3O1UA

Iron-catalyzed oxidation intermediates captured in a dna repair dioxygenase
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
202
structure length
202
Chain Sequence
EPLAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMSVAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLCQRAATAAGYPDFQPDACLINRYAPGAKLCLHQDKDEPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGIQPLKAGFHPLTIDCRYNLTFRQAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Alpha-ketoglutarate-dependent dioxygenase AlkB
publication title Iron-catalysed oxidation intermediates captured in a DNA repair dioxygenase.
pubmed doi rcsb
source organism Escherichia coli
total genus 50
structure length 202
sequence length 202
ec nomenclature ec 1.14.11.33: DNA oxidative demethylase.
pdb deposition date 2010-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 3o1uA00
4IE5A 3RZJA 3I3QA 4IE0A 2FDKA 5DABA 2FD8A 4NIHA 3O1TA 4OCTA 4O7XA 3LFMA 4QKNA 2FDFA 3S5AA 3BUCA 3BKZA 2IUWA 3KHBA 3H8OA 3I49A 2FDHA 4ZS2A 4NIIA 4IE6A 3T4HB 4RFRB 2FDIA 3BTXA 3BI3A 3H8XA 3RZHA 4NRPA 4JHTA 3I2OA 4MGTA 4NRMA 3O1MA 3BTYA 5F8PA 4IDZA 3T4VA 3O1RA 3RZMA 2FDGA 4NRQA 4NPMA 3BIEA 4CXXA 2FDJA 4CXYA 4NROA 3I3MA 4QKFA 3BU0A 3BTZA 4QHOA 3RZLA 4CXWA 4ZS3A 4QKBA 4NJ4A 3O1VA 3RZKA 3O1UA 3O1OA 4MG2A 3RZGA 3S57A 4QKDA 3O1SA 3H8RA 4NPLA 4IE4A 4O61A 4IE7A 3T3YA 4NIGA 4ZHNA 4NIDA 3O1PA 3KHCA
chains in the Genus database with same CATH superfamily
4LUKA 2RM21 3ELNA 4KG0A 4J25A 2XL9A 4UFHA 5FMBA 5FUNA 2AH2A 2AC1A 2P37A 3OB8A 3TAYA 5FRAA 1W8HA 3IT8A 3SEEA 1X33A 3ST7A 5DUWA 3VBOA 3WOGA 1HRV2 4BWOA 4DRRA 5LW9A 4O7XA 2RR11 1QDOA 2EXKA 2Z4FA 4LBOA 5A32B 4CUCA 1JZ2A 2R0HA 5FZ8A 1RB8G 2RDRA 3BPZA 1S2KA 3LF7A 1RXGA 2XJRA 3GXUA 5JR7B 1W8WA 1SDWA 1V6KA 5AC93 5F37A 2WA3A 4LHKA 3WNOA 5KXEA 1GU3A 1OFSA 1T2XA 2GP3A 5JLVA 4A6SA 1J59A 5JOWA 2NM1A 5LRSA 4QHZA 5J48A 4XABA 1XE8A 3T30A 4EYUA 4PBPA 4AF9A 2WNOA 1SFPA 4IE6A 2VULA 4HETA 2XGXA 2FDIA 2FZ2A 4R9CA 5FZAA 5LATA 2BZDA 2QE3A 5C3QA 1XU2A 5IK7A 2WA4A 4QB1A 2P6CA 5T55A 4CPBA 4XIKA 4CUAA 4CU8A 5L9VA 4GIQA 3I2OA 2PLV3 1EV13 1VBC3 2LUWA 4AEJA 4E8DA 3CJIB 1K3IA 4PLNA 3THPA 1ZZ8A 1XU1A 1AR93 2CGPA 4Y5SA 3ZPOA 1WMDA 5JXIA 5LBFA 2QZ2A 3NJZA 5J37A 1VALA 2XJUA 5CFDC 5FO8B 2QQUA 5CKQA 1AX0A 3ACFA 4QPGC 4DUVA 5FFOC 2ZGUA 2CHHA 4WM7B 3SITA 5IVCA 1AR81 1HB4A 2RS52 2DTYA 3MPPG 3POIA 4MADA 3D6EA 4UW3A 1UMHA 2ZGRA 1E5IA 3KMHA 4YG3A 1HRV3 2VMEA 1WZXA 4QU2A 1UKGA 1JI6A 1H8TA 5BNNC 3AX4A 1EY2A 4YG0A 3AJZA 3DUIA 1W6QB 1OMIA 1QY4A 3VZNA 3JD72 4MGKE 2J1UA 5M0TA 1FT9A 5CAZA 2CYFA 2ZXQA 4FAGA 2XHNA 4L92A 3WP5A 1SG3A 1LOAA 4DS0A 5GALA 4YVSB 3SKVA 5A1AA 1CWPA 2NYYA 2WABA 5FXVA 1DZTA 4YGBA 5FBZA 4PJYA 1YCIA 2P34A 4JZRA 4AFBA 1QF3A 4BB3A 1GWKA 2YROA 4LO7A 3LFIA 2YXSA 1YQ2A 1LAJA 1CAXA 1UIJA 2WZR1 4XJ8A 5LBEA 1UX7A 5D8AA 4YW3A 5F5IA 4O61A 5FLHA 2RM22 5APAA 1YJKA 5IK4A 4OMCA 4GKYA 5FV3A 2Y6KA 3HIFA 4ZHNA 5EYYA 1QH7A 2XG3A 4S2GA 4HFSA 3O1PA 4IETA 3VKOA 4AI1A 2VMDA 5GLZA 4OFGA 1I1EA 1A3KA 1K5MB 2JE8A 2RS53 1TZOA 4Q1RA 5KXBA 5FKCA 3ZXDA 4MX3A 3AP7A 4G9SB 1RUC1 1ND2C 3A23A 5KHJA 4I2OA 1SZBA 3POFA 1VB2A 3GF6A 4CA9A 1Q8OA 2A6ZA 3DF0A 4YPJA 2WT1A 4FPOB 3VV1A 2ZEZA 3JD73 3PIJA 3B01A 4Y1VA 4DEVA 4BQ2A 3G7DA 1P8JA 3IN9A 1RUH1 2GC0A 5LEJA 1IS3A 2I74A 5E88A 1KGYA 5JI7A 4FPYA 1G8WA 4CCCA 2HYKA 1OLQA 2VVFA 1UN1A 1JOBA 5T3NA 3FLTA 4CU6A 3J7MA 1LCLA 5E8AA 4AE2A 4DNYA 1ZA4A 3LEIA 5K0UB 3OUJA 2VW0A 2X5IA 4GA9A 2WZEA 5DZFA 1WW4A 5JI9A 5CZKA 1A6CA 4LBNA 4R9BA 5DG1A 3CZUA 5JCTA 5KHGA 3WV6A 1MR5A 2DTWA 1Q8SA 5CISA 4RFRB 1ODNA 5J7MA 1DQ0A 4MYEA 3D5OA 4YVWB 1I5ZA 1OPMA 3PVEA 5HCHA 4XJWA 5FZ9A 2RM23 1L7LA 1FAYA 4PDWC 2WR9A 3IB3A 2DVBA 4WV8A 1ZRIA 1UCXA 2N7GA 4JGYB 4BQ1A 2IVIB 2QQWA 2Z42A 2ZOEB 5FLIA 2OW4A 4U2AA 3VBHC 1PM4A 3N7JA 5LA9A 4QGNA 2ZX2A 1GSLA 2QQIA 5D2AA 5A6ZA 1F5JA 1O3TA 2D3SA 5C3PA 4XIOA 2VXRA 1CIYA 5DUUA 4A44A 3AVRA 3I2HA 4Y4YA 3POYA 3ZMNA 1LU1A 1YIFA 2QCSB 2VTFA 4LE3A 1S0JA 2EIGA 2VOKA 3MICA 1XYOA 3OOXA 2WRAA 4FP2A 5FYCA 1OLRA 1Q43A 3ZFFC 4CCDA 3KV5A 1DGWA 1ENXA 1PM7A 3H8UA 1J1TA 3Q8FA 5L7OA 4HVOA 5C71A 4B1MA 3GBFA 1JODA 4UFMA 3SHRA 2QVSB 3LOIA 2A6VA 2CV6A 3POJA 1ZREA 1DGRN 1LEMA 5L73A 5FZKA 1PGW1 1BKZA 1XSQA 3KV6A 4LQRA 3C7FA 2JD4A 3ALQA 2ERFA 4FPFA 4R9AA 2JDPA 5T52A 3WQBA 4GH4A 1WD3A 1W28A 2D98A 5C5TA 1ENQA 1LOFA 1WCKA 2XJSA 1COV1 4NHKA 1NA1B 4AYUA 5FMCA 1POV3 4S2FA 5ABJA 5C8CA 3MIHA 1AUYA 2YC4A 3WNPA 4D7TA 2ORXA 2W0XA 2DDUA 3VBOC 3V0AA 1VBE1 5BV6A 5LA1A 4BXFA 4CEYB 4O65A 1W6PA 2KA3A 4XEZA 1OC1A 4ZONA 3RFRA 3VZOA 3I2JA 2WFF2 4KWKA 4IE7A 3KT7A 2ZACA 2UWBA 5SV5A 3PUQA 1OVPA 2WAOA 1UOGA 2JDNA 2JX9A 3OYWB 4XYXA 5JXGA 2VVDA 4XUPA 1ND2B 1O5LA 1CD3G 3OGSA 4WVMA 2XBO1 3ZYRA 2BOIA 2VCBA 4LUMA 3OF1A 2D6PA 5FYZA 3FHAA 4DIQA 2CDPA 1RUH2 3LPFA 4XJZA 1RYYA 3KZ4C 3ES1A 3I3QA 3LA7A 2B7YA 1UOFA 4OUSA 4EWAA 2VNRA 1A78A 4FQ4A 1DYKA 1KITA 2YB7A 2JB4A 3I59A 4AEDB 4BA6A 1H6YA 2FHRA 3LIGA 4GXLA 3O1TA 2G4IA 3JB4C 3WDXA 4EN9B 5GZFA 5EIYB 1FMD1 1ULPA 4G3YC 2WN2A 3ILNA 3ZX7A 5A1FA 5FP3A 4X6QB 4H14A 2C26A 3MW4A 2DCTA 1MPXA 4GWMA 3ZYJB 2DBIA 1C28A 2VZTA 1YRZA 1TME1 2VMIA 2YBSA 3MV01 4PDWB 4WZFA 4YW1A 5J09A 2FDHA 1XE7A 3FJSA 3RJRA 2GNMA 2VCCA 4NHMA 3WVJA 4MH0E 1JU4A 4FOYA 1DGLA 2BOJA 3TNPB 2W94A 5FZOA 2R0FA 1ULCA 3WY6A 2WFF3 3VD4A 3OY8A 3LA3A 3TRSB 2GH2A 4AWDA 1SFNA 2WLQA 4UBHA 2XKOA 1RJ7A 3DECA 1KRIA 3UJQA 3VLBB 1LOCA 4YGCA 1W8TA 5LBCA 1PZ7A 3O1MA 2ARBA 4XXPA 3V0BB 2J42A 1UOJA 1UZYA 3KT1A 4OI4A 2WNUB 3RZMA 1SLCA 1VMFA 1YHFA 4WM8B 1RUH3 2Y0IA 4J6GA 4P02B 3WDTA 2JWPA 2RS31 3WP4A 3OBRA 1PGW2 2VGDA 2DCKA 3CNAA 4P9LA 4AGRA 2NN8A 3A7QA 3T09A 5D8AC 2Y0OA 1COV2 1CZVA 3AYDA 3DYOA 1GP6A 3LZZA 1PK6A 3C7EA 3OGJA 2VECA 2P5BA 4XUQA 2YFUA 5H9QA 1ZBA1 3W9AA 4PIXA 5F5AA 5IAVA 1VBE2 1I9RA 2A6YA 1Y9GA 5CADA 3VBOB 3VHOA 2BEOA 1BQPA 1IQAA 3ILRA 4LHLA 2D6NA 5A32A 4RA0A 5FYHA 3PNAA 3OGGA 3UV9A 1OD3A 3ROUA 5A6QA 2TBVA 2BNMA 2H0BA 3THDA 1DF0A 4OI1A 2XBO2 5F3CA 5IVEA 4NWWA 3IIIA 2GNTA 3EXUA 1CN1A 3AL5A 4RGKA 5CEHA 2VBBA 3V56A 1HIXA 2IFWA 4QAWA 4XETA 5K9YA 3VBRB 5FPXA 5A70A 1UY1A 1OD5A 3HWJA 4HBNA 1YNAA 3T3YA 1H30A 3WQ1A 4K20A 4YW5A 3VUOA 2W87A 5BNPA 2ZJCA 2VZVA 4XAEA 2J22A 1JUIA 5FZ3A 2D6KA 4EN7B 1UQXA 3KHCA 1MS5A 1JYTA 4COUA 4AFAA 2PN5A 2RMU1 2DVFA 3RJ2X 2VOTA 4W4ZA 4YG6A 3AVSA 4H55A 5BXXA 3UK9A 4LULA 3OEBA 1ZX5A 3Q8AA 1EPWA 4OQ8A 1COV3 1W8UA 4N53C 1TME2 3AKTA 4PF5A 3RSJA 2GALA 3DV8A 2G9GA 1AXYA 2XDVA 2P4EA 1QJX1 1H4HA 1T6BX 2FDFA 2X10A 1VBE3 4K1YA 4WM7A 4Y1ZA 1W99A 1SEFA 2CU5A 4IV3B 4AI9A 1H8TB 3ZLIA 2X29A 5EQUA 1JYNA 4CDWA 4W6XA 1LOEA 3OPWA 4C0BA 5LY2A 3WDWA 3MV11 1I5PA 3BTAA 4GB31 5FYBA 2XBO3 5LK7B 4FFHA 3WHTA 3WP3A 1UZVA 1HQLA 2X09A 1O7FA 1W3VA 2XJPA 3K77A 2IXKA 1H4GA 4Q8KA 2ZABA 5L7OC 4TZDA 3VKNA 3O0WA 4CEWB 5FYYA 1HRI1 2RS32 1QQP1 3M70A 5EJ3A 4NVPA 3NVCA 3WHUA 4IEOA 2JKXA 1N3PA 3BOPA 4H7LA 1Z7S1 5JWPA 1M4WA 4NHLA 4GH4C 1AR71 3HJRA 1LOFC 4XURA 4R4ZA 2HEVF 1KS4A 5LASA 1NQJA 1D7PM 2QQJA 2E26A 4E2GA 2GAUA 1K5JA 5ABJC 1YO8A 5C8CC 3RVHA 3MBWA 2FMDA 1OQ1A 3TN91 2QTWB 5F3IA 3ZKUA 4KH9A 3USUB 3AKQA 2VBPA 2VL4A 1TME3 2W47A 3AYAA 2X8KA 4JDMA 4NROA 5FP8A 3VBSA 1WLCA 1HN1A 1PIV1 1RJ8A 2OS2A 2YU1A 3ILFA 3WQ7A 4AQ6A 4IL7A 1SBEA 3KLSA 3WW1A 4UXAA 2Y8KA 4ET7A 4DXTA 1G9CA 4RQPB 2ZAAA 1W39A 4W6WA 3WNKA 2B5HA 4WVWA 4LBKA 2DV9A 1RUE2 1MS4A 4LHSA 4MVTA 2AEZA 2EAAA 2XWJB 2ZZJA 4CUGA 3O1VA 1SQ4A 1ZRRA 3C7GA 2YPDA 4AHYA 4AI0A 2HYXA 2DVGA 3OSDA 4QM9A 3RWNA 1BBT1 1JUHA 1DHKB 1X82A 3RMXA 4DUWA 5IVVA 5JOXA 1WLTA 2E32A 3WG3A 3WF4A 5L9BA 1XJAA 1O3QA 3S30A 2X05A 2X5IB 1UY4A 1XNAA 4FO9A 2RMU2 5K0UA 2OIIA 1WBFA 2C9KA 1W6OA 3N9OA 4JQTA 4LBJA 5GLTA 2EA7A 5IT6A 3HD8B 2A7AA 3NKGA 3I97A 2D6LX 4LO5B 4XPVA 5FTTC 2JDAA 1QXRA 2DVAA 2CWSA 3AMNA 1QJU1 1PX4A 3ETPA 1NLQA 3RRDA 1O5UA 4YVWA 2WWJA 2Z5WA 3MLJA 3QOPA 4BU2A 1GQGA 4DXZA 1ASJ1 2GSYA 4XAAA 5FDBA 3ACHA 2DFCA 2JE9A 4AXOA 4JGYA 4FAHA 3KVBA 2FDKA 1W6MA 1PHMA 5FPBA 4K40A 1UY2A 2W1UA 1C5IA 4BMBA 3AZWA 2JJ6A 3UKNA 3OPZA 3AJYA 1DG6A 3UL2A 4GWIA 4LBMA 4AI2A 4TXWA 3HN3A 3ZYGA 4I01A 4IEVA 1RUE3 4AGGA 4QX5A 5FP7A 3RDIA 3BB6A 4ZU5A 3U75A 3Q8CA 4BZ4A 4DB5A 1HRI2 4UOJA 2JDUA 1QQP2 2XR4A 1RVF1 4BQ4A 4F8AA 5IUQA 1AL21 2BERA 2HWC1 3EB7A 1IS6A 1LTEA 1ZNPA 1Z7S2 4LK7A 4RD7A 4LOSA 1AR72 1QJZA 3POEA 5A3MA 1RUNA 5FZEA 3E6BA 1RC6A 4GH4B 2J1SA 2ZKLA 1PK6C 2RMU3 2MEV1 2O0OA 2VMGA 4I09A 4IESA 1V9U1 2DURA 1LGCA 1NA1A 2ZMNA 4Y5TA 3TN92 5L36A 2ETEA 2WDBA 3FUOA 4LNVA 5A80A 3ZO0B 2Y60A 4B7KA 3V0AB 2OVUA 1PGSA 1SLLA 4MXVA 2VD7A 1W6PB 4E9KA 1PIV2 4QDRA 4CEYA 1KQRA 5A6XA 4DXSA 3WW4A 4HT1T 4FTSA 2WO7A 4LO4B 3OYWA 2IVJA 5F5CA 5FZ1A 3BOWA 2UY9A 1R1ZA 3AL6A 1GP4A 4OUMA 5CKNA 2EIEA 3B5LB 5JSPA 4FPEA 