1JS9A

Brome mosaic virus
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
149
structure length
149
Chain Sequence
b'KAIKAIAGYSISKWEASSDAITAKATNAMSITLPHELSSEKNKELKVGRVLLWLGLLPSVAGRIKACVAEKQAQAEAAFQVALAVADSSKEVVAAMYTDAFRGATLGDLLNLQIYLYASEAVPAKAVVVHLEVEHVRPTFDDFFTPVYR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coat protein
publication title The crystallographic structure of brome mosaic virus.
pubmed doi rcsb
molecule tags Virus
total genus 18
structure length 149
sequence length 149
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2001-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01318 Bromo_coat Bromovirus coat protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.220 Mainly Beta Sandwich Jelly Rolls Satellite virus coat domain 1js9A00
1JS9A 3J7MA 3J7NA 3J7LA 4NIAA 1A34A 1STMA 1CWPA 4OQ8A 1YC61 1ZA7A 4OQ9A
chains in the Genus database with same CATH superfamily
4FPLA 1HV1A 1OVSA 3RZMA 1ZX5A 2RJ2A 4ZU7A 3NSTA 5JZGB 1BK1A 4AW7A 3AB0A 1Q43A 4I2OA 1BBT2 3RFRA 4PBPA 4O7XA 1GLHA 2JB8A 1OOPA 4CRQA 5KHGA 1DBNA 1QNWA 3CO2A 2ZX1A 3VDAA 5BUVA 1IQDC 1WMEA 4FPYA 3OYWB 4Q1PA 2XDVA 1FV3A 2QUOA 3WNOA 5CEHA 2OZ6A 4A7KA 4UYBA 3WINE 1OLRA 1XB9A 1CX1A 3ZFFA 1H1MA 3RZGA 2RR13 1YFYA 4ASMB 1N3QA 1WW7A 3IWZA 1VRH3 3TOJA 1GUIA 4YWAA 1ACCA 1LECA 1YQ5A 1EPZA 5DAVA 4DUXA 4OI0A 3I3DA 1MS0A 2VQUA 1VE0A 2HWC3 2BBVA 2BW8A 4Q4Y3 3N4MA 2RM22 2I2SA 2Q4SA 3CLPA 3ZYJB 3NJYA 4BQYA 4D7YA 5C5UA 1PX4A 2Y6FA 4PF5A 5JSRA 3UJQA 3P5BA 4XW3A 1WBLA 1W6NB 2XLGA 2W08A 5L7OB 2C0ZA 2R1DA 3E6BA 1J3PA 2P6HA 2RS52 3W58A 2QQNA 4FI9A 1CIYA 4NHKA 4C91A 2GNTA 2GNDA 3PVOA 1R1A1 1G8WA 3HQUA 3JXSA 2P1BA 4OCTA 2IC1A 3M8LA 5JOXA 2Z4FA 4D8MA 2R063 4XBLA 2WZR3 4XC9A 2HWF1 5DDJ1 4AQ2A 4AR2A 4YZ5A 2DVDA 3M3IA 3CF6E 4XJZA 3KHCA 3OPZA 4FQ4A 4FQZA 2Q8EA 2VW1A 2RDRA 2GSYA 3MIDA 2JDZA 1DZRA 1S0IA 2VECA 2A6WA 2ATFA 1AX1A 4LT5A 2NPIA 3R4SA 2ARBA 2VBDA 3OBRA 1LESA 4CU7A 1UY1A 3OGGA 1RMU3 2R49A 1O5LA 2JECA 5FMOL 4XOGA 1X82A 5C70A 1XSQA 1LEMA 2D3RA 2E7TA 3EO6A 3DKWA 5GZCA 2GMPA 5HXVA 3AVRA 4AQTA 4QPWA 3PU3A 1J83A 2VQTA 2WNEA 2ZACA 4FXGB 2I45A 3WF1A 4QDRA 1R093 1VBD2 3DPRC 5F8PA 5GM0A 1W8WA 1D2QA 4R4ZA 4UFMA 2WWUA 1BHGA 1DGLA 1YRZA 1QOSA 1ULEA 2ZHMA 4IV3C 5ANQA 3T09A 4R9DA 2EICA 2G4IA 1LEDA 4K1YA 5FIXA 2XUMA 2D6PA 5K0UA 5CB7A 4TWTA 1ZBA3 1AF9A 1OHFA 3ZYGA 5JR2A 3VUOA 2RV9A 2Z79A 1E5IA 4V2WA 3WG2A 5APAA 1IPJA 4R9AA 1SLTA 3BU7A 3CJIA 2BVVA 3MFAA 2A6ZA 2AZ5A 4RS5B 5D8AB 1O6UA 3FN9A 1UXXX 2GALA 4M3CA 3D5OA 5A33B 3N35A 1HKDA 1W3XA 3FUOA 3OOXA 1UKGA 1QH7A 1LGNA 5A7QA 2YBKA 4CCJA 4YZ1A 4BQXA 2ERFA 1XU2A 1NE4A 5J96B 3ZSEA 1WMDA 2D6LX 2VH9A 4RFRB 2JG8A 1IGOA 5E88A 3TNQA 1FXZA 4LBKA 4N7IA 1GBGA 3ILRA 5FZ7A 3PTRB 2IZWA 1NLSA 2PTMA 2ZZJA 3C2UA 2VMFA 3KF3A 3VBRA 1EP0A 4JCKA 4D69A 5KXBA 5I8SA 5LA1A 3VD9A 2J7MA 1FPN3 3H0OA 1WA6X 3N9NA 3IT8A 4YLZA 2Z69A 4P9WA 2RDNA 1UCXA 1QJFA 1Z7S3 4E4SA 4K8RB 3MHZA 3AKRA 5EPAA 4DXTA 5C9AA 1CAVB 3THCA 4BPZA 4GB32 4Q0SA 4WM8A 4P9GA 1YFWA 5F5QA 3HBKA 5FPVA 1NCQB 1K12A 3SMHA 1JOJA 3LKJA 4BH9A 2HWE1 4QPGB 2PLV2 1W9SA 3OG2A 4FFHA 3BALA 4LKFA 5FZKA 1YLLA 4TXWA 2WINB 2ZABA 4CDUB 1D0HA 5KHJA 2V09A 1AR73 3RDIA 3ZN6B 3T3YA 3JD71 5A6ZA 4QHBA 2MEV2 4COUA 1B09A 4XJUA 1FI2A 1XNKA 4O9EA 2WS93 2B7YA 4P9IA 1QJU3 3UYJA 1RUE1 4YVWA 1Q8PA 4WVVA 2JIGA 5HCFA 3MF6A 4GZ9A 1HRI2 3TN93 1TME3 1WWYA 3MV01 4YVSC 1KXGA 3K46A 3ZO0B 4YGDA 1JYTA 3AYCA 4RHV3 4MADA 2ORZA 2XL7A 2JDKA 2KM2A 3KS7A 1B35A 2VQ0A 2VTXA 4QXKA 4QHZA 2VZQA 2ZAHA 1PGL2 3UETA 3B5LB 4W4ZA 5C8CB 4FPFA 2Y6JA 3KV5A 3POJA 2QQWA 3WF2A 2XXZA 3RG0A 3UK9A 5IFPA 2W87A 5EYXA 1CAUA 4LBLA 5DAWA 2JDNA 2XQXA 2FD8A 5A7NA 5FV3A 2EIDA 5T5PA 1CZSA 3GZTB 5A6XA 3AX4A 4HFSA 3CBNA 4N9IA 5C4WA 2HYKA 2QQLA 2SBAA 2CGOA 3FBMA 5FY1A 5LBFA 4AEDA 4AFDA 4DXRA 3B00A 3EXUA 3WDUA 3ZFGC 4NIDA 5LEJA 4AHWA 5IVVA 1W6PB 1JHNA 2LTNA 4B4PA 3KV4A 3ILFA 3C7HA 3S30A 5IAXA 4A7ZA 5F3GA 3LCPA 4CU8A 1LNSA 4RR3B 5FCCA 1GZWB 4Q29A 3H1WA 4PI2A 2JEMA 5CKQA 2VZUA 1KS4A 4YM3A 5AVPA 1O59A 2W0XA 2LALA 2VJXA 4AWDA 4BHPA 5F5IA 3VDDB 4MHRA 2XONA 1BBT1 5FPLA 2B9UA 2AUYA 1JZ7A 4OYUA 1AX0A 4Y22A 2X5IA 5ACA2 4OI1A 4B7KA 2GH8A 1ZA7A 4PJYA 5LCWL 3VBUA 1UWWA 4D6QA 4QGLA 3ZR5A 1XNTA 5A3TA 3DUIA 1LHNA 4B4QA 5FK8A 1I3HA 3APBA 5CFDB 2NP0A 2WT1A 1QH6A 4R52A 2WABA 3U07A 1RJ8A 2VCMA 4JGZB 3J7LA 4Y5SA 2J1RA 2NYYA 4LE4A 3WNNA 1NA1B 4BA6A 3O1PA 1N3PA 3OF1A 4XF3A 3K3NA 3ROUA 5CKNA 2D6NA 1ZZCA 2RM21 4AI9A 3O1TA 1PGW2 5EJ3A 3VBFB 4YZ3A 4XIOA 2ARCA 3GCWA 5FQ0B 1ND3A 2D40A 1VRBA 3MUY1 1DCSA 3THDA 4IEYA 4LNVA 1RUJ2 4MUVA 4PQQA 4BXFA 1MS3A 1GV9A 2ZMKA 1EUUA 1W2OA 3CL1A 2JG9B 1GNYA 5FP9A 4AI3A 4BM8A 3PJQA 2VOVA 4QX2A 5FZLA 1R64A 4I30A 2F4PA 1OA4A 1WCQA 1IOAA 4GJYA 5FMDA 4P14A 1QF3A 2MPFA 3FMGA 3N9OA 4ZY9A 2ZPXA 3AMQA 1JYXA 4CEWB 2ORXA 4HONA 1H2KA 5ABJB 1MVEA 3VBOB 1UN1A 2VZRA 3Q8CA 2ZEWA 3L2HA 2R0FA 4U36A 5J09A 2Z42A 5FZOA 2RR11 4XHXA 4GH4C 4HSLA 2J1TA 3CZUA 5FP4A 3ZFFC 2SLIA 3DXUA 3PUAA 3C3VA 3U78A 1CAWB 3ZFEA 4A42A 4CEYC 2ZMNA 1W04A 4Z8BA 3O1VA 5IUQA 1RXFA 4IE6A 4Q4Y1 1JW6A 4YRDA 5H9QA 5K9YA 1VBE3 4QXCA 1YCIA 3Q8FA 2XJTA 3BTZA 1CZVA 1GANA 1SBEA 2RJKA 5JZGA 1CD3G 1FNZA 4GULA 3HD8B 5JPNB 1XBFA 2F4LA 2WJSA 2E51A 4F7ZA 2LRPA 1YIFA 1LAJA 1VBD1 3WD5A 2YUEA 3OGRA 3K51A 2Y6GA 1BMV2 1K42A 1WD4A 2OIIA 4D0QA 3GZUC 4LHKA 3W20A 3ME2A 3JB8A 2VNGA 1PO23 2ZGPA 4OMCA 3OYWA 1KD7A 1VPHA 4Y1UA 1O4YA 2A5ZA 3B02A 3WLUA 1PM4A 2QQMA 1SZBA 2WZR1 1DGWX 2D5HA 2IXCA 1KDKA 1ENXA 1RUC3 4LUKA 1H1AA 2UY9A 3LIGA 1SLCA 2VW0A 5FO9B 3VHPA 2RS32 5FXZA 3VDCA 4XFIA 1AYM3 2ZHNA 1PIV3 4LO6B 3K3OA 1DFQA 4R4XA 2R0HA 2D3SA 1AL23 2GNBA 4BQ1A 1W90A 3BB6A 2FDFA 1V6IA 2DU1A 4MGIE 1W6NA 5L7OA 1H4GA 4NROA 2GC2A 1VAKA 4XZPA 1H2LA 1DQ6A 1LOAA 1QDCA 4NRPA 3QCWA 2JD4A 3H1YA 3ETQA 3BPZA 5JXIA 1W3VA 1UX7A 2FHRA 2JDUA 2YZ4A 5FKBA 5GLZA 4C0BA 1PO22 4B4RA 4S2DA 4AK3A 4HL0A 4Q5OA 4LQRA 4MLOA 4WVMB 2UY8A 3T2TA 2A3YA 2RE9A 2YG0A 4M0HA 3I4IA 4M4PA 2N7GA 1NOVA 1ZBA1 3DECA 3GJAA 3LD8A 1BQPA 4UFJA 3U1XA 5L9VA 2VCCA 2WN3A 2W52A 4IGPA 1V6KA 4NIHA 1C57A 4MGZE 2Q30A 3T08A 2AR6A 2I07B 4GB31 2ILMA 4IEWA 3CJIC 1LHUA 3VHOA 1M4WA 4WM7C 5FXVA 4V1PA 1T6BX 4CP9B 4K20A 1BYHA 5FZEA 3W9AA 1MZEA 4BE3A 5BNQA 1NYWA 3K75B 4NVPA 1JZ2A 2VMIA 5KHHA 1JYNA 3NNFA 1ZVFA 2PLV1 1ND2C 2CY6A 2QKDA 1W2TA 1OH4A 5FPAA 3DKQA 1RUF2 2W1SA 4MYEA 3WQ1A 2JG8C 4L2NA 4AAXA 3JBG3 4OMDA 4MGQA 1BEV3 1J1LA 2MEV1 4DRVA 3RZKA 2VZTA 1QWRA 2BGOA 2HH9A 1IPKA 1WW5A 5LEKA 1EY2A 3PU8A 1FPN1 5FYYA 4EJRA 3POEA 1UD1A 3S5QA 1HRI1 1JXNA 1BXHA 3EYPA 3BIWE 3CNAA 4TLFA 4HKOA 2GNMA 4I0WB 4NPRA 1OT5A 1GP4A 1J1TA 2L9LA 3QACA 4KBBA 2UWCA 5BXXA 4BDVB 3VLBB 4RS5A 5D8AA 5FPZA 3KB5A 2IXLA 2YV8A 5GLWA 4EWEA 3LA7A 5C9AC 5A33A 4NHXA 3JQXA 3LAGA 2K46A 3I97A 2B8MA 4MO3M 4WM8C 2YPJA 2XJQA 3IZOA 4TN7A 4HANA 1OD3A 4DXSA 4IERA 1JZ6A 4W65A 4NAMA 2DWRA 4E2QA 3MFCA 1MS8A 4NRQA 4O9GA 1OH3A 4XF0A 1AR71 1H8TC 1UPSA 1GU3A 3LSEA 3CKHA 1ZRRA 1ZNPA 3AP6A 5FZ3A 2V72A 3P1IA 4MG2A 1UYYA 3MYXA 3WOGA 3IB3A 4NIGA 4HMZA 4XMAA 2WS91 1STMA 3GHMA 4AF9A 1DGWA 2OS2A 1JOPA 1ZM1A 1YC61 3BYWA 1V6LA 2YU1A 4RL7A 4CCLA 4Y4RA 1SFNA 5FAXA 1OXCA 1R1A2 1UY3A 3UJOA 5DAPA 1FAYA 4E4HA 2R7EB 3O1OA 3GNEA 4FFGA 2DCZA 2HWF2 1CAVA 2HJIA 2UWAA 2VGDA 3H3UA 5DDJ2 4HVRA 4MHUA 3A21A 5F7UA 4Y1YA 3BIEA 1AX2A 1B35C 4DRRA 5AC93 4CCOA 1JBCA 1FT9A 1SDDB 1XU1A 4N90A 5FBJA 4BQ3A 1NCQA 1VBB2 1ZYBA 3BVCA 4DO0A 2WNUB 1VMHA 4DY3A 1W9WA 3D3AA 3NV2A 4QPGA 3OGSA 1WLDA 1ZRDA 3BTAA 3LDRA 1GQHA 4LPLA 5K4LA 5IVBA 3LEKA 4FAGA 4CDUA 1PZ9A 3VN4A 4LKSA 3I7DA 3SLIA 2W68A 1RUG3 1GSLA 1YHFA 2R042 3ZN6A 4Y20B 1ZBE3 2HWD3 2ZBJA 4J25A 1HN1A 2GH2A 1TMF3 1SACA 2CGPA 3NJZA 4BIOA 4UFHA 3H8RA 3AYDA 1LOGA 4JKLA 1LOBA 1QJX3 5C4WC 1O8SA 3R4UA 1UYZA 2VZ3A 3ZDVA 4AEDC 2FCUA 4N43C 2JDAA 4XFGA 3RPQA 3CJXA 3VBHC 2R16A 1OUXA 2QZ3A 3DV8A 3B69A 4HBNA 2VZPA 4KBZA 1KJLA 3JU9A 4Y24A 3RI9A 1PGW1 3UL2A 4XMIA 4Q8KA 1S0BA 1REDA 1RGSA 2HEWF 2YHJA 1QJZA 1DP0A 1W39A 3PURA 1RUJ1 5DUWA 2HWB2 3ZXLA 3D8CA 4QQ2A 5FXWA 1Y9MA 1YXWA 2D5FA 5C8CA 2DV9A 3KV6A 3NNLA 3OSDA 4JKMA 2J1SA 3ECQA 2RMU2 4F8AA 1OA3A 1F2NA 1WBFA 1OURA 4U2AA 1W8FA 3S5AA 1R1ZA 1WCKA 3T2OA 5J1XA 4OVEA 2X5IC 4UWDA 1VIWB 2J1AA 4XCAA 5CYYA 4SLIA 1GP5A 2ZX4A 5JXJA 3W5MA 5LBCA 3VBUC 1G7YA 1UIKA 1HXS2 4GA9A 2VBBA 2NLRA 4OULA 2YGLA 4Q8LA 1L7QA 1NQDA 5IW0A 3WF4A 3KV9A 1TMF2 1KFUL 3MPPG 5FZMA 3LEMA 2ID4A 4FFFA 4YW3A 1W6PA 3MDPA 2D6KA 4QT6A 3AXEA 