3O1UA

Iron-catalyzed oxidation intermediates captured in a dna repair dioxygenase
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
202
structure length
202
Chain Sequence
EPLAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMSVAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLCQRAATAAGYPDFQPDACLINRYAPGAKLCLHQDKDEPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGIQPLKAGFHPLTIDCRYNLTFRQAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-ketoglutarate-dependent dioxygenase AlkB
publication title Iron-catalysed oxidation intermediates captured in a DNA repair dioxygenase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 50
structure length 202
sequence length 202
ec nomenclature ec 1.14.11.33: DNA oxidative demethylase.
pdb deposition date 2010-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 3o1uA00
4O61A 4QKFA 3BI3A 4NPLA 4CXXA 4NRMA 3O1PA 3O1TA 4NIGA 3T4VA 3O1OA 3BIEA 2FDGA 4QHOA 4ZHNA 4ZS3A 4NIHA 4MGTA 3I3QA 4IE4A 4QKNA 3O1SA 4CXWA 3O1UA 3RZHA 4O7XA 4NPMA 3S5AA 4CXYA 3O1VA 3S57A 3H8XA 3KHCA 4NROA 2FDKA 3RZLA 3T3YA 2IUWA 3BTYA 3I3MA 2FD8A 4NRQA 3RZKA 4ZS2A 3LFMA 3O1MA 4IE7A 3BKZA 3RZMA 4IE6A 5DABA 4MG2A 5F8PA 3RZGA 3BTXA 3BTZA 3BUCA 3O1RA 3I2OA 3I49A 4IE0A 4NRPA 4IDZA 4JHTA 4IE5A 3BU0A 4NIIA 3KHBA 2FDJA 3RZJA 4NJ4A 4OCTA 2FDHA 3T4HB 3H8RA 2FDFA 4NIDA 3H8OA 4QKDA 4QKBA 4RFRB 2FDIA
chains in the Genus database with same CATH superfamily
1NXD1 1WKYA 3ZSJA 4CP9B 1DLCA 1O4ZA 3HBKA 3HBZA 1FMD3 2Y60A 1RMU2 2JG8B 1Y3TA 2WL1A 4Q1RA 1QDCA 3BIEA 4JDOA 3E5XA 1DHKB 1NLRA 1L7LA 1VAVA 4XUQA 5FY5A 3IIIA 3P3NA 5A6YA 3V0BB 3CHXA 4XXPA 5FWJA 4QQHA 2XLAA 3WDXA 4NUBA 4CCEA 1WW4A 2C0ZA 1XBFA 4GZ9A 1HLCA 3UJOA 4RL7A 2VMHA 3EJKA 4N53B 4DXSA 3EBRA 1V00A 4XETA 4BMBA 1O3TA 1QNYA 4HFSA 4RGGA 1W9TA 5A7QA 1GZWA 2P3KA 4AGRA 1LHVA 3BU7A 3VDBA 5DN2A 3BPSA 5FZBA 2VNOA 3WDYA 4DXRA 4RHV2 2WO1A 2XLFA 4BIFA 2PHDA 3NW4A 5A33B 2ZCWA 3NKGA 2VCBA 3GZEA 2ZGRA 1LB2A 2O8QA 1JZ5A 2C24A 1OD5A 5F2SA 4A7YA 3B93A 5LCWL 2Z42A 4P08A 4QX1A 4A6OA 3BODA 4CXYA 5C8CB 3O5SA 1GKBA 2B45X 1MS0A 5E16A 1PGL1 5DDJ2 3KZ4C 1PZ7A 4AZZA 1MACA 3VBOC 1LEDA 2P17A 4JCKA 2R7EB 1RUG1 2D6LX 1RUH3 2VOXA 2YROA 3AKQA 3K4AA 4GH4B 5FZ7A 1QQP2 5A7OA 1NQJA 2WYSA 4IV1B 3AMQA 1LULA 4UBGA 3VBOA 3OJBA 4SLIA 3I3MA 3FE5A 2CAVA 1POQA 2DU0A 4W65A 1J58A 2VOTA 3L2HA 2H6BA 4CPBD 3WNNA 4ET7A 3N9NA 1JN2P 1HJGA 3B69A 4AFCA 2CAUA 4Z2AA 2UURA 4WZCA 1CWPA 4YVSB 5FY9A 4META 4BQ1A 2ENRA 3ZYJB 1RUH1 3P6BA 3ETQA 4DUXA 2GMEA 2XGXA 1P8JA 3VD4A 1RINA 4TLGA 5I0DA 2XMLA 1JYCA 3I54A 5D1IA 1NQDA 3KVAA 4HN1A 4FFGA 2ZHMA 5IVVA 4H7LA 2VZPA 4LHKA 4QPGC 1F4HA 2DCKA 1EAH2 1AR81 2V5YA 1IPKA 2WINB 2ZX0A 3T2TA 1QU0A 3TRSB 4UFKA 1AVBA 3HD8B 5E88A 5FMCA 1XC6A 3K2OA 4Q2FA 4GWJA 2HKXA 3POSA 3SCGA 2ORXA 4CCCA 2LTNA 2ZEWA 2WNVC 3HJRA 3WW2A 1I3HA 1TNRA 1WMEA 3G7DA 4Q4W1 3GZTB 3TEXA 1UD1A 2WIIB 1N3PA 4YZ1A 4IE5A 1RUE3 1B35A 4CYDA 1MS4A 1S0CA 4AI9A 3O0VA 2R16A 3M70A 4AAXA 2JDZA 4PQ9A 2FDJA 2YV8A 4ZU7A 2GC3A 1HRV3 4IESA 4JGZC 2NLRA 1UYZA 5C3RA 5C70A 5A1AA 3PVEA 3NAPB 1LOFC 1RUI3 5GM0A 1NCRB 4LITA 4N7IA 3POWA 1RUE1 4NIDA 2NP0A 2VZ3A 1K5MC 1KJRA 5C5TA 4XJ9A 4QKBA 3MDPA 1VB4A 1VBB2 3A7QA 3IDCB 1QJU2 3ENRA 1LECA 5T52A 1HRV1 4D7YA 3RS6A 3ZFGB 2HWC3 5CKMA 2VCCA 1K5MA 2PLV2 2AC1A 1VBA2 2CGOA 2W3JA 2ARXA 4KWKA 5C3OA 1RJ8A 1V6MA 3BPZA 1OUXA 5HXMA 5ANQA 2PHLA 3CZJA 4LBMA 1AR73 4AEDB 3PUHA 3FHIB 3GDBA 4MXWB 1PO21 3G6JB 5KHIA 4ASMB 1R092 5C7GA 4A45A 4GJZA 1C8NA 4L0PA 3VBSB 1NE4A 1W90A 2HWF2 2Y6HA 3E97A 2HWC1 4QQOA 2DVGA 3W21A 1OLME 4XF1A 4DUVA 3AYDA 4COVA 3GZAA 3RI9A 2WZPP 2Q8DA 4YM0A 1FATA 1N3OA 1AR71 1LOAA 3HNMA 1SDDB 2HWD3 2VZUA 1APNA 1QJEA 2VBDA 3B00A 2SBAA 3E5QA 4XQ4A 2WR9A 1N3QA 1US2A 5FKCA 1QNWA 5FZOA 1PK6C 5A3WA 4UFMA 5C3QA 4P9GA 2P3YA 3IAPA 1X82A 4Q27A 4YLZA 5FYYA 2HYXA 2P6CA 3WD5A 3QCWA 4Z2WA 4YW3A 4S2GA 2XQRA 5CU1A 3MFAA 2BNOA 3PVOA 4B7EA 2AR6A 1JW6A 1PK6A 5F5QA 4R9CA 1DZTA 2W52A 4GAZA 3R4SA 3TN93 3NMBA 2HWD1 4CEWB 1VJ2A 4FP3A 1N1TA 2FCTA 2JDPA 1G8WA 5GJ6A 4Y20A 2D6NA 2QCSB 3WG4A 2BWAA 3S0MA 2Q5TA 1W6PA 4QPYA 3JB8A 5DG2A 4PCRA 1DLLA 2H0VA 3TN91 3H50A 3OGGA 3KF5A 3OYWA 2P1BA 4K9SA 2PQSA 5FZAA 3CJXA 4COZA 1S4CA 1YXWA 1CAWB 2BGOA 4XMIA 4OHVA 1O91A 5FZIA 2BTVC 4BYYA 4EN6B 2JKXA 2HJIA 4QB1A 4HXCA 4NHYA 5IWFA 4CU8A 2H6CA 1SPPB 3BTZA 2IXJA 2NM1A 3POGA 2Z69A 3CEWA 5A3TA 1MZFA 3GBFA 3U78A 1GQHA 1I5PA 1ULEA 2WSVA 2Y34A 1W8NA 2ZEXA 3ZN6A 4IEZA 1RUOA 2VOVA 1MEC3 4MLOA 3WNOA 3D0JA 1DQ4A 2X10A 1HRI3 1D4VB 1UOGA 2O0OA 4XF3A 1LHWA 3SH4A 5HI0A 3IKWA 1Z7S2 3VD9A 2HWE2 5G05L 5IK4A 2YZ4A 4KL1A 3H7JA 4HPKA 5JPNB 1HIXA 5BNNA 3RZJA 3ZXGA 1UY4A 2FDHA 3KQRA 3T4HB 1AYM2 2QDRA 3BCWA 3VZNA 3I2HA 1N1YA 1GR3A 1NCQC 2J1AA 3E5UA 3ZFEA 1T6GC 4YW7A 4RGKA 4CDWA 5F7UA 1HRI1 3P3PA 1FXZA 2BGPA 2H0BA 2Y0IA 3U11A 5JZGB 2GNDA 1I5ZA 2ZMLA 4LXLA 1LEMA 3A4UA 3AKRA 5DZEA 3WNXA 1HB3A 3KF3A 3TEWA 4UF0B 3SCHA 1ASJ1 3WX5A 2UWBA 3Q8AA 4QD2A 3ABZA 2ETEA 4I30A 1CJDA 2EXKA 5FZEA 4TTGA 3LEKA 1FV3A 1JZ4A 1W8TA 5FZ9A 1VE0A 1WUVA 4G9SB 2XJRA 2IVJA 3IDEA 2WFF3 1W03A 3NNMA 3J8F3 3TOJA 1DDLA 1W6OA 1GLHA 1O8SA 2VCMA 1AYN1 3MW3A 1PNGA 3J4UH 3D8CA 4RA0A 2A3WA 4Y5Z0 3DV8A 5EYYA 4FPKA 1SZBA 2X29A 1WLWA 4AVBA 3O1SA 5BNPA 3AP7A 3SHRA 1BZWA 1NZIA 2Y38A 4NWVA 3I4IA 4LBOA 4DRVA 2R071 5FYHA 2B8MA 2WO7A 4X8PA 3T0AA 1VBC1 3DYPA 3THDA 4ZZ8A 1COV1 3N36A 2BNMA 1Q43A 3S57A 3I2GA 1JXNA 5F6LB 3RI8A 3VBUC 3LF7A 1QIQA 1DYOA 2VMEA 4XFFA 5CFCA 5ABJC 3PJQA 5J09A 3MV01 1LNSA 1MS1A 2VU9A 5FTTC 1CN1A 3SEPA 4EE2A 1GZWB 1SBDA 4BLJA 2L9LA 3I2IA 3JQXA 3VKLA 5SV5A 2YHJA 1DQ1A 5FZLA 2VY0A 2VQAA 5FKBA 4X6QB 4B4QA 1UO9A 1XB9A 3VDDC 1AJKA 1RUD2 3JBG2 3RDIA 4XJUA 3NNJA 1YHFA 3UK9A 2WWJA 3OCPA 1VR3A 2DVAA 1QEXA 2VZOA 1WA4A 1OC1A 5IFPA 2QFEA 4GULA 4XHBA 3J7LA 1OA4A 5FYUA 2Q1MA 3MF6A 4PHZA 2OS2A 2ARAA 2VH9A 4XW3A 4CU7A 1AXYA 1OFSA 4XUNA 1UOJA 4RR3A 4Y22A 4UFLA 1QJY2 5GZDA 2VQTA 5DUVA 3SLIA 1V6OA 2LM3A 5BNOA 1YRZA 2ATFA 1NZCA 3ORJA 4XDQA 4CDUC 1SFNA 3JD73 4XDPA 3KV4A 3MV11 2WT1A 1GMMA 3MIBA 4HVRA 1A8DA 5FO8B 3SCFA 1KJLA 1GSLA 3ZVXA 2RDSA 1XRUA 3BIWE 3TBDA 1AR63 1W0NA 2Z79A 1W2TA 1REFA 4NRPA 3SKJE 4AGGA 4IDZA 4JHTA 4NPRA 5B4NA 3MF9A 3MO4A 2EIDA 4IV3C 4OMCA 3LPGA 1AHSA 3E6BA 5A7NA 4JVAA 2R062 5LBCA 4A42A 1UKRA 4MXVA 1BBT2 4UW6A 5BUVA 1SFPA 3JZVA 1OSGA 4XABA 1L7QA 1PMHX 2YBSA 5GKAC 1BVVA 1AR61 3HPNA 2D5HA 1XSQA 3FMGA 3RPQA 4MGZE 3H8OA 4D3WA 2HBUA 1PGW2 4OI1A 1Y9MA 1BKZA 5FOBB 1B35B 1UY2A 4LIUA 4I3GA 2XB6C 3JQWA 4Q29A 3UNPA 5K8SA 2QQPA 3FLPA 1CJPA 2DF7A 3IDBB 2E9QA 1X9PA 2FMYA 5FIXA 3ZX7A 5LW9A 5FY0A 1GNZA 4NIGA 5ACA2 1O8PA 3VZJA 5L9RA 4BU2A 2DUPA 4FQZA 1W8HA 2D6KA 1ENRA 2EXJA 2OX0A 4W4ZA 2OIIA 5KHJA 4AEJA 2BVBA 4PQQA 1PNFA 5CKNA 2D7FA 1ND3C 4L92A 5F1RA 4Q0UA 3PL0A 4TXWA 4ZKTB 2ZPXA 1UOBA 5LY2A 1W6MA 1RUF2 1HB1A 2AUYA 2JIGA 4Z07A 4ZY9A 4CTEA 4HVQA 5AFEA 4ISQA 1MS5A 2GP3A 5KWRA 1UY3A 4FSJA 1K5MB 1VBD3 5A80A 1H2MA 3DXUA 4Y5SA 3ALQA 4A3ZA 1NAEA 1LENA 4YG0A 3RFRA 1R083 3OY8A 4CDQC 2UY9A 4BH9A 3QBQA 4OLLA 2DCJA 5DXDA 3A0NA 1GNYA 3FWEA 3W59A 1RMU3 3UL2A 1ZREA 5FK8A 3SH3A 3H8UA 2BVVA 3KHCA 3PNAA 3RNSA 1VBD1 2YGMA 2UWCA 3RZLA 4CCNA 2UU8A 1JUIA 4Q0SA 1R081 3AXDA 4JKLA 2WLPA 5I8YA 2O14A 1FAYA 2IUWA 1LHUA 5IYYA 3V0AA 4UW3A 5FZOB 1F35A 1ZBE3 1YI9A 2JEMA 3KCYA 3QLQA 4LBLA 3HT2A 2YFZA 2JB4A 2GNMA 2DUOA 1ZBA1 2WFPA 4RHV3 2VVEA 4S2DA 4B7KA 4BK4A 2P3IA 3H3ZA 4Z1VA 1W9FA 3NL1A 3J7MA 4J1WA 4BB3A 3B02A 1DU3D 4ISRA 4F83A 1ZBE1 4FCAA 3HNYM 3B7MA 1PHMA 3CQOA 1MZ6A 1MS3A 4Y20B 5DDJ3 3AYCA 4DEVA 3ZR5A 1W6PB 4HBNA 4RHV1 1XNCA 3POFA 4NVPA 3ZLIA 3LA7A 5CFDC 1QQP3 2WNUB 3K75B 4ATEA 4A7KA 2EIGA 4K8RB 3WP5A 3LOIA 3D4KA 4K21A 2BWCA 4IE0A 5GZCA 3OYWB 3EYPA 2BV4A 1WBLA 3IT8A 4XUTA 5KHKA 5K0UB 4NHLA 5DDJ1 4YM1A 4CEYA 1LODA 2VBBA 2DBIA 3KHBA 5FZMA 1QQP1 2YC2A 2KM2A 3O12A 4K40A 4NN0A 4YGDA 4BE3A 3GNEA 4FPYA 2WO2A 2DFCA 1ZZ7A 2DCTA 3ZYRA 1YUDA 4A7ZA 1VMHA 2R042 1EAH3 2WAAA 5GALA 3MIDA 5JMOA 1BYHA 3ZPOA 4B8EA 4JKKA 3ZN6B 3MFCA 1CAVA 3OPTA 3QH6A 4RQPC 3HWJA 2J1SA 4C0BA 1NT0A 5EQUA 4PLMA 4RFRB 1DP0A 1DQ0A 4DXZA 4J1XA 3IMNA 2TEPA 3I3EA 4QKFA 4FOQA 2RS33 4HPKB 1EAH1 1XJAA 4R9BA 5FP8A 1EV12 2V09A 4C1WA 5BNNB 1V70A 2E7QA 4I3PA 3T4VA 3ZN4A 2GZWA 3K4ZA 3D5OA 3DYMA 4Q0PA 3AXEA 4BA6A 4QHOA 1S55A 3VZLA 2R0FA 3ZFEB 4QB2A 2JX9A 4AFAA 1VLNA 4QHZA 4CDWB 2WWSA 4M4PA 1MVQA 1WW6A 2JXAA 3POYA 1OOPA 5EJ1B 3LA3A 1VBE1 3DUIA 4GJYA 4PT6A 3SKVA 1W28A 2RS31 1Y9GA 4HK9A 4BHPA 3GF6A 4XIOA 1NX9A 5I0SA 2WN2A 3M8LA 4QKNA 1AXKA 2UY8A 3LDRA 4LOSA 4MUVA 1V6LA 1VBB3 4P9JA 1QJU3 1UXXX 4YM2A 5A7SA 4ITCA 2IZWA 5FUIA 1F8VA 3ZXLA 1W8WA 2PLV3 1VBA3 2JDHA 3S5AA 1LOGA 2EVXA 4Y5TA 1RL3A 5A3OA 1YFWA 1W6OB 5F3CA 1HV0A 3LB9A 1BMV2 