5DUXA 2H6CA 2SBAA 4XMAA 1YUDA 4EV0A 2JEMA 3FC0A 4P9YA 1GBGA 2JB8A 4FPKA 4Q4Y1 3CQOA 3BYWA 4LO8A 2Y6LA 4OI2A 3HQRA 5BNPC 3W5MA 2PHDA 3AZYA 3WNLA 1HRI3 3KQ4B 1QQP3 3HEIA 4AEDA 2B9UA 4Q4W1 4YFWA 3GJBA 5JUVA 2QBXA 3FFZA 2BBAA 2BU9A 2SLIA 2P3IA 1Z7S3 3I2GA 1E57A 3OCPA 3H7JA 5EJZB 4Z2AA 4KNCA 5GZGA 1AR73 1OQDA 2JKBA 1APNA 1JTZX 3IPVB 1QJU2 3RZGA 2D3RA 2LTNA 2XMLA 3A21A 3IDEA 3Q8EA 1NCRB 5H9RA 1ASJ2 1YJLA 3SMHA 3TN93 1I6XA 1XE0A 3JU9A 4AL9A 4IEXA 4Z07A 1PMHX 4LKSA 4PT6A 4WM7C 3WG1A 4HSJA 3PMSA 4BYYA 1QJY1 3TYJA 3M3IA 2ZKNA 1BVP1 1BVVA 2YV8A 3S7EA 1UU4A 4OZXA 3ZN6B 1PIV3 4BK4A 1U5YA 2JECA 1SLTA 4CDWC 1O4ZA 2QQNA 3OY8B 2QDRA 3RGBA 3N9MA 4B4QA 1Q8VA 5C70A 5FBJA 2DU0A 1UPSA 2E6VA 3RZJA 3CKHA 3VZJA 4PIYA 3NJVA 5FZFA 3L2HA 2J1VA 5GZDA 3H42B 2Q8DA 1CR7A 3ZXKA 1XBFA 5EFUA 1RVF2 1NXD1 1AL22 2J1TA 1Y43B 2A75A 1YQCA 4WZCA 4F3JA 4I3GA 2WNUA 1VE0A 4QX3A 4WM8A 1R64A 2WBKA 3N3HA 1JYIA 3UGGA 5JOYA 1VAMA 5FXZA 5C9AA 3VDAA 5AFEA 1C57A 1LR5A 3T2QA 1NOVA 1XRUA 2MEV2 1ZRDA 1UW8A 4YW6A 1PK6B 4ZKTB 5CG9A 1V9U2 2VPVA 4JDNA 4W65A 4YNIA 4RS5A 2Y6HA 3TWIA 2D93A 1MVQA 5FPVA 4ZXEA 1YI7A 4UFLA 3E6CC 1VP6A 4NIIA 1QJU3 1HB3A 4M3CB 4X8NA 2ZEYA 4XZUG 5FZ4A 2XUEA 5ACA1 2IXJA 3BTXA 4JRLA 4K9SA 1UZWA 4XQ4A 1ASJ3 4XILA 3VBSC 1NE6A 1FV2A 1YYNA 2BQPA 2B39A 4BIFA 2O1QA 3ZIXA 1K5MC 4E4HA 1V6JA 2D7FA 5CKMA 4D7YA 4FOQA 2JICA 4JAAA 2D97A 4QB6A 3BTYA 2IFRA 2VU9A 1JS9A 3I2KA 3IAQA 1W8FA 3R4SA 4MHRA 4CU9A 5BNQA 3SXWA 3LE0A 1KFUL 2ZGSA 5F1RA 4GJZA 1YFUA 1QKQA 1AYM1 2MPFA 1ZZBA 3N7MA 4Q4Y2 3WF0A 2ZGQA 4J1WA 3VBRA 3GZUC 4FT8A 1NZIA 5BNPB 4XF1A 4CXYA 4K1ZA 1RVF3 4Q0SA 3QACA 4Q4W2 1AL23 3BGAA 5LY1A 5KHKA 3GZEA 4BLIA 5K0UC 4QXKA 4JX0A 1D0HA 1VRBA 5JSOA 3CU7A 1AYN1 4UYBA 3EO6A 5C3RA 1N1VA 3DGTA 4LBLA 3RZLA 3I7DA 2FCUA 1O59A 2ZMKA 2OQ6A 2MEV3 2C4XA 4CXWA 3ETQA 4YVWC 2VMHA 2IXCA 4A3XA 1V9U3 2I07B 1CX1A 3SH5A 4H3WA 4QX2A 3N9NA 3MO4A 4JKLA 3H1WA 4BLJA 5A3WA 3POBA 3S5QA 1QJY2 4INDA 4JGYC 3K46A 5IFTA 4D3WA 1Y7BA 5BYNA 2R041 2XJQA 4IEZA 4IV3A 3ZXJA 5FJKA 4E27A 2AUYA 1W9FA 1CAUB 5E1RA 4D94A 4CDWB 1GICA 3IBMA 4YGDA 2W92A 1STMA 2IXHA 2XUMA 4NWVA 2XKPA 1SPPA 2ZHNA 5EP9A 3LDBA 1AZDA 1Y9MA 2ZMLA 5ANQA 3LEMA 2QQVA 1F2NA 2I45A 1Z78A 4D6QA 5CNAA 1T6GC 5A7WA 3IAPA 4PQ9A 1GP5A 4MO3M 4V1PA 1O8SA 1AF9A 2DF7A 3NAPB 4MZUA 3FZ3A 4XE9A 1OI6A 4PQQA 4NO4A 4Q4Y3 1L7RA 1W2UA 4CEWA 3AP4A 3HNMA 5T50A 2WKKA 4LKFA 1O8PA 1W0OA 3GBGA 1FPN1 1NXMA 1SBDA 4RSUA 4DPNA 1WW5A 3I2FA 3RG0A 2R6QA 5J98B 2J7MA 2P3YA 3UESA 2VZSA 1NA1C 4N90A 4K8RB 4JGZB 4BQ5A 5A33B 4XJAA 3ZDSA 4EN6B 4FP3A 1S0DA 1SMVA 1SCRA 5LWBA 3BUCA 2VUCA 5JPNB 1HQNA 1W90A 3USUA 5FKBA 2RR12 4CEYC 3VBSB 2GP5A 2YYOA 4B4RA 1LJ7A 2XXZA 2QQOA 1QJY3 1SCSA 1DYPA 3MUY1 4LA2A 4PI0A 4UW4A 1NAEA 1V6MA 1JYWA 2CY6A 1H2KA 1S0FA 1J3QA 4CCLA 2BJSA 2HKXA 3T4HB 1YQ8A 4RQPA 3BPSA 3AP6A 3MEPA 4QDSA 3VGIA 4EN0A 3B93A 5EHDA 3BI3A 4FPCA 1RUOA 3HMYA 3ZSLA 2WNVB 3K4DA 2PHFA 1B35B 5FMDA 1AYM2 5FIXA 1ZZ9A 4S2DA 5LA0A 4MUVA 4ARYA 2H0VA 1IPKA 1Y9QA 4EE2A 1YXWA 2ZHKA 1F15A 4RL7A 1BK1A 2KM2A 3SCHA 4AEDC 2OUJA 4OHZA 3NL1A 3WNMA 1RUJ1 5C5UA 2EXIA 5IHRA 3O1RA 1GZWA 3B69A 4KBZA 4YZ3A 5EJ1B 4Y20B 3NV4A 1AYN2 1LGNA 1QOSA 1W6OB 2ZX0A 5E6HA 5BY5A 1M06G 2BVBA 4NPMA 1JU3A 3FUQA 4EJRA 4C90A 3M3QA 2QNKA 1QJFA 1XOYA 4XDPA 4BQYA 2NMNA 1QWRA 3WUDA 2UU8A 2FCTA 5KC6A 4PCRA 2VW1A 3JUUA 4MOAA 1GWLA 2ZHLA 3BCWA 3IDAA 3MPBA 2VAUA 2UY8A 4QKFA 2B46X 3BU0A 4FXGB 1AR82 3THTA 1W6MB 2R042 4XW3A 2OPKA 1DCSA 3PHMA 2C9AA 4C8DA 2RR13 3OBTA 2Z69A 3LPGA 4QKBA 4EROA 4TLGA 5FY4A 4Q2FA 4ASLA 4CCOA 4ITCA 3NQHA 1RL3A 3T2OA 1QIQA 4Y4RA 2D43A 3LWCA 3Q8BA 1VMJA 1OPOA 2YBKA 3U14A 1HJFA 3SCGA 1AJKA 1BCXA 1H9PA 2YBPA 1GOHA 2V09A 3I3EA 5HPOA 1G86A 2ZA9A 1HLCA 2WT2A 1AYM3 2WZ8A 4IE4A 3ZXAC 3OUHA 3RI8A 2WNUC 2DWRA 3TEWA 4TWTA 4CZSA 4WM8C 2OUHA 5DZGA 1ZVFA 1VRH1 1OSGA 1C4RA 3HNBM 1PVXA 1FPN2 1E5RA 5JDBA 4NUBA 1XNBA 4XF0A 2WZR2 3FL7A 4BCUA 1DYOA 4GD4A 4XFIA 5AVAA 1H6XA 5KWRA 2GMMA 4CDUA 4QQ2A 4RS5C 3S0MA 1DIWA 4L9BA 1JHNA 1F4HA 3PVOA 4BQXA 3HAGA 4YW7A 1W9SA 3C2UA 2R49A 5C3SA 2OPWA 2OKXA 1C8NA 3AMHA 3POSA 2RJKA 4O9GA 3ZVXA 4A2UA 4GULA 1W0PA 2TUNA 5K8SA 4ARXA 1DBNA 4KG8A 4NPRA 5L9RA 3PU8A 4UT5A 2CGOA 5IJRA 2QQLA 1R091 4I0BA 1AR83 2VH9A 3ZN5A 3WF3A 4GWNA 1CGPA 2R043 1FYUA 4CDXA 3GCWA 3ME2A 4DY3A 4ORFA 1RUC2 4AZZA 2D3PA 4UBGA 4BIOA 2WLPA 4JVAA 3W20A 2GU9A 3U78A 1IQDC 3WLUA 1PVC1 1JZ6A 4R52A 3T08A 3GM8A 3PJYA 1KXGA 3PUHA 3O14A 2LS6A 5LB6A 3UKTA 1XYPA 3U4SA 4LTAA 4D8MA 1R081 2CAVA 4Y33A 3LQCA 3RMYA 3VBRC 3LGRA 3W5NA 2VJXA 4LT5A 1ALYA 4C1WA 2PMWB 3UYJA 3VBUA 5JXJA 1LHVA 2K0GA 4P9GA 4DOUA 1RUJ2 5FK7A 3H8XA 4GWJA 4AQTA 4IGQA 4Q4X1 3LSDA 3PLQA 2A1XA 1ZBE1 3HNYM 1FPN3 1O6UA 2GH8A 3N7KA 4YZ5A 3U4XA 4QX7A 2Y34A 2WZR3 3PDQA 1N1TA 1WCQA 3AYEA 3IPVA 4GALA 4TSVA 2PAEA 3LOBA 2IXIA 4M0NA 2HWD1 4FI9A 1GUIA 3T4VA 1N47A 1SLBA 1WKYA 5FPUA 1EPZA 1NCRA 2C5DA 2R32A 1WCUA 4Y24A 3T2TA 1TNFA 1WLDA 4NRQA 4MXWB 4K21A 4JHZA 4UF0B 2DCYA 1Q8PA 1DQ1A 3FE5A 4IV3C 4U36A 5HV4A 3I3BA 2FDJA 3PIGA 3VKMA 2Z2SB 1H8TC 1YWKA 2PXJA 3A22A 2W39A 4XFCA 3VL8A 3ZN6A 4A3ZA 4KGGA 2ARCA 5FZDA 2GN7A 3N4MA 3AFGA 2ES3A 1X8EA 4HG6B 1UYYA 1RUC3 3MI8A 5DDJ1 2XPJA 5DMYA 1LKNA 4IV1B 1JZ5A 2V4AA 3ABZA 2BUKA 4XQDA 1UZ0A 4A45A 2A3YA 4NJ4A 2FMYA 1V70A 4EZ4A 5D1IA 4OYUA 4CEWC 3VBFA 2FZ1A 5FO9B 2DBNA 2XH6A 3J7HA 1EP0A 2XHKA 2H6BA 1S2BA 1SBFA 3PUIA 4N7IA 4HOOA 4CP9B 1PO11 2CSGA 4D0QA 3K75B 4I30A 5C9AB 3K3OA 3WXPA 1RUJ3 1X50A 1GZCA 3VHNA 4OHWA 4XMIA 4ASKA 4MGYE 4AGVA 1S0GA 2Y6FA 1XNKA 4QX0A 5L19A 4TTGA 4RS5B 4H7MA 4AFDA 1S4CA 2Y26A 3ZXEA 2NZ9A 4KI5M 2QQKA 3WP6A 1AXKA 4RFT0 4CSWA 1K42A 4M3CA 2QKDA 3LCPA 3HVDA 3WW2A 3T1MA 4WVZA 4XF3A 1BEV1 4GAZA 4RYDA 4JV4A 4AFMA 5CYYA 3J4UH 5BNOA 5IK8A 3N9QA 1H1MA 3IIAA 3R0RA 4RQPC 4Y5Z0 1PVC2 1U0AA 2UWAA 3HR9A 3SH4A 4HXCA 1W05A 4A7YA 4HMZA 2PHUA 2JENA 3TBDA 3RZZA 4XUOA 3MFAA 1DDLA 1R082 3LFMA 3MDPA 2BFUS 2E7TA 5FPAA 3LA2A 5F6LB 3S5AA 3LKJA 1J83A 1O4YA 2V5DA 2ZGTA 3C7OA 5LZ6A 3WDUA 2HBTA 3WD5A 4ZY9A 3JQXA 5EXOA 3H8OA 2Y64A 4DO0A 4F83A 3AZVA 1GLHA 2NPIA 2X5IC 3CL1A 1FMD2 4Q4X2 4YRDA 4YSFA 1ZBE2 3GYDA 1WBLA 3ASIA 3B3QE 3CBNA 1OH3A 1TG7A 3VDCA 5HCFA 5GLVA 5IYYA 4OQ9A 1DQ5A 2HWD2 5H9SA 1UIKA 3VZMA 4NR1A 1HB2A 3UGHA 5CB7A 3ZYIB 5G04L 3GNEA 1Y3TA 5FXWA 4P14A 1A8MA 3JBG1 2QQPA 1GNYA 4HVQA 4EWDA 1FX5A 2Q8CA 5JAXA 2PELA 4N9HA 1TNRA 3AC0A 3NWKA 1CIWA 2C6SA 5CFCA 1J1LA 4NRMA 1GWMA 2VZ1A 2W1WA 1W6NB 3I4IA 2WYSA 3VD9A 1AJOA 1D2SA 2F4LA 2IC1A 1W9WA 4CUBA 2L9LA 3APBA 4AVSA 1MQTA 2CNAA 3MHZA 2XLAA 1JMUB 1CAUA 1SHWB 5JIAA 2RJ2A 5CA6A 3AM2A 1SPPB 3CMGA 2YU2A 2ZEXA 4IEPA 5DDJ2 2Q1FA 2OA2A 1NX9A 3AYCA 3B7MA 1PVC3 1GOFA 3E5UA 2YY1A 3MIGA 1ENRA 1DFQA 2EALA 2DUPA 5A7WB 3VB9A 4CXXA 1MS8A 2B45X 4QDQA 4FPGA 1JZ7A 1LEDA 1S2EA 1S0IA 2GC2A 1R083 1G6NA 1VPHA 2KD7A 3I3DA 3MIBA 3WF2A 3WNNA 2ZGNA 1SFYA 3NAPA 5FYVA 4B4PA 1PO12 1QU0A 1QGLA 1W06A 3KV4A 4JC1A 2ILMA 2BW8A 1RMU1 3JQWA 2CDOA 4YZ2A 5I8SA 1SLIA 2LRPA 4CDQB 3KCXA 3ATGA 3TNQA 4M00A 4RHV1 1QEXA 2AGSA 3LEKA 1OVSA 4CDUC 3WX5A 1FMD3 1NT0A 1OF4A 4Q4X3 1POV0 4C91A 1ZBE3 4C0HA 4DINB 2WSUA 3JZVA 1ZBA2 2W68A 1H2MA 1WMEA 2BV4A 4N8MA 5DAVA 4OVEA 4JGZA 2O14A 4P9IA 3C7HA 5A33A 3E97A 2HWD3 1CQ9A 3ACLA 5FY9A 1VR3A 4EZHA 2BTVC 3H8RA 1W9YA 3KF3A 3KT4A 4L97A 4P5YA 1BEV2 1V6NA 4KU8A 4NPLA 1NZCA 4FPJA 3ZOIA 5IWFA 2F4PA 4L0PA 1DQ4A 3EYPA 1NG0A 2VNGA 1W2TA 3VDDB 3VKLA 1X36A 1NE4A 1H8VA 4L11A 3B9IA 3MIDA 4UI9L 4YW4A 1ZZ6A 3LDRA 2F6BA 4LXLA 2VTXA 3CLPA 2P6HA 1VMHA 2PA7A 3ZMOA 3EHKA 1OXCA 2RDNA 2WNVA 3ZR6A 2XVGA 5DDJ3 1QNWA 2R1BA 4FOVA 1B35A 2WO2A 4NE9A 2ZEWA 5I0RA 1KDKA 3O12A 2ZX4A 4HN0A 3VBUC 4R8HA 3AK0A 1OUXA 4QHBA 3GGLA 4HVRA 5LBBA 4KL1A 4A4AA 4HN1A 2MHFA 2R071 5FYIA 1GZWB 3TEZA 1ODMA 1PO21 2HWB1 1PO13 2RS33 5FAXA 1PGL1 4Z1VA 2BFUL 1Q5OA 3M1HA 4Y20A 2BBVA 4QT6A 1UYXA 3AMMA 2J1RA 1PX3A 3V65A 1IOAA 3K4AA 1DP0A 3AXEA 2RVAA 1AX2A 5LK5A 4OI0A 3JBG2 1E5SA 4BDVB 2BP6A 4ES9A 1NCRC 3TEYA 1ZBA3 1QJX2 1VIWB 3HN1A 3ENRA 3MZHA 1D0GA 1G9AA 5FY0A 2EICA 2XJTA 4AW7A 1TQ5A 4ZZ5A 2HEYF 1CJDA 3QD6A 5F5QA 1BEV3 1YFWA 4FXKB 2XVLA 1KDMA 1FXZA 2PHLA 3AMQA 4Y26A 3H1YA 4TN7A 4YFZA 4QPIA 4BQ3A 4Z92B 4DXRA 3GBWA 2Q1ZB 4NRPA 3FX3A 1RUI1 4JHTA 4GB32 3VHRA 4E4SA 2YUEA 4XHXA 2NLRA 1DZRA 3BU7A 2Q5TA 1A8DA 1LESA 4PHZA 4URTA 3VDBA 1CZTA 3VBFC 2VZPA 4IEWA 1WA4A 4AQ2A 4ZU4A 4AVTA 3HOBA 3MUZ1 4QPGA 1RMU2 2E7AA 5C7GA 2UURA 3INAA 4IERA 4BH9A 2P2KA 2VQAA 1LHNA 2A5ZA 3VD3A 3IM0A 3KQRA 4FQZA 1VBA1 4XJUA 4KWJA 1QH6A 5BNNA 2DVDA 4PLMA 1UNBA 4CDUB 5FOJB 5FUPA 5A3OA 3PUAA 4I3PA 1FV3A 1MACA 2ZGOA 4XF4A 2YFZA 1JZ4A 4GZ9A 1UYPA 3E5XA 3LSEA 3AP5A 1U5IA 3ES4A 4DFSA 1OLMA 5A7OA 2EAKA 1NY71 3JBG3 4LO6B 4COYA 3Q9OA 3I3MA 3NSTA 3R6SA 3CIHA 4QGMA 3DPRA 3O5SA 