOF C;  1G86 A;  1SQ4 A;  1W2N A;  1A3K A;  4HKO A;  1EP0 A;  4K8F A;  4UI9 L;  5F3G A;  3WDT A;  2VZQ A;  1HQW A;  2XQR A;  3NKT A;  5F32 A;  3ZYP A;  2VTX J;  1Q3E A;  5FTT C;  4XJA A;  3LQC A;  2XWB B;  2BV4 A;  4IDZ A;  1VRH 2;  4NO4 A;  3B93 A;  3RRD A;  3I7D A;  5JI9 A;  4HAN A;  3N4M A;  3AVS A;  1EAH 3;  4QKN A;  4XFB A;  1GZW B;  2E31 A;  3WDX A;  5KHJ A;  3ZXG A;  4DB5 A;  4PLN A;  4R4Z A;  2MEV 3;  4XCA A;  2XBO 3;  3ZX7 A;  4HVR A;  2R0F A;  1W6N A;  4UF0 A;  3OBA A;  1HXS 1;  5HXM A;  3OG2 A;  1WUV A;  2WT2 A;  4KGQ A;  4XJW A;  1WZX A;  1VBA 1;  2HYX A;  2IFW A;  4Z2A A;  1G9B A;  2ARC A;  4PBO A;  2ORZ A;  4N7U A;  4BJ0 A;  1GYK A;  1C1F A;  3DYM A;  5J1X A;  2B46 X;  2ZAA A;  2RM2 3;  4XFA A;  2BU9 A;  2F6B A;  1JYI A;  1MR5 A;  4N8M A;  2ZCW A;  1DGR N;  1VJ2 A;  2HKX A;  5FPU A;  4Y20 A;  2RDS A;  1LHN A;  4R52 A;  1UN1 A;  3S0M A;  3NMB A;  1DIW A;  2CSG A;  1YI9 A;  2FDF A;  4FFI A;  4NWV A;  4XAC A;  4IGP A;  5G04 L;  1UZV A;  1XU1 A;  5I93 A;  4XOG A;  3USU B;  2FQP A;  3KF5 A;  4QD2 A;  1JYX A;  4DQA A;  1VAL A;  4PDW A;  5BUV A;  1ZRR A;  2RHP A;  3FX3 A;  4MGQ A;  4IE4 A;  4MG2 A;  2Y6K A;  3C2U A;  2X29 A;  1AX0 A;  4LO7 A;  1HV1 A;  3K3N A;  3OEB A;  1CJD A;  3KT4 A;  3BYW A;  5DXD A;  2HBU A;  2CAV A;  4FVV A;  4D6Q A;  5IVE A;  5LA0 A;  4BE3 A;  1MS8 A;  3S5Q A;  1EPZ A;  5LZ6 A;  2RS3 2;  3SKV A;  3J7M A;  1SBE A;  3NV1 A;  4XDO A;  2BWC A;  1Z78 A;  1W04 A;  2A1X A;  1AYN 1;  4FPC A;  3OUI A;  4XJZ A;  5FO7 B;  1Q8Q A;  2VPV A;  3MLK A;  4HT1 T;  5B4N A;  4XAA A;  5FBZ A;  1SCS A;  2BGP A;  2D6P A;  1QJE A;  1AXY A;  4YSF A;  5A3L A;  3KV4 A;  5FO9 B;  3GCX A;  4FFF A;  3KT1 A;  1W8U A;  2KA3 A;  3AZV A;  3EHK A;  3POF A;  3P3N A;  3ZSJ A;  3JB8 A;  3LEI A;  1RUG 2;  2WWU A;  4QPG B;  5IUQ A;  4HN0 A;  1RUO A;  4BQX A;  2PAM A;  3AYE A;  3KMH A;  4OMD A;  1XYN A;  2W87 A;  2Y26 A;  1N1T A;  3VBR B;  5L36 A;  3VLB B;  5FZ0 A;  1RUJ 2;  3W5N A;  5JR7 B;  1E5R A;  1OSG A;  3I8T A;  1VBB 1;  5FZI A;  3PUH A;  1JOD A;  1TG7 A;  4QX8 A;  4QHZ A;  4HK9 A;  2MNG A;  1AYM 1;  3O1M A;  1AR9 3;  1KEX A;  1IZ3 A;  4QKB A;  3U0Z A;  4RFR B;  2K9Z A;  2PHW A;  3U07 A;  5HV4 A;  5FYM A;  3D8C A;  2VMG A;  5F6K A;  3JD7 1;  3AMM A;  3FWE A;  2CGN A;  4KGG A;  1NLS A;  4S2F A;  1FMD 1;  4H7L A;  4QB2 A;  5A7Q A;  3VDD B;  1OOP B;  3WSO A;  4B29 A;  2QFE A;  2H0B A;  4IER A;  4XIK A;  5FYZ A;  3ZYH A;  4Y1V A;  5LK5 A;  4QX7 A;  3URF A;  3WG3 A;  2C26 A;  3V56 