2IXHA 1IS3A 2QQJA 1VBB1 3F95A 5H9RA 1QJU1 5T55A 1R093 2C26A 1YIFA 4FQ4A 2JE9A 2WA4A 4P14A 3ASIA 3RSJA 5BNPB 2HWF3 1MQTB 2PLV1 2RJKA 3ZYFA 2E26A 3SMHA 1LTEA 2WWUA 1JOPA 3ZFFC 1U5YA 5J3UA 4L9BA 1Z78A 1H6YA 4DFSA 1X8EA 4A3XA 3BKZA 4EQVA 5A3MA 5CFCB 2DCYA 4A41A 2HWF1 3KWVA 2FHRA 2RJLA 4I0WB 5FPUA 2J42A 1MPXA 1Y43B 4JTOA 4QHBA 3USUA 3KT4A 4AG4A 1RTVA 2WZR1 3FFQA 2WT0A 4P5YA 4RS5C 4WM7C 3TAYA 1UL9A 3M3QA 4Q4X2 4YW6A 2XJQA 3EXUA 3IIAA 3MYXA 3ZYBA 4XFBA 2VZ1A 2D97A 2W95A 4DUWA 1H2NA 2EF6A 2WBKA 3O1RA 3O1MA 1C1FA 1GZ9A 1PZ8A 3N7MA 1QOSA 4WM7A 2ZXQA 1W3VA 3HIFA 3MUZ1 4IEWA 4R9AA 1WA6X 1CVNA 2VW2A 1LCLA 3CJIC 3B5LB 1F15A 3UESA 4M3CF 5F6KA 2DV9A 4RR3B 3B9CA 4Y22B 4MGQA 3UGHA 5KHHA 2VMDA 1DZRA 5BNOB 1HB2A 1WD4A 2WZ8A 3CJIA 2Y6JA 2C9AA 4FTBA 4YM3A 3H8RA 4AXOA 2WAOA 2ZKLA 1JZ7A 4K6BA 5CVRA 1AL22 1VAMA 1FX5A 4FI9A 4JC1A 4XAAA 3VBRA 1SMVA 2ZGQA 3LEMA 1JHNA 4BQ5A 1LESA 1Q3EA 4XMAA 4H2AA 5HV0A 3LGRA 3ZXKA 5C4WC 3LCPA 2VTXA 2BYVE 2A1XA 4QDRA 4AHXA 2A71A 1A6CA 1FPN1 2WABA 3I2DA 5F5AA 1R1ZA 4Y4YA 1POV0 1QH7A 3UGFA 3OUHA 2VD7A 4IETA 1HV1A 1OH3A 2BJSA 4NR1A 4QPWA 2ZEYA 2IFRA 2ZKNA 2ZGOA 4YYOA 3CIHA 4XPVA 4N8MA 1O7FA 1Z7S3 4XQDA 3GHMA 2HWE3 4GD4A 2GN3A 5IT6A 1BEV2 1WCKA 1J3QA 4NHKA 5CISA 3C7EA 3DF0A 4Q4V2 2YU1A 5HCAA 1US3A 1AYM3 1LOCA 5F3GA 3HMYA 4Q0VA 4YG3A 3KD4A 4IE4A 4XVHA 4URAA 5FZKA 4N7UA 2JWPA 4G4FA 1Z7S1 2HWE1 1C28A 1OPMA 1ENQA 2NPIA 2ZGSA 4HSLA 2NN8A 4Y1XA 3ZIXA 4MO3M 4R4ZA 3HR9A 5HBAA 1PGSA 1AYM1 1DGRA 3A21A 1ALYA 1QXJA 5T5LA 1SBFA 3ZIWA 2QE3A 1H30A 1BK1A 1UZWA 3M3CA 4NROA 1UXZA 3LZZA 3H42B 4LBQD 1W6MB 4AGVA 4QAWA 1W8ZA 4XQWA 2VNVA 3U1XA 3F2ZA 1ULCA 1WCQA 1YIPA 2RE9A 2BZDA 4WM8C 1IS6A 3POIA 4MADA 3HNBM 3ZO0B 3U4SA 2D3SA 5LRSA 1DGRN 1FMD1 4QXCA 1S2KA 3B3QE 3O0XA 3OY8B 2BU9A 1KD7A 3WCSA 3MICA 1DG6A 5IAXA 2XBO2 1ZNPA 1IS5A 1U5IA 3ZM8A 4AHWA 2RHPA 1H4HA 1RVF2 1YNAA 3BTAA 2WYFA 1V6JA 3M7AA 3QACA 1Q8PA 1JU4A 5FMOL 5L7OC 2YU2A 3R0RA 3RVHA 4CP0A 4PBPA 1QOOA 3NKTA 4AE2A 5JDBA 2PHTA 1D7PM 2F4LA 1GWLA 1S0JA 1ULGA 4MVTA 5EV7A 5L7OA 5FZ3A 1OQ1A 2OZ6A 2TBVA 1QXRA 3V0AB 5GZEA 4AWDA 5DAXA 5FXZA 2VVDA 4E2SA 3I2KA 1YQCA 1ZRCA 1Q8SA 5CYYA 2SLIA 3O7OA 2F6BA 2KXLA 3ILFA 4PF1A 2QQWA 4KG8A 3WDTA 3S6PA 1RXGA 2ZHLA 1A34A 2W87A 1QJX2 1RUD3 2YDEA 3BN6A 1ZZ9A 3JBG3 3WG2A 2YBPA 1O4TA 3HEIA 1Q8VA 3LPFA 1W0OA 3MLLA 3PTYA 2Y0OA 3SXWA 4DO0A 3WF4A 1ODNA 5CG9A 4P9WA 2QQKA 4OCTA 2XUEA 4R4XA 2FBEA 2DTYA 4F7ZA 1I6XA 3AKPA 4AW7A 4LO4B 5ACA3 4CUAA 1U5ZA 1UAIA 3OUJA 2WDBA 2DYCA 2JD9A 3JBG1 3AYAA 4UFHA 5A1LA 5FYIA 1R1A2 3ZMOA 1XE0A 2VCAA 3ZKUA 3DKWA 1V9U2 4FFHA 1UNBA 4Q4Y2 2QKDA 1XYOA 4QKDA 4QPGA 2XJTA 5A7WB 5C5UA 4I02A 4CEYB 1CZVA 5LA0A 1S0FA 1NKGA 4GXLA 5IVYA 4OHWA 3T09A 2PELA 1J84A 4KWUA 1N1VA 1WLTA 1K45A 2X5IB 3FX3A 1SLTA 2O1QA 5CB7A 4CCLA 3LA2A 3ZYIB 3O1PA 4CUCA 2E63A 2GN7A 1SHWB 2I2SA 2WNVA 2BNNA 3BOPA 3I97A 3U14A 1WMFA 4HVOA 4PLOA 4OHZA 3V65A 4ZHNA 1TVGA 1D2SA 1DGLA 1W6NA 3DPRC 4LEJA 2BQPA 4JDNA 5DAPA 2BBVA 3J7HA 1BBT3 4NOTA 1CAVB 1XSRA 3T0DA 5KBFA 4OUSA 3UYJA 1G9CA 5LA1A 4LIVA 5DZFA 3WEZA 3DPRA 2VBPA 4OI4A 4Q8LA 4JGZA 2VOKA 4PF5A 4FPHA 5FQ0B 4CDXC 4CRQA 1XNBA 1W9WA 3R4DB 2VXJA 3CZUA 1LOFA 2X8KA 4FPGA 5E6HA 3TNQA 3VBHC 1XE7A 5JLVA 1IQDC 3AZXA 5KXDA 3DECA 1BBT1 1VRBA 4JRLA 2YC0A 1KS4A 3CMGA 1TE1B 1IZ3A 4EWDA 1RUI1 1QF3A 1JZ8A 4QX3A 2BFUL 3VBHA 3H8XA 1POV3 3AZZA 1NLSA 2QUOA 1OOPB 5EPAA 4XDOA 4AHZA 1PGW1 1DGWX 4IERA 4IUGA 5TSWA 3WP3A 2B46X 3ELNA 1CX1A 4UI9L 5FWEA 2UYBA 3ZSLA 1QGLA 4IGOA 3U10A 3GCWA 1AR92 4QGMA 1UMIA 4UOJA 2OPWA 4NIAA 1EP0A 4BQ4A 1RUF3 3IPVA 5FYBA 2Y6LA 1POV1 1O3QA 5C9AB 3MW4A 2KR2A 2Y26A 4IE7A 1VRH2 4H14A 3WSOA 1TQ5A 2A6VA 4R52A 5JCTA 4JZRA 4FAGA 1XYNA 2K46A 2XKOA 1YO8A 2ZGPA 4BM8A 5A1FA 4DEQA 1ZX5A 3KS7A 3LIGA 4J6GA 2ZX4A 1D4M2 4GKYA 3L9JT 4QPIC 2FQPA 3H0OA 5J36A 4TN7A 1GQPA 5DUWA 2Q1ZB 2E32A 3VBFC 3PDQA 2MEV2 4W50A 1O3SA 4DIQA 3RWKX 1A3KA 2DBNA 4LE4A 3ZKYA 1JS9A 1Q8QA 1RUC2 4IL7A 1GZCA 4F3JA 3I2OA 2VMIA 3JU9A 2A3XA 2VUDA 4LKDA 5J1XA 2EIEA 2RVAA 4FPCA 1B09A 4YSFA 2F4PA 5T3NA 1XNKA 3VZOA 1ZRRA 2GALA 1LU2A 5LASA 4AR2A 4LUKA 4DPNA 3W9AA 4EJRA 4N43C 2D6PA 5LEKA 4PI0A 1J83A 5FP4A 4EV0A 1SLCA 2OKXA 2Z5WA 2VJXA 4KGQA 3ZSMA 1YJKA 5IATA 2LROA 1UYXA 4EN0A 4WM7B 4CVUA 4PIYA 3AKTA 4Y1YA 2WS92 2XLGA 1YQ2A 5IVBA 3ZXJA 5K4LA 4OQ9A 3WG1A 3H7YA 5CA6A 3A22A 5JOZA 4OULA 1ZM1A 1J1TA 4E8DA 3J26N 3WVJA 4COUA 4CXXA 1G9FA 2RS52 3FBMA 4C90A 2ZZJA 3C2UA 2AH2A 4KH9A 5FYZA 4UYBA 2ZGNA 3QH7A 3CKHA 2I45A 3RYPA 1WBFA 1X9TA 1EY2A 3BYWA 3VBRB 5IUQA 1WW7A 3GM8A 4LTAA 4Z92B 3FFZA 2MPFA 2XJPA 1BCXA 4YVWC 1MEC1 2D98A 5BV6A 4GIQA 1GP4A 4B3NA 1WMDA 2R043 2ZEZA 1I1EA 1AUYA 4LJHA 5CZKA 3KT1A 2A6ZA 3K3NA 2XHKA 1NG0A 4KMQA 2PHWA 1RUNA 4YVWA 3AMNA 3O1UA 1NCQA 1PM4A 3RZZA 4W6WA 4E8CA 4QX5A 1W9YA 5AVPA 1XQNA 2CHHA 2VVFA 3U37A 4MOAA 1W9SA 5IJRA 3T2QA 1EV13 4ES8A 1V6NA 4GA9A 2ORZA 5IVCA 1CZTA 3RYRA 1J3RA 3TYJA 3NO8A 4BMEA 1TNFA 4YNIA 2AREA 3E1F1 3MIHA 3N35A 4Z8BA 3BTYA 1RXFA 2PA7A 1JH5A 1N1SA 2YC4A 1RB8G 2A6XA 1EV11 3PURA 4Z82A 3K77A 4LUMA 4DRRA 4EZHA 2ET1A 1QH6A 3OD0A 4FVVA 3R6SA 3GALA 3HT1A 4QB6A 4XF9A 4YGCA 1HB4A 2WFF1 5GZFA 4D8MA 1GOHA 4LHNA 2JD4A 3J8F1 2D44A 2WSUA 2XL9A 5IVEA 1TZOA 2B9UA 2JG9C 3J9SA 4PDWC 3WNKA 3JXSA 2PTMA 1SLAA 3VLBB 3ECQA 4QQLA 5EZWA 1QDOA 4L99A 4XJWA 5F3EA 4N90A 3RZGA 3FZ3A 1DZQA 3ZYHA 1H1AA 2IVIB 2JECA 1J1LA 5BXXA 1N47A 3VZMA 4JV4A 2D3PA 4PDWA 1XU2A 4XBNA 3VBUA 5K7PA 4Y1UA 1AL0G 1RUG2 1Y4WA 2HEWF 4BPZA 5ABJA 1ND2C 1PO12 2DU1A 2VZSA 3Q8EA 4UXAA 1GBGA 5FYTA 3TNPB 3WQ0A 2PHXA 4UW5A 4OYUA 5D2AA 4RSUA 3RWNA 3EMRA 3M4FA 2WLQA 3ATGA 4PIXA 3VKOA 1PVC2 1BMV1 4HT1T 5T54A 2E7AA 5FZFA 3H3LA 5L7OB 1ZZBA 1XXNA 1T6BX 2VO5A 1BLZA 3H1MA 1PVXA 5I0UA 3VDDA 4CSWA 4XFIA 1UU5A 2XJUA 5A70A 4XE9A 4YRDA 5A32A 1PZ9A 1HQNA 4PBOA 2PHRA 5EYXA 1CESA 2W1WA 4XF0A 1OBNA 3AVSA 3OD4A 5EIYB 4CUBA 3VBOB 5FDBA 4FPJA 2J1VA 4Y24A 4LT5A 4EN9B 2CNAA 3Q8CA 4I2OA 1AR82 4Q4X3 1RHI2 3ZDSA 4FPOB 2QZ2A 2IXIA 3GYDA 4CDUA 1NA1C 5FOJB 3AZWA 1UU4A 3MIEA 2NMOA 2ZA9A 3BI3A 4HL0A 1IPJA 1FYUA 4XCAA 1VALA 4BOWA 4GB32 3Q8BA 2XJSA 3JD71 1BXHA 1ONAA 4OUEA 4Q4W2 5JVVA 2FDGA 1DQ6A 4BJ0A 2WNEA 3NNFA 1J3PA 2P34A 3O0WA 2Y6GA 4LHLA 5JMCA 1HN1A 5JOYA 1FV2A 2CU5A 2EICA 3OEBA 4IV3A 4PLNA 1KGYA 3WF1A 4JGYC 4QPGB 2W0XA 3MIGA 1REEA 1EYBA 5FXVA 5J48A 4QXHA 3C8XA 4MGTA 2PXJA 4LORA 2A5ZA 5HXVA 1UYYA 1AL23 3WCRA 5A6XA 1G9AA 2AZ5A 4K3UA 3ETPA 4U2AA 2C4XA 1ZVFA 5C33A 2WNVB 3PUAA 5FY7A 3N9OA 3LEGA 3BB6A 5FFOC 2JICA 1W6NB 1JHJA 3EHKA 2PYTA 3NJZA 2G9ZA 3WHTA 1HRV2 5AC92 2K0GA 1AL21 5JIAA 1A8MA 5L9BA 5DG1A 1C4RA 5JAXA 4M3CA 1H4GA 1UZYA 1BEV3 2RS12 1OUSA 4CZSA 3WINE 2WT2A 4LA2A 4JGZB 1DIWA 1Q56A 4Q4V3 3NNLA 5T50A 1PO22 3OBRA 2A6YA 1G86A 5ANNA 3ROUA 3LSDA 5KC6A 1SLLA 4Y26A 3IBMA 4H3WA 3ZYGA 1C8M2 2HWB2 1OLRA 3VDAA 1ND3A 3LFMA 2J1RA 4HN0A 5FPLA 4NE9A 5JR2A 3PU3A 4GMP0 3HQRA 4V1PA 1BEV1 3VBHB 3ZN5A 1CIYA 2J1UA 4PI2A 1X36A 2YMZA 3HQXA 4KU7A 2P37A 2X53S 2VXRA 4AI8A 1WCUA 1G6NA 2IXCA 3BALA 5FYVA 4N53C 4CDQA 4CUGA 1JYVA 3KV5A 1SBEA 1V0AA 3PIJA 1F2NA 1GQGA 1GOGA 3TEYA 2A6WA 2ZMNA 4P9LA 1YFYA 3LAGA 3IPVB 3KQ4B 1KDMA 3B9IA 4XTPA 5JOXA 4XC9A 5KHGA 3BUCA 4LBQA 5I0RA 5DZGA 3KLSA 2VAUA 3GJAA 4XACA 4DS0A 1NY72 3PUSA 3VL9A 3FLRA 1IOAA 2NZ9A 1ZYBA 1RMU1 3AZYA 1XPWA 4LBKA 1YEWA 2VZVA 5FPZA 2JDMA 1DYKA 1LR5A 2A70A 4JDMA 2XBO3 2ZGLA 4RGAA 4P02B 2AACA 3BOWA 4QQ2A 4E2GA 5C8CC 1RVF3 1BVP1 1TME2 2XQXA 1C3HA 2Y8KA 4M0HA 4XOGA 1PIV2 1PK6B 4UWDA 4BQXA 2YYOA 5FMOS 4CP1A 1AXZA 4UFJA 2Y6KA 1BQPA 1DYPA 2D6MA 4GH4C 4QWNA 4AL9A 5C8CA 4IV1C 2XWBB 4N9HA 2XBO1 3U0ZA 2FDFA 1E5RA 1RVF1 3QD6A 4FXGB 2LUWA 5FJHA 1J59A 2ES3A 3FUQA 2BDRA 4IV1A 4YVSC 1HX6A 3WF2A 1LHNA 2OT7A 2HBTA 4FT8A 4IW3A 2EA7A 1CONA 2W08A 1DGWA 2LALA 4B1MA 1DQ5A 2QQNA 3DCQA 4LBNA 5CFDA 1QJX3 4BLIA 2GAUA 5C71A 3THPA 5J37A 3OF1A 1WGPA 1CX4A 2ERFA 2WQ8A 3FHAA 3JUUA 4F8AA 3M1HA 3BVCA 4XFCA 4IGPA 1PX3A 4W8JA 1WWYA 1JOJA 4UW4A 1LOEA 3NRUA 5AVAA 1C57A 5B2GB 2QNKA 4EN8B 3W20A 2C5DA 2VW0A 4MHUA 5FREA 1ZA4A 4AF9A 1QJX1 3P1IA 3AMHA 3USSA 4R8HA 3VHOA 5T5OA 1R1A3 1H2LA 5DUXA 4E2QA 1IKQA 2XG3A 5FPBA 4Q4Y3 4AQSA 4V2VA 2PAEA 3RZHA 1O59A 2Q8CA 1R64A 3KM5A 4B29A 1AF9A 3UKTA 3T30A 1HKDA 4HANA 1UY0A 4RQPA 4K7JA 3LDKA 5LBBA 1ASJ2 1RIRA 3PHMA 3ZXAC 4S2HA 1VPHA 4HZFA 2E6VA 1VMJA 1R1A1 2VE1A 1ST8A 1ACCA 3NAPC 3V56A 4Q4Y1 3WT3A 1HQLA 2XKPA 3GBWA 3UT0A 1YJLA 2Z4FA 3INAA 1XNTA 4L11A 2G1MA 3MGUA 1NCQB 1ULFA 3AFGA 4LO7A 1W6QA 3R4UA 2OW4A 2AGSA 2Q1FA 2B9VA 3LFIA 2VM9A 3ZFGC 4AQTA 3RZKA 1RITA 1AYN2 3OGSA 5JXGA 3VHRA 3WNPA 1UPSA 2WC2A 3S7EA 2RM22 2P2KA 1M06G 1GZTA 4EYUA 2FZ2A 4XF4A 4FPLA 4AEDC 5C3SA 5FZ1A 1GYKA 5KR7A 1JZ3A 5BPXA 1WW5A 2DURA 2R072 2EAKA 2WZEA 1VBC2 3FLTA 4IGQA 5E89A 3OTFA 2DCZA 