4B1LA 1GNHA 1QJX3 1OURA 1BLZA 1V6IA 2CGNA 3ZPYA 3SNMA 3B00A 1MS0A 4P00B 3J26N 1HV0A 5EWSA 4CDXB 5FZBA 3UGFA 4LEJA 4QQHA 5A1LA 1F5FA 4I0AA 5HXVA 2G1MA 4ISQA 2OZ6A 3KSCA 5AFBA 3RYKA 3QH7A 4MLOA 4TLFA 5F2SA 5T5LA 1D4VB 4OULA 4ZZ8A 3D8CA 1BHGA 1HX6A 4CE8A 1WLWA 1XXNA 1UYZA 2BVVA 1ZZCA 3GHMA 4GB33 4N43B 1C8M1 2D44A 3IMNA 5KC5A 3M3EA 5A7SA 4ZU7A 1BBT2 4Q0UA 2Q8EA 3VBUB 3IDCB 4ONUA 3O0VA 2R072 3D3AA 3EMRA 4NIAA 2ZX1A 1PO22 2HWB2 2XQRA 1PGL2 3MGUA 2E9QA 2IZWA 1RMU3 2W08A 4UAPA 4PI2A 4COWA 4Y1UA 2CL2A 3PMEA 2PAKA 5FY8A 4FPLA 2B4KA 5A3UA 5JVVA 2ENRA 5T5PA 4YZ1A 4UWDA 1RUF1 5DABA 5FP9A 3VL9A 2OQ7A 3U10A 5LRRA 2D40A 2HJIA 2QUOA 1W0NA 3DXUA 2BGCA 1JW6A 5FY1A 1UAIA 1XNTA 4HANA 1ND3A 1O4TA 5CFCC 4JDOA 2W46A 1URXA 5A7QA 1IHMA 2W5FA 3M3OA 4MXWA 3BKZA 4UW6A 2PAMA 2ZGLA 5SV8A 2GNBA 3ZDVA 4UF0A 1DU3D 2JIGA 1MQTC 3DN7A 5T5OA 3RYRA 3ZM8A 4LKEA 4COZA 3DCQA 1LB2A 1UKRA 2JD9A 4LOTA 5GLWA 4V2VA 1ONAA 1E5HA 1RUI2 3CEWA 3OD4A 1UY3A 3U11A 4GQ7A 4Z82A 2XOMA 1W3XA 1WA6X 3RNSA 1UMIA 2WZPP 1C5HA 3ZFGB 3H3LA 3FFQA 4HKLA 1MZ5A 5JIUA 5CVRA 2WINB 3DL3A 3RS6A 4BJ0A 2RV9A 1MVEA 2IXLA 1UX6A 2YMZA 3KM5A 4IV1A 2W3JA 1QOOA 3HQUA 3NAPC 2QZ3A 4RR3B 4XBQA 3VBFB 4LPLA 4C1XA 2HWC2 2VUAA 4CCEA 1BBT3 3M7AA 5JZGB 1VBA2 4QQPA 2W52A 1LU2A 1NYWA 2R073 3VBHA 4CP9A 1PO23 2HWB3 3MYXA 4XHBA 5FYUA 2TEPA 2G9ZA 2GZWA 3H3ZA 3K4ZA 4M3CF 4MHUA 4QU1A 5T54A 5A6YA 1HN0A 2E33A 2PHXA 3NNMA 4NHYA 5FZLA 2FDGA 4ZXKA 4JGZC 3BIEA 2WC2A 4KWUA 5FZ6A 4EN8B 1NY72 3H3UA 3U07A 3I2DA 1EUTA 3G6JB 4FVVA 4XVHA 4N9IA 1UU6A 4Q0PA 3ZXFA 3HPNA 1GMMA 3IKWA 1IGOA 4UFKA 4LBQB 2A70A 2PTMA 2P3JA 3WNXA 5BNOB 3BTZA 1GYKA 3D4KA 2J1AA 3WEZA 1QJEA 4QXHA 1XC6A 5DAQA 3ZYFA 2JG8A 4V2WA 3MLLA 1L7QA 2TNFA 1RUI3 1G9BA 2WNVC 1XNCA 1B35C 1C8M2 1DLCA 1QMJA 5FZMA 4L99A 3L9JT 3VKFC 2NMOA 4OMDA 4BHPA 4BE3A 4CP1A 4P9WA 1CAVA 2UYAA 3K51A 2OZJA 1DQ6A 2WWUA 3PUSA 1NLSA 1Y4WA 3DXTA 1ZRFA 4AVAA 4DEQA 5IVFA 1DGWX 1UWWA 2HWC3 3PVNA 3WCRA 1FOD1 3PTYA 5F9TA 5FZ7A 4LLFA 1VBA3 2VZUA 3A0KA 2FQPA 4H2AA 1IS5A 5DG2A 5FY5A 1RUF2 4NIGA 3AFKA 3J9SA 1OT5A 4IW3A 4XBLA 2HWF1 3M4FA 4AVBA 1NLRA 4IEYA 1PMJX 1IPSA 2K2SA 5E89A 4E8CA 5DPNA 3PTRB 1QXJA 4K3UA 1CPNA 1D2QA 4OHVA 2AZ5A 1NCQB 4GJYA 5HCBA 4AHZA 5CFCB 2UYBA 2BWAA 1LOBA 2ZTNA 4GKXA 3NO8A 1CAWB 3T0DA 2FD8A 4XBNA 4HSLA 3H50A 2RG4A 5EZWA 1UXXX 1GFF2 1W6NA 1MQTB 4XDQA 1CONA 4QPIC 1U5ZA 5FLJA 4Y3OA 3ACGA 1OH4A 5IVBA 4Y22B 1POV1 5E16A 2EXJA 3OGRA 5F3EA 5IW0A 4OHXA 1F9KA 1REEA 2K9ZA 1C8M3 1C1LA 1OA4A 1YI9A 4ZS2A 5GZEA 5F2WA 4CCJA 2DCZA 4DZGA 5EPAA 2KXLA 2GN3A 3URFA 3BIWE 3J7LA 4CDQA 2B8MA 4Q4W3 1O3SA 3THCA 1R1A1 4R9DA 1FATA 5CBLA 1ULOA 2ZBJA 1J84A 4Z8BA 1S0EA 2WO1A 1QHDA 4KQ7A 5CIRA 1RUF3 1HV1A 1IG3A 1AX1A 2VUJA 5FK8A 1ULDA 5ACA2 3CF6E 5A3NA 4FFFA 5A7NA 1TMF1 3DEMA 5C33A 3NNGA 4LA3A 3QCWA 5FZCA 3W58A 3DPRC 4AHWA 1CJPA 4LBQD 3QBQA 2LW8A 3BALA 4JTOA 4Y1XA 5GZCA 3HT1A 2ZCWA 2VC9A 4XFBA 4B29A 3GALA 2C0ZA 3GZTB 3VDDA 1ZZ7A 4XFFA 5FCCA 4XCBA 4JTNA 1W2OA 3L2YA 3KB5A 3ZFEA 3X29B 2VXJA 3AP9A 3RI9A 4ASMB 4AOCA 4HK9A 2ARXA 3KS7A 3OBZA 4YARA 3K48A 4AQSA 3USSA 4HLTA 2D6MA 4K6BA 3MLKA 1N1SA 2JXAA 1IZ3A 4YYOA 2PQSA 2WS91 2HBUA 5FPLA 3QH6A 5GKAC 5KR7A 1H9WA 1HJGA 4I02A 1KJRA 1DGRA 2NQYA 3ZSKA 3JCIA 1JYCA 1PNFA 2VQUA 1FOD2 1RUD1 2PHWA 3S6PA 2WFF1 4ATEA 3F95A 5HBAA 2WN3A 4YGEA 4BPZA 5J3UA 3ZYPA 2XONA 4S2HA 2HWF2 1G9FA 3C3VA 5FO7B 1IPJA 3SCFA 3P3PA 4FTEA 2ZAHA 3S57A 4IGPA 4K8FA 4JRAA 1GV9A 4CYDA 3D0SA 3O7OA 3MIFA 1BJQA 1U12A 4GMP0 4Q26A 3OG2A 4AAXA 2W2IA 2VOVA 1AXZA 1ND3C 1AR61 2XLFA 4X6RB 2ZGMA 2J1EA 2DUQA 4WBBA 5ACA3 1UY0A 3RPQA 4AAPA 1GOGA 4W50A 4NHXA 4EQVA 1G9DA 3MFCA 2VZRA 3U37A 1OKQA 1JOJA 3K3NA 4LMFA 2AENA 3N7LA 4IGOA 4L8QA 4QPIB 4A7ZA 5A3LA 4CU7A 2HEWF 4AEKA 5HCAA 4IE5A 1IS4A 5DAWA 1VBD1 3RWKX 2AACA 4IXLA 4IV1C 2OX0A 2JG9A 1AHSA 4N53A 1AL0G 1UPIA 1HB1A 1VLNA 4QQOA 5CFDB 3M2MA 4R4XA 1RTVA 2HLEA 1SDDB 3KWVA 4QPGB 2DYCA 4Q0QA 1UU5A 3R4UA 1UOBA 1N3QA 2A3WA 4QKNA 4XACA 3T2PA 1O91A 4W8JA 1ST8A 5J1XA 1F31A 2V73A 3A4UA 4MGQA 4KMQA 5C9AC 4META 4Q5OA 5FQ0B 1D4M1 2ZZQA 1R1A2 3QLQA 5FZHA 2PFWA 4XFGA 1FOD3 1OOPA 2A73B 3TEXA 5BNNB 1DLLA 2VG9A 4LIUA 2AREA 5C3OA 1AYN3 2P1BA 5I0SA 2HWF3 4XFHA 3P3NA 3EQEA 4PBOA 2VR4A 1QNYA 1WCSA 3ZKYA 1TMF2 3UJOA 4AVVA 1OUSA 2D6OX 2RHPA 1Z0HA 2WJSA 4BK5A 2B9VA 2F17A 3DPRB 4CP2A 4QD2A 2VNVA 1O3RA 3RZHA 1G7YA 4CRQA 1UD1A 4FOWA 3WDVA 4E2QA 2QDNA 5IAXA 4MGTA 2R1DA 3J7NA 5I91A 1HXS1 1H1IA 1HDKA 5FYTA 1RXFA 4AI8A 2JG8C 1ZA7A 1JZ8A 1ULFA 3H1MA 3WT3A 2BGOA 5F8PA 3D82A 3MW2A 4IDZA 4OZOA 4G4FA 2KR2A 3JB8A 5FZ0A 2WWSA 4ISRA 2K46A 5LEKA 1BZWA 2EVXA 2WS92 2ZX3A 3FMGA 4LJHA 4XQWA 5K4LA 4N43A 5HV0A 3FLPA 5JPMB 3WQ0A 2ZGPA 2VVEA 2BDRA 5I8YA 1RUD2 5JOZA 2ADDA 1CPMA 5DAXA 4Q0VA 4LIVA 4IQPA 1JN2P 1GANA 5FZGA 4LKDA 2Y6GA 1LRHA 3KGZA 1PMIA 2VNOA 3WUCA 3LAGA 1XQNA 1R1A3 1VBB1 3BODA 1A34A 5FOBB 4FTBA 3CZJA 1REFA 4ZS3A 3SC7X 5D21A 3GZAA 3PU3A 5GJ6A 3GHNA 1AR62 3RZKA 4DQAA 1H1AA 5H9PA 2XB6C 1ND3B 3PJQA 2W1QA 4MG2A 1TMF3 3ACIA 3HBKA 3VN4A 3NV1A 4XTPA 1FI2A 1NQDA 5I0TA 3T0AA 2VZOA 3O1SA 4HPKA 3CJXA 4NOTA 1CESA 4MSVA 2Q0AA 3BN6A 2LROA 4JKMA 3OGVA 3AMPA 3GDBA 4W6YA 1IKQA 1KD7A 1UL9A 2A3XA 3HBZA 3RQ0A 5FZIA 1DQ2A 1WWYA 4QX8A 1ZRCA 4BQWA 1VBD2 4YM1A 3SH3A 4KU7A 3ZR5A 3B94A 1VAKA 3ZFGA 1ULEA 1ZYBA 3CO2A 5DUVA 2VQ0A 4NAMA 2B42B 4Q1PA 4KWLA 3KCYA 2WS93 4HKOA 2P3KA 5K7PA 1CVNA 2VCMA 2VW2A 4RR3A 1WCDJ 1VRH2 3VZKA 4A42A 1HKDA 3M8LA 3VBHB 5JZGA 1D4M2 5JXHA 1VB4A 2AR6A 1RUD3 4M3CE 4CDQC 4DRVA 4NIHA 2GNDA 4QPYA 1BK0A 3WCSA 3F2ZA 2RJLA 4LK6A 5ERLA 4JCKA 1RIRA 5G05L 2XQXA 3U0ZA 4RGGA 1YIPA 3AZZA 2ID4A 5C4WA 2YC2A 3E5QA 5KHIA 4AR2A 2JDYA 2O8OA 2BYVE 1JZ3A 2ADEA 2D5FA 1JHJA 4Q4V1 4AI3A 1GQPA 1KEXA 3K2OA 3OBAA 1AR63 3ZFFB 2ATFA 4TYSA 5CU1A 3SISA 2W1SA 3M3CA 4COVA 1R092 1W2AX 1YC61 3WG2A 3I49A 1YFXA 2GC3A 2BPA2 2BRTA 1HXS2 1LOGA 1LHWA 2GC1A 3MF6A 3PURA 4LBQA 3GJAA 3UKVA 3VDDC 4OHYA 1FNYA 2WAAA 3AZXA 1UXZA 4AVCA 3PL0A 4MGZE 3ZFEC 1W8OA 1EAH1 3CHXA 2JG8B 4YM2A 5F7UA 4FSJA 2JE7A 5CG8A 4PF1A 4QXCA 3BVCA 1XB9A 1OF3A 4PIZA 5EV7A 1SLAA 5J36A 1VBD3 5GM0A 1GQHA 5J96B 3H0OA 4XC9A 3H7YA 5FJHA 1F4AA 4LHNA 2YPJA 1CAVB 3UT0A 3ZSMA 1WGPA 4F7ZA 4EWEA 1W8NA 2ZHMA 4FFGA 4DMIA 3SEPA 1JOPA 3HT2A 5HXMA 2Z79A 5C8WA 3P6BA 3ZSEA 1S0BA 1YQ5A 1H2LA 1XNDA 1VRH3 2BNNA 2XJVA 4Q29A 4QGLA 4RGAA 1LENA 4WVVA 5FUIA 1H0BA 5FWEA 5LA2A 1D4M3 1REDA 2GMPA 1VBB2 2RDQA 2WIIB 1EUUA 3KF5A 3T1LA 4XDOA 3CDZB 1HQWA 1WMXA 1RUE1 2JDHA 1MZFA 1X8MA 1H2NA 4XTMA 5I8TA 2D5HA 3VD7A 2JDMA 3FBMA 1MS9A 3N9LA 1K12A 1PZ8A 4ZPIA 3VZLA 5FR3A 2WNEA 1QXPA 2VOXA 4E2SA 1BYHA 2ORZA 1NCQA 4BOWA 5DQ0A 3I8TA 2CAUA 1CAWA 4D69A 4D7SA 1R093 4IUGA 4P08A 3NNLA 5C6CA 2E31A 4LE4A 4XUTA 3VHPA 1OA2A 5B4NA 1HW5A 1Q3EA 3ZIWA 2EF6A 1LECA 1HXS3 2MNGA 5B2GB 1X7NA 4XF9A 3NMBA 2R061 1WW7A 1S55A 3A0NA 3OTFA 3I2IA 3OJBA 4Y22A 1LHUA 4BISA 5FP4A 2JG9C 3J8F1 2PHTA 3CJIA 1F8VA 4QKDA 1RGSA 4Q8LA 3B02A 5I0DA 1WUVA 2E53A 1B09A 3EJKA 5I93A 5IVJA 2P17A 1UZZA 3NW4A 2YHJA 4CCMA 1OOPC 1XYNA 4ES8A 2YZ4A 5FYMA 2V72A 4Y1YA 5DXDA 2R7EB 2HWE1 4PLOA 1W6QA 2BGPA 2OT7A 1VBB3 4FFIA 1X9TA 3E1F1 1J3RA 2ZPXA 4Q4V2 4IE0A 2ZGKA 3TOJA 1ACCA 2RE9A 1NUKA 2VMFA 1GR3A 3NNFA 4CCKA 4OCTA 4QPWA 2Y33A 4YM0A 4YVSA 1LGBA 2Q4SA 3O1UA 1OBNA 1WD4A 4P5HA 1XSRA 1RHI1 4BXSV 2A71A 4D6SA 5FPZA 4CDXC 1UF2C 2WYFA 2XVKA 3W59A 5BPXA 1MZ6A 1EAH2 1CAXB 1UO9A 1QDCA 1ENSA 2YC0A 4DUXA 3AB0A 3ZFEB 3POWA 2XLGA 5D8AB 2YDEA 3WDYA 3NV2A 2EIDA 2VO5A 2Q1MA 3KGLA 2VMCA 3VD5A 3W21A 1KS5A 4QB2A 1J58A 2DFBA 2JDKA 1POQA 3KV9A 3KVAA 4N43C 4GMP1 2VZQA 5ANNA 4BMEA 5A3PA 1UMZA 3AKRA 2VZ3A 4NAOA 2DU1A 2OXBA 3WSOA 5KXDA 3N9PA 1MEC1 4RN5A 2W9XA 3MW3A 3U1XA 1OFNA 1RUG1 3FHQA 4XZPA 1NKGA 1WMFA 1K45A 2VOWA 1K5MA 4Z2WA 1GKBA 2ET1A 3PVBB 4LLOA 2WFPA 2XWBB 4SLIA 5DAPA 1V6OA 3RYPA 4XJ9A 5FXXA 1ULGA 1BMV1 5FY7A 4YLZA 3ZN4A 1U5XA 3ON7A 5BUVA 4IEQA 4URAA 1JYXA 1W04A 2JDZA 2QQMA 2RDSA 1F35A 2E51A 2WO3A 1PNGA 2AYHA 4FCAA 4Q4V3 2RS11 5FMOS 3NRUA 4CVUA 1N3OA 4CP0A 1C1FA 2YGLA 3B9CA 2GDFA 4CPBD 4YWAA 2V4VA 4N7UA 2Y38A 2QJVA 2R062 5DN2A 2VCAA 4XUNA 1KJLA 2BNOA 2FBEA 1EAH3 3NV3A 4I0WB 4MGSA 2PQQA 3GCXA 4AG4A 3J8F2 2E7QA 4AK3A 4E4DX 1YLLA 2E63A 3MIEA 2JG9B 4HKWA 2YGMA 4KBBA 4N53B 3DYPA 3ZFGC 3ZXGA 3OEAA 2X53S 4CCNA 2A6XA 5KHHA 1XPWA 2IWGB 2CWMA 3NJYA 1LHOA 1OA3A 2V5YA 2Y6JA 4XCAA 4RR3C 5CFDA 4B8EA 3O1OA 5JZGC 2PYTA 2CTVA 3O0XA 1TEIA 1S1AA 5AVPA 1Q56A 1Q8QA 3WR0A 3NKTA 2BWCA 2FCVA 3OD0A 4LITA 4RHV2 1OLME 1OOPB 4MGIE 4OLLA 5FWJA 2ZS6B 5AC91 3LDKA 5FQ0A 2EIBA 5JMCA 2HWE2 1LNSA 5C4WC 4XOGA 3TB0A 1US2A 4M01A 2DUOA 2HH9A 4B7EA 4O9EA 3E6DA 1SACA 2O8QA 2UWCA 4UFIA 1W8ZA 3HQXA 3V64A 1CX4A 5L7OB 1V6LA 3KD4A 4D6RA 1GZ9A 2XL7A 3C8XA 1RHI2 4OUEA 1CZSA 5FYSA 2R30A 