1JS9A

Brome mosaic virus
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
149
structure length
149
Chain Sequence
KAIKAIAGYSISKWEASSDAITAKATNAMSITLPHELSSEKNKELKVGRVLLWLGLLPSVAGRIKACVAEKQAQAEAAFQVALAVADSSKEVVAAMYTDAFRGATLGDLLNLQIYLYASEAVPAKAVVVHLEVEHVRPTFDDFFTPVYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coat protein
publication title The crystallographic structure of brome mosaic virus.
pubmed doi rcsb
molecule tags Virus
total genus 18
structure length 149
sequence length 149
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2001-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01318 Bromo_coat Bromovirus coat protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.220 Mainly Beta Sandwich Jelly Rolls Satellite virus coat domain 1js9A00
3J7NA 1STMA 3J7MA 1ZA7A 4NIAA 4OQ8A 1YC61 1A34A 3J7LA 1JS9A 1CWPA 4OQ9A
chains in the Genus database with same CATH superfamily
1QNWA 4XF1A 5AFEA 1AL22 1TNFA 3N9MA 4D8MA 4K6BA 2P4EA 3JCIA 5F5CA 1CPMA 2ARXA 5JMCA 1MS9A 1BVP1 5HCFA 1FMD1 1IS3A 4MGQA 1PGW2 2VXJA 5ANNA 5G04L 5IVBA 3ZFFB 1XNAA 5A3PA 3AKPA 3VGIA 2RJLA 5I8TA 1VAMA 1COV1 4NN0A 4ARYA 1OFSA 4RYDA 1OLMA 2D6LX 2K0GA 3B7MA 2MPFA 1U0AA 4R9DA 1VBD3 1KJRA 4HLTA 3WDYA 3MW4A 4JQRA 1T2XA 1UOBA 1AR73 4Z82A 1HRV2 1AR82 5CVRA 3D0SA 5IJRA 3ZYRA 5FXZA 1XNKA 3H3LA 1SFNA 5A33B 3GYDA 3KQRA 1NCQB 1SLAA 3EBRA 4YZ1A 1J1LA 1OKQA 1OF3A 3P3PA 4XXPA 3VBFB 4QB2A 5A6ZA 3CJIB 2RV9A 3RYKA 4IE6A 2BRTA 3HN3A 2RS11 5I93A 1V6KA 1ASJ3 1CIWA 1ND3B 1YQCA 1WMDA 1QOTA 2E32A 2RJ2A 1W6MB 3WF3A 2J22A 5JPNB 3I59A 1YEWA 2ZGMA 1GP5A 1VRH2 4RS5B 2DU1A 3QACA 4IE5A 4JGYB 5JR2A 1N3PA 4L92A 3ZFEB 1KEXA 1IGOA 2ZEYA 4JQTA 2WNVA 3T4HB 1C5HA 3LA7A 4QDSA 4HONA 1FATA 3ZSKA 4RFRB 2WABA 1UZZA 2DURA 2Q0AA 3PMSA 1ACCA 2CDOA 1H8TC 1ULOA 3N9PA 5BPXA 2JG8A 2EIGA 2OW4A 2Y0IA 1W90A 3FUOA 4FTEA 1GZWA 1BBT1 3A4UA 5FZOA 5A7PA 3I2JA 2K9ZA 3O5SA 4WVVA 3ZDSA 2QQJA 4HG6B 4IV3C 4Q4W2 2PYTA 3AZZA 2P37A 1LOBA 1YQ5A 4UFHA 2ARBA 3H3ZA 1HX6A 3VBHB 5D8AB 1DIWA 5T3NA 3ZM8A 3O1MA 1HN0A 3IMNA 3OGSA 1L7RA 4R4XA 4AQTA 3OEBA 4H7MA 1OF4A 2DUOA 1NXD1 1QXRA 3P3NA 2LS6A 3ETQA 4OHVA 3IM0A 4UFLA 4URTA 4SLIA 1E5IA 3P1IA 4D7YA 4JKMA 4V2WA 3RZZA 3W5MA 4COZA 3E5XA 1UNBA 2H0BA 2VMIA 3PU8A 4CSWA 3ES4A 1GP6A 4LLFA 2EAAA 4RR3C 4W6YA 2R043 3VZOA 1ENSA 1ZA4A 3IPVB 4ES8A 2BUKA 1NA1B 4AL9A 4N53C 4NROA 2VCBA 1PX3A 5FZKA 1SQ4A 1Q8QA 5DAXA 5FMCA 3LKJA 3ZXDA 5I0RA 4M00A 4B4QA 3THPA 2HWF2 3VKLA 3WHUA 5CBLA 5F39A 3DCQA 4A6OA 4XUOA 1WCSA 2E33A 2XL7A 3H8RA 3ZXJA 1GUIA 1OQDA 1RMU2 2E7TA 1LOCA 1HQWA 2O8OA 3NJZA 2QNKA 4LEJA 3LFMA 4OZXA 3ES1A 3HD8B 1R092 3M1HA 3P6BA 4XZPA 5A7WA 3ZPOA 4COUA 5DPNA 4LKEA 3AMQA 1BZWA 2KM2A 4RGKA 3PJQA 4Y5Z0 5L7OA 1RHI2 4RHV1 4JRLA 3OBTA 4YFWA 2WWSA 3T30A 2PHLA 2GNDA 1NQDA 1LOFA 1JUIA 3RSJA 2XH6A 5EZWA 1C8M3 1W3XA 1U12A 2A6XA 3EQEA 1BEV1 5DDJ3 5FZLA 1UYZA 5FY5A 1FNYA 4C91A 5FYSA 5JXHA 1S0JA 2ZACA 4MG2A 1CZVA 1ZZ9A 4C90A 4X8NA 1Y3TA 1S2EA 3PTRB 3ZX7A 4EJRA 3JBG2 3VZNA 3F2ZA 5GZFA 5T5LA 3D4KA 1JZ5A 1MEC3 3C8XA 1YJKA 4AVVA 1JXNA 2RHPA 2RM22 4RA0A 1N47A 3FE5A 3GNEA 3M3CA 1RUJ2 1XXNA 1GBGA 3M3IA 3ON7A 4JX0A 4CDWB 1GYKA 4XDPA 2IUWA 3RG0A 2RJKA 3FBMA 3R6SA 1GWLA 4O65A 1AYN2 2OPWA 4Y1ZA 5JOYA 3O1PA 5LA2A 1OVSA 1UY2A 3E97A 4DRVA 4BQ2A 4UW4A 4CU6A 5CISA 4WM7A 1QJX2 2QE3A 3M70A 4IV1B 5E6HA 4AK3A 2E6VA 2PHRA 4AGGA 1O91A 3UNPA 1DCSA 3POEA 2GH8A 2H0VA 2X53S 2V72A 3K4ZA 5FLJA 5BNNC 5I0DA 1W8WA 2QVSB 4NE9A 5FZHA 4TN7A 1LOAA 3CKHA 3VBSB 2Y6FA 4A2UA 4E27A 3W58A 1OVPA 3DYPA 3JQXA 4E2QA 2RR12 1O3RA 3AZYA 2HWC2 1UL9A 2ADDA 3ZYFA 5AC92 3C7GA 3ZXGA 4DZGA 1W0OA 2K2SA 1PGL2 4WM8A 1RUC2 1VMJA 3I8TA 4A7ZA 1LEDA 1VP6A 3AVSA 1FPN1 3C3VA 3ZMNA 4PI2A 5DUVA 5DUUA 2CGPA 2DV9A 2B5HA 2W1WA 3FLRA 3AZVA 1SFYA 3WV6A 2VVFA 3ST7A 4LBNA 1YNAA 3W59A 1W04A 3N4MA 2FCUA 4K21A 4RGGA 3VDDB 2BVVA 1PNFA 2YBSA 2UURA 2J1VA 4Y20A 1POV3 3BUCA 1OPMA 3K4DA 5F6KA 3JD73 5GM0A 1JOJA 3DYMA 5C3OA 4XVHA 2FD8A 1QJY1 1W6PA 1MZ6A 3ZFGC 2JE9A 2XHKA 3DECA 3I2IA 5DABA 1N1SA 4OYUA 5EJ3A 1O6UA 1XU1A 1D2SA 4M3CF 1H9PA 2A71A 4IEUA 4W4ZA 4FTBA 1O5LA 3AJYA 4CCLA 4CP9A 3WY6A 2Y26A 1CAVB 2OIIA 3DF0A 4M4RA 5LZ6A 4RN5A 4YW7A 2C0ZA 4QX5A 1AYM1 2ID4A 2VTFA 3I2GA 3B93A 4PDWB 5GLVA 1ZRCA 2VL4A 3ZLIA 5C3QA 1W9YA 1J59A 1KFUL 5L9BA 4NAOA 1IQAA 2D6KA 1T6BX 1RUOA 2IXHA 4ES9A 3N9LA 3GF6A 4X6RB 1V6OA 2Q1ZB 2D5HA 4AZZA 4QU1A 1A8MA 1O8PA 1W8HA 1PK6A 2YC2A 1YIPA 2XJPA 4KBBA 5FPBA 3G6JB 5IW0A 5LCWL 3BGAA 3TN93 1VBC2 1LULA 1XSQA 3K77A 1EPWA 1ZZBA 1YHFA 5C8CA 4I3GA 2ADEA 3SXWA 3FFZA 3NL1A 1X33A 5DUXA 3QCWA 5FZCA 5C5UA 1WD3A 3OY8A 1QWRA 4Z07A 3VBRC 3WINE 3WVJA 2WLPA 2VZPA 2DUQA 1W6NA 4PHZA 4QPIB 1WGPA 2EALA 4LE3A 4MGYE 5A7OA 3UJQA 3WT3A 2LROA 3WNMA 5JXGA 2BEOA 3VBUB 2IXKA 3BU0A 2JKBA 3HOBA 1GOGA 2QBXA 2Y34A 1K5MB 1DQ6A 1HRI3 1GLHA 1Z0HA 2JX9A 1WCKA 3NMBA 2NZ9A 2WS93 2WWJA 2XKOA 4PQ9A 3GALA 5FP7A 4Q2FA 2PQQA 4M3CB 2ZAHA 2NP0A 4QXCA 2B9UA 1HJFA 5C7GA 1WA6X 1UAIA 3ZFFC 1ZYBA 2YBPA 3ZXEA 1PIV3 2Y6LA 3M4FA 1QQP2 2VVDA 2XKPA 3PUQA 1FOD1 1AHSA 2MEV1 2QDRA 4KL1A 4PF5A 2FDJA 4Q4V1 4YZ2A 1JZ6A 1MS3A 4CEWA 1NZCA 3GCXA 3BPZA 3LOBA 3FLTA 3KHBA 1WBFA 2JDUA 2C5DA 4JAAA 4Y22A 5LBBA 4KNCA 1MQTB 5J36A 1UU4A 3B02A 2VE1A 1RVF1 1NCQC 2CGNA 3HJRA 4MYEA 5ABJB 1PMJX 3VBFC 2ZPXA 1RUD1 3I2FA 3CJIC 3S5QA 4FQ4A 1UW8A 3UK9A 3Q9OA 3GZUC 5JPMB 5IAVA 3POSA 1UYYA 4AFCA 4LBJA 3I97A 2MNGA 4U2AA 4QPYA 3WNLA 4M3CE 1ND3C 4BU2A 2ZZJA 4QDQA 3ZXKA 1JUHA 1UD1A 2J1UA 4K40A 4PT6A 4RS5C 4JGYC 4URAA 1V6LA 1YIFA 3MW2A 4AHYA 3CZUA 3ZFEC 4YFZA 5IVYA 3KV9A 4MXWA 4PIYA 2DDUA 4XYXA 1WLWA 1GZTA 3SH3A 1HB2A 4MSVA 3R05A 1L3JA 4MLOA 5FYTA 1RUF2 1MZFA 3H8UA 4FTSA 3HWJA 5HI0A 5EIYB 4YW6A 4CCOA 3RZJA 1Q8SA 1URXA 4DY5A 4KU8A 3BTYA 1RGSA 3CNAA 3THTA 1LGNA 1LHWA 2WSVA 4IEQA 5JI7A 4AFDA 5IT6A 4PBOA 1AL0G 3DPRB 4HOOA 3N9NA 3BALA 3VBHC 5D8AC 4GKXA 5FP3A 5KC5A 5BNPB 3OYWA 3PTYA 5FO9B 3PLQA 1NOVA 1U5ZA 1WLTA 2JDKA 3B5LB 4I0AA 2GC1A 1HB3A 3J7LA 4AVCA 1RUE3 5GZDA 2EXKA 1UX7A 5IVEA 3VL8A 2CSGA 2PAEA 4GD4A 2R30A 1NCRA 1ENRA 1VBA1 5E16A 4JZRA 3VZLA 4DNYA 2RS52 1DF0A 1WW7A 1ZZ6A 4FOYA 1JBCA 5KHKA 3R0RA 3P5BA 1QJZA 2ARCA 1NA1C 1SPPB 2QQUA 1PO22 5IVFA 3O1UA 2RMU1 4KU7A 1YO8A 4BE3A 1L7QA 4UFKA 4XJAA 4AVBA 1JZ4A 3KHCA 2HLEA 1D4M3 1WLCA 2GC2A 4HETA 5T5PA 4GMP0 4FI9A 3IDAA 4NHMA 1DLCA 1HQLA 3I7DA 4Q4X2 3ZMOA 5FPUA 1F4HA 1S0BA 3SCHA 3GZTB 1QJU3 4D69A 5IK4A 2RDSA 4N43B 1Z7S3 3SEEA 2EAKA 2YFZA 2EA7A 2VQAA 1I3HA 2GP5A 4XHXA 2A6ZA 1PMHX 1H9WA 4OHZA 5FZ7A 4CCEA 1GNYA 3KVAA 4ONUA 4BXFA 4NVPA 3AMNA 2WAOA 3KSCA 2GU9A 1LEMA 5FIXA 3GM8A 2Q5TA 1XNDA 5H9PA 1KGYA 5BNOB 5FPLA 3SLIA 3K3NA 2Q1MA 2Q1FA 1C4RA 1CPNA 3KCYA 1ULPA 5FZ3A 2ZGTA 3FMGA 1XE7A 2J1TA 5GZEA 3W9AA 2VOWA 2FDHA 5FR3A 3PJYA 2ZX0A 1W9WA 1AXKA 1OI6A 1GQHA 2VVEA 4CEYB 4QXBA 2PHXA 2X5IB 4YSFA 3ZSLA 2ZCWA 3NNLA 3KLSA 2I74A 1DZQA 2GNMA 1GQGA 1AL21 1U5IA 1RUH3 1COV3 1HXS2 1DGWA 1XYPA 2ORXA 2VMDA 3PVOA 4OCTA 1F9KA 4E4SA 3LA3A 4HL0A 3V0AB 2QQMA 2Y60A 3OEAA 1TEIA 1F5JA 4XPVA 2BNMA 1DYPA 3BIEA 4QQ2A 4AI0A 1PGW1 4FO9A 2PHFA 4Q0SA 4RGAA 4HT1T 4P08A 2VW2A 1HKDA 4JGZA 5FP9A 4IV1C 2BGCA 1DG6A 1JYCA 3MICA 2YFUA 5K0UB 1AR92 3HQXA 4IEWA 5AVPA 3T4VA 3LD8A 2DYCA 1DZRA 1MPXA 4GQ7A 1TME2 2XJSA 2VUCA 5FBZA 4AI3A 2JWPA 2DVAA 2RS13 1HRV1 1AR81 2ZGNA 3IWZA 3VBSC 2AUYA 4COVA 1JOPA 1ND2B 1QKQA 1SLIA 2HEWF 2WUHA 3VDBA 5T5JA 3ZN4A 1VBD2 2J1SA 3ZKUA 4DO0A 5A1AA 1R64A 4UW3A 5FZ9A 5L73A 2QDNA 4HN0A 2OVUA 3I3EA 4G3YC 4I0BA 3J8F2 3VHPA 1VRH1 4XCBA 4FPCA 2I2SA 2R1DA 4AHZA 4AVAA 2CNAA 1CJPA 5BY5A 1B35B 2C4XA 3Q8FA 4DINB 1BBT3 3IKWA 3IBMA 4R4ZA 3AKQA 5F9TA 1KS5A 1W6QA 5T50A 1R1A2 2WBKA 1WW6A 3CDZB 3S7IA 3VDDC 3USUB 4CDQB 1AX1A 5F5AA 2OS2A 3BB6A 2QQLA 3RDIA 1W2OA 1ZM1A 2JDHA 4QPGA 4LKSA 1QGLA 4JHZA 5CFCB 3MIBA 3B9CA 3AXDA 3SISA 1HW5A 1XBFA 3V0BB 2FDKA 3VD5A 3PNAA 4Q4W1 4NHYA 4FOQA 2HWE3 2MHFA 4YW4A 3RVHA 5K7PA 5ACA2 1W6OA 1OA4A 4O7XA 4D3WA 2UWBA 5LBEA 2UU8A 2VNGA 2X8KA 5I8YA 3VZJA 1SG3A 1OLME 4CDXB 4XACA 5GLUA 4XTMA 5EYXA 4NHXA 4QXHA 3KQ4B 2UWCA 4OHWA 1X36A 4A3ZA 1PVC2 2O0OA 3IIAA 3QLQA 1RTVA 4GH4B 4PDWC 1F15A 5FYMA 3VBOB 1MS8A 3OBRA 4ZPIA 1ST8A 1RUI2 2GMMA 5JSPA 1LGBA 2IXIA 5F2SA 4YM3A 4CCDA 1G86A 5FZOB 4ATEA 5CADA 1TZOA 1TMF2 2J42A 4OQ9A 4FBFA 1CX1A 5HXMA 4W50A 2R062 4A7YA 1CQ9A 1ZRDA 1QXJA 2BGOA 2OUJA 4XE9A 3JUUA 5C6CA 2ZGUA 2G9FA 2HWF1 2P3YA 2ILMA 1SLBA 1CX4A 1LR5A 4KMQA 4OZOA 4AEDB 1LECA 2ZKNA 4RHV3 1RMU1 