1JS9A

Brome mosaic virus
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
149
structure length
149
Chain Sequence
KAIKAIAGYSISKWEASSDAITAKATNAMSITLPHELSSEKNKELKVGRVLLWLGLLPSVAGRIKACVAEKQAQAEAAFQVALAVADSSKEVVAAMYTDAFRGATLGDLLNLQIYLYASEAVPAKAVVVHLEVEHVRPTFDDFFTPVYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords Coat protein
publication title The crystallographic structure of brome mosaic virus.
pubmed doi rcsb
total genus 18
structure length 149
sequence length 149
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2001-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01318 Bromo_coat Bromovirus coat protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.220 Mainly Beta Sandwich Jelly Rolls Satellite virus coat domain 1js9A00
3J7LA 4NIAA 1JS9A 1STMA 1YC61 4OQ9A 3J7MA 1A34A 4OQ8A 1CWPA 1ZA7A 3J7NA
chains in the Genus database with same CATH superfamily
2WQZC 1VB4A 3NV4A 4AGVA 4OQ9A 2XJTA 5GZCA 5ABJB 1GNZA 3HT2A 3OOXA 1W9SA 4AYUA 3HT1A 5A3MA 2DTWA 3WP3A 4H7MA 4ITCA 3I3MA 3PMSA 3UNPA 5T54A 4A6OA 2BWAA 4Y5TA 2E33A 4LHLA 4QT6A 2AGSA 4GJZA 2VQ0A 1LOAA 1RUI3 2WS92 2BBVA 1WCKA 2XLFA 1OPMA 3O5SA 1DZRA 1QOSA 2ERFA 5C70A 1MACA 3WW3A 4QHOA 3JD71 5E8AA 4B7KA 4E9KA 4YW6A 1C8M2 4B1LA 2VAUA 1YLLA 2DBIA 3IDAA 2WQ4A 4CDWB 4QPYA 1RUG1 4LKDA 5IK4A 2YPJA 2R071 2MEV2 3ZFEC 1NA1B 1OUXA 1W0PA 4O9GA 5H9QA 1W0OA 2VOXA 2CDPA 1EPWA 1EPZA 2VNRA 3QACA 4JV4A 4XF4A 2BYVE 1UYXA 3ZLIA 3EB7A 3B01A 1PVC1 4FCAA 4FPFA 3H50A 4QXBA 4ZZ8A 2ZEXA 2B9VA 2WNUB 4H2AA 5A7NA 3E6CC 1J59A 1G9BA 1NQJA 5FDBA 4LULA 3LPFA 3A0KA 3FHIB 1PGW1 3U0ZA 4AI9A 1DQ1A 5ABJC 4QPWA 1GOGA 4NVPA 4XJ9A 1H30A 4AEJA 2RJ2A 2VZUA 3BB6A 3H3ZA 3POGA 1KRIA 5GM0A 1FI2A 3SEPA 1OH4A 1DGWX 1I5PA 1MZ6A 4GKYA 5F5QA 3BTZA 2VZ1A 3NQHA 1DLLA 2JWPA 4JX0A 4AQ2A 5LWBA 2ZKNA 3MV11 1U5IA 1GU3A 1X8MA 1MS4A 2ET7A 3V56A 2Z42A 4QQHA 1JZ3A 4FFHA 5IT6A 1J1LA 5K0UA 1GZCA 3C8XA 3H8UA 2IC1A 4ES8A 3VBRB 1LHUA 3I4IA 4OI2A 3CZJA 1MS8A 4LO7A 3O12A 5D8AA 4CDWC 3WQ1A 4XFHA 1JZ4A 1FPN2 1JHJA 5A7QA 4TSVA 4IV3B 1YQ5A 3AP5A 3S5AA 3ZFGA 1NA1C 2VUCA 2WNOA 4CU8A 4XF9A 2LM3A 1FOD3 1H4HA 2K2SA 2P3IA 4W6YA 3EO6A 5LATA 5BNOB 2Z69A 1PGL2 2W46A 3VL9A 1AJOA 3FUQA 3SHRA 1W6NB 4PBOA 5EJZB 1ZRCA 2IVJA 4G4FA 4HG6B 4IEXA 1CWPA 4PLMA 3MW3A 3I59B 4YW1A 2RS13 2EICA 2WNUC 4MH0E 4ORFA 4GMP0 3H8OA 1RUE3 3L2YA 3GZEA 5E89A 4JZRA 4M3CB 1XYOA 3WP6A 3NWKA 5DXDA 1OOPA 1TZOA 2X10A 1MZFA 4UW5A 1G9FA 3ZSEA 4XDQA 1GOFA 5CKNA 1RMU1 3ZXGA 3WUCA 1WD3A 4WVMA 3ZXLA 4E4SA 1UCXA 3DKQA 5C6CA 1DQ0A 4MVTA 1QF3A 1H1MA 2XJQA 3UL2A 1HIXA 1XBFA 1EV11 2XG3A 5FZ4A 5BNPB 5HI0A 2W1SA 4A3ZA 3ZPYA 1SFNA 5KC6A 2LRPA 2WSVA 1LGBA 2XONA 1UX6A 2GNBA 5A6ZA 3B02A 1UOGA 2ZEZA 3VBRC 4AFDA 5FLIA 1CJDA 3T1LA 1RHI3 5FUNA 4Y5SA 3VDCA 1XU2A 4JTNA 4LITA 4IV3C 5FZ1A 4QKNA 1LOBA 5LK7B 2DTYA 3POYA 3UGHA 4RHV2 3CHXA 5EHDA 4JHTA 5FXZA 4LXLA 1BKZA 1HRI2 3ETQA 4MGTA 2VZPA 3WF3A 1OT5A 2Y38A 1XE8A 3EXUA 4P5YA 2GU9A 2VH9A 4AZZA 3WF1A 3AMQA 4N7IA 1EY2A 1Z7S3 2NMOA 1QU0A 2A3WA 3FJSA 3WINE 3LE0A 2BGPA 3P5BA 4PBPA 2AYHA 4AEKA 2XJPA 5GLZA 4HSLA 3ZMOA 1G9CA 2PAEA 4Q4X1 1IPJA 1K5MC 3C3VA 3WG3A 5DUUA 5CB7A 3LIHA 4E8DA 4I0WB 1Y4WA 4GZ9A 4PIYA 4KNCA 1OI6A 1VBD3 3R4SA 2FDJA 1DHKB 2VMHA 4XJZA 2PYTA 5CZKA 4BLJA 1HB1A 3GNEA 5F39A 2JG8A 5GLUA 5APAA 5BNPC 1VBC3 1W8ZA 2CGOA 5T52A 1LOEA 1QXRA 4LKSA 4UYBA 2JE9A 2VVDA 4P9YA 4IUGA 3A21A 5F3CA 2VQTA 3OBRA 3DXTA 4KU8A 5A80A 1QJU3 5IVEA 3ROUA 1RINA 3I2JA 1S55A 1UYYA 3O1UA 4AAPA 4IQPA 1NZCA 3ME2A 4PI2A 3RJ2X 3EMRA 3W5MA 3F95A 3JZVA 2DFBA 3IDBB 3B7MA 5EYXA 2ADEA 2ZTNA 4W65A 2VTXA 2J42A 5FQ0A 5I0RA 3PUQA 1CGPA 4QX2A 4E27A 1OQ1A 5DG2A 1UOBA 4FQZA 4AFMA 1AR92 3QOPA 4E2SA 4DXSA 2RDQA 2ADDA 5FZOB 4AVBA 1SCSA 5JZGC 1OUSA 1U5XA 2JX9A 2XHNA 3AYCA 5T50A 2B8MA 1ZBA1 2OQ6A 2UY9A 3VZNA 1DQ6A 4BQ4A 2V72A 3GHMA 3LOIA 2Y8KA 4N43B 4Q4W3 5FZAA 3UK9A 2VMGA 1J1TA 2R16A 3VBSA 1WLTA 4IE5A 5F3GA 4NHMA 1UY1A 4EWDA 1UYZA 4YVSB 5FPZA 3ZN5A 4COVA 2D6LX 3SCGA 3VKLA 1TNRA 1RUC2 2B4KA 4XTPA 3U11A 3B9CA 3PUAA 4V2WA 3S6PA 4AGGA 2PHRA 4HVRA 2D43A 2VW2A 5JMOA 4AOCA 3AK0A 1QOOA 3ILFA 2WA3A 4ZU4A 5JUVA 4CVUA 4I01A 1A34A 2GN3A 3GCXA 4F83A 1ZYBA 5FP3A 4AQ6A 5K8SA 1LJ7A 5EIYB 4YVWC 1PO11 1JW6A 4RQPA 5JAXA 1PMJX 1QDCA 4FPOB 3WDYA 3W20A 