4QMAA 1OKOA 1BXHA 1GZTA 4HL0A 4YW2A 5T5JA 3FWEA 1LULA 1IG0A 5BNOC 2W91A 4NN0A 4Q27A 5IK5A 3I54A 3FN9A 4M4RA 2PLV1 4JKKA 1EV11 1VBC1 2R16A 1TE1B 3POGA 1VJ2A 1AR91 2R063 5F32A 5A7PA 5F39A 5C8CB 1PZ9A 2EXHA 5ABJB 4DY5A 1W03A 4HONA 3AXDA 3IMMA 3J8F3 3FBYA 3WZ1A 3ZSJA 5JSRA 1IKPA 1YFYA 2LM3A 4QQLA 2WSVA 5JMOA 2IUWA 4NMIA 1MEC2 1US3A 1MS1A 2W95A 5TSWA 2VTXJ 1W9TA 3KHBA 3SQOA 4AHXA 4LR4A 1RUG2 1HRV1 4FBFA 4HZFA 2Q8OA 1VAVA 1OHFA 5ISLA 4M0HA 4XXAA 4FPHA 3WINE 4A6OA 1JH5A 4CTEA 4WVMB 5LCWL 4RHV3 1BMV2 1GNZA 1X9PA 1RINA 1ND2A 4J1XA 2VQTA 2LALA 3N36A 2HWE3 3IDBB 3ITQA 1N1YA 4UFJA 5KXCA 2QFEA 2PHRA 5HI0A 2RS12 2I2SA 5DZEA 2VE1A 1NCQC 3IWZA 2WQ4A 1L3JA 1S0CA 3I59B 3LB9A 3N35A 1ZM1A 2G9FA 2VY0A 4HPKB 2VBDA 1RHI3 5FREA 1LODA 3UNPA 2OYZA 4SBVA 3LEGA 4UW5A 3R4DB 1V0AA 3DYMA 1FNZA 2YG0A 3ECQA 5F3GA 1MS3A 3FHIB 3ORJA 3OPTA 1KFXL 1I3HA 1RITA 1W2NA 4L2NA 4X8PA 5FMOL 5JR2A 4ATFA 2WT0A 4YZ4A 3T0BA 4A7KA 3CJIC 4QXBA 4HK8A 1V00A 3NJXA 4QWNA 2C1FA 4A41A 4LORA 4GMP3 3FLRA 3NNJA 3ZXLA 4PDWA 2JIJA 5KBFA 1J3PA 3AKPA 4QHOA 3UETA 2A6WA 2NP0A 1EYBA 1MEC3 5FZOB 2RS51 2VM9A 4IEUA 4XFAA 3WF1A 5AC92 5I0UA 3KCCA 1JYVA 3AKSA 1RUG3 1MZEA 2VUDA 5EYXA 4MV2A 4QX1A 5IATA 2Q30A 2WL1A 2DCJA 3P1IA 1WW6A 3SKJE 2G19A 3DKWA 5C4WB 4YM3A 2ARAA 2C24A 3ZYHA 4E4ZA 2GMEA 4JQRA 3H9AA 3MF9A 2ET7A 4QM8A 3JD71 3ZYBA 5IVYA 3LIHA 5IFPA 4K7JA 1QOTA 3P5BA 5B4XA 2AEYA 3OUIA 5GLUA 4BM8A 4YVSC 2WQZC 3DKQA 4B3NA 3V0BA 3IZOA 3WW3A 3ZFFA 2RS13 1JXNA 3D0JA 4P9JA 4P9XA 1DZQA 4M4PA 1JBCA 3LD8A 5A3TA 3SLIA 1C3HA 3S7IA 5F6KA 1OQEA 4AEMA 1AVBA 2PLV2 4NIDA 1EV12 1VBC2 2WUHA 3JXSA 3WG4A 1AR92 1TVGA 1YEWA 4AFCA 2WQ8A 4KGQA 3R05A 3EBRA 1YQ6A
chains in the Genus database with same CATH topology
4IE5A 3RZJA 3I3QA 4IE0A 2FDKA 5DABA 2FD8A 4NIHA 3O1TA 4OCTA 4O7XA 3LFMA 4QKNA 2FDFA 3S5AA 3BUCA 3BKZA 2IUWA 3KHBA 3H8OA 3I49A 2FDHA 4ZS2A 4NIIA 4IE6A 3T4HB 4RFRB 2FDIA 3BTXA 3BI3A 3H8XA 3RZHA 4NRPA 4JHTA 3I2OA 4MGTA 4NRMA 3O1MA 3BTYA 5F8PA 4IDZA 3T4VA 3O1RA 3RZMA 2FDGA 4NRQA 4NPMA 3BIEA 4CXXA 2FDJA 4CXYA 4NROA 3I3MA 4QKFA 3BU0A 3BTZA 4QHOA 3RZLA 4CXWA 4ZS3A 4QKBA 4NJ4A 3O1VA 3RZKA 3O1UA 3O1OA 4MG2A 3RZGA 3S57A 4QKDA 3O1SA 3H8RA 4NPLA 4IE4A 4O61A 4IE7A 3T3YA 4NIGA 4ZHNA 4NIDA 3O1PA 3KHCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IE5 A;  3RZJ A;  3I3Q A;  4IE0 A;  2FDK A;  5DAB A;  2FD8 A;  4NIH A;  3O1T A;  4OCT A;  4O7X A;  3LFM A;  4QKN A;  2FDF A;  3S5A A;  3BUC A;  3BKZ A;  2IUW A;  3KHB A;  3H8O A;  3I49 A;  2FDH A;  4ZS2 A;  4NII A;  4IE6 A;  3T4H B;  4RFR B;  2FDI A;  3BTX A;  3BI3 A;  3H8X A;  3RZH A;  4NRP A;  4JHT A;  3I2O A;  4MGT A;  4NRM A;  3O1M A;  3BTY A;  5F8P A;  4IDZ A;  3T4V A;  3O1R A;  3RZM A;  2FDG A;  4NRQ A;  4NPM A;  3BIE A;  4CXX A;  2FDJ A;  4CXY A;  4NRO A;  3I3M A;  4QKF A;  3BU0 A;  3BTZ A;  4QHO A;  3RZL A;  4CXW A;  4ZS3 A;  4QKB A;  4NJ4 A;  3O1V A;  3RZK A;  3O1U A;  3O1O A;  4MG2 A;  3RZG A;  3S57 A;  4QKD A;  3O1S A;  3H8R A;  4NPL A;  4IE4 A;  4O61 A;  4IE7 A;  3T3Y A;  4NIG A;  4ZHN A;  4NID A;  3O1P A;  3KHC A; 
#chains in the Genus database with same CATH topology
 4LUK A;  2RM2 1;  3ELN A;  4KG0 A;  4J25 A;  2XL9 A;  4UFH A;  5FMB A;  5FUN A;  2AH2 A;  2AC1 A;  2P37 A;  3OB8 A;  3TAY A;  5FRA A;  1W8H A;  3IT8 A;  3SEE A;  1X33 A;  3ST7 A;  5DUW A;  3VBO A;  3WOG A;  1HRV 2;  4BWO A;  4DRR A;  5LW9 A;  4O7X A;  2RR1 1;  1QDO A;  2EXK A;  2Z4F A;  4LBO A;  5A32 B;  4CUC A;  1JZ2 A;  2R0H A;  5FZ8 A;  1RB8 G;  2RDR A;  3BPZ A;  1S2K A;  3LF7 A;  1RXG A;  2XJR A;  3GXU A;  5JR7 B;  1W8W A;  1SDW A;  1V6K A;  5AC9 3;  5F37 A;  2WA3 A;  4LHK A;  3WNO A;  5KXE A;  1GU3 A;  1OFS A;  1T2X A;  2GP3 A;  5JLV A;  4A6S A;  1J59 A;  5JOW A;  2NM1 A;  5LRS A;  4QHZ A;  5J48 A;  4XAB A;  1XE8 A;  3T30 A;  4EYU A;  4PBP A;  4AF9 A;  2WNO A;  1SFP A;  4IE6 A;  2VUL A;  4HET A;  2XGX A;  2FDI A;  2FZ2 A;  4R9C A;  5FZA A;  5LAT A;  2BZD A;  2QE3 A;  5C3Q A;  1XU2 A;  5IK7 A;  2WA4 A;  4QB1 A;  2P6C A;  5T55 A;  4CPB A;  4XIK A;  4CUA A;  4CU8 A;  5L9V A;  4GIQ A;  3I2O A;  2PLV 3;  1EV1 3;  1VBC 3;  2LUW A;  4AEJ A;  4E8D A;  3CJI B;  1K3I A;  4PLN A;  3THP A;  1ZZ8 A;  1XU1 A;  1AR9 3;  2CGP A;  4Y5S A;  3ZPO A;  1WMD A;  5JXI A;  5LBF A;  2QZ2 A;  3NJZ A;  5J37 A;  1VAL A;  2XJU A;  5CFD C;  5FO8 B;  2QQU A;  5CKQ A;  1AX0 A;  3ACF A;  4QPG C;  4DUV A;  5FFO C;  2ZGU A;  2CHH A;  4WM7 B;  3SIT A;  5IVC A;  1AR8 1;  1HB4 A;  2RS5 2;  2DTY A;  3MPP G;  3POI A;  4MAD A;  3D6E A;  4UW3 A;  1UMH A;  2ZGR A;  1E5I A;  3KMH A;  4YG3 A;  1HRV 3;  2VME A;  1WZX A;  4QU2 A;  1UKG A;  1JI6 A;  1H8T A;  5BNN C;  3AX4 A;  1EY2 A;  4YG0 A;  3AJZ A;  3DUI A;  1W6Q B;  1OMI A;  1QY4 A;  3VZN A;  3JD7 2;  4MGK E;  2J1U A;  5M0T A;  1FT9 A;  5CAZ A;  2CYF A;  2ZXQ A;  4FAG A;  2XHN A;  4L92 A;  3WP5 A;  1SG3 A;  1LOA A;  4DS0 A;  5GAL A;  4YVS B;  3SKV A;  5A1A A;  1CWP A;  2NYY A;  2WAB A;  5FXV A;  1DZT A;  4YGB A;  5FBZ A;  4PJY A;  1YCI A;  2P34 A;  4JZR A;  4AFB A;  1QF3 A;  4BB3 A;  1GWK A;  2YRO A;  4LO7 A;  3LFI A;  2YXS A;  1YQ2 A;  1LAJ A;  1CAX A;  1UIJ A;  2WZR 1;  4XJ8 A;  5LBE A;  1UX7 A;  5D8A A;  4YW3 A;  5F5I A;  4O61 A;  5FLH A;  2RM2 2;  5APA A;  1YJK A;  5IK4 A;  4OMC A;  4GKY A;  5FV3 A;  2Y6K A;  3HIF A;  4ZHN A;  5EYY A;  1QH7 A;  2XG3 A;  4S2G A;  4HFS A;  3O1P A;  4IET A;  3VKO A;  4AI1 A;  2VMD A;  5GLZ A;  4OFG A;  1I1E A;  1A3K A;  1K5M B;  2JE8 A;  2RS5 3;  1TZO A;  4Q1R A;  5KXB A;  5FKC A;  3ZXD A;  4MX3 A;  3AP7 A;  4G9S B;  1RUC 1;  1ND2 C;  3A23 A;  5KHJ A;  4I2O A;  1SZB A;  3POF A;  1VB2 A;  3GF6 A;  4CA9 A;  1Q8O A;  2A6Z A;  3DF0 A;  4YPJ A;  2WT1 A;  4FPO B;  3VV1 A;  2ZEZ A;  3JD7 3;  3PIJ A;  3B01 A;  4Y1V A;  4DEV A;  4BQ2 A;  3G7D A;  1P8J A;  3IN9 A;  1RUH 1;  2GC0 A;  5LEJ A;  1IS3 A;  2I74 A;  5E88 A;  1KGY A;  5JI7 A;  4FPY A;  1G8W A;  4CCC A;  2HYK A;  1OLQ A;  2VVF A;  1UN1 A;  1JOB A;  5T3N A;  3FLT A;  4CU6 A;  3J7M A;  1LCL A;  5E8A A;  4AE2 A;  4DNY A;  1ZA4 A;  3LEI A;  5K0U B;  3OUJ A;  2VW0 A;  2X5I A;  4GA9 A;  2WZE A;  5DZF A;  1WW4 A;  5JI9 A;  5CZK A;  1A6C A;  4LBN A;  4R9B A;  5DG1 A;  3CZU A;  5JCT A;  5KHG A;  3WV6 A;  1MR5 A;  2DTW A;  1Q8S A;  5CIS A;  4RFR B;  1ODN A;  5J7M A;  1DQ0 A;  4MYE A;  3D5O A;  4YVW B;  1I5Z A;  1OPM A;  3PVE A;  5HCH A;  4XJW A;  5FZ9 A;  2RM2 3;  1L7L A;  1FAY A;  4PDW C;  2WR9 A;  3IB3 A;  2DVB A;  4WV8 A;  1ZRI A;  1UCX A;  2N7G A;  4JGY B;  4BQ1 A;  2IVI B;  2QQW A;  2Z42 A;  2ZOE B;  5FLI A;  2OW4 A;  4U2A A;  3VBH C;  1PM4 A;  3N7J A;  5LA9 A;  4QGN A;  2ZX2 A;  1GSL A;  2QQI A;  5D2A A;  5A6Z A;  1F5J A;  1O3T A;  2D3S A;  5C3P A;  4XIO A;  2VXR A;  1CIY A;  5DUU A;  4A44 A;  3AVR A;  3I2H A;  4Y4Y A;  3POY A;  3ZMN A;  1LU1 A;  1YIF A;  2QCS B;  2VTF A;  4LE3 A;  1S0J A;  2EIG A;  2VOK A;  3MIC A;  1XYO A;  3OOX A;  2WRA A;  4FP2 A;  5FYC A;  1OLR A;  1Q43 A;  3ZFF C;  4CCD A;  3KV5 A;  1DGW A;  1ENX A;  1PM7 A;  3H8U A;  1J1T A;  3Q8F A;  5L7O A;  4HVO A;  5C71 A;  4B1M A;  3GBF A;  1JOD A;  4UFM A;  3SHR A;  2QVS B;  3LOI A;  2A6V A;  2CV6 A;  3POJ A;  1ZRE A;  1DGR N;  1LEM A;  5L73 A;  5FZK A;  1PGW 1;  1BKZ A;  1XSQ A;  3KV6 A;  4LQR A;  3C7F A;  2JD4 A;  3ALQ A;  2ERF A;  4FPF A;  4R9A A;  2JDP A;  5T52 A;  3WQB A;  4GH4 A;  1WD3 A;  1W28 A;  2D98 A;  5C5T A;  1ENQ A;  1LOF A;  1WCK A;  2XJS A;  1COV 1;  4NHK A;  1NA1 B;  4AYU A;  5FMC A;  1POV 3;  4S2F A;  5ABJ A;  5C8C A;  3MIH A;  1AUY A;  2YC4 A;  3WNP A;  4D7T A;  2ORX A;  2W0X A;  2DDU A;  3VBO C;  3V0A A;  1VBE 1;  5BV6 A;  5LA1 A;  4BXF A;  4CEY B;  4O65 A;  1W6P A;  2KA3 A;  4XEZ A;  1OC1 A;  4ZON A;  3RFR A;  3VZO A;  3I2J A;  2WFF 2;  4KWK A;  4IE7 A;  3KT7 A;  2ZAC A;  2UWB A;  5SV5 A;  3PUQ A;  1OVP A;  2WAO A;  1UOG A;  2JDN A;  2JX9 A;  3OYW B;  4XYX A;  5JXG A;  2VVD A;  4XUP A;  1ND2 B;  1O5L A;  1CD3 G;  3OGS A;  4WVM A;  2XBO 1;  3ZYR A;  2BOI A;  2VCB A;  4LUM A;  3OF1 A;  2D6P A;  5FYZ A;  3FHA A;  4DIQ A;  2CDP A;  1RUH 2;  3LPF A;  4XJZ A;  1RYY A;  3KZ4 C;  3ES1 A;  3I3Q A;  3LA7 A;  2B7Y A;  1UOF A;  4OUS A;  4EWA A;  2VNR A;  1A78 A;  4FQ4 A;  1DYK A;  1KIT A;  2YB7 A;  2JB4 A;  3I59 A;  4AED B;  4BA6 A;  1H6Y A;  2FHR A;  3LIG A;  4GXL A;  3O1T A;  2G4I A;  3JB4 C;  3WDX A;  4EN9 B;  5GZF A;  5EIY B;  1FMD 1;  1ULP A;  4G3Y C;  2WN2 A;  3ILN A;  3ZX7 A;  5A1F A;  5FP3 A;  4X6Q B;  4H14 A;  2C26 A;  3MW4 A;  2DCT A;  1MPX A;  4GWM A;  3ZYJ B;  2DBI A;  1C28 A;  2VZT A;  1YRZ A;  1TME 1;  2VMI A;  2YBS A;  3MV0 1;  4PDW B;  4WZF A;  4YW1 A;  