1COV2 4UAPA 4KG0A 2JIJA 4LLOA 4HK8A 1WCDJ 2QQVA 3GJBA 4LLFA 5IK7A 2CYFA 2GU9A 2YPDA 1JYTA 2BFUS 4ATFA 2ADEA 2MHFA 4IEVA 2DVDA 4FTEA 3SEEA 4MH0E 2VZRA 5CNAA 4TSVA 1VBA1 4XAEA 2UYAA 1AR93 3VB9A 1IGOA 3W58A 1QHDA 4IEUA 4I01A 1RGSA 2GP5A 1UMZA 2E53A 2Z2SB 5GLVA 2JDYA 1YYNA 3C7FA 3MPBA 1R091 4GMP3 3X29B 1VRH3 2W1UA 1G9BA 4CEWC 5FPAA 5IW0A 3ZFFA 5M0TA 5FCCA 5FO9B 2RDNA 5IAVA 1H8TC 1AR91 2NYYA 4XFAA 4XJAA 2CWMA 1O3RA 3I2JA 3WUCA 1D4M3 3VBUB 3AJYA 4DINB 1ZZ6A 3RG0A 2CSGA 5ABJB 1JBCA 4K8FA 5A6ZA 2GNTA 3PVBB 1LAJA 2CV6A 1UU6A 1GWKA 2OA2A 1JZ6A 2N7GA 1AX0A 1LGCA 1H8TA 2ZZQA 3E6DA 3LEIA 2MEV3 1OH4A 4D6RA 1ZZ8A 1VRH1 1JYWA 1FI2A 3OBZA 3IWZA 4LBJA 4LKFA 2QBXA 3FL7A 5IVJA 1GOFA 1CIWA 2G9FA 4RS5A 1L7RA 1QOTA 1RUC3 2RJ2A 4IEYA 5FXWA 4ARXA 3AP5A 5CKQA 3VDDB 1D4M1 1H9WA 4NPLA 2DVBA 1CQ9A 2EXIA 4NMIA 2ZGTA 1H6XA 2BPA2 1ULPA 3MW2A 3AP6A 3AC0A 3N9MA 2PAMA 5CG8A 2MEV1 5A7PA 3ACIA 1XE8A 2VOWA 3NVCA 4LPLA 3KB5A 2WNOA 1OA3A 4K1ZA 4LHSA 2E31A 5A3UA 3EQEA 2NQYA 2J22A 4MGYE 3T08A 4OZOA 1E5HA 4NIHA 2QDNA 2OUHA 3DKQA 4Y4RA 4HKWA 4CDUB 1JMUB 4WVVA 1W04A 1FOD2 1OA2A 1SPPA 3GBGA 1C5IA 1HW5A 4FPFA 1Y7BA 2WS93 1UZVA 1CZSA 2VMFA 3IMMA 1LGBA 1T2XA 2P3JA 3A0KA 3LOBA 4JKMA 4FOYA 5FR3A 2WKKA 3OGVA 2EIBA 3OEAA 1LRHA 4GALA 1JODA 3WF0A 1K5JA 2BBAA 4R9DA 2BOIA 2VNGA 1X8MA 4IV3B 5CIRA 5C4WA 4HONA 5FZ4A 1STMA 2RS53 5F9TA 5HV4A 2WRAA 4NAOA 5I91A 2FCVA 1EPWA 2WS91 2AEZA 4UFIA 4D0QA 5L9VA 5CBLA 5JZGC 1LJ7A 4ONUA 3VN4A 4C91A 5FUNA 5DAVA 4DQAA 1UIKA 2HH9A 2ZX3A 5HCFA 4E4ZA 4YZ2A 2XVGA 3LE0A 3I59A 4YW5A 4KWLA 5IHRA 4EWAA 2BEOA 4SBVA 2OYZA 2XOMA 2DWRA 2YBKA 3SH5A 4M3CE 1W05A 2VQUA 5JSPA 2JDAA 5FP9A 1ULOA 3CDZB 3IAQA 5JI9A 3OPWA 5FY4A 2K2SA 2RMU2 4M3CB 4XJZA 2ZHNA 5K9YA 1QMJA 2R1BA 4OVEA 1NXMA 4M4RA 4XIKA 1YFXA 1SCRA 5E1RA 3LSEA 2E51A 2B4KA 3N3HA 2VC9A 5EJ3A 2DVFA 2ZTNA 4QM8A 3VD3A 4DZGA 1MR5A 4FPEA 1H0BA 2OZJA 2JDNA 3D6EA 2ID4A 5JI7A 3U4XA 3NV1A 1ND3B 3DXTA 2KD7A 4TYSA 4YWAA 1CD3G 1KFXL 2ZBJA 1AX2A 4QX7A 4WM8A 5KC5A 4AQ6A 1JI6A 5D21A 4IQPA 2ZMKA 2IXKA 2WN3A 5JSRA 4CDQB 2RR12 1WLCA 1HDKA 2X09A 4CCKA 5C8WA 5FZGA 1ZBA2 4ZXKA 1WLDA 5FLIA 4Q0QA 1GUIA 2RDQA 2BUKA 4JHZA 1OMIA 1MVEA 4LBQB 2WQZC 4EZ4A 4S2FA 3W5MA 1HQWA 4IEOA 1ZBE2 1UIJA 1XU1A 2P4EA 2Q4SA 3RJRA 3ZR6A 3WQ1A 1GU3A 2ZGUA 4AVVA 4CCOA 1JYNA 3M3OA 4EROA 2GDFA 4FTSA 2VNRA 2C6SA 4JQRA 3PJYA 1RUG3 1WD3A 4MYEA 1PO13 1KDKA 1W39A 1YI7A 4IEXA 4MSVA 5L73A 5DAWA 5FP3A 1HXS2 3AM2A 3ITQA 4WV8A 1YFUA 1VB2A 2GC2A 1Q8OA 4HKLA 4YZ3A 3MEPA 3C7OA 4YFZA 1PVC3 1ODMA 4FFFA 3O1TA 4OFGA 4XHXA 3HAGA 4COWA 2AYHA 2ZAHA 5FZHA 2YPJA 1RUJ2 3V64A 3WZ1A 1YQ6A 3U75A 3ACGA 4J25A 3AMPA 1PO11 5A3PA 2W5FA 3OG2A 3WQBA 2R32A 3GCXA 4W6YA 5LY1A 3WHUA 1RUD1 1GANA 2JDUA 3AP4A 1QJY3 4OUMA 4XJ8A 2D40A 4KBZA 5FUPA 5F2WA 1PVC1 5J98B 3JCIA 2YG0A 3T2PA 1ZRFA 1RYYA 2OQ6A 1AR83 3POJA 2D6OX 1RHI3 3FC0A 5CFDB 1PM7A 3GGLA 4V2WA 4LE3A 4INDA 5EJZB 1SG3A 1AZDA 4XBLA 3WV6A 4BCUA 3WNLA 3NV2A 4ASLA 5ACA1 1JUHA 3ZSEA 2WJSA 3LQCA 5I0TA 2BW8A 3C7GA 1QJY1 3PIGA 4BWOA 5IK5A 4QXKA 2ZS6B 4ZXEA 3N4MA 4GB33 2R063 1UMHA 1ZZCA 4Q4W3 4YZ5A 5A3NA 4W6XA 4O9GA 1RHI1 3WW3A 3WNMA 1RJ7A 3KSCA 2CGPA 3HVDA 3TWIA 3OB8A 4CE8A 5HCHA 5LRRA 2OPKA 2QQUA 3RRDA 1UWWA 2K9ZA 1B35C 3ON7A 4HOOA 3T0BA 3WW1A 1JYIA 1F4AA 4AFBA 4RN5A 4FOWA 1VBE2 3FHQA 4ZONA 5EFUA 5CADA 4GB31 2RS32 2R061 2V4AA 4RQPB 2MNGA 3PLQA 4L8QA 4ZS2A 5EXOA 3WF3A 5F37A 3IN9A 5EHDA 1TMF2 3ST7A 1XNAA 1SLBA 1W0PA 1OVPA 1UF2C 4LQRA 3PTRB 4AVCA 4CDXA 4KGGA 1WCSA 5DABA 5IVFA 3IZOA 3CNAA 5AC93 5L36A 3APBA 1W99A 2XHNA 2W92A 1KXGA 3EO6A 3H1WA 2GSYA 4QXBA 4ZZ5A 3CF6E 1W2AX 1W6QB 2HEVF 3CL1A 4L2NA 4M0NA 2RS13 3U07A 4QX0A 1O5UA 1MS9A 1PO23 2QVSB 2VUJA 3CBNA 4XBQA 4O65A 5JWPA 3I49A 1O4YA 5AC91 1UN1A 4BK5A 1C8M3 2HWB3 4QU2A 3PMEA 2JKBA 3BU0A 3ES4A 2YFUA 4NIIA 4FBFA 1OI6A 4AAPA 5ISLA 2RS11 2YY1A 3KV6A 1QY4A 1KS5A 2D5FA 4CA9A 5LA9A 1W2OA 1S0BA 2GMPA 3VKFC 3VD5A 3NV4A 2ZOEB 2C9KA 1RUF1 2Y6FA 2V4VA 4AK3A 4MHRA 4H55A 1OLQA 3VZKA 4YARA 1C8M1 2HWB1 5GLTA 1E5SA 4JRAA 4WBBA 1W8OA 3ZSKA 4YZ4A 1UW8A 4HLTA 3OOXA 5C6CA 1YQ8A 3VUOA 4LK7A 3TB0A 3ZPYA 2WZR2 1F9KA 1D2QA 4CCJA 5JR7B 4QPIA 1H8VA 1XYPA 2QZ3A 3I2FA 4K1YA 5L19A 2O8OA 2FCUA 5H9QA 4OHYA 4XEZA 3AL6A 4LO6B 3VBFA 4AI3A 4JX0A 1S2BA 3ZFFB 3ZXFA 1CAXA 3RQ0A 3AKSA 5FPXA 5APAA 2ZGMA 1S2EA 2OQ7A 3ZDVA 4ZU5A 1TME3 5LB6A 4QX2A 2VUAA 3FN9A 5FY8A 1PIV3 5B4XA 3USUB 1FNZA 3MLJA 2ZABA 1IS4A 1NY71 4MGIE 2JB8A 4AYUA 1MS8A 3MIFA 4I0AA 1H8TB 5FPVA 1DF0A 1UZZA 2WNUC 4OI2A 1REDA 4N9IA 4QMAA 4N43A 1YLLA 4RS5B 1TME1 2VMGA 1H1IA 2XXZA 3NJVA 1S0GA 5K0UC 1PIV1 5H9SA 2WNUA 2J1EA 3ZXEA 1OQEA 3C7HA 4D7TA 5KXBA 4OHXA 2W47A 1KITA 3P5BA 5FAXA 3RYKA 1M4WA 2ZX2A 5KXEA 2VPVA 5K0UA 2DTWA 4KWJA 4YGBA 1SEFA 2CTVA 3CJIB 3O1VA 2EXHA 1FPN2 2PQQA 2WUHA 3JB4C 1SCSA 4YW4A 4AOCA 5LWBA 4LKEA 4ES9A 5FK7A 5D8AC 5FP7A 4HMZA 1TG7A 3SC7X 3VD7A 4TZDA 3NWKA 2Q8EA 3O14A 3ZMNA 1HN0A 1NUKA 4AHYA 4MX3A 4XILA 2BOJA 2FD8A 2W91A 4XFGA 5D8AA 4QU1A 4B4PA 3OGRA 4A4AA 3UETA 5CEHA 4KNCA 5BNNC 1OT5A 4Y1VA 1OF3A 5C4WB 3I3DA 4XZPA 4E4DX 1K42A 3SISA 3VKMA 2G4IA 2WA3A 4DNYA 4P9YA 4WVMA 3ZFEC 4CDWC 2R041 3S30A 1ASJ3 1OKQA 2ZJCA 1K3IA 3D3AA 1Z0HA 4WVWA 4MG2A 5JSOA 3I59B 2PFWA 2GNBA 2VL4A 2R30A 1LKNA 4NHXA 4M01A 3MUY1 3KGZA 3GXUA 3NQHA 3K46A 4BDVB 1G7YA 3LIHA 2GH8A 3THCA 1V6IA 2RG4A 5CAZA 2HYKA 1ULDA 3PUQA 1IPSA 1FMD2 2J1TA 1AYN3 4XTMA 3SQOA 3WG3A 1NLQA 3H1YA 2V72A 1CGPA 2RM23 4JQTA 4WVZA 3AK0A 2QQLA 3MZHA 2RDRA 3LKJA 3ACLA 1CR7A 3AMMA 4YGEA 3K3OA 3M3EA 4BISA 1GV9A 1O5LA 2W46A 4NJ4A 5BY5A 2R073 4Q1PA 5BNPC 5FYCA 1VBC3 1COV3 1MQTC 4NAMA 1PGL2 3N9QA 2JG9A 2RM21 3PVNA 2CDPA 5FV3A 1Y9QA 1HJFA 4WM8B 3ZYPA 4AFDA 1BK0A 4FOVA 3E6CC 1JYXA 1MQTA 4BZ4A 4KBBA 5IK8A 3I7DA 4A2UA 5CFCC 4QGLA 3NNGA 1JOBA 1GFF2 2ZHKA 2VZQA 1NYWA 2VZTA 4I09A 5FYMA 4Y3OA 1ND2A 4NRMA 2VGDA 3O1OA 4XCBA 3T1MA 3AFKA 4CU9A 3WDVA 4CCDA 3K51A 4P9XA 5GZGA 1RUH2 2BRTA 2GC1A 1IG0A 2E33A 2GC0A 3QOPA 4OMDA 3RMYA 3OSDA 3KMHA 3D82A 3T1LA 4AI1A 3TEZA 4MGKE 3HOBA 2XL7A 2XUMA 1YC61 3ILNA 4DMIA 4RFT0 3N7LA 5A6QA 1SDWA 3EB7A 3GHNA 5LBFA 1VAKA 5DUUA 3VV1A 4ASKA 4RR3C 3DYOA 2W94A 4BQWA 4E9KA 2VULA 3WP6A 5BNOC 2TUNA 2XH6A 2Y33A 2VQ0A 4BQYA 3ILRA 1YWKA 5C3PA 3ES1A 5H9PA 4LOTA 4GWIA 1NA1A 2CL2A 1F5FA 3PMSA 3PUIA 4Q4X1 4LA3A 1QWRA 1YCIA 2ZACA 2XWJB 3N7KA 4Y1ZA 1DQ2A 2F17A 2LRPA 5FO7B 1FT9A 3T3YA 4WZFA 3OBTA 2GMMA 1JU3A 5F5IA 2BERA 3VL8A 2ARCA 3OPZA 4GKXA 3HN1A 3AX4A 2QJVA 3B01A 3C3VA 1FOD3 1I9RA 1SFYA 3D0SA 1W8UA 3KGLA 1RUE2 2P6HA 1MZEA 3R05A 4JGYA 2VUCA 5FY1A 1D0GA 4XUPA 1C1LA 2BGCA 2QQOA 3WDWA 5DAQA 3RZMA 1U5XA 4YW2A 2JJ6A 2WO3A 4B1LA 4IE6A 2W68A 4G3YC 4AFMA 1H9PA 4M00A 2EALA 2JDKA 1DFQA 5J7MA 4TLFA 1Q5OA 1FOD1 1RUI2 1E57A 3RMXA 3M3IA 5F3IA 2W39A 3DPRB 3PU8A 5BYNA 4LNVA 1QJFA 4DOUA 1SLIA 3WDUA 4OI0A 5E8AA 2BP6A 5DMYA 2YGLA 3I3BA 2HWC2 4HG6B 4CDXB 4X8NA 4XFHA 4C8DA 2JG8C 4CU6A 3W5NA 1CAUA 4MZUA 1AR72 1UPIA 1UZ0A 1X7NA 4Q4V1 4CP9A 4NHMA 1S0DA 1ZRIA 3RGBA 5LK7B 3GZUC 1TEIA 2EAAA 2Q0AA 1BJQA 2RMU3 2FZ1A 2JG8A 5ERLA 1A78A 5I8SA 2NMNA 3N9LA 2DDUA 5LK5A 3Q9OA 4FO9A 3V0BA 1IHMA 3MI8A 1ZRDA 4AI0A 1OVSA 2YB7A 2HLEA 2D93A 3BGAA 4BQ2A 3UV9A 1QKQA 3J7NA 4P9IA 2B5HA 2HWD2 4N53A 4XYXA 2B7YA 1U12A 4P00B 1W3XA 1QXPA 5FLHA 2RMU1 2A75A 3MPPG 2PHUA 4LMFA 2ARBA 3SNMA 4CCMA 4XUOA 1W2NA 1OD3A 1IQAA 2VTXJ 3K4DA 1AJOA 4NWWA 3RJ2X 5A33A 4ARYA 1LOBA 2GH2A 4KI5M 3DN7A 3NJYA 4DXTA 3IM0A 1KRIA 5JXJA 3TN92 2RR13 2OVUA 5FJKA 2VECA 4EWEA 2V73A 1ZBA3 5GLWA 1UYPA 2IC1A 1GNHA 2ZX1A 5KXCA 4ZS3A 4QPIB 4L97A 5FMBA 4BQ3A 1E5IA 2G9GA 1SACA 1IG3A 3I3QA 4QGNA 4LULA 3VBFB 4GH4A 4QDSA 5JIUA 4KU8A 2RR11 1CAXB 3DL3A 3KVBA 5F32A 5HCBA 5LZ6A 4BXSV 2X05A 1URXA 4O7XA 3WW4A 4XURA 1ENSA 1EUTA 2YUEA 3AZVA 3THTA 4NPMA 4P5HA 1HXS3 1KQRA 1OF4A 1OHFA 2QQMA 2Q30A 3SITA 4U36A 1PMIA 5BNQA 2I74A 4YVSA 4KQ7A 2PMWB 2FDKA 5FRAA 4XXAA 5JOWA 5JXIA 1OFNA 4GQ7A 1RUJ3 2I07B 5FBJA 4N43B 3VGIA 2B42B 1OPOA 1S0IA 4RD7A 1UKGA 3T2OA 1D0HA 3WUDA 1LGNA 2QQIA 3WP4A 1HXS1 1JTZX 2A3YA 2CDOA 2ADDA 4CEYC 3AP9A 1SQ4A 2R0HA 3H3UA 5DPNA 4D6SA 4NRQA 1MEC2 3VKNA 2XONA 1CPMA 4QDQA 5EP9A 5FBZA 1V9U3 1VMFA 1HRI2 2X5IC 1U0AA 5IFTA 4Y33A 5A7WA 4CPBA 1RUJ1 1V6KA 4LR4A 4NO4A 3LD8A 2G19A 3OBAA 2KA3A 3AJZA 5LATA 3DEMA 1WMXA 1VIWB 2W9XA 4IXLA 5DQ0A 5FZ0A 4HKOA 1DBNA 2X5IA 2LS6A 3NV3A 4FP2A 5FYSA 5G04L 2DFBA 2OUJA 1NCRC 2LW8A 1V9U1 1W2UA 1XNDA 4AI2A 1RC6A 3BTXA 3HN3A 1AX1A 5AFBA 2DUQA 5D8AB 3FUOA 2W1QA 3FJSA 3POBA 1EPZA 2CWSA 3IDAA 3NAPA 1WZXA 4YVWB 1S1AA 5FZDA 1DCSA 1NCRA 2PAKA 4RYDA 3UKNA 5LA2A 2WQ4A 1VBE3 2V5DA 3KV9A 3NSTA 4OZXA 4PIZA 4WVMB 5FQ0A 1G9DA 4B4RA 4AVSA 2A7AA 2W1SA 1OOPC 1TMF3 2VR4A 1H2KA 3ZFGA 4HSJA 1XOYA 5J96B 2WFF2 3URFA 2JE8A 4URTA 2IFWA 3J8F2 1GP5A 4E4HA 