1DYPA 3BCWA 4UFMA 3WV6A 3JD73 4LQRA 2RMU1 1TNFA 3K3OA 3NJVA 4Z82A 1K42A 2GP5A 3THDA 2TUNA 3UESA 2Q1ZB 3NNGA 4QU1A 1QMJA 2CTVA 2W91A 4QKFA 4RS5B 3CU7A 2F17A 3WD5A 5JOYA 2Q0AA 1RUG3 2Y33A 3C7GA 1MQTA 1RB8G 3HNMA 2R073 4NE9A 1GKBA 3KHCA 2XVGA 3O0WA 4N43C 4AHZA 1W2UA 4XFGA 3WQBA 1S2BA 5G05L 1PVC3 3T08A 1AVBA 4LTAA 4YVSC 3SMHA 4OI0A 4CUAA 3KMHA 1UZWA 4XE9A 2VGDA 1PO22 3I2HA 1YQCA 4L99A 1PX4A 5JDBA 2A3YA 2QE3A 4IGOA 2PHUA 5BYNA 1CAWA 4K7JA 4LA2A 5JXGA 3UJQA 1HJGA 1ZZ9A 3UKVA 1BCXA 3WOGA 4R9BA 4QGNA 2D5HA 2FZ1A 3AP7A 4RA0A 2PXJA 1LU1A 5CFDA 2KXLA 4UWDA 2ZGOA 3SKVA 4CDXA 1LNSA 3NW4A 1O59A 3RZZA 4FPKA 1GZWA 2OUJA 3G7DA 1F9KA 1GWKA 4RL7A 4BQYA 1HQLA 1Y9QA 1NY72 5B4XA 3JQWA 1NXMA 5DZEA 5FZ3A 3F2ZA 4QQOA 3M2MA 4LBMA 3ZXKA 3WXPA 2CL2A 4RS5C 3FN9A 1V9U2 5KXEA 1HB3A 5CEHA 4XUTA 2OS2A 2OZJA 4GMP1 5FZ7A 1B35B 3KCCA 2WA4A 2C26A 1O7FA 1OA3A 2KD7A 2DU1A 1DYKA 4HPKA 5M0TA 3OF1A 2NLRA 1R1ZA 4K9SA 4GB31 2P37A 3RZMA 5IVCA 3MO4A 4W8JA 1AL21 3HQUA 2EXKA 2AREA 5DAWA 2DCJA 5GKAC 1WMEA 3RS6A 1REFA 1W2AX 4IV1A 4IW3A 2YFUA 1VBB3 3PL0A 1POQA 1CJPA 3INAA 4ATFA 4BQXA 3LA7A 4QX1A 3EHKA 1ODMA 3CF6E 4YM1A 1VBA2 1AYM1 1BK1A 4ASKA 1D2QA 5HCBA 3ZDVA 3VD4A 3HJRA 1M4WA 1MS5A 3ACIA 5ANQA 3VBUA 3E97A 2D6KA 3M7AA 1RMU3 3ETPA 5BNNC 1YI7A 5JPNB 1V6KA 1MS0A 2A6ZA 2DVDA 3MLJA 2ZZJA 4OCTA 3ZM8A 3MHZA 4AVSA 3AKSA 2E53A 1EV13 5C3OA 2HBUA 1OBNA 1IPSA 5DN2A 1OA2A 2ETEA 4HMZA 1CAUB 4ET7A 3VDDB 2Q1MA 1GQPA 2PQQA 5GALA 3ZN4A 1R082 1SPPB 5I91A 2RS51 4XF3A 1C57A 1WCSA 3WW2A 1B35C 2W1UA 5IAVA 1F5FA 4FBFA 2VVEA 3T09A 1QQP1 4WZCA 2XR4A 3HNBM 4XFAA 5C8CA 1GBGA 4LT5A 5FYSA 4CTEA 3PVBB 4XDPA 1XNDA 1U12A 5KHHA 3C7EA 3FFQA 5C3QA 4NIHA 4XBNA 2XJRA 4NMIA 5FMCA 3D8CA 1XXNA 3ZR6A 4CP1A 1DLCA 5LY1A 2BOIA 4QX0A 5CBLA 3QH7A 1UZ0A 1H1IA 1LCLA 3SLIA 3RGBA 3IB3A 1RUF1 1RUC1 2KM2A 2HWF1 1UU5A 4LBQD 4Q4X3 3ZYIB 3SCHA 4CEWB 2YBPA 2XBO2 1Q8VA 2VJXA 4DRRA 3OBZA 5FLJA 5FY7A 3D4KA 3KF5A 4QQLA 1ND2A 5FYMA 5GJ6A 1AXYA 4E4ZA 1RUJ2 2UYBA 2YV8A 4KL1A 5C4WB 5C5UA 3OUJA 1O3SA 4Q0SA 5FPVA 4FTBA 1J58A 5B4NA 3LSDA 2F6BA 4LO5B 2JDHA 2ZEWA 5C33A 2OXBA 1AYN2 1BEV1 4AHYA 3WSOA 4OMDA 1FATA 2P34A 4PLNA 2FZ2A 2WDBA 1PM7A 2QDRA 4ZONA 1GNHA 4LEJA 1R091 3AL6A 3MFAA 5IJRA 3VBHA 2XJUA 2G4IA 2ARBA 2A5ZA 4QPIB 1W8TA 1AXZA 4FOQA 3MLKA 1PK6B 4XIKA 4BK5A 5FBJA 3VBOA 3M3EA 4XF1A 4N9HA 4EJRA 1N3QA 2IXCA 2ZXQA 4NPRA 1D7PM 1KDMA 3I3BA 3WCRA 2X09A 1WCDJ 2VQUA 2BRTA 3ALQA 3KHBA 2GMPA 4YRDA 3MEPA 4Y20A 3D3AA 1JS9A 2FCTA 2E51A 2QUOA 4FVVA 4NIGA 3UJOA 4WM7A 1W8FA 4QDRA 5A1AA 2YMZA 4XJUA 3U14A 2JIJA 1VE0A 3BIWE 4ZY9A 4OI1A 2DUPA 3MW4A 4I09A 2BVVA 1LAJA 2VVFA 1KD7A 1LRHA 2I07B 1RUD1 2SLIA 3Q8EA 3DYMA 4J6GA 2B9UA 4Q5OA 3SITA 1VAVA 4NIIA 2YC2A 1ZBA3 1W28A 4YLZA 5F5CA 5C4WC 5J37A 2DWRA 3LIGA 4EV0A 3O1TA 4RGGA 4CDQB 3U10A 3OD4A 2C24A 4B3NA 5A3NA 4AL9A 4BXSV 2IFWA 2RV9A 3DCQA 4BPZA 4XURA 1CZTA 4GKXA 4PJYA 1VRH2 2IXIA 3SH3A 4V1PA 3MFCA 1NY71 4O7XA 5ERLA 1POV0 4CE8A 4AVCA 5KHGA 1X50A 2OPKA 5JXIA 1DU3D 4DOUA 4CEYA 1ASJ2 1V9U1 4JGYA 1PK6C 1F8VA 4LK7A 2GALA 2VCAA 5LBFA 3WW4A 4AFBA 2D7FA 3FLTA 3BVCA 3CJIB 4DY3A 4Z2AA 3USUB 5A3UA 5IHRA 5A7WA 3KGZA 3LCPA 5JOZA 1PO13 2J22A 3IZOA 5I8SA 1ULGA 2ZGNA 2ZX4A 3R4DB 4R8HA 5K4LA 3VHOA 4D94A 1HV1A 1LECA 3WY6A 2RMU3 5KHIA 1ZZCA 4XJAA 4CUBA 4X6RB 5BUVA 2X5IB 3UT0A 3N4MA 3TB0A 3E5XA 1WW7A 1GQGA 2CU5A 2FCUA 4C8DA 3ZYBA 2D3PA 3KWVA 1LHOA 4CUCA 4F8AA 4DUXA 2VCMA 4R9AA 2Q1FA 5L9VA 2AR6A 5FP8A 1MZ5A 2BVBA 3N9MA 1W8HA 5EXOA 4CXWA 2DBNA 1UNBA 3N9OA 4CCMA 2R30A 1J84A 3I3QA 4CDQC 3PIJA 3SQOA 4JGZB 4CCOA 4NIAA 4NRQA 1ZZBA 4QXKA 3S30A 2BDRA 2JB4A 5DABA 1DFQA 1CR7A 2PLV2 3K4ZA 4ARXA 2ZABA 4EN6B 4WBBA 2LW8A 3P1IA 2YXSA 3NNLA 5HPOA 2VOWA 4DEQA 5A70A 1Q3EA 2AENA 2ZX0A 4JKKA 4KGGA 5JMCA 1OH3A 1TME3 4NHKA 4YW4A 1CPNA 4OVEA 1RUH1 4IEWA 1RIRA 2W9XA 3IWZA 2IZWA 3GZUC 3CZUA 2P3KA 2WNVA 3OUHA 3GXUA 1G8WA 1B09A 4LIVA 5FP4A 2FHRA 1AX0A 2QCSB 3MF6A 3EYPA 1TMF2 2CWMA 2X5IC 3T3YA 1UN1A 1QOTA 1W6OA 3O1VA 3FWEA 2J1TA 3PLQA 4FPEA 5LA1A 4GMP3 4EQVA 4PDWC 3LDBA 1IS6A 1H2MA 4JTOA 2R041 2YB7A 2XBO1 2ZGQA 4XW3A 4Y1YA 2VW1A 4ASMB 1V00A 4D0QA 2W08A 1HJFA 1LHNA 4GB33 1SLCA 4CDUA 1BJQA 3FLRA 2WLPA 2RS32 2UWAA 1AL23 4BA6A 5GZDA 3VKFC 1JYNA 2Z5WA 4JGZC 2E6VA 5LBEA 3WDWA 1WD4A 4QHZA 5FPAA 4YZ5A 1QKQA 