4XFHA 1O8SA 1UQXA 2C9AA 2XL9A 1WW4A 4GA9A 4YGBA 4YVWA 5IAXA 4Y1VA 1R091 2VULA 3UESA 4QKFA 1O59A 1APNA 4Y1XA 3CLPA 1BEV3 3SQOA 2ZJCA 4QPIC 4YG3A 3WCSA 1RHI1 1QJFA 2WA4A 2FZ2A 4LJHA 3NW4A 3VBUC 3ZN6B 2E9QA 1DQ2A 2B9VA 1K5MC 1XNTA 4YW2A 1NAEA 3W21A 1R082 1BHGA 3U75A 1QXPA 3RZLA 3RJRA 4XJ8A 1V00A 1V6JA 5FYCA 1C57A 3SITA 3T0DA 5FQ0A 2PAKA 5CKMA 2Q4SA 1OPOA 1T6GC 1CAWA 1JW6A 2P1BA 4XEZA 3JBG1 5F5QA 1BXHA 2XHNA 5SV5A 1W05A 2DUPA 3AP7A 3ZYIB 2FCVA 5G05L 4YW5A 2RM21 2VBBA 1PVXA 1ULFA 4MZUA 1SBEA 1RUJ1 2R1BA 1MQTC 2JECA 3G7DA 1V9U2 3NNJA 4BIOA 5C5TA 3VKOA 2HBTA 3USSA 1BKZA 4UI9L 5ABJC 2BJSA 2NMOA 3MIGA 4PLNA 3RGBA 1EV12 1AYN1 5EP9A 3M2MA 4DUXA 1OHFA 1UY4A 1VLNA 4OHXA 4QGNA 4Y33A 3UETA 1RUNA 1Q8OA 2VZVA 1QJX1 3JXSA 3A22A 3KF3A 5EWSA 4RQPB 4PBPA 3AKSA 3MLKA 4A4AA 4D94A 4H3WA 4QX0A 4NIDA 4I09A 2R49A 4Y5TA 4FFFA 3SCGA 1L7LA 2QQKA 5DAVA 1FPN3 1OLQA 3O14A 3UKVA 2GNBA 1H8TA 3J26N 5FTTC 1JH5A 1EUTA 2EF6A 2Q8CA 5HBAA 4XJZA 5KHGA 2WQZC 3BI3A 2IFRA 2RR11 1GMMA 2HWC1 4UWDA 1PGL1 1F5FA 5I0TA 4NRQA 5L9VA 1RUC1 4QQPA 3N7JA 2BZDA 2YY1A 2WA3A 4Y26A 4WM7B 4CPBD 4IV3A 3T2OA 5A6YA 2VM9A 1RINA 5FZGA 4O9EA 2XBO2 3MIFA 3MLJA 1ZBA2 1EP0A 1MR5A 3BOWA 4XETA 2P3KA 5FXWA 3DPRC 4BMEA 2WR9A 3RI8A 3DKQA 3K48A 1IKQA 2CAUA 2ZZQA 4FPHA 1QJY3 5E89A 5BNPC 1XB9A 2OQ7A 4BCUA 2JE8A 1ENQA 4MOAA 5FY1A 4AAPA 4FAGA 1NXMA 2YB7A 5KXDA 3B01A 3WOGA 3LB9A 1WMXA 2WYSA 4XW3A 2EVXA 2PELA 2XJUA 3AP9A 4LXLA 4QXKA 3WD5A 3WW1A 4RR3A 2YC0A 4G9SB 4PCRA 1ZZ8A 4E8DA 4C0HA 1I9RA 3BTZA 2UWAA 3AXEA 4XMAA 5J98B 2B7YA 2WRAA 4XDOA 4B29A 5CA6A 1RUG2 3EB7A 1FT9A 1AYM3 3OOXA 3HQRA 5DZFA 3GDBA 2BTVC 3N7MA 4Y5SA 1Z78A 1ODNA 2YV8A 3OTFA 5F3EA 4CZSA 1NG0A 1OFNA 3FLPA 1UX6A 3A0KA 4CUGA 3NJYA 1SHWB 4LULA 2PLV2 4JHTA 3H7YA 3KCCA 2BP6A 4QX7A 3FHAA 3NQHA 4IE0A 4WBBA 2OXBA 1UZVA 2XVKA 2R32A 2JEMA 2ZMLA 3T2TA 4N43C 4XUTA 5K4LA 3SKVA 1US2A 1YQ8A 1XNBA 2ET7A 2I07B 4YZ3A 1UXXX 2W08A 4XAEA 1HB1A 4UW6A 4YVSB 5FYBA 4ZHNA 4NPLA 3A21A 2WSUA 2WZ8A 1WCQA 3NAPB 1IKPA 1DQ0A 5T5OA 3I2DA 4DFSA 1VBC1 1YQ6A 5BNOC 2Z69A 2G9ZA 2XR4A 2V09A 4WVZA 4DEQA 4R9CA 1LHUA 2XQRA 2WYFA 2WNUB 2B45X 1IZ3A 2V4VA 2JD9A 3RZHA 3KF5A 3N3HA 5FJHA 4FPFA 1XC6A 3GJBA 4NOTA 4CEYC 2D44A 3H0OA 2XOMA 2QJVA 5GKAC 3ILFA 3ZN5A 3JU9A 1FOD3 2MEV3 1O7FA 1VAKA 1GOFA 1UZ0A 3FWEA 2DCTA 4CU8A 1W8NA 1SDDB 2AZ5A 4KG0A 4P9XA 4AXOA 1UN1A 2TUNA 4ZS3A 4ARXA 4YM1A 3IT8A 2HWD2 4GZ9A 5J48A 3T1MA 1UPSA 2JB4A 1CR7A 1OLRA 3VDAA 4WVWA 1ONAA 1QQP1 4W8JA 3WUDA 1RVF3 2E7QA 3BYWA 1S0FA 3OY8B 5FZEA 5BNNA 5K0UC 3ZXLA 1U5YA 3Q8EA 3ZYHA 5A1LA 4NHKA 1PHMA 1Q8VA 1VBB2 2BU9A 4XCAA 1ND2C 2AGSA 2VTXA 1A6CA 4OFGA 3O1TA 3ELNA 5IFPA 2B42B 4QGMA 1LTEA 1M06G 4W6WA 1DZTA 1G9FA 1REEA 2IVJA 2P3JA 5FAXA 2CGOA 3OD4A 3OJBA 4Y1UA 5C4WB 3BN6A 4IQPA 1S0IA 4FAHA 4LMFA 5JZGB 1CD3G 4ET7A 1H2MA 3WW4A 4FPYA 3ZXFA 1CZTA 5GZCA 4IEYA 4L11A 4P9YA 3WQ7A 4ISRA 3N7LA 5FZ8A 5CKNA 1X50A 4IGPA 2FCTA 4CU9A 5M0TA 4TTGA 3RZKA 4YW3A 4BOWA 1B35C 1OXCA 2HKXA 2EIEA 4S2GA 2OKXA 1IQDC 1J83A 2Y64A 4QHBA 4S2DA 3ZVXA 4CDQC 1RUF1 1QDOA 3I3DA 3NJVA 3TBDA 4YZ5A 3LZZA 1VAVA 5FK8A 4DXTA 5DAPA 2ETEA 5CFCC 2VECA 3ZFGA 1NUKA 1OOPB 4XFBA 4ZKTB 4D0QA 3AMMA 3URFA 5GZGA 4AG4A 1CAXB 1JHNA 4NHLA 4K8FA 3HQUA 2XJTA 1DP0A 3MDPA 4XURA 4BQWA 4MADA 4Q26A 3LEIA 3ACLA 1BLZA 1VBA3 5T54A 1UIJA 2RVAA 5IHRA 4MXWB 1S2BA 2R6QA 4CDXC 2WIIB 3MI8A 4QB6A 2VY0A 1NLRA 1J1TA 1W06A 4HN1A 2HH9A 4LA2A 3CJXA 4OUEA 3CHXA 4QX2A 3O1OA 3H8OA 3K46A 4GH4C 4K8RB 3LSDA 2VTXJ 2XVLA 1C3HA 3VBOC 1LU1A 1H2KA 1OQEA 2B4KA 2RMU3 2W52A 1SLCA 1SZBA 1YI9A 4XFAA 4B1LA 4XF0A 3MF9A 4YZ4A 2J1EA 3MV01 4LO8A 5A70A 4HZFA 3ZOIA 5C9AB 1J84A 2RS51 4HKWA 1DYKA 2VW1A 4AEMA 1PMIA 1PO21 1H4GA 3OUIA 4XBNA 4YGEA 4AGVA 4COWA 3T2QA 3MF6A 2CL2A 2BBVA 1YFWA 3TYJA 5LEJA 1F35A 4M4PA 4YLZA 1EYBA 3CEWA 5DAWA 4I3PA 3UKNA 2V5DA 2QZ2A 4AEDC 4S2HA 3Q8BA 2HWB2 1QHDA 1EAH3 1UKGA 4C0BA 2ZGRA 1AZDA 2VOKA 2NN8A 1IS5A 1GP4A 3AMHA 3D82A 4PLOA 1SDWA 3THCA 3VBRA 4QHZA 5IATA 1C28A 4Q4X1 3GCWA 1BMV2 1CAUB 2DCZA 4IEPA 4P9JA 3AVRA 4Q4Y2 1DQ5A 3QOPA 3OGJA 5B4NA 2QFEA 4CDUA 1OKOA 3UJOA 3BKZA 2PN5A 3I49A 3WNKA 2O1QA 2P17A 2WC2A 3ATGA 2R072 2VZQA 2AACA 1N1TA 5EFUA 5FZFA 3ZFFA 1YUDA 1WA4A 2VH9A 4UXAA 1NLQA 1UYPA 1AL23 2JKXA 4ZZ5A 3PU3A 4BB3A 4FPJA 3MPPG 4AI9A 5LBCA 1E5SA 1MS5A 2RS32 4FOVA 5LB6A 2XXZA 3RS6A 2VNOA 4D6RA 4KH9A 1JI6A 2YGLA 1I5PA 4LBQD 4UF0B 5A3MA 2LRPA 3N35A 4B8EA 4LITA 1X7NA 4Q0UA 2CDPA 1D7PM 3KT4A 1GU3A 4KWJA 1PO12 1WZXA 4K20A 2AEZA 3K4AA 1NQJA 4ZS2A 5A33A 1HXS1 1RIRA 5A7QA 1NCQA 3VBFA 2A3WA 2DCYA 1P8JA 2BERA 2LUWA 3I2OA 5A3UA 5FLHA 5FYUA 3AX4A 3KB5A 4R8HA 1HRV3 3UGFA 1RUH2 1MVQA 2W47A 1ND3A 1XYNA 3GBGA 1W6MA 4JKKA 5K8SA 2WT2A 4RQPC 4RS5A 4JGYA 1QMJA 4XFFA 3W5NA 1AR91 2VQ0A 2ZHNA 1CZSA 3FX3A 3ZFEA 1TME1 2G4IA 3EXUA 3NKTA 3O0WA 3AL6A 3B69A 3UYJA 1ZX5A 4OUSA 3ZR6A 5J96B 1JHJA 2BV4A 1Y9MA 3NVCA 4GB32 1QU0A 2NYYA 3W20A 3AP6A 4W65A 1VRH3 4LA3A 4KWKA 1H1AA 1VBD1 4C8DA 2IFWA 1QEXA 3ILRA 1EPZA 1XNCA 3RWNA 3VN4A 3LDRA 2BWAA 2D3SA 3BOPA 1RITA 4JGZB 4GMP1 3HIFA 4AEKA 3AZWA 4DXRA 2Y6GA 3BODA 4Y4YA 5FYYA 3J8F1 5JR7B 1IOAA 2TBVA 3ALQA 3LIHA 4R9AA 1STMA 3LAGA 3PVBB 5D8AA 5FZDA 4YPJA 3VBHA 3WR0A 3KV4A 3APBA 4CCMA 3Q8CA 3QH7A 1QY4A 2YROA 1N3OA 4IERA 1DLLA 4Y24A 3OGGA 2D97A 2XLFA 1R1A1 3ETPA 4WV8A 1ZRIA 3OPTA 4Q4W3 4QWNA 1AXYA 1WKYA 2J1AA 3T09A 3VHNA 4K3UA 3U0ZA 4AW7A 3SH4A 3CIHA 1QDCA 3VKMA 5KR7A 1G9AA 3S0MA 3O0VA 1UO9A 4AHWA 3U4XA 1FAYA 1HV0A 2ZHLA 1VALA 1JZ8A 3IPVA 4MGIE 2FDIA 2JD4A 4QX8A 4XIOA 1ZA7A 3VDCA 1YC61 1NA1A 3ZXAC 3POFA 2FHRA 2FMDA 3H50A 4ZONA 5ACA1 1EUUA 1B09A 1DGLA 3CL1A 1R1ZA 4YM2A 5JLVA 1SLLA 1S2KA 5H9SA 2JG9B 1CGPA 4LIVA 5HCAA 4MGZE 3HN1A 3MFAA 1UMZA 2XJRA 3O7OA 4FPEA 4DMIA 2HWE2 1PVC1 3U1XA 1JS9A 1UOGA 2QQNA 3LOIA 1YLLA 4UOJA 1RUI1 3POGA 2XJQA 2HWF3 2C9KA 3NWKA 1QH7A 4IE7A 4M0NA 5DAQA 1TMF1 4QQOA 3I3BA 4QT6A 1RMU3 2IXLA 5FO8B 2R061 4YVSC 2JICA 4ZXKA 3PIGA 1DFQA 1VMHA 2OYZA 1R093 1FX5A 3NAPC 1PZ9A 1VB4A 3FL7A 4INDA 2E7AA 4BH9A 5CFDB 4K7JA 4B3NA 3LIGA 4XMIA 2ZEXA 4HPKB 4KGGA 3S7EA 4CP2A 1RL3A 1POQA 2IXCA 1RHI3 4D7SA 4UYBA 1UF2C 4UT5A 5F7UA 2WNUC 1N1YA 1X8EA 4FFIA 1G6NA 2XMLA 5A80A 2QZ3A 4P5YA 5JSRA 1XRUA 4LORA 3F95A 2ERFA 3IMMA 5FOBB 3RZMA 2IXJA 1AX2A 2YUEA 4ZY9A 5T55A 5J09A 1BK0A 2WFF3 2BNNA 3WUCA 4BQ1A 3K3OA 4KWLA 1JODA 2BOIA 4CXWA 2GAUA 2JIJA 2OZJA 4LT5A 3M8LA 3JBG3 5GALA 1R081 2WLQA 1YFUA 3WNXA 2WZR2 4UFJA 5A1FA 1OD5A 3RYPA 5A6QA 2DBIA 1VMFA 2CY6A 2RM23 4IV1A 1VE0A 4UBHA 1RUJ3 4XILA 4EN8B 3UGGA 5DZEA 5DMYA 4LUMA 4WVMB 3K2OA 1KFXL 2IC1A 4E8CA 2RDQA 2XG3A 3EO6A 1UPIA 2DFBA 3FUQA 1AYN3 5DQ0A 4D6SA 5F1RA 2D6NA 3KMHA 3VBSA 3TEXA 3VKNA 1IS6A 1HV1A 1BCXA 5A7NA 1QJX3 2WKKA 3MV11 1VBE2 4D6QA 2ET1A 4WZFA 3HPNA 4CRQA 1KXGA 1V9U1 4QQHA 3ACHA 4Q27A 3TOJA 1ULDA 3SH5A 5F3CA 3RI9A 1V0AA 3PUHA 1EV11 3RJ2X 3LCPA 1UZWA 1UU5A 2ZGLA 2SLIA 4DY3A 5C4WC 5A32B 4P00B 1MS4A 2FQPA 5FQ0B 5JZGC 3O1SA 3WG2A 4E4HA 4XHBA 1NKGA 3ZIWA 1LODA 2F4PA 2DU0A 2RR13 1CN1A 5IYYA 1X82A 2PXJA 2BVBA 3DXUA 5EXOA 3DEMA 2VOVA 3ZYJB 5HPOA 5KC6A 4EZ4A 4BISA 1RUC3 2GALA 5F2WA 5FP4A 1YCIA 3UV9A 3FBYA 2B39A 2ZX2A 2W1UA 4ZU7A 3M3QA 5C3SA 2Y8KA 3VDDA 1WMFA 3KS7A 2D3RA 1H1MA 2XQXA 3AZXA 2VQUA 3I2KA 1IS4A 2V73A 4LHSA 4QPWA 5JVVA 4CE8A 2O14A 3TEWA 4EQVA 3VUOA 5I8SA 5KWRA 5FDBA 1C8NA 4AFAA 1OOPC 3RFRA 1XE0A 5FZAA 1ZRRA 1FMD3 1W8ZA 2XBO1 1ZBA1 2DF7A 2VMEA 4QAWA 4YW1A 2BYVE 4I0WB 4QKBA 1GANA 1S1AA 3I2HA 3PMEA 4KI5M 2YBKA 5EV7A 4CXYA 2VZ1A 1AR62 1CAVA 1ZBE2 2ZHMA 3M7AA 2J7MA 4CDWC 3CBNA 1JTZX 1H8TB 3IIIA 4NWWA 1GSLA 5FLIA 3OSDA 5DUWA 1UY3A 4PDWA 5KBFA 3WW2A 2C6SA 3J4UH 5I0SA 2W9XA 2VNVA 3IB3A 4BWOA 5JI9A 4LO7A 5C9AC 5CG8A 4MO3M 4IV3B 3PHMA 1RUG1 1SCRA 1AXZA 1LCLA 1W99A 1K45A 1A8DA 1X9PA 4IL7A 1AVBA 3NJXA 1NE6A 2DVDA 4XJUA 3Q8AA 4QGLA 3VZMA 3CZJA 5CG9A 1FXZA 4NRPA 2TEPA 2YU2A 1DHKB 1JU3A 1MACA 4JRAA 4XQDA 2LW8A 3I3MA 4ASKA 2NMNA 5IK8A 1ODMA 4CTEA 1AR72 1YJLA 2PLV1 3OF1A 2ARAA 5IUQA 3POWA 1X9TA 3NKGA 2AREA 4GALA 2CV6A 1VBC3 2DWRA 4QM8A 5KXBA 4HKOA 4QPIA 3OPWA 2XDVA 2XB6C 3SC7X 4XF4A 5E88A 3VBUA 4UW5A 3C7FA 4HSJA 5C33A 1JOBA 2RE9A 1K5MA 4IEVA 3B3QE 4BMBA 3AK0A 4F83A 2VMCA 4YARA 1ASJ2 1XOYA 1NY72 1XPWA 2BDRA 2GN7A 2VPVA 4M3CA 3SMHA 1I5ZA 1GFF2 2ZBJA 3RMXA 2CWSA 4QX3A 4JTOA 5KXCA 5JIUA 1DGWX 2BFUS 4J25A 1ZZ7A 2I45A 2RDRA 3N9OA 3T3YA 5TSWA 3OPZA 4Q0QA 5DZGA 4QKDA 3VD3A 2QQOA 5FZIA 4PJYA 5AFBA 4ZXEA 3E5QA 3I59B 1WCUA 4C1XA 5HXVA 1G7YA 1ULEA 2BQPA 