1K12A 1UX6A 3KCXA 4AEDA 5I8TA 1C5HA 4MXWA 3ACHA 5SV8A 1CPNA 1JZ2A 3Q8FA 4ZPIA 1GICA 1PX4A 2PN5A 1VP6A 4DB5A 1TMF1 3VBSA 5F39A 4UBHA 5C9AC 2YXSA 1GWMA 3AYEA 4A6SA 3S7IA 2FDIA 1O6UA 1UOFA 1ENXA 2TNFA 4MV2A 4H7MA 2XVLA 3I8TA 1OLMA 4O61A 2ZGKA 2XVKA 2PHFA 5FZ6A 5C9AA 2QTWB 4D94A 3WQ7A 1F5JA 2P5BA 4COYA 1QJZA 2VG9A 3CLPA 2VMCA 4Q8KA 1OKOA 2RV9A 2D43A 4LO8A 4FFIA 1FNYA 2JG9B 4PDWB 3M2MA 3AL5A 3VHNA 4D69A 4I0BA 3VDCA 3UKVA 1GP6A 5JPMB 5FZ8A 1OURA 5LEJA 4YW1A 4AEMA 5A3LA 4YFWA 4CEWA 2OXBA 5FLJA 5GLUA 3WY6A 4ZU4A 4GMP1 3NJXA 2WZR3 4CXWA 2A73B 4Q26A 4E27A 3B94A 3AB0A 3LWCA 1ND2B 1EUUA 1ZA7A 3CU7A 5T5PA 4BXFA 1BHGA 4D6QA 1F31A 4LO5B 2XR4A 2R1DA 1W06A 3N7JA 5A32B 5GLZA 3UJQA 2IXLA 3ME2A 1W8FA 1UCXA 1KFUL 3H9AA 4GWNA 4QT6A 1LHOA 2IWGB 4FXKB 4MGSA 1NOVA 4LK6A 3K48A 2C1FA 1CAWA 3WLUA 3N9PA 3JD72 4CP2A 1RUC1 1S0EA 5FMDA 4A44A 1NE6A 5FZCA 3ZXDA 1LU1A 4YG6A 4LKSA 3WOGA 1UX7A 4AEKA 3MBWA 4D7SA 4HETA 1AR62 4XZUG 4JTNA 2AENA 2R49A 3ACFA 2UWAA 2JENA 2CGNA 2B39A 4ORFA 1NA1B 3A23A 4X6RB 5LBEA 4YPJA 5JXHA 5T5JA 1IKPA 4O9EA 3VBRC 3MHZA 2D3RA 3WXPA 5I93A 1UQXA 1H1MA 1FPN3 4IEPA 5F8PA 3OUIA 3CO2A 4AQ2A 2XJVA 5JUVA 3KCCA 3VHPA 4DY5A 2R6QA 3DGTA 2XDVA 4PJYA 5F5CA 4UT5A 4QX8A 4JGYB 4GWMA 2AEYA 3OGJA 4BIOA 2ET7A 2HEYF 2JE7A 4TWTA 2Q8OA 2J7MA 1MZ5A 2RS51 2ILMA 3LDBA 4K20A 1L3JA 5JZGA 4Q5OA 4C0HA 4UF0A 4AVAA 4DY3A 1OQDA 2VW1A 5FXXA 1KEXA 3S5QA 2ZAAA 3AVRA 4JAAA 3VBSC 3IB3A 3ZOIA 4OQ8A 4IEQA 1X33A 1PMJX 3KT7A 1UY1A 3POEA 3MLKA 2CY6A 4C1XA 5HPOA 4AVTA 4QM9A 2XPJA 2Y64A 2W2IA 4EN7B 3WR0A 3HQUA 1VBD2 2E7TA 4QQPA 5EWSA 2FMDA 4FAHA 1OXCA 1X50A 2VTFA 3UGGA 4E4SA 3L2YA 1CAUB 1R082 1YQ5A 3FBYA
chains in the Genus database with same CATH topology
4O61A 4QKFA 3BI3A 4NPLA 4CXXA 4NRMA 3O1PA 3O1TA 4NIGA 3T4VA 3O1OA 3BIEA 2FDGA 4QHOA 4ZHNA 4ZS3A 4NIHA 4MGTA 3I3QA 4IE4A 4QKNA 3O1SA 4CXWA 3O1UA 3RZHA 4O7XA 4NPMA 3S5AA 4CXYA 3O1VA 3S57A 3H8XA 3KHCA 4NROA 2FDKA 3RZLA 3T3YA 2IUWA 3BTYA 3I3MA 2FD8A 4NRQA 3RZKA 4ZS2A 3LFMA 3O1MA 4IE7A 3BKZA 3RZMA 4IE6A 5DABA 4MG2A 5F8PA 3RZGA 3BTXA 3BTZA 3BUCA 3O1RA 3I2OA 3I49A 4IE0A 4NRPA 4IDZA 4JHTA 4IE5A 3BU0A 4NIIA 3KHBA 2FDJA 3RZJA 4NJ4A 4OCTA 2FDHA 3T4HB 3H8RA 2FDFA 4NIDA 3H8OA 4QKDA 4QKBA 4RFRB 2FDIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O61 A;  4QKF A;  3BI3 A;  4NPL A;  4CXX A;  4NRM A;  3O1P A;  3O1T A;  4NIG A;  3T4V A;  3O1O A;  3BIE A;  2FDG A;  4QHO A;  4ZHN A;  4ZS3 A;  4NIH A;  4MGT A;  3I3Q A;  4IE4 A;  4QKN A;  3O1S A;  4CXW A;  3O1U A;  3RZH A;  4O7X A;  4NPM A;  3S5A A;  4CXY A;  3O1V A;  3S57 A;  3H8X A;  3KHC A;  4NRO A;  2FDK A;  3RZL A;  3T3Y A;  2IUW A;  3BTY A;  3I3M A;  2FD8 A;  4NRQ A;  3RZK A;  4ZS2 A;  3LFM A;  3O1M A;  4IE7 A;  3BKZ A;  3RZM A;  4IE6 A;  5DAB A;  4MG2 A;  5F8P A;  3RZG A;  3BTX A;  3BTZ A;  3BUC A;  3O1R A;  3I2O A;  3I49 A;  4IE0 A;  4NRP A;  4IDZ A;  4JHT A;  4IE5 A;  3BU0 A;  4NII A;  3KHB A;  2FDJ A;  3RZJ A;  4NJ4 A;  4OCT A;  2FDH A;  3T4H B;  3H8R A;  2FDF A;  4NID A;  3H8O A;  4QKD A;  4QKB A;  4RFR B;  2FDI A; 
#chains in the Genus database with same CATH topology
 1NXD 1;  1WKY A;  3ZSJ A;  4CP9 B;  1DLC A;  1O4Z A;  3HBK A;  3HBZ A;  1FMD 3;  2Y60 A;  1RMU 2;  2JG8 B;  1Y3T A;  2WL1 A;  4Q1R A;  1QDC A;  3BIE A;  4JDO A;  3E5X A;  1DHK B;  1NLR A;  1L7L A;  1VAV A;  4XUQ A;  5FY5 A;  3III A;  3P3N A;  5A6Y A;  3V0B B;  3CHX A;  4XXP A;  5FWJ A;  4QQH A;  2XLA A;  3WDX A;  4NUB A;  4CCE A;  1WW4 A;  2C0Z A;  1XBF A;  4GZ9 A;  1HLC A;  3UJO A;  4RL7 A;  2VMH A;  3EJK A;  4N53 B;  4DXS A;  3EBR A;  1V00 A;  4XET A;  4BMB A;  1O3T A;  1QNY A;  4HFS A;  4RGG A;  1W9T A;  5A7Q A;  1GZW A;  2P3K A;  4AGR A;  1LHV A;  3BU7 A;  3VDB A;  5DN2 A;  3BPS A;  5FZB A;  2VNO A;  3WDY A;  4DXR A;  4RHV 2;  2WO1 A;  2XLF A;  4BIF A;  2PHD A;  3NW4 A;  5A33 B;  2ZCW A;  3NKG A;  2VCB A;  3GZE A;  2ZGR A;  1LB2 A;  2O8Q A;  1JZ5 A;  2C24 A;  1OD5 A;  5F2S A;  4A7Y A;  3B93 A;  5LCW L;  2Z42 A;  4P08 A;  4QX1 A;  4A6O A;  3BOD A;  4CXY A;  5C8C B;  3O5S A;  1GKB A;  2B45 X;  1MS0 A;  5E16 A;  1PGL 1;  5DDJ 2;  3KZ4 C;  1PZ7 A;  4AZZ A;  1MAC A;  3VBO C;  1LED A;  2P17 A;  4JCK A;  2R7E B;  1RUG 1;  2D6L X;  1RUH 3;  2VOX A;  2YRO A;  3AKQ A;  3K4A A;  4GH4 B;  5FZ7 A;  1QQP 2;  5A7O A;  1NQJ A;  2WYS A;  4IV1 B;  3AMQ A;  1LUL A;  4UBG A;  3VBO A;  3OJB A;  4SLI A;  3I3M A;  3FE5 A;  2CAV A;  1POQ A;  2DU0 A;  4W65 A;  1J58 A;  2VOT A;  3L2H A;  2H6B A;  4CPB D;  3WNN A;  4ET7 A;  3N9N A;  1JN2 P;  1HJG A;  3B69 A;  4AFC A;  2CAU A;  4Z2A A;  2UUR A;  4WZC A;  1CWP A;  4YVS B;  5FY9 A;  4MET A;  4BQ1 A;  2ENR A;  3ZYJ B;  1RUH 1;  3P6B A;  3ETQ A;  4DUX A;  2GME A;  2XGX A;  1P8J A;  3VD4 A;  1RIN A;  4TLG A;  5I0D A;  2XML A;  1JYC A;  3I54 A;  5D1I A;  1NQD A;  3KVA A;  4HN1 A;  4FFG A;  2ZHM A;  5IVV A;  4H7L A;  2VZP A;  4LHK A;  4QPG C;  1F4H A;  2DCK A;  1EAH 2;  1AR8 1;  2V5Y A;  1IPK A;  2WIN B;  2ZX0 A;  3T2T A;  1QU0 A;  3TRS B;  4UFK A;  1AVB A;  3HD8 B;  5E88 A;  5FMC A;  1XC6 A;  3K2O A;  4Q2F A;  4GWJ A;  2HKX A;  3POS A;  3SCG A;  2ORX A;  4CCC A;  2LTN A;  2ZEW A;  2WNV C;  3HJR A;  3WW2 A;  1I3H A;  1TNR A;  1WME A;  3G7D A;  4Q4W 1;  3GZT B;  3TEX A;  1UD1 A;  2WII B;  1N3P A;  4YZ1 A;  4IE5 A;  1RUE 3;  1B35 A;  4CYD A;  1MS4 A;  1S0C A;  4AI9 A;  3O0V A;  2R16 A;  3M70 A;  4AAX A;  2JDZ A;  4PQ9 A;  2FDJ A;  2YV8 A;  4ZU7 A;  2GC3 A;  1HRV 3;  4IES A;  4JGZ C;  2NLR A;  1UYZ A;  5C3R A;  5C70 A;  5A1A A;  3PVE A;  3NAP B;  1LOF C;  1RUI 3;  5GM0 A;  1NCR B;  4LIT A;  4N7I A;  3POW A;  1RUE 1;  4NID A;  2NP0 A;  2VZ3 A;  1K5M C;  1KJR A;  5C5T A;  4XJ9 A;  4QKB A;  3MDP A;  1VB4 A;  1VBB 2;  3A7Q A;  3IDC B;  1QJU 2;  3ENR A;  1LEC A;  5T52 A;  1HRV 1;  4D7Y A;  3RS6 A;  3ZFG B;  2HWC 3;  5CKM A;  2VCC A;  1K5M A;  2PLV 2;  2AC1 A;  1VBA 2;  2CGO A;  2W3J A;  2ARX A;  4KWK A;  5C3O A;  1RJ8 A;  1V6M A;  3BPZ A;  1OUX A;  5HXM A;  5ANQ A;  2PHL A;  3CZJ A;  4LBM A;  1AR7 3;  4AED B;  3PUH A;  3FHI B;  3GDB A;  4MXW B;  1PO2 1;  3G6J B;  5KHI A;  4ASM B;  1R09 2;  5C7G A;  4A45 A;  4GJZ A;  1C8N A;  4L0P A;  3VBS B;  1NE4 A;  1W90 A;  2HWF 2;  2Y6H A;  3E97 A;  2HWC 1;  4QQO A;  2DVG A;  3W21 A;  1OLM E;  4XF1 A;  4DUV A;  3AYD A;  4COV A;  3GZA A;  3RI9 A;  2WZP P;  2Q8D A;  4YM0 A;  1FAT A;  1N3O A;  1AR7 1;  1LOA A;  3HNM A;  1SDD B;  2HWD 3;  2VZU A;  1APN A;  1QJE A;  2VBD A;  3B00 A;  2SBA A;  3E5Q A;  4XQ4 A;  2WR9 A;  1N3Q A;  1US2 A;  5FKC A;  1QNW A;  5FZO A;  1PK6 C;  5A3W A;  4UFM A;  5C3Q A;  4P9G A;  2P3Y A;  3IAP A;  1X82 A;  4Q27 A;  4YLZ A;  5FYY A;  2HYX A;  2P6C A;  3WD5 A;  3QCW A;  4Z2W A;  4YW3 A;  4S2G A;  2XQR A;  5CU1 A;  3MFA A;  2BNO A;  3PVO A;  4B7E A;  2AR6 A;  1JW6 A;  1PK6 A;  5F5Q A;  4R9C A;  1DZT A;  2W52 A;  4GAZ A;  3R4S A;  3TN9 3;  3NMB A;  2HWD 1;  4CEW B;  1VJ2 A;  4FP3 A;  1N1T A;  2FCT A;  2JDP A;  1G8W A;  5GJ6 A;  4Y20 A;  2D6N A;  2QCS B;  3WG4 A;  2BWA A;  3S0M A;  2Q5T A;  1W6P A;  4QPY A;  3JB8 A;  5DG2 A;  4PCR A;  1DLL A;  2H0V A;  3TN9 1;  3H50 A;  3OGG A;  3KF5 A;  3OYW A;  2P1B A;  4K9S A;  2PQS A;  5FZA A;  3CJX A;  4COZ A;  1S4C A;  1YXW A;  1CAW B;  2BGO A;  4XMI A;  4OHV A;  1O91 A;  5FZI A;  2BTV C;  4BYY A;  4EN6 B;  2JKX A;  2HJI A;  4QB1 A;  4HXC A;  4NHY A;  5IWF A;  4CU8 A;  2H6C A;  1SPP B;  3BTZ A;  2IXJ A;  2NM1 A;  3POG A;  2Z69 A;  3CEW A;  5A3T A;  1MZF A;  3GBF A;  3U78 A;  1GQH A;  1I5P A;  1ULE A;  2WSV A;  2Y34 A;  1W8N A;  2ZEX A;  3ZN6 A;  4IEZ A;  1RUO A;  2VOV A;  1MEC 3;  4MLO A;  3WNO A;  3D0J A;  1DQ4 A;  2X10 A;  1HRI 3;  1D4V B;  1UOG A;  2O0O A;  4XF3 A;  1LHW A;  3SH4 A;  5HI0 A;  3IKW A;  1Z7S 2;  3VD9 A;  2HWE 2;  5G05 L;  5IK4 A;  2YZ4 A;  4KL1 A;  3H7J A;  4HPK A;  5JPN B;  1HIX A;  5BNN A;  3RZJ A;  3ZXG A;  1UY4 A;  2FDH A;  3KQR A;  3T4H B;  1AYM 2;  2QDR A;  3BCW A;  3VZN A;  3I2H A;  1N1Y A;  1GR3 A;  1NCQ C;  2J1A A;  3E5U A;  3ZFE A;  1T6G C;  4YW7 A;  4RGK A;  4CDW A;  5F7U A;  1HRI 1;  3P3P A;  1FXZ A;  2BGP A;  2H0B A;  2Y0I A;  3U11 A;  5JZG B;  2GND A;  1I5Z A;  2ZML A;  4LXL A;  1LEM A;  3A4U A;  3AKR A;  5DZE A;  3WNX A;  1HB3 A;  3KF3 A;  3TEW A;  4UF0 B;  3SCH A;  1ASJ 1;  3WX5 A;  2UWB A;  3Q8A A;  4QD2 A;  3ABZ A;  2ETE A;  4I30 A;  1CJD A;  2EXK A;  5FZE A;  4TTG A;  3LEK A;  1FV3 A;  1JZ4 A;  1W8T A;  5FZ9 A;  1VE0 A;  1WUV A;  4G9S B;  2XJR A;  2IVJ A;  3IDE A;  2WFF 3;  1W03 A;  3NNM A;  3J8F 3;  3TOJ A;  1DDL A;  1W6O A;  1GLH A;  1O8S A;  2VCM A;  1AYN 1;  3MW3 A;  1PNG A;  3J4U H;  3D8C A;  