5J09 A;  2FDH A;  1XE7 A;  3FJS A;  3RJR A;  2GNM A;  2VCC A;  4NHM A;  3WVJ A;  4MH0 E;  1JU4 A;  4FOY A;  1DGL A;  2BOJ A;  3TNP B;  2W94 A;  5FZO A;  2R0F A;  1ULC A;  3WY6 A;  2WFF 3;  3VD4 A;  3OY8 A;  3LA3 A;  3TRS B;  2GH2 A;  4AWD A;  1SFN A;  2WLQ A;  4UBH A;  2XKO A;  1RJ7 A;  3DEC A;  1KRI A;  3UJQ A;  3VLB B;  1LOC A;  4YGC A;  1W8T A;  5LBC A;  1PZ7 A;  3O1M A;  2ARB A;  4XXP A;  3V0B B;  2J42 A;  1UOJ A;  1UZY A;  3KT1 A;  4OI4 A;  2WNU B;  3RZM A;  1SLC A;  1VMF A;  1YHF A;  4WM8 B;  1RUH 3;  2Y0I A;  4J6G A;  4P02 B;  3WDT A;  2JWP A;  2RS3 1;  3WP4 A;  3OBR A;  1PGW 2;  2VGD A;  2DCK A;  3CNA A;  4P9L A;  4AGR A;  2NN8 A;  3A7Q A;  3T09 A;  5D8A C;  2Y0O A;  1COV 2;  1CZV A;  3AYD A;  3DYO A;  1GP6 A;  3LZZ A;  1PK6 A;  3C7E A;  3OGJ A;  2VEC A;  2P5B A;  4XUQ A;  2YFU A;  5H9Q A;  1ZBA 1;  3W9A A;  4PIX A;  5F5A A;  5IAV A;  1VBE 2;  1I9R A;  2A6Y A;  1Y9G A;  5CAD A;  3VBO B;  3VHO A;  2BEO A;  1BQP A;  1IQA A;  3ILR A;  4LHL A;  2D6N A;  5A32 A;  4RA0 A;  5FYH A;  3PNA A;  3OGG A;  3UV9 A;  1OD3 A;  3ROU A;  5A6Q A;  2TBV A;  2BNM A;  2H0B A;  3THD A;  1DF0 A;  4OI1 A;  2XBO 2;  5F3C A;  5IVE A;  4NWW A;  3III A;  2GNT A;  3EXU A;  1CN1 A;  3AL5 A;  4RGK A;  5CEH A;  2VBB A;  3V56 A;  1HIX A;  2IFW A;  4QAW A;  4XET A;  5K9Y A;  3VBR B;  5FPX A;  5A70 A;  1UY1 A;  1OD5 A;  3HWJ A;  4HBN A;  1YNA A;  3T3Y A;  1H30 A;  3WQ1 A;  4K20 A;  4YW5 A;  3VUO A;  2W87 A;  5BNP A;  2ZJC A;  2VZV A;  4XAE A;  2J22 A;  1JUI A;  5FZ3 A;  2D6K A;  4EN7 B;  1UQX A;  3KHC A;  1MS5 A;  1JYT A;  4COU A;  4AFA A;  2PN5 A;  2RMU 1;  2DVF A;  3RJ2 X;  2VOT A;  4W4Z A;  4YG6 A;  3AVS A;  4H55 A;  5BXX A;  3UK9 A;  4LUL A;  3OEB A;  1ZX5 A;  3Q8A A;  1EPW A;  4OQ8 A;  1COV 3;  1W8U A;  4N53 C;  1TME 2;  3AKT A;  4PF5 A;  3RSJ A;  2GAL A;  3DV8 A;  2G9G A;  1AXY A;  2XDV A;  2P4E A;  1QJX 1;  1H4H A;  1T6B X;  2FDF A;  2X10 A;  1VBE 3;  4K1Y A;  4WM7 A;  4Y1Z A;  1W99 A;  1SEF A;  2CU5 A;  4IV3 B;  4AI9 A;  1H8T B;  3ZLI A;  2X29 A;  5EQU A;  1JYN A;  4CDW A;  4W6X A;  1LOE A;  3OPW A;  4C0B A;  5LY2 A;  3WDW A;  3MV1 1;  1I5P A;  3BTA A;  4GB3 1;  5FYB A;  2XBO 3;  5LK7 B;  4FFH A;  3WHT A;  3WP3 A;  1UZV A;  1HQL A;  2X09 A;  1O7F A;  1W3V A;  2XJP A;  3K77 A;  2IXK A;  1H4G A;  4Q8K A;  2ZAB A;  5L7O C;  4TZD A;  3VKN A;  3O0W A;  4CEW B;  5FYY A;  1HRI 1;  2RS3 2;  1QQP 1;  3M70 A;  5EJ3 A;  4NVP A;  3NVC A;  3WHU A;  4IEO A;  2JKX A;  1N3P A;  3BOP A;  4H7L A;  1Z7S 1;  5JWP A;  1M4W A;  4NHL A;  4GH4 C;  1AR7 1;  3HJR A;  1LOF C;  4XUR A;  4R4Z A;  2HEV F;  1KS4 A;  5LAS A;  1NQJ A;  1D7P M;  2QQJ A;  2E26 A;  4E2G A;  2GAU A;  1K5J A;  5ABJ C;  1YO8 A;  5C8C C;  3RVH A;  3MBW A;  2FMD A;  1OQ1 A;  3TN9 1;  2QTW B;  5F3I A;  3ZKU A;  4KH9 A;  3USU B;  3AKQ A;  2VBP A;  2VL4 A;  1TME 3;  2W47 A;  3AYA A;  2X8K A;  4JDM A;  4NRO A;  5FP8 A;  3VBS A;  1WLC A;  1HN1 A;  1PIV 1;  1RJ8 A;  2OS2 A;  2YU1 A;  3ILF A;  3WQ7 A;  4AQ6 A;  4IL7 A;  1SBE A;  3KLS A;  3WW1 A;  4UXA A;  2Y8K A;  4ET7 A;  4DXT A;  1G9C A;  4RQP B;  2ZAA A;  1W39 A;  4W6W A;  3WNK A;  2B5H A;  4WVW A;  4LBK A;  2DV9 A;  1RUE 2;  1MS4 A;  4LHS A;  4MVT A;  2AEZ A;  2EAA A;  2XWJ B;  2ZZJ A;  4CUG A;  3O1V A;  1SQ4 A;  1ZRR A;  3C7G A;  2YPD A;  4AHY A;  4AI0 A;  2HYX A;  2DVG A;  3OSD A;  4QM9 A;  3RWN A;  1BBT 1;  1JUH A;  1DHK B;  1X82 A;  3RMX A;  4DUW A;  5IVV A;  5JOX A;  1WLT A;  2E32 A;  3WG3 A;  3WF4 A;  5L9B A;  1XJA A;  1O3Q A;  3S30 A;  2X05 A;  2X5I B;  1UY4 A;  1XNA A;  4FO9 A;  2RMU 2;  5K0U A;  2OII A;  1WBF A;  2C9K A;  1W6O A;  3N9O A;  4JQT A;  4LBJ A;  5GLT A;  2EA7 A;  5IT6 A;  3HD8 B;  2A7A A;  3NKG A;  3I97 A;  2D6L X;  4LO5 B;  4XPV A;  5FTT C;  2JDA A;  1QXR A;  2DVA A;  2CWS A;  3AMN A;  1QJU 1;  1PX4 A;  3ETP A;  1NLQ A;  3RRD A;  1O5U A;  4YVW A;  2WWJ A;  2Z5W A;  3MLJ A;  3QOP A;  4BU2 A;  1GQG A;  4DXZ A;  1ASJ 1;  2GSY A;  4XAA A;  5FDB A;  3ACH A;  2DFC A;  2JE9 A;  4AXO A;  4JGY A;  4FAH A;  3KVB A;  2FDK A;  1W6M A;  1PHM A;  5FPB A;  4K40 A;  1UY2 A;  2W1U A;  1C5I A;  4BMB A;  3AZW A;  2JJ6 A;  3UKN A;  3OPZ A;  3AJY A;  1DG6 A;  3UL2 A;  4GWI A;  4LBM A;  4AI2 A;  4TXW A;  3HN3 A;  3ZYG A;  4I01 A;  4IEV A;  1RUE 3;  4AGG A;  4QX5 A;  5FP7 A;  3RDI A;  3BB6 A;  4ZU5 A;  3U75 A;  3Q8C A;  4BZ4 A;  4DB5 A;  1HRI 2;  4UOJ A;  2JDU A;  1QQP 2;  2XR4 A;  1RVF 1;  4BQ4 A;  4F8A A;  5IUQ A;  1AL2 1;  2BER A;  2HWC 1;  3EB7 A;  1IS6 A;  1LTE A;  1ZNP A;  1Z7S 2;  4LK7 A;  4RD7 A;  4LOS A;  1AR7 2;  1QJZ A;  3POE A;  5A3M A;  1RUN A;  5FZE A;  3E6B A;  1RC6 A;  4GH4 B;  2J1S A;  2ZKL A;  1PK6 C;  2RMU 3;  2MEV 1;  2O0O A;  2VMG A;  4I09 A;  4IES A;  1V9U 1;  2DUR A;  1LGC A;  1NA1 A;  2ZMN A;  4Y5T A;  3TN9 2;  5L36 A;  2ETE A;  2WDB A;  3FUO A;  4LNV A;  5A80 A;  3ZO0 B;  2Y60 A;  4B7K A;  3V0A B;  2OVU A;  1PGS A;  1SLL A;  4MXV A;  2VD7 A;  1W6P B;  4E9K A;  1PIV 2;  4QDR A;  4CEY A;  1KQR A;  5A6X A;  4DXS A;  3WW4 A;  4HT1 T;  4FTS A;  2WO7 A;  4LO4 B;  3OYW A;  2IVJ A;  5F5C A;  5FZ1 A;  3BOW A;  2UY9 A;  1R1Z A;  3AL6 A;  1GP4 A;  4OUM A;  5CKN A;  2EIE A;  3B5L B;  5JSP A;  4FPE A;  5DUX A;  2H6C A;  2SBA A;  4XMA A;  1YUD A;  4EV0 A;  2JEM A;  3FC0 A;  4P9Y A;  1GBG A;  2JB8 A;  4FPK A;  4Q4Y 1;  3CQO A;  3BYW A;  4LO8 A;  2Y6L A;  4OI2 A;  3HQR A;  5BNP C;  3W5M A;  2PHD A;  3AZY A;  3WNL A;  1HRI 3;  3KQ4 B;  1QQP 3;  3HEI A;  4AED A;  2B9U A;  4Q4W 1;  4YFW A;  3GJB A;  5JUV A;  2QBX A;  3FFZ A;  2BBA A;  2BU9 A;  2SLI A;  2P3I A;  1Z7S 3;  3I2G A;  1E57 A;  3OCP A;  3H7J A;  5EJZ B;  4Z2A A;  4KNC A;  5GZG A;  1AR7 3;  1OQD A;  2JKB A;  1APN A;  1JTZ X;  3IPV B;  1QJU 2;  3RZG A;  2D3R A;  2LTN A;  2XML A;  3A21 A;  3IDE A;  3Q8E A;  1NCR B;  5H9R A;  1ASJ 2;  1YJL A;  3SMH A;  3TN9 3;  1I6X A;  1XE0 A;  3JU9 A;  4AL9 A;  4IEX A;  4Z07 A;  1PMH X;  4LKS A;  4PT6 A;  4WM7 C;  3WG1 A;  4HSJ A;  3PMS A;  4BYY A;  1QJY 1;  3TYJ A;  3M3I A;  2ZKN A;  1BVP 1;  1BVV A;  2YV8 A;  3S7E A;  1UU4 A;  4OZX A;  3ZN6 B;  1PIV 3;  4BK4 A;  1U5Y A;  2JEC A;  1SLT A;  4CDW C;  1O4Z A;  2QQN A;  3OY8 B;  2QDR A;  3RGB A;  3N9M A;  4B4Q A;  1Q8V A;  5C70 A;  5FBJ A;  2DU0 A;  1UPS A;  2E6V A;  3RZJ A;  3CKH A;  3VZJ A;  4PIY A;  3NJV A;  5FZF A;  3L2H A;  2J1V A;  5GZD A;  3H42 B;  2Q8D A;  1CR7 A;  3ZXK A;  1XBF A;  5EFU A;  1RVF 2;  1NXD 1;  1AL2 2;  2J1T A;  1Y43 B;  2A75 A;  1YQC A;  4WZC A;  4F3J A;  4I3G A;  2WNU A;  1VE0 A;  4QX3 A;  4WM8 A;  1R64 A;  2WBK A;  3N3H A;  1JYI A;  3UGG A;  5JOY A;  1VAM A;  5FXZ A;  5C9A A;  3VDA A;  5AFE A;  1C57 A;  1LR5 A;  3T2Q A;  1NOV A;  1XRU A;  2MEV 2;  1ZRD A;  1UW8 A;  4YW6 A;  1PK6 B;  4ZKT B;  5CG9 A;  1V9U 2;  2VPV A;  4JDN A;  4W65 A;  4YNI A;  4RS5 A;  2Y6H A;  3TWI A;  2D93 A;  1MVQ A;  5FPV A;  4ZXE A;  1YI7 A;  4UFL A;  3E6C C;  1VP6 A;  4NII A;  1QJU 3;  1HB3 A;  4M3C B;  4X8N A;  2ZEY A;  4XZU G;  5FZ4 A;  2XUE A;  5ACA 1;  2IXJ A;  3BTX A;  4JRL A;  4K9S A;  1UZW A;  4XQ4 A;  1ASJ 3;  4XIL A;  3VBS C;  1NE6 A;  1FV2 A;  1YYN A;  2BQP A;  2B39 A;  4BIF A;  2O1Q A;  3ZIX A;  1K5M C;  4E4H A;  1V6J A;  2D7F A;  5CKM A;  4D7Y A;  4FOQ A;  2JIC A;  4JAA A;  2D97 A;  4QB6 A;  3BTY A;  2IFR A;  2VU9 A;  1JS9 A;  3I2K A;  3IAQ A;  1W8F A;  3R4S A;  4MHR A;  4CU9 A;  5BNQ A;  3SXW A;  3LE0 A;  1KFU L;  2ZGS A;  5F1R A;  4GJZ A;  1YFU A;  1QKQ A;  1AYM 1;  2MPF A;  1ZZB A;  3N7M A;  4Q4Y 2;  3WF0 A;  2ZGQ A;  4J1W A;  3VBR A;  3GZU C;  4FT8 A;  1NZI A;  5BNP B;  4XF1 A;  4CXY A;  4K1Z A;  1RVF 3;  4Q0S A;  3QAC A;  4Q4W 2;  1AL2 3;  3BGA A;  5LY1 A;  5KHK A;  3GZE A;  4BLI A;  5K0U C;  4QXK A;  4JX0 A;  1D0H A;  1VRB A;  5JSO A;  3CU7 A;  1AYN 1;  4UYB A;  3EO6 A;  5C3R A;  1N1V A;  3DGT A;  4LBL A;  3RZL A;  3I7D A;  2FCU A;  1O59 A;  2ZMK A;  2OQ6 A;  2MEV 3;  2C4X A;  4CXW A;  3ETQ A;  4YVW C;  2VMH A;  2IXC A;  4A3X A;  1V9U 3;  2I07 B;  1CX1 A;  3SH5 A;  4H3W A;  4QX2 A;  3N9N A;  3MO4 A;  4JKL A;  3H1W A;  4BLJ A;  5A3W A;  3POB A;  3S5Q A;  1QJY 2;  4IND A;  4JGY C;  3K46 A;  5IFT A;  4D3W A;  1Y7B A;  5BYN A;  2R04 1;  2XJQ A;  4IEZ A;  4IV3 A;  3ZXJ A;  5FJK A;  4E27 A;  2AUY A;  1W9F A;  1CAU B;  5E1R A;  4D94 A;  4CDW B;  1GIC A;  3IBM A;  4YGD A;  2W92 A;  1STM A;  2IXH A;  2XUM A;  4NWV A;  2XKP A;  1SPP A;  2ZHN A;  5EP9 A;  3LDB A;  1AZD A;  1Y9M A;  2ZML A;  5ANQ A;  3LEM A;  2QQV A;  1F2N A;  2I45 A;  1Z78 A;  4D6Q A;  5CNA A;  1T6G C;  5A7W A;  3IAP A;  4PQ9 A;  1GP5 A;  4MO3 M;  4V1P A;  1O8S A;  