A;  4K9S A;  4XZP A;  5T5J A;  4O9E A;  2GN7 A;  1R09 2;  1ND2 C;  5GM0 A;  3GCW A;  2UWC A;  2PLV 2;  3KVB A;  4AE2 A;  2C1F A;  3AZY A;  1H8V A;  1ULD A;  3T1M A;  1T6B X;  3A0N A;  2X53 S;  2VTX A;  2HWC 3;  4XVH A;  1D2Q A;  2BTV C;  3IAP A;  1NT0 A;  1QNW A;  1CAX B;  1OLQ A;  1W6N B;  4UF0 B;  5ABJ C;  5EWS A;  4BPZ A;  1W0P A;  4LXL A;  5JSR A;  5LWB A;  1PIV 3;  1VB2 A;  2VO5 A;  3PMS A;  3GYD A;  3T0B A;  2JDK A;  3M8L A;  4IET A;  1YQ8 A;  1H1I A;  1O59 A;  3O1S A;  1YIP A;  2TUN A;  3NNG A;  1UZW A;  3AKQ A;  2WZ8 A;  4RHV 2;  3ZN6 A;  3LOB A;  2W1Q A;  3VD3 A;  4BB3 A;  3DV8 A;  3C7O A;  2HWD 2;  2QUO A;  4DFS A;  1K5M B;  2VQU A;  4AF9 A;  4Y20 B;  4MGK E;  2BFU S;  2E33 A;  3ETQ A;  2DBI A;  1SLB A;  5C33 A;  5IT6 A;  1H4G A;  3E6C C;  3LIG A;  2PQS A;  1H8T B;  2RJL A;  1L7R A;  2B42 B;  5SV8 A;  1FNZ A;  1WA6 X;  2QZ3 A;  4JX0 A;  4EV0 A;  1YI7 A;  5EJ3 A;  2ZGM A;  1QDO A;  2EXH A;  2P17 A;  4A7K A;  3S5A A;  3HQU A;  1NCR A;  4J6G A;  1DBN A;  1PVC 1;  2JDN A;  4PDW B;  4XUO A;  1D0H A;  1ZZ8 A;  3KV6 A;  4JDM A;  4QXB A;  1FAT A;  2CWM A;  2QQO A;  1LU2 A;  4JCK A;  4YYO A;  4OQ8 A;  2O0O A;  4YAR A;  4P08 A;  4Z92 B;  4COW A;  1LGB A;  2R07 1;  1TNR A;  2E7Q A;  2JD4 A;  3WY6 A;  4BHP A;  4CRQ A;  4DXZ A;  2WWJ A;  4DXS A;  5A1A A;  5JOY A;  2P1B A;  2WZR 3;  2WO3 A;  5L7O C;  1UY0 A;  1DU3 D;  2VC9 A;  2ZGT A;  1NLR A;  2PXJ A;  4KH9 A;  3DUI A;  3LFI A;  3B69 A;  3BPZ A;  5IVY A;  1GWL A;  2VQT A;  3LCP A;  1XE7 A;  2WFF 1;  4Q4Y 3;  3T2Q A;  1RVF 1;  3ZPY A;  1JZ6 A;  5DN2 A;  1Q8S A;  3BTX A;  3CJX A;  1YJK A;  1ZBA 2; 
#chains in the Genus database with same CATH homology
 3H8O A;  3RZL A;  5DAB A;  3BTY A;  4ZS2 A;  3RZM A;  4CXW A;  2FDI A;  4NJ4 A;  4IE6 A;  4JHT A;  4IE5 A;  3O1M A;  4NIG A;  4QKB A;  4RFR B;  4NRP A;  3KHC A;  3BKZ A;  4IE0 A;  3KHB A;  4CXX A;  5F8P A;  3S57 A;  3H8R A;  3O1P A;  2FDG A;  3BI3 A;  4IDZ A;  3BU0 A;  4QKN A;  4IE7 A;  4NRQ A;  3T3Y A;  3O1O A;  4NPM A;  4O61 A;  2FDJ A;  3O1S A;  3T4V A;  3BUC A;  3RZG A;  4NPL A;  3O1V A;  3LFM A;  4O7X A;  4NII A;  3RZJ A;  2FDH A;  4NIH A;  3RZH A;  2FDF A;  4ZS3 A;  3I2O A;  3I3M A;  3S5A A;  4OCT A;  4QKF A;  3I3Q A;  4QHO A;  3O1T A;  3I49 A;  3O1R A;  3H8X A;  4MGT A;  4NRM A;  4MG2 A;  4IE4 A;  3BTZ A;  4CXY A;  2FDK A;  4NRO A;  4NID A;  3RZK A;  2IUW A;  2FD8 A;  4ZHN A;  3O1U A;  3BIE A;  4QKD A;  3T4H B;  3BTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...