4RA0 A;  2A3W A;  4Y5Z 0;  3DV8 A;  5EYY A;  4FPK A;  1SZB A;  2X29 A;  1WLW A;  4AVB A;  3O1S A;  5BNP A;  3AP7 A;  3SHR A;  1BZW A;  1NZI A;  2Y38 A;  4NWV A;  3I4I A;  4LBO A;  4DRV A;  2R07 1;  5FYH A;  2B8M A;  2WO7 A;  4X8P A;  3T0A A;  1VBC 1;  3DYP A;  3THD A;  4ZZ8 A;  1COV 1;  3N36 A;  2BNM A;  1Q43 A;  3S57 A;  3I2G A;  1JXN A;  5F6L B;  3RI8 A;  3VBU C;  3LF7 A;  1QIQ A;  1DYO A;  2VME A;  4XFF A;  5CFC A;  5ABJ C;  3PJQ A;  5J09 A;  3MV0 1;  1LNS A;  1MS1 A;  2VU9 A;  5FTT C;  1CN1 A;  3SEP A;  4EE2 A;  1GZW B;  1SBD A;  4BLJ A;  2L9L A;  3I2I A;  3JQX A;  3VKL A;  5SV5 A;  2YHJ A;  1DQ1 A;  5FZL A;  2VY0 A;  2VQA A;  5FKB A;  4X6Q B;  4B4Q A;  1UO9 A;  1XB9 A;  3VDD C;  1AJK A;  1RUD 2;  3JBG 2;  3RDI A;  4XJU A;  3NNJ A;  1YHF A;  3UK9 A;  2WWJ A;  3OCP A;  1VR3 A;  2DVA A;  1QEX A;  2VZO A;  1WA4 A;  1OC1 A;  5IFP A;  2QFE A;  4GUL A;  4XHB A;  3J7L A;  1OA4 A;  5FYU A;  2Q1M A;  3MF6 A;  4PHZ A;  2OS2 A;  2ARA A;  2VH9 A;  4XW3 A;  4CU7 A;  1AXY A;  1OFS A;  4XUN A;  1UOJ A;  4RR3 A;  4Y22 A;  4UFL A;  1QJY 2;  5GZD A;  2VQT A;  5DUV A;  3SLI A;  1V6O A;  2LM3 A;  5BNO A;  1YRZ A;  2ATF A;  1NZC A;  3ORJ A;  4XDQ A;  4CDU C;  1SFN A;  3JD7 3;  4XDP A;  3KV4 A;  3MV1 1;  2WT1 A;  1GMM A;  3MIB A;  4HVR A;  1A8D A;  5FO8 B;  3SCF A;  1KJL A;  1GSL A;  3ZVX A;  2RDS A;  1XRU A;  3BIW E;  3TBD A;  1AR6 3;  1W0N A;  2Z79 A;  1W2T A;  1REF A;  4NRP A;  3SKJ E;  4AGG A;  4IDZ A;  4JHT A;  4NPR A;  5B4N A;  3MF9 A;  3MO4 A;  2EID A;  4IV3 C;  4OMC A;  3LPG A;  1AHS A;  3E6B A;  5A7N A;  4JVA A;  2R06 2;  5LBC A;  4A42 A;  1UKR A;  4MXV A;  1BBT 2;  4UW6 A;  5BUV A;  1SFP A;  3JZV A;  1OSG A;  4XAB A;  1L7Q A;  1PMH X;  2YBS A;  5GKA C;  1BVV A;  1AR6 1;  3HPN A;  2D5H A;  1XSQ A;  3FMG A;  3RPQ A;  4MGZ E;  3H8O A;  4D3W A;  2HBU A;  1PGW 2;  4OI1 A;  1Y9M A;  1BKZ A;  5FOB B;  1B35 B;  1UY2 A;  4LIU A;  4I3G A;  2XB6 C;  3JQW A;  4Q29 A;  3UNP A;  5K8S A;  2QQP A;  3FLP A;  1CJP A;  2DF7 A;  3IDB B;  2E9Q A;  1X9P A;  2FMY A;  5FIX A;  3ZX7 A;  5LW9 A;  5FY0 A;  1GNZ A;  4NIG A;  5ACA 2;  1O8P A;  3VZJ A;  5L9R A;  4BU2 A;  2DUP A;  4FQZ A;  1W8H A;  2D6K A;  1ENR A;  2EXJ A;  2OX0 A;  4W4Z A;  2OII A;  5KHJ A;  4AEJ A;  2BVB A;  4PQQ A;  1PNF A;  5CKN A;  2D7F A;  1ND3 C;  4L92 A;  5F1R A;  4Q0U A;  3PL0 A;  4TXW A;  4ZKT B;  2ZPX A;  1UOB A;  5LY2 A;  1W6M A;  1RUF 2;  1HB1 A;  2AUY A;  2JIG A;  4Z07 A;  4ZY9 A;  4CTE A;  4HVQ A;  5AFE A;  4ISQ A;  1MS5 A;  2GP3 A;  5KWR A;  1UY3 A;  4FSJ A;  1K5M B;  1VBD 3;  5A80 A;  1H2M A;  3DXU A;  4Y5S A;  3ALQ A;  4A3Z A;  1NAE A;  1LEN A;  4YG0 A;  3RFR A;  1R08 3;  3OY8 A;  4CDQ C;  2UY9 A;  4BH9 A;  3QBQ A;  4OLL A;  2DCJ A;  5DXD A;  3A0N A;  1GNY A;  3FWE A;  3W59 A;  1RMU 3;  3UL2 A;  1ZRE A;  5FK8 A;  3SH3 A;  3H8U A;  2BVV A;  3KHC A;  3PNA A;  3RNS A;  1VBD 1;  2YGM A;  2UWC A;  3RZL A;  4CCN A;  2UU8 A;  1JUI A;  4Q0S A;  1R08 1;  3AXD A;  4JKL A;  2WLP A;  5I8Y A;  2O14 A;  1FAY A;  2IUW A;  1LHU A;  5IYY A;  3V0A A;  4UW3 A;  5FZO B;  1F35 A;  1ZBE 3;  1YI9 A;  2JEM A;  3KCY A;  3QLQ A;  4LBL A;  3HT2 A;  2YFZ A;  2JB4 A;  2GNM A;  2DUO A;  1ZBA 1;  2WFP A;  4RHV 3;  2VVE A;  4S2D A;  4B7K A;  4BK4 A;  2P3I A;  3H3Z A;  4Z1V A;  1W9F A;  3NL1 A;  3J7M A;  4J1W A;  4BB3 A;  3B02 A;  1DU3 D;  4ISR A;  4F83 A;  1ZBE 1;  4FCA A;  3HNY M;  3B7M A;  1PHM A;  3CQO A;  1MZ6 A;  1MS3 A;  4Y20 B;  5DDJ 3;  3AYC A;  4DEV A;  3ZR5 A;  1W6P B;  4HBN A;  4RHV 1;  1XNC A;  3POF A;  4NVP A;  3ZLI A;  3LA7 A;  5CFD C;  1QQP 3;  2WNU B;  3K75 B;  4ATE A;  4A7K A;  2EIG A;  4K8R B;  3WP5 A;  3LOI A;  3D4K A;  4K21 A;  2BWC A;  4IE0 A;  5GZC A;  3OYW B;  3EYP A;  2BV4 A;  1WBL A;  3IT8 A;  4XUT A;  5KHK A;  5K0U B;  4NHL A;  5DDJ 1;  4YM1 A;  4CEY A;  1LOD A;  2VBB A;  2DBI A;  3KHB A;  5FZM A;  1QQP 1;  2YC2 A;  2KM2 A;  3O12 A;  4K40 A;  4NN0 A;  4YGD A;  4BE3 A;  3GNE A;  4FPY A;  2WO2 A;  2DFC A;  1ZZ7 A;  2DCT A;  3ZYR A;  1YUD A;  4A7Z A;  1VMH A;  2R04 2;  1EAH 3;  2WAA A;  5GAL A;  3MID A;  5JMO A;  1BYH A;  3ZPO A;  4B8E A;  4JKK A;  3ZN6 B;  3MFC A;  1CAV A;  3OPT A;  3QH6 A;  4RQP C;  3HWJ A;  2J1S A;  4C0B A;  1NT0 A;  5EQU A;  4PLM A;  4RFR B;  1DP0 A;  1DQ0 A;  4DXZ A;  4J1X A;  3IMN A;  2TEP A;  3I3E A;  4QKF A;  4FOQ A;  2RS3 3;  4HPK B;  1EAH 1;  1XJA A;  4R9B A;  5FP8 A;  1EV1 2;  2V09 A;  4C1W A;  5BNN B;  1V70 A;  2E7Q A;  4I3P A;  3T4V A;  3ZN4 A;  2GZW A;  3K4Z A;  3D5O A;  3DYM A;  4Q0P A;  3AXE A;  4BA6 A;  4QHO A;  1S55 A;  3VZL A;  2R0F A;  3ZFE B;  4QB2 A;  2JX9 A;  4AFA A;  1VLN A;  4QHZ A;  4CDW B;  2WWS A;  4M4P A;  1MVQ A;  1WW6 A;  2JXA A;  3POY A;  1OOP A;  5EJ1 B;  3LA3 A;  1VBE 1;  3DUI A;  4GJY A;  4PT6 A;  3SKV A;  1W28 A;  2RS3 1;  1Y9G A;  4HK9 A;  4BHP A;  3GF6 A;  4XIO A;  1NX9 A;  5I0S A;  2WN2 A;  3M8L A;  4QKN A;  1AXK A;  2UY8 A;  3LDR A;  4LOS A;  4MUV A;  1V6L A;  1VBB 3;  4P9J A;  1QJU 3;  1UXX X;  4YM2 A;  5A7S A;  4ITC A;  2IZW A;  5FUI A;  1F8V A;  3ZXL A;  1W8W A;  2PLV 3;  1VBA 3;  2JDH A;  3S5A A;  1LOG A;  2EVX A;  4Y5T A;  1RL3 A;  5A3O A;  1YFW A;  1W6O B;  5F3C A;  1HV0 A;  3LB9 A;  1BMV 2;  2IXH A;  1IS3 A;  2QQJ A;  1VBB 1;  3F95 A;  5H9R A;  1QJU 1;  5T55 A;  1R09 3;  2C26 A;  1YIF A;  4FQ4 A;  2JE9 A;  2WA4 A;  4P14 A;  3ASI A;  3RSJ A;  5BNP B;  2HWF 3;  1MQT B;  2PLV 1;  2RJK A;  3ZYF A;  2E26 A;  3SMH A;  1LTE A;  2WWU A;  1JOP A;  3ZFF C;  1U5Y A;  5J3U A;  4L9B A;  1Z78 A;  1H6Y A;  4DFS A;  1X8E A;  4A3X A;  3BKZ A;  4EQV A;  5A3M A;  5CFC B;  2DCY A;  4A41 A;  2HWF 1;  3KWV A;  2FHR A;  2RJL A;  4I0W B;  5FPU A;  2J42 A;  1MPX A;  1Y43 B;  4JTO A;  4QHB A;  3USU A;  3KT4 A;  4AG4 A;  1RTV A;  2WZR 1;  3FFQ A;  2WT0 A;  4P5Y A;  4RS5 C;  4WM7 C;  3TAY A;  1UL9 A;  3M3Q A;  4Q4X 2;  4YW6 A;  2XJQ A;  3EXU A;  3IIA A;  3MYX A;  3ZYB A;  4XFB A;  2VZ1 A;  2D97 A;  2W95 A;  4DUW A;  1H2N A;  2EF6 A;  2WBK A;  3O1R A;  3O1M A;  1C1F A;  1GZ9 A;  1PZ8 A;  3N7M A;  1QOS A;  4WM7 A;  2ZXQ A;  1W3V A;  3HIF A;  3MUZ 1;  4IEW A;  4R9A A;  1WA6 X;  1CVN A;  2VW2 A;  1LCL A;  3CJI C;  3B5L B;  1F15 A;  3UES A;  4M3C F;  5F6K A;  2DV9 A;  4RR3 B;  3B9C A;  4Y22 B;  4MGQ A;  3UGH A;  5KHH A;  2VMD A;  1DZR A;  5BNO B;  1HB2 A;  1WD4 A;  2WZ8 A;  3CJI A;  2Y6J A;  2C9A A;  4FTB A;  4YM3 A;  3H8R A;  4AXO A;  2WAO A;  2ZKL A;  1JZ7 A;  4K6B A;  5CVR A;  1AL2 2;  1VAM A;  1FX5 A;  4FI9 A;  4JC1 A;  4XAA A;  3VBR A;  1SMV A;  2ZGQ A;  3LEM A;  1JHN A;  4BQ5 A;  1LES A;  1Q3E A;  4XMA A;  4H2A A;  5HV0 A;  3LGR A;  3ZXK A;  5C4W C;  3LCP A;  2VTX A;  2BYV E;  2A1X A;  4QDR A;  4AHX A;  2A71 A;  1A6C A;  1FPN 1;  2WAB A;  3I2D A;  5F5A A;  1R1Z A;  4Y4Y A;  1POV 0;  1QH7 A;  3UGF A;  3OUH A;  2VD7 A;  4IET A;  1HV1 A;  1OH3 A;  2BJS A;  4NR1 A;  4QPW A;  2ZEY A;  2IFR A;  2ZKN A;  2ZGO A;  4YYO A;  3CIH A;  4XPV A;  4N8M A;  1O7F A;  1Z7S 3;  4XQD A;  3GHM A;  2HWE 3;  4GD4 A;  2GN3 A;  5IT6 A;  1BEV 2;  1WCK A;  1J3Q A;  4NHK A;  5CIS A;  3C7E A;  3DF0 A;  4Q4V 2;  2YU1 A;  5HCA A;  1US3 A;  1AYM 3;  1LOC A;  5F3G A;  3HMY A;  4Q0V A;  4YG3 A;  3KD4 A;  4IE4 A;  4XVH A;  4URA A;  5FZK A;  4N7U A;  2JWP A;  4G4F A;  1Z7S 1;  2HWE 1;  1C28 A;  1OPM A;  1ENQ A;  2NPI A;  2ZGS A;  4HSL A;  2NN8 A;  4Y1X A;  3ZIX A;  4MO3 M;  4R4Z A;  3HR9 A;  5HBA A;  1PGS A;  1AYM 1;  1DGR A;  3A21 A;  1ALY A;  1QXJ A;  5T5L A;  1SBF A;  3ZIW A;  2QE3 A;  1H30 A;  1BK1 A;  1UZW A;  3M3C A;  4NRO A;  1UXZ A;  3LZZ A;  3H42 B;  4LBQ D;  1W6M B;  4AGV A;  4QAW A;  1W8Z A;  4XQW A;  2VNV A;  3U1X A;  3F2Z A;  1ULC A;  1WCQ A;  1YIP A;  2RE9 A;  2BZD A;  4WM8 C;  1IS6 A;  3POI A;  4MAD A;  3HNB M;  3ZO0 B;  3U4S A;  2D3S A;  5LRS A;  1DGR N;  1FMD 1;  4QXC A;  1S2K A;  3B3Q E;  3O0X A;  3OY8 B;  2BU9 A;  1KD7 A;  3WCS A;  3MIC A;  1DG6 A;  5IAX A;  2XBO 2;  1ZNP A;  1IS5 A;  1U5I A;  3ZM8 A;  4AHW A;  2RHP A;  1H4H A;  1RVF 2;  1YNA A;  3BTA A;  2WYF A;  1V6J A;  3M7A A;  3QAC A;  1Q8P A;  1JU4 A;  5FMO L;  5L7O C;  2YU2 A;  3R0R A;  3RVH A;  4CP0 A;  4PBP A;  1QOO A;  3NKT A;  4AE2 A;  5JDB A;  2PHT A;  1D7P M;  2F4L A;  1GWL A;  1S0J A;  1ULG A;  4MVT A;  5EV7 A;  5L7O A;  5FZ3 A;  1OQ1 A;  2OZ6 A;  2TBV A;  1QXR A;  3V0A B;  5GZE A;  4AWD A;  5DAX A;  5FXZ A;  2VVD A;  4E2S A;  3I2K A;  1YQC A;  1ZRC A;  1Q8S A;  5CYY A;  2SLI A;  3O7O A;  2F6B A;  2KXL A;  3ILF A;  4PF1 A;  2QQW A;  4KG8 A;  3WDT A;  3S6P A;  1RXG A;  2ZHL A;  1A34 A;  2W87 A;  1QJX 2;  1RUD 3;  2YDE A;  3BN6 