1AF9 A;  2DF7 A;  3NAP B;  4MZU A;  3FZ3 A;  4XE9 A;  1OI6 A;  4PQQ A;  4NO4 A;  4Q4Y 3;  1L7R A;  1W2U A;  4CEW A;  3AP4 A;  3HNM A;  5T50 A;  2WKK A;  4LKF A;  1O8P A;  1W0O A;  3GBG A;  1FPN 1;  1NXM A;  1SBD A;  4RSU A;  4DPN A;  1WW5 A;  3I2F A;  3RG0 A;  2R6Q A;  5J98 B;  2J7M A;  2P3Y A;  3UES A;  2VZS A;  1NA1 C;  4N90 A;  4K8R B;  4JGZ B;  4BQ5 A;  5A33 B;  4XJA A;  3ZDS A;  4EN6 B;  4FP3 A;  1S0D A;  1SMV A;  1SCR A;  5LWB A;  3BUC A;  2VUC A;  5JPN B;  1HQN A;  1W90 A;  3USU A;  5FKB A;  2RR1 2;  4CEY C;  3VBS B;  2GP5 A;  2YYO A;  4B4R A;  1LJ7 A;  2XXZ A;  2QQO A;  1QJY 3;  1SCS A;  1DYP A;  3MUY 1;  4LA2 A;  4PI0 A;  4UW4 A;  1NAE A;  1V6M A;  1JYW A;  2CY6 A;  1H2K A;  1S0F A;  1J3Q A;  4CCL A;  2BJS A;  2HKX A;  3T4H B;  1YQ8 A;  4RQP A;  3BPS A;  3AP6 A;  3MEP A;  4QDS A;  3VGI A;  4EN0 A;  3B93 A;  5EHD A;  3BI3 A;  4FPC A;  1RUO A;  3HMY A;  3ZSL A;  2WNV B;  3K4D A;  2PHF A;  1B35 B;  5FMD A;  1AYM 2;  5FIX A;  1ZZ9 A;  4S2D A;  5LA0 A;  4MUV A;  4ARY A;  2H0V A;  1IPK A;  1Y9Q A;  4EE2 A;  1YXW A;  2ZHK A;  1F15 A;  4RL7 A;  1BK1 A;  2KM2 A;  3SCH A;  4AED C;  2OUJ A;  4OHZ A;  3NL1 A;  3WNM A;  1RUJ 1;  5C5U A;  2EXI A;  5IHR A;  3O1R A;  1GZW A;  3B69 A;  4KBZ A;  4YZ3 A;  5EJ1 B;  4Y20 B;  3NV4 A;  1AYN 2;  1LGN A;  1QOS A;  1W6O B;  2ZX0 A;  5E6H A;  5BY5 A;  1M06 G;  2BVB A;  4NPM A;  1JU3 A;  3FUQ A;  4EJR A;  4C90 A;  3M3Q A;  2QNK A;  1QJF A;  1XOY A;  4XDP A;  4BQY A;  2NMN A;  1QWR A;  3WUD A;  2UU8 A;  2FCT A;  5KC6 A;  4PCR A;  2VW1 A;  3JUU A;  4MOA A;  1GWL A;  2ZHL A;  3BCW A;  3IDA A;  3MPB A;  2VAU A;  2UY8 A;  4QKF A;  2B46 X;  3BU0 A;  4FXG B;  1AR8 2;  3THT A;  1W6M B;  2R04 2;  4XW3 A;  2OPK A;  1DCS A;  3PHM A;  2C9A A;  4C8D A;  2RR1 3;  3OBT A;  2Z69 A;  3LPG A;  4QKB A;  4ERO A;  4TLG A;  5FY4 A;  4Q2F A;  4ASL A;  4CCO A;  4ITC A;  3NQH A;  1RL3 A;  3T2O A;  1QIQ A;  4Y4R A;  2D43 A;  3LWC A;  3Q8B A;  1VMJ A;  1OPO A;  2YBK A;  3U14 A;  1HJF A;  3SCG A;  1AJK A;  1BCX A;  1H9P A;  2YBP A;  1GOH A;  2V09 A;  3I3E A;  5HPO A;  1G86 A;  2ZA9 A;  1HLC A;  2WT2 A;  1AYM 3;  2WZ8 A;  4IE4 A;  3ZXA C;  3OUH A;  3RI8 A;  2WNU C;  2DWR A;  3TEW A;  4TWT A;  4CZS A;  4WM8 C;  2OUH A;  5DZG A;  1ZVF A;  1VRH 1;  1OSG A;  1C4R A;  3HNB M;  1PVX A;  1FPN 2;  1E5R A;  5JDB A;  4NUB A;  1XNB A;  4XF0 A;  2WZR 2;  3FL7 A;  4BCU A;  1DYO A;  4GD4 A;  4XFI A;  5AVA A;  1H6X A;  5KWR A;  2GMM A;  4CDU A;  4QQ2 A;  4RS5 C;  3S0M A;  1DIW A;  4L9B A;  1JHN A;  1F4H A;  3PVO A;  4BQX A;  3HAG A;  4YW7 A;  1W9S A;  3C2U A;  2R49 A;  5C3S A;  2OPW A;  2OKX A;  1C8N A;  3AMH A;  3POS A;  2RJK A;  4O9G A;  3ZVX A;  4A2U A;  4GUL A;  1W0P A;  2TUN A;  5K8S A;  4ARX A;  1DBN A;  4KG8 A;  4NPR A;  5L9R A;  3PU8 A;  4UT5 A;  2CGO A;  5IJR A;  2QQL A;  1R09 1;  4I0B A;  1AR8 3;  2VH9 A;  3ZN5 A;  3WF3 A;  4GWN A;  1CGP A;  2R04 3;  1FYU A;  4CDX A;  3GCW A;  3ME2 A;  4DY3 A;  4ORF A;  1RUC 2;  4AZZ A;  2D3P A;  4UBG A;  4BIO A;  2WLP A;  4JVA A;  3W20 A;  2GU9 A;  3U78 A;  1IQD C;  3WLU A;  1PVC 1;  1JZ6 A;  4R52 A;  3T08 A;  3GM8 A;  3PJY A;  1KXG A;  3PUH A;  3O14 A;  2LS6 A;  5LB6 A;  3UKT A;  1XYP A;  3U4S A;  4LTA A;  4D8M A;  1R08 1;  2CAV A;  4Y33 A;  3LQC A;  3RMY A;  3VBR C;  3LGR A;  3W5N A;  2VJX A;  4LT5 A;  1ALY A;  4C1W A;  2PMW B;  3UYJ A;  3VBU A;  5JXJ A;  1LHV A;  2K0G A;  4P9G A;  4DOU A;  1RUJ 2;  5FK7 A;  3H8X A;  4GWJ A;  4AQT A;  4IGQ A;  4Q4X 1;  3LSD A;  3PLQ A;  2A1X A;  1ZBE 1;  3HNY M;  1FPN 3;  1O6U A;  2GH8 A;  3N7K A;  4YZ5 A;  3U4X A;  4QX7 A;  2Y34 A;  2WZR 3;  3PDQ A;  1N1T A;  1WCQ A;  3AYE A;  3IPV A;  4GAL A;  4TSV A;  2PAE A;  3LOB A;  2IXI A;  4M0N A;  2HWD 1;  4FI9 A;  1GUI A;  3T4V A;  1N47 A;  1SLB A;  1WKY A;  5FPU A;  1EPZ A;  1NCR A;  2C5D A;  2R32 A;  1WCU A;  4Y24 A;  3T2T A;  1TNF A;  1WLD A;  4NRQ A;  4MXW B;  4K21 A;  4JHZ A;  4UF0 B;  2DCY A;  1Q8P A;  1DQ1 A;  3FE5 A;  4IV3 C;  4U36 A;  5HV4 A;  3I3B A;  2FDJ A;  3PIG A;  3VKM A;  2Z2S B;  1H8T C;  1YWK A;  2PXJ A;  3A22 A;  2W39 A;  4XFC A;  3VL8 A;  3ZN6 A;  4A3Z A;  4KGG A;  2ARC A;  5FZD A;  2GN7 A;  3N4M A;  3AFG A;  2ES3 A;  1X8E A;  4HG6 B;  1UYY A;  1RUC 3;  3MI8 A;  5DDJ 1;  2XPJ A;  5DMY A;  1LKN A;  4IV1 B;  1JZ5 A;  2V4A A;  3ABZ A;  2BUK A;  4XQD A;  1UZ0 A;  4A45 A;  2A3Y A;  4NJ4 A;  2FMY A;  1V70 A;  4EZ4 A;  5D1I A;  4OYU A;  4CEW C;  3VBF A;  2FZ1 A;  5FO9 B;  2DBN A;  2XH6 A;  3J7H A;  1EP0 A;  2XHK A;  2H6B A;  1S2B A;  1SBF A;  3PUI A;  4N7I A;  4HOO A;  4CP9 B;  1PO1 1;  2CSG A;  4D0Q A;  3K75 B;  4I30 A;  5C9A B;  3K3O A;  3WXP A;  1RUJ 3;  1X50 A;  1GZC A;  3VHN A;  4OHW A;  4XMI A;  4ASK A;  4MGY E;  4AGV A;  1S0G A;  2Y6F A;  1XNK A;  4QX0 A;  5L19 A;  4TTG A;  4RS5 B;  4H7M A;  4AFD A;  1S4C A;  2Y26 A;  3ZXE A;  2NZ9 A;  4KI5 M;  2QQK A;  3WP6 A;  1AXK A;  4RFT 0;  4CSW A;  1K42 A;  4M3C A;  2QKD A;  3LCP A;  3HVD A;  3WW2 A;  3T1M A;  4WVZ A;  4XF3 A;  1BEV 1;  4GAZ A;  4RYD A;  4JV4 A;  4AFM A;  5CYY A;  3J4U H;  5BNO A;  5IK8 A;  3N9Q A;  1H1M A;  3IIA A;  3R0R A;  4RQP C;  4Y5Z 0;  1PVC 2;  1U0A A;  2UWA A;  3HR9 A;  3SH4 A;  4HXC A;  1W05 A;  4A7Y A;  4HMZ A;  2PHU A;  2JEN A;  3TBD A;  3RZZ A;  4XUO A;  3MFA A;  1DDL A;  1R08 2;  3LFM A;  3MDP A;  2BFU S;  2E7T A;  5FPA A;  3LA2 A;  5F6L B;  3S5A A;  3LKJ A;  1J83 A;  1O4Y A;  2V5D A;  2ZGT A;  3C7O A;  5LZ6 A;  3WDU A;  2HBT A;  3WD5 A;  4ZY9 A;  3JQX A;  5EXO A;  3H8O A;  2Y64 A;  4DO0 A;  4F83 A;  3AZV A;  1GLH A;  2NPI A;  2X5I C;  3CL1 A;  1FMD 2;  4Q4X 2;  4YRD A;  4YSF A;  1ZBE 2;  3GYD A;  1WBL A;  3ASI A;  3B3Q E;  3CBN A;  1OH3 A;  1TG7 A;  3VDC A;  5HCF A;  5GLV A;  5IYY A;  4OQ9 A;  1DQ5 A;  2HWD 2;  5H9S A;  1UIK A;  3VZM A;  4NR1 A;  1HB2 A;  3UGH A;  5CB7 A;  3ZYI B;  5G04 L;  3GNE A;  1Y3T A;  5FXW A;  4P14 A;  1A8M A;  3JBG 1;  2QQP A;  1GNY A;  4HVQ A;  4EWD A;  1FX5 A;  2Q8C A;  5JAX A;  2PEL A;  4N9H A;  1TNR A;  3AC0 A;  3NWK A;  1CIW A;  2C6S A;  5CFC A;  1J1L A;  4NRM A;  1GWM A;  2VZ1 A;  2W1W A;  1W6N B;  3I4I A;  2WYS A;  3VD9 A;  1AJO A;  1D2S A;  2F4L A;  2IC1 A;  1W9W A;  4CUB A;  2L9L A;  3APB A;  4AVS A;  1MQT A;  2CNA A;  3MHZ A;  2XLA A;  1JMU B;  1CAU A;  1SHW B;  5JIA A;  2RJ2 A;  5CA6 A;  3AM2 A;  1SPP B;  3CMG A;  2YU2 A;  2ZEX A;  4IEP A;  5DDJ 2;  2Q1F A;  2OA2 A;  1NX9 A;  3AYC A;  3B7M A;  1PVC 3;  1GOF A;  3E5U A;  2YY1 A;  3MIG A;  1ENR A;  1DFQ A;  2EAL A;  2DUP A;  5A7W B;  3VB9 A;  4CXX A;  1MS8 A;  2B45 X;  4QDQ A;  4FPG A;  1JZ7 A;  1LED A;  1S2E A;  1S0I A;  2GC2 A;  1R08 3;  1G6N A;  1VPH A;  2KD7 A;  3I3D A;  3MIB A;  3WF2 A;  3WNN A;  2ZGN A;  1SFY A;  3NAP A;  5FYV A;  4B4P A;  1PO1 2;  1QU0 A;  1QGL A;  1W06 A;  3KV4 A;  4JC1 A;  2ILM A;  2BW8 A;  1RMU 1;  3JQW A;  2CDO A;  4YZ2 A;  5I8S A;  1SLI A;  2LRP A;  4CDQ B;  3KCX A;  3ATG A;  3TNQ A;  4M00 A;  4RHV 1;  1QEX A;  2AGS A;  3LEK A;  1OVS A;  4CDU C;  3WX5 A;  1FMD 3;  1NT0 A;  1OF4 A;  4Q4X 3;  1POV 0;  4C91 A;  1ZBE 3;  4C0H A;  4DIN B;  2WSU A;  3JZV A;  1ZBA 2;  2W68 A;  1H2M A;  1WME A;  2BV4 A;  4N8M A;  5DAV A;  4OVE A;  4JGZ A;  2O14 A;  4P9I A;  3C7H A;  5A33 A;  3E97 A;  2HWD 3;  1CQ9 A;  3ACL A;  5FY9 A;  1VR3 A;  4EZH A;  2BTV C;  3H8R A;  1W9Y A;  3KF3 A;  3KT4 A;  4L97 A;  4P5Y A;  1BEV 2;  1V6N A;  4KU8 A;  4NPL A;  1NZC A;  4FPJ A;  3ZOI A;  5IWF A;  2F4P A;  4L0P A;  1DQ4 A;  3EYP A;  1NG0 A;  2VNG A;  1W2T A;  3VDD B;  3VKL A;  1X36 A;  1NE4 A;  1H8V A;  4L11 A;  3B9I A;  3MID A;  4UI9 L;  4YW4 A;  1ZZ6 A;  3LDR A;  2F6B A;  4LXL A;  2VTX A;  3CLP A;  2P6H A;  1VMH A;  2PA7 A;  3ZMO A;  3EHK A;  1OXC A;  2RDN A;  2WNV A;  3ZR6 A;  2XVG A;  5DDJ 3;  1QNW A;  2R1B A;  4FOV A;  1B35 A;  2WO2 A;  4NE9 A;  2ZEW A;  5I0R A;  1KDK A;  3O12 A;  2ZX4 A;  4HN0 A;  3VBU C;  4R8H A;  3AK0 A;  1OUX A;  4QHB A;  3GGL A;  4HVR A;  5LBB A;  4KL1 A;  4A4A A;  4HN1 A;  2MHF A;  2R07 1;  5FYI A;  1GZW B;  3TEZ A;  1ODM A;  1PO2 1;  2HWB 1;  1PO1 3;  2RS3 3;  5FAX A;  1PGL 1;  4Z1V A;  2BFU L;  1Q5O A;  3M1H A;  4Y20 A;  2BBV A;  4QT6 A;  1UYX A;  3AMM A;  2J1R A;  1PX3 A;  3V65 A;  1IOA A;  3K4A A;  1DP0 A;  3AXE A;  2RVA A;  1AX2 A;  5LK5 A;  4OI0 A;  3JBG 2;  1E5S A;  4BDV B;  2BP6 A;  4ES9 A;  1NCR C;  3TEY A;  1ZBA 3;  1QJX 2;  1VIW B;  3HN1 A;  3ENR A;  3MZH A;  1D0G A;  1G9A A;  5FY0 A;  2EIC A;  2XJT A;  4AW7 A;  1TQ5 A;  4ZZ5 A;  2HEY F;  1CJD A;  3QD6 A;  5F5Q A;  1BEV 3;  1YFW A;  4FXK B;  2XVL A;  1KDM A;  1FXZ A;  2PHL A;  3AMQ A;  