2B45X 5LRRA 5FYMA 3GZAA 4DXZA 1HB2A 1HX6A 1CGPA 4RR3A 1H9PA 4AL9A 1GZWA 3IAQA 4QDSA 4A41A 1YFXA 4LBOA 1TNFA 3ZM8A 4PF1A 4YGBA 3VDDA 5KHIA 3KVAA 4XDOA 5FZCA 1AZDA 1SBDA 1JZ5A 2VBPA 3HOBA 5BY5A 2LW8A 1QQP3 1UZVA 4FPJA 2BEOA 4QGNA 2JDHA 5JAXA 4LIVA 1Y7BA 1YJKA 3JB4C 3AL6A 2IVJA 2YB7A 4Y5Z0 1HDKA 1JU3A 4Q0QA 3ZLIA 3VD4A 3SCGA 5CFDA 5CIRA 4PLOA 2VG9A 1OC1A 2E26A 3MO4A 5JDBA 4JGZA 5G05L 4Y1ZA 1F5FA 4UF0B 4X8PA 1UKRA 1NA1A 2YROA 5DZFA 5JPMB 4W6WA 1VJ2A 5FR3A 4FFIA 4FXKB 3ZFEC 3IKWA 3RI8A 1T6GC 3NQHA 3VBFA 4TZDA 1U5XA 5LATA 1VBE1 4M3CE 3H50A 3WQBA 1C8M2 1LOFC 3LPGA 5FQ0A 1XYNA 4FO9A 5KC6A 1A78A 2IXKA 4B7EA 3CDZB 4OI2A 5KHKA 4NR1A 4UXAA 2A75A 1WMXA 2NMNA 3RWKX 2JG9A 3ELNA 1F9KA 1FOD3 2D43A 2Q1FA 2WLPA 3VBSC 3IDAA 4RA0A 1C5HA 3NJVA 1UYXA 3ZXKA 5T54A 4IEZA 3T4HB 3WEZA 1AR63 4CDQB 1PO21 1I5PA 1YEWA 4CUBA 3OEBA 4KWJA 3VZOA 3NV3A 4Q2FA 4CEWA 3WV6A 3VBOA 5ABJA 4CCDA 4FCAA 2BDRA 1QY4A 1E5RA 3NVCA 3OUIA 2B39A 5ERLA 1CN1A 5C3PA 1QEXA 5GZDA 3NMBA 3LEIA 4UFIA 1AYN2 4YNIA 1CAWA 1QKQA 1NY71 1PX3A 2QJVA 4DPNA 3BCWA 2NM1A 1AYM1 3MW3A 1PIV1 4JX0A 4Q4V3 3VD7A 2Y33A 2XLAA 1Y43B 3RMXA 3J8F2 4CP1A 1W6OB 3PMEA 1AJOA 3NAPB 4UAPA 4JQTA 1XNDA 5A3WA 3HN1A 4WZFA 3L9JT 3V0AB 1GOFA 1SG3A 2PHFA 3AZYA 4LBQD 4YW7A 5JUVA 4Q26A 5B4NA 5L7OC 3I2OA 4LUMA 4CUCA 1UF2C 3J4UH 3E6DA 4NMIA 1J3RA 5CNAA 1VALA 1V0AA 3O5SA 3OBZA 1G9FA 2OXBA 1SFYA 2CAVA 4LO8A 4IE4A 1GICA 4G4FA 4ZU4A 3ZX7A 2ARXA 4H7MA 2W1QA 3HEIA 5A80A 1F5JA 2VCAA 4KMQA 5A3OA 5FDBA 1O91A 3J26N 1MQTB 1JYCA 4MGSA 3PJYA 1YQ8A 2ZGLA 3UESA 5F1RA 2YC2A 1XYPA 4GMP0 4M3CF 5C7GA 5GZFA 4CDWB 1OSGA 4IDZA 1YQ6A 1RUD3 2VAUA 3E5QA 3DF0A 4JZRA 5J7MA 2QQVA 1IS5A 1YI7A 2YBSA 4MGYE 4ZKTB 1SLAA 2VUCA 1PO12 3MLJA 5L73A 4HPKB 2X29A 5FZAA 3TRSB 3EQEA 2W91A 1LENA 4AEKA 2XUEA 4HZFA 4QQLA 1YI9A 1HQNA 3JBG1 1W8TA 4NOTA 1BEV1 2ET7A 4QM9A 3R6SA 3OBTA 4YW4A 5LY1A 1TG7A 5EHDA 3ZKUA 3AP9A 4LBNA 1U5YA 2BNOA 4A45A 3UGHA 3WW4A 1GWLA 3LWCA 1KDMA 4WVMA 3ZIXA 2XWJB 2GAUA 4WZCA 4OQ9A 4MZUA 2ZX2A 3AK0A 4XQDA 2AEYA 2DUOA 1DQ4A 3B3QE 3IPVB 4LHSA 4YZ4A 3UKTA 4BXSV 4AGVA 1BCXA 2VTFA 5FRAA 5JIAA 3N7KA 2RVAA 5G04L 4XFBA 3Q8EA 3RYKA 2PHRA 4XHBA 3WQ7A 5EWSA 5D8AC 2RR12 2E33A 4CP9A 2VNVA 1IG3A 3ZIWA 4IUGA 1VRH2 4W6XA 5FYHA 1VBB1 1H8VA 5A3PA 2GZWA 3LA3A 4EE2A 5IK7A 1D2SA 2HWC2 3RJ2X 2XJVA 2VR4A 4I0BA 4Q4Y2 2EXJA 4GKXA 1ZZ9A 1Q8QA 2O8QA 4D6RA 3FLPA 4QU2A 2R041 3AMPA 1KEXA 2X10A 2MNGA 4QQHA 4NPLA 3CMGA 5FZ8A 3KCCA 4QQPA 5IJRA 3WDVA 3RRDA 1N1TA 4HK9A 2KXLA 4LITA 3WT3A 1HB4A 2OPWA 3LFIA 2X05A 3RWNA 4A6SA 2DYCA 4Q0VA 5K8SA 2ZS6B 5FUIA 3PL0A 5A7WB 1QOTA 2QQJA 3PUHA 3PVEA 2R062 4DIQA 2WZR2 4MGTA 4CEYB 2DTWA 1UU5A 2HWB1 2UYBA 1LJ7A 2VW2A 2OZJA 2WIIB 1X9TA 3CQOA 5F2SA 5HCBA 4DNYA 5AC91 5FY5A 1A34A 2CDPA 2RMU1 1FATA 2WSUA 3ENRA 3HWJA 4I3GA 1NCQC 1HN0A 1RMU2 3I3EA 2JKXA 3QD6A 3ITQA 5FZIA 4QPGC 1G9BA 1S0FA 2ES3A 1EPWA 4NE9A 5CISA 1HXS1 1RUG1 4CDUC 2GU9A 3N9PA 1ZBE1 1S4CA 4MOAA 5FO8B 2A3WA 1TMF1 3ZN4A 1ENQA 2CYFA 2FQPA 4CCCA 1R092 4CDXC 2CWSA 3AP7A 1UOJA 1YFUA 4CTEA 3AKPA 4CXWA 2AC1A 1SLBA 3S7IA 1KS5A 5JXHA 3JUUA 4GMP1 5BNPB 4YG0A 2ZX0A 1ULDA 4IEVA 1CQ9A 2PELA 4TYSA 2BRTA 2BWAA 3WQ0A 3OCPA 4XETA 1REEA 2E32A 1ZBA2 1SLIA 4UOJA 3USUB 5CVRA 3WP3A 1LULA 1L7LA 2YC0A 2XWBB 2E53A 2UU8A 4QM8A 1XNAA 2WNUA 4FTEA 3EB7A 1TZOA 2G1MA 5KWRA 3OGJA 2DTYA 4KWLA 4NAOA 1VB4A 3AZVA 3DPRB 3FJSA 5KC5A 3I49A 5F2WA 4MVTA 4Y20A 5DQ0A 1XE7A 2HEVF 2LUWA 4IV3B 3UGFA 3UNPA 4LHNA 5TSWA 2WFF3 1UQXA 1W9FA 2QQUA 3H3ZA 4UW4A 2ZKLA 3MIFA 4NPMA 5F3IA 2ZGTA 4BMEA 2JE7A 3X29B 4R9BA 4FOWA 4K7JA 3WDWA 2IVIB 3I2DA 5E8AA 3ZXJA 2WNVC 1NLRA 1WGPA 3AMNA 4XDQA 4BZ4A 4E9KA 4INDA 1FPN2 5FYIA 3TNPB 4Y5TA 1C8M1 1AXYA 2B5HA 3WG1A 4TTGA 1W0PA 4KG8A 2WO1A 3SCHA 2ZEXA 1Z7S2 2IXJA 3OJBA 3WX5A 2C26A 3BGAA 2UWBA 2WO2A 4GALA 4LR4A 3AP5A 2QQIA 3WNKA 1N1YA 5T5JA 4HN1A 3M3EA 2YPDA 2BFUS 5F32A 1QHDA 4L9BA 5FMBA 3FFZA 3GXUA 3WP4A 2JD9A 3AKTA 2WZPP 1COV3 3N9MA 2WFF2 3IN9A 1W8OA 1AR72 1AYN1 3FHIB 4YYOA 1Q8VA 1N1SA 3QH6A 4E4DX 2AREA 4J1XA 5DMYA 3WW3A 4Y1XA 3TEZA 4OHWA 2EAKA 3C7GA 4N53C 1NA1C 3EBRA 5LASA 2BTVC 2D98A 4AI1A 2WS92 3J8F1 3VKOA 1QJU2 1U12A 3ZDSA 1O3QA 4YM0A 1OUSA 2DCYA 4AEMA 2WT0A 1XC6A 2NZ9A 3IMMA 4W6YA 3TN92 4PIZA 3B9CA 1U5ZA 1TME2 4HVOA 2G19A 4L99A 3SNMA 3TBDA 1AR83 3ZXFA 3INAA 5CBLA 1PVXA 2CNAA 3VB9A 3LF7A 4LIUA 4KWUA 5A32B 3HT1A 4RHV2 1FOD1 2W47A 2EAAA 2ZTNA 3J7HA 1AR93 2JG9C 2HBUA 1GP6A 1URXA 4OUMA 2HLEA 3N7MA 4YG6A 1UZ0A 4PI0A 3WDYA 1UMHA 1W2NA 1UXZA 1H4HA 1RYYA 1CVNA 3VZKA 1XE0A 5CA6A 2ZGRA 5JMCA 5FZFA 4CEWC 4WV8A 3GZEA 3THTA 1DG6A 1PVC3 3H3LA 4UF0A 5C3SA 2JE8A 5JLVA 5D21A 5DUUA 5LA0A 5FZ1A 2R6QA 1I5ZA 1QJY3 4ZXEA 4Q4V1 4HETA 4C8DA 3UKVA 2O8OA 3OUHA 2BWCA 2DURA 5LBBA 4PBOA 3T0BA 3ABZA 1UOGA 3FUQA 1PO11 1XOYA 3G6JB 3ZYIB 5IHRA 4EN6B 4BQ4A 2VCBA 4FOYA 1OVPA 2WFPA 3A0KA 2KD7A 4Z2AA 1MS9A 4I02A 3ZXEA 3KHBA 1WW4A 3TEXA 1ZZBA 1AXKA 4FPGA 1BLZA 3KMHA 4CDQA 1DYKA 4JTNA 5F37A 3K4AA 1F35A 3ST7A 5DXDA 1JI6A 1JZ8A 3SKJE 4ZZ5A 3T1MA 3ZFGB 1OOPC 5I0RA 4RGAA 1KFXL 1W2AX 2X09A 2EXIA 1HIXA 1QMJA 4FTBA 3I2IA 1NCRB 2PHWA 1W06A 4NHMA 2DF7A 3LPFA 3B9IA 2C1FA 1LTEA 3WZ1A 4Q1RA 1RUD1 1VRH1 2WAAA 3C8XA 1W6OA 5FLJA 3DL3A 3NAPA 4FBFA 3C7FA 2HWC1 4M00A 2VPVA 3V0AA 1RUH3 3SCFA 2RJLA 2VZ1A 1OQDA 1S0EA 2Y8KA 1NT0A 1GWKA 1UPIA 3BN6A 4D7SA 5LK7B 3VL9A 1D7PM 3MIGA 4IL7A 4P08A 2W92A 3UKNA 2OT7A 5F5CA 1EV13 3SH5A 1OF4A 2E7AA 2EA7A 1CJPA 2VVEA 4IETA 3ZYFA 5IK5A 4QKFA 5C5TA 2JDMA 2LS6A 2VOWA 3R0RA 3M2MA 2BFUL 2R073 2P3IA 4EN8B 4G9SB 2Q5TA 4KU8A 1UOFA 1HLCA 3O12A 4L8QA 4Q4X3 1MQTA 4XFCA 4AI8A 4ET7A 5IT6A 4XACA 4QWNA 2Q1MA 1RVF3 5T55A 2Q8OA 1G9AA 2R061 1UY0A 4CDWA 4BQWA 2QTWB 3N36A 3BTYA 1WLWA 1OKOA 1H6YA 4Q4W3 5FLHA 1Z0HA 2Z2SB 3IIAA 4SBVA 4YW2A 1YNAA 3ZSLA 5J37A 4AFMA 1UOBA 5LB6A 2QNKA 1V6JA 3MLKA 5JI9A 3M3CA 1W9TA 4XF4A 1JZ3A 1M06G 1A8DA 3KT7A 4CZSA 1RMU1 4K1ZA 2DCTA 1VBE2 3QH7A 4HPKA 1VLNA 5EQUA 2VNOA 4MSVA 2QBXA 4P5HA 3H8XA 3P3NA 4MV2A 1CZTA 4E2GA 1SCSA 5A3LA 4LORA 2BERA 2J1VA 1JMUB 4P9YA 3HBZA 4BLIA 4CSWA 1G6NA 3PUSA 4Y4YA 3LZZA 4AFCA 4X8NA 4YARA 2QFEA 1R091 4OUEA 2AENA 4Z82A 3MEPA 3ASIA 1HJFA 1PM7A 5A70A 5DAQA 3N7LA 4GH4B 5GALA 1W8HA 1HRV3 1K5MB 3FC0A 3IPVA 2PA7A 2XJUA 5FMCA 1ALYA 3LGRA 1HB1A 2WZEA 4XCBA 5LRSA 2O14A 3ACIA 1SHWB 1ULPA 4ZU5A 3W5NA 1ONAA 2C4XA 2VUAA 2D3PA 1LCLA 5K0UC 2F6BA 1RUC2 2VOKA 1TVGA 3LA2A 4G3YC 1PZ8A 4LLFA 1NY72 2BYVE 3SISA 4BJ0A 4DB5A 3OTFA 1AYM2 1PIV2 2XH6A 2DVBA 2OUJA 3N9LA 3WW2A 1AL22 2D6MA 1UZYA 2IFWA 3U14A 2AGSA 1UAIA 4C1WA 1EAH3 3K48A 4COZA 1XYOA 4COYA 2WYFA 3NNJA 5IWFA 3MF9A 3PVNA 4RYDA 3MW2A 1WD3A 1UIJA 3AM2A 2WN2A 1WKYA 5F6KA 3VBRC 1OPOA 3WDXA 1O3RA 1FNYA 4E8DA 4L92A 2JDPA 2K0GA 4QU1A 5A7WA 3E97A 4JHZA 5A7PA 5HV0A 2BZDA 2A73B 1WA4A 2VMGA 1W0NA 3LDKA 1OLQA 3SEPA 4CEYA 1O3SA 1VB2A 4XABA 4XUQA 5T5LA 1Z7S1 4IE5A 1P8JA 1VBC3 3MGUA 5I0TA 2X8KA 5FP7A 1E5SA 3K2OA 4LBMA 2HYXA 2P34A 3MI8A 3OB8A 1JTZX 5EIYB 1CX4A 1JUIA 3WXPA 3RQ0A 4QX7A 3FHAA 3RZHA 3N3HA 2OUHA 3E5UA 3KWVA 4XFHA 2CU5A 5JR7B 2V5YA 1MEC3 4EV0A 5F5AA 4LHLA 2W1WA 3SKVA 4ISRA 1VBA3 1WCSA 3LQCA 5FLIA 3VKMA 1BJQA 1EAH2 4XAEA 1W6QB 5FWJA 2EIEA 1CR7A 2WFF1 4FP2A 2Y6HA 4QHOA 3R4DB 3M7AA 3CHXA 4XBQA 1AL0G 2ZHKA 4Y26A 3HIFA 1XPWA 3JBG2 4QPIB 5EFUA 1BEV2 5JCTA 1R083 5LA9A 2A6YA 1H0BA 4Q27A 5BNPA 1QIQA 1W2UA 4DINB 1IKPA 4CA9A 1QJU1 3MIEA 3MZHA 4AQSA 1KRIA 3PIJA 4K6BA 4YVWC 4WM7B 3TN91 4ZZ8A 1Q5OA 1TME1 4BLJA 4IV1B 1ULFA 4J1WA 4UW3A 2VVFA 3D0SA 3USUA 2YFUA 1APNA 5JIUA 3HR9A 4RHV1 2WDBA 4XUPA 1ND2B 1S55A 1VP6A 1PK6B 5C3QA 5EP9A 3HQRA 4QB2A 2PHDA 3GBGA 3K4DA 4ITCA 2VY0A 3DPRA 3KT4A 3GBFA 1S0JA 5EZWA 3M70A 4A2UA 4IV3A 4LO4B 3WUDA 1EUTA 1V9U3 1COV1 4CU6A 4DUWA 1Z78A 2G9FA 2V5DA 3MUZ1 5DZGA 5IATA 3HN3A 4CXXA 5JOYA 1L3JA 3HNMA 5C33A 3BUCA 4CPBA 1X8EA 1AUYA 4N7UA 3RZLA 1E5HA 1ZA4A 4RQPB 1X9PA 4NO4A 2OX0A 4DUVA 2PFWA 3PMSA 4EWAA 1CIWA 3AXDA 3POBA 1SFPA 3HJRA 1TE1B 1F31A 3ACFA 3C7OA 1AR81 1W0OA 2ZMLA 1F4HA 5FJHA 5BV6A 2FMDA 2F17A 3FWEA 5B2GB 2VZVA 3NV4A 1AR91 4KG0A 4LO7A 4Q0UA 5FZDA 3RS6A 1XSRA 5IVJA 3D6EA 3D82A 3GDBA 5AC92 1DQ0A 1H8TB 4I0AA 3EHKA 3V65A 3E1F1 2VQAA 1YIPA 1TQ5A 2RS13 3OBAA 3RMYA 3UT0A 3VZJA 4B3NA 3WP6A 1DHKB 2J1UA 2VXJA 1RL3A 2BP6A 5FYZA 1RUG2 1JOBA 1BZWA 3V64A 1RUI3 1PVC1 1ZBE2 1LGCA 1OPMA 2HWD2 3I8TA 2FCVA 2VULA 3I2KA 3SH4A 1MZ5A 2XVKA 3LIHA 1KQRA 1QJX2 5IK4A 1QJY1 1A8MA 3MW4A 2C9AA 1W8UA 3T2PA 4DY5A 2WBKA 2EF6A 3AC0A 4DQAA 1VAMA 