4P14A 5A6YA 3LA2A 5H9SA 4QGLA 4HXCA 4BH9A 3AYDA 1DGWA 2GC0A 4FQ4A 4XVHA 1V6JA 1AYM3 3WP5A 1LOFA 3AFKA 4CP2A 3BKZA 2K0GA 5LRRA 3ES1A 4MV2A 1MEC1 1W9YA 3C7FA 2GC1A 2RDRA 4WV8A 2JDPA 3ACHA 4AEDA 5A1FA 4C1WA 4TLFA 3TN92 1HXS1 3ZIWA 1UX7A 5A3LA 3AYAA 4UFHA 1LEDA 2WRAA 5FOBB 4RR3A 4YM0A 3LDRA 3WR0A 3TWIA 4P00B 3B5LB 1UY3A 5GLWA 4OHZA 4CXYA 1U0AA 4C0BA 3JBG2 4COUA 1JXNA 2PELA 3MUZ1 2Y26A 3WVJA 2RS53 1IZ3A 1PMHX 4QD2A 2HWC2 2RM22 1W6PA 3ZYJB 3SCFA 4FPLA 3VDDA 4CCKA 3I3DA 2WL1A 1QQP3 4LHKA 4XAEA 1AR81 1H2LA 1IHMA 1PZ9A 4AFCA 3PU3A 1OSGA 2D6OX 3OYWA 4GQ7A 1I1EA 3K2OA 4Q29A 4I30A 5AFEA 4P02B 1GNYA 1J3QA 1O5UA 1AR61 4LOSA 3R05A 2WNEA 3IPVA 4AR2A 5LA9A 3DF0A 3QLQA 3LF7A 4A7ZA 2V73A 4IE0A 4ZS3A 1F4AA 1VRH1 1DGRA 3ELNA 5LCWL 1RUF3 1URXA 2LTNA 2NM1A 1W8OA 2HWF3 3WF2A 3KT7A 5EJ1B 5I0SA 5CFCA 5K0UB 1TG7A 1LENA 4E2GA 2RJLA 4URTA 3N9PA 2ZGPA 1ASJ1 5D8AB 3T2TA 4MGYE 1OKOA 4MXVA 4XPVA 2OX0A 1OFNA 2YC4A 2GDFA 3ZFGB 3H3LA 2ZGTA 3VDBA 3NRUA 2VG9A 3ECQA 4PQ9A 3NV2A 4K1YA 1VIWB 3RNSA 3ZYPA 1JZ2A 1BEV3 4TXWA 3TNQA 5C8WA 2DUOA 1D4M1 4NOTA 4E4DX 2VBPA 1Q43A 1F31A 1R093 2OA2A 5KHKA 1G9DA 4IEQA 3CDZB 3S7EA 1KS4A 2HYKA 1LHVA 3ZR5A 3AZVA 1YRZA 3H3UA 1XRUA 1V70A 1AL0G 2FMDA 3GYDA 4W50A 4BHPA 4A4AA 1BXHA 4TYSA 4B8EA 2NQYA 4KGQA 2R0FA 5IWFA 1OF4A 2XJSA 2R0HA 4UI9L 1OOPB 1I3HA 2EXIA 1APNA 3I2DA 1ULCA 2B39A 2R062 1NCQB 4UBHA 4XMAA 4N53C 2VZTA 3PJYA 4NRPA 3ZVXA 2WZR2 3JUUA 2F4PA 3POJA 3OGGA 4WVMB 4LBQA 2B5HA 3ST7A 1VMFA 3WEZA 5A3PA 2XQXA 3T0AA 3ZXFA 4K8RB 1V6IA 2KA3A 4PIZA 3LFIA 4BM8A 1WCQA 4Q0UA 4PHZA 1MR5A 5HV0A 1C1LA 2ENRA 3LEMA 1VBE3 1CVNA 3IM0A 5J1XA 1RUD3 1OHFA 1AUYA 4I0AA 3ILNA 3M4FA 3ZYRA 1YUDA 4CZSA 5K0UC 4URAA 1POV1 1LESA 4DRVA 1CAVA 1LOGA 2Q5TA 1FNYA 1NUKA 2ZHNA 2VNGA 3KT1A 5JPMB 2WZPP 2NZ9A 3T1MA 1OLRA 3J8F3 1BYHA 1EAH1 2NMNA 3UYJA 3ZFGC 5FMOS 4QXHA 3ZSKA 2YZ4A 4AVAA 5JWPA 3O1MA 2BW8A 3OEAA 4Q0PA 1FV2A 5FOJB 3BTXA 2RR12 2J1UA 2DCKA 5IAXA 1SQ4A 4YZ1A 1N3PA 1V9U3 2GNDA 2IXJA 3WG1A 1H8TA 2A6YA 3OY8A 1ZBE1 3POWA 3JB4C 4OHWA 4SBVA 4XIOA 3U1XA 1LTEA 4QM8A 4XUOA 1BBT2 4FOYA 2D3RA 4Y4YA 2A7AA 2VD7A 4Y3OA 2HBTA 3VZKA 1LHWA 4AFAA 4D6QA 1S0CA 2PHXA 2OZ6A 4Y22A 2RS31 1KEXA 2ID4A 4FPGA 2VL4A 4UW3A 4OZXA 1S0GA 4XACA 4AE2A 3GJAA 1CIYA 2JG8B 4FPJA 1R1A2 5FZGA 3RVHA 3RI8A 1JI6A 2GH2A 4HOOA 4PLOA 1QJY3 4OHXA 2CGPA 1NCQA 4BISA 4UT5A 1G6NA 1JTZX 3NAPA 4ISRA 3A23A 4XHBA 1A8DA 2DVAA 4LKEA 1UQXA 2HWB2 2Q8EA 1GSLA 1YJLA 4H3WA 4IEVA 2JB8A 1WW5A 3SH4A 1SLAA 2VZRA 3RSJA 1WMDA 4WVWA 4CP9A 1W04A 4QX8A 1VPHA 5DAVA 2IXHA 4FXGB 1KXGA 4MOAA 4QM9A 5E16A 4Y26A 1NX9A 1ONAA 2WFF1 4DMIA 3WDXA 4EN9B 5JLVA 2HWE1 3K75B 5J3UA 1BVP1 2VCBA 2Y64A 3GBFA 5EV7A 1QJX1 3RWNA 3K77A 1CD3G 2IFRA 2YGLA 2OQ7A 1LU2A 4IE7A 5FQ0B 1FNZA 1RL3A 2ORZA 3N3HA 4IEUA 5EP9A 1PIV2 3NV1A 4XC9A 4XFFA 4AI0A 2A6WA 2YY1A 4ZKTB 1ST8A 5BNOC 1J83A 3T2PA 3OTFA 5FLHA 5FZ8A 1EUUA 5LBCA 4Q4V1 3KV6A 5FO8B 4HETA 4PI0A 1RUH3 4L92A 2ATFA 4QKBA 2I74A 4LNVA 3T4VA 3MIGA 4EN8B 3B3QE 4P08A 4FFGA 2QFEA 2BQPA 3J26N 4HANA 4DIQA 3KVBA 4S2FA 4D6RA 1CAXB 2OIIA 2YROA 3I7DA 3Q8FA 1CIWA 4FPCA 3VBSB 2JG9A 3D82A 4WVZA 3POFA 5A3WA 3RZJA 1O4TA 1JZ8A 4Z92B 3NJZA 1LB2A 3AKPA 5CADA 2Y6FA 3FX3A 3O1OA 1W8NA 1N47A 1UW8A 2CHHA 3ZN6A 2A73B 2R043 4K8FA 1O6UA 2XBO3 4WVVA 2A3XA 2QTWB 2VU9A 2XUEA 5FZEA 2JDUA 1O3RA 4MZUA 2YG0A 3WG4A 5CG8A 1UL9A 5T3NA 2WS91 3HVDA 4QPGA 5FK7A 3O0XA 2VUAA 1US2A 3KM5A 5F3IA 2ZMKA 4HK8A 3AB0A 3RWKX 3HBKA 3NMBA 4PQQA 5LEJA 2XOMA 2G9ZA 1FMD2 3HN1A 4RQPB 1JUHA 4XQDA 1C8M1 4CSWA 1N3OA 1IKQA 2ET1A 4QDQA 3HD8B 4YSFA 1XB9A 4HKLA 2QQMA 2YBSA 5DDJ2 1ENRA 1CQ9A 3G6JB 2HKXA 4QX3A 4D7YA 1UZZA 2AACA 1SLLA 4KWKA 1W9FA 5L7OA 1MEC3 2MEV1 3APBA 4A45A 2VZSA 2HWD2 2P17A 2E26A 1HXS3 4NPLA 1K5MA 1MQTB 1MPXA 3VKNA 5FYZA 2I2SA 5EJ3A 4A44A 4QHBA 1VRBA 1WA6X 5F1RA 4XETA 2VZVA 4IERA 1HRV2 1F35A 2G1MA 3DPRA 1MS3A 1VAKA 1JOJA 2ZEYA 5J98B 3WNKA 1XNBA 3M70A 3ZFFA 4ES9A 1L7LA 1UY4A 2EIGA 3BUCA 2Y0OA 1RYYA 2FBEA 3JB8A 5A7PA 2LALA 4DQAA 2OW4A 4QB6A 1CAXA 4AAXA 5FKBA 5AC92 1GYKA 3HAGA 5FCCA 1COV2 1AR83 3C7HA 1CAWB 4B4RA 2XVKA 5GLTA 4Q4Y2 2YBKA 4HLTA 3E5UA 1HQNA 3KCXA 1HQWA 1AR63 3K46A 3HPNA 4DO0A 1SBFA 1RVF2 3V64A 5CFDB 4MX3A 3RI9A 3OSDA 5IVYA 1W03A 1WBFA 4RQPC 2XVLA 4ZXEA 4CDXB 5FYCA 1VRH3 1GZWB 1KITA 2WT1A 