4Y26 A;  3H1Y A;  4TN7 A;  4YFZ A;  4QPI A;  4BQ3 A;  4Z92 B;  4DXR A;  3GBW A;  2Q1Z B;  4NRP A;  3FX3 A;  1RUI 1;  4JHT A;  4GB3 2;  3VHR A;  4E4S A;  2YUE A;  4XHX A;  2NLR A;  1DZR A;  3BU7 A;  2Q5T A;  1A8D A;  1LES A;  4PHZ A;  4URT A;  3VDB A;  1CZT A;  3VBF C;  2VZP A;  4IEW A;  1WA4 A;  4AQ2 A;  4ZU4 A;  4AVT A;  3HOB A;  3MUZ 1;  4QPG A;  1RMU 2;  2E7A A;  5C7G A;  2UUR A;  3INA A;  4IER A;  4BH9 A;  2P2K A;  2VQA A;  1LHN A;  2A5Z A;  3VD3 A;  3IM0 A;  3KQR A;  4FQZ A;  1VBA 1;  4XJU A;  4KWJ A;  1QH6 A;  5BNN A;  2DVD A;  4PLM A;  1UNB A;  4CDU B;  5FOJ B;  5FUP A;  5A3O A;  3PUA A;  4I3P A;  1FV3 A;  1MAC A;  2ZGO A;  4XF4 A;  2YFZ A;  1JZ4 A;  4GZ9 A;  1UYP A;  3E5X A;  3LSE A;  3AP5 A;  1U5I A;  3ES4 A;  4DFS A;  1OLM A;  5A7O A;  2EAK A;  1NY7 1;  3JBG 3;  4LO6 B;  4COY A;  3Q9O A;  3I3M A;  3NST A;  3R6S A;  3CIH A;  4QGM A;  3DPR A;  3O5S A;  4B1L A;  1GNH A;  1QJX 3;  1OUR A;  1BLZ A;  1V6I A;  2CGN A;  3ZPY A;  3SNM A;  3B00 A;  1MS0 A;  4P00 B;  3J26 N;  1HV0 A;  5EWS A;  4CDX B;  5FZB A;  3UGF A;  4LEJ A;  4QQH A;  5A1L A;  1F5F A;  4I0A A;  5HXV A;  2G1M A;  4ISQ A;  2OZ6 A;  3KSC A;  5AFB A;  3RYK A;  3QH7 A;  4MLO A;  4TLF A;  5F2S A;  5T5L A;  1D4V B;  4OUL A;  4ZZ8 A;  3D8C A;  1BHG A;  1HX6 A;  4CE8 A;  1WLW A;  1XXN A;  1UYZ A;  2BVV A;  1ZZC A;  3GHM A;  4GB3 3;  4N43 B;  1C8M 1;  2D44 A;  3IMN A;  5KC5 A;  3M3E A;  5A7S A;  4ZU7 A;  1BBT 2;  4Q0U A;  2Q8E A;  3VBU B;  3IDC B;  4ONU A;  3O0V A;  2R07 2;  3D3A A;  3EMR A;  4NIA A;  2ZX1 A;  1PO2 2;  2HWB 2;  2XQR A;  1PGL 2;  3MGU A;  2E9Q A;  2IZW A;  1RMU 3;  2W08 A;  4UAP A;  4PI2 A;  4COW A;  4Y1U A;  2CL2 A;  3PME A;  2PAK A;  5FY8 A;  4FPL A;  2B4K A;  5A3U A;  5JVV A;  2ENR A;  5T5P A;  4YZ1 A;  4UWD A;  1RUF 1;  5DAB A;  5FP9 A;  3VL9 A;  2OQ7 A;  3U10 A;  5LRR A;  2D40 A;  2HJI A;  2QUO A;  1W0N A;  3DXU A;  2BGC A;  1JW6 A;  5FY1 A;  1UAI A;  1XNT A;  4HAN A;  1ND3 A;  1O4T A;  5CFC C;  4JDO A;  2W46 A;  1URX A;  5A7Q A;  1IHM A;  2W5F A;  3M3O A;  4MXW A;  3BKZ A;  4UW6 A;  2PAM A;  2ZGL A;  5SV8 A;  2GNB A;  3ZDV A;  4UF0 A;  1DU3 D;  2JIG A;  1MQT C;  3DN7 A;  5T5O A;  3RYR A;  3ZM8 A;  4LKE A;  4COZ A;  3DCQ A;  1LB2 A;  1UKR A;  2JD9 A;  4LOT A;  5GLW A;  4V2V A;  1ONA A;  1E5H A;  1RUI 2;  3CEW A;  3OD4 A;  1UY3 A;  3U11 A;  4GQ7 A;  4Z82 A;  2XOM A;  1W3X A;  1WA6 X;  3RNS A;  1UMI A;  2WZP P;  1C5H A;  3ZFG B;  3H3L A;  3FFQ A;  4HKL A;  1MZ5 A;  5JIU A;  5CVR A;  2WIN B;  3DL3 A;  3RS6 A;  4BJ0 A;  2RV9 A;  1MVE A;  2IXL A;  1UX6 A;  2YMZ A;  3KM5 A;  4IV1 A;  2W3J A;  1QOO A;  3HQU A;  3NAP C;  2QZ3 A;  4RR3 B;  4XBQ A;  3VBF B;  4LPL A;  4C1X A;  2HWC 2;  2VUA A;  4CCE A;  1BBT 3;  3M7A A;  5JZG B;  1VBA 2;  4QQP A;  2W52 A;  1LU2 A;  1NYW A;  2R07 3;  3VBH A;  4CP9 A;  1PO2 3;  2HWB 3;  3MYX A;  4XHB A;  5FYU A;  2TEP A;  2G9Z A;  2GZW A;  3H3Z A;  3K4Z A;  4M3C F;  4MHU A;  4QU1 A;  5T54 A;  5A6Y A;  1HN0 A;  2E33 A;  2PHX A;  3NNM A;  4NHY A;  5FZL A;  2FDG A;  4ZXK A;  4JGZ C;  3BIE A;  2WC2 A;  4KWU A;  5FZ6 A;  4EN8 B;  1NY7 2;  3H3U A;  3U07 A;  3I2D A;  1EUT A;  3G6J B;  4FVV A;  4XVH A;  4N9I A;  1UU6 A;  4Q0P A;  3ZXF A;  3HPN A;  1GMM A;  3IKW A;  1IGO A;  4UFK A;  4LBQ B;  2A70 A;  2PTM A;  2P3J A;  3WNX A;  5BNO B;  3BTZ A;  1GYK A;  3D4K A;  2J1A A;  3WEZ A;  1QJE A;  4QXH A;  1XC6 A;  5DAQ A;  3ZYF A;  2JG8 A;  4V2W A;  3MLL A;  1L7Q A;  2TNF A;  1RUI 3;  1G9B A;  2WNV C;  1XNC A;  1B35 C;  1C8M 2;  1DLC A;  1QMJ A;  5FZM A;  4L99 A;  3L9J T;  3VKF C;  2NMO A;  4OMD A;  4BHP A;  4BE3 A;  4CP1 A;  4P9W A;  1CAV A;  2UYA A;  3K51 A;  2OZJ A;  1DQ6 A;  2WWU A;  3PUS A;  1NLS A;  1Y4W A;  3DXT A;  1ZRF A;  4AVA A;  4DEQ A;  5IVF A;  1DGW X;  1UWW A;  2HWC 3;  3PVN A;  3WCR A;  1FOD 1;  3PTY A;  5F9T A;  5FZ7 A;  4LLF A;  1VBA 3;  2VZU A;  3A0K A;  2FQP A;  4H2A A;  1IS5 A;  5DG2 A;  5FY5 A;  1RUF 2;  4NIG A;  3AFK A;  3J9S A;  1OT5 A;  4IW3 A;  4XBL A;  2HWF 1;  3M4F A;  4AVB A;  1NLR A;  4IEY A;  1PMJ X;  1IPS A;  2K2S A;  5E89 A;  4E8C A;  5DPN A;  3PTR B;  1QXJ A;  4K3U A;  1CPN A;  1D2Q A;  4OHV A;  2AZ5 A;  1NCQ B;  4GJY A;  5HCB A;  4AHZ A;  5CFC B;  2UYB A;  2BWA A;  1LOB A;  2ZTN A;  4GKX A;  3NO8 A;  1CAW B;  3T0D A;  2FD8 A;  4XBN A;  4HSL A;  3H50 A;  2RG4 A;  5EZW A;  1UXX X;  1GFF 2;  1W6N A;  1MQT B;  4XDQ A;  1CON A;  4QPI C;  1U5Z A;  5FLJ A;  4Y3O A;  3ACG A;  1OH4 A;  5IVB A;  4Y22 B;  1POV 1;  5E16 A;  2EXJ A;  3OGR A;  5F3E A;  5IW0 A;  4OHX A;  1F9K A;  1REE A;  2K9Z A;  1C8M 3;  1C1L A;  1OA4 A;  1YI9 A;  4ZS2 A;  5GZE A;  5F2W A;  4CCJ A;  2DCZ A;  4DZG A;  5EPA A;  2KXL A;  2GN3 A;  3URF A;  3BIW E;  3J7L A;  4CDQ A;  2B8M A;  4Q4W 3;  1O3S A;  3THC A;  1R1A 1;  4R9D A;  1FAT A;  5CBL A;  1ULO A;  2ZBJ A;  1J84 A;  4Z8B A;  1S0E A;  2WO1 A;  1QHD A;  4KQ7 A;  5CIR A;  1RUF 3;  1HV1 A;  1IG3 A;  1AX1 A;  2VUJ A;  5FK8 A;  1ULD A;  5ACA 2;  3CF6 E;  5A3N A;  4FFF A;  5A7N A;  1TMF 1;  3DEM A;  5C33 A;  3NNG A;  4LA3 A;  3QCW A;  5FZC A;  3W58 A;  3DPR C;  4AHW A;  1CJP A;  4LBQ D;  3QBQ A;  2LW8 A;  3BAL A;  4JTO A;  4Y1X A;  5GZC A;  3HT1 A;  2ZCW A;  2VC9 A;  4XFB A;  4B29 A;  3GAL A;  2C0Z A;  3GZT B;  3VDD A;  1ZZ7 A;  4XFF A;  5FCC A;  4XCB A;  4JTN A;  1W2O A;  3L2Y A;  3KB5 A;  3ZFE A;  3X29 B;  2VXJ A;  3AP9 A;  3RI9 A;  4ASM B;  4AOC A;  4HK9 A;  2ARX A;  3KS7 A;  3OBZ A;  4YAR A;  3K48 A;  4AQS A;  3USS A;  4HLT A;  2D6M A;  4K6B A;  3MLK A;  1N1S A;  2JXA A;  1IZ3 A;  4YYO A;  2PQS A;  2WS9 1;  2HBU A;  5FPL A;  3QH6 A;  5GKA C;  5KR7 A;  1H9W A;  1HJG A;  4I02 A;  1KJR A;  1DGR A;  2NQY A;  3ZSK A;  3JCI A;  1JYC A;  1PNF A;  2VQU A;  1FOD 2;  1RUD 1;  2PHW A;  3S6P A;  2WFF 1;  4ATE A;  3F95 A;  5HBA A;  2WN3 A;  4YGE A;  4BPZ A;  5J3U A;  3ZYP A;  2XON A;  4S2H A;  2HWF 2;  1G9F A;  3C3V A;  5FO7 B;  1IPJ A;  3SCF A;  3P3P A;  4FTE A;  2ZAH A;  3S57 A;  4IGP A;  4K8F A;  4JRA A;  1GV9 A;  4CYD A;  3D0S A;  3O7O A;  3MIF A;  1BJQ A;  1U12 A;  4GMP 0;  4Q26 A;  3OG2 A;  4AAX A;  2W2I A;  2VOV A;  1AXZ A;  1ND3 C;  1AR6 1;  2XLF A;  4X6R B;  2ZGM A;  2J1E A;  2DUQ A;  4WBB A;  5ACA 3;  1UY0 A;  3RPQ A;  4AAP A;  1GOG A;  4W50 A;  4NHX A;  4EQV A;  1G9D A;  3MFC A;  2VZR A;  3U37 A;  1OKQ A;  1JOJ A;  3K3N A;  4LMF A;  2AEN A;  3N7L A;  4IGO A;  4L8Q A;  4QPI B;  4A7Z A;  5A3L A;  4CU7 A;  2HEW F;  4AEK A;  5HCA A;  4IE5 A;  1IS4 A;  5DAW A;  1VBD 1;  3RWK X;  2AAC A;  4IXL A;  4IV1 C;  2OX0 A;  2JG9 A;  1AHS A;  4N53 A;  1AL0 G;  1UPI A;  1HB1 A;  1VLN A;  4QQO A;  5CFD B;  3M2M A;  4R4X A;  1RTV A;  2HLE A;  1SDD B;  3KWV A;  4QPG B;  2DYC A;  4Q0Q A;  1UU5 A;  3R4U A;  1UOB A;  1N3Q A;  2A3W A;  4QKN A;  4XAC A;  3T2P A;  1O91 A;  4W8J A;  1ST8 A;  5J1X A;  1F31 A;  2V73 A;  3A4U A;  4MGQ A;  4KMQ A;  5C9A C;  4MET A;  4Q5O A;  5FQ0 B;  1D4M 1;  2ZZQ A;  1R1A 2;  3QLQ A;  5FZH A;  2PFW A;  4XFG A;  1FOD 3;  1OOP A;  2A73 B;  3TEX A;  5BNN B;  1DLL A;  2VG9 A;  4LIU A;  2ARE A;  5C3O A;  1AYN 3;  2P1B A;  5I0S A;  2HWF 3;  4XFH A;  3P3N A;  3EQE A;  4PBO A;  2VR4 A;  1QNY A;  1WCS A;  3ZKY A;  1TMF 2;  3UJO A;  4AVV A;  1OUS A;  2D6O X;  2RHP A;  1Z0H A;  2WJS A;  4BK5 A;  2B9V A;  2F17 A;  3DPR B;  4CP2 A;  4QD2 A;  2VNV A;  1O3R A;  3RZH A;  1G7Y A;  4CRQ A;  1UD1 A;  4FOW A;  3WDV A;  4E2Q A;  2QDN A;  5IAX A;  4MGT A;  2R1D A;  3J7N A;  5I91 A;  1HXS 1;  1H1I A;  1HDK A;  5FYT A;  1RXF A;  4AI8 A;  2JG8 C;  1ZA7 A;  1JZ8 A;  1ULF A;  3H1M A;  3WT3 A;  2BGO A;  5F8P A;  3D82 A;  3MW2 A;  4IDZ A;  4OZO A;  4G4F A;  2KR2 A;  3JB8 A;  5FZ0 A;  2WWS A;  4ISR A;  2K46 A;  5LEK A;  1BZW A;  2EVX A;  2WS9 2;  2ZX3 A;  3FMG A;  4LJH A;  4XQW A;  5K4L A;  4N43 A;  5HV0 A;  3FLP A;  5JPM B;  3WQ0 A;  2ZGP A;  2VVE A;  2BDR A;  5I8Y A;  1RUD 2;  5JOZ A;  2ADD A;  1CPM A;  5DAX A;  4Q0V A;  4LIV A;  4IQP A;  1JN2 P;  1GAN A;  5FZG A;  4LKD A;  2Y6G A;  1LRH A;  3KGZ A;  1PMI A;  2VNO A;  3WUC A;  3LAG A;  1XQN A;  1R1A 3;  1VBB 1;  3BOD A;  1A34 A;  5FOB B;  4FTB A;  3CZJ A;  1REF A;  4ZS3 A;  3SC7 X;  5D21 A;  3GZA A;  3PU3 A;  5GJ6 A;  3GHN A;  1AR6 2;  3RZK A;  4DQA A;  1H1A A;  5H9P A;  2XB6 C;  1ND3 B;  3PJQ A;  2W1Q A;  4MG2 A;  1TMF 3;  3ACI A;  3HBK A;  3VN4 A;  3NV1 A;  4XTP A;  1FI2 A;  1NQD A;  5I0T A;  3T0A A;  2VZO A;  3O1S A;  4HPK A;  3CJX A;  4NOT A;  1CES A;  4MSV A;  2Q0A A;  3BN6 A;  2LRO A;  4JKM A;  3OGV A;  3AMP A;  3GDB A;  4W6Y A;  1IKQ A;  1KD7 A;  1UL9 A;  2A3X A;  3HBZ A;  3RQ0 A;  5FZI A;  