3DN7A 3ZSKA 2P3KA 2FMYA 2OW4A 5GLTA 3ZXAC 2AACA 4ORFA 2WQ8A 4XJAA 3RGBA 2ADEA 3U11A 1NKGA 3AP4A 2H0BA 3LOIA 4CU9A 2JXAA 5A32A 4AVCA 3BTXA 1RINA 2EXKA 2HWE3 1C1FA 1ND3C 4RGKA 2YXSA 3WG4A 2WWJA 4LJHA 5KR7A 1US2A 4OQ8A 1MACA 1A3KA 4O61A 1H6XA 3J9SA 4X6RB 2GN3A 4XUTA 2DVAA 1OD5A 4OLLA 3AZZA 3GBWA 3IDCB 3NL1A 1LU2A 4CDQC 2PHUA 3VV1A 2RS12 3FL7A 2GP3A 2XBO3 2CHHA 4FOVA 4YGCA 4N43B 1XNCA 1RUE3 3U4XA 1WLTA 1DU3D 5FYSA 2AEZA 5FZGA 3VBHB 1NLQA 2Y34A 2K9ZA 4CDXB 5KXDA 2EIBA 1XRUA 3TYJA 2ZXQA 1PNGA 3PHMA 2Y0OA 3MIHA 3CIHA 3ETPA 4H7LA 1NUKA 4XFAA 2XQRA 5CFCB 2WO7A 4XUNA 2Q8DA 4QKDA 3W21A 2DBIA 3MIBA 3OUJA 5JWPA 3NKGA 4CXYA 4L97A 5LY2A 1LOEA 3UGGA 1ZZ7A 1L7RA 5EJZB 1W99A 3DYOA 5J3UA 3A7QA 5M0TA 2BUKA 3MBWA 5DDJ3 4NIAA 1LOCA 2E6VA 3WDTA 4BK5A 2FZ1A 5JZGC 4IEQA 5DN2A 1ZRIA 1SMVA 1WCDJ 1YQCA 1QQP2 3KCXA 3R05A 5JI7A 4CCEA 4HK8A 2R071 2W9XA 3ZFGA 5ISLA 1OA2A 1NZIA 2XBO2 3NRUA 4RGGA 1ZRCA 2QCSB 4XFFA 4XQ4A 3KQRA 3VL8A 4B8EA 2ET1A 3TEWA 3KZ4C 1NCRA 2BVBA 2ETEA 3HNBM 1QDOA 5C8WA 5FYUA 2BPA2 4OHZA 1C5IA 1QXRA 1S0CA 4CDWC 1RUC1 4Q4W1 4UW5A 4YW5A 3USSA 4R9CA 1DIWA 2MHFA 4IGOA 2E31A 3AYAA 5FKCA 1O5UA 3WF3A 4YZ2A 1ZREA 4XURA 4HVQA 4JAAA 3E5XA 3AZXA 4LE3A 3RSJA 5L36A 2YFZA 1NXMA 4HLTA 1AL21 1YYNA 2BU9A 1OKQA 4GWMA 5JVVA 4OZXA 5C3OA 2DU0A 4P9XA 4ARYA 4V2VA 4BQ5A 2JWPA 2QVSB 4XYXA 4JGYB 3IIIA 5LA2A 1DQ5A 2BNMA 2XVGA 4BISA 1FOD2 5BNNB 1W03A 3O7OA 2IWGB 1J84A 3FE5A 4MX3A 5A3MA 4XF9A 4K9SA 3O0XA 3AJZA 4XAAA 3PNAA 1AR62 1HRV1 1JN2P 3FLRA 3URFA 4K3UA 3WNMA 4NWWA 4XE9A 2JENA 1LHVA 2RM23 4UT5A 1LHOA 2TBVA 5BNOB 1D4VB 2CWMA 4AGRA 5EV7A 2B42B 1DYOA 1JUHA 4QGMA 5FPUA 2W3JA 2G9ZA 5DG2A 1W05A 4L11A 2BV4A 2ZGUA 2XKOA 3POIA 2QQKA 3VKNA 5FPBA 2HKXA 2G9GA 4Q4V2 3VBSB 2RS53 1DDLA 2CAUA 4QDQA 1SDWA 2DBNA 3H1MA 4BQ2A 3D4KA 2PN5A 3PLQA 2ZJCA 1O3TA 1ULOA 1RC6A 3FZ3A 1EAH1 4ZPIA 4B1MA 3VD3A 2BQPA 2A71A 5LBEA 5FPXA 2XKPA 3GALA 4LTAA 4OHVA 4PQ9A 1DQ1A 4BB3A 4JDOA 3KSCA 3EJKA 3KF5A 4BK4A 3WHUA 4A3XA 2ZGNA 3LB9A 4EQVA 1GOGA 2Y60A 4GH4A 1K5MA 4BYYA 4AOCA 5I8TA 5A3UA 4XF1A 4YM1A 5JMOA 4AVBA 4LBJA 5EYYA 3DGTA 4JRAA 1JYIA 4HOOA 2A70A 4FTSA 3DCQA 4C1XA 1DGRA 1VMJA 2PYTA 1VBC1 2IXIA 1GYKA 2VTXJ 1AHSA 3AFGA 3BOWA 2GC0A 2HBTA 3Q8AA 4PDWB 4RN5A 4EN9B 2YGMA 4LEJA 5FWEA 1J59A 1OQEA 3AKQA 4RS5C 4AVAA 1LGBA 3Q9OA 1RUD2 5JXGA 2WQ4A 3N9QA 1IS6A 4K40A 5BYNA 1QXPA 1PGSA 1MEC1 3NW4A 1VBD3 3ES1A 5GZEA 2FDGA 3LEGA 1DF0A 1VBA1 4GQ7A 2LM3A 3TB0A 4HKWA 4DZGA 3WR0A 4CP0A 4KQ7A 5FYCA 1DQ2A 3FFQA 4XDPA 1UY4A 5T52A 3DYMA 5I93A 3A23A 4QAWA 2FZ2A 1UNBA 1R081 4FOQA 3WNLA 1H30A 4LOSA 5FZ4A 3NJXA 2C5DA 5BNPC 1JYVA 2A1XA 5FYTA 3KM5A 5HCHA 1V6OA 4PT6A 4AVSA 2NN8A 2VM9A 2ZGSA 3OPTA 5IK8A 2ZA9A 1T2XA 4META 2ZGMA 1N3OA 4ZS3A 4AEJA 4D3WA 1NXD1 3PTYA 4W8JA 1OLMA 3AMHA 2XOMA 1UYPA 1Q8OA 4UBGA 4CP2A 4LK6A 2TNFA 2JJ6A 4A3ZA 4UI9L 2Z5WA 5FOJB 1RUOA 4OHXA 1YWKA 5A7OA 1W6QA 4XXAA 4OUSA 3S6PA 1V9U1 5AFBA 2ZOEB 1RTVA 2QZ2A 4XIKA 5GKAC 3E6CC 4CVUA 1S2BA 2JIJA 2HWD1 1MVQA 2BOJA 3OEAA 4QPIA 1YQ2A 3ZXGA 3OD4A 4I3PA 5DPNA 5HBAA 1QJX1 1LB2A 1BKZA 1NX9A 2ENRA 2CSGA 2PAKA 2BGPA 3OD0A 3U4SA 3HAGA 1ASJ3 2QDRA 1FX5A 4WM7A 4GB33 1OMIA 4XPVA 4IV1A 4FPOB 5T5OA 3AZWA 2EIGA 4AXOA 4JHTA 1O4ZA 3P6BA 4O65A 2A6XA 5H9PA 1ND2A 2KA3A 1G86A 1ZRFA 1PK6A 3LDBA 5FYVA 2PLV3 5DUXA 4AYUA 5IFTA 4BU2A 2BBAA 4PCRA 1W28A 4NRMA 5F6LB 4COVA 1DYPA 3GJBA 5C8CC 2V73A 2CGNA 1X7NA 4IESA 2MEV3 3AFKA 1DZTA 3RVHA 4ASLA 2RS11 3WCRA 5K7PA 1G9DA 5HXMA 3ZXDA 4COWA 4YPJA 1F15A 4YFZA 3J7NA 2OKXA 4QPYA 3VBFC 4UFLA 1HRI3 1RUI1 2QDNA 2RDSA 1X33A 2XR4A 5IVFA 3V0BB 1RUNA 2XL9A 3POSA 1AJKA 3M4FA 4RQPA 4X6QB 2XPJA 1ZZ6A 1K3IA 1E57A 3I2HA 4PLNA 5LK5A 2WC2A 1ASJ2 2VU9A 2Y6KA 4H3WA 5IVEA 4L0PA 2E9QA 3O14A 4IE0A 3PUQA 3HMYA 4A4AA 1IKQA 1RHI3 4MXWB 4RR3C 3LE0A 4UBHA 5A1AA 1Y9GA 5B4XA 2CL2A 2KR2A 4D6SA 4MH0E 2W39A 3TAYA 4Z07A 1H8TA 3VDDC 2J42A 4YGEA 1GNHA 1QQP1 2XJSA 5F3CA 3PUIA 1C1LA 4YFWA 5ANNA 2OYZA 3IDBB 4LA3A 4JRLA 3VD5A 5CADA 2PAEA 3FBYA 2VZOA 2WT2A 1UZZA 2P17A 5FP8A 2XBO1 1PMHX 3WUCA 1LHWA 5BPXA 1UU4A 1WCUA 3WHTA 1C4RA 2Y0IA 3BPSA 1QU0A 2B46X 1GOHA 3O0VA 4XEZA 5C3RA 2GP5A 4EN7B 2Y26A 2E7QA 5CFDC 2ZKNA 1ODNA 4LMFA 2P5BA 3I59B 3KGLA 4WVWA 3ZYRA 2DUPA 5IVCA 1TNRA 4JGZC 3QOPA 4FPCA 1CONA 1A6CA 2FCTA 5A6QA 1W6MB 4YSFA 4AAPA 1POV3 1KJRA 4KNCA 1CESA 1I9RA 1S2KA 1AXZA 2XMLA 4WBBA 5C6CA 1HQLA 4ATFA 1RHI2 4NHYA 4QX5A 3ZR6A 5ACA3 4I01A 3WNXA 3I2FA 3SITA 2WUHA 1NE6A 4EZ4A 3GGLA 1C28A 1SLLA 2LROA 1FYUA 2Q1ZB 3H42B 4TSVA 5GJ6A 3D0JA 5H9SA 1UZWA 3U75A 3UV9A 4OHYA 1FV2A 1H1IA 3WW1A 2XG3A 1GZ9A 5FY7A 4GKYA 5E1RA 3RYPA 4Z1VA 4AHXA 4B1LA 2B4KA 5CG8A 1GKBA 1G9CA 2WYSA 1AR61 5HCAA 4N43A 3QLQA 2DFCA 2H6BA 2JDYA 4JDMA 2BJSA 1OBNA 3VBHA 3M3QA 3A22A 4E4ZA 5A6YA 2WNVB 2ZAAA 4CDXA 3VZNA 2CV6A 2V4VA 2VZSA 1W8NA 3M1HA 1COV2 3IDEA 4PIYA 3VBOC 4DFSA 5ABJC 1NCRC 2VOXA 3KCYA 2VUJA 3HT2A 1MS1A 3AJYA 3I2GA 5CFCA 2O0OA 1CAXB 2B9VA 4YVSB 1RUJ3 1Y9QA 1WZXA 2XJRA 5FZBA 4AI2A 2VUDA 1V6NA 1F8VA 3ACHA 4N8MA 5FO7B 2P4EA 4D7TA 2GDFA 3H9AA 5SV8A 5A1LA 5FZ9A 4ES9A 2GMEA 2A3XA 2NMOA 3OY8B 1X36A 3F2ZA 3GF6A 2DVFA 1AR82 4C90A 2J1EA 1UX6A 3LOBA 1SPPB 2TEPA 3VHNA 5I8YA 4FT8A 1AR92 2PHTA 5D1IA 4IE7A 3K4ZA 4AVTA 1Q56A 1JU4A 3HNYM 3KGZA 1D0GA 3ZN5A 1UO9A 1K5JA 3BKZA 3CZJA 1GWMA 4J6GA 4A6OA 4LKEA 2ZGOA 3ACLA 3VZMA 4JQRA 2FDHA 4N53B 2UYAA 2EXHA 4GJZA 2DDUA 4IEPA 4CCMA 4DEVA 1LR5A 3PIGA 3K77A 4CCKA 3AL5A 3NV1A 2NQYA 3AKSA 5I0SA 1PVC2 1PNFA 1IS4A 1KITA 4JKKA 5CU1A 5FZ6A 3WCSA 5EJ1B 2AH2A 3VZLA 4DOUA 5FUPA 2R32A 1DLLA 5DAXA 3CU7A 1QJY2 4D94A 4LULA 4EYUA 3W59A 3I3MA 5E89A 2RS51 2WL1A 4DEQA 3SH3A 3O0WA 4JDNA 1HB3A 4QX8A 4P5YA 3SHRA 1MPXA 1OFSA 1IS3A 2XJPA 5L9BA 5C71A 1ULGA 3NWKA 4JGYA 3POFA 3ZYPA 4QX0A 3RJRA 5A7SA 5BNNA 4BIFA 1RITA 4AI0A 1PMJX 4ASKA 3WY6A 1K45A 2WLQA 2ZCWA 3AYEA 4DS0A 1ENRA 3THPA 5FZ0A 1N47A 1GFF2 2VD7A 1XXNA 4KI5M 4JC1A 3I2JA 4LXLA 1HV0A 5T50A 4AGGA 1K5MC 3NNMA 2YDEA 2RS33 3F95A 3H7YA 1RB8G 4LBQB 3ACGA 2W46A 2ZEZA 3SC7X 2XLFA 1IPSA 4KGQA 5L9RA 4GIQA 3ZYHA 1LOFA 2R30A 5BNOA 4YG3A 1MS5A 4QX3A 3KQ4B 4UW6A 4KWKA 5HPOA 5HV4A 1X8MA 2D44A 3WVJA 3ZOIA 5GLVA 1QJEA 2R1BA 2PQQA 5SV5A 2W94A 2Q8CA 4P00B 3VBSA 3ZPOA 3ATGA 1D4M3 1VMFA 1DGRN 2VL4A 4IEXA 1Q8SA 3LFMA 4P9JA 4QD2A 4ZXKA 3S0MA 3DXTA 5DABA 4ATEA 3JCIA 1RUH2 3WP5A 1QGLA 1WMFA 2ZGQA 5I91A 1IZ3A 1UL9A 2PXJA 4GAZA 1UMIA 1GQGA 3LSDA 1QOOA 4IEOA 1FMD3 1OI6A 1RIRA 4IEUA 1SQ4A 1RJ7A 5GZGA 1OOPB 2ZEYA 1EV12 4ZS2A 4QX1A 2IXHA 2X53S 3ZVXA 5FYBA 4Z92B 4LA2A 4EN0A 4MGKE 2FDJA 2ZX3A 3H8OA 2R072 3AMMA 2W95A 1OFNA 3ZFFB 4Q4X2 4YW1A 5FZHA 3ZYBA 1POQA 1WW6A 2VOTA 3GYDA 3DYPA 1LODA 4AFBA 1RVF2 1UY2A 2D7FA 4PDWA 1H2NA 3NO8A 5DUVA 1POV0 3IAPA 3U37A 4P02B 3MV11 3SXWA 3POYA 2O1QA 4Q4W2 2WAOA 1S1AA 1RUF3 1US3A 2RDQA 3ZMOA 3ZMNA 4F3JA 4LKDA 3O1UA 2PHXA 2A6VA 4HG6B 1D4M2 4HXCA 4ES8A 3T4VA 2VNRA 3BU0A 3S57A 4A7YA 5HI0A 2DVGA 1Y3TA 3KLSA 5CKMA 4Y1VA 4FAHA 2VMHA 3S7EA 4R8HA 4AVVA 1YUDA 4NIIA 4Z2WA 4ARXA 4CE8A 1HJGA 2K2SA 1FMD2 3T30A 3G7DA 4LLOA 4XTPA 4E2SA 1QXJA 4RSUA 4ONUA 5I0UA 4OI4A 4QPIC 2ADDA 5H9RA 1BVVA 2WSVA 1JYWA 4GWNA 1ASJ1 1TEIA 1HRV2 1JODA 4GD4A 2WKKA 1GQPA 4IV1C 3AVSA 5F3EA 2DUQA 2PMWB 4FPEA 4KU7A 2YC4A 5AVAA 5CG9A 1PHMA 3ES4A 1XNBA 2H0VA 4OZOA 1HW5A 2BNNA 3POWA 4K8FA 3I3QA 1PK6C 1JZ4A 1ODMA 2EVXA 4IQPA 5T3NA 2Y6LA 4E8CA 1C8NA 1LRHA 3CEWA 1MS4A 1REFA 2P3YA 4H55A 2WNUC 5CZKA 3PDQA 4BCUA 2IFRA 4DMIA 2WA4A 3A0NA 1I1EA 2OA2A 5DZEA 3H8UA 3VKLA 1H2MA 2P3JA 2VMCA 2YYOA 1R1A3 1VAVA 1LU1A 1LKNA 2ZGKA 2GMMA 4QQOA 1O8PA 2RG4A 2Q0AA 4HT1T 2HWF3 2D6OX 2GN7A 2JE9A 3B93A 1HQWA 2GC3A 3FHQA 1PZ7A 3ON7A 4RQPC 2W5FA 5FP3A 5K0UB 2YBPA 1PGL1 3U0ZA 3KVBA 3A4UA 4ZHNA 2C9KA 3ORJA 1VBB3 3CJIB 1V6MA 1RHI1 2WNOA 3P3PA 1H9WA 4IGQA 1DLCA 3VDBA 4M3CB 1EYBA 1KGYA 1S0GA 1ST8A 2PHLA 2VE1A 1N1VA 1VBC2 4Q0PA 3ZPYA 3H7JA 4NHLA 2E63A 4UFKA 4M01A 2AYHA 2R043 5FFOC 2OQ6A 5J98B 4CUAA 2BOIA 3JQWA 5FK7A 3BI3A 2JG8B 3VHRA 3L2YA 5I0DA 1MEC2 3GM8A 4BWOA 1W9YA 2W2IA 5FREA 3VBRB 2WZ8A 1VBA2 4RFT0 4S2FA 5KXEA 3V0BA 1NG0A 2WR9A 5JOWA 3NKTA 5A3NA 4YW6A 3OGVA 1XQNA 5LZ6A 3QBQA 2UURA 4JTOA 4EZHA 1BVP1 4NWVA 4GWJA 4C0HA 4F83A 3O1SA 2V4AA 1OF3A 1R082 1GZCA 2HWB3 4ISQA 1POV1 3HPNA 2EALA 4AFAA 5C9AB 4MXWA 1NZCA 5FY0A 3SQOA 2RMU3 4QXHA 1V00A 2Y64A 5ACA1 1S0DA 5A1FA 2D97A 5AFEA 5F39A 4FSJA 4BOWA 4PLMA 4WM8B 2DFBA 4MXVA 5E16A 4CPBD 2J22A 2WQZC 5FJKA 3O1MA 4XJWA 2WRAA 1BK0A 4GXLA 1HXS3 2ARAA 4KH9A 4XXPA 4BMBA 1GMMA 