A;  1ZZ9 A;  3JBG 3;  3WG2 A;  2YBP A;  1O4T A;  3HEI A;  1Q8V A;  3LPF A;  1W0O A;  3MLL A;  3PTY A;  2Y0O A;  3SXW A;  4DO0 A;  3WF4 A;  1ODN A;  5CG9 A;  4P9W A;  2QQK A;  4OCT A;  2XUE A;  4R4X A;  2FBE A;  2DTY A;  4F7Z A;  1I6X A;  3AKP A;  4AW7 A;  4LO4 B;  5ACA 3;  4CUA A;  1U5Z A;  1UAI A;  3OUJ A;  2WDB A;  2DYC A;  2JD9 A;  3JBG 1;  3AYA A;  4UFH A;  5A1L A;  5FYI A;  1R1A 2;  3ZMO A;  1XE0 A;  2VCA A;  3ZKU A;  3DKW A;  1V9U 2;  4FFH A;  1UNB A;  4Q4Y 2;  2QKD A;  1XYO A;  4QKD A;  4QPG A;  2XJT A;  5A7W B;  5C5U A;  4I02 A;  4CEY B;  1CZV A;  5LA0 A;  1S0F A;  1NKG A;  4GXL A;  5IVY A;  4OHW A;  3T09 A;  2PEL A;  1J84 A;  4KWU A;  1N1V A;  1WLT A;  1K45 A;  2X5I B;  3FX3 A;  1SLT A;  2O1Q A;  5CB7 A;  4CCL A;  3LA2 A;  3ZYI B;  3O1P A;  4CUC A;  2E63 A;  2GN7 A;  1SHW B;  2I2S A;  2WNV A;  2BNN A;  3BOP A;  3I97 A;  3U14 A;  1WMF A;  4HVO A;  4PLO A;  4OHZ A;  3V65 A;  4ZHN A;  1TVG A;  1D2S A;  1DGL A;  1W6N A;  3DPR C;  4LEJ A;  2BQP A;  4JDN A;  5DAP A;  2BBV A;  3J7H A;  1BBT 3;  4NOT A;  1CAV B;  1XSR A;  3T0D A;  5KBF A;  4OUS A;  3UYJ A;  1G9C A;  5LA1 A;  4LIV A;  5DZF A;  3WEZ A;  3DPR A;  2VBP A;  4OI4 A;  4Q8L A;  4JGZ A;  2VOK A;  4PF5 A;  4FPH A;  5FQ0 B;  4CDX C;  4CRQ A;  1XNB A;  1W9W A;  3R4D B;  2VXJ A;  3CZU A;  1LOF A;  2X8K A;  4FPG A;  5E6H A;  3TNQ A;  3VBH C;  1XE7 A;  5JLV A;  1IQD C;  3AZX A;  5KXD A;  3DEC A;  1BBT 1;  1VRB A;  4JRL A;  2YC0 A;  1KS4 A;  3CMG A;  1TE1 B;  1IZ3 A;  4EWD A;  1RUI 1;  1QF3 A;  1JZ8 A;  4QX3 A;  2BFU L;  3VBH A;  3H8X A;  1POV 3;  3AZZ A;  1NLS A;  2QUO A;  1OOP B;  5EPA A;  4XDO A;  4AHZ A;  1PGW 1;  1DGW X;  4IER A;  4IUG A;  5TSW A;  3WP3 A;  2B46 X;  3ELN A;  1CX1 A;  4UI9 L;  5FWE A;  2UYB A;  3ZSL A;  1QGL A;  4IGO A;  3U10 A;  3GCW A;  1AR9 2;  4QGM A;  1UMI A;  4UOJ A;  2OPW A;  4NIA A;  1EP0 A;  4BQ4 A;  1RUF 3;  3IPV A;  5FYB A;  2Y6L A;  1POV 1;  1O3Q A;  5C9A B;  3MW4 A;  2KR2 A;  2Y26 A;  4IE7 A;  1VRH 2;  4H14 A;  3WSO A;  1TQ5 A;  2A6V A;  4R52 A;  5JCT A;  4JZR A;  4FAG A;  1XYN A;  2K46 A;  2XKO A;  1YO8 A;  2ZGP A;  4BM8 A;  5A1F A;  4DEQ A;  1ZX5 A;  3KS7 A;  3LIG A;  4J6G A;  2ZX4 A;  1D4M 2;  4GKY A;  3L9J T;  4QPI C;  2FQP A;  3H0O A;  5J36 A;  4TN7 A;  1GQP A;  5DUW A;  2Q1Z B;  2E32 A;  3VBF C;  3PDQ A;  2MEV 2;  4W50 A;  1O3S A;  4DIQ A;  3RWK X;  1A3K A;  2DBN A;  4LE4 A;  3ZKY A;  1JS9 A;  1Q8Q A;  1RUC 2;  4IL7 A;  1GZC A;  4F3J A;  3I2O A;  2VMI A;  3JU9 A;  2A3X A;  2VUD A;  4LKD A;  5J1X A;  2EIE A;  2RVA A;  4FPC A;  1B09 A;  4YSF A;  2F4P A;  5T3N A;  1XNK A;  3VZO A;  1ZRR A;  2GAL A;  1LU2 A;  5LAS A;  4AR2 A;  4LUK A;  4DPN A;  3W9A A;  4EJR A;  4N43 C;  2D6P A;  5LEK A;  4PI0 A;  1J83 A;  5FP4 A;  4EV0 A;  1SLC A;  2OKX A;  2Z5W A;  2VJX A;  4KGQ A;  3ZSM A;  1YJK A;  5IAT A;  2LRO A;  1UYX A;  4EN0 A;  4WM7 B;  4CVU A;  4PIY A;  3AKT A;  4Y1Y A;  2WS9 2;  2XLG A;  1YQ2 A;  5IVB A;  3ZXJ A;  5K4L A;  4OQ9 A;  3WG1 A;  3H7Y A;  5CA6 A;  3A22 A;  5JOZ A;  4OUL A;  1ZM1 A;  1J1T A;  4E8D A;  3J26 N;  3WVJ A;  4COU A;  4CXX A;  1G9F A;  2RS5 2;  3FBM A;  4C90 A;  2ZZJ A;  3C2U A;  2AH2 A;  4KH9 A;  5FYZ A;  4UYB A;  2ZGN A;  3QH7 A;  3CKH A;  2I45 A;  3RYP A;  1WBF A;  1X9T A;  1EY2 A;  3BYW A;  3VBR B;  5IUQ A;  1WW7 A;  3GM8 A;  4LTA A;  4Z92 B;  3FFZ A;  2MPF A;  2XJP A;  1BCX A;  4YVW C;  1MEC 1;  2D98 A;  5BV6 A;  4GIQ A;  1GP4 A;  4B3N A;  1WMD A;  2R04 3;  2ZEZ A;  1I1E A;  1AUY A;  4LJH A;  5CZK A;  3KT1 A;  2A6Z A;  3K3N A;  2XHK A;  1NG0 A;  4KMQ A;  2PHW A;  1RUN A;  4YVW A;  3AMN A;  3O1U A;  1NCQ A;  1PM4 A;  3RZZ A;  4W6W A;  4E8C A;  4QX5 A;  1W9Y A;  5AVP A;  1XQN A;  2CHH A;  2VVF A;  3U37 A;  4MOA A;  1W9S A;  5IJR A;  3T2Q A;  1EV1 3;  4ES8 A;  1V6N A;  4GA9 A;  2ORZ A;  5IVC A;  1CZT A;  3RYR A;  1J3R A;  3TYJ A;  3NO8 A;  4BME A;  1TNF A;  4YNI A;  2ARE A;  3E1F 1;  3MIH A;  3N35 A;  4Z8B A;  3BTY A;  1RXF A;  2PA7 A;  1JH5 A;  1N1S A;  2YC4 A;  1RB8 G;  2A6X A;  1EV1 1;  3PUR A;  4Z82 A;  3K77 A;  4LUM A;  4DRR A;  4EZH A;  2ET1 A;  1QH6 A;  3OD0 A;  4FVV A;  3R6S A;  3GAL A;  3HT1 A;  4QB6 A;  4XF9 A;  4YGC A;  1HB4 A;  2WFF 1;  5GZF A;  4D8M A;  1GOH A;  4LHN A;  2JD4 A;  3J8F 1;  2D44 A;  2WSU A;  2XL9 A;  5IVE A;  1TZO A;  2B9U A;  2JG9 C;  3J9S A;  4PDW C;  3WNK A;  3JXS A;  2PTM A;  1SLA A;  3VLB B;  3ECQ A;  4QQL A;  5EZW A;  1QDO A;  4L99 A;  4XJW A;  5F3E A;  4N90 A;  3RZG A;  3FZ3 A;  1DZQ A;  3ZYH A;  1H1A A;  2IVI B;  2JEC A;  1J1L A;  5BXX A;  1N47 A;  3VZM A;  4JV4 A;  2D3P A;  4PDW A;  1XU2 A;  4XBN A;  3VBU A;  5K7P A;  4Y1U A;  1AL0 G;  1RUG 2;  1Y4W A;  2HEW F;  4BPZ A;  5ABJ A;  1ND2 C;  1PO1 2;  2DU1 A;  2VZS A;  3Q8E A;  4UXA A;  1GBG A;  5FYT A;  3TNP B;  3WQ0 A;  2PHX A;  4UW5 A;  4OYU A;  5D2A A;  4RSU A;  3RWN A;  3EMR A;  3M4F A;  2WLQ A;  3ATG A;  4PIX A;  3VKO A;  1PVC 2;  1BMV 1;  4HT1 T;  5T54 A;  2E7A A;  5FZF A;  3H3L A;  5L7O B;  1ZZB A;  1XXN A;  1T6B X;  2VO5 A;  1BLZ A;  3H1M A;  1PVX A;  5I0U A;  3VDD A;  4CSW A;  4XFI A;  1UU5 A;  2XJU A;  5A70 A;  4XE9 A;  4YRD A;  5A32 A;  1PZ9 A;  1HQN A;  4PBO A;  2PHR A;  5EYX A;  1CES A;  2W1W A;  4XF0 A;  1OBN A;  3AVS A;  3OD4 A;  5EIY B;  4CUB A;  3VBO B;  5FDB A;  4FPJ A;  2J1V A;  4Y24 A;  4LT5 A;  4EN9 B;  2CNA A;  3Q8C A;  4I2O A;  1AR8 2;  4Q4X 3;  1RHI 2;  3ZDS A;  4FPO B;  2QZ2 A;  2IXI A;  3GYD A;  4CDU A;  1NA1 C;  5FOJ B;  3AZW A;  1UU4 A;  3MIE A;  2NMO A;  2ZA9 A;  3BI3 A;  4HL0 A;  1IPJ A;  1FYU A;  4XCA A;  1VAL A;  4BOW A;  4GB3 2;  3Q8B A;  2XJS A;  3JD7 1;  1BXH A;  1ONA A;  4OUE A;  4Q4W 2;  5JVV A;  2FDG A;  1DQ6 A;  4BJ0 A;  2WNE A;  3NNF A;  1J3P A;  2P34 A;  3O0W A;  2Y6G A;  4LHL A;  5JMC A;  1HN1 A;  5JOY A;  1FV2 A;  2CU5 A;  2EIC A;  3OEB A;  4IV3 A;  4PLN A;  1KGY A;  3WF1 A;  4JGY C;  4QPG B;  2W0X A;  3MIG A;  1REE A;  1EYB A;  5FXV A;  5J48 A;  4QXH A;  3C8X A;  4MGT A;  2PXJ A;  4LOR A;  2A5Z A;  5HXV A;  1UYY A;  1AL2 3;  3WCR A;  5A6X A;  1G9A A;  2AZ5 A;  4K3U A;  3ETP A;  4U2A A;  2C4X A;  1ZVF A;  5C33 A;  2WNV B;  3PUA A;  5FY7 A;  3N9O A;  3LEG A;  3BB6 A;  5FFO C;  2JIC A;  1W6N B;  1JHJ A;  3EHK A;  2PYT A;  3NJZ A;  2G9Z A;  3WHT A;  1HRV 2;  5AC9 2;  2K0G A;  1AL2 1;  5JIA A;  1A8M A;  5L9B A;  5DG1 A;  1C4R A;  5JAX A;  4M3C A;  1H4G A;  1UZY A;  1BEV 3;  2RS1 2;  1OUS A;  4CZS A;  3WIN E;  2WT2 A;  4LA2 A;  4JGZ B;  1DIW A;  1Q56 A;  4Q4V 3;  3NNL A;  5T50 A;  1PO2 2;  3OBR A;  2A6Y A;  1G86 A;  5ANN A;  3ROU A;  3LSD A;  5KC6 A;  1SLL A;  4Y26 A;  3IBM A;  4H3W A;  3ZYG A;  1C8M 2;  2HWB 2;  1OLR A;  3VDA A;  1ND3 A;  3LFM A;  2J1R A;  4HN0 A;  5FPL A;  4NE9 A;  5JR2 A;  3PU3 A;  4GMP 0;  3HQR A;  4V1P A;  1BEV 1;  3VBH B;  3ZN5 A;  1CIY A;  2J1U A;  4PI2 A;  1X36 A;  2YMZ A;  3HQX A;  4KU7 A;  2P37 A;  2X53 S;  2VXR A;  4AI8 A;  1WCU A;  1G6N A;  2IXC A;  3BAL A;  5FYV A;  4N53 C;  4CDQ A;  4CUG A;  1JYV A;  3KV5 A;  1SBE A;  1V0A A;  3PIJ A;  1F2N A;  1GQG A;  1GOG A;  3TEY A;  2A6W A;  2ZMN A;  4P9L A;  1YFY A;  3LAG A;  3IPV B;  3KQ4 B;  1KDM A;  3B9I A;  4XTP A;  5JOX A;  4XC9 A;  5KHG A;  3BUC A;  4LBQ A;  5I0R A;  5DZG A;  3KLS A;  2VAU A;  3GJA A;  4XAC A;  4DS0 A;  1NY7 2;  3PUS A;  3VL9 A;  3FLR A;  1IOA A;  2NZ9 A;  1ZYB A;  1RMU 1;  3AZY A;  1XPW A;  4LBK A;  1YEW A;  2VZV A;  5FPZ A;  2JDM A;  1DYK A;  1LR5 A;  2A70 A;  4JDM A;  2XBO 3;  2ZGL A;  4RGA A;  4P02 B;  2AAC A;  3BOW A;  4QQ2 A;  4E2G A;  5C8C C;  1RVF 3;  1BVP 1;  1TME 2;  2XQX A;  1C3H A;  2Y8K A;  4M0H A;  4XOG A;  1PIV 2;  1PK6 B;  4UWD A;  4BQX A;  2YYO A;  5FMO S;  4CP1 A;  1AXZ A;  4UFJ A;  2Y6K A;  1BQP A;  1DYP A;  2D6M A;  4GH4 C;  4QWN A;  4AL9 A;  5C8C A;  4IV1 C;  2XWB B;  4N9H A;  2XBO 1;  3U0Z A;  2FDF A;  1E5R A;  1RVF 1;  3QD6 A;  4FXG B;  2LUW A;  5FJH A;  1J59 A;  2ES3 A;  3FUQ A;  2BDR A;  4IV1 A;  4YVS C;  1HX6 A;  3WF2 A;  1LHN A;  2OT7 A;  2HBT A;  4FT8 A;  4IW3 A;  2EA7 A;  1CON A;  2W08 A;  1DGW A;  2LAL A;  4B1M A;  1DQ5 A;  2QQN A;  3DCQ A;  4LBN A;  5CFD A;  1QJX 3;  4BLI A;  2GAU A;  5C71 A;  3THP A;  5J37 A;  3OF1 A;  1WGP A;  1CX4 A;  2ERF A;  2WQ8 A;  3FHA A;  3JUU A;  4F8A A;  3M1H A;  3BVC A;  4XFC A;  4IGP A;  1PX3 A;  4W8J A;  1WWY A;  1JOJ A;  4UW4 A;  1LOE A;  3NRU A;  5AVA A;  1C57 A;  5B2G B;  2QNK A;  4EN8 B;  3W20 A;  2C5D A;  2VW0 A;  4MHU A;  5FRE A;  1ZA4 A;  4AF9 A;  1QJX 1;  3P1I A;  3AMH A;  3USS A;  4R8H A;  3VHO A;  5T5O A;  1R1A 3;  1H2L A;  5DUX A;  4E2Q A;  1IKQ A;  2XG3 A;  5FPB