2CAVA 5CKQA 2W3JA 1DQ4A 1MQTA 2A6VA 2WO2A 5DG2A 1QQP3 2VUJA 5BUVA 2WNVB 1GICA 1H1IA 4FPKA 1YXWA 4AI8A 5ABJA 4E4ZA 3UGHA 1HB4A 4PIZA 1DU3D 5FPVA 4DXZA 1Q5OA 1H4HA 1UXZA 4XIKA 4LK6A 4TSVA 2HWD1 4LUKA 2W1QA 4QKNA 2JG8B 3ASIA 3X29B 5LASA 2VBDA 3V56A 1QOOA 2Z2SB 2WZPP 2CWMA 1A34A 3GZAA 4KQ7A 1GZWB 4D7TA 2Y6JA 4F7ZA 2VXRA 4JKLA 2NM1A 2ZHKA 2LTNA 1BVVA 1YWKA 2WDBA 3MIDA 3OUJA 1VBB1 1H6XA 5GJ6A 2OPKA 2ZKLA 3U11A 5J1XA 1O4TA 2R042 1OQ1A 5L19A 4A45A 2VW0A 5GLZA 3RZGA 1KDKA 3O12A 3RYRA 2A1XA 3LEKA 4TWTA 3U07A 3AB0A 1X8MA 1EY2A 3FJSA 4FP2A 3AFGA 3U14A 2XONA 3ZSMA 5KXEA 3NNFA 2YGMA 4A42A 5F5IA 1YI7A 3WQ0A 3DPRA 2YZ4A 1RUF3 2OUHA 4LHKA 4AVTA 3HBKA 4AHXA 1XQNA 1GZ9A 4LR4A 1RJ8A 1XJAA 2JXAA 3LPFA 5BNPA 1JYNA 3B00A 2LM3A 2O8QA 1WBLA 3AYAA 4MHRA 4BIFA 3LA2A 2BGPA 4K1ZA 4NR1A 5FREA 3TNPB 1SACA 5JMOA 1VIWB 3DN7A 4X8PA 3ILNA 4AVSA 2WT1A 3HVDA 4HMZA 3PDQA 4Q0PA 4N9IA 3NV3A 3AKTA 4P02B 5B4XA 5A7WB 4LBLA 5FPAA 5LRSA 4YNIA 1Q56A 1C8M2 2VUDA 1POV0 3ABZA 2WN2A 2D93A 1D2QA 5FJKA 1SPPA 1LRHA 4BXSV 4TXWA 3OB8A 5DDJ2 1LHVA 3WP6A 5FYHA 1C5IA 4KBZA 1ZNPA 5L7OB 3ACGA 4TYSA 1DGRA 3POJA 1HIXA 3WZ1A 5CAZA 3R4DB 2NLRA 1IPKA 5FMOS 4MHUA 2JG9C 1PM7A 3RQ0A 4UFMA 3VL9A 5FZ4A 3CU7A 2RS53 1MEC2 4NPRA 1UIKA 4NPMA 3JB8A 3O1RA 3LEGA 2A70A 1PO23 4I2OA 2DCJA 2HEVF 4E2SA 3D3AA 3CO2A 2EICA 4N43A 5IVJA 1S0CA 2QQPA 2Z4FA 3OGVA 4AWDA 1UCXA 5FY9A 1SFPA 5KHHA 4DPNA 2VZTA 1AX0A 1GQPA 5ANQA 5JSOA 2KXLA 4EWAA 2R16A 4JDOA 2Q8OA 2EXIA 1TQ5A 2WT0A 5BNOA 3MLLA 1CVNA 4Q4X3 1JYTA 3MUZ1 4CCJA 3PIJA 5CFDC 4OI1A 2Q8EA 3D8CA 3NV1A 5IK7A 4L0PA 4YWAA 2VOXA 1UMHA 5LW9A 1UKRA 2HWB1 5IWFA 4QD2A 5AVAA 4DS0A 3TB0A 5T52A 4BQ4A 1ZREA 3VHOA 2TNFA 5A3NA 1JYWA 3MO4A 2ZEZA 4CEYA 1BMV1 4JVAA 3WG1A 3R4UA 3QH6A 4Q1PA 4Q4Y1 5C3PA 3ROUA 3KVBA 3MHZA 5D2AA 3M3OA 1EAH2 1ZZCA 1V70A 2G9GA 3V0AA 3KT7A 2ENRA 2GMEA 2RG4A 2W0XA 5FCCA 4QU2A 4XOGA 3DUIA 1FV3A 5CIRA 3I54A 4CA9A 2R071 4FXKB 2WN3A 4GIQA 4JTNA 4LTAA 2UY8A 4BQ3A 1LKNA 3AYDA 2XLAA 3D6EA 3E6BA 3VD9A 1HXS3 2W2IA 2JDMA 3HMYA 2VOTA 2GZWA 4WM8B 5K0UA 2RS31 1LGCA 3HBZA 3ZO0B 4LQRA 4AI2A 4BJ0A 2D43A 4N53A 5EHDA 4EN0A 2VCCA 5A3WA 3N7KA 1PZ7A 4OI0A 4YGCA 3JD72 4XFIA 1PO11 1ND2A 4CDUB 4MH0E 5B2GB 2A6WA 5JIAA 4LK7A 1AR93 2YG0A 1YFYA 1TME3 1Y9QA 3GHMA 4P9IA 4Y20B 4YM0A 4UFIA 1RUH1 2WO7A 5FKCA 4MGKE 4R52A 3WQBA 2BPA2 5FYVA 4MX3A 1W6PB 1BK1A 1RXFA 3VD4A 4MGTA 4HANA 2WAAA 3HAGA 2JIGA 2VMGA 4DRRA 4AF9A 4EE2A 2Z42A 1LNSA 4UAPA 4AE2A 1B35A 1LHNA 4CCCA 5FWEA 1KJLA 1OBNA 2EXJA 2VR4A 1GR3A 4GMP3 5BXXA 5JXJA 3TAYA 3C7EA 4GB31 3HNYM 4N7UA 3USUA 4CDQA 4CP9B 5LY1A 5LEKA 3J8F3 1G9DA 3LGRA 2QKDA 3AFKA 5CB7A 4DUWA 4AI1A 3KV5A 3L9JT 1CESA 2V4AA 5CFCA 4BM8A 3U37A 5FOJB 1IG0A 3T1LA 2A75A 4XUQA 3TN92 3V0BA 4B1MA 2UYAA 4E2GA 1R1A3 4XF3A 4OQ8A 5FO7B 1W03A 4QX1A 2X5IC 1SCSA 5A3LA 4B7EA 2ZOEB 1PK6B 4CDXA 4CU7A 2W46A 3WDVA 2JDNA 4NAMA 3L2HA 2ZGOA 3PL0A 4Q4V3 3KGLA 3ACFA 4RL7A 4ASMB 1UOJA 3FHIB 2X29A 5AC91 4GH4A 3TRSB 1W9FA 3INAA 1BQPA 4N8MA 3VBOA 5ACA3 3D5OA 5C8CB 2A5ZA 1E57A 2H6BA 3DGTA 4PI0A 2ZTNA 1HRI2 1UZYA 4NRMA 2WS92 2W94A 5FMDA 1LOEA 4COYA 4LOSA 2NQYA 3WP5A 3ME2A 4DIQA 1RUD3 1NT0A 1W6NB 2Z5WA 4MXVA 1V6NA 4N90A 1PVC3 1YRZA 4OVEA 4IE4A 2YPJA 3TWIA 4MV2A 3WDUA 4V2VA 2WNEA 5FUIA 2P3IA 1PIV2 1Q43A 1RUI3 2PHDA 4L97A 2WWUA 2WL1A 3LDKA 3WDTA 4CYDA 1I6XA 5FWJA 3H8XA 3MYXA 4AEDA 5HV4A 4C1WA 3VHRA 1F4AA 2F4LA 1TMF3 4Z1VA 5LWBA 3WSOA 3PUIA 2HWE1 3OUHA 2R063 5DXDA 4META 3VKFC 5EYYA 1W0PA 2GDFA 4EROA 1W28A 1H30A 4LPLA 5FY7A 2D5FA 2DFCA 2DTWA 4IGQA 5EJ1B 4DB5A 4ZZ8A 4NUBA 4YG6A 2XUEA 2P2KA 1FI2A 4RD7A 4BHPA 1U5XA 2ZXQA 4CEWB 1HQNA 2JDZA 3ZN6A 3AYCA 1WD4A 2D6PA 3GGLA 3HT1A 5FBJA 1OMIA 1OUXA 4B7KA 4XXAA 1Q3EA 4Y22B 4XFCA 3KD4A 1ALYA 3GXUA 5ISLA 2DCKA 1HLCA 3U10A 1VPHA 2VZSA 4LHLA 4BLIA 3WF0A 4LBQA 3J9SA 4RSUA 4CCNA 4DUVA 4LNVA 5A7SA 5L36A 2F6BA 1W3VA 4BYYA 3B9IA 1ZRFA 1R083 3LDBA 1ENXA 1US3A 1QIQA 2GH2A 3EYPA 3VB9A 3IAQA 3U78A 2Y38A 4HBNA 1OA3A 2WQ4A 1NZIA 3WXPA 4GKYA 2V5YA 2WNVC 2ZABA 1G8WA 4LE4A 3ZPYA 5BYNA 5FV3A 3SNMA 2ES3A 3FZ3A 1AUYA 3QD6A 2WZR1 3MIHA 4Q0VA 5FMBA 5SV8A 1TE1B 4DQAA 3DL3A 2JG8C 2WFF2 3C7OA 3LFIA 2BWCA 3SEPA 2VMFA 4EN7B 4RQPA 1W2UA 3GBWA 4M01A 1V9U3 5D21A 5F6LB 4XJ9A 1RUE2 1SBFA 2FBEA 1EV13 1GWMA 2Q8DA 2VD7A 2E31A 2Y6HA 4XC9A 4GWJA 4CUAA 1UWWA 3LF7A 4PIXA 1MZEA 1VB2A 3H1MA 1A78A 4CVUA 4NIGA 1W2AX 1VBE1 3BCWA 3OYWB 4LO4B 3WHTA 3RWKX 4B4RA 3BTAA 1H2LA 2FMYA 4L2NA 5GLTA 1Y9GA 3U4SA 3GHNA 1F31A 3E6CC 1C1LA 3HNMA 1OA2A 3BU7A 4NMIA 1NCRB 1O4YA 5I91A 3LEMA 4BPZA 2D40A 1SBDA 1HJGA 2IWGB 2W1SA 2ZX4A 5E1RA 2VJXA 2HYKA 1S4CA 2EIBA 5EJZB 4EWDA 5ERLA 1TVGA 1D4M2 2VBPA 3BIWE 3JQWA 1UOFA 4IESA 3IDCB 2G19A 2VZUA 1ULGA 5C8WA 4ZU5A 4G4FA 3DXTA 1QJU2 5HV0A 1Z7S2 4SBVA 2XBO3 4I01A 1ZBA3 4AOCA 5LRRA 5LA1A 3A0NA 5FZ6A 4TLFA 2YDEA 4GJZA 2ATFA 3PUSA 3AYEA 5FZMA 4K1YA 1WWYA 3POIA 3J7NA 3C2UA 3KM5A 3BVCA 2VO5A 1KS4A 1W9SA 2SBAA 4E9KA 5L7OC 2JDAA 2ZGPA 4V1PA 4DEVA 1A3KA 1AR61 3WDXA 1ZBE1 4GAZA 4QMAA 1GNHA 3GBFA 2WFPA 4HK8A 3CJIA 1FMD2 1RUG3 3ACIA 1LOFC 3OBZA 3WQ1A 4O9GA 5J7MA 2HYXA 5FRAA 4A41A 2YHJA 4P14A 5JOXA 1AR83 1COV2 1C1FA 3AP5A 3DKWA 2KA3A 4DOUA 1REDA 2X10A 4Z2WA 5JOWA 4FP3A 5F37A 4AQ2A 4YVSA 3T08A 2ZX1A 3RNSA 2PLV3 1K3IA 4BQYA 3NAPA 1XU2A 2R0HA 3IZOA 1IHMA 4FQZA 4EV0A 1NX9A 4PQQA 5JCTA 1H6YA 1D0HA 1SMVA 1TNRA 4HXCA 2WNUA 1AR71 4E4DX 4O61A 2RS12 4NIAA 1CIYA 1KQRA 4LKFA 1GOHA 4MGSA 4WM7C 4NIHA 3ZSEA 2VZRA 3RRDA 2B8MA 5CNAA 1GKBA 4GWNA 2VC9A 3S5AA 1O3QA 3IN9A 5C71A 2KR2A 2PHUA 2X09A 1JU4A 2D6OX 4OMCA 4YRDA 3H3UA 3WP3A 1AF9A 3THDA 2W91A 2AYHA 5FFOC 4AEJA 4KGQA 1O3SA 4HVRA 1J3RA 3ZR5A 1ASJ1 3NV2A 5C70A 2FDGA 2F17A 2ZMNA 1JMUB 1NY71 4JDMA 5FP8A 3V64A 5A3TA 4Y1YA 4A6SA 4BA6A 2GC0A 3TNQA 5KHJA 3FHQA 2ZAAA 4CXXA 1H8VA 3JB4C 3KCXA 4ISQA 4TZDA 1BBT2 1REFA 4WM8C 4CP1A 4LBMA 3LQCA 3PVNA 2ZX3A 3PURA 4Q8KA 1JZ3A 1OC1A 1QNYA 2IZWA 2HWD3 1JYXA 2VG9A 1OT5A 5KHIA 2Y6KA 1PM4A 2DTYA 5FPXA 2W39A 4CDUC 2BOJA 3NNGA 4OLLA 4RFT0 1WW5A 2PHTA 4GXLA 3H1YA 1W6QB 4H2AA 1LB2A 2XLGA 5APAA 5C4WA 1WMEA 2WO3A 3POBA 2OX0A 4KG8A 2FDFA 1W0NA 2W68A 2ZEWA 5JZGA 4FXGB 3RMYA 1OH4A 1VBB3 2D7FA 4QPGB 1F2NA 5CU1A 2HBUA 4HK9A 4IGOA 3HR9A 3BPSA 4L8QA 2D6MA 1W39A 4FOWA 1W6OB 4BDVB 2PHWA 3ZDVA 5J37A 4FPGA 3K75B 5A6XA 5FYZA 5L9RA 5JOZA 4PF1A 4U36A 2R041 1OD3A 1V6MA 2JDPA 4Z2AA 4XQWA 4XAAA 5FUPA 2YPDA 2BFUL 4ORFA 3KZ4C 5LA9A 4EYUA 1PX4A 5C3RA 3H9AA 2W87A 5LK7B 2JDYA 1OOPA 1W8UA 2GN3A 4XF9A 1XYOA 2W92A 1FYUA 4Y4RA 2GSYA 3CF6E 4BK5A 2VZOA 1M4WA 4CP0A 1CAXA 4FSJA 1S55A 4UBGA 4GJYA 3O0XA 5JDBA 1TG7A 1CWPA 3NO8A 4RHV2 4LBKA 2VAUA 3ZIXA 1YQ2A 1PK6C 3H7JA 4CDWA 5FZ0A 3NV4A 4LHNA 1DQ1A 3MGUA 3HEIA 4XBLA 3T0BA 5IVCA 4Q1RA 1BEV2 1S0DA 5BNQA 3C7HA 3ZSJA 3IDEA 4DXSA 1BJQA 4XZUG 5C8CC 3A23A 4AR2A 3ZKYA 5FY4A 5FPZA 5C9AA 1V6IA 2VGDA 3CQOA 4YVWB 1GWKA 3E5UA 2PTMA 3ORJA 1C8M1 1RXGA 4NJ4A 1PNGA 1PZ8A 3N36A 4HVQA 3WEZA 1AJOA 5DDJ1 5IVVA 4NO4A 5EQUA 1F8VA 4FVVA 1SLTA 4XBQA 3K51A 1LAJA 4QQLA 4XTPA 3WG4A 2D98A 4HKLA 1MEC1 4AGRA 1I1EA 2A7AA 4OULA 2BW8A 5GLWA 4N7IA 2GMPA 1LESA 3MPBA 3OBAA 1CAUA 1ULCA 1CAWB 4W6XA 2PMWB 2E63A 2YMZA 2UYBA 4QDRA 3KGZA 2N7GA 2ORZA 5FK7A 1G9BA 2PA7A 2WO1A 2HWC3 1O5UA 4CEWC 2HWB3 1NYWA 2L9LA 5CEHA 1DGRN 4LOTA 2K46A 2QCSB 4BQ5A 2YYOA 3FC0A 1AJKA 2ZMKA 3L2YA 3PUAA 4AFMA 1NLSA 2XWJB 2VQTA 1BYHA 3N9QA 4HSLA 4CUBA 2KD7A 1FNZA 4Q4Y3 5F8PA 5IFTA 1RB8G 4IEXA 2Q30A 3I4IA 2VMHA 3WW3A 3VV1A 4EN9B 1FPN2 3I3QA 4Q5OA 1PGSA 4UF0A 4LKDA 4XJWA 2R073 3MW3A 3O1VA 4YYOA 3UL2A 2A73B 3HT2A 4HFSA 2BNOA 4H55A 3FN9A 1UU6A 1EAH1 2CU5A 2VUAA 3J7MA 3OCPA 3OG2A 1JZ2A 5FMOL 2PFWA 1KD7A 2RS33 4FCAA 4AAXA 5FXXA 3LWCA 2G1MA 2J1RA 4J1XA 2R7EB 4KWUA 2E26A 2D3PA 3MFCA 2P34A 4K9SA 1PO13 4N9HA 1JN2P 3AM2A 3MBWA 1QJY2 4Z8BA 1IPJA 3OD0A 4Z92B 4M0HA 3ITQA 3AC0A 3ZYPA 4L9BA 2AC1A 1Q8PA 4S2FA 2R0FA 3ZYBA 1POV1 4BLJA 1HDKA 1Y4WA 3JD71 4FFHA 3OGRA 2NPIA 3FFQA 2OT7A 2VCAA 1JYVA 5FY0A 4A44A 3AJZA 1D0GA 1AYM2 3ENRA 4OHYA 4FFGA 2C26A 1JYIA 4J1WA 4GWMA 5FZ1A 1G9CA 1ZVFA 2A3XA 2VZ3A 2HJIA 4GB33 4PLMA 2AENA 4RR3B 5FY8A 4MVTA 3S6PA 1NCRC 4ATFA 2QTWB 4TLGA 5JUVA 1VRBA 2CYFA 2P5BA 1Y7BA 1YYNA 3KWVA 4N53B 4EN6B 5LA0A 2WZEA 3VD7A 3NSTA 5H9RA 2WINB 1H2NA 3NNMA 3UKTA 4X6QB 4XUPA 1E5RA 1FV2A 3EMRA 3MIEA 1LJ7A 2DVGA 2FZ1A 2Y33A 2Z79A 3NRUA 2YXSA 2BBAA 3TN91 5JAXA 4FPOB 5H9QA 1J3PA 3AP4A 5LBFA 5AC93 1DDLA 2XVGA 3QBQA 4HVOA 3T2PA 3WG3A 3M3EA 3PVEA 5F3GA 4IXLA 1E5HA 2VCMA 