3E6DA 1VR3A 2H6CA 3ACGA 2ZGLA 4QGMA 1FPN1 5J7MA 5D1IA 4HONA 5LA0A 3VLBB 3KS7A 3VZJA 1BLZA 3B69A 3MGUA 2P3YA 5T5PA 3LA3A 4CCEA 1UPSA 2BFUS 1QEXA 4LBJA 4BJ0A 5JZGA 1PGL1 1BBT1 2ZMNA 1QH6A 3RZLA 4HPKB 3IAPA 1XSRA 1T6GC 5FYTA 4K20A 5D2AA 5FYVA 2WO1A 2J1RA 1Y3TA 4ATEA 1D4M3 3RJRA 1RUI2 1FAYA 1SHWB 3OUIA 4D7SA 3PTYA 5C9AA 4IV1B 3LEGA 1XNCA 2ZACA 3DYOA 4EWAA 3H42B 4D8MA 1XNAA 2CGNA 2RE9A 3B00A 4GXLA 2BV4A 4SLIA 1UOJA 2VCCA 5GZEA 2Z79A 4CCDA 3VZMA 5T55A 4CP0A 1U5ZA 3WT3A 3RMYA 3AVRA 2CY6A 3WNNA 3ZYHA 4CCCA 3NKTA 1I5ZA 3VBUB 5A3TA 4P9IA 5L9BA 4OI4A 4Y33A 4IDZA 2PMWB 2XMLA 5F37A 5CFDC 4HBNA 1JYXA 3OEBA 4X6QB 1E5RA 4M00A 4Y1XA 4YVWA 4NPMA 1TQ5A 4CDXC 3UGGA 4M4RA 2JDZA 3H7YA 4TLGA 1YWKA 2MHFA 2AH2A 4P9XA 4N7UA 2GC3A 3VHNA 4JVAA 3MLLA 4EZ4A 1PX3A 4FFIA 1POV3 1S1AA 3PHMA 3POEA 4K3UA 4RHV1 1SG3A 2W94A 1JYWA 3VB9A 2QQNA 3I2GA 4M3CE 1SEFA 1HRI1 4FXKB 3CO2A 1KDKA 5FRAA 2VBBA 1EAH3 3ACFA 2IUWA 2IWGB 2ZJCA 1MZEA 1GP4A 5C8CB 3I54A 3N36A 4CCNA 1FT9A 1UKGA 2QDNA 3E5QA 3GZTB 4IEYA 4IV1C 3OCPA 4K1ZA 5A6XA 3OD0A 1PM4A 4BE3A 2QZ2A 2WR9A 4LO6B 5FZLA 5J96B 4XFBA 4ZU7A 2JICA 2BGOA 4CPBD 1ZBE3 1AHSA 2ILMA 4YW2A 1N1TA 4XBLA 3E6BA 4COZA 4UFIA 1VLNA 1XPWA 1FXZA 2NN8A 2QVSB 5FXXA 2BU9A 2XLAA 1K45A 3ZO0B 3PNAA 4OFGA 5EFUA 1IG0A 1ND2B 2WT2A 4XYXA 2FDIA 4QDSA 3VBUC 1H9PA 2RS33 1JUIA 1YNAA 1FOD2 1H4GA 4XUPA 4DPNA 2RDSA 5HV4A 1YFWA 2JDYA 3LQCA 4META 3ZYGA 3BIEA 4YFZA 4S2HA 2VMEA 1XE0A 1OURA 2WO7A 2PAKA 3ZXEA 4EN0A 5G04L 1WW6A 2RS12 3VBHB 2D3SA 2V4VA 2Q30A 1DQ5A 3PMEA 4LE3A 2H6BA 5FMBA 1RUE2 2UY8A 4MG2A 3RFRA 5BY5A 2JE8A 1DP0A 3VBOB 1UY2A 3RYKA 3P6BA 4AHWA 1DBNA 3RZGA 5I0TA 3M1HA 2CNAA 4AHXA 3Q8CA 2WFF3 5C8CC 4FPYA 2HWE3 3S0MA 2JD4A 1C5HA 3KQRA 3MI8A 5IW0A 4MGSA 4Y20B 5JI7A 4YW3A 5A33A 4XXAA 4MGZE 4YG6A 1QJX3 1YHFA 1K5JA 1LGCA 4LBLA 4WM7B 1ULEA 1AR91 4GALA 3OPZA 4G9SB 3BTAA 1GLHA 1REDA 3FZ3A 1UD1A 4LPLA 3WW1A 5HXMA 2Y6HA 4UFKA 2DV9A 4GH4A 4BIOA 3AYEA 3RYPA 3IT8A 4Q4V3 1MS9A 5AC91 3PJQA 2VBDA 5FO9B 5FJHA 1RHI2 1IS5A 1COV1 1ODNA 1QWRA 4Z8BA 4WM8A 5LBBA 1ND2C 5C3SA 4M0HA 4ARYA 2BWCA 4DUWA 5BNNA 1S0BA 5FY4A 1GWMA 2D93A 4N90A 4DS0A 1Y9MA 2VC9A 1TE1B 3FC0A 1T6BX 1Y43B 2I45A 1Q8PA 3AMHA 3DV8A 5DG1A 1FV3A 2X8KA 5DAQA 5E1RA 1ZRRA 2XQRA 4I02A 1D0HA 4CU9A 4IEZA 1SFPA 2DUQA 2OVUA 4BMEA 4CEYB 4YGCA 2BP6A 2PHLA 4JGYB 4LUMA 2WS93 1O91A 3VBOC 4UF0A 2WO3A 1UZVA 5FY1A 2VXRA 5A7WB 4MUVA 2K46A 4JDMA 2Y6LA 1RXFA 4XFCA 4EZHA 5IVBA 5T5JA 2D97A 3SISA 1US3A 1VBD2 1C8M3 1NLQA 3V0BA 1GMMA 1QHDA 2R1DA 4QX7A 4RD7A 2B7YA 4WM7C 3A7QA 1HB2A 5FXVA 1VBC2 3N7MA 2C9KA 2JENA 4X8PA 1AR72 1NCRA 2MEV3 2V5DA 3H8XA 4RFRB 2P1BA 3ZDSA 1PVXA 2W5FA 3VBFA 1OQDA 2TNFA 3DYPA 4XTMA 4GWJA 2YU1A 2WN3A 4NHXA 4YGDA 2CWSA 2RDNA 1QJU2 3H1YA 3HQRA 3DUIA 2JDMA 3I3EA 4IE4A 4IESA 1PO21 1WGPA 4CEWC 4A7YA 4XCAA 5EWSA 2H0BA 1ZA4A 1VJ2A 3AZWA 2YUEA 4GD4A 2VMIA 5HCAA 5IK7A 4PF1A 3MUY1 1C4RA 3TRSB 4MHRA 4KH9A 5I0UA 1Q8OA 2EAAA 3GHNA 5A32A 5DZFA 2ZGSA 3WG2A 1UYPA 4CEYC 1XC6A 2WC2A 3R4UA 1Z0HA 4JGYC 3K51A 5F9TA 2B45X 3THTA 4NWVA 1QNWA 1YJKA 3K48A 1RUNA 2C9AA 3I8TA 4XJWA 4QX5A 3N9QA 4Q4W2 4R9CA 2WNVB 1QXPA 4QPIC 4BQ1A 3WQ7A 1OKQA 1S2EA 4Q26A 1UU4A 3AVSA 2XUMA 3JQXA 2D98A 1FPN3 3KF3A 4G3YC 3HBZA 5JR2A 3LDKA 1W6OB 4FTEA 3N7JA 2GP3A 4XBQA 2WYSA 3AC0A 4FPHA 4CXXA 4PF5A 4E2QA 4BU2A 4LHNA 2WWUA 1JN2P 2V5YA 4M4PA 1BZWA 2PFWA 1BBT3 3MW2A 4QQPA 2G9FA 4W6WA 5DAXA 4KBZA 5HCHA 4QU2A 1GOHA 1HW5A 2Y0IA 2VUDA 3ITQA 3D6EA 4OLLA 4XEZA 2BPA2 1H2KA 1NLRA 1SLTA 1BQPA 1NYWA 1XJAA 3BYWA 4KWLA 4XOGA 4CDUB 3POBA 5BNQA 4YW5A 1OA4A 1DYOA 3MIFA 4OHVA 1UAIA 3NNJA 1VBA1 4PCRA 4MXWA 1GZTA 1OXCA 4KBBA 4GIQA 3T0BA 3X29B 4K40A 1UIJA 2VQAA 3O0VA 3JD72 5FXWA 5SV8A 1EYBA 4AQTA 3N9NA 2ORXA 4DXTA 4J1XA 5F6LB 2JKXA 4DINB 1W6QB 1RUG2 4YGBA 3ZSMA 2EXJA 2C6SA 4AEDB 2R072 4XMIA 4DXRA 5FZDA 1KFXL 3IMNA 1W06A 4Y4RA 1S0FA 5IVVA 1SZBA 1WLWA 2ZOEB 2YPDA 2ZX2A 4RR3B 2R32A 3R0RA 2L9LA 5FP9A 4AI8A 3MBWA 3LEIA 2GSYA 1R081 3S5QA 2WKKA 3WF4A 3ES4A 2WYFA 3M3IA 1PVC2 4CUGA 4EROA 3CJIC 4M01A 1KJLA 1BHGA 2QJVA 4YARA 5JCTA 3K4AA 4HN0A 3H9AA 4RHV3 3THCA 4NAOA 3LWCA 4W6XA 1W6PB 4OUMA 3QD6A 4IEOA 1HRI3 1PGW2 1P8JA 2LROA 2VMDA 3GDBA 3RMXA 3U78A 3EJKA 5KXCA 4R4XA 1VMJA 2JD9A 5EZWA 5L36A 5TSWA 1GWLA 3OYWB 3PDQA 2OPWA 4IETA 3O14A 4AK3A 