A;  4Q4Y 3;  4AQS A;  4V2V A;  2PAE A;  3RZH A;  1O59 A;  2Q8C A;  1R64 A;  3KM5 A;  4B29 A;  1AF9 A;  3UKT A;  3T30 A;  1HKD A;  4HAN A;  1UY0 A;  4RQP A;  4K7J A;  3LDK A;  5LBB A;  1ASJ 2;  1RIR A;  3PHM A;  3ZXA C;  4S2H A;  1VPH A;  4HZF A;  2E6V A;  1VMJ A;  1R1A 1;  2VE1 A;  1ST8 A;  1ACC A;  3NAP C;  3V56 A;  4Q4Y 1;  3WT3 A;  1HQL A;  2XKP A;  3GBW A;  3UT0 A;  1YJL A;  2Z4F A;  3INA A;  1XNT A;  4L11 A;  2G1M A;  3MGU A;  1NCQ B;  1ULF A;  3AFG A;  4LO7 A;  1W6Q A;  3R4U A;  2OW4 A;  2AGS A;  2Q1F A;  2B9V A;  3LFI A;  2VM9 A;  3ZFG C;  4AQT A;  3RZK A;  1RIT A;  1AYN 2;  3OGS A;  5JXG A;  3VHR A;  3WNP A;  1UPS A;  2WC2 A;  3S7E A;  2RM2 2;  2P2K A;  1M06 G;  1GZT A;  4EYU A;  2FZ2 A;  4XF4 A;  4FPL A;  4AED C;  5C3S A;  5FZ1 A;  1GYK A;  5KR7 A;  1JZ3 A;  5BPX A;  1WW5 A;  2DUR A;  2R07 2;  2EAK A;  2WZE A;  1VBC 2;  3FLT A;  4IGQ A;  5E89 A;  3OTF A;  2DCZ A;  1COV 2;  4UAP A;  4KG0 A;  2JIJ A;  4LLO A;  4HK8 A;  1WCD J;  2QQV A;  3GJB A;  4LLF A;  5IK7 A;  2CYF A;  2GU9 A;  2YPD A;  1JYT A;  2BFU S;  4ATF A;  2ADE A;  2MHF A;  4IEV A;  2DVD A;  4FTE A;  3SEE A;  4MH0 E;  2VZR A;  5CNA A;  4TSV A;  1VBA 1;  4XAE A;  2UYA A;  1AR9 3;  3VB9 A;  1IGO A;  3W58 A;  1QHD A;  4IEU A;  4I01 A;  1RGS A;  2GP5 A;  1UMZ A;  2E53 A;  2Z2S B;  5GLV A;  2JDY A;  1YYN A;  3C7F A;  3MPB A;  1R09 1;  4GMP 3;  3X29 B;  1VRH 3;  2W1U A;  1G9B A;  4CEW C;  5FPA A;  5IW0 A;  3ZFF A;  5M0T A;  5FCC A;  5FO9 B;  2RDN A;  5IAV A;  1H8T C;  1AR9 1;  2NYY A;  4XFA A;  4XJA A;  2CWM A;  1O3R A;  3I2J A;  3WUC A;  1D4M 3;  3VBU B;  3AJY A;  4DIN B;  1ZZ6 A;  3RG0 A;  2CSG A;  5ABJ B;  1JBC A;  4K8F A;  5A6Z A;  2GNT A;  3PVB B;  1LAJ A;  2CV6 A;  1UU6 A;  1GWK A;  2OA2 A;  1JZ6 A;  2N7G A;  1AX0 A;  1LGC A;  1H8T A;  2ZZQ A;  3E6D A;  3LEI A;  2MEV 3;  1OH4 A;  4D6R A;  1ZZ8 A;  1VRH 1;  1JYW A;  1FI2 A;  3OBZ A;  3IWZ A;  4LBJ A;  4LKF A;  2QBX A;  3FL7 A;  5IVJ A;  1GOF A;  1CIW A;  2G9F A;  4RS5 A;  1L7R A;  1QOT A;  1RUC 3;  2RJ2 A;  4IEY A;  5FXW A;  4ARX A;  3AP5 A;  5CKQ A;  3VDD B;  1D4M 1;  1H9W A;  4NPL A;  2DVB A;  1CQ9 A;  2EXI A;  4NMI A;  2ZGT A;  1H6X A;  2BPA 2;  1ULP A;  3MW2 A;  3AP6 A;  3AC0 A;  3N9M A;  2PAM A;  5CG8 A;  2MEV 1;  5A7P A;  3ACI A;  1XE8 A;  2VOW A;  3NVC A;  4LPL A;  3KB5 A;  2WNO A;  1OA3 A;  4K1Z A;  4LHS A;  2E31 A;  5A3U A;  3EQE A;  2NQY A;  2J22 A;  4MGY E;  3T08 A;  4OZO A;  1E5H A;  4NIH A;  2QDN A;  2OUH A;  3DKQ A;  4Y4R A;  4HKW A;  4CDU B;  1JMU B;  4WVV A;  1W04 A;  1FOD 2;  1OA2 A;  1SPP A;  3GBG A;  1C5I A;  1HW5 A;  4FPF A;  1Y7B A;  2WS9 3;  1UZV A;  1CZS A;  2VMF A;  3IMM A;  1LGB A;  1T2X A;  2P3J A;  3A0K A;  3LOB A;  4JKM A;  4FOY A;  5FR3 A;  2WKK A;  3OGV A;  2EIB A;  3OEA A;  1LRH A;  4GAL A;  1JOD A;  3WF0 A;  1K5J A;  2BBA A;  4R9D A;  2BOI A;  2VNG A;  1X8M A;  4IV3 B;  5CIR A;  5C4W A;  4HON A;  5FZ4 A;  1STM A;  2RS5 3;  5F9T A;  5HV4 A;  2WRA A;  4NAO A;  5I91 A;  2FCV A;  1EPW A;  2WS9 1;  2AEZ A;  4UFI A;  4D0Q A;  5L9V A;  5CBL A;  5JZG C;  1LJ7 A;  4ONU A;  3VN4 A;  4C91 A;  5FUN A;  5DAV A;  4DQA A;  1UIK A;  2HH9 A;  2ZX3 A;  5HCF A;  4E4Z A;  4YZ2 A;  2XVG A;  3LE0 A;  3I59 A;  4YW5 A;  4KWL A;  5IHR A;  4EWA A;  2BEO A;  4SBV A;  2OYZ A;  2XOM A;  2DWR A;  2YBK A;  3SH5 A;  4M3C E;  1W05 A;  2VQU A;  5JSP A;  2JDA A;  5FP9 A;  1ULO A;  3CDZ B;  3IAQ A;  5JI9 A;  3OPW A;  5FY4 A;  2K2S A;  2RMU 2;  4M3C B;  4XJZ A;  2ZHN A;  5K9Y A;  1QMJ A;  2R1B A;  4OVE A;  1NXM A;  4M4R A;  4XIK A;  1YFX A;  1SCR A;  5E1R A;  3LSE A;  2E51 A;  2B4K A;  3N3H A;  2VC9 A;  5EJ3 A;  2DVF A;  2ZTN A;  4QM8 A;  3VD3 A;  4DZG A;  1MR5 A;  4FPE A;  1H0B A;  2OZJ A;  2JDN A;  3D6E A;  2ID4 A;  5JI7 A;  3U4X A;  3NV1 A;  1ND3 B;  3DXT A;  2KD7 A;  4TYS A;  4YWA A;  1CD3 G;  1KFX L;  2ZBJ A;  1AX2 A;  4QX7 A;  4WM8 A;  5KC5 A;  4AQ6 A;  1JI6 A;  5D21 A;  4IQP A;  2ZMK A;  2IXK A;  2WN3 A;  5JSR A;  4CDQ B;  2RR1 2;  1WLC A;  1HDK A;  2X09 A;  4CCK A;  5C8W A;  5FZG A;  1ZBA 2;  4ZXK A;  1WLD A;  5FLI A;  4Q0Q A;  1GUI A;  2RDQ A;  2BUK A;  4JHZ A;  1OMI A;  1MVE A;  4LBQ B;  2WQZ C;  4EZ4 A;  4S2F A;  3W5M A;  1HQW A;  4IEO A;  1ZBE 2;  1UIJ A;  1XU1 A;  2P4E A;  2Q4S A;  3RJR A;  3ZR6 A;  3WQ1 A;  1GU3 A;  2ZGU A;  4AVV A;  4CCO A;  1JYN A;  3M3O A;  4ERO A;  2GDF A;  4FTS A;  2VNR A;  2C6S A;  4JQR A;  3PJY A;  1RUG 3;  1WD3 A;  4MYE A;  1PO1 3;  1KDK A;  1W39 A;  1YI7 A;  4IEX A;  4MSV A;  5L73 A;  5DAW A;  5FP3 A;  1HXS 2;  3AM2 A;  3ITQ A;  4WV8 A;  1YFU A;  1VB2 A;  2GC2 A;  1Q8O A;  4HKL A;  4YZ3 A;  3MEP A;  3C7O A;  4YFZ A;  1PVC 3;  1ODM A;  4FFF A;  3O1T A;  4OFG A;  4XHX A;  3HAG A;  4COW A;  2AYH A;  2ZAH A;  5FZH A;  2YPJ A;  1RUJ 2;  3V64 A;  3WZ1 A;  1YQ6 A;  3U75 A;  3ACG A;  4J25 A;  3AMP A;  1PO1 1;  5A3P A;  2W5F A;  3OG2 A;  3WQB A;  2R32 A;  3GCX A;  4W6Y A;  5LY1 A;  3WHU A;  1RUD 1;  1GAN A;  2JDU A;  3AP4 A;  1QJY 3;  4OUM A;  4XJ8 A;  2D40 A;  4KBZ A;  5FUP A;  5F2W A;  1PVC 1;  5J98 B;  3JCI A;  2YG0 A;  3T2P A;  1ZRF A;  1RYY A;  2OQ6 A;  1AR8 3;  3POJ A;  2D6O X;  1RHI 3;  3FC0 A;  5CFD B;  1PM7 A;  3GGL A;  4V2W A;  4LE3 A;  4IND A;  5EJZ B;  1SG3 A;  1AZD A;  4XBL A;  3WV6 A;  4BCU A;  3WNL A;  3NV2 A;  4ASL A;  5ACA 1;  1JUH A;  3ZSE A;  2WJS A;  3LQC A;  5I0T A;  2BW8 A;  3C7G A;  1QJY 1;  3PIG A;  4BWO A;  5IK5 A;  4QXK A;  2ZS6 B;  4ZXE A;  3N4M A;  4GB3 3;  2R06 3;  1UMH A;  1ZZC A;  4Q4W 3;  4YZ5 A;  5A3N A;  4W6X A;  4O9G A;  1RHI 1;  3WW3 A;  3WNM A;  1RJ7 A;  3KSC A;  2CGP A;  3HVD A;  3TWI A;  3OB8 A;  4CE8 A;  5HCH A;  5LRR A;  2OPK A;  2QQU A;  3RRD A;  1UWW A;  2K9Z A;  1B35 C;  3ON7 A;  4HOO A;  3T0B A;  3WW1 A;  1JYI A;  1F4A A;  4AFB A;  4RN5 A;  4FOW A;  1VBE 2;  3FHQ A;  4ZON A;  5EFU A;  5CAD A;  4GB3 1;  2RS3 2;  2R06 1;  2V4A A;  4RQP B;  2MNG A;  3PLQ A;  4L8Q A;  4ZS2 A;  5EXO A;  3WF3 A;  5F37 A;  3IN9 A;  5EHD A;  1TMF 2;  3ST7 A;  1XNA A;  1SLB A;  1W0P A;  1OVP A;  1UF2 C;  4LQR A;  3PTR B;  4AVC A;  4CDX A;  4KGG A;  1WCS A;  5DAB A;  5IVF A;  3IZO A;  3CNA A;  5AC9 3;  5L36 A;  3APB A;  1W99 A;  2XHN A;  2W92 A;  1KXG A;  3EO6 A;  3H1W A;  2GSY A;  4QXB A;  4ZZ5 A;  3CF6 E;  1W2A X;  1W6Q B;  2HEV F;  3CL1 A;  4L2N A;  4M0N A;  2RS1 3;  3U07 A;  4QX0 A;  1O5U A;  1MS9 A;  1PO2 3;  2QVS B;  2VUJ A;  3CBN A;  4XBQ A;  4O65 A;  5JWP A;  3I49 A;  1O4Y A;  5AC9 1;  1UN1 A;  4BK5 A;  1C8M 3;  2HWB 3;  4QU2 A;  3PME A;  2JKB A;  3BU0 A;  3ES4 A;  2YFU A;  4NII A;  4FBF A;  1OI6 A;  4AAP A;  5ISL A;  2RS1 1;  2YY1 A;  3KV6 A;  1QY4 A;  1KS5 A;  2D5F A;  4CA9 A;  5LA9 A;  1W2O A;  1S0B A;  2GMP A;  3VKF C;  3VD5 A;  3NV4 A;  2ZOE B;  2C9K A;  1RUF 1;  2Y6F A;  2V4V A;  4AK3 A;  4MHR A;  4H55 A;  1OLQ A;  3VZK A;  4YAR A;  1C8M 1;  2HWB 1;  5GLT A;  1E5S A;  4JRA A;  4WBB A;  1W8O A;  3ZSK A;  4YZ4 A;  1UW8 A;  4HLT A;  3OOX A;  5C6C A;  1YQ8 A;  3VUO A;  4LK7 A;  3TB0 A;  3ZPY A;  2WZR 2;  1F9K A;  1D2Q A;  4CCJ A;  5JR7 B;  4QPI A;  1H8V A;  1XYP A;  2QZ3 A;  3I2F A;  4K1Y A;  5L19 A;  2O8O A;  2FCU A;  5H9Q A;  4OHY A;  4XEZ A;  3AL6 A;  4LO6 B;  3VBF A;  4AI3 A;  4JX0 A;  1S2B A;  3ZFF B;  3ZXF A;  1CAX A;  3RQ0 A;  3AKS A;  5FPX A;  5APA A;  2ZGM A;  1S2E A;  2OQ7 A;  3ZDV A;  4ZU5 A;  1TME 3;  5LB6 A;  4QX2 A;  2VUA A;  3FN9 A;  5FY8 A;  1PIV 3;  5B4X A;  3USU B;  1FNZ A;  3MLJ A;  2ZAB A;  1IS4 A;  1NY7 1;  4MGI E;  2JB8 A;  4AYU A;  1MS8 A;  3MIF A;  4I0A A;  1H8T B;  5FPV A;  1DF0 A;  1UZZ A;  2WNU C;  4OI2 A;  1RED A;  4N9I A;  4QMA A;  4N43 A;  1YLL A;  4RS5 B;  1TME 1;  2VMG A;  1H1I A;  2XXZ A;  3NJV A;  1S0G A;  5K0U C;  1PIV 1;  5H9S A;  2WNU A;  2J1E A;  3ZXE A;  1OQE A;  3C7H A;  4D7T A;  5KXB A;  4OHX A;  2W47 A;  1KIT A;  3P5B A;  5FAX A;  3RYK A;  1M4W A;  2ZX2 A;  5KXE A;  2VPV A;  5K0U A;  2DTW A;  4KWJ A;  4YGB A;  1SEF A;  2CTV A;  3CJI B;  3O1V A;  2EXH A;  1FPN 2;  2PQQ A;  2WUH A;  3JB4 C;  1SCS A;  4YW4 A;  4AOC A;  5LWB A;  4LKE A;  4ES9 A;  5FK7 A;  5D8A C;  5FP7 A;  4HMZ A;  1TG7 A;  3SC7 X;  3VD7 A;  4TZD A;  3NWK A;  2Q8E A;  3O14 A;  3ZMN A;  1HN0 A;  1NUK A;  4AHY A;  4MX3 A;  4XIL A;  2BOJ A;  2FD8 A;  2W91 A;  4XFG A;  5D8A A;  4QU1 A;  4B4P A;  3OGR A;  4A4A A;  3UET A;  5CEH A;  4KNC A;  5BNN C;  1OT5 A;  4Y1V A;  1OF3 A;  5C4W B;  3I3D A;  4XZP A;  4E4D X;  1K42 A;  3SIS A;  3VKM A;  2G4I A;  2WA3 A;  4DNY A;  4P9Y A;  4WVM A;  3ZFE C;  4CDW C;  2R04 1;  3S30 A;  1ASJ 3;  1OKQ A;  2ZJC A;  1K3I A;  3D3A A;  1Z0H A;  4WVW A;  