4CPBA 2A6YA 2JG9A 2IVIB 2W95A 1MVEA 2YU1A 3EJKA 4CUCA 3AL5A 3MEPA 2AR6A 4CCKA 4F8AA 3BTXA 2HEYF 2OZ6A 1QOSA 2EIDA 4A3XA 2ZA9A 5FZBA 1W9TA 1J58A 3WP4A 4AFBA 3D0JA 2C1FA 3H42B 4LBOA 1FOD2 2MEV2 2ZGQA 4LO5B 4YG0A 1HRI1 4Q4V2 5E8AA 5F32A 5D1IA 3B94A 1KDMA 1RJ7A 2WS91 2RDNA 3KT1A 2QQVA 3V65A 3WX5A 2LALA 3LE0A 3MUY1 3WF1A 5LATA 4GWIA 1RC6A 1WLDA 4NIIA 1Y43B 3H1WA 3TEYA 3WNNA 4EWEA 4P9LA 3WDWA 1PIV1 1VJ2A 1W8FA 5CFDA 1UYXA 2P6CA 1MZ5A 4Q29A 4F3JA 4P9GA 1RVF2 2A3YA 3DV8A 4HPKA 4JCKA 3VZKA 1LU2A 5K9YA 3LPGA 4XQ4A 1SEFA 3ZYGA 1RUD2 2VU9A 1OSGA 1CONA 3SKJE 1K42A 2AH2A 2CHHA 1RYYA 1LOGA 1GZCA 2ZGKA 5LK5A 3IAPA 4BQXA 5A3OA 4JGZC 4H14A 3TEZA 1W2NA 4BZ4A 3IDBB 5CYYA 2WNOA 4ITCA 4XDQA 5BNNB 2X05A 1IG3A 3J7HA 3R4SA 4IEOA 5FUNA 2DVFA 2YC4A 4A7KA 3LSEA 4LLOA 2OQ6A 5HCBA 2XPJA 1QH6A 4L99A 4B4PA 2ZS6B 4BK4A 3A7QA 3EHKA 4OI2A 4ZU4A 2XJVA 4AQ6A 4OI4A 5CZKA 1K12A 1K5JA 4IUGA 5F3IA 4Q8LA 2Y0OA 5FKBA 5DG1A 1JZ7A 1J3QA 2DBNA 3JZVA 5LY2A 5JWPA 1W2TA 4JDNA 2QUOA 3WNPA 4WVMA 3DYOA 3E1F1 1XSRA 4IDZA 4IETA 2CTVA 1GV9A 2JB8A 2WZR3 4OUMA 1MS0A 1W8TA 3WF4A 4AYUA 5HCHA 2ZGSA 1OUSA 3GZEA 3ECQA 4OMDA 4XUNA 1QF3A 3E6DA 1DYOA 3WNOA 3SHRA 1NE4A 1KRIA 2AEYA 4WZCA 4NWVA 3GJAA 4FT8A 2QQWA 2W5FA 4P9WA 3VLBB 5FXVA 5A32A 2WFF1 4LO6B 4R9BA 3WF2A 4LBQB 1VBA2 1VBE3 3AMPA 1HN1A 4QPGC 1S0GA 1WCDJ 1LHOA 1IPSA 3UT0A 2DVBA 3ZFGB 4QM9A 1GNZA 1RUE1 1YFXA 2XWBB 1CJDA 1VR3A 4Y3OA 4QB1A 2JJ6A 5I0UA 3RPQA 1N1VA 5BV6A 2RMU2 2VNRA 4XABA 3POYA 1S0EA 4P5HA 1MS1A 4H7LA 2B46X 2GNTA 1LENA 4FPLA 1OURA 2GC3A 1H0BA 2UY9A 3KV6A 5DN2A 2EXHA 4ASLA 1QJEA 2JENA 4JV4A 2WJSA 2OA2A 2XUMA 1W8OA 3S57A 2WQ8A 2GP3A 2PQSA 2C24A 2X5IA 3CMGA 2PAMA 1UY1A 3HNBM 3S30A 2JE7A 1D4M1 2H6CA 3AKRA 4I02A 1O4ZA 5JXIA 5IK5A 1N3QA 1D4VB 1WUVA 2QQIA 3MZHA 4XFGA 4IEZA 1QJU1 1UMIA 3T0AA 1Z7S1 4GULA 1OH3A 4JC1A 4EZHA 5FYIA 2P6HA 4YGDA 1KITA 1XE8A 2E51A 1DBNA 4IW3A 4QHOA 5EPAA 3SCFA 1UY0A 4MUVA 1AR63 1ZBE3 5J3UA 1O3TA 3VBRB 4J6GA 4YVWC 4AQSA 4LIUA 4I30A 3WCRA 2E53A 2XGXA 3WLUA
chains in the Genus database with same CATH topology
3J7NA 1STMA 3J7MA 1ZA7A 4NIAA 4OQ8A 1YC61 1A34A 3J7LA 1JS9A 1CWPA 4OQ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J7N A;  1STM A;  3J7M A;  1ZA7 A;  4NIA A;  4OQ8 A;  1YC6 1;  1A34 A;  3J7L A;  1JS9 A;  1CWP A;  4OQ9 A; 
#chains in the Genus database with same CATH topology
 1QNW A;  4XF1 A;  5AFE A;  1AL2 2;  1TNF A;  3N9M A;  4D8M A;  4K6B A;  2P4E A;  3JCI A;  5F5C A;  1CPM A;  2ARX A;  5JMC A;  1MS9 A;  1BVP 1;  5HCF A;  1FMD 1;  1IS3 A;  4MGQ A;  1PGW 2;  2VXJ A;  5ANN A;  5G04 L;  5IVB A;  3ZFF B;  1XNA A;  5A3P A;  3AKP A;  3VGI A;  2RJL A;  5I8T A;  1VAM A;  1COV 1;  4NN0 A;  4ARY A;  1OFS A;  4RYD A;  1OLM A;  2D6L X;  2K0G A;  3B7M A;  2MPF A;  1U0A A;  4R9D A;  1VBD 3;  1KJR A;  4HLT A;  3WDY A;  3MW4 A;  4JQR A;  1T2X A;  1UOB A;  1AR7 3;  4Z82 A;  1HRV 2;  1AR8 2;  5CVR A;  3D0S A;  5IJR A;  3ZYR A;  5FXZ A;  1XNK A;  3H3L A;  1SFN A;  5A33 B;  3GYD A;  3KQR A;  1NCQ B;  1SLA A;  3EBR A;  4YZ1 A;  1J1L A;  1OKQ A;  1OF3 A;  3P3P A;  4XXP A;  3VBF B;  4QB2 A;  5A6Z A;  3CJI B;  2RV9 A;  3RYK A;  4IE6 A;  2BRT A;  3HN3 A;  2RS1 1;  5I93 A;  1V6K A;  1ASJ 3;  1CIW A;  1ND3 B;  1YQC A;  1WMD A;  1QOT A;  2E32 A;  2RJ2 A;  1W6M B;  3WF3 A;  2J22 A;  5JPN B;  3I59 A;  1YEW A;  2ZGM A;  1GP5 A;  1VRH 2;  4RS5 B;  2DU1 A;  3QAC A;  4IE5 A;  4JGY B;  5JR2 A;  1N3P A;  4L92 A;  3ZFE B;  1KEX A;  1IGO A;  2ZEY A;  4JQT A;  2WNV A;  3T4H B;  1C5H A;  3LA7 A;  4QDS A;  4HON A;  1FAT A;  3ZSK A;  4RFR B;  2WAB A;  1UZZ A;  2DUR A;  2Q0A A;  3PMS A;  1ACC A;  2CDO A;  1H8T C;  1ULO A;  3N9P A;  5BPX A;  2JG8 A;  2EIG A;  2OW4 A;  2Y0I A;  1W90 A;  3FUO A;  4FTE A;  1GZW A;  1BBT 1;  3A4U A;  5FZO A;  5A7P A;  3I2J A;  2K9Z A;  3O5S A;  4WVV A;  3ZDS A;  2QQJ A;  4HG6 B;  4IV3 C;  4Q4W 2;  2PYT A;  3AZZ A;  2P37 A;  1LOB A;  1YQ5 A;  4UFH A;  2ARB A;  3H3Z A;  1HX6 A;  3VBH B;  5D8A B;  1DIW A;  5T3N A;  3ZM8 A;  3O1M A;  1HN0 A;  3IMN A;  3OGS A;  1L7R A;  4R4X A;  4AQT A;  3OEB A;  4H7M A;  1OF4 A;  2DUO A;  1NXD 1;  1QXR A;  3P3N A;  2LS6 A;  3ETQ A;  4OHV A;  3IM0 A;  4UFL A;  4URT A;  4SLI A;  1E5I A;  3P1I A;  4D7Y A;  4JKM A;  4V2W A;  3RZZ A;  3W5M A;  4COZ A;  3E5X A;  1UNB A;  2H0B A;  2VMI A;  3PU8 A;  4CSW A;  3ES4 A;  1GP6 A;  4LLF A;  2EAA A;  4RR3 C;  4W6Y A;  2R04 3;  3VZO A;  1ENS A;  1ZA4 A;  3IPV B;  4ES8 A;  2BUK A;  1NA1 B;  4AL9 A;  4N53 C;  4NRO A;  2VCB A;  1PX3 A;  5FZK A;  1SQ4 A;  1Q8Q A;  5DAX A;  5FMC A;  3LKJ A;  3ZXD A;  5I0R A;  4M00 A;  4B4Q A;  3THP A;  2HWF 2;  3VKL A;  3WHU A;  5CBL A;  5F39 A;  3DCQ A;  4A6O A;  4XUO A;  1WCS A;  2E33 A;  2XL7 A;  3H8R A;  3ZXJ A;  1GUI A;  1OQD A;  1RMU 2;  2E7T A;  1LOC A;  1HQW A;  2O8O A;  3NJZ A;  2QNK A;  4LEJ A;  3LFM A;  4OZX A;  3ES1 A;  3HD8 B;  1R09 2;  3M1H A;  3P6B A;  4XZP A;  5A7W A;  3ZPO A;  4COU A;  5DPN A;  4LKE A;  3AMQ A;  1BZW A;  2KM2 A;  4RGK A;  3PJQ A;  4Y5Z 0;  5L7O A;  1RHI 2;  4RHV 1;  4JRL A;  3OBT A;  4YFW A;  2WWS A;  3T30 A;  2PHL A;  2GND A;  1NQD A;  1LOF A;  1JUI A;  3RSJ A;  2XH6 A;  5EZW A;  1C8M 3;  1W3X A;  1U12 A;  2A6X A;  3EQE A;  1BEV 1;  5DDJ 3;  5FZL A;  1UYZ A;  5FY5 A;  1FNY A;  4C91 A;  5FYS A;  5JXH A;  1S0J A;  2ZAC A;  4MG2 A;  1CZV A;  1ZZ9 A;  4C90 A;  4X8N A;  1Y3T A;  1S2E A;  3PTR B;  3ZX7 A;  4EJR A;  3JBG 2;  3VZN A;  3F2Z A;  5GZF A;  5T5L A;  3D4K A;  1JZ5 A;  1MEC 3;  3C8X A;  1YJK A;  4AVV A;  1JXN A;  2RHP A;  2RM2 2;  4RA0 A;  1N47 A;  3FE5 A;  3GNE A;  3M3C A;  1RUJ 2;  1XXN A;  1GBG A;  3M3I A;  3ON7 A;  4JX0 A;  4CDW B;  1GYK A;  4XDP A;  2IUW A;  3RG0 A;  2RJK A;  3FBM A;  3R6S A;  1GWL A;  4O65 A;  1AYN 2;  2OPW A;  4Y1Z A;  5JOY A;  3O1P A;  5LA2 A;  1OVS A;  1UY2 A;  3E97 A;  4DRV A;  4BQ2 A;  4UW4 A;  4CU6 A;  5CIS A;  4WM7 A;  1QJX 2;  2QE3 A;  3M70 A;  4IV1 B;  5E6H A;  4AK3 A;  2E6V A;  2PHR A;  4AGG A;  1O91 A;  3UNP A;  1DCS A;  3POE A;  2GH8 A;  2H0V A;  2X53 S;  2V72 A;  3K4Z A;  5FLJ A;  5BNN C;  5I0D A;  1W8W A;  2QVS B;  4NE9 A;  5FZH A;  4TN7 A;  1LOA A;  3CKH A;  3VBS B;  2Y6F A;  4A2U A;  4E27 A;  3W58 A;  1OVP A;  3DYP A;  3JQX A;  4E2Q A;  2RR1 2;  1O3R A;  3AZY A;  2HWC 2;  1UL9 A;  2ADD A;  3ZYF A;  5AC9 2;  3C7G A;  3ZXG A;  4DZG A;  1W0O A;  2K2S A;  1PGL 2;  4WM8 A;  1RUC 2;  1VMJ A;  3I8T A;  4A7Z A;  1LED A;  1VP6 A;  3AVS A;  1FPN 1;  3C3V A;  3ZMN A;  4PI2 A;  5DUV A;  5DUU A;  2CGP A;  2DV9 A;  2B5H A;  2W1W A;  3FLR A;  3AZV A;  1SFY A;  3WV6 A;  2VVF A;  3ST7 A;  4LBN A;  1YNA A;  3W59 A;  1W04 A;  3N4M A;  2FCU A;  4K21 A;  4RGG A;  3VDD B;  2BVV A;  1PNF A;  2YBS A;  2UUR A;  2J1V A;  4Y20 A;  1POV 3;  3BUC A;  1OPM A;  3K4D A;  5F6K A;  3JD7 3;  5GM0 A;  1JOJ A;  3DYM A;  5C3O A;  4XVH A;  2FD8 A;  1QJY 1;  1W6P A;  1MZ6 A;  3ZFG C;  2JE9 A;  2XHK A;  3DEC A;  3I2I A;  5DAB A;  1N1S A;  4OYU A;  5EJ3 A;  1O6U A;  1XU1 A;  1D2S A;  4M3C F;  1H9P A;  2A71 A;  4IEU A;  4W4Z A;  4FTB A;  1O5L A;  3AJY A;  4CCL A;  4CP9 A;  3WY6 A;  2Y26 A;  1CAV B;  2OII A;  3DF0 A;  4M4R A;  5LZ6 A;  4RN5 A;  4YW7 A;  2C0Z A;  4QX5 A;  1AYM 1;  2ID4 A;  2VTF A;  3I2G A;  3B93 A;  4PDW B;  5GLV A;  1ZRC A;  2VL4 A;  3ZLI A;  5C3Q A;  1W9Y A;  1J59 A;  1KFU L;  5L9B A;  4NAO A;  1IQA A;  2D6K A;  1T6B X;  1RUO A;  2IXH A;  4ES9 A;  3N9L A;  3GF6 A;  4X6R B;  1V6O A;  2Q1Z B;  2D5H A;  4AZZ A;  4QU1 A;  1A8M A;  1O8P A;  1W8H A;  1PK6 A;  2YC2 A;  1YIP A;  2XJP A;  4KBB A;  5FPB A;  3G6J B;  5IW0 A;  5LCW L;  3BGA A;  3TN9 3;  1VBC 2;  1LUL A;  1XSQ A;  3K77 A;  1EPW A;  1ZZB A;  1YHF A;  5C8C A;  4I3G A;  2ADE A;  3SXW A;  3FFZ A;  3NL1 A;  1X33 A;  5DUX A;  3QCW A;  5FZC A;  5C5U A;  1WD3 A;  3OY8 A;  1QWR A;  4Z07 A;  3VBR C;  3WIN E;  3WVJ A;  2WLP A;  2VZP A;  2DUQ A;  1W6N A;  4PHZ A;  4QPI B;  1WGP A;  2EAL A;  4LE3 A;  4MGY E;  5A7O A;  3UJQ A;  3WT3 A;  2LRO A;  3WNM A;  5JXG A;  2BEO A;  3VBU B;  2IXK A;  3BU0 A;  2JKB A;  3HOB A;  1GOG A;  2QBX A;  2Y34 A;  1K5M B;  1DQ6 A;  1HRI 3;  1GLH A;  1Z0H A;  2JX9 A;  1WCK A;  3NMB A;  2NZ9 A;  2WS9 3;  2WWJ A;  2XKO A;  4PQ9 A;  3GAL A;  5FP7 A;  4Q2F A;  2PQQ A;  4M3C B;  2ZAH A;  2NP0 A;  4QXC A;  2B9U A;  1HJF A;  5C7G A;  1WA6 X;  1UAI A;  3ZFF C;  