1IQAA 1JHJA 3RYRA 2VXRA 1SEFA 1JH5A 5D2AA 4XJ9A 1DZQA 1OQ1A 3KT1A 1YJLA 4FPKA 1IG0A 3POGA 4AHZA 1I6XA 1ENSA 2GC1A 2ZZQA 4N9HA 1F4AA 4IW3A 1V9U2 2JX9A 2P6CA 2YU2A 3C7EA 4GMP3 4XJ8A 1RXGA 3RZZA 3I59A 3WF0A 1O4TA 4YVWB 2VMEA 5EXOA 1XE8A 5IVYA 4FPHA 4XILA 1W6MA 2C24A 2VO5A 1GZTA 4QB1A 5CFCC 3HVDA 2QQOA 3MICA 1X50A 3N7JA 1V70A 4URTA 1O7FA 1B35B 2PAMA 1WLCA 3PVBB 4KGGA 2QE3A 2FDKA 1MZFA 3Q8BA 1ULCA 5FY9A 3SEEA 2C6SA 5DG1A 5GLUA 2OPKA 3J7MA 2Y38A 2TUNA 1WUVA 2YMZA 2XVLA 4A44A 4AG4A 1CAUB 4H2AA 4K21A 3ILNA 4CYDA 3B7MA 4NN0A 2XHKA 3V56A 2VVDA 3VKFC 3JD73 3U10A 4S2HA 1UU6A 2WNVA 5JSPA 1U0AA 4FP3A 3RNSA 4AHYA 1MZ6A 2JKBA 5C4WB 3KD4A 4AEDB 4QKNA 2VC9A 4CCNA 2WA3A 4LK7A 4M4RA 1C8M3 2CDOA 3B01A 4PHZA 1MR5A 1RUI2 4WVZA 1CAXA 2BGCA 4ZONA 4YVSA 5LW9A 4JVAA 3FLTA 4AZZA 4NJ4A 3RZJA 4XQWA 5CAZA 1AVBA 1OLME 3ALQA 2JB4A 4E27A 3OY8A 5IAVA 3NAPC 1YO8A 1RUH1 1BMV1 4Y33A 1NQJA 1JS9A 5JSOA 2P2KA 4HSJA 2ZHLA 2WWSA 4XBNA 4EROA 5J36A 1SPPA 4Y22B 2X5IB 4JGYC 2HWE2 3BODA 3ZKYA 1Q3EA 1SCRA 1EV11 2PQSA 4W50A 5BNNC 4P9LA 3ZSJA 2FDIA 1ZZ8A 3VBUB 4XTMA 5KBFA 5L19A 4RD7A 5FUNA 1AYN3 2HEYF 3GHNA 1QNYA 5JOZA 3JD72 2DCKA 2RS31 4M0NA 4N53A 3MPBA 4LOTA 4Q4X1 4YM2A 5IYYA 4Y3OA 3BOPA 1NAEA 1MQTC 3DEMA 1RVF1 3J8F3 1RUE2 3FX3A 4GWIA 2XHNA 4OFGA 5FY8A 5BNOC 2QQPA 5FMOS 2DCJA 3JZVA 4AQ6A 3T0DA 2H6CA 4JV4A 4XUOA 2RHPA 4KL1A 5F9TA 5FY4A 4S2GA 3VGIA 1ND3B 1D4M1 1CPNA 5LWBA 1J3QA 3TEYA 4H14A 5FTTC 1BBT3 1CJDA 3T0AA 4AE2A 4HN0A 4QXBA 2CTVA 1CPMA 2WO3A 3B94A 3NNGA 5FBZA 2YY1A 2A7AA 3ZSMA 1FMD1 3I54A 4I09A 1S2EA 3OPWA 3GCXA 1SBFA 3HQXA 4FVVA 4XVHA 3O1RA 2OQ7A 4QKBA 1VR3A 1IHMA 1U5IA 3MLLA 1J58A 1UMZA 1CWPA 4LO5B 4TLGA 5FOBB 5FXXA 5E6HA 4EWDA 3I3BA 2JICA 4LBQA 3IM0A 5KXCA 2W1UA 2OVUA 2XGXA 3IBMA 1W8ZA 1XJAA 5FZOB 1PMIA 3T2QA 2I74A 4PIXA 4B29A 3EMRA 1UW8A 1Y4WA 4QMAA 3ZFEB 4URAA 3TWIA 5J48A 3WG3A 4HKLA 2VMDA 2XB6C 4PDWC 1GNZA 3IMNA 1C3HA 2D93A 2P37A 1GR3A 2IUWA 4IXLA 3T1LA 1PO13 4XZUG 3WSOA 3WNPA 4CUGA 4NUBA 2FBEA 4QB6A 3M3OA 1RUF1
chains in the Genus database with same CATH topology
1JS9A 3J7MA 3J7NA 3J7LA 4NIAA 1A34A 1STMA 1CWPA 4OQ8A 1YC61 1ZA7A 4OQ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JS9 A;  3J7M A;  3J7N A;  3J7L A;  4NIA A;  1A34 A;  1STM A;  1CWP A;  4OQ8 A;  1YC6 1;  1ZA7 A;  4OQ9 A; 
#chains in the Genus database with same CATH topology
 4FPL A;  1HV1 A;  1OVS A;  3RZM A;  1ZX5 A;  2RJ2 A;  4ZU7 A;  3NST A;  5JZG B;  1BK1 A;  4AW7 A;  3AB0 A;  1Q43 A;  4I2O A;  1BBT 2;  3RFR A;  4PBP A;  4O7X A;  1GLH A;  2JB8 A;  1OOP A;  4CRQ A;  5KHG A;  1DBN A;  1QNW A;  3CO2 A;  2ZX1 A;  3VDA A;  5BUV A;  1IQD C;  1WME A;  4FPY A;  3OYW B;  4Q1P A;  2XDV A;  1FV3 A;  2QUO A;  3WNO A;  5CEH A;  2OZ6 A;  4A7K A;  4UYB A;  3WIN E;  1OLR A;  1XB9 A;  1CX1 A;  3ZFF A;  1H1M A;  3RZG A;  2RR1 3;  1YFY A;  4ASM B;  1N3Q A;  1WW7 A;  3IWZ A;  1VRH 3;  3TOJ A;  1GUI A;  4YWA A;  1ACC A;  1LEC A;  1YQ5 A;  1EPZ A;  5DAV A;  4DUX A;  4OI0 A;  3I3D A;  1MS0 A;  2VQU A;  1VE0 A;  2HWC 3;  2BBV A;  2BW8 A;  4Q4Y 3;  3N4M A;  2RM2 2;  2I2S A;  2Q4S A;  3CLP A;  3ZYJ B;  3NJY A;  4BQY A;  4D7Y A;  5C5U A;  1PX4 A;  2Y6F A;  4PF5 A;  5JSR A;  3UJQ A;  3P5B A;  4XW3 A;  1WBL A;  1W6N B;  2XLG A;  2W08 A;  5L7O B;  2C0Z A;  2R1D A;  3E6B A;  1J3P A;  2P6H A;  2RS5 2;  3W58 A;  2QQN A;  4FI9 A;  1CIY A;  4NHK A;  4C91 A;  2GNT A;  2GND A;  3PVO A;  1R1A 1;  1G8W A;  3HQU A;  3JXS A;  2P1B A;  4OCT A;  2IC1 A;  3M8L A;  5JOX A;  2Z4F A;  4D8M A;  2R06 3;  4XBL A;  2WZR 3;  4XC9 A;  2HWF 1;  5DDJ 1;  4AQ2 A;  4AR2 A;  4YZ5 A;  2DVD A;  3M3I A;  3CF6 E;  4XJZ A;  3KHC A;  3OPZ A;  4FQ4 A;  4FQZ A;  2Q8E A;  2VW1 A;  2RDR A;  2GSY A;  3MID A;  2JDZ A;  1DZR A;  1S0I A;  2VEC A;  2A6W A;  2ATF A;  1AX1 A;  4LT5 A;  2NPI A;  3R4S A;  2ARB A;  2VBD A;  3OBR A;  1LES A;  4CU7 A;  1UY1 A;  3OGG A;  1RMU 3;  2R49 A;  1O5L A;  2JEC A;  5FMO L;  4XOG A;  1X82 A;  5C70 A;  1XSQ A;  1LEM A;  2D3R A;  2E7T A;  3EO6 A;  3DKW A;  5GZC A;  2GMP A;  5HXV A;  3AVR A;  4AQT A;  4QPW A;  3PU3 A;  1J83 A;  2VQT A;  2WNE A;  2ZAC A;  4FXG B;  2I45 A;  3WF1 A;  4QDR A;  1R09 3;  1VBD 2;  3DPR C;  5F8P A;  5GM0 A;  1W8W A;  1D2Q A;  4R4Z A;  4UFM A;  2WWU A;  1BHG A;  1DGL A;  1YRZ A;  1QOS A;  1ULE A;  2ZHM A;  4IV3 C;  5ANQ A;  3T09 A;  4R9D A;  2EIC A;  2G4I A;  1LED A;  4K1Y A;  5FIX A;  2XUM A;  2D6P A;  5K0U A;  5CB7 A;  4TWT A;  1ZBA 3;  1AF9 A;  1OHF A;  3ZYG A;  5JR2 A;  3VUO A;  2RV9 A;  2Z79 A;  1E5I A;  4V2W A;  3WG2 A;  5APA A;  1IPJ A;  4R9A A;  1SLT A;  3BU7 A;  3CJI A;  2BVV A;  3MFA A;  2A6Z A;  2AZ5 A;  4RS5 B;  5D8A B;  1O6U A;  3FN9 A;  1UXX X;  2GAL A;  4M3C A;  3D5O A;  5A33 B;  3N35 A;  1HKD A;  1W3X A;  3FUO A;  3OOX A;  1UKG A;  1QH7 A;  1LGN A;  5A7Q A;  2YBK A;  4CCJ A;  4YZ1 A;  4BQX A;  2ERF A;  1XU2 A;  1NE4 A;  5J96 B;  3ZSE A;  1WMD A;  2D6L X;  2VH9 A;  4RFR B;  2JG8 A;  1IGO A;  5E88 A;  3TNQ A;  1FXZ A;  4LBK A;  4N7I A;  1GBG A;  3ILR A;  5FZ7 A;  3PTR B;  2IZW A;  1NLS A;  2PTM A;  2ZZJ A;  3C2U A;  2VMF A;  3KF3 A;  3VBR A;  1EP0 A;  4JCK A;  4D69 A;  5KXB A;  5I8S A;  5LA1 A;  3VD9 A;  2J7M A;  1FPN 3;  3H0O A;  1WA6 X;  3N9N A;  3IT8 A;  4YLZ A;  2Z69 A;  4P9W A;  2RDN A;  1UCX A;  1QJF A;  1Z7S 3;  4E4S A;  4K8R B;  3MHZ A;  3AKR A;  5EPA A;  4DXT A;  5C9A A;  1CAV B;  3THC A;  4BPZ A;  4GB3 2;  4Q0S A;  4WM8 A;  4P9G A;  1YFW A;  5F5Q A;  3HBK A;  5FPV A;  1NCQ B;  1K12 A;  3SMH A;  1JOJ A;  3LKJ A;  4BH9 A;  2HWE 1;  4QPG B;  2PLV 2;  1W9S A;  3OG2 A;  4FFH A;  3BAL A;  4LKF A;  5FZK A;  1YLL A;  4TXW A;  2WIN B;  2ZAB A;  4CDU B;  1D0H A;  5KHJ A;  2V09 A;  1AR7 3;  3RDI A;  3ZN6 B;  3T3Y A;  3JD7 1;  5A6Z A;  4QHB A;  2MEV 2;  4COU A;  1B09 A;  4XJU A;  1FI2 A;  1XNK A;  4O9E A;  2WS9 3;  2B7Y A;  4P9I A;  1QJU 3;  3UYJ A;  1RUE 1;  4YVW A;  1Q8P A;  4WVV A;  2JIG A;  5HCF A;  3MF6 A;  4GZ9 A;  1HRI 2;  3TN9 3;  1TME 3;  1WWY A;  3MV0 1;  4YVS C;  1KXG A;  3K46 A;  3ZO0 B;  4YGD A;  1JYT A;  3AYC A;  4RHV 3;  4MAD A;  2ORZ A;  2XL7 A;  2JDK A;  2KM2 A;  3KS7 A;  1B35 A;  2VQ0 A;  2VTX A;  4QXK A;  4QHZ A;  2VZQ A;  2ZAH A;  1PGL 2;  3UET A;  3B5L B;  4W4Z A;  5C8C B;  4FPF A;  2Y6J A;  3KV5 A;  3POJ A;  2QQW A;  3WF2 A;  2XXZ A;  3RG0 A;  3UK9 A;  5IFP A;  2W87 A;  5EYX A;  1CAU A;  4LBL A;  5DAW A;  2JDN A;  2XQX A;  2FD8 A;  5A7N A;  5FV3 A;  2EID A;  5T5P A;  1CZS A;  3GZT B;  5A6X A;  3AX4 A;  4HFS A;  3CBN A;  4N9I A;  5C4W A;  2HYK A;  2QQL A;  2SBA A;  2CGO A;  3FBM A;  5FY1 A;  5LBF A;  4AED A;  4AFD A;  4DXR A;  3B00 A;  3EXU A;  3WDU A;  3ZFG C;  4NID A;  5LEJ A;  4AHW A;  5IVV A;  1W6P B;  1JHN A;  2LTN A;  4B4P A;  3KV4 A;  3ILF A;  3C7H A;  3S30 A;  5IAX A;  4A7Z A;  5F3G A;  3LCP A;  4CU8 A;  1LNS A;  4RR3 B;  5FCC A;  1GZW B;  4Q29 A;  3H1W A;  4PI2 A;  2JEM A;  5CKQ A;  2VZU A;  1KS4 A;  4YM3 A;  5AVP A;  1O59 A;  2W0X A;  2LAL A;  2VJX A;  4AWD A;  4BHP A;  5F5I A;  3VDD B;  4MHR A;  2XON A;  1BBT 1;  5FPL A;  2B9U A;  2AUY A;  1JZ7 A;  4OYU A;  1AX0 A;  4Y22 A;  2X5I A;  5ACA 2;  4OI1 A;  4B7K A;  2GH8 A;  1ZA7 A;  4PJY A;  5LCW L;  3VBU A;  1UWW A;  4D6Q A;  4QGL A;  3ZR5 A;  1XNT A;  5A3T A;  3DUI A;  1LHN A;  4B4Q A;  5FK8 A;  1I3H A;  3APB A;  5CFD B;  2NP0 A;  2WT1 A;  1QH6 A;  4R52 A;  2WAB A;  3U07 A;  1RJ8 A;  2VCM A;  4JGZ B;  3J7L A;  4Y5S A;  2J1R A;  2NYY A;  4LE4 A;  3WNN A;  1NA1 B;  4BA6 A;  3O1P A;  1N3P A;  3OF1 A;  4XF3 A;  3K3N A;  3ROU A;  5CKN A;  2D6N A;  1ZZC A;  2RM2 1;  4AI9 A;  3O1T A;  1PGW 2;  5EJ3 A;  3VBF B;  4YZ3 A;  4XIO A;  2ARC A;  3GCW A;  5FQ0 B;  1ND3 A;  2D40 A;  1VRB A;  3MUY 1;  1DCS A;  3THD A;  4IEY A;  4LNV A;  1RUJ 2;  4MUV A;  4PQQ A;  4BXF A;  1MS3 A;  1GV9 A;  2ZMK A;  1EUU A;  1W2O A;  3CL1 A;  2JG9 B;  1GNY A;  5FP9 A;  4AI3 A;  4BM8 A;  3PJQ A;  2VOV A;  4QX2 A;  5FZL A;  1R64 A;  4I30 A;  2F4P A;  1OA4 A;  1WCQ A;  1IOA A;  4GJY A;  5FMD A;  4P14 A;  1QF3 A;  2MPF A;  3FMG A;  3N9O A;  4ZY9 A;  2ZPX A;  3AMQ A;  1JYX A;  4CEW B;  2ORX A;  4HON A;  1H2K A;  5ABJ B;  1MVE A;  3VBO B;  1UN1 A;  2VZR A;  3Q8C A;  2ZEW A;  3L2H A;  2R0F A;  4U36 A;  5J09 A;  2Z42 A;  5FZO A;  2RR1 1;  4XHX A;  4GH4 C;  4HSL A;  2J1T A;  3CZU A;  5FP4 A;  3ZFF C;  2SLI A;  3DXU A;  