1DQ2 A;  1WWY A;  4QX8 A;  1ZRC A;  4BQW A;  1VBD 2;  4YM1 A;  3SH3 A;  4KU7 A;  3ZR5 A;  3B94 A;  1VAK A;  3ZFG A;  1ULE A;  1ZYB A;  3CO2 A;  5DUV A;  2VQ0 A;  4NAM A;  2B42 B;  4Q1P A;  4KWL A;  3KCY A;  2WS9 3;  4HKO A;  2P3K A;  5K7P A;  1CVN A;  2VCM A;  2VW2 A;  4RR3 A;  1WCD J;  1VRH 2;  3VZK A;  4A42 A;  1HKD A;  3M8L A;  3VBH B;  5JZG A;  1D4M 2;  5JXH A;  1VB4 A;  2AR6 A;  1RUD 3;  4M3C E;  4CDQ C;  4DRV A;  4NIH A;  2GND A;  4QPY A;  1BK0 A;  3WCS A;  3F2Z A;  2RJL A;  4LK6 A;  5ERL A;  4JCK A;  1RIR A;  5G05 L;  2XQX A;  3U0Z A;  4RGG A;  1YIP A;  3AZZ A;  2ID4 A;  5C4W A;  2YC2 A;  3E5Q A;  5KHI A;  4AR2 A;  2JDY A;  2O8O A;  2BYV E;  1JZ3 A;  2ADE A;  2D5F A;  1JHJ A;  4Q4V 1;  4AI3 A;  1GQP A;  1KEX A;  3K2O A;  3OBA A;  1AR6 3;  3ZFF B;  2ATF A;  4TYS A;  5CU1 A;  3SIS A;  2W1S A;  3M3C A;  4COV A;  1R09 2;  1W2A X;  1YC6 1;  3WG2 A;  3I49 A;  1YFX A;  2GC3 A;  2BPA 2;  2BRT A;  1HXS 2;  1LOG A;  1LHW A;  2GC1 A;  3MF6 A;  3PUR A;  4LBQ A;  3GJA A;  3UKV A;  3VDD C;  4OHY A;  1FNY A;  2WAA A;  3AZX A;  1UXZ A;  4AVC A;  3PL0 A;  4MGZ E;  3ZFE C;  1W8O A;  1EAH 1;  3CHX A;  2JG8 B;  4YM2 A;  5F7U A;  4FSJ A;  2JE7 A;  5CG8 A;  4PF1 A;  4QXC A;  3BVC A;  1XB9 A;  1OF3 A;  4PIZ A;  5EV7 A;  1SLA A;  5J36 A;  1VBD 3;  5GM0 A;  1GQH A;  5J96 B;  3H0O A;  4XC9 A;  3H7Y A;  5FJH A;  1F4A A;  4LHN A;  2YPJ A;  1CAV B;  3UT0 A;  3ZSM A;  1WGP A;  4F7Z A;  4EWE A;  1W8N A;  2ZHM A;  4FFG A;  4DMI A;  3SEP A;  1JOP A;  3HT2 A;  5HXM A;  2Z79 A;  5C8W A;  3P6B A;  3ZSE A;  1S0B A;  1YQ5 A;  1H2L A;  1XND A;  1VRH 3;  2BNN A;  2XJV A;  4Q29 A;  4QGL A;  4RGA A;  1LEN A;  4WVV A;  5FUI A;  1H0B A;  5FWE A;  5LA2 A;  1D4M 3;  1RED A;  2GMP A;  1VBB 2;  2RDQ A;  2WII B;  1EUU A;  3KF5 A;  3T1L A;  4XDO A;  3CDZ B;  1HQW A;  1WMX A;  1RUE 1;  2JDH A;  1MZF A;  1X8M A;  1H2N A;  4XTM A;  5I8T A;  2D5H A;  3VD7 A;  2JDM A;  3FBM A;  1MS9 A;  3N9L A;  1K12 A;  1PZ8 A;  4ZPI A;  3VZL A;  5FR3 A;  2WNE A;  1QXP A;  2VOX A;  4E2S A;  1BYH A;  2ORZ A;  1NCQ A;  4BOW A;  5DQ0 A;  3I8T A;  2CAU A;  1CAW A;  4D69 A;  4D7S A;  1R09 3;  4IUG A;  4P08 A;  3NNL A;  5C6C A;  2E31 A;  4LE4 A;  4XUT A;  3VHP A;  1OA2 A;  5B4N A;  1HW5 A;  1Q3E A;  3ZIW A;  2EF6 A;  1LEC A;  1HXS 3;  2MNG A;  5B2G B;  1X7N A;  4XF9 A;  3NMB A;  2R06 1;  1WW7 A;  1S55 A;  3A0N A;  3OTF A;  3I2I A;  3OJB A;  4Y22 A;  1LHU A;  4BIS A;  5FP4 A;  2JG9 C;  3J8F 1;  2PHT A;  3CJI A;  1F8V A;  4QKD A;  1RGS A;  4Q8L A;  3B02 A;  5I0D A;  1WUV A;  2E53 A;  1B09 A;  3EJK A;  5I93 A;  5IVJ A;  2P17 A;  1UZZ A;  3NW4 A;  2YHJ A;  4CCM A;  1OOP C;  1XYN A;  4ES8 A;  2YZ4 A;  5FYM A;  2V72 A;  4Y1Y A;  5DXD A;  2R7E B;  2HWE 1;  4PLO A;  1W6Q A;  2BGP A;  2OT7 A;  1VBB 3;  4FFI A;  1X9T A;  3E1F 1;  1J3R A;  2ZPX A;  4Q4V 2;  4IE0 A;  2ZGK A;  3TOJ A;  1ACC A;  2RE9 A;  1NUK A;  2VMF A;  1GR3 A;  3NNF A;  4CCK A;  4OCT A;  4QPW A;  2Y33 A;  4YM0 A;  4YVS A;  1LGB A;  2Q4S A;  3O1U A;  1OBN A;  1WD4 A;  4P5H A;  1XSR A;  1RHI 1;  4BXS V;  2A71 A;  4D6S A;  5FPZ A;  4CDX C;  1UF2 C;  2WYF A;  2XVK A;  3W59 A;  5BPX A;  1MZ6 A;  1EAH 2;  1CAX B;  1UO9 A;  1QDC A;  1ENS A;  2YC0 A;  4DUX A;  3AB0 A;  3ZFE B;  3POW A;  2XLG A;  5D8A B;  2YDE A;  3WDY A;  3NV2 A;  2EID A;  2VO5 A;  2Q1M A;  3KGL A;  2VMC A;  3VD5 A;  3W21 A;  1KS5 A;  4QB2 A;  1J58 A;  2DFB A;  2JDK A;  1POQ A;  3KV9 A;  3KVA A;  4N43 C;  4GMP 1;  2VZQ A;  5ANN A;  4BME A;  5A3P A;  1UMZ A;  3AKR A;  2VZ3 A;  4NAO A;  2DU1 A;  2OXB A;  3WSO A;  5KXD A;  3N9P A;  1MEC 1;  4RN5 A;  2W9X A;  3MW3 A;  3U1X A;  1OFN A;  1RUG 1;  3FHQ A;  4XZP A;  1NKG A;  1WMF A;  1K45 A;  2VOW A;  1K5M A;  4Z2W A;  1GKB A;  2ET1 A;  3PVB B;  4LLO A;  2WFP A;  2XWB B;  4SLI A;  5DAP A;  1V6O A;  3RYP A;  4XJ9 A;  5FXX A;  1ULG A;  1BMV 1;  5FY7 A;  4YLZ A;  3ZN4 A;  1U5X A;  3ON7 A;  5BUV A;  4IEQ A;  4URA A;  1JYX A;  1W04 A;  2JDZ A;  2QQM A;  2RDS A;  1F35 A;  2E51 A;  2WO3 A;  1PNG A;  2AYH A;  4FCA A;  4Q4V 3;  2RS1 1;  5FMO S;  3NRU A;  4CVU A;  1N3O A;  4CP0 A;  1C1F A;  2YGL A;  3B9C A;  2GDF A;  4CPB D;  4YWA A;  2V4V A;  4N7U A;  2Y38 A;  2QJV A;  2R06 2;  5DN2 A;  2VCA A;  4XUN A;  1KJL A;  2BNO A;  2FBE A;  1EAH 3;  3NV3 A;  4I0W B;  4MGS A;  2PQQ A;  3GCX A;  4AG4 A;  3J8F 2;  2E7Q A;  4AK3 A;  4E4D X;  1YLL A;  2E63 A;  3MIE A;  2JG9 B;  4HKW A;  2YGM A;  4KBB A;  4N53 B;  3DYP A;  3ZFG C;  3ZXG A;  3OEA A;  2X53 S;  4CCN A;  2A6X A;  5KHH A;  1XPW A;  2IWG B;  2CWM A;  3NJY A;  1LHO A;  1OA3 A;  2V5Y A;  2Y6J A;  4XCA A;  4RR3 C;  5CFD A;  4B8E A;  3O1O A;  5JZG C;  2PYT A;  2CTV A;  3O0X A;  1TEI A;  1S1A A;  5AVP A;  1Q56 A;  1Q8Q A;  3WR0 A;  3NKT A;  2BWC A;  2FCV A;  3OD0 A;  4LIT A;  4RHV 2;  1OLM E;  1OOP B;  4MGI E;  4OLL A;  5FWJ A;  2ZS6 B;  5AC9 1;  3LDK A;  5FQ0 A;  2EIB A;  5JMC A;  2HWE 2;  1LNS A;  5C4W C;  4XOG A;  3TB0 A;  1US2 A;  4M01 A;  2DUO A;  2HH9 A;  4B7E A;  4O9E A;  3E6D A;  1SAC A;  2O8Q A;  2UWC A;  4UFI A;  1W8Z A;  3HQX A;  3V64 A;  1CX4 A;  5L7O B;  1V6L A;  3KD4 A;  4D6R A;  1GZ9 A;  2XL7 A;  3C8X A;  1RHI 2;  4OUE A;  1CZS A;  5FYS A;  2R30 A;  4QMA A;  1OKO A;  1BXH A;  1GZT A;  4HL0 A;  4YW2 A;  5T5J A;  3FWE A;  1LUL A;  1IG0 A;  5BNO C;  2W91 A;  4NN0 A;  4Q27 A;  5IK5 A;  3I54 A;  3FN9 A;  4M4R A;  2PLV 1;  4JKK A;  1EV1 1;  1VBC 1;  2R16 A;  1TE1 B;  3POG A;  1VJ2 A;  1AR9 1;  2R06 3;  5F32 A;  5A7P A;  5F39 A;  5C8C B;  1PZ9 A;  2EXH A;  5ABJ B;  4DY5 A;  1W03 A;  4HON A;  3AXD A;  3IMM A;  3J8F 3;  3FBY A;  3WZ1 A;  3ZSJ A;  5JSR A;  1IKP A;  1YFY A;  2LM3 A;  4QQL A;  2WSV A;  5JMO A;  2IUW A;  4NMI A;  1MEC 2;  1US3 A;  1MS1 A;  2W95 A;  5TSW A;  2VTX J;  1W9T A;  3KHB A;  3SQO A;  4AHX A;  4LR4 A;  1RUG 2;  1HRV 1;  4FBF A;  4HZF A;  2Q8O A;  1VAV A;  1OHF A;  5ISL A;  4M0H A;  4XXA A;  4FPH A;  3WIN E;  4A6O A;  1JH5 A;  4CTE A;  4WVM B;  5LCW L;  4RHV 3;  1BMV 2;  1GNZ A;  1X9P A;  1RIN A;  1ND2 A;  4J1X A;  2VQT A;  2LAL A;  3N36 A;  2HWE 3;  3IDB B;  3ITQ A;  1N1Y A;  4UFJ A;  5KXC A;  2QFE A;  2PHR A;  5HI0 A;  2RS1 2;  2I2S A;  5DZE A;  2VE1 A;  1NCQ C;  3IWZ A;  2WQ4 A;  1L3J A;  1S0C A;  3I59 B;  3LB9 A;  3N35 A;  1ZM1 A;  2G9F A;  2VY0 A;  4HPK B;  2VBD A;  1RHI 3;  5FRE A;  1LOD A;  3UNP A;  2OYZ A;  4SBV A;  3LEG A;  4UW5 A;  3R4D B;  1V0A A;  3DYM A;  1FNZ A;  2YG0 A;  3ECQ A;  5F3G A;  1MS3 A;  3FHI B;  3ORJ A;  3OPT A;  1KFX L;  1I3H A;  1RIT A;  1W2N A;  4L2N A;  4X8P A;  5FMO L;  5JR2 A;  4ATF A;  2WT0 A;  4YZ4 A;  3T0B A;  4A7K A;  3CJI C;  4QXB A;  4HK8 A;  1V00 A;  3NJX A;  4QWN A;  2C1F A;  4A41 A;  4LOR A;  4GMP 3;  3FLR A;  3NNJ A;  3ZXL A;  4PDW A;  2JIJ A;  5KBF A;  1J3P A;  3AKP A;  4QHO A;  3UET A;  2A6W A;  2NP0 A;  1EYB A;  1MEC 3;  5FZO B;  2RS5 1;  2VM9 A;  4IEU A;  4XFA A;  3WF1 A;  5AC9 2;  5I0U A;  3KCC A;  1JYV A;  3AKS A;  1RUG 3;  1MZE A;  2VUD A;  5EYX A;  4MV2 A;  4QX1 A;  5IAT A;  2Q30 A;  2WL1 A;  2DCJ A;  3P1I A;  1WW6 A;  3SKJ E;  2G19 A;  3DKW A;  5C4W B;  4YM3 A;  2ARA A;  2C24 A;  3ZYH A;  4E4Z A;  2GME A;  4JQR A;  3H9A A;  3MF9 A;  2ET7 A;  4QM8 A;  3JD7 1;  3ZYB A;  5IVY A;  3LIH A;  5IFP A;  4K7J A;  1QOT A;  3P5B A;  5B4X A;  2AEY A;  3OUI A;  5GLU A;  4BM8 A;  4YVS C;  2WQZ C;  3DKQ A;  4B3N A;  3V0B A;  3IZO A;  3WW3 A;  3ZFF A;  2RS1 3;  1JXN A;  3D0J A;  4P9J A;  4P9X A;  1DZQ A;  4M4P A;  1JBC A;  3LD8 A;  5A3T A;  3SLI A;  1C3H A;  3S7I A;  5F6K A;  1OQE A;  4AEM A;  1AVB A;  2PLV 2;  4NID A;  1EV1 2;  1VBC 2;  2WUH A;  3JXS A;  3WG4 A;  1AR9 2;  1TVG A;  1YEW A;  4AFC A;  2WQ8 A;  4KGQ A;  3R05 A;  3EBR A;  1YQ6 A; 
#chains in the Genus database with same CATH homology
 4IE5 A;  3RZJ A;  3I3Q A;  4IE0 A;  2FDK A;  5DAB A;  2FD8 A;  4NIH A;  3O1T A;  4OCT A;  4O7X A;  3LFM A;  4QKN A;  2FDF A;  3S5A A;  3BUC A;  3BKZ A;  2IUW A;  3KHB A;  3H8O A;  3I49 A;  2FDH A;  4ZS2 A;  4NII A;  4IE6 A;  3T4H B;  4RFR B;  2FDI A;  3BTX A;  3BI3 A;  3H8X A;  3RZH A;  4NRP A;  4JHT A;  3I2O A;  4MGT A;  4NRM A;  3O1M A;  3BTY A;  5F8P A;  4IDZ A;  3T4V A;  3O1R A;  3RZM A;  2FDG A;  4NRQ A;  4NPM A;  3BIE A;  4CXX A;  2FDJ A;  4CXY A;  4NRO A;  3I3M A;  4QKF A;  3BU0 A;  3BTZ A;  4QHO A;  3RZL A;  4CXW A;  4ZS3 A;  4QKB A;  4NJ4 A;  3O1V A;  3RZK A;  3O1U A;  3O1O A;  4MG2 A;  3RZG A;  3S57 A;  4QKD A;  3O1S A;  3H8R A;  4NPL A;  4IE4 A;  4O61 A;  4IE7 A;  3T3Y A;  4NIG A;  4ZHN A;  4NID A;  3O1P A;  3KHC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...