4CDUC 2W92A 3RDIA 3AFGA 3KLSA 5GZFA 2MNGA 4HL0A 1GP6A 1YQ6A 1RITA 2DVBA 4O65A 1DF0A 2ZKLA 1PGSA 5H9PA 5L9RA 3IPVB 1ND3A 2PTMA 4XHXA 3WCSA 1OVPA 2GNTA 5C7GA 3AKTA 3AX4A 1X7NA 2YYOA 2JKBA 3BOPA 2WIIB 3J7HA 1E5IA 1X9PA 1ENQA 2WT0A 4I3PA 5DPNA 5LA2A 1RUJ1 2W2IA 1HV0A 5LK5A 1OLMA 2WFPA 2ZAHA 1DGRN 1LOFC 3IIAA 5BV6A 5CFCB 1AXKA 4IXLA 4NROA 2BEOA 3AP4A 1IS3A 5F5AA 5F6KA 2VZQA 5JIUA 1QY4A 4LUKA 4YM3A 4GJYA 1AYN1 2Y6JA 1CONA 3IAQA 1JMUB 3J4UH 4ONUA 4RR3C 5A7SA 2PN5A 3AMNA 1SDDB 5T5LA 1A6CA 2FD8A 5CVRA 4XQWA 1W6QA 3AKQA 4EWEA 4TZDA 4CU6A 2ARAA 4UFLA 3O1SA 3WDVA 4LJHA 4OUSA 5HCFA 1VBB2 2GH8A 2WAAA 4DB5A 2PHWA 3PURA 2WINB 2WWSA 2XJVA 4YG3A 5FZHA 4LO8A 3TNPB 1JU4A 1AR71 4MLOA 2R49A 4K21A 1O5LA 4LBOA 2WLQA 3VD7A 1YIFA 3VDDC 4PDWA 5FK8A 5IVJA 1E5HA 1L7QA 3VDAA 4KG0A 1HX6A 5IFPA 3WNLA 4XCBA 1SMVA 4Q2FA 1ZREA 1IQDC 1PZ7A 1UXXX 3KQ4B 4Q8LA 4UXAA 1RMU2 3UKTA 1R64A 1JYCA 1SLIA 4QAWA 5FY8A 4CPBA 3AJYA 1YQ2A 5A6QA 4BIFA 1ZVFA 1ZRDA 4LBQB 3FFZA 2DCTA 1AR93 3PUHA 2B46X 3H1WA 4P9WA 4A2UA 2C0ZA 1EV12 2HYXA 5FMDA 1SCRA 5E6HA 5LRSA 2O0OA 4UBGA 3THPA 4FFFA 1W90A 1VALA 2V4AA 3BALA 4LE4A 3FMGA 1VB2A 3OB8A 5KXBA 3V0AA 1ALYA 5AC93 5CFCC 2GMEA 4JHZA 4A3XA 1O4ZA 4RGKA 4JQTA 1CAVB 4L0PA 1RUOA 1NKGA 5CNAA 4LLOA 4QKDA 3TEXA 2VOVA 2YDEA 4XILA 5FPXA 1RUC3 1GP5A 5JSPA 2SBAA 2VOTA 5FYUA 4B29A 2OYZA 2JIGA 1IQAA 3VUOA 2GMMA 1IG3A 5JOWA 1CZVA 1W8WA 5KC5A 4YG0A 5I8TA 2ZGMA 3CBNA 3LOBA 2VPVA 1JOPA 4Y5Z0 4NUBA 4U36A 3USSA 4OMCA 1XNTA 1UXZA 1U5YA 4XABA 3LAGA 1UU6A 4NHLA 5F3EA 1H8TB 1RXGA 4I0BA 4Q4X2 3OY8B 4U2AA 4YGEA 3ILRA 5FUPA 1SFYA 3URFA 1ZM1A 3VHRA 4ZHNA 1OFSA 3PTRB 1ZX5A 3VHPA 2DDUA 4HT1T 1HB4A 1CX4A 1WKYA 2QBXA 1UIKA 2P3JA 4Y22B 3T2OA 5FZCA 3O1PA 1FYUA 3KSCA 4NAMA 5AVPA 4YM2A 2AUYA 2CDOA 4DUVA 5C5TA 5IVFA 2UU8A 3BTYA 4PT6A 3NAPB 2QQPA 1OLME 3T0DA 3L2HA 1YO8A 2UURA 4JKMA 4FSJA 2IXLA 3T30A 1OD3A 5DUWA 5LEKA 1YEWA 1W6MA 1YFUA 1LODA 3KGLA 3NV3A 4JRAA 2XLGA 1ACCA 2W52A 2XHKA 3J9SA 4LKFA 4CP9B 1QJEA 2P5BA 2LUWA 3BN6A 4O9EA 1A8MA 4UW6A 2VNVA 1PO23 1ENSA 2PLV1 1YYNA 4K6BA 4XAAA 2XKOA 3RRDA 1MVQA 3RPQA 3DGTA 1W2OA 3JXSA 3HOBA 2A6VA 2PA7A 5D8AC 3C2UA 3QCWA 1T2XA 1Z78A 1GV9A 3WP4A 1DZTA 4COWA 2FDGA 2QQWA 3ZFEA 4XUQA 4FI9A 4WZFA 2VR4A 1H8TC 4O61A 3A0NA 2LS6A 3GJBA 1ZZ6A 5DZGA 1X82A 4AF9A 5ACA1 1UPIA 2ZBJA 3UV9A 4AVTA 4CCJA 5FWJA 3Q8AA 1ZBA2 4LIUA 4LK6A 2WQ8A 2XWJB 3PUSA 2E7QA 3WUDA 3RG0A 1KGYA 1TMF1 4N53A 3ZXJA 3WLUA 2WZ8A 1NE4A 4Y1UA 2D6PA 2Y34A 2YGMA 1ZRIA 4Q8KA 1D2SA 2JG9B 3MPBA 5GLVA 1JYTA 5ABJA 4FTSA 2W1WA 4Q27A 3HNYM 1OOPC 1AF9A 4HSJA 5K7PA 5FY5A 4F7ZA 2E31A 1ZNPA 2HEYF 1NCQC 2GZWA 2WO2A 5FPLA 4HVQA 3NAPC 2QQLA 4BQWA 2HLEA 3ZN6B 1IKPA 2AZ5A 4Q0VA 4XF0A 4GWIA 3NKGA 4QWNA 4D69A 3BU7A 3DKWA 3QBQA 1JU3A 4QPGB 4FT8A 1F4HA 5JIAA 1DQ4A 3U75A 2YU2A 3EBRA 4HKOA 5LASA 1PO12 1F15A 4XUNA 4EE2A 4D6SA 1VBA3 1GANA 2ZCWA 4X8NA 5FJKA 3I2KA 2Z4FA 4CU7A 2Y6GA 1JYIA 4CDWA 4N9IA 5K9YA 2RMU2 5AFBA 4MGKE 2DCZA 5F5IA 2PHDA 3TN91 1VBB1 1NA1A 1LULA 2TEPA 2WJSA 5J09A 5L7OB 1WWYA 1E57A 5I8YA 1NLSA 2BGCA 3OGSA 3WDTA 1ULPA 3TEYA 2DFCA 5JSRA 5IK5A 1O3QA 1K5MB 4E8CA 1JZ5A 1Q56A 1RJ7A 3IDEA 5C3RA 2X05A 3JBG1 4GULA 2WNUA 3OBTA 1R083 1WLDA 2VULA 3W59A 5I93A 3FHQA 1STMA 2HWC1 2RM21 2JG9C 1W9WA 2WWJA 5CKQA 3DPRB 4AVVA 2MPFA 3ZFFB 3BPSA 3AP6A 2J1SA 5KR7A 3VZLA 4LOTA 4BMBA 3GBWA 2BOJA 5CA6A 5J48A 1C1FA 4Y1VA 1UZYA 4UW4A 4BOWA 1UMHA 1LEMA 4KQ7A 4AI2A 4COYA 1WW4A 1OC1A 4NR1A 1CPMA 1V6LA 3H7JA 2YC0A 1I6XA 4Z07A 5FO7B 3C7OA 2JG8C 3MIHA 3MYXA 1TME2 4QPGC 1YI9A 3TOJA 4L8QA 4DXZA 5L73A 2BERA 1WCUA 5DUVA 1JHNA 2JDKA 3HQXA 4I2OA 1NOVA 3VBRA 3OBAA 2EAKA 3FHAA 2A71A 3N35A 4B7EA 2J1AA 1H9WA 2WBKA 4Y24A 2W39A 1JH5A 4NIDA 1RUJ3 4IV3A 1J3RA 3WX5A 1OQEA 3POSA 1LKNA 3TEZA 4KI5M 3AZYA 3ORJA 4TN7A 2VOKA 2ZA9A 5L7OC 2CYFA 2WSUA 5BNOA 3GF6A 1OMIA 1J3PA 4XJ8A 3M8LA 1CN1A 3H1MA 3LB9A 4C91A 2BNNA 1W6NA 2Q4SA 1S4CA 1AYN3 5JZGB 4NJ4A 2ZZQA 4NHYA 3WNOA 3FE5A 1X36A 3B9IA 3DEMA 4GB32 3I59A 2WUHA 4QB2A 3I2OA 3U37A 1AL22 5F2WA 5CKMA 3KT4A 5IK8A 1DZQA 3NO8A 1ZZ7A 4QXCA 3RYRA 3T2QA 1GZ9A 1Q5OA 4DZGA 3DPRC 2EALA 4M3CA 3NNFA 3H0OA 3HEIA 5FIXA 1QJZA 4LORA 3ZFFC 4GWMA 5C9AB 2K9ZA 3CLPA 4QB1A 1AR73 3ENRA 5DAPA 3IBMA 3ON7A 5F8PA 4D3WA 2WAOA 3VD3A 2R061 1AYM2 2TBVA 1TVGA 5T5OA 2WZR1 3N7LA 