3PUA A;  3C3V A;  3U78 A;  1CAW B;  3ZFE A;  4A42 A;  4CEY C;  2ZMN A;  1W04 A;  4Z8B A;  3O1V A;  5IUQ A;  1RXF A;  4IE6 A;  4Q4Y 1;  1JW6 A;  4YRD A;  5H9Q A;  5K9Y A;  1VBE 3;  4QXC A;  1YCI A;  3Q8F A;  2XJT A;  3BTZ A;  1CZV A;  1GAN A;  1SBE A;  2RJK A;  5JZG A;  1CD3 G;  1FNZ A;  4GUL A;  3HD8 B;  5JPN B;  1XBF A;  2F4L A;  2WJS A;  2E51 A;  4F7Z A;  2LRP A;  1YIF A;  1LAJ A;  1VBD 1;  3WD5 A;  2YUE A;  3OGR A;  3K51 A;  2Y6G A;  1BMV 2;  1K42 A;  1WD4 A;  2OII A;  4D0Q A;  3GZU C;  4LHK A;  3W20 A;  3ME2 A;  3JB8 A;  2VNG A;  1PO2 3;  2ZGP A;  4OMC A;  3OYW A;  1KD7 A;  1VPH A;  4Y1U A;  1O4Y A;  2A5Z A;  3B02 A;  3WLU A;  1PM4 A;  2QQM A;  1SZB A;  2WZR 1;  1DGW X;  2D5H A;  2IXC A;  1KDK A;  1ENX A;  1RUC 3;  4LUK A;  1H1A A;  2UY9 A;  3LIG A;  1SLC A;  2VW0 A;  5FO9 B;  3VHP A;  2RS3 2;  5FXZ A;  3VDC A;  4XFI A;  1AYM 3;  2ZHN A;  1PIV 3;  4LO6 B;  3K3O A;  1DFQ A;  4R4X A;  2R0H A;  2D3S A;  1AL2 3;  2GNB A;  4BQ1 A;  1W90 A;  3BB6 A;  2FDF A;  1V6I A;  2DU1 A;  4MGI E;  1W6N A;  5L7O A;  1H4G A;  4NRO A;  2GC2 A;  1VAK A;  4XZP A;  1H2L A;  1DQ6 A;  1LOA A;  1QDC A;  4NRP A;  3QCW A;  2JD4 A;  3H1Y A;  3ETQ A;  3BPZ A;  5JXI A;  1W3V A;  1UX7 A;  2FHR A;  2JDU A;  2YZ4 A;  5FKB A;  5GLZ A;  4C0B A;  1PO2 2;  4B4R A;  4S2D A;  4AK3 A;  4HL0 A;  4Q5O A;  4LQR A;  4MLO A;  4WVM B;  2UY8 A;  3T2T A;  2A3Y A;  2RE9 A;  2YG0 A;  4M0H A;  3I4I A;  4M4P A;  2N7G A;  1NOV A;  1ZBA 1;  3DEC A;  3GJA A;  3LD8 A;  1BQP A;  4UFJ A;  3U1X A;  5L9V A;  2VCC A;  2WN3 A;  2W52 A;  4IGP A;  1V6K A;  4NIH A;  1C57 A;  4MGZ E;  2Q30 A;  3T08 A;  2AR6 A;  2I07 B;  4GB3 1;  2ILM A;  4IEW A;  3CJI C;  1LHU A;  3VHO A;  1M4W A;  4WM7 C;  5FXV A;  4V1P A;  1T6B X;  4CP9 B;  4K20 A;  1BYH A;  5FZE A;  3W9A A;  1MZE A;  4BE3 A;  5BNQ A;  1NYW A;  3K75 B;  4NVP A;  1JZ2 A;  2VMI A;  5KHH A;  1JYN A;  3NNF A;  1ZVF A;  2PLV 1;  1ND2 C;  2CY6 A;  2QKD A;  1W2T A;  1OH4 A;  5FPA A;  3DKQ A;  1RUF 2;  2W1S A;  4MYE A;  3WQ1 A;  2JG8 C;  4L2N A;  4AAX A;  3JBG 3;  4OMD A;  4MGQ A;  1BEV 3;  1J1L A;  2MEV 1;  4DRV A;  3RZK A;  2VZT A;  1QWR A;  2BGO A;  2HH9 A;  1IPK A;  1WW5 A;  5LEK A;  1EY2 A;  3PU8 A;  1FPN 1;  5FYY A;  4EJR A;  3POE A;  1UD1 A;  3S5Q A;  1HRI 1;  1JXN A;  1BXH A;  3EYP A;  3BIW E;  3CNA A;  4TLF A;  4HKO A;  2GNM A;  4I0W B;  4NPR A;  1OT5 A;  1GP4 A;  1J1T A;  2L9L A;  3QAC A;  4KBB A;  2UWC A;  5BXX A;  4BDV B;  3VLB B;  4RS5 A;  5D8A A;  5FPZ A;  3KB5 A;  2IXL A;  2YV8 A;  5GLW A;  4EWE A;  3LA7 A;  5C9A C;  5A33 A;  4NHX A;  3JQX A;  3LAG A;  2K46 A;  3I97 A;  2B8M A;  4MO3 M;  4WM8 C;  2YPJ A;  2XJQ A;  3IZO A;  4TN7 A;  4HAN A;  1OD3 A;  4DXS A;  4IER A;  1JZ6 A;  4W65 A;  4NAM A;  2DWR A;  4E2Q A;  3MFC A;  1MS8 A;  4NRQ A;  4O9G A;  1OH3 A;  4XF0 A;  1AR7 1;  1H8T C;  1UPS A;  1GU3 A;  3LSE A;  3CKH A;  1ZRR A;  1ZNP A;  3AP6 A;  5FZ3 A;  2V72 A;  3P1I A;  4MG2 A;  1UYY A;  3MYX A;  3WOG A;  3IB3 A;  4NIG A;  4HMZ A;  4XMA A;  2WS9 1;  1STM A;  3GHM A;  4AF9 A;  1DGW A;  2OS2 A;  1JOP A;  1ZM1 A;  1YC6 1;  3BYW A;  1V6L A;  2YU1 A;  4RL7 A;  4CCL A;  4Y4R A;  1SFN A;  5FAX A;  1OXC A;  1R1A 2;  1UY3 A;  3UJO A;  5DAP A;  1FAY A;  4E4H A;  2R7E B;  3O1O A;  3GNE A;  4FFG A;  2DCZ A;  2HWF 2;  1CAV A;  2HJI A;  2UWA A;  2VGD A;  3H3U A;  5DDJ 2;  4HVR A;  4MHU A;  3A21 A;  5F7U A;  4Y1Y A;  3BIE A;  1AX2 A;  1B35 C;  4DRR A;  5AC9 3;  4CCO A;  1JBC A;  1FT9 A;  1SDD B;  1XU1 A;  4N90 A;  5FBJ A;  4BQ3 A;  1NCQ A;  1VBB 2;  1ZYB A;  3BVC A;  4DO0 A;  2WNU B;  1VMH A;  4DY3 A;  1W9W A;  3D3A A;  3NV2 A;  4QPG A;  3OGS A;  1WLD A;  1ZRD A;  3BTA A;  3LDR A;  1GQH A;  4LPL A;  5K4L A;  5IVB A;  3LEK A;  4FAG A;  4CDU A;  1PZ9 A;  3VN4 A;  4LKS A;  3I7D A;  3SLI A;  2W68 A;  1RUG 3;  1GSL A;  1YHF A;  2R04 2;  3ZN6 A;  4Y20 B;  1ZBE 3;  2HWD 3;  2ZBJ A;  4J25 A;  1HN1 A;  2GH2 A;  1TMF 3;  1SAC A;  2CGP A;  3NJZ A;  4BIO A;  4UFH A;  3H8R A;  3AYD A;  1LOG A;  4JKL A;  1LOB A;  1QJX 3;  5C4W C;  1O8S A;  3R4U A;  1UYZ A;  2VZ3 A;  3ZDV A;  4AED C;  2FCU A;  4N43 C;  2JDA A;  4XFG A;  3RPQ A;  3CJX A;  3VBH C;  2R16 A;  1OUX A;  2QZ3 A;  3DV8 A;  3B69 A;  4HBN A;  2VZP A;  4KBZ A;  1KJL A;  3JU9 A;  4Y24 A;  3RI9 A;  1PGW 1;  3UL2 A;  4XMI A;  4Q8K A;  1S0B A;  1RED A;  1RGS A;  2HEW F;  2YHJ A;  1QJZ A;  1DP0 A;  1W39 A;  3PUR A;  1RUJ 1;  5DUW A;  2HWB 2;  3ZXL A;  3D8C A;  4QQ2 A;  5FXW A;  1Y9M A;  1YXW A;  2D5F A;  5C8C A;  2DV9 A;  3KV6 A;  3NNL A;  3OSD A;  4JKM A;  2J1S A;  3ECQ A;  2RMU 2;  4F8A A;  1OA3 A;  1F2N A;  1WBF A;  1OUR A;  4U2A A;  1W8F A;  3S5A A;  1R1Z A;  1WCK A;  3T2O A;  5J1X A;  4OVE A;  2X5I C;  4UWD A;  1VIW B;  2J1A A;  4XCA A;  5CYY A;  4SLI A;  1GP5 A;  2ZX4 A;  5JXJ A;  3W5M A;  5LBC A;  3VBU C;  1G7Y A;  1UIK A;  1HXS 2;  4GA9 A;  2VBB A;  2NLR A;  4OUL A;  2YGL A;  4Q8L A;  1L7Q A;  1NQD A;  5IW0 A;  3WF4 A;  3KV9 A;  1TMF 2;  1KFU L;  3MPP G;  5FZM A;  3LEM A;  2ID4 A;  4FFF A;  4YW3 A;  1W6P A;  3MDP A;  2D6K A;  4QT6 A;  3AXE A;  2B45 X;  5LRR A;  5FYM A;  3GZA A;  4DXZ A;  1HB2 A;  1HX6 A;  1CGP A;  4RR3 A;  1H9P A;  4AL9 A;  1GZW A;  3IAQ A;  4QDS A;  4A41 A;  1YFX A;  4LBO A;  1TNF A;  3ZM8 A;  4PF1 A;  4YGB A;  3VDD A;  5KHI A;  3KVA A;  4XDO A;  5FZC A;  1AZD A;  1SBD A;  1JZ5 A;  2VBP A;  3HOB A;  5BY5 A;  2LW8 A;  1QQP 3;  1UZV A;  4FPJ A;  2BEO A;  4QGN A;  2JDH A;  5JAX A;  4LIV A;  1Y7B A;  1YJK A;  3JB4 C;  3AL6 A;  2IVJ A;  2YB7 A;  4Y5Z 0;  1HDK A;  1JU3 A;  4Q0Q A;  3ZLI A;  3VD4 A;  3SCG A;  5CFD A;  5CIR A;  4PLO A;  2VG9 A;  1OC1 A;  2E26 A;  3MO4 A;  5JDB A;  4JGZ A;  5G05 L;  4Y1Z A;  1F5F A;  4UF0 B;  4X8P A;  1UKR A;  1NA1 A;  2YRO A;  5DZF A;  5JPM B;  4W6W A;  1VJ2 A;  5FR3 A;  4FFI A;  4FXK B;  3ZFE C;  3IKW A;  3RI8 A;  1T6G C;  3NQH A;  3VBF A;  4TZD A;  1U5X A;  5LAT A;  1VBE 1;  4M3C E;  3H50 A;  3WQB A;  1C8M 2;  1LOF C;  3LPG A;  5FQ0 A;  1XYN A;  4FO9 A;  5KC6 A;  1A78 A;  2IXK A;  4B7E A;  3CDZ B;  4OI2 A;  5KHK A;  4NR1 A;  4UXA A;  2A75 A;  1WMX A;  2NMN A;  3RWK X;  2JG9 A;  3ELN A;  1F9K A;  1FOD 3;  2D43 A;  2Q1F A;  2WLP A;  3VBS C;  3IDA A;  4RA0 A;  1C5H A;  3NJV A;  1UYX A;  3ZXK A;  5T54 A;  4IEZ A;  3T4H B;  3WEZ A;  1AR6 3;  4CDQ B;  1PO2 1;  1I5P A;  1YEW A;  4CUB A;  3OEB A;  4KWJ A;  3VZO A;  3NV3 A;  4Q2F A;  4CEW A;  3WV6 A;  3VBO A;  5ABJ A;  4CCD A;  4FCA A;  2BDR A;  1QY4 A;  1E5R A;  3NVC A;  3OUI A;  2B39 A;  5ERL A;  1CN1 A;  5C3P A;  1QEX A;  5GZD A;  3NMB A;  3LEI A;  4UFI A;  1AYN 2;  4YNI A;  1CAW A;  1QKQ A;  1NY7 1;  1PX3 A;  2QJV A;  4DPN A;  3BCW A;  2NM1 A;  1AYM 1;  3MW3 A;  1PIV 1;  4JX0 A;  4Q4V 3;  3VD7 A;  2Y33 A;  2XLA A;  1Y43 B;  3RMX A;  3J8F 2;  4CP1 A;  1W6O B;  3PME A;  1AJO A;  3NAP B;  4UAP A;  4JQT A;  1XND A;  5A3W A;  3HN1 A;  4WZF A;  3L9J T;  3V0A B;  1GOF A;  1SG3 A;  2PHF A;  3AZY A;  4LBQ D;  4YW7 A;  5JUV A;  4Q26 A;  5B4N A;  5L7O C;  3I2O A;  4LUM A;  4CUC A;  1UF2 C;  3J4U H;  3E6D A;  4NMI A;  1J3R A;  5CNA A;  1VAL A;  1V0A A;  3O5S A;  3OBZ A;  1G9F A;  2OXB A;  1SFY A;  2CAV A;  4LO8 A;  4IE4 A;  1GIC A;  4G4F A;  4ZU4 A;  3ZX7 A;  2ARX A;  4H7M A;  2W1Q A;  3HEI A;  5A80 A;  1F5J A;  2VCA A;  4KMQ A;  5A3O A;  5FDB A;  1O91 A;  3J26 N;  1MQT B;  1JYC A;  4MGS A;  3PJY A;  1YQ8 A;  2ZGL A;  3UES A;  5F1R A;  2YC2 A;  1XYP A;  4GMP 0;  4M3C F;  5C7G A;  5GZF A;  4CDW B;  1OSG A;  4IDZ A;  1YQ6 A;  1RUD 3;  2VAU A;  3E5Q A;  3DF0 A;  4JZR A;  5J7M A;  2QQV A;  1IS5 A;  1YI7 A;  2YBS A;  4MGY E;  4ZKT B;  1SLA A;  2VUC A;  1PO1 2;  3MLJ A;  5L73 A;  4HPK B;  2X29 A;  5FZA A;  3TRS B;  3EQE A;  2W91 A;  1LEN A;  4AEK A;  2XUE A;  4HZF A;  4QQL A;  1YI9 A;  1HQN A;  3JBG 1;  1W8T A;  4NOT A;  1BEV 1;  2ET7 A;  4QM9 A;  3R6S A;  3OBT A;  4YW4 A;  5LY1 A;  1TG7 A;  5EHD A;  3ZKU A;  3AP9 A;  4LBN A;  1U5Y A;  2BNO A;  4A45 A;  3UGH A;  3WW4 A;  1GWL A;  3LWC A;  1KDM A;  4WVM A;  3ZIX A;  2XWJ B;  2GAU A;  4WZC A;  4OQ9 A;  4MZU A;  2ZX2 A;  3AK0 A;  4XQD A;  2AEY A;  2DUO A;  1DQ4 A;  3B3Q E;  3IPV B;  4LHS A;  4YZ4 A;  3UKT A;  4BXS V;  4AGV A;  1BCX A;  2VTF A;  5FRA A;  5JIA A;  3N7K A;  2RVA A;  5G04 L;  4XFB A;  3Q8E A;  3RYK A;  2PHR A;  4XHB A;  3WQ7 