4MG2 A;  5JSO A;  3I59 B;  2PFW A;  2GNB A;  2VL4 A;  2R30 A;  1LKN A;  4NHX A;  4M01 A;  3MUY 1;  3KGZ A;  3GXU A;  3NQH A;  3K46 A;  4BDV B;  1G7Y A;  3LIH A;  2GH8 A;  3THC A;  1V6I A;  2RG4 A;  5CAZ A;  2HYK A;  1ULD A;  3PUQ A;  1IPS A;  1FMD 2;  2J1T A;  1AYN 3;  4XTM A;  3SQO A;  3WG3 A;  1NLQ A;  3H1Y A;  2V72 A;  1CGP A;  2RM2 3;  4JQT A;  4WVZ A;  3AK0 A;  2QQL A;  3MZH A;  2RDR A;  3LKJ A;  3ACL A;  1CR7 A;  3AMM A;  4YGE A;  3K3O A;  3M3E A;  4BIS A;  1GV9 A;  1O5L A;  2W46 A;  4NJ4 A;  5BY5 A;  2R07 3;  4Q1P A;  5BNP C;  5FYC A;  1VBC 3;  1COV 3;  1MQT C;  4NAM A;  1PGL 2;  3N9Q A;  2JG9 A;  2RM2 1;  3PVN A;  2CDP A;  5FV3 A;  1Y9Q A;  1HJF A;  4WM8 B;  3ZYP A;  4AFD A;  1BK0 A;  4FOV A;  3E6C C;  1JYX A;  1MQT A;  4BZ4 A;  4KBB A;  5IK8 A;  3I7D A;  4A2U A;  5CFC C;  4QGL A;  3NNG A;  1JOB A;  1GFF 2;  2ZHK A;  2VZQ A;  1NYW A;  2VZT A;  4I09 A;  5FYM A;  4Y3O A;  1ND2 A;  4NRM A;  2VGD A;  3O1O A;  4XCB A;  3T1M A;  3AFK A;  4CU9 A;  3WDV A;  4CCD A;  3K51 A;  4P9X A;  5GZG A;  1RUH 2;  2BRT A;  2GC1 A;  1IG0 A;  2E33 A;  2GC0 A;  3QOP A;  4OMD A;  3RMY A;  3OSD A;  3KMH A;  3D82 A;  3T1L A;  4AI1 A;  3TEZ A;  4MGK E;  3HOB A;  2XL7 A;  2XUM A;  1YC6 1;  3ILN A;  4DMI A;  4RFT 0;  3N7L A;  5A6Q A;  1SDW A;  3EB7 A;  3GHN A;  5LBF A;  1VAK A;  5DUU A;  3VV1 A;  4ASK A;  4RR3 C;  3DYO A;  2W94 A;  4BQW A;  4E9K A;  2VUL A;  3WP6 A;  5BNO C;  2TUN A;  2XH6 A;  2Y33 A;  2VQ0 A;  4BQY A;  3ILR A;  1YWK A;  5C3P A;  3ES1 A;  5H9P A;  4LOT A;  4GWI A;  1NA1 A;  2CL2 A;  1F5F A;  3PMS A;  3PUI A;  4Q4X 1;  4LA3 A;  1QWR A;  1YCI A;  2ZAC A;  2XWJ B;  3N7K A;  4Y1Z A;  1DQ2 A;  2F17 A;  2LRP A;  5FO7 B;  1FT9 A;  3T3Y A;  4WZF A;  3OBT A;  2GMM A;  1JU3 A;  5F5I A;  2BER A;  3VL8 A;  2ARC A;  3OPZ A;  4GKX A;  3HN1 A;  3AX4 A;  2QJV A;  3B01 A;  3C3V A;  1FOD 3;  1I9R A;  1SFY A;  3D0S A;  1W8U A;  3KGL A;  1RUE 2;  2P6H A;  1MZE A;  3R05 A;  4JGY A;  2VUC A;  5FY1 A;  1D0G A;  4XUP A;  1C1L A;  2BGC A;  2QQO A;  3WDW A;  5DAQ A;  3RZM A;  1U5X A;  4YW2 A;  2JJ6 A;  2WO3 A;  4B1L A;  4IE6 A;  2W68 A;  4G3Y C;  4AFM A;  1H9P A;  4M00 A;  2EAL A;  2JDK A;  1DFQ A;  5J7M A;  4TLF A;  1Q5O A;  1FOD 1;  1RUI 2;  1E57 A;  3RMX A;  3M3I A;  5F3I A;  2W39 A;  3DPR B;  3PU8 A;  5BYN A;  4LNV A;  1QJF A;  4DOU A;  1SLI A;  3WDU A;  4OI0 A;  5E8A A;  2BP6 A;  5DMY A;  2YGL A;  3I3B A;  2HWC 2;  4HG6 B;  4CDX B;  4X8N A;  4XFH A;  4C8D A;  2JG8 C;  4CU6 A;  3W5N A;  1CAU A;  4MZU A;  1AR7 2;  1UPI A;  1UZ0 A;  1X7N A;  4Q4V 1;  4CP9 A;  4NHM A;  1S0D A;  1ZRI A;  3RGB A;  5LK7 B;  3GZU C;  1TEI A;  2EAA A;  2Q0A A;  1BJQ A;  2RMU 3;  2FZ1 A;  2JG8 A;  5ERL A;  1A78 A;  5I8S A;  2NMN A;  3N9L A;  2DDU A;  5LK5 A;  3Q9O A;  4FO9 A;  3V0B A;  1IHM A;  3MI8 A;  1ZRD A;  4AI0 A;  1OVS A;  2YB7 A;  2HLE A;  2D93 A;  3BGA A;  4BQ2 A;  3UV9 A;  1QKQ A;  3J7N A;  4P9I A;  2B5H A;  2HWD 2;  4N53 A;  4XYX A;  2B7Y A;  1U12 A;  4P00 B;  1W3X A;  1QXP A;  5FLH A;  2RMU 1;  2A75 A;  3MPP G;  2PHU A;  4LMF A;  2ARB A;  3SNM A;  4CCM A;  4XUO A;  1W2N A;  1OD3 A;  1IQA A;  2VTX J;  3K4D A;  1AJO A;  4NWW A;  3RJ2 X;  5A33 A;  4ARY A;  1LOB A;  2GH2 A;  4KI5 M;  3DN7 A;  3NJY A;  4DXT A;  3IM0 A;  1KRI A;  5JXJ A;  3TN9 2;  2RR1 3;  2OVU A;  5FJK A;  2VEC A;  4EWE A;  2V73 A;  1ZBA 3;  5GLW A;  1UYP A;  2IC1 A;  1GNH A;  2ZX1 A;  5KXC A;  4ZS3 A;  4QPI B;  4L97 A;  5FMB A;  4BQ3 A;  1E5I A;  2G9G A;  1SAC A;  1IG3 A;  3I3Q A;  4QGN A;  4LUL A;  3VBF B;  4GH4 A;  4QDS A;  5JIU A;  4KU8 A;  2RR1 1;  1CAX B;  3DL3 A;  3KVB A;  5F32 A;  5HCB A;  5LZ6 A;  4BXS V;  2X05 A;  1URX A;  4O7X A;  3WW4 A;  4XUR A;  1ENS A;  1EUT A;  2YUE A;  3AZV A;  3THT A;  4NPM A;  4P5H A;  1HXS 3;  1KQR A;  1OF4 A;  1OHF A;  2QQM A;  2Q30 A;  3SIT A;  4U36 A;  1PMI A;  5BNQ A;  2I74 A;  4YVS A;  4KQ7 A;  2PMW B;  2FDK A;  5FRA A;  4XXA A;  5JOW A;  5JXI A;  1OFN A;  4GQ7 A;  1RUJ 3;  2I07 B;  5FBJ A;  4N43 B;  3VGI A;  2B42 B;  1OPO A;  1S0I A;  4RD7 A;  1UKG A;  3T2O A;  1D0H A;  3WUD A;  1LGN A;  2QQI A;  3WP4 A;  1HXS 1;  1JTZ X;  2A3Y A;  2CDO A;  2ADD A;  4CEY C;  3AP9 A;  1SQ4 A;  2R0H A;  3H3U A;  5DPN A;  4D6S A;  4NRQ A;  1MEC 2;  3VKN A;  2XON A;  1CPM A;  4QDQ A;  5EP9 A;  5FBZ A;  1V9U 3;  1VMF A;  1HRI 2;  2X5I C;  1U0A A;  5IFT A;  4Y33 A;  5A7W A;  4CPB A;  1RUJ 1;  1V6K A;  4LR4 A;  4NO4 A;  3LD8 A;  2G19 A;  3OBA A;  2KA3 A;  3AJZ A;  5LAT A;  3DEM A;  1WMX A;  1VIW B;  2W9X A;  4IXL A;  5DQ0 A;  5FZ0 A;  4HKO A;  1DBN A;  2X5I A;  2LS6 A;  3NV3 A;  4FP2 A;  5FYS A;  5G04 L;  2DFB A;  2OUJ A;  1NCR C;  2LW8 A;  1V9U 1;  1W2U A;  1XND A;  4AI2 A;  1RC6 A;  3BTX A;  3HN3 A;  1AX1 A;  5AFB A;  2DUQ A;  5D8A B;  3FUO A;  2W1Q A;  3FJS A;  3POB A;  1EPZ A;  2CWS A;  3IDA A;  3NAP A;  1WZX A;  4YVW B;  1S1A A;  5FZD A;  1DCS A;  1NCR A;  2PAK A;  4RYD A;  3UKN A;  5LA2 A;  2WQ4 A;  1VBE 3;  2V5D A;  3KV9 A;  3NST A;  4OZX A;  4PIZ A;  4WVM B;  5FQ0 A;  1G9D A;  4B4R A;  4AVS A;  2A7A A;  2W1S A;  1OOP C;  1TMF 3;  2VR4 A;  1H2K A;  3ZFG A;  4HSJ A;  1XOY A;  5J96 B;  2WFF 2;  3URF A;  2JE8 A;  4URT A;  2IFW A;  3J8F 2;  1GP5 A;  4E4H A;  1K12 A;  1UX6 A;  3KCX A;  4AED A;  5I8T A;  1C5H A;  4MXW A;  3ACH A;  5SV8 A;  1CPN A;  1JZ2 A;  3Q8F A;  4ZPI A;  1GIC A;  1PX4 A;  2PN5 A;  1VP6 A;  4DB5 A;  1TMF 1;  3VBS A;  5F39 A;  4UBH A;  5C9A C;  2YXS A;  1GWM A;  3AYE A;  4A6S A;  3S7I A;  2FDI A;  1O6U A;  1UOF A;  1ENX A;  2TNF A;  4MV2 A;  4H7M A;  2XVL A;  3I8T A;  1OLM A;  4O61 A;  2ZGK A;  2XVK A;  2PHF A;  5FZ6 A;  5C9A A;  2QTW B;  4D94 A;  3WQ7 A;  1F5J A;  2P5B A;  4COY A;  1QJZ A;  2VG9 A;  3CLP A;  2VMC A;  4Q8K A;  1OKO A;  2RV9 A;  2D43 A;  4LO8 A;  4FFI A;  1FNY A;  2JG9 B;  4PDW B;  3M2M A;  3AL5 A;  3VHN A;  4D69 A;  4I0B A;  3VDC A;  3UKV A;  1GP6 A;  5JPM B;  5FZ8 A;  1OUR A;  5LEJ A;  4YW1 A;  4AEM A;  5A3L A;  4YFW A;  4CEW A;  2OXB A;  5FLJ A;  5GLU A;  3WY6 A;  4ZU4 A;  4GMP 1;  3NJX A;  2WZR 3;  4CXW A;  2A73 B;  4Q26 A;  4E27 A;  3B94 A;  3AB0 A;  3LWC A;  1ND2 B;  1EUU A;  1ZA7 A;  3CU7 A;  5T5P A;  4BXF A;  1BHG A;  4D6Q A;  1F31 A;  4LO5 B;  2XR4 A;  2R1D A;  1W06 A;  3N7J A;  5A32 B;  5GLZ A;  3UJQ A;  2IXL A;  3ME2 A;  1W8F A;  1UCX A;  1KFU L;  3H9A A;  4GWN A;  4QT6 A;  1LHO A;  2IWG B;  4FXK B;  4MGS A;  1NOV A;  4LK6 A;  3K48 A;  2C1F A;  1CAW A;  3WLU A;  3N9P A;  3JD7 2;  4CP2 A;  1RUC 1;  1S0E A;  5FMD A;  4A44 A;  1NE6 A;  5FZC A;  3ZXD A;  1LU1 A;  4YG6 A;  4LKS A;  3WOG A;  1UX7 A;  4AEK A;  3MBW A;  4D7S A;  4HET A;  1AR6 2;  4XZU G;  4JTN A;  2AEN A;  2R49 A;  3ACF A;  2UWA A;  2JEN A;  2CGN A;  2B39 A;  4ORF A;  1NA1 B;  3A23 A;  4X6R B;  5LBE A;  4YPJ A;  5JXH A;  5T5J A;  1IKP A;  4O9E A;  3VBR C;  3MHZ A;  2D3R A;  3WXP A;  5I93 A;  1UQX A;  1H1M A;  1FPN 3;  4IEP A;  5F8P A;  3OUI A;  3CO2 A;  4AQ2 A;  2XJV A;  5JUV A;  3KCC A;  3VHP A;  4DY5 A;  2R6Q A;  3DGT A;  2XDV A;  4PJY A;  5F5C A;  4UT5 A;  4QX8 A;  4JGY B;  4GWM A;  2AEY A;  3OGJ A;  4BIO A;  2ET7 A;  2HEY F;  2JE7 A;  4TWT A;  2Q8O A;  2J7M A;  1MZ5 A;  2RS5 1;  2ILM A;  3LDB A;  4K20 A;  1L3J A;  5JZG A;  4Q5O A;  4C0H A;  4UF0 A;  4AVA A;  4DY3 A;  1OQD A;  2VW1 A;  5FXX A;  1KEX A;  3S5Q A;  2ZAA A;  3AVR A;  4JAA A;  3VBS C;  3IB3 A;  3ZOI A;  4OQ8 A;  4IEQ A;  1X33 A;  1PMJ X;  3KT7 A;  1UY1 A;  3POE A;  3MLK A;  2CY6 A;  4C1X A;  5HPO A;  4AVT A;  4QM9 A;  2XPJ A;  2Y64 A;  2W2I A;  4EN7 B;  3WR0 A;  3HQU A;  1VBD 2;  2E7T A;  4QQP A;  5EWS A;  2FMD A;  4FAH A;  1OXC A;  1X50 A;  2VTF A;  3UGG A;  4E4S A;  3L2Y A;  1CAU B;  1R08 2;  1YQ5 A;  3FBY A; 
#chains in the Genus database with same CATH homology
 4O61 A;  4QKF A;  3BI3 A;  4NPL A;  4CXX A;  4NRM A;  3O1P A;  3O1T A;  4NIG A;  3T4V A;  3O1O A;  3BIE A;  2FDG A;  4QHO A;  4ZHN A;  4ZS3 A;  4NIH A;  4MGT A;  3I3Q A;  4IE4 A;  4QKN A;  3O1S A;  4CXW A;  3O1U A;  3RZH A;  4O7X A;  4NPM A;  3S5A A;  4CXY A;  3O1V A;  3S57 A;  3H8X A;  3KHC A;  4NRO A;  2FDK A;  3RZL A;  3T3Y A;  2IUW A;  3BTY A;  3I3M A;  2FD8 A;  4NRQ A;  3RZK A;  4ZS2 A;  3LFM A;  3O1M A;  4IE7 A;  3BKZ A;  3RZM A;  4IE6 A;  5DAB A;  4MG2 A;  5F8P A;  3RZG A;  3BTX A;  3BTZ A;  3BUC A;  3O1R A;  3I2O A;  3I49 A;  4IE0 A;  4NRP A;  4IDZ A;  4JHT A;  4IE5 A;  3BU0 A;  4NII A;  3KHB A;  2FDJ A;  3RZJ A;  4NJ4 A;  4OCT A;  2FDH A;  3T4H B;  3H8R A;  2FDF A;  4NID A;  3H8O A;  4QKD A;  4QKB A;  4RFR B;  2FDI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...