1XU1A 3VBSC 5FFOC 4A42A 1KQRA 4MGIE 1WMFA 3VV1A 5BNPA 3IMMA 1D4VB 1YFXA 3ZXDA 4LLFA 2CSGA 3GGLA 1DDLA 4KU7A 1X33A 2X29A 4YYOA 1A3KA 2WABA 3W58A 1KJRA 4LO4B 1O8SA 1H2NA 1WBLA 4YVWB 1E5SA 1WUVA 5FZ0A 3ABZA 1C3HA 2QQIA 4NWWA 2NPIA 2P6HA 3IIIA 4RN5A 5FWEA 3BODA 5IYYA 2OT7A 1KS5A 1S0IA 2DVGA 2YHJA 1O3TA 2AEZA 1SBDA 2RS52 5B2GB 3WQ0A 4JCKA 1RJ8A 1XOYA 5EPAA 4C90A 1WMXA 5FP7A 1QQP2 1GQHA 1GUIA 1IOAA 3CIHA 2FDKA 2RR11 4J25A 2JXAA 1ZRFA 3D0JA 1I9RA 1YXWA 3I2IA 3AKRA 3Q8BA 3U4XA 4YPJA 5D21A 3KB5A 2BUKA 2BZDA 3NVCA 2ZHLA 5FUIA 3O7OA 1ASJ3 3B93A 3HR9A 2FQPA 4XDOA 3KZ4C 4CCLA 1M06G 1DGLA 3RQ0A 1W9TA 4AGRA 5C9AC 1MQTC 4L2NA 4ZU5A 1AX1A 1RUF2 1H6XA 1L7RA 5FY0A 3BI3A 2HWF2 4A41A 2V09A 1OD5A 3MPPG 1YC61 3MIBA 2ZGUA 3HIFA 3ZSLA 3QH6A 3IKWA 3TBDA 3MZHA 5SV5A 1VP6A 1R1A1 2BBAA 1CZSA 4KG8A 2X53S 3OG2A 4LBNA 1XE7A 4LR4A 3WNMA 1C5IA 5LB6A 3ZKUA 1N1YA 3MICA 4KWUA 1Q8SA 2XB6C 3AJZA 1QGLA 4QQ2A 4FP3A 4ZPIA 1BEV2 4JQRA 3PIGA 5ANNA 4Z2WA 4NN0A 3T4HB 1GR3A 1NQDA 1BK0A 2HWB1 4ZS2A 5FMOL 5F7UA 4DFSA 1R092 2D5FA 4Q1RA 3MF9A 3OGJA 4RYDA 1KFUL 4MSVA 2BTVC 2FCVA 3SH5A 4LA3A 4MYEA 4HK9A 4LHSA 5DUXA 2ZGKA 3WHUA 5FV3A 5BPXA 3D0SA 2WZEA 1BMV2 4XZUG 2PLV3 3ZOIA 3J7LA 3FBMA 2VMFA 3N7KA 4KWJA 3W21A 1DCSA 1X9TA 1W3XA 3GBGA 1OLQA 1UOFA 1PIV1 3GALA 4CRQA 5A33B 4INDA 2VO5A 1GFF2 2R6QA 5FZOA 3O1RA 3DECA 2R7EB 4HVOA 3AL5A 2P4EA 5JI9A 2ZGRA 4V2VA 3TAYA 4FAGA 2JJ6A 1VBE2 1RUD2 1ULFA 4N43A 2O1QA 2A6XA 2ZPXA 3E1F1 4GH4B 5ACA3 2DURA 5BXXA 4OQ8A 2JDAA 3UGFA 1O8PA 1ZA7A 1NAEA 4OYUA 4WM8B 1SLBA 4YVSA 3ATGA 3LGRA 1TMF3 4JAAA 4KMQA 5FZFA 5LW9A 5JXJA 5BNNB 1TME1 4L9BA 3J8F2 3BGAA 4JRLA 3UETA 4EN7B 3EQEA 2ZMLA 5KBFA 3GM8A 1VMHA 3GCWA 3WNXA 2R1BA 2WN2A 4XQ4A 2BNMA 1OVSA 2VNOA 4YNIA 5JOXA 3JCIA 4OUEA 3VL8A 3N9LA 1OPOA 4GWNA 5FZBA 4DY5A 4GAZA 1NT0A 1XSQA 4H7LA 3SKJE 1Y7BA 2P2KA 3GZAA 2VECA 2PAMA 1PMIA 1IS4A 3LZZA 1FMD1 2W68A 5EYYA 4CA9A 4UF0B 2HEVF 4IEPA 3UKNA 3LKJA 1PNFA 2N7GA 1S2KA 5FAXA 4RS5A 5DDJ1 3RZKA 3OPWA 1IPKA 2Q8OA 1AX2A 3V0BB 3ZX7A 3AMPA 4XXPA 3MIDA 1Y9GA 4B4QA 2HWD1 2O8QA 1QXJA 3TN93 4XFIA 1QJY2 3IDCB 5FZKA 3AZZA 1NCRB 1PZ8A 1QDOA 3BOWA 4GH4C 5JR7B 1PHMA 3VBFB 1QNYA 4WM8C 2IVIB 1HRV1 3M3OA 3AMMA 3JBG3 2ZAAA 3S7IA 5FR3A 3ZPOA 1K12A 2RVAA 1V6NA 4IGPA 4Q0QA 4YFWA 2HWC3 2RM23 3CL1A 4HZFA 1UF2C 2JDNA 4B4PA 5C3PA 3AXDA 1HN0A 2JEMA 2P6CA 1SDWA 2EVXA 1LR5A 2JECA 3LD8A 5IUQA 4AI3A 1G9AA 4ASLA 4FAHA 5J36A 2HEWF 4IL7A 2QQVA 3BPZA 4Q4Y1 1NZIA 1JODA 1QJFA 4XZPA 1YIPA 1RGSA 4P9LA 1V6MA 5A32B 4LMFA 2EXHA 2E7TA 1JOBA 5CYYA 1RVF1 1W3VA 3NJYA 4FOWA 1JBCA 5FYYA 1RUH2 4NO4A 3AZXA 4YW7A 1Z7S2 4IGQA 1ZZ8A 4OULA 2XL7A 1CESA 3DL3A 3KV4A 3VBHC 2AC1A 4F3JA 1JZ6A 3TYJA 4YZ4A 4YWAA 1K3IA 2XGXA 3KV5A 5LY2A 4AW7A 2EF6A 1UMZA 1B35A 3TEWA 3FL7A 5JSOA 3NJXA 3ZSJA 1YQ8A 2VMCA 2B42B 1NCRC 2CAUA 3LEKA 1ENXA 1S0DA 3VN4A 4BQ2A 4TTGA 2XWBB 4L11A 1HDKA 2R042 1W0NA 2ES3A 3KD4A 5FREA 3MDPA 4C1XA 4ZZ5A 1UO9A 3VBFC 4AI1A 5FZMA 4IE6A 1RUI1 4J1WA 5CAZA 4HN1A 5FZ9A 2XPJA 4BXFA 2XL9A 3H8RA 4BYYA 2D40A 4D7TA 2O14A 2J1EA 2Q8DA 3HMYA 4JDNA 4OHYA 2VZ3A 2J1VA 4MXWB 4A6SA 3WF0A 1MVEA 1VAMA 2R063 4BK4A 2WZR3 4Y1ZA 1MEC2 3K4DA 1JYVA 4C0HA 2W3JA 1JZ7A 4JKLA 4N8MA 4RFT0 1HXS2 4MHUA 4TWTA 2QKDA 2E7AA 3KCYA 3OPTA 2DF7A 1F2NA 1S0EA 5FZIA 3OGVA 1BMV1 1CAUA 2BFUL 2Z2SB 3CJXA 1REEA 1SPPA 3A4UA 3DN7A 3KVAA 1G86A 4L97A 3A22A 1H1AA 2VW0A 4UOJA 3LFMA 3Q9OA 4EYUA 4DNYA 2E9QA 5KHJA 4B1MA 1Q8QA 1FX5A 1BVVA 5ISLA 1VBE1 4R4ZA 1QIQA 3D5OA 2O8OA 2XH6A 4ISQA 1AR82 5FYHA 1GICA 1F5JA 2RR13 3SC7X 3SXWA 2GC2A 3ZXAC 1LOCA 1MS1A 3K3NA 3LSEA 2ZX3A 1O4YA 3CEWA 4AXOA 2W95A 2EIEA 1NE6A 3POIA 5I0DA 1S0JA 2ZHKA 4BLIA 1IGOA 1W2TA 3J7MA 3J8F1 4RGAA 1AR62 2UYAA 4CEWA 1ULDA 5F2SA 1ND3B 3FUOA 2FMYA 1AJKA 2QQUA 3NNMA 5IATA 2GN7A 5C4WA 1W8UA 4P9JA 3AP9A 4BWOA 5E88A 3PVEA 2IXKA 5FY9A 3U07A 1A78A 1L3JA 4OZOA 2NYYA 3R6SA 5A7OA 1FOD1 3PVOA 3WDUA 1UMIA 1R1A3 1XNKA 5JXHA 2QQKA 1WA4A 3I2FA 2FDFA 5FBZA 1XQNA 2VUJA 2A75A 1C28A 2EIBA 3CNAA 4UAPA 2EIDA 3U4SA 4R9DA 1HKDA 5CISA 4BQ3A 1W99A 2XKPA 4QPIA 1UWWA 2RS11 2VE1A 3VZOA 1PK6A 2HWB3 3MIEA 2VTFA 3JU9A 1D4M2 2Q8CA 1YFYA 2GAUA 1RUE1 4CYDA 4QMAA 2VZOA 2DVFA 2PQSA 3FBYA 5KWRA 5DMYA 3KV9A 4S2GA 3M3QA 1QJY1 1D0GA 2AEYA 3HWJA 3IN9A 3NSTA 5FPUA 2WNVC 2E63A 1EP0A 2CV6A 4PDWB 