A;  5EWS A;  5D8A C;  2RR1 2;  2E33 A;  4CP9 A;  2VNV A;  1IG3 A;  3ZIW A;  4IUG A;  1VRH 2;  4W6X A;  5FYH A;  1VBB 1;  1H8V A;  5A3P A;  2GZW A;  3LA3 A;  4EE2 A;  5IK7 A;  1D2S A;  2HWC 2;  3RJ2 X;  2XJV A;  2VR4 A;  4I0B A;  4Q4Y 2;  2EXJ A;  4GKX A;  1ZZ9 A;  1Q8Q A;  2O8Q A;  4D6R A;  3FLP A;  4QU2 A;  2R04 1;  3AMP A;  1KEX A;  2X10 A;  2MNG A;  4QQH A;  4NPL A;  3CMG A;  5FZ8 A;  3KCC A;  4QQP A;  5IJR A;  3WDV A;  3RRD A;  1N1T A;  4HK9 A;  2KXL A;  4LIT A;  3WT3 A;  1HB4 A;  2OPW A;  3LFI A;  2X05 A;  3RWN A;  4A6S A;  2DYC A;  4Q0V A;  5K8S A;  2ZS6 B;  5FUI A;  3PL0 A;  5A7W B;  1QOT A;  2QQJ A;  3PUH A;  3PVE A;  2R06 2;  4DIQ A;  2WZR 2;  4MGT A;  4CEY B;  2DTW A;  1UU5 A;  2HWB 1;  2UYB A;  1LJ7 A;  2VW2 A;  2OZJ A;  2WII B;  1X9T A;  3CQO A;  5F2S A;  5HCB A;  4DNY A;  5AC9 1;  5FY5 A;  1A34 A;  2CDP A;  2RMU 1;  1FAT A;  2WSU A;  3ENR A;  3HWJ A;  4I3G A;  1NCQ C;  1HN0 A;  1RMU 2;  3I3E A;  2JKX A;  3QD6 A;  3ITQ A;  5FZI A;  4QPG C;  1G9B A;  1S0F A;  2ES3 A;  1EPW A;  4NE9 A;  5CIS A;  1HXS 1;  1RUG 1;  4CDU C;  2GU9 A;  3N9P A;  1ZBE 1;  1S4C A;  4MOA A;  5FO8 B;  2A3W A;  1TMF 1;  3ZN4 A;  1ENQ A;  2CYF A;  2FQP A;  4CCC A;  1R09 2;  4CDX C;  2CWS A;  3AP7 A;  1UOJ A;  1YFU A;  4CTE A;  3AKP A;  4CXW A;  2AC1 A;  1SLB A;  3S7I A;  1KS5 A;  5JXH A;  3JUU A;  4GMP 1;  5BNP B;  4YG0 A;  2ZX0 A;  1ULD A;  4IEV A;  1CQ9 A;  2PEL A;  4TYS A;  2BRT A;  2BWA A;  3WQ0 A;  3OCP A;  4XET A;  1REE A;  2E32 A;  1ZBA 2;  1SLI A;  4UOJ A;  3USU B;  5CVR A;  3WP3 A;  1LUL A;  1L7L A;  2YC0 A;  2XWB B;  2E53 A;  2UU8 A;  4QM8 A;  1XNA A;  2WNU A;  4FTE A;  3EB7 A;  1TZO A;  2G1M A;  5KWR A;  3OGJ A;  2DTY A;  4KWL A;  4NAO A;  1VB4 A;  3AZV A;  3DPR B;  3FJS A;  5KC5 A;  3I49 A;  5F2W A;  4MVT A;  4Y20 A;  5DQ0 A;  1XE7 A;  2HEV F;  2LUW A;  4IV3 B;  3UGF A;  3UNP A;  4LHN A;  5TSW A;  2WFF 3;  1UQX A;  1W9F A;  2QQU A;  3H3Z A;  4UW4 A;  2ZKL A;  3MIF A;  4NPM A;  5F3I A;  2ZGT A;  4BME A;  2JE7 A;  3X29 B;  4R9B A;  4FOW A;  4K7J A;  3WDW A;  2IVI B;  3I2D A;  5E8A A;  3ZXJ A;  2WNV C;  1NLR A;  1WGP A;  3AMN A;  4XDQ A;  4BZ4 A;  4E9K A;  4IND A;  1FPN 2;  5FYI A;  3TNP B;  4Y5T A;  1C8M 1;  1AXY A;  2B5H A;  3WG1 A;  4TTG A;  1W0P A;  4KG8 A;  2WO1 A;  3SCH A;  2ZEX A;  1Z7S 2;  2IXJ A;  3OJB A;  3WX5 A;  2C26 A;  3BGA A;  2UWB A;  2WO2 A;  4GAL A;  4LR4 A;  3AP5 A;  2QQI A;  3WNK A;  1N1Y A;  5T5J A;  4HN1 A;  3M3E A;  2YPD A;  2BFU S;  5F32 A;  1QHD A;  4L9B A;  5FMB A;  3FFZ A;  3GXU A;  3WP4 A;  2JD9 A;  3AKT A;  2WZP P;  1COV 3;  3N9M A;  2WFF 2;  3IN9 A;  1W8O A;  1AR7 2;  1AYN 1;  3FHI B;  4YYO A;  1Q8V A;  1N1S A;  3QH6 A;  4E4D X;  2ARE A;  4J1X A;  5DMY A;  3WW3 A;  4Y1X A;  3TEZ A;  4OHW A;  2EAK A;  3C7G A;  4N53 C;  1NA1 C;  3EBR A;  5LAS A;  2BTV C;  2D98 A;  4AI1 A;  2WS9 2;  3J8F 1;  3VKO A;  1QJU 2;  1U12 A;  3ZDS A;  1O3Q A;  4YM0 A;  1OUS A;  2DCY A;  4AEM A;  2WT0 A;  1XC6 A;  2NZ9 A;  3IMM A;  4W6Y A;  3TN9 2;  4PIZ A;  3B9C A;  1U5Z A;  1TME 2;  4HVO A;  2G19 A;  4L99 A;  3SNM A;  3TBD A;  1AR8 3;  3ZXF A;  3INA A;  5CBL A;  1PVX A;  2CNA A;  3VB9 A;  3LF7 A;  4LIU A;  4KWU A;  5A32 B;  3HT1 A;  4RHV 2;  1FOD 1;  2W47 A;  2EAA A;  2ZTN A;  3J7H A;  1AR9 3;  2JG9 C;  2HBU A;  1GP6 A;  1URX A;  4OUM A;  2HLE A;  3N7M A;  4YG6 A;  1UZ0 A;  4PI0 A;  3WDY A;  1UMH A;  1W2N A;  1UXZ A;  1H4H A;  1RYY A;  1CVN A;  3VZK A;  1XE0 A;  5CA6 A;  2ZGR A;  5JMC A;  5FZF A;  4CEW C;  4WV8 A;  3GZE A;  3THT A;  1DG6 A;  1PVC 3;  3H3L A;  4UF0 A;  5C3S A;  2JE8 A;  5JLV A;  5D21 A;  5DUU A;  5LA0 A;  5FZ1 A;  2R6Q A;  1I5Z A;  1QJY 3;  4ZXE A;  4Q4V 1;  4HET A;  4C8D A;  3UKV A;  2O8O A;  3OUH A;  2BWC A;  2DUR A;  5LBB A;  4PBO A;  3T0B A;  3ABZ A;  1UOG A;  3FUQ A;  1PO1 1;  1XOY A;  3G6J B;  3ZYI B;  5IHR A;  4EN6 B;  4BQ4 A;  2VCB A;  4FOY A;  1OVP A;  2WFP A;  3A0K A;  2KD7 A;  4Z2A A;  1MS9 A;  4I02 A;  3ZXE A;  3KHB A;  1WW4 A;  3TEX A;  1ZZB A;  1AXK A;  4FPG A;  1BLZ A;  3KMH A;  4CDQ A;  1DYK A;  4JTN A;  5F37 A;  3K4A A;  1F35 A;  3ST7 A;  5DXD A;  1JI6 A;  1JZ8 A;  3SKJ E;  4ZZ5 A;  3T1M A;  3ZFG B;  1OOP C;  5I0R A;  4RGA A;  1KFX L;  1W2A X;  2X09 A;  2EXI A;  1HIX A;  1QMJ A;  4FTB A;  3I2I A;  1NCR B;  2PHW A;  1W06 A;  4NHM A;  2DF7 A;  3LPF A;  3B9I A;  2C1F A;  1LTE A;  3WZ1 A;  4Q1R A;  1RUD 1;  1VRH 1;  2WAA A;  3C8X A;  1W6O A;  5FLJ A;  3DL3 A;  3NAP A;  4FBF A;  3C7F A;  2HWC 1;  4M00 A;  2VPV A;  3V0A A;  1RUH 3;  3SCF A;  2RJL A;  2VZ1 A;  1OQD A;  1S0E A;  2Y8K A;  1NT0 A;  1GWK A;  1UPI A;  3BN6 A;  4D7S A;  5LK7 B;  3VL9 A;  1D7P M;  3MIG A;  4IL7 A;  4P08 A;  2W92 A;  3UKN A;  2OT7 A;  5F5C A;  1EV1 3;  3SH5 A;  1OF4 A;  2E7A A;  2EA7 A;  1CJP A;  2VVE A;  4IET A;  3ZYF A;  5IK5 A;  4QKF A;  5C5T A;  2JDM A;  2LS6 A;  2VOW A;  3R0R A;  3M2M A;  2BFU L;  2R07 3;  2P3I A;  4EN8 B;  4G9S B;  2Q5T A;  4KU8 A;  1UOF A;  1HLC A;  3O12 A;  4L8Q A;  4Q4X 3;  1MQT A;  4XFC A;  4AI8 A;  4ET7 A;  5IT6 A;  4XAC A;  4QWN A;  2Q1M A;  1RVF 3;  5T55 A;  2Q8O A;  1G9A A;  2R06 1;  1UY0 A;  4CDW A;  4BQW A;  2QTW B;  3N36 A;  3BTY A;  1WLW A;  1OKO A;  1H6Y A;  4Q4W 3;  5FLH A;  1Z0H A;  2Z2S B;  3IIA A;  4SBV A;  4YW2 A;  1YNA A;  3ZSL A;  5J37 A;  4AFM A;  1UOB A;  5LB6 A;  2QNK A;  1V6J A;  3MLK A;  5JI9 A;  3M3C A;  1W9T A;  4XF4 A;  1JZ3 A;  1M06 G;  1A8D A;  3KT7 A;  4CZS A;  1RMU 1;  4K1Z A;  2DCT A;  1VBE 2;  3QH7 A;  4HPK A;  1VLN A;  5EQU A;  2VNO A;  4MSV A;  2QBX A;  4P5H A;  3H8X A;  3P3N A;  4MV2 A;  1CZT A;  4E2G A;  1SCS A;  5A3L A;  4LOR A;  2BER A;  2J1V A;  1JMU B;  4P9Y A;  3HBZ A;  4BLI A;  4CSW A;  1G6N A;  3PUS A;  4Y4Y A;  3LZZ A;  4AFC A;  4X8N A;  4YAR A;  2QFE A;  1R09 1;  4OUE A;  2AEN A;  4Z82 A;  3MEP A;  3ASI A;  1HJF A;  1PM7 A;  5A70 A;  5DAQ A;  3N7L A;  4GH4 B;  5GAL A;  1W8H A;  1HRV 3;  1K5M B;  3FC0 A;  3IPV A;  2PA7 A;  2XJU A;  5FMC A;  1ALY A;  3LGR A;  1HB1 A;  2WZE A;  4XCB A;  5LRS A;  2O14 A;  3ACI A;  1SHW B;  1ULP A;  4ZU5 A;  3W5N A;  1ONA A;  2C4X A;  2VUA A;  2D3P A;  1LCL A;  5K0U C;  2F6B A;  1RUC 2;  2VOK A;  1TVG A;  3LA2 A;  4G3Y C;  1PZ8 A;  4LLF A;  1NY7 2;  2BYV E;  3SIS A;  4BJ0 A;  4DB5 A;  3OTF A;  1AYM 2;  1PIV 2;  2XH6 A;  2DVB A;  2OUJ A;  3N9L A;  3WW2 A;  1AL2 2;  2D6M A;  1UZY A;  2IFW A;  3U14 A;  2AGS A;  1UAI A;  4C1W A;  1EAH 3;  3K48 A;  4COZ A;  1XYO A;  4COY A;  2WYF A;  3NNJ A;  5IWF A;  3MF9 A;  3PVN A;  4RYD A;  3MW2 A;  1WD3 A;  1UIJ A;  3AM2 A;  2WN2 A;  1WKY A;  5F6K A;  3VBR C;  1OPO A;  3WDX A;  1O3R A;  1FNY A;  4E8D A;  4L92 A;  2JDP A;  2K0G A;  4QU1 A;  5A7W A;  3E97 A;  4JHZ A;  5A7P A;  5HV0 A;  2BZD A;  2A73 B;  1WA4 A;  2VMG A;  1W0N A;  3LDK A;  1OLQ A;  3SEP A;  4CEY A;  1O3S A;  1VB2 A;  4XAB A;  4XUQ A;  5T5L A;  1Z7S 1;  4IE5 A;  1P8J A;  1VBC 3;  3MGU A;  5I0T A;  2X8K A;  5FP7 A;  1E5S A;  3K2O A;  4LBM A;  2HYX A;  2P34 A;  3MI8 A;  3OB8 A;  1JTZ X;  5EIY B;  1CX4 A;  1JUI A;  3WXP A;  3RQ0 A;  4QX7 A;  3FHA A;  3RZH A;  3N3H A;  2OUH A;  3E5U A;  3KWV A;  4XFH A;  2CU5 A;  5JR7 B;  2V5Y A;  1MEC 3;  4EV0 A;  5F5A A;  4LHL A;  2W1W A;  3SKV A;  4ISR A;  1VBA 3;  1WCS A;  3LQC A;  5FLI A;  3VKM A;  1BJQ A;  1EAH 2;  4XAE A;  1W6Q B;  5FWJ A;  2EIE A;  1CR7 A;  2WFF 1;  4FP2 A;  2Y6H A;  4QHO A;  3R4D B;  3M7A A;  3CHX A;  4XBQ A;  1AL0 G;  2ZHK A;  4Y26 A;  3HIF A;  1XPW A;  3JBG 2;  4QPI B;  5EFU A;  1BEV 2;  5JCT A;  1R08 3;  5LA9 A;  2A6Y A;  1H0B A;  4Q27 A;  5BNP A;  1QIQ A;  1W2U A;  4DIN B;  1IKP A;  4CA9 A;  1QJU 1;  3MIE A;  3MZH A;  4AQS A;  1KRI A;  3PIJ A;  4K6B A;  4YVW C;  4WM7 B;  3TN9 1;  4ZZ8 A;  1Q5O A;  1TME 1;  4BLJ A;  4IV1 B;  1ULF A;  4J1W A;  4UW3 A;  2VVF A;  3D0S A;  3USU A;  2YFU A;  1APN A;  5JIU A;  3HR9 A;  4RHV 1;  2WDB A;  4XUP A;  1ND2 B;  1S55 A;  1VP6 A;  1PK6 B;  5C3Q A;  5EP9 A;  3HQR A;  4QB2 A;  2PHD A;  3GBG A;  3K4D A;  4ITC A;  2VY0 A;  3DPR A;  3KT4 A;  3GBF A;  1S0J A;  5EZW A;  3M70 A;  4A2U A;  4IV3 A;  4LO4 B;  3WUD A;  1EUT A;  1V9U 3;  1COV 1;  4CU6 A;  4DUW A;  1Z78 A;  2G9F A;  2V5D A;  3MUZ 1;  5DZG A;  5IAT A;  3HN3 A;  4CXX A;  5JOY A;  1L3J A;  3HNM A;  5C33 A;  3BUC A;  4CPB A;  1X8E A;  1AUY A;  4N7U A;  3RZL