1ZYB A;  2YBP A;  3ZXE A;  1PIV 3;  2Y6L A;  3M4F A;  1QQP 2;  2VVD A;  2XKP A;  3PUQ A;  1FOD 1;  1AHS A;  2MEV 1;  2QDR A;  4KL1 A;  4PF5 A;  2FDJ A;  4Q4V 1;  4YZ2 A;  1JZ6 A;  1MS3 A;  4CEW A;  1NZC A;  3GCX A;  3BPZ A;  3LOB A;  3FLT A;  3KHB A;  1WBF A;  2JDU A;  2C5D A;  4JAA A;  4Y22 A;  5LBB A;  4KNC A;  1MQT B;  5J36 A;  1UU4 A;  3B02 A;  2VE1 A;  1RVF 1;  1NCQ C;  2CGN A;  3HJR A;  4MYE A;  5ABJ B;  1PMJ X;  3VBF C;  2ZPX A;  1RUD 1;  3I2F A;  3CJI C;  3S5Q A;  4FQ4 A;  1UW8 A;  3UK9 A;  3Q9O A;  3GZU C;  5JPM B;  5IAV A;  3POS A;  1UYY A;  4AFC A;  4LBJ A;  3I97 A;  2MNG A;  4U2A A;  4QPY A;  3WNL A;  4M3C E;  1ND3 C;  4BU2 A;  2ZZJ A;  4QDQ A;  3ZXK A;  1JUH A;  1UD1 A;  2J1U A;  4K40 A;  4PT6 A;  4RS5 C;  4JGY C;  4URA A;  1V6L A;  1YIF A;  3MW2 A;  4AHY A;  3CZU A;  3ZFE C;  4YFZ A;  5IVY A;  3KV9 A;  4MXW A;  4PIY A;  2DDU A;  4XYX A;  1WLW A;  1GZT A;  3SH3 A;  1HB2 A;  4MSV A;  3R05 A;  1L3J A;  4MLO A;  5FYT A;  1RUF 2;  1MZF A;  3H8U A;  4FTS A;  3HWJ A;  5HI0 A;  5EIY B;  4YW6 A;  4CCO A;  3RZJ A;  1Q8S A;  1URX A;  4DY5 A;  4KU8 A;  3BTY A;  1RGS A;  3CNA A;  3THT A;  1LGN A;  1LHW A;  2WSV A;  4IEQ A;  5JI7 A;  4AFD A;  5IT6 A;  4PBO A;  1AL0 G;  3DPR B;  4HOO A;  3N9N A;  3BAL A;  3VBH C;  5D8A C;  4GKX A;  5FP3 A;  5KC5 A;  5BNP B;  3OYW A;  3PTY A;  5FO9 B;  3PLQ A;  1NOV A;  1U5Z A;  1WLT A;  2JDK A;  3B5L B;  4I0A A;  2GC1 A;  1HB3 A;  3J7L A;  4AVC A;  1RUE 3;  5GZD A;  2EXK A;  1UX7 A;  5IVE A;  3VL8 A;  2CSG A;  2PAE A;  4GD4 A;  2R30 A;  1NCR A;  1ENR A;  1VBA 1;  5E16 A;  4JZR A;  3VZL A;  4DNY A;  2RS5 2;  1DF0 A;  1WW7 A;  1ZZ6 A;  4FOY A;  1JBC A;  5KHK A;  3R0R A;  3P5B A;  1QJZ A;  2ARC A;  1NA1 C;  1SPP B;  2QQU A;  1PO2 2;  5IVF A;  3O1U A;  2RMU 1;  4KU7 A;  1YO8 A;  4BE3 A;  1L7Q A;  4UFK A;  4XJA A;  4AVB A;  1JZ4 A;  3KHC A;  2HLE A;  1D4M 3;  1WLC A;  2GC2 A;  4HET A;  5T5P A;  4GMP 0;  4FI9 A;  3IDA A;  4NHM A;  1DLC A;  1HQL A;  3I7D A;  4Q4X 2;  3ZMO A;  5FPU A;  1F4H A;  1S0B A;  3SCH A;  3GZT B;  1QJU 3;  4D69 A;  5IK4 A;  2RDS A;  4N43 B;  1Z7S 3;  3SEE A;  2EAK A;  2YFZ A;  2EA7 A;  2VQA A;  1I3H A;  2GP5 A;  4XHX A;  2A6Z A;  1PMH X;  1H9W A;  4OHZ A;  5FZ7 A;  4CCE A;  1GNY A;  3KVA A;  4ONU A;  4BXF A;  4NVP A;  3AMN A;  2WAO A;  3KSC A;  2GU9 A;  1LEM A;  5FIX A;  3GM8 A;  2Q5T A;  1XND A;  5H9P A;  1KGY A;  5BNO B;  5FPL A;  3SLI A;  3K3N A;  2Q1M A;  2Q1F A;  1C4R A;  1CPN A;  3KCY A;  1ULP A;  5FZ3 A;  2ZGT A;  3FMG A;  1XE7 A;  2J1T A;  5GZE A;  3W9A A;  2VOW A;  2FDH A;  5FR3 A;  3PJY A;  2ZX0 A;  1W9W A;  1AXK A;  1OI6 A;  1GQH A;  2VVE A;  4CEY B;  4QXB A;  2PHX A;  2X5I B;  4YSF A;  3ZSL A;  2ZCW A;  3NNL A;  3KLS A;  2I74 A;  1DZQ A;  2GNM A;  1GQG A;  1AL2 1;  1U5I A;  1RUH 3;  1COV 3;  1HXS 2;  1DGW A;  1XYP A;  2ORX A;  2VMD A;  3PVO A;  4OCT A;  1F9K A;  4E4S A;  3LA3 A;  4HL0 A;  3V0A B;  2QQM A;  2Y60 A;  3OEA A;  1TEI A;  1F5J A;  4XPV A;  2BNM A;  1DYP A;  3BIE A;  4QQ2 A;  4AI0 A;  1PGW 1;  4FO9 A;  2PHF A;  4Q0S A;  4RGA A;  4HT1 T;  4P08 A;  2VW2 A;  1HKD A;  4JGZ A;  5FP9 A;  4IV1 C;  2BGC A;  1DG6 A;  1JYC A;  3MIC A;  2YFU A;  5K0U B;  1AR9 2;  3HQX A;  4IEW A;  5AVP A;  3T4V A;  3LD8 A;  2DYC A;  1DZR A;  1MPX A;  4GQ7 A;  1TME 2;  2XJS A;  2VUC A;  5FBZ A;  4AI3 A;  2JWP A;  2DVA A;  2RS1 3;  1HRV 1;  1AR8 1;  2ZGN A;  3IWZ A;  3VBS C;  2AUY A;  4COV A;  1JOP A;  1ND2 B;  1QKQ A;  1SLI A;  2HEW F;  2WUH A;  3VDB A;  5T5J A;  3ZN4 A;  1VBD 2;  2J1S A;  3ZKU A;  4DO0 A;  5A1A A;  1R64 A;  4UW3 A;  5FZ9 A;  5L73 A;  2QDN A;  4HN0 A;  2OVU A;  3I3E A;  4G3Y C;  4I0B A;  3J8F 2;  3VHP A;  1VRH 1;  4XCB A;  4FPC A;  2I2S A;  2R1D A;  4AHZ A;  4AVA A;  2CNA A;  1CJP A;  5BY5 A;  1B35 B;  2C4X A;  3Q8F A;  4DIN B;  1BBT 3;  3IKW A;  3IBM A;  4R4Z A;  3AKQ A;  5F9T A;  1KS5 A;  1W6Q A;  5T50 A;  1R1A 2;  2WBK A;  1WW6 A;  3CDZ B;  3S7I A;  3VDD C;  3USU B;  4CDQ B;  1AX1 A;  5F5A A;  2OS2 A;  3BB6 A;  2QQL A;  3RDI A;  1W2O A;  1ZM1 A;  2JDH A;  4QPG A;  4LKS A;  1QGL A;  4JHZ A;  5CFC B;  3MIB A;  3B9C A;  3AXD A;  3SIS A;  1HW5 A;  1XBF A;  3V0B B;  2FDK A;  3VD5 A;  3PNA A;  4Q4W 1;  4NHY A;  4FOQ A;  2HWE 3;  2MHF A;  4YW4 A;  3RVH A;  5K7P A;  5ACA 2;  1W6O A;  1OA4 A;  4O7X A;  4D3W A;  2UWB A;  5LBE A;  2UU8 A;  2VNG A;  2X8K A;  5I8Y A;  3VZJ A;  1SG3 A;  1OLM E;  4CDX B;  4XAC A;  5GLU A;  4XTM A;  5EYX A;  4NHX A;  4QXH A;  3KQ4 B;  2UWC A;  4OHW A;  1X36 A;  4A3Z A;  1PVC 2;  2O0O A;  3IIA A;  3QLQ A;  1RTV A;  4GH4 B;  4PDW C;  1F15 A;  5FYM A;  3VBO B;  1MS8 A;  3OBR A;  4ZPI A;  1ST8 A;  1RUI 2;  2GMM A;  5JSP A;  1LGB A;  2IXI A;  5F2S A;  4YM3 A;  4CCD A;  1G86 A;  5FZO B;  4ATE A;  5CAD A;  1TZO A;  1TMF 2;  2J42 A;  4OQ9 A;  4FBF A;  1CX1 A;  5HXM A;  4W50 A;  2R06 2;  4A7Y A;  1CQ9 A;  1ZRD A;  1QXJ A;  2BGO A;  2OUJ A;  4XE9 A;  3JUU A;  5C6C A;  2ZGU A;  2G9F A;  2HWF 1;  2P3Y A;  2ILM A;  1SLB A;  1CX4 A;  1LR5 A;  4KMQ A;  4OZO A;  4AED B;  1LEC A;  2ZKN A;  4RHV 3;  1RMU 1;  4XFH A;  1O8S A;  1UQX A;  2C9A A;  2XL9 A;  1WW4 A;  4GA9 A;  4YGB A;  4YVW A;  5IAX A;  4Y1V A;  1R09 1;  2VUL A;  3UES A;  4QKF A;  1O59 A;  1APN A;  4Y1X A;  3CLP A;  1BEV 3;  3SQO A;  2ZJC A;  4QPI C;  4YG3 A;  3WCS A;  1RHI 1;  1QJF A;  2WA4 A;  2FZ2 A;  4LJH A;  3NW4 A;  3VBU C;  3ZN6 B;  2E9Q A;  1DQ2 A;  2B9V A;  1K5M C;  1XNT A;  4YW2 A;  1NAE A;  3W21 A;  1R08 2;  1BHG A;  3U75 A;  1QXP A;  3RZL A;  3RJR A;  4XJ8 A;  1V00 A;  1V6J A;  5FYC A;  1C57 A;  3SIT A;  3T0D A;  5FQ0 A;  2PAK A;  5CKM A;  2Q4S A;  1OPO A;  1T6G C;  1CAW A;  1JW6 A;  2P1B A;  4XEZ A;  3JBG 1;  5F5Q A;  1BXH A;  2XHN A;  5SV5 A;  1W05 A;  2DUP A;  3AP7 A;  3ZYI B;  2FCV A;  5G05 L;  4YW5 A;  2RM2 1;  2VBB A;  1PVX A;  1ULF A;  4MZU A;  1SBE A;  1RUJ 1;  2R1B A;  1MQT C;  2JEC A;  3G7D A;  1V9U 2;  3NNJ A;  4BIO A;  5C5T A;  3VKO A;  2HBT A;  3USS A;  1BKZ A;  4UI9 L;  5ABJ C;  2BJS A;  2NMO A;  3MIG A;  4PLN A;  3RGB A;  1EV1 2;  1AYN 1;  5EP9 A;  3M2M A;  4DUX A;  1OHF A;  1UY4 A;  1VLN A;  4OHX A;  4QGN A;  4Y33 A;  3UET A;  1RUN A;  1Q8O A;  2VZV A;  1QJX 1;  3JXS A;  3A22 A;  3KF3 A;  5EWS A;  4RQP B;  4PBP A;  3AKS A;  3MLK A;  4A4A A;  4D94 A;  4H3W A;  4QX0 A;  4NID A;  4I09 A;  2R49 A;  4Y5T A;  4FFF A;  3SCG A;  1L7L A;  2QQK A;  5DAV A;  1FPN 3;  1OLQ A;  3O14 A;  3UKV A;  2GNB A;  1H8T A;  3J26 N;  5FTT C;  1JH5 A;  1EUT A;  2EF6 A;  2Q8C A;  5HBA A;  4XJZ A;  5KHG A;  2WQZ C;  3BI3 A;  2IFR A;  2RR1 1;  1GMM A;  2HWC 1;  4UWD A;  1PGL 1;  1F5F A;  5I0T A;  4NRQ A;  5L9V A;  1RUC 1;  4QQP A;  3N7J A;  2BZD A;  2YY1 A;  2WA3 A;  4Y26 A;  4WM7 B;  4CPB D;  4IV3 A;  3T2O A;  5A6Y A;  2VM9 A;  1RIN A;  5FZG A;  4O9E A;  2XBO 2;  3MIF A;  3MLJ A;  1ZBA 2;  1EP0 A;  1MR5 A;  3BOW A;  4XET A;  2P3K A;  5FXW A;  3DPR C;  4BME A;  2WR9 A;  3RI8 A;  3DKQ A;  3K48 A;  1IKQ A;  2CAU A;  2ZZQ A;  4FPH A;  1QJY 3;  5E89 A;  5BNP C;  1XB9 A;  2OQ7 A;  4BCU A;  2JE8 A;  1ENQ A;  4MOA A;  5FY1 A;  4AAP A;  4FAG A;  1NXM A;  2YB7 A;  5KXD A;  3B01 A;  3WOG A;  3LB9 A;  1WMX A;  2WYS A;  4XW3 A;  2EVX A;  2PEL A;  2XJU A;  3AP9 A;  4LXL A;  4QXK A;  3WD5 A;  3WW1 A;  4RR3 A;  2YC0 A;  4G9S B;  4PCR A;  1ZZ8 A;  4E8D A;  4C0H A;  1I9R A;  3BTZ A;  2UWA A;  3AXE A;  4XMA A;  5J98 B;  2B7Y A;  2WRA A;  4XDO A;  4B29 A;  5CA6 A;  1RUG 2;  3EB7 A;  1FT9 A;  1AYM 3;  3OOX A;  3HQR A;  5DZF A;  3GDB A;  2BTV C;  3N7M A;  4Y5S A;  1Z78 A;  1ODN A;  2YV8 A;  3OTF A;  5F3E A;  4CZS A;  1NG0 A;  1OFN A;  3FLP A;  1UX6 A;  3A0K A;  4CUG A;  3NJY A;  1SHW B;  4LUL A;  2PLV 2;  4JHT A;  3H7Y A;  3KCC A;  2BP6 A;  4QX7 A;  3FHA A;  3NQH A;  4IE0 A;  4WBB A;  2OXB A;  1UZV A;  2XVK A;  2R32 A;  2JEM A;  2ZML A;  3T2T A;  4N43 C;  4XUT A;  5K4L A;  3SKV A;  1US2 A;  1YQ8 A;  1XNB A;  2ET7 A;  2I07 B;  4YZ3 A;  1UXX X;  2W08 A;  4XAE A;  1HB1 A;  4UW6 A;  4YVS B;  5FYB A;  4ZHN A;  4NPL A;  3A21 A;  2WSU A;  2WZ8 A;  1WCQ A;  3NAP B;  1IKP A;  1DQ0 A;  5T5O A;  3I2D A;  4DFS A;  1VBC 1;  1YQ6 A;  5BNO C;  2Z69 A;  2G9Z A;  2XR4 A;  2V09 A;  4WVZ A;  4DEQ A;  4R9C A;  1LHU A;  2XQR A;  2WYF A;  2WNU B;  2B45 X;  1IZ3 A;  2V4V A;  2JD9 A;  3RZH A;  3KF5 A;  3N3H A;  