2QQJA 5CG9A 1H0BA 3NL1A 2VTXJ 4H55A 5FTTC 2C5DA 2CAVA 1N1SA 3ZKYA 1EUTA 1TEIA 3I97A 5C71A 5L19A 1NG0A 2RJKA 2G19A 1PIV3 4FP2A 3W5NA 4UFJA 3AXEA 3CMGA 4H14A 1C8NA 4YZ3A 5H9RA 2HH9A 2BNOA 1ND3C 1SBEA 1W39A 2QZ3A 2ZX1A 3L9JT 5IFTA 1RHI1 2DCYA 2GNMA 4M3CF 3VGIA 2RG4A 3BU0A 3ACLA 5HXVA 1WLCA 1W2NA 1PNGA 3B94A 1DQ2A 2ARCA 3MV01 3S57A 4CDQA 1YCIA 1V6OA 3V0AB 3M3CA 2UWCA 1H8VA 3HN3A 1ULOA 2QNKA 4HFSA 3VKOA 4BDVB 3CKHA 2C1FA 5A1LA 1UY0A 2RHPA 3SNMA 1EAH2 1G7YA 5AVAA 5HBAA 1Z7S1 4FOVA 1X8EA 1UKRA 5DQ0A 1QH7A 3ZYFA 2W87A 4MO3M 5A3OA 2HJIA 2NP0A 2Y60A 5FZ6A 1XYNA 1DIWA 1RC6A 3CJIA 3LPGA 4P9GA 3USUA 4AEDC 4BCUA 4YZ2A 5GZGA 2VXJA 2W1QA 4BZ4A 4NRMA 5FPBA 5LZ6A 2D44A 1ZBE2 2A1XA 4RSUA 2A70A 2QQOA 1FMD3 2DU0A 2W0XA 4Q1PA 1VBD1 5CIRA 2XXZA 3ASIA 3P3NA 4GA9A 4P5HA 3ZIXA 3SEEA 2X5IA 1RTVA 5DDJ3 1VBC1 2D6MA 3PUIA 2OUHA 4S2DA 2DYCA 3CQOA 1N1VA 3VKMA 2Y6KA 4I3GA 1LGNA 2HWD3 3PVNA 2FDHA 4ZXKA 4HKWA 4AQSA 4AG4A 4MADA 1CX1A 4PIXA 4BB3A 3RZHA 4E4HA 2PHFA 1OF3A 1H6YA 3AM2A 3FLPA 5ACA2 5KXDA 4LBKA 1QJU1 2C4XA 4JGZA 5JVVA 5EQUA 1HRV3 2E32A 2VM9A 3W9AA 3WZ1A 1DG6A 4AEMA 1W6MB 5FYIA 4M0NA 2D6NA 1HLCA 2PHTA 2OKXA 3VD5A 2WFF2 3WHTA 4AWDA 3I49A 2HWE2 2KR2A 1XYPA 2YFZA 4FO9A 3PU8A 1COV3 2ZS6B 4JDOA 3J7NA 1QJX2 5FKCA 1WZXA 2F4LA 4R52A 4Q4Y3 2J7MA 1AZDA 2VY0A 5F32A 4Z1VA 1V0AA 3V65A 2H0VA 3OGRA 1SACA 4A7KA 3ZFEB 2JE7A 4DEVA 1RVF3 4MGQA 3OJBA 4Q4W1 4Q4V2 2ARXA 3DXUA 4W4ZA 2EA7A 2G9GA 3P3PA 4JC1A 5CU1A 2BJSA 1W05A 2UWBA 2ZHMA 3WNPA 1HN1A 3ZMNA 2W47A 2XDVA 5FYBA 4N53B 3VD9A 4BQ5A 1NXD1
chains in the Genus database with same CATH topology
3J7LA 4NIAA 1JS9A 1STMA 1YC61 4OQ9A 3J7MA 1A34A 4OQ8A 1CWPA 1ZA7A 3J7NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J7L A;  4NIA A;  1JS9 A;  1STM A;  1YC6 1;  4OQ9 A;  3J7M A;  1A34 A;  4OQ8 A;  1CWP A;  1ZA7 A;  3J7N A; 
#chains in the Genus database with same CATH topology
 2WQZ C;  1VB4 A;  3NV4 A;  4AGV A;  4OQ9 A;  2XJT A;  5GZC A;  5ABJ B;  1GNZ A;  3HT2 A;  3OOX A;  1W9S A;  4AYU A;  3HT1 A;  5A3M A;  2DTW A;  3WP3 A;  4H7M A;  4ITC A;  3I3M A;  3PMS A;  3UNP A;  5T54 A;  4A6O A;  2BWA A;  4Y5T A;  2E33 A;  4LHL A;  4QT6 A;  2AGS A;  4GJZ A;  2VQ0 A;  1LOA A;  1RUI 3;  2WS9 2;  2BBV A;  1WCK A;  2XLF A;  1OPM A;  3O5S A;  1DZR A;  1QOS A;  2ERF A;  5C70 A;  1MAC A;  3WW3 A;  4QHO A;  3JD7 1;  5E8A A;  4B7K A;  4E9K A;  4YW6 A;  1C8M 2;  4B1L A;  2VAU A;  1YLL A;  2DBI A;  3IDA A;  2WQ4 A;  4CDW B;  4QPY A;  1RUG 1;  4LKD A;  5IK4 A;  2YPJ A;  2R07 1;  2MEV 2;  3ZFE C;  1NA1 B;  1OUX A;  1W0P A;  4O9G A;  5H9Q A;  1W0O A;  2VOX A;  2CDP A;  1EPW A;  1EPZ A;  2VNR A;  3QAC A;  4JV4 A;  4XF4 A;  2BYV E;  1UYX A;  3ZLI A;  3EB7 A;  3B01 A;  1PVC 1;  4FCA A;  4FPF A;  3H50 A;  4QXB A;  4ZZ8 A;  2ZEX A;  2B9V A;  2WNU B;  4H2A A;  5A7N A;  3E6C C;  1J59 A;  1G9B A;  1NQJ A;  5FDB A;  4LUL A;  3LPF A;  3A0K A;  3FHI B;  1PGW 1;  3U0Z A;  4AI9 A;  1DQ1 A;  5ABJ C;  4QPW A;  1GOG A;  4NVP A;  4XJ9 A;  1H30 A;  4AEJ A;  2RJ2 A;  2VZU A;  3BB6 A;  3H3Z A;  3POG A;  1KRI A;  5GM0 A;  1FI2 A;  3SEP A;  1OH4 A;  1DGW X;  1I5P A;  1MZ6 A;  4GKY A;  5F5Q A;  3BTZ A;  2VZ1 A;  3NQH A;  1DLL A;  2JWP A;  4JX0 A;  4AQ2 A;  5LWB A;  2ZKN A;  3MV1 1;  1U5I A;  1GU3 A;  1X8M A;  1MS4 A;  2ET7 A;  3V56 A;  2Z42 A;  4QQH A;  1JZ3 A;  4FFH A;  5IT6 A;  1J1L A;  5K0U A;  1GZC A;  3C8X A;  3H8U A;  2IC1 A;  4ES8 A;  3VBR B;  1LHU A;  3I4I A;  4OI2 A;  3CZJ A;  1MS8 A;  4LO7 A;  3O12 A;  5D8A A;  4CDW C;  3WQ1 A;  4XFH A;  1JZ4 A;  1FPN 2;  1JHJ A;  5A7Q A;  4TSV A;  4IV3 B;  1YQ5 A;  3AP5 A;  3S5A A;  3ZFG A;  1NA1 C;  2VUC A;  2WNO A;  4CU8 A;  4XF9 A;  2LM3 A;  1FOD 3;  1H4H A;  2K2S A;  2P3I A;  4W6Y A;  3EO6 A;  5LAT A;  5BNO B;  2Z69 A;  1PGL 2;  2W46 A;  3VL9 A;  1AJO A;  3FUQ A;  3SHR A;  1W6N B;  4PBO A;  5EJZ B;  1ZRC A;  2IVJ A;  4G4F A;  4HG6 B;  4IEX A;  1CWP A;  4PLM A;  3MW3 A;  3I59 B;  4YW1 A;  2RS1 3;  2EIC A;  2WNU C;  4MH0 E;  4ORF A;  4GMP 0;  3H8O A;  1RUE 3;  3L2Y A;  3GZE A;  5E89 A;  4JZR A;  4M3C B;  1XYO A;  3WP6 A;  3NWK A;  5DXD A;  1OOP A;  1TZO A;  2X10 A;  1MZF A;  4UW5 A;  1G9F A;  3ZSE A;  4XDQ A;  1GOF A;  5CKN A;  1RMU 1;  3ZXG A;  3WUC A;  1WD3 A;  