A;  1E5H A;  1ZA4 A;  4RQP B;  1X9P A;  4NO4 A;  2OX0 A;  4DUV A;  2PFW A;  3PMS A;  4EWA A;  1CIW A;  3AXD A;  3POB A;  1SFP A;  3HJR A;  1TE1 B;  1F31 A;  3ACF A;  3C7O A;  1AR8 1;  1W0O A;  2ZML A;  1F4H A;  5FJH A;  5BV6 A;  2FMD A;  2F17 A;  3FWE A;  5B2G B;  2VZV A;  3NV4 A;  1AR9 1;  4KG0 A;  4LO7 A;  4Q0U A;  5FZD A;  3RS6 A;  1XSR A;  5IVJ A;  3D6E A;  3D82 A;  3GDB A;  5AC9 2;  1DQ0 A;  1H8T B;  4I0A A;  3EHK A;  3V65 A;  3E1F 1;  2VQA A;  1YIP A;  1TQ5 A;  2RS1 3;  3OBA A;  3RMY A;  3UT0 A;  3VZJ A;  4B3N A;  3WP6 A;  1DHK B;  2J1U A;  2VXJ A;  1RL3 A;  2BP6 A;  5FYZ A;  1RUG 2;  1JOB A;  1BZW A;  3V64 A;  1RUI 3;  1PVC 1;  1ZBE 2;  1LGC A;  1OPM A;  2HWD 2;  3I8T A;  2FCV A;  2VUL A;  3I2K A;  3SH4 A;  1MZ5 A;  2XVK A;  3LIH A;  1KQR A;  1QJX 2;  5IK4 A;  1QJY 1;  1A8M A;  3MW4 A;  2C9A A;  1W8U A;  3T2P A;  4DY5 A;  2WBK A;  2EF6 A;  3AC0 A;  4DQA A;  1VAM A;  3DN7 A;  3ZSK A;  2P3K A;  2FMY A;  2OW4 A;  5GLT A;  3ZXA C;  2AAC A;  4ORF A;  2WQ8 A;  4XJA A;  3RGB A;  2ADE A;  3U11 A;  1NKG A;  3AP4 A;  2H0B A;  3LOI A;  4CU9 A;  2JXA A;  5A32 A;  4AVC A;  3BTX A;  1RIN A;  2EXK A;  2HWE 3;  1C1F A;  1ND3 C;  4RGK A;  2YXS A;  3WG4 A;  2WWJ A;  4LJH A;  5KR7 A;  1US2 A;  4OQ8 A;  1MAC A;  1A3K A;  4O61 A;  1H6X A;  3J9S A;  4X6R B;  2GN3 A;  4XUT A;  2DVA A;  1OD5 A;  4OLL A;  3AZZ A;  3GBW A;  3IDC B;  3NL1 A;  1LU2 A;  4CDQ C;  2PHU A;  3VV1 A;  2RS1 2;  3FL7 A;  2GP3 A;  2XBO 3;  2CHH A;  4FOV A;  4YGC A;  4N43 B;  1XNC A;  1RUE 3;  3U4X A;  1WLT A;  1DU3 D;  5FYS A;  2AEZ A;  5FZG A;  3VBH B;  1NLQ A;  2Y34 A;  2K9Z A;  4CDX B;  5KXD A;  2EIB A;  1XRU A;  3TYJ A;  2ZXQ A;  1PNG A;  3PHM A;  2Y0O A;  3MIH A;  3CIH A;  3ETP A;  4H7L A;  1NUK A;  4XFA A;  2XQR A;  5CFC B;  2WO7 A;  4XUN A;  2Q8D A;  4QKD A;  3W21 A;  2DBI A;  3MIB A;  3OUJ A;  5JWP A;  3NKG A;  4CXY A;  4L97 A;  5LY2 A;  1LOE A;  3UGG A;  1ZZ7 A;  1L7R A;  5EJZ B;  1W99 A;  3DYO A;  5J3U A;  3A7Q A;  5M0T A;  2BUK A;  3MBW A;  5DDJ 3;  4NIA A;  1LOC A;  2E6V A;  3WDT A;  4BK5 A;  2FZ1 A;  5JZG C;  4IEQ A;  5DN2 A;  1ZRI A;  1SMV A;  1WCD J;  1YQC A;  1QQP 2;  3KCX A;  3R05 A;  5JI7 A;  4CCE A;  4HK8 A;  2R07 1;  2W9X A;  3ZFG A;  5ISL A;  1OA2 A;  1NZI A;  2XBO 2;  3NRU A;  4RGG A;  1ZRC A;  2QCS B;  4XFF A;  4XQ4 A;  3KQR A;  3VL8 A;  4B8E A;  2ET1 A;  3TEW A;  3KZ4 C;  1NCR A;  2BVB A;  2ETE A;  3HNB M;  1QDO A;  5C8W A;  5FYU A;  2BPA 2;  4OHZ A;  1C5I A;  1QXR A;  1S0C A;  4CDW C;  1RUC 1;  4Q4W 1;  4UW5 A;  4YW5 A;  3USS A;  4R9C A;  1DIW A;  2MHF A;  4IGO A;  2E31 A;  3AYA A;  5FKC A;  1O5U A;  3WF3 A;  4YZ2 A;  1ZRE A;  4XUR A;  4HVQ A;  4JAA A;  3E5X A;  3AZX A;  4LE3 A;  3RSJ A;  5L36 A;  2YFZ A;  1NXM A;  4HLT A;  1AL2 1;  1YYN A;  2BU9 A;  1OKQ A;  4GWM A;  5JVV A;  4OZX A;  5C3O A;  2DU0 A;  4P9X A;  4ARY A;  4V2V A;  4BQ5 A;  2JWP A;  2QVS B;  4XYX A;  4JGY B;  3III A;  5LA2 A;  1DQ5 A;  2BNM A;  2XVG A;  4BIS A;  1FOD 2;  5BNN B;  1W03 A;  3O7O A;  2IWG B;  1J84 A;  3FE5 A;  4MX3 A;  5A3M A;  4XF9 A;  4K9S A;  3O0X A;  3AJZ A;  4XAA A;  3PNA A;  1AR6 2;  1HRV 1;  1JN2 P;  3FLR A;  3URF A;  4K3U A;  3WNM A;  4NWW A;  4XE9 A;  2JEN A;  1LHV A;  2RM2 3;  4UT5 A;  1LHO A;  2TBV A;  5BNO B;  1D4V B;  2CWM A;  4AGR A;  5EV7 A;  2B42 B;  1DYO A;  1JUH A;  4QGM A;  5FPU A;  2W3J A;  2G9Z A;  5DG2 A;  1W05 A;  4L11 A;  2BV4 A;  2ZGU A;  2XKO A;  3POI A;  2QQK A;  3VKN A;  5FPB A;  2HKX A;  2G9G A;  4Q4V 2;  3VBS B;  2RS5 3;  1DDL A;  2CAU A;  4QDQ A;  1SDW A;  2DBN A;  3H1M A;  4BQ2 A;  3D4K A;  2PN5 A;  3PLQ A;  2ZJC A;  1O3T A;  1ULO A;  1RC6 A;  3FZ3 A;  1EAH 1;  4ZPI A;  4B1M A;  3VD3 A;  2BQP A;  2A71 A;  5LBE A;  5FPX A;  2XKP A;  3GAL A;  4LTA A;  4OHV A;  4PQ9 A;  1DQ1 A;  4BB3 A;  4JDO A;  3KSC A;  3EJK A;  3KF5 A;  4BK4 A;  3WHU A;  4A3X A;  2ZGN A;  3LB9 A;  4EQV A;  1GOG A;  2Y60 A;  4GH4 A;  1K5M A;  4BYY A;  4AOC A;  5I8T A;  5A3U A;  4XF1 A;  4YM1 A;  5JMO A;  4AVB A;  4LBJ A;  5EYY A;  3DGT A;  4JRA A;  1JYI A;  4HOO A;  2A70 A;  4FTS A;  3DCQ A;  4C1X A;  1DGR A;  1VMJ A;  2PYT A;  1VBC 1;  2IXI A;  1GYK A;  2VTX J;  1AHS A;  3AFG A;  3BOW A;  2GC0 A;  2HBT A;  3Q8A A;  4PDW B;  4RN5 A;  4EN9 B;  2YGM A;  4LEJ A;  5FWE A;  1J59 A;  1OQE A;  3AKQ A;  4RS5 C;  4AVA A;  1LGB A;  3Q9O A;  1RUD 2;  5JXG A;  2WQ4 A;  3N9Q A;  1IS6 A;  4K40 A;  5BYN A;  1QXP A;  1PGS A;  1MEC 1;  3NW4 A;  1VBD 3;  3ES1 A;  5GZE A;  2FDG A;  3LEG A;  1DF0 A;  1VBA 1;  4GQ7 A;  2LM3 A;  3TB0 A;  4HKW A;  4DZG A;  3WR0 A;  4CP0 A;  4KQ7 A;  5FYC A;  1DQ2 A;  3FFQ A;  4XDP A;  1UY4 A;  5T52 A;  3DYM A;  5I93 A;  3A23 A;  4QAW A;  2FZ2 A;  1UNB A;  1R08 1;  4FOQ A;  3WNL A;  1H30 A;  4LOS A;  5FZ4 A;  3NJX A;  2C5D A;  5BNP C;  1JYV A;  2A1X A;  5FYT A;  3KM5 A;  5HCH A;  1V6O A;  4PT6 A;  4AVS A;  2NN8 A;  2VM9 A;  2ZGS A;  3OPT A;  5IK8 A;  2ZA9 A;  1T2X A;  4MET A;  2ZGM A;  1N3O A;  4ZS3 A;  4AEJ A;  4D3W A;  1NXD 1;  3PTY A;  4W8J A;  1OLM A;  3AMH A;  2XOM A;  1UYP A;  1Q8O A;  4UBG A;  4CP2 A;  4LK6 A;  2TNF A;  2JJ6 A;  4A3Z A;  4UI9 L;  2Z5W A;  5FOJ B;  1RUO A;  4OHX A;  1YWK A;  5A7O A;  1W6Q A;  4XXA A;  4OUS A;  3S6P A;  1V9U 1;  5AFB A;  2ZOE B;  1RTV A;  2QZ2 A;  4XIK A;  5GKA C;  3E6C C;  4CVU A;  1S2B A;  2JIJ A;  2HWD 1;  1MVQ A;  2BOJ A;  3OEA A;  4QPI A;  1YQ2 A;  3ZXG A;  3OD4 A;  4I3P A;  5DPN A;  5HBA A;  1QJX 1;  1LB2 A;  1BKZ A;  1NX9 A;  2ENR A;  2CSG A;  2PAK A;  2BGP A;  3OD0 A;  3U4S A;  3HAG A;  1ASJ 3;  2QDR A;  1FX5 A;  4WM7 A;  4GB3 3;  1OMI A;  4XPV A;  4IV1 A;  4FPO B;  5T5O A;  3AZW A;  2EIG A;  4AXO A;  4JHT A;  1O4Z A;  3P6B A;  4O65 A;  2A6X A;  5H9P A;  1ND2 A;  2KA3 A;  1G86 A;  1ZRF A;  1PK6 A;  3LDB A;  5FYV A;  2PLV 3;  5DUX A;  4AYU A;  5IFT A;  4BU2 A;  2BBA A;  4PCR A;  1W28 A;  4NRM A;  5F6L B;  4COV A;  1DYP A;  3GJB A;  5C8C C;  2V73 A;  2CGN A;  1X7N A;  4IES A;  2MEV 3;  3AFK A;  1DZT A;  3RVH A;  4ASL A;  2RS1 1;  3WCR A;  5K7P A;  1G9D A;  5HXM A;  3ZXD A;  4COW A;  4YPJ A;  1F15 A;  4YFZ A;  3J7N A;  2OKX A;  4QPY A;  3VBF C;  4UFL A;  1HRI 3;  1RUI 1;  2QDN A;  2RDS A;  1X33 A;  2XR4 A;  5IVF A;  3V0B B;  1RUN A;  2XL9 A;  3POS A;  1AJK A;  3M4F A;  4RQP A;  4X6Q B;  2XPJ A;  1ZZ6 A;  1K3I A;  1E57 A;  3I2H A;  4PLN A;  5LK5 A;  2WC2 A;  1ASJ 2;  2VU9 A;  2Y6K A;  4H3W A;  5IVE A;  4L0P A;  2E9Q A;  3O14 A;  4IE0 A;  3PUQ A;  3HMY A;  4A4A A;  1IKQ A;  1RHI 3;  4MXW B;  4RR3 C;  3LE0 A;  4UBH A;  5A1A A;  1Y9G A;  5B4X A;  2CL2 A;  2KR2 A;  4D6S A;  4MH0 E;  2W39 A;  3TAY A;  4Z07 A;  1H8T A;  3VDD C;  2J42 A;  4YGE A;  1GNH A;  1QQP 1;  2XJS A;  5F3C A;  3PUI A;  1C1L A;  4YFW A;  5ANN A;  2OYZ A;  3IDB B;  4LA3 A;  4JRL A;  3VD5 A;  5CAD A;  2PAE A;  3FBY A;  2VZO A;  2WT2 A;  1UZZ A;  2P17 A;  5FP8 A;  2XBO 1;  1PMH X;  3WUC A;  1LHW A;  5BPX A;  1UU4 A;  1WCU A;  3WHT A;  1C4R A;  2Y0I A;  3BPS A;  1QU0 A;  2B46 X;  1GOH A;  3O0V A;  4XEZ A;  5C3R A;  2GP5 A;  4EN7 B;  2Y26 A;  2E7Q A;  5CFD C;  2ZKN A;  1ODN A;  4LMF A;  2P5B A;  3I59 B;  3KGL A;  4WVW A;  3ZYR A;  2DUP A;  5IVC A;  1TNR A;  4JGZ C;  3QOP A;  4FPC A;  1CON A;  1A6C A;  2FCT A;  5A6Q A;  1W6M B;  4YSF A;  4AAP A;  1POV 3;  1KJR A;  4KNC A;  1CES A;  1I9R A;  1S2K A;  1AXZ A;  2XML A;  4WBB A;  5C6C A;  1HQL A;  4ATF A;  1RHI 2;  4NHY A;  4QX5 A;  3ZR6 A;  5ACA 3;  4I01 A;  3WNX A;  3I2F A;  3SIT A;  2WUH A;  1NE6 A;  4EZ4 A;  3GGL A;  1C28 A;  1SLL A;  2LRO A;  1FYU A;  2Q1Z B;  3H42 B;  4TSV A;  5GJ6 A;  3D0J A;  5H9S A;  1UZW A;  3U75 A;  3UV9 A;  4OHY A;  1FV2 A;  1H1I A;  3WW1 A;  2XG3 A;  1GZ9 A;  5FY7 A;  4GKY A;  5E1R A;  3RYP A;  4Z1V A;  4AHX A;  4B1L A;  2B4K A;  5CG8 A;  1GKB A;  1G9C A;  2WYS A;  1AR6 1;  5HCA A;  4N43 A;  3QLQ A;  2DFC A;  2H6B A;  2JDY A;  4JDM A;  2BJS A;  1OBN A;  3VBH A;  3M3Q A;  3A22 A;  4E4Z A;  5A6Y A;  2WNV B;  2ZAA A;  4CDX A;  3VZN A;  2CV6 A;  2V4V A;  2VZS A;  1W8N A;  3M1H A;  1COV 2;  3IDE A;  4PIY A;  3VBO C;  4DFS A;  5ABJ C;  1NCR C;  2VOX A;  3KCY A;  2VUJ A;  3HT2 A;  1MS1 A;  3AJY A;  3I2G A;  5CFC A;  2O0O A;  1CAX B;  2B9V A;  4YVS B;  1RUJ 3;  1Y9Q A;  1WZX A;  2XJR A;  5FZB A;  4AI2 A;  2VUD A;  1V6N A;  1F8V A;  3ACH A;  4N8M A;  