5FJH A;  4FPF A;  1XC6 A;  3GJB A;  4NOT A;  4CEY C;  2D44 A;  3H0O A;  2XOM A;  2QJV A;  5GKA C;  3ILF A;  3ZN5 A;  3JU9 A;  1FOD 3;  2MEV 3;  1O7F A;  1VAK A;  1GOF A;  1UZ0 A;  3FWE A;  2DCT A;  4CU8 A;  1W8N A;  1SDD B;  2AZ5 A;  4KG0 A;  4P9X A;  4AXO A;  1UN1 A;  2TUN A;  4ZS3 A;  4ARX A;  4YM1 A;  3IT8 A;  2HWD 2;  4GZ9 A;  5J48 A;  3T1M A;  1UPS A;  2JB4 A;  1CR7 A;  1OLR A;  3VDA A;  4WVW A;  1ONA A;  1QQP 1;  4W8J A;  3WUD A;  1RVF 3;  2E7Q A;  3BYW A;  1S0F A;  3OY8 B;  5FZE A;  5BNN A;  5K0U C;  3ZXL A;  1U5Y A;  3Q8E A;  3ZYH A;  5A1L A;  4NHK A;  1PHM A;  1Q8V A;  1VBB 2;  2BU9 A;  4XCA A;  1ND2 C;  2AGS A;  2VTX A;  1A6C A;  4OFG A;  3O1T A;  3ELN A;  5IFP A;  2B42 B;  4QGM A;  1LTE A;  1M06 G;  4W6W A;  1DZT A;  1G9F A;  1REE A;  2IVJ A;  2P3J A;  5FAX A;  2CGO A;  3OD4 A;  3OJB A;  4Y1U A;  5C4W B;  3BN6 A;  4IQP A;  1S0I A;  4FAH A;  4LMF A;  5JZG B;  1CD3 G;  4ET7 A;  1H2M A;  3WW4 A;  4FPY A;  3ZXF A;  1CZT A;  5GZC A;  4IEY A;  4L11 A;  4P9Y A;  3WQ7 A;  4ISR A;  3N7L A;  5FZ8 A;  5CKN A;  1X50 A;  4IGP A;  2FCT A;  4CU9 A;  5M0T A;  4TTG A;  3RZK A;  4YW3 A;  4BOW A;  1B35 C;  1OXC A;  2HKX A;  2EIE A;  4S2G A;  2OKX A;  1IQD C;  1J83 A;  2Y64 A;  4QHB A;  4S2D A;  3ZVX A;  4CDQ C;  1RUF 1;  1QDO A;  3I3D A;  3NJV A;  3TBD A;  4YZ5 A;  3LZZ A;  1VAV A;  5FK8 A;  4DXT A;  5DAP A;  2ETE A;  5CFC C;  2VEC A;  3ZFG A;  1NUK A;  1OOP B;  4XFB A;  4ZKT B;  4D0Q A;  3AMM A;  3URF A;  5GZG A;  4AG4 A;  1CAX B;  1JHN A;  4NHL A;  4K8F A;  3HQU A;  2XJT A;  1DP0 A;  3MDP A;  4XUR A;  4BQW A;  4MAD A;  4Q26 A;  3LEI A;  3ACL A;  1BLZ A;  1VBA 3;  5T54 A;  1UIJ A;  2RVA A;  5IHR A;  4MXW B;  1S2B A;  2R6Q A;  4CDX C;  2WII B;  3MI8 A;  4QB6 A;  2VY0 A;  1NLR A;  1J1T A;  1W06 A;  4HN1 A;  2HH9 A;  4LA2 A;  3CJX A;  4OUE A;  3CHX A;  4QX2 A;  3O1O A;  3H8O A;  3K46 A;  4GH4 C;  4K8R B;  3LSD A;  2VTX J;  2XVL A;  1C3H A;  3VBO C;  1LU1 A;  1H2K A;  1OQE A;  2B4K A;  2RMU 3;  2W52 A;  1SLC A;  1SZB A;  1YI9 A;  4XFA A;  4B1L A;  4XF0 A;  3MF9 A;  4YZ4 A;  2J1E A;  3MV0 1;  4LO8 A;  5A70 A;  4HZF A;  3ZOI A;  5C9A B;  1J84 A;  2RS5 1;  4HKW A;  1DYK A;  2VW1 A;  4AEM A;  1PMI A;  1PO2 1;  1H4G A;  3OUI A;  4XBN A;  4YGE A;  4AGV A;  4COW A;  3T2Q A;  3MF6 A;  2CL2 A;  2BBV A;  1YFW A;  3TYJ A;  5LEJ A;  1F35 A;  4M4P A;  4YLZ A;  1EYB A;  3CEW A;  5DAW A;  4I3P A;  3UKN A;  2V5D A;  2QZ2 A;  4AED C;  4S2H A;  3Q8B A;  2HWB 2;  1QHD A;  1EAH 3;  1UKG A;  4C0B A;  2ZGR A;  1AZD A;  2VOK A;  2NN8 A;  1IS5 A;  1GP4 A;  3AMH A;  3D82 A;  4PLO A;  1SDW A;  3THC A;  3VBR A;  4QHZ A;  5IAT A;  1C28 A;  4Q4X 1;  3GCW A;  1BMV 2;  1CAU B;  2DCZ A;  4IEP A;  4P9J A;  3AVR A;  4Q4Y 2;  1DQ5 A;  3QOP A;  3OGJ A;  5B4N A;  2QFE A;  4CDU A;  1OKO A;  3UJO A;  3BKZ A;  2PN5 A;  3I49 A;  3WNK A;  2O1Q A;  2P17 A;  2WC2 A;  3ATG A;  2R07 2;  2VZQ A;  2AAC A;  1N1T A;  5EFU A;  5FZF A;  3ZFF A;  1YUD A;  1WA4 A;  2VH9 A;  4UXA A;  1NLQ A;  1UYP A;  1AL2 3;  2JKX A;  4ZZ5 A;  3PU3 A;  4BB3 A;  4FPJ A;  3MPP G;  4AI9 A;  5LBC A;  1E5S A;  1MS5 A;  2RS3 2;  4FOV A;  5LB6 A;  2XXZ A;  3RS6 A;  2VNO A;  4D6R A;  4KH9 A;  1JI6 A;  2YGL A;  1I5P A;  4LBQ D;  4UF0 B;  5A3M A;  2LRP A;  3N35 A;  4B8E A;  4LIT A;  1X7N A;  4Q0U A;  2CDP A;  1D7P M;  3KT4 A;  1GU3 A;  4KWJ A;  1PO1 2;  1WZX A;  4K20 A;  2AEZ A;  3K4A A;  1NQJ A;  4ZS2 A;  5A33 A;  1HXS 1;  1RIR A;  5A7Q A;  1NCQ A;  3VBF A;  2A3W A;  2DCY A;  1P8J A;  2BER A;  2LUW A;  3I2O A;  5A3U A;  5FLH A;  5FYU A;  3AX4 A;  3KB5 A;  4R8H A;  1HRV 3;  3UGF A;  1RUH 2;  1MVQ A;  2W47 A;  1ND3 A;  1XYN A;  3GBG A;  1W6M A;  4JKK A;  5K8S A;  2WT2 A;  4RQP C;  4RS5 A;  4JGY A;  1QMJ A;  4XFF A;  3W5N A;  1AR9 1;  2VQ0 A;  2ZHN A;  1CZS A;  3FX3 A;  3ZFE A;  1TME 1;  2G4I A;  3EXU A;  3NKT A;  3O0W A;  3AL6 A;  3B69 A;  3UYJ A;  1ZX5 A;  4OUS A;  3ZR6 A;  5J96 B;  1JHJ A;  2BV4 A;  1Y9M A;  3NVC A;  4GB3 2;  1QU0 A;  2NYY A;  3W20 A;  3AP6 A;  4W65 A;  1VRH 3;  4LA3 A;  4KWK A;  1H1A A;  1VBD 1;  4C8D A;  2IFW A;  1QEX A;  3ILR A;  1EPZ A;  1XNC A;  3RWN A;  3VN4 A;  3LDR A;  2BWA A;  2D3S A;  3BOP A;  1RIT A;  4JGZ B;  4GMP 1;  3HIF A;  4AEK A;  3AZW A;  4DXR A;  2Y6G A;  3BOD A;  4Y4Y A;  5FYY A;  3J8F 1;  5JR7 B;  1IOA A;  2TBV A;  3ALQ A;  3LIH A;  4R9A A;  1STM A;  3LAG A;  3PVB B;  5D8A A;  5FZD A;  4YPJ A;  3VBH A;  3WR0 A;  3KV4 A;  3APB A;  4CCM A;  3Q8C A;  3QH7 A;  1QY4 A;  2YRO A;  1N3O A;  4IER A;  1DLL A;  4Y24 A;  3OGG A;  2D97 A;  2XLF A;  1R1A 1;  3ETP A;  4WV8 A;  1ZRI A;  3OPT A;  4Q4W 3;  4QWN A;  1AXY A;  1WKY A;  2J1A A;  3T09 A;  3VHN A;  4K3U A;  3U0Z A;  4AW7 A;  3SH4 A;  3CIH A;  1QDC A;  3VKM A;  5KR7 A;  1G9A A;  3S0M A;  3O0V A;  1UO9 A;  4AHW A;  3U4X A;  1FAY A;  1HV0 A;  2ZHL A;  1VAL A;  1JZ8 A;  3IPV A;  4MGI E;  2FDI A;  2JD4 A;  4QX8 A;  4XIO A;  1ZA7 A;  3VDC A;  1YC6 1;  1NA1 A;  3ZXA C;  3POF A;  2FHR A;  2FMD A;  3H50 A;  4ZON A;  5ACA 1;  1EUU A;  1B09 A;  1DGL A;  3CL1 A;  1R1Z A;  4YM2 A;  5JLV A;  1SLL A;  1S2K A;  5H9S A;  2JG9 B;  1CGP A;  4LIV A;  5HCA A;  4MGZ E;  3HN1 A;  3MFA A;  1UMZ A;  2XJR A;  3O7O A;  4FPE A;  4DMI A;  2HWE 2;  1PVC 1;  3U1X A;  1JS9 A;  1UOG A;  2QQN A;  3LOI A;  1YLL A;  4UOJ A;  1RUI 1;  3POG A;  2XJQ A;  2HWF 3;  2C9K A;  3NWK A;  1QH7 A;  4IE7 A;  4M0N A;  5DAQ A;  1TMF 1;  4QQO A;  3I3B A;  4QT6 A;  1RMU 3;  2IXL A;  5FO8 B;  2R06 1;  4YVS C;  2JIC A;  4ZXK A;  3PIG A;  1DFQ A;  1VMH A;  2OYZ A;  1R09 3;  1FX5 A;  3NAP C;  1PZ9 A;  1VB4 A;  3FL7 A;  4IND A;  2E7A A;  4BH9 A;  5CFD B;  4K7J A;  4B3N A;  3LIG A;  4XMI A;  2ZEX A;  4HPK B;  4KGG A;  3S7E A;  4CP2 A;  1RL3 A;  1POQ A;  2IXC A;  1RHI 3;  4D7S A;  4UYB A;  1UF2 C;  4UT5 A;  5F7U A;  2WNU C;  1N1Y A;  1X8E A;  4FFI A;  1G6N A;  2XML A;  5A80 A;  2QZ3 A;  4P5Y A;  5JSR A;  1XRU A;  4LOR A;  3F95 A;  2ERF A;  3IMM A;  5FOB B;  3RZM A;  2IXJ A;  1AX2 A;  2YUE A;  4ZY9 A;  5T55 A;  5J09 A;  1BK0 A;  2WFF 3;  2BNN A;  3WUC A;  4BQ1 A;  3K3O A;  4KWL A;  1JOD A;  2BOI A;  4CXW A;  2GAU A;  2JIJ A;  2OZJ A;  4LT5 A;  3M8L A;  3JBG 3;  5GAL A;  1R08 1;  2WLQ A;  1YFU A;  3WNX A;  2WZR 2;  4UFJ A;  5A1F A;  1OD5 A;  3RYP A;  5A6Q A;  2DBI A;  1VMF A;  2CY6 A;  2RM2 3;  4IV1 A;  1VE0 A;  4UBH A;  1RUJ 3;  4XIL A;  4EN8 B;  3UGG A;  5DZE A;  5DMY A;  4LUM A;  4WVM B;  3K2O A;  1KFX L;  2IC1 A;  4E8C A;  2RDQ A;  2XG3 A;  3EO6 A;  1UPI A;  2DFB A;  3FUQ A;  1AYN 3;  5DQ0 A;  4D6S A;  5F1R A;  2D6N A;  3KMH A;  3VBS A;  3TEX A;  3VKN A;  1IS6 A;  1HV1 A;  1BCX A;  5A7N A;  1QJX 3;  2WKK A;  3MV1 1;  1VBE 2;  4D6Q A;  2ET1 A;  4WZF A;  3HPN A;  4CRQ A;  1KXG A;  1V9U 1;  4QQH A;  3ACH A;  4Q27 A;  3TOJ A;  1ULD A;  3SH5 A;  5F3C A;  3RI9 A;  1V0A A;  3PUH A;  1EV1 1;  3RJ2 X;  3LCP A;  1UZW A;  1UU5 A;  2ZGL A;  2SLI A;  4DY3 A;  5C4W C;  5A32 B;  4P00 B;  1MS4 A;  2FQP A;  5FQ0 B;  5JZG C;  3O1S A;  3WG2 A;  4E4H A;  4XHB A;  1NKG A;  3ZIW A;  1LOD A;  2F4P A;  2DU0 A;  2RR1 3;  1CN1 A;  5IYY A;  1X82 A;  2PXJ A;  2BVB A;  3DXU A;  5EXO A;  3DEM A;  2VOV A;  3ZYJ B;  5HPO A;  5KC6 A;  4EZ4 A;  4BIS A;  1RUC 3;  2GAL A;  5F2W A;  5FP4 A;  1YCI A;  3UV9 A;  3FBY A;  2B39 A;  2ZX2 A;  2W1U A;  4ZU7 A;  3M3Q A;  5C3S A;  2Y8K A;  3VDD A;  1WMF A;  3KS7 A;  2D3R A;  1H1M A;  2XQX A;  3AZX A;  2VQU A;  3I2K A;  1IS4 A;  2V73 A;  4LHS A;  4QPW A;  5JVV A;  4CE8 A;  2O14 A;  3TEW A;  4EQV A;  3VUO A;  5I8S A;  5KWR A;  5FDB A;  1C8N A;  4AFA A;  1OOP C;  3RFR A;  1XE0 A;  5FZA A;  1ZRR A;  1FMD 3;  1W8Z A;  2XBO 1;  1ZBA 1;  2DF7 A;  2VME A;  4QAW A;  4YW1 A;  2BYV E;  4I0W B;  4QKB A;  1GAN A;  1S1A A;  3I2H A;  3PME A;  4KI5 M;  2YBK A;  5EV7 A;  4CXY A;  2VZ1 A;  1AR6 2;  1CAV A;  1ZBE 2;  2ZHM A;  3M7A A;  2J7M A;  4CDW C;  3CBN A;  1JTZ X;  1H8T B;  3III A;  4NWW A;  1GSL A;  5FLI A;  3OSD A;  5DUW A;  1UY3 A;  4PDW A;  5KBF A;  3WW2 A;  2C6S A;  3J4U H;  5I0S A;  2W9X A;  2VNV A;  3IB3 A;  4BWO A;  5JI9 A;  4LO7 A;  5C9A C;  5CG8 A;  4MO3 M;  4IV3 B;  3PHM A;  1RUG 1;  1SCR A;  1AXZ A;  1LCL A;  1W99 A;  1K45 A;  1A8D A;  1X9P A;  4IL7 A;  1AVB A;  3NJX A;  1NE6 A;  2DVD A;  4XJU A;  3Q8A A;  4QGL A;  3VZM A;  3CZJ A;  5CG9 A;  1FXZ A;  4NRP A;  2TEP A;  2YU2 A;  1DHK B;  1JU3 A;  1MAC A;  4JRA A;  4XQD A;  2LW8 A;  3I3M A;  4ASK A;  2NMN A;  5IK8 A;  1ODM A;  4CTE A;  1AR7 2;  1YJL A;  2PLV 1;  3OF1 A;  2ARA A;  5IUQ A;  3POW A;  1X9T A;  3NKG A;  2ARE A;  4GAL A;  2CV6 A;  1VBC 3;  2DWR A;  4QM8 A;  5KXB A;  4HKO A;  4QPI A;  3OPW A;  2XDV A;  2XB6 C;  3SC7 X;  4XF4 A;  5E88 A;  3VBU A;  4UW5 A;  3C7F A;  4HSJ A;  5C33 A;  1JOB A;  2RE9 A;  1K5M A;  4IEV A;  3B3Q E;  4BMB A;  3AK0 A;  4F83 A;  2VMC A;  4YAR A;  1ASJ 2;  1XOY A;  1NY7 2;  1XPW A;  2BDR A;  2GN7 A;  2VPV A;  4M3C A;  3SMH A;  1I5Z A;  1GFF 2;  2ZBJ A;  3RMX A;  2CWS A;  4QX3 A;  4JTO A;  5KXC A;  5JIU A;  1DGW X;  2BFU S;  4J25 A;  1ZZ7 A;  2I45 A;  2RDR A;  3N9O A;  3T3Y A;  5TSW A;  3OPZ A;  4Q0Q A;  5DZG A;  4QKD A;  3VD3 A;  2QQO A;  5FZI A;  4PJY A;  5AFB A;  4ZXE A;  3E5Q A;  3I59 B;  1WCU A;  4C1X A;  5HXV A;  1G7Y A;  1ULE A;  2BQP A;  2CAV A;  5CKQ A;  2W3J A;  1DQ4 A;  1MQT A;  2A6V A;  2WO2 A;  5DG2 A;  1QQP 3;  2VUJ A;  5BUV A;  2WNV B;  1GIC A;  1H1I A;  4FPK A;  1YXW A;  4AI8 A;  5ABJ A;  4E4Z A;  3UGH A;  1HB4 A;  4PIZ A;  1DU3 D;  5FPV A;  4DXZ A;  1Q5O A;  1H4H A;  1UXZ A;  4XIK A;  4LK6 A;  4TSV A;  2HWD 1;  4LUK A;  2W1Q A;  4QKN A;  2JG8 B;  3ASI A;  3X29 B;  5LAS A;  2VBD A;  3V56 A;  1QOO A;  2Z2S B;  2WZP P;  2CWM A;  1A34 A;  3GZA A;  4KQ7 A;  1GZW B;  4D7T A;  2Y6J A;  4F7Z A;  2VXR A;  4JKL A;  2NM1 A;  2ZHK A;  2LTN A;  1BVV A;  1YWK A;  2WDB A;  3MID A;  3OUJ A;  1VBB 1;  1H6X A;  5GJ6 A;  2OPK A;  2ZKL A;  3U11 A;  5J1X A;  1O4T A;  2R04 2;  1OQ1 A;  5L19 A;  4A45 A;  2VW0 A;  5GLZ A;  3RZG A;  1KDK A;  3O12 A;  3RYR A;  2A1X A;  3LEK A;  4TWT A;  3U07 A;  3AB0 A;  1X8M A;  1EY2 A;  3FJS A;  4FP2 A;  3AFG A;  3U14 A;  2XON A;  3ZSM A;  5KXE A;  3NNF A;  2YGM A;  4A42 A;  5F5I A;  1YI7 A;  3WQ0 A;  3DPR A;  2YZ4 A;  1RUF 3;  2OUH A;  4LHK A;  4AVT A;  3HBK A;  4AHX A;  1XQN A;  1GZ9 A;  4LR4 A;  1RJ8 A;  1XJA A;  2JXA A;  3LPF A;  5BNP A;  1JYN A;  3B00 A;  2LM3 A;  2O8Q A;  1WBL A;  3AYA A;  4MHR A;  4BIF A;  3LA2 A;  2BGP A;  4K1Z A;  4NR1 A;  5FRE A;  3TNP B;  1SAC A;  5JMO A;  1VIW B;  3DN7 A;  4X8P A;  3ILN A;  4AVS A;  2WT1 A;  3HVD A;  4HMZ A;  3PDQ A;  4Q0P A;  4N9I A;  3NV3 A;  3AKT A;  4P02 B;  5B4X A;  5A7W B;  4LBL A;  5FPA A;  5LRS A;  4YNI A;  1Q56 A;  1C8M 2;  2VUD A;  1POV 0;  3ABZ A;  2WN2 A;  2D93 A;  1D2Q A;  5FJK A;  1SPP A;  1LRH A;  4BXS V;  4TXW A;  3OB8 A;  5DDJ 2;  1LHV A;  3WP6 A;  5FYH A;  1C5I A;  4KBZ A;  1ZNP A;  5L7O B;  3ACG A;  4TYS A;  1DGR A;  3POJ A;  1HIX A;  3WZ1 A;  5CAZ A;  3R4D B;  2NLR A;  1IPK A;  5FMO S;  4MHU A;  2JG9 C;  1PM7 A;  3RQ0 A;  4UFM A;  3VL9 A;  5FZ4 A;  3CU7 A;  2RS5 3;  1MEC 2;  4NPR A;  1UIK A;  4NPM A;  3JB8 A;  3O1R A;  3LEG A;  2A70 A;  1PO2 3;  4I2O A;  2DCJ A;  2HEV F;  4E2S A;  3D3A A;  3CO2 A;  2EIC A;  4N43 A;  5IVJ A;  1S0C A;  2QQP A;  2Z4F A;  3OGV A;  4AWD A;  1UCX A;  5FY9 A;  1SFP A;  5KHH A;  4DPN A;  2VZT A;  1AX0 A;  1GQP A;  5ANQ A;  5JSO A;  2KXL A;  4EWA A;  2R16 A;  4JDO A;  2Q8O A;  2EXI A;  1TQ5 A;  2WT0 A;  5BNO A;  3MLL A;  1CVN A;  4Q4X 3;  1JYT A;  3MUZ 1;  4CCJ A;  3PIJ A;  5CFD C;  4OI1 A;  2Q8E A;  3D8C A;  3NV1 A;  5IK7 A;  4L0P A;  4YWA A;  2VOX A;  1UMH A;  5LW9 A;  1UKR A;  2HWB 1;  5IWF A;  4QD2 A;  5AVA A;  4DS0 A;  3TB0 A;  5T52 A;  4BQ4 A;  1ZRE A;  3VHO A;  2TNF A;  5A3N A;  1JYW A;  3MO4 A;  2ZEZ A;  4CEY A;  1BMV 1;  4JVA A;  3WG1 A;  3R4U A;  3QH6 A;  4Q1P A;  4Q4Y 1;  5C3P A;  3ROU A;  3KVB A;  3MHZ A;  5D2A A;  3M3O A;  1EAH 2;  1ZZC A;  1V70 A;  2G9G A;  3V0A A;  3KT7 A;  2ENR A;  2GME A;  2RG4 A;  2W0X A;  5FCC A;  4QU2 A;  4XOG A;  3DUI A;  1FV3 A;  5CIR A;  3I54 A;  4CA9 A;  2R07 1;  4FXK B;  2WN3 A;  4GIQ A;  4JTN A;  4LTA A;  2UY8 A;  4BQ3 A;  1LKN A;  3AYD A;  2XLA A;  3D6E A;  3E6B A;  3VD9 A;  1HXS 3;  2W2I A;  2JDM A;  3HMY A;  2VOT A;  2GZW A;  4WM8 B;  5K0U A;  2RS3 1;  1LGC A;  3HBZ A;  3ZO0 B;  4LQR A;  4AI2 A;  4BJ0 A;  2D43 A;  4N53 A;  5EHD A;  4EN0 A;  2VCC A;  5A3W A;  3N7K A;  1PZ7 A;  4OI0 A;  4YGC A;  3JD7 2;  4XFI A;  1PO1 1;  1ND2 A;  4CDU B;  4MH0 E;  5B2G B;  2A6W A;  5JIA A;  4LK7 A;  1AR9 3;  2YG0 A;  1YFY A;  1TME 3;  1Y9Q A;  3GHM A;  4P9I A;  4Y20 B;  4YM0 A;  4UFI A;  1RUH 1;  2WO7 A;  5FKC A;  4MGK E;  4R52 A;  3WQB A;  2BPA 2;  5FYV A;  4MX3 A;  1W6P B;  1BK1 A;  1RXF A;  3VD4 A;  4MGT A;  4HAN A;  2WAA A;  3HAG A;  2JIG A;  2VMG A;  4DRR A;  4AF9 A;  4EE2 A;  2Z42 A;  1LNS A;  4UAP A;  4AE2 A;  1B35 A;  1LHN A;  4CCC A;  5FWE A;  1KJL A;  1OBN A;  2EXJ A;  2VR4 A;  1GR3 A;  4GMP 3;  5BXX A;  5JXJ A;  3TAY A;  3C7E A;  4GB3 1;  3HNY M;  4N7U A;  3USU A;  4CDQ A;  4CP9 B;  5LY1 A;  5LEK A;  3J8F 3;  1G9D A;  3LGR A;  2QKD A;  3AFK A;  5CB7 A;  4DUW A;  4AI1 A;  3KV5 A;  3L9J T;  1CES A;  2V4A A;  5CFC A;  4BM8 A;  3U37 A;  5FOJ B;  1IG0 A;  3T1L A;  2A75 A;  4XUQ A;  3TN9 2;  3V0B A;  4B1M A;  2UYA A;  4E2G A;  1R1A 3;  4XF3 A;  4OQ8 A;  5FO7 B;  1W03 A;  4QX1 A;  2X5I C;  1SCS A;  5A3L A;  4B7E A;  2ZOE B;  1PK6 B;  4CDX A;  4CU7 A;  2W46 A;  3WDV A;  2JDN A;  4NAM A;  3L2H A;  2ZGO A;  3PL0 A;  4Q4V 3;  3KGL A;  3ACF A;  4RL7 A;  4ASM B;  1UOJ A;  3FHI B;  2X29 A;  5AC9 1;  4GH4 A;  3TRS B;  1W9F A;  3INA A;  1BQP A;  4N8M A;  3VBO A;  5ACA 3;  3D5O A;  5C8C B;  2A5Z A;  1E57 A;  2H6B A;  3DGT A;  4PI0 A;  2ZTN A;  1HRI 2;  1UZY A;  4NRM A;  2WS9 2;  2W94 A;  5FMD A;  1LOE A;  4COY A;  4LOS A;  2NQY A;  3WP5 A;  3ME2 A;  4DIQ A;  1RUD 3;  1NT0 A;  1W6N B;  2Z5W A;  4MXV A;  1V6N A;  4N90 A;  1PVC 3;  1YRZ A;  4OVE A;  4IE4 A;  2YPJ A;  3TWI A;  4MV2 A;  3WDU A;  4V2V A;  2WNE A;  5FUI A;  2P3I A;  1PIV 2;  1Q43 A;  1RUI 3;  2PHD A;  4L97 A;  2WWU A;  2WL1 A;  3LDK A;  3WDT A;  4CYD A;  1I6X A;  5FWJ A;  3H8X A;  3MYX A;  4AED A;  5HV4 A;  4C1W A;  3VHR A;  1F4A A;  2F4L A;  1TMF 3;  4Z1V A;  5LWB A;  3WSO A;  3PUI A;  2HWE 1;  3OUH A;  2R06 3;  5DXD A;  4MET A;  3VKF C;  5EYY A;  1W0P A;  2GDF A;  4ERO A;  1W28 A;  1H30 A;  4LPL A;  5FY7 A;  2D5F A;  2DFC A;  2DTW A;  4IGQ A;  5EJ1 B;  4DB5 A;  4ZZ8 A;  4NUB A;  4YG6 A;  2XUE A;  2P2K A;  1FI2 A;  4RD7 A;  4BHP A;  1U5X A;  2ZXQ A;  4CEW B;  1HQN A;  2JDZ A;  3ZN6 A;  3AYC A;  1WD4 A;  2D6P A;  3GGL A;  3HT1 A;  5FBJ A;  1OMI A;  1OUX A;  4B7K A;  4XXA A;  1Q3E A;  4Y22 B;  4XFC A;  3KD4 A;  1ALY A;  3GXU A;  5ISL A;  2DCK A;  1HLC A;  3U10 A;  1VPH A;  2VZS A;  4LHL A;  4BLI A;  3WF0 A;  4LBQ A;  3J9S A;  4RSU A;  4CCN A;  4DUV A;  4LNV A;  5A7S A;  5L36 A;  2F6B A;  1W3V A;  4BYY A;  3B9I A;  1ZRF A;  1R08 3;  3LDB A;  1ENX A;  1US3 A;  1QIQ A;  2GH2 A;  3EYP A;  3VB9 A;  3IAQ A;  3U78 A;  2Y38 A;  4HBN A;  1OA3 A;  2WQ4 A;  1NZI A;  3WXP A;  4GKY A;  2V5Y A;  2WNV C;  2ZAB A;  1G8W A;  4LE4 A;  3ZPY A;  5BYN A;  5FV3 A;  3SNM A;  2ES3 A;  3FZ3 A;  1AUY A;  3QD6 A;  2WZR 1;  3MIH A;  4Q0V A;  5FMB A;  5SV8 A;  1TE1 B;  4DQA A;  3DL3 A;  2JG8 C;  2WFF 2;  3C7O A;  3LFI A;  2BWC A;  3SEP A;  2VMF A;  4EN7 B;  4RQP A;  1W2U A;  3GBW A;  4M01 A;  1V9U 3;  5D21 A;  5F6L B;  4XJ9 A;  1RUE 2;  1SBF A;  2FBE A;  1EV1 3;  1GWM A;  2Q8D A;  2VD7 A;  2E31 A;  2Y6H A;  4XC9 A;  4GWJ A;  4CUA A;  1UWW A;  3LF7 A;  4PIX A;  1MZE A;  1VB2 A;  3H1M A;  1A78 A;  4CVU A;  4NIG A;  1W2A X;  1VBE 1;  3BCW A;  3OYW B;  4LO4 B;  3WHT A;  3RWK X;  4B4R A;  3BTA A;  1H2L A;  2FMY A;  4L2N A;  5GLT A;  1Y9G A;  3U4S A;  3GHN A;  1F31 A;  3E6C C;  1C1L A;  3HNM A;  1OA2 A;  3BU7 A;  4NMI A;  1NCR B;  1O4Y A;  5I91 A;  3LEM A;  4BPZ A;  2D40 A;  1SBD A;  1HJG A;  2IWG B;  2W1S A;  2ZX4 A;  5E1R A;  2VJX A;  2HYK A;  1S4C A;  2EIB A;  5EJZ B;  4EWD A;  5ERL A;  1TVG A;  1D4M 2;  2VBP A;  3BIW E;  3JQW A;  1UOF A;  4IES A;  3IDC B;  2G19 A;  2VZU A;  1ULG A;  5C8W A;  4ZU5 A;  4G4F A;  3DXT A;  1QJU 2;  5HV0 A;  1Z7S 2;  4SBV A;  2XBO 3;  4I01 A;  1ZBA 3;  4AOC A;  5LRR A;  5LA1 A;  3A0N A;  5FZ6 A;  4TLF A;  2YDE A;  4GJZ A;  2ATF A;  3PUS A;  3AYE A;  5FZM A;  4K1Y A;  1WWY A;  3POI A;  3J7N A;  3C2U A;  3KM5 A;  3BVC A;  2VO5 A;  1KS4 A;  1W9S A;  2SBA A;  4E9K A;  5L7O C;  2JDA A;  2ZGP A;  4V1P A;  4DEV A;  1A3K A;  1AR6 1;  3WDX A;  1ZBE 1;  4GAZ A;  