5FO7 B;  2P4E A;  4D7T A;  2GDF A;  3H9A A;  5SV8 A;  5A1L A;  5FZ9 A;  4ES9 A;  2GME A;  2A3X A;  2NMO A;  3OY8 B;  1X36 A;  3F2Z A;  3GF6 A;  2DVF A;  1AR8 2;  4C90 A;  2J1E A;  1UX6 A;  3LOB A;  1SPP B;  2TEP A;  3VHN A;  5I8Y A;  4FT8 A;  1AR9 2;  2PHT A;  5D1I A;  4IE7 A;  3K4Z A;  4AVT A;  1Q56 A;  1JU4 A;  3HNY M;  3KGZ A;  1D0G A;  3ZN5 A;  1UO9 A;  1K5J A;  3BKZ A;  3CZJ A;  1GWM A;  4J6G A;  4A6O A;  4LKE A;  2ZGO A;  3ACL A;  3VZM A;  4JQR A;  2FDH A;  4N53 B;  2UYA A;  2EXH A;  4GJZ A;  2DDU A;  4IEP A;  4CCM A;  4DEV A;  1LR5 A;  3PIG A;  3K77 A;  4CCK A;  3AL5 A;  3NV1 A;  2NQY A;  3AKS A;  5I0S A;  1PVC 2;  1PNF A;  1IS4 A;  1KIT A;  4JKK A;  5CU1 A;  5FZ6 A;  3WCS A;  5EJ1 B;  2AH2 A;  3VZL A;  4DOU A;  5FUP A;  2R32 A;  1DLL A;  5DAX A;  3CU7 A;  1QJY 2;  4D94 A;  4LUL A;  4EYU A;  3W59 A;  3I3M A;  5E89 A;  2RS5 1;  2WL1 A;  4DEQ A;  3SH3 A;  3O0W A;  4JDN A;  1HB3 A;  4QX8 A;  4P5Y A;  3SHR A;  1MPX A;  1OFS A;  1IS3 A;  2XJP A;  5L9B A;  5C71 A;  1ULG A;  3NWK A;  4JGY A;  3POF A;  3ZYP A;  4QX0 A;  3RJR A;  5A7S A;  5BNN A;  4BIF A;  1RIT A;  4AI0 A;  1PMJ X;  4ASK A;  3WY6 A;  1K45 A;  2WLQ A;  2ZCW A;  3AYE A;  4DS0 A;  1ENR A;  3THP A;  5FZ0 A;  1N47 A;  1GFF 2;  2VD7 A;  1XXN A;  4KI5 M;  4JC1 A;  3I2J A;  4LXL A;  1HV0 A;  5T50 A;  4AGG A;  1K5M C;  3NNM A;  2YDE A;  2RS3 3;  3F95 A;  3H7Y A;  1RB8 G;  4LBQ B;  3ACG A;  2W46 A;  2ZEZ A;  3SC7 X;  2XLF A;  1IPS A;  4KGQ A;  5L9R A;  4GIQ A;  3ZYH A;  1LOF A;  2R30 A;  5BNO A;  4YG3 A;  1MS5 A;  4QX3 A;  3KQ4 B;  4UW6 A;  4KWK A;  5HPO A;  5HV4 A;  1X8M A;  2D44 A;  3WVJ A;  3ZOI A;  5GLV A;  1QJE A;  2R1B A;  2PQQ A;  5SV5 A;  2W94 A;  2Q8C A;  4P00 B;  3VBS A;  3ZPO A;  3ATG A;  1D4M 3;  1VMF A;  1DGR N;  2VL4 A;  4IEX A;  1Q8S A;  3LFM A;  4P9J A;  4QD2 A;  4ZXK A;  3S0M A;  3DXT A;  5DAB A;  4ATE A;  3JCI A;  1RUH 2;  3WP5 A;  1QGL A;  1WMF A;  2ZGQ A;  5I91 A;  1IZ3 A;  1UL9 A;  2PXJ A;  4GAZ A;  1UMI A;  1GQG A;  3LSD A;  1QOO A;  4IEO A;  1FMD 3;  1OI6 A;  1RIR A;  4IEU A;  1SQ4 A;  1RJ7 A;  5GZG A;  1OOP B;  2ZEY A;  1EV1 2;  4ZS2 A;  4QX1 A;  2IXH A;  2X53 S;  3ZVX A;  5FYB A;  4Z92 B;  4LA2 A;  4EN0 A;  4MGK E;  2FDJ A;  2ZX3 A;  3H8O A;  2R07 2;  3AMM A;  2W95 A;  1OFN A;  3ZFF B;  4Q4X 2;  4YW1 A;  5FZH A;  3ZYB A;  1POQ A;  1WW6 A;  2VOT A;  3GYD A;  3DYP A;  1LOD A;  4AFB A;  1RVF 2;  1UY2 A;  2D7F A;  4PDW A;  1H2N A;  3NO8 A;  5DUV A;  1POV 0;  3IAP A;  3U37 A;  4P02 B;  3MV1 1;  3SXW A;  3POY A;  2O1Q A;  4Q4W 2;  2WAO A;  1S1A A;  1RUF 3;  1US3 A;  2RDQ A;  3ZMO A;  3ZMN A;  4F3J A;  4LKD A;  3O1U A;  2PHX A;  2A6V A;  4HG6 B;  1D4M 2;  4HXC A;  4ES8 A;  3T4V A;  2VNR A;  3BU0 A;  3S57 A;  4A7Y A;  5HI0 A;  2DVG A;  1Y3T A;  3KLS A;  5CKM A;  4Y1V A;  4FAH A;  2VMH A;  3S7E A;  4R8H A;  4AVV A;  1YUD A;  4NII A;  4Z2W A;  4ARX A;  4CE8 A;  1HJG A;  2K2S A;  1FMD 2;  3T30 A;  3G7D A;  4LLO A;  4XTP A;  4E2S A;  1QXJ A;  4RSU A;  4ONU A;  5I0U A;  4OI4 A;  4QPI C;  2ADD A;  5H9R A;  1BVV A;  2WSV A;  1JYW A;  4GWN A;  1ASJ 1;  1TEI A;  1HRV 2;  1JOD A;  4GD4 A;  2WKK A;  1GQP A;  4IV1 C;  3AVS A;  5F3E A;  2DUQ A;  2PMW B;  4FPE A;  4KU7 A;  2YC4 A;  5AVA A;  5CG9 A;  1PHM A;  3ES4 A;  1XNB A;  2H0V A;  4OZO A;  1HW5 A;  2BNN A;  3POW A;  4K8F A;  3I3Q A;  1PK6 C;  1JZ4 A;  1ODM A;  2EVX A;  4IQP A;  5T3N A;  2Y6L A;  4E8C A;  1C8N A;  1LRH A;  3CEW A;  1MS4 A;  1REF A;  2P3Y A;  4H55 A;  2WNU C;  5CZK A;  3PDQ A;  4BCU A;  2IFR A;  4DMI A;  2WA4 A;  3A0N A;  1I1E A;  2OA2 A;  5DZE A;  3H8U A;  3VKL A;  1H2M A;  2P3J A;  2VMC A;  2YYO A;  1R1A 3;  1VAV A;  1LU1 A;  1LKN A;  2ZGK A;  2GMM A;  4QQO A;  1O8P A;  2RG4 A;  2Q0A A;  4HT1 T;  2HWF 3;  2D6O X;  2GN7 A;  2JE9 A;  3B93 A;  1HQW A;  2GC3 A;  3FHQ A;  1PZ7 A;  3ON7 A;  4RQP C;  2W5F A;  5FP3 A;  5K0U B;  2YBP A;  1PGL 1;  3U0Z A;  3KVB A;  3A4U A;  4ZHN A;  2C9K A;  3ORJ A;  1VBB 3;  3CJI B;  1V6M A;  1RHI 1;  2WNO A;  3P3P A;  1H9W A;  4IGQ A;  1DLC A;  3VDB A;  4M3C B;  1EYB A;  1KGY A;  1S0G A;  1ST8 A;  2PHL A;  2VE1 A;  1N1V A;  1VBC 2;  4Q0P A;  3ZPY A;  3H7J A;  4NHL A;  2E63 A;  4UFK A;  4M01 A;  2AYH A;  2R04 3;  5FFO C;  2OQ6 A;  5J98 B;  4CUA A;  2BOI A;  3JQW A;  5FK7 A;  3BI3 A;  2JG8 B;  3VHR A;  3L2Y A;  5I0D A;  1MEC 2;  3GM8 A;  4BWO A;  1W9Y A;  2W2I A;  5FRE A;  3VBR B;  2WZ8 A;  1VBA 2;  4RFT 0;  4S2F A;  5KXE A;  3V0B A;  1NG0 A;  2WR9 A;  5JOW A;  3NKT A;  5A3N A;  4YW6 A;  3OGV A;  1XQN A;  5LZ6 A;  3QBQ A;  2UUR A;  4JTO A;  4EZH A;  1BVP 1;  4NWV A;  4GWJ A;  4C0H A;  4F83 A;  3O1S A;  2V4A A;  1OF3 A;  1R08 2;  1GZC A;  2HWB 3;  4ISQ A;  1POV 1;  3HPN A;  2EAL A;  4AFA A;  5C9A B;  4MXW A;  1NZC A;  5FY0 A;  3SQO A;  2RMU 3;  4QXH A;  1V00 A;  2Y64 A;  5ACA 1;  1S0D A;  5A1F A;  2D97 A;  5AFE A;  5F39 A;  4FSJ A;  4BOW A;  4PLM A;  4WM8 B;  2DFB A;  4MXV A;  5E16 A;  4CPB D;  2J22 A;  2WQZ C;  5FJK A;  3O1M A;  4XJW A;  2WRA A;  1BK0 A;  4GXL A;  1HXS 3;  2ARA A;  4KH9 A;  4XXP A;  4BMB A;  1GMM A;  1IQA A;  1JHJ A;  3RYR A;  2VXR A;  1SEF A;  1JH5 A;  5D2A A;  4XJ9 A;  1DZQ A;  1OQ1 A;  3KT1 A;  1YJL A;  4FPK A;  1IG0 A;  3POG A;  4AHZ A;  1I6X A;  1ENS A;  2GC1 A;  2ZZQ A;  4N9H A;  1F4A A;  4IW3 A;  1V9U 2;  2JX9 A;  2P6C A;  2YU2 A;  3C7E A;  4GMP 3;  4XJ8 A;  1RXG A;  3RZZ A;  3I59 A;  3WF0 A;  1O4T A;  4YVW B;  2VME A;  5EXO A;  1XE8 A;  5IVY A;  4FPH A;  4XIL A;  1W6M A;  2C24 A;  2VO5 A;  1GZT A;  4QB1 A;  5CFC C;  3HVD A;  2QQO A;  3MIC A;  1X50 A;  3N7J A;  1V70 A;  4URT A;  1O7F A;  1B35 B;  2PAM A;  1WLC A;  3PVB B;  4KGG A;  2QE3 A;  2FDK A;  1MZF A;  3Q8B A;  1ULC A;  5FY9 A;  3SEE A;  2C6S A;  5DG1 A;  5GLU A;  2OPK A;  3J7M A;  2Y38 A;  2TUN A;  1WUV A;  2YMZ A;  2XVL A;  4A44 A;  4AG4 A;  1CAU B;  4H2A A;  4K21 A;  3ILN A;  4CYD A;  3B7M A;  4NN0 A;  2XHK A;  3V56 A;  2VVD A;  3VKF C;  3JD7 3;  3U10 A;  4S2H A;  1UU6 A;  2WNV A;  5JSP A;  1U0A A;  4FP3 A;  3RNS A;  4AHY A;  1MZ6 A;  2JKB A;  5C4W B;  3KD4 A;  4AED B;  4QKN A;  2VC9 A;  4CCN A;  2WA3 A;  4LK7 A;  4M4R A;  1C8M 3;  2CDO A;  3B01 A;  4PHZ A;  1MR5 A;  1RUI 2;  4WVZ A;  1CAX A;  2BGC A;  4ZON A;  4YVS A;  5LW9 A;  4JVA A;  3FLT A;  4AZZ A;  4NJ4 A;  3RZJ A;  4XQW A;  5CAZ A;  1AVB A;  1OLM E;  3ALQ A;  2JB4 A;  4E27 A;  3OY8 A;  5IAV A;  3NAP C;  1YO8 A;  1RUH 1;  1BMV 1;  4Y33 A;  1NQJ A;  1JS9 A;  5JSO A;  2P2K A;  4HSJ A;  2ZHL A;  2WWS A;  4XBN A;  4ERO A;  5J36 A;  1SPP A;  4Y22 B;  2X5I B;  4JGY C;  2HWE 2;  3BOD A;  3ZKY A;  1Q3E A;  1SCR A;  1EV1 1;  2PQS A;  4W50 A;  5BNN C;  4P9L A;  3ZSJ A;  2FDI A;  1ZZ8 A;  3VBU B;  4XTM A;  5KBF A;  5L19 A;  4RD7 A;  5FUN A;  1AYN 3;  2HEY F;  3GHN A;  1QNY A;  5JOZ A;  3JD7 2;  2DCK A;  2RS3 1;  4M0N A;  4N53 A;  3MPB A;  4LOT A;  4Q4X 1;  4YM2 A;  5IYY A;  4Y3O A;  3BOP A;  1NAE A;  1MQT C;  3DEM A;  1RVF 1;  3J8F 3;  1RUE 2;  3FX3 A;  4GWI A;  2XHN A;  4OFG A;  5FY8 A;  5BNO C;  2QQP A;  5FMO S;  2DCJ A;  3JZV A;  4AQ6 A;  3T0D A;  2H6C A;  4JV4 A;  4XUO A;  2RHP A;  4KL1 A;  5F9T A;  5FY4 A;  4S2G A;  3VGI A;  1ND3 B;  1D4M 1;  1CPN A;  5LWB A;  1J3Q A;  3TEY A;  4H14 A;  5FTT C;  1BBT 3;  1CJD A;  3T0A A;  4AE2 A;  4HN0 A;  4QXB A;  2CTV A;  1CPM A;  2WO3 A;  3B94 A;  3NNG A;  5FBZ A;  2YY1 A;  2A7A A;  3ZSM A;  1FMD 1;  3I54 A;  4I09 A;  1S2E A;  3OPW A;  3GCX A;  1SBF A;  3HQX A;  4FVV A;  4XVH A;  3O1R A;  2OQ7 A;  4QKB A;  1VR3 A;  1IHM A;  1U5I A;  3MLL A;  1J58 A;  1UMZ A;  1CWP A;  4LO5 B;  4TLG A;  5FOB B;  5FXX A;  5E6H A;  4EWD A;  3I3B A;  2JIC A;  4LBQ A;  3IM0 A;  5KXC A;  2W1U A;  2OVU A;  2XGX A;  3IBM A;  1W8Z A;  1XJA A;  5FZO B;  1PMI A;  3T2Q A;  2I74 A;  4PIX A;  4B29 A;  3EMR A;  1UW8 A;  1Y4W A;  4QMA A;  3ZFE B;  4URA A;  3TWI A;  5J48 A;  3WG3 A;  4HKL A;  2VMD A;  2XB6 C;  4PDW C;  1GNZ A;  3IMN A;  1C3H A;  2D93 A;  2P37 A;  1GR3 A;  2IUW A;  4IXL A;  3T1L A;  1PO1 3;  4XZU G;  3WSO A;  3WNP A;  4CUG A;  4NUB A;  2FBE A;  4QB6 A;  3M3O A;  1RUF 1; 
#chains in the Genus database with same CATH homology
 1JS9 A;  3J7M A;  3J7N A;  3J7L A;  4NIA A;  1A34 A;  1STM A;  1CWP A;  4OQ8 A;  1YC6 1;  1ZA7 A;  4OQ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...