4QMA A;  1GNH A;  3GBF A;  2WFP A;  4HK8 A;  3CJI A;  1FMD 2;  1RUG 3;  3ACI A;  1LOF C;  3OBZ A;  3WQ1 A;  4O9G A;  5J7M A;  2HYX A;  5FRA A;  4A41 A;  2YHJ A;  4P14 A;  5JOX A;  1AR8 3;  1COV 2;  1C1F A;  3AP5 A;  3DKW A;  2KA3 A;  4DOU A;  1RED A;  2X10 A;  4Z2W A;  5JOW A;  4FP3 A;  5F37 A;  4AQ2 A;  4YVS A;  3T08 A;  2ZX1 A;  3RNS A;  2PLV 3;  1K3I A;  4BQY A;  3NAP A;  1XU2 A;  2R0H A;  3IZO A;  1IHM A;  4FQZ A;  4EV0 A;  1NX9 A;  4PQQ A;  5JCT A;  1H6Y A;  1D0H A;  1SMV A;  1TNR A;  4HXC A;  2WNU A;  1AR7 1;  4E4D X;  4O61 A;  2RS1 2;  4NIA A;  1CIY A;  1KQR A;  4LKF A;  1GOH A;  4MGS A;  4WM7 C;  4NIH A;  3ZSE A;  2VZR A;  3RRD A;  2B8M A;  5CNA A;  1GKB A;  4GWN A;  2VC9 A;  3S5A A;  1O3Q A;  3IN9 A;  5C71 A;  2KR2 A;  2PHU A;  2X09 A;  1JU4 A;  2D6O X;  4OMC A;  4YRD A;  3H3U A;  3WP3 A;  1AF9 A;  3THD A;  2W91 A;  2AYH A;  5FFO C;  4AEJ A;  4KGQ A;  1O3S A;  4HVR A;  1J3R A;  3ZR5 A;  1ASJ 1;  3NV2 A;  5C70 A;  2FDG A;  2F17 A;  2ZMN A;  1JMU B;  1NY7 1;  4JDM A;  5FP8 A;  3V64 A;  5A3T A;  4Y1Y A;  4A6S A;  4BA6 A;  2GC0 A;  3TNQ A;  5KHJ A;  3FHQ A;  2ZAA A;  4CXX A;  1H8V A;  3JB4 C;  3KCX A;  4ISQ A;  4TZD A;  1BBT 2;  1REF A;  4WM8 C;  4CP1 A;  4LBM A;  3LQC A;  3PVN A;  2ZX3 A;  3PUR A;  4Q8K A;  1JZ3 A;  1OC1 A;  1QNY A;  2IZW A;  2HWD 3;  1JYX A;  2VG9 A;  1OT5 A;  5KHI A;  2Y6K A;  1PM4 A;  2DTY A;  5FPX A;  2W39 A;  4CDU C;  2BOJ A;  3NNG A;  4OLL A;  4RFT 0;  1WW5 A;  2PHT A;  4GXL A;  3H1Y A;  1W6Q B;  4H2A A;  1LB2 A;  2XLG A;  5APA A;  5C4W A;  1WME A;  2WO3 A;  3POB A;  2OX0 A;  4KG8 A;  2FDF A;  1W0N A;  2W68 A;  2ZEW A;  5JZG A;  4FXG B;  3RMY A;  1OH4 A;  1VBB 3;  2D7F A;  4QPG B;  1F2N A;  5CU1 A;  2HBU A;  4HK9 A;  4IGO A;  3HR9 A;  3BPS A;  4L8Q A;  2D6M A;  1W39 A;  4FOW A;  1W6O B;  4BDV B;  2PHW A;  3ZDV A;  5J37 A;  4FPG A;  3K75 B;  5A6X A;  5FYZ A;  5L9R A;  5JOZ A;  4PF1 A;  4U36 A;  2R04 1;  1OD3 A;  1V6M A;  2JDP A;  4Z2A A;  4XQW A;  4XAA A;  5FUP A;  2YPD A;  2BFU L;  4ORF A;  3KZ4 C;  5LA9 A;  4EYU A;  1PX4 A;  5C3R A;  3H9A A;  2W87 A;  5LK7 B;  2JDY A;  1OOP A;  1W8U A;  2GN3 A;  4XF9 A;  1XYO A;  2W92 A;  1FYU A;  4Y4R A;  2GSY A;  3CF6 E;  4BK5 A;  2VZO A;  1M4W A;  4CP0 A;  1CAX A;  4FSJ A;  1S55 A;  4UBG A;  4GJY A;  3O0X A;  5JDB A;  1TG7 A;  1CWP A;  3NO8 A;  4RHV 2;  4LBK A;  2VAU A;  3ZIX A;  1YQ2 A;  1PK6 C;  3H7J A;  4CDW A;  5FZ0 A;  3NV4 A;  4LHN A;  1DQ1 A;  3MGU A;  3HEI A;  4XBL A;  3T0B A;  5IVC A;  4Q1R A;  1BEV 2;  1S0D A;  5BNQ A;  3C7H A;  3ZSJ A;  3IDE A;  4DXS A;  1BJQ A;  4XZU G;  5C8C C;  3A23 A;  4AR2 A;  3ZKY A;  5FY4 A;  5FPZ A;  5C9A A;  1V6I A;  2VGD A;  3CQO A;  4YVW B;  1GWK A;  3E5U A;  2PTM A;  3ORJ A;  1C8M 1;  1RXG A;  4NJ4 A;  1PNG A;  1PZ8 A;  3N36 A;  4HVQ A;  3WEZ A;  1AJO A;  5DDJ 1;  5IVV A;  4NO4 A;  5EQU A;  1F8V A;  4FVV A;  1SLT A;  4XBQ A;  3K51 A;  1LAJ A;  4QQL A;  4XTP A;  3WG4 A;  2D98 A;  4HKL A;  1MEC 1;  4AGR A;  1I1E A;  2A7A A;  4OUL A;  2BW8 A;  5GLW A;  4N7I A;  2GMP A;  1LES A;  3MPB A;  3OBA A;  1CAU A;  1ULC A;  1CAW B;  4W6X A;  2PMW B;  2E63 A;  2YMZ A;  2UYB A;  4QDR A;  3KGZ A;  2N7G A;  2ORZ A;  5FK7 A;  1G9B A;  2PA7 A;  2WO1 A;  2HWC 3;  1O5U A;  4CEW C;  2HWB 3;  1NYW A;  2L9L A;  5CEH A;  1DGR N;  4LOT A;  2K46 A;  2QCS B;  4BQ5 A;  2YYO A;  3FC0 A;  1AJK A;  2ZMK A;  3L2Y A;  3PUA A;  4AFM A;  1NLS A;  2XWJ B;  2VQT A;  1BYH A;  3N9Q A;  4HSL A;  4CUB A;  2KD7 A;  1FNZ A;  4Q4Y 3;  5F8P A;  5IFT A;  1RB8 G;  4IEX A;  2Q30 A;  3I4I A;  2VMH A;  3WW3 A;  3VV1 A;  4EN9 B;  1FPN 2;  3I3Q A;  4Q5O A;  1PGS A;  4UF0 A;  4LKD A;  4XJW A;  2R07 3;  3MW3 A;  3O1V A;  4YYO A;  3UL2 A;  2A73 B;  3HT2 A;  4HFS A;  2BNO A;  4H55 A;  3FN9 A;  1UU6 A;  1EAH 1;  2CU5 A;  2VUA A;  3J7M A;  3OCP A;  3OG2 A;  1JZ2 A;  5FMO L;  2PFW A;  1KD7 A;  2RS3 3;  4FCA A;  4AAX A;  5FXX A;  3LWC A;  2G1M A;  2J1R A;  4J1X A;  2R7E B;  4KWU A;  2E26 A;  2D3P A;  3MFC A;  2P34 A;  4K9S A;  1PO1 3;  4N9H A;  1JN2 P;  3AM2 A;  3MBW A;  1QJY 2;  4Z8B A;  1IPJ A;  3OD0 A;  4Z92 B;  4M0H A;  3ITQ A;  3AC0 A;  3ZYP A;  4L9B A;  2AC1 A;  1Q8P A;  4S2F A;  2R0F A;  3ZYB A;  1POV 1;  4BLJ A;  1HDK A;  1Y4W A;  3JD7 1;  4FFH A;  3OGR A;  2NPI A;  3FFQ A;  2OT7 A;  2VCA A;  1JYV A;  5FY0 A;  4A44 A;  3AJZ A;  1D0G A;  1AYM 2;  3ENR A;  4OHY A;  4FFG A;  2C26 A;  1JYI A;  4J1W A;  4GWM A;  5FZ1 A;  1G9C A;  1ZVF A;  2A3X A;  2VZ3 A;  2HJI A;  4GB3 3;  4PLM A;  2AEN A;  4RR3 B;  5FY8 A;  4MVT A;  3S6P A;  1NCR C;  4ATF A;  2QTW B;  4TLG A;  5JUV A;  1VRB A;  2CYF A;  2P5B A;  1Y7B A;  1YYN A;  3KWV A;  4N53 B;  4EN6 B;  5LA0 A;  2WZE A;  3VD7 A;  3NST A;  5H9R A;  2WIN B;  1H2N A;  3NNM A;  3UKT A;  4X6Q B;  4XUP A;  1E5R A;  1FV2 A;  3EMR A;  3MIE A;  1LJ7 A;  2DVG A;  2FZ1 A;  2Y33 A;  2Z79 A;  3NRU A;  2YXS A;  2BBA A;  3TN9 1;  5JAX A;  4FPO B;  5H9Q A;  1J3P A;  3AP4 A;  5LBF A;  5AC9 3;  1DDL A;  2XVG A;  3QBQ A;  4HVO A;  3T2P A;  3WG3 A;  3M3E A;  3PVE A;  5F3G A;  4IXL A;  1E5H A;  2VCM A;  4CPB A;  2A6Y A;  2JG9 A;  2IVI B;  2W95 A;  1MVE A;  2YU1 A;  3EJK A;  4CUC A;  3AL5 A;  3MEP A;  2AR6 A;  4CCK A;  4F8A A;  3BTX A;  2HEY F;  2OZ6 A;  1QOS A;  2EID A;  4A3X A;  2ZA9 A;  5FZB A;  1W9T A;  1J58 A;  3WP4 A;  4AFB A;  3D0J A;  2C1F A;  3H42 B;  4LBO A;  1FOD 2;  2MEV 2;  2ZGQ A;  4LO5 B;  4YG0 A;  1HRI 1;  4Q4V 2;  5E8A A;  5F32 A;  5D1I A;  3B94 A;  1KDM A;  1RJ7 A;  2WS9 1;  2RDN A;  3KT1 A;  2QQV A;  3V65 A;  3WX5 A;  2LAL A;  3LE0 A;  3MUY 1;  3WF1 A;  5LAT A;  4GWI A;  1RC6 A;  1WLD A;  4NII A;  1Y43 B;  3H1W A;  3TEY A;  3WNN A;  4EWE A;  4P9L A;  3WDW A;  1PIV 1;  1VJ2 A;  1W8F A;  5CFD A;  1UYX A;  2P6C A;  1MZ5 A;  4Q29 A;  4F3J A;  4P9G A;  1RVF 2;  2A3Y A;  3DV8 A;  4HPK A;  4JCK A;  3VZK A;  1LU2 A;  5K9Y A;  3LPG A;  4XQ4 A;  1SEF A;  3ZYG A;  1RUD 2;  2VU9 A;  1OSG A;  1CON A;  3SKJ E;  1K42 A;  2AH2 A;  2CHH A;  1RYY A;  1LOG A;  1GZC A;  2ZGK A;  5LK5 A;  3IAP A;  4BQX A;  5A3O A;  4JGZ C;  4H14 A;  3TEZ A;  1W2N A;  4BZ4 A;  3IDB B;  5CYY A;  2WNO A;  4ITC A;  4XDQ A;  5BNN B;  2X05 A;  1IG3 A;  3J7H A;  3R4S A;  4IEO A;  5FUN A;  2DVF A;  2YC4 A;  4A7K A;  3LSE A;  4LLO A;  2OQ6 A;  5HCB A;  2XPJ A;  1QH6 A;  4L99 A;  4B4P A;  2ZS6 B;  4BK4 A;  3A7Q A;  3EHK A;  4OI2 A;  4ZU4 A;  2XJV A;  4AQ6 A;  4OI4 A;  5CZK A;  1K12 A;  1K5J A;  4IUG A;  5F3I A;  4Q8L A;  2Y0O A;  5FKB A;  5DG1 A;  1JZ7 A;  1J3Q A;  2DBN A;  3JZV A;  5LY2 A;  5JWP A;  1W2T A;  4JDN A;  2QUO A;  3WNP A;  4WVM A;  3DYO A;  3E1F 1;  1XSR A;  4IDZ A;  4IET A;  2CTV A;  1GV9 A;  2JB8 A;  2WZR 3;  4OUM A;  1MS0 A;  1W8T A;  3WF4 A;  4AYU A;  5HCH A;  2ZGS A;  1OUS A;  3GZE A;  3ECQ A;  4OMD A;  4XUN A;  1QF3 A;  3E6D A;  1DYO A;  3WNO A;  3SHR A;  1NE4 A;  1KRI A;  2AEY A;  4WZC A;  4NWV A;  3GJA A;  4FT8 A;  2QQW A;  2W5F A;  4P9W A;  3VLB B;  5FXV A;  5A32 A;  2WFF 1;  4LO6 B;  4R9B A;  3WF2 A;  4LBQ B;  1VBA 2;  1VBE 3;  3AMP A;  1HN1 A;  4QPG C;  1S0G A;  1WCD J;  1LHO A;  1IPS A;  3UT0 A;  2DVB A;  3ZFG B;  4QM9 A;  1GNZ A;  1RUE 1;  1YFX A;  2XWB B;  1CJD A;  1VR3 A;  4Y3O A;  4QB1 A;  2JJ6 A;  5I0U A;  3RPQ A;  1N1V A;  5BV6 A;  2RMU 2;  2VNR A;  4XAB A;  3POY A;  1S0E A;  4P5H A;  1MS1 A;  4H7L A;  2B46 X;  2GNT A;  1LEN A;  4FPL A;  1OUR A;  2GC3 A;  1H0B A;  2UY9 A;  3KV6 A;  5DN2 A;  2EXH A;  4ASL A;  1QJE A;  2JEN A;  4JV4 A;  2WJS A;  2OA2 A;  2XUM A;  1W8O A;  3S57 A;  2WQ8 A;  2GP3 A;  2PQS A;  2C24 A;  2X5I A;  3CMG A;  2PAM A;  1UY1 A;  3HNB M;  3S30 A;  2JE7 A;  1D4M 1;  2H6C A;  3AKR A;  4I02 A;  1O4Z A;  5JXI A;  5IK5 A;  1N3Q A;  1D4V B;  1WUV A;  2QQI A;  3MZH A;  4XFG A;  4IEZ A;  1QJU 1;  1UMI A;  3T0A A;  1Z7S 1;  4GUL A;  1OH3 A;  4JC1 A;  4EZH A;  5FYI A;  2P6H A;  4YGD A;  1KIT A;  1XE8 A;  2E51 A;  1DBN A;  4IW3 A;  4QHO A;  5EPA A;  3SCF A;  1UY0 A;  4MUV A;  1AR6 3;  1ZBE 3;  5J3U A;  1O3T A;  3VBR B;  4J6G A;  4YVW C;  4AQS A;  4LIU A;  4I30 A;  3WCR A;  2E53 A;  2XGX A;  3WLU A; 
#chains in the Genus database with same CATH homology
 3J7N A;  1STM A;  3J7M A;  1ZA7 A;  4NIA A;  4OQ8 A;  1YC6 1;  1A34 A;  3J7L A;  1JS9 A;  1CWP A;  4OQ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...