4WVM A;  3ZXL A;  4E4S A;  1UCX A;  3DKQ A;  5C6C A;  1DQ0 A;  4MVT A;  1QF3 A;  1H1M A;  2XJQ A;  3UL2 A;  1HIX A;  1XBF A;  1EV1 1;  2XG3 A;  5FZ4 A;  5BNP B;  5HI0 A;  2W1S A;  4A3Z A;  3ZPY A;  1SFN A;  5KC6 A;  2LRP A;  2WSV A;  1LGB A;  2XON A;  1UX6 A;  2GNB A;  5A6Z A;  3B02 A;  1UOG A;  2ZEZ A;  3VBR C;  4AFD A;  5FLI A;  1CJD A;  3T1L A;  1RHI 3;  5FUN A;  4Y5S A;  3VDC A;  1XU2 A;  4JTN A;  4LIT A;  4IV3 C;  5FZ1 A;  4QKN A;  1LOB A;  5LK7 B;  2DTY A;  3POY A;  3UGH A;  4RHV 2;  3CHX A;  5EHD A;  4JHT A;  5FXZ A;  4LXL A;  1BKZ A;  1HRI 2;  3ETQ A;  4MGT A;  2VZP A;  3WF3 A;  1OT5 A;  2Y38 A;  1XE8 A;  3EXU A;  4P5Y A;  2GU9 A;  2VH9 A;  4AZZ A;  3WF1 A;  3AMQ A;  4N7I A;  1EY2 A;  1Z7S 3;  2NMO A;  1QU0 A;  2A3W A;  3FJS A;  3WIN E;  3LE0 A;  2BGP A;  3P5B A;  4PBP A;  2AYH A;  4AEK A;  2XJP A;  5GLZ A;  4HSL A;  3ZMO A;  1G9C A;  2PAE A;  4Q4X 1;  1IPJ A;  1K5M C;  3C3V A;  3WG3 A;  5DUU A;  5CB7 A;  3LIH A;  4E8D A;  4I0W B;  1Y4W A;  4GZ9 A;  4PIY A;  4KNC A;  1OI6 A;  1VBD 3;  3R4S A;  2FDJ A;  1DHK B;  2VMH A;  4XJZ A;  2PYT A;  5CZK A;  4BLJ A;  1HB1 A;  3GNE A;  5F39 A;  2JG8 A;  5GLU A;  5APA A;  5BNP C;  1VBC 3;  1W8Z A;  2CGO A;  5T52 A;  1LOE A;  1QXR A;  4LKS A;  4UYB A;  2JE9 A;  2VVD A;  4P9Y A;  4IUG A;  3A21 A;  5F3C A;  2VQT A;  3OBR A;  3DXT A;  4KU8 A;  5A80 A;  1QJU 3;  5IVE A;  3ROU A;  1RIN A;  3I2J A;  1S55 A;  1UYY A;  3O1U A;  4AAP A;  4IQP A;  1NZC A;  3ME2 A;  4PI2 A;  3RJ2 X;  3EMR A;  3W5M A;  3F95 A;  3JZV A;  2DFB A;  3IDB B;  3B7M A;  5EYX A;  2ADE A;  2ZTN A;  4W65 A;  2VTX A;  2J42 A;  5FQ0 A;  5I0R A;  3PUQ A;  1CGP A;  4QX2 A;  4E27 A;  1OQ1 A;  5DG2 A;  1UOB A;  4FQZ A;  4AFM A;  1AR9 2;  3QOP A;  4E2S A;  4DXS A;  2RDQ A;  2ADD A;  5FZO B;  4AVB A;  1SCS A;  5JZG C;  1OUS A;  1U5X A;  2JX9 A;  2XHN A;  3AYC A;  5T50 A;  2B8M A;  1ZBA 1;  2OQ6 A;  2UY9 A;  3VZN A;  1DQ6 A;  4BQ4 A;  2V72 A;  3GHM A;  3LOI A;  2Y8K A;  4N43 B;  4Q4W 3;  5FZA A;  3UK9 A;  2VMG A;  1J1T A;  2R16 A;  3VBS A;  1WLT A;  4IE5 A;  5F3G A;  4NHM A;  1UY1 A;  4EWD A;  1UYZ A;  4YVS B;  5FPZ A;  3ZN5 A;  4COV A;  2D6L X;  3SCG A;  3VKL A;  1TNR A;  1RUC 2;  2B4K A;  4XTP A;  3U11 A;  3B9C A;  3PUA A;  4V2W A;  3S6P A;  4AGG A;  2PHR A;  4HVR A;  2D43 A;  2VW2 A;  5JMO A;  4AOC A;  3AK0 A;  1QOO A;  3ILF A;  2WA3 A;  4ZU4 A;  5JUV A;  4CVU A;  4I01 A;  1A34 A;  2GN3 A;  3GCX A;  4F83 A;  1ZYB A;  5FP3 A;  4AQ6 A;  5K8S A;  1LJ7 A;  5EIY B;  4YVW C;  1PO1 1;  1JW6 A;  4RQP A;  5JAX A;  1PMJ X;  1QDC A;  4FPO B;  3WDY A;  3W20 A;  1DYP A;  3BCW A;  4UFM A;  3WV6 A;  3JD7 3;  4LQR A;  2RMU 1;  1TNF A;  3K3O A;  3NJV A;  4Z82 A;  1K42 A;  2GP5 A;  3THD A;  2TUN A;  3UES A;  2Q1Z B;  3NNG A;  4QU1 A;  1QMJ A;  2CTV A;  2W91 A;  4QKF A;  4RS5 B;  3CU7 A;  2F17 A;  3WD5 A;  5JOY A;  2Q0A A;  1RUG 3;  2Y33 A;  3C7G A;  1MQT A;  1RB8 G;  3HNM A;  2R07 3;  4NE9 A;  1GKB A;  3KHC A;  2XVG A;  3O0W A;  4N43 C;  4AHZ A;  1W2U A;  4XFG A;  3WQB A;  1S2B A;  5G05 L;  1PVC 3;  3T08 A;  1AVB A;  4LTA A;  4YVS C;  3SMH A;  4OI0 A;  4CUA A;  3KMH A;  1UZW A;  4XE9 A;  2VGD A;  1PO2 2;  3I2H A;  1YQC A;  4L99 A;  1PX4 A;  5JDB A;  2A3Y A;  2QE3 A;  4IGO A;  2PHU A;  5BYN A;  1CAW A;  4K7J A;  4LA2 A;  5JXG A;  3UJQ A;  1HJG A;  1ZZ9 A;  3UKV A;  1BCX A;  3WOG A;  4R9B A;  4QGN A;  2D5H A;  2FZ1 A;  3AP7 A;  4RA0 A;  2PXJ A;  1LU1 A;  5CFD A;  2KXL A;  4UWD A;  2ZGO A;  3SKV A;  4CDX A;  1LNS A;  3NW4 A;  1O59 A;  3RZZ A;  4FPK A;  1GZW A;  2OUJ A;  3G7D A;  1F9K A;  1GWK A;  4RL7 A;  4BQY A;  1HQL A;  1Y9Q A;  1NY7 2;  5B4X A;  3JQW A;  1NXM A;  5DZE A;  5FZ3 A;  3F2Z A;  4QQO A;  3M2M A;  4LBM A;  3ZXK A;  3WXP A;  2CL2 A;  4RS5 C;  3FN9 A;  1V9U 2;  5KXE A;  1HB3 A;  5CEH A;  4XUT A;  2OS2 A;  2OZJ A;  4GMP 1;  5FZ7 A;  1B35 B;  3KCC A;  2WA4 A;  2C26 A;  1O7F A;  1OA3 A;  2KD7 A;  2DU1 A;  1DYK A;  4HPK A;  5M0T A;  3OF1 A;  2NLR A;  1R1Z A;  4K9S A;  4GB3 1;  2P37 A;  3RZM A;  5IVC A;  3MO4 A;  4W8J A;  1AL2 1;  3HQU A;  2EXK A;  2ARE A;  5DAW A;  2DCJ A;  5GKA C;  1WME A;  3RS6 A;  1REF A;  1W2A X;  4IV1 A;  4IW3 A;  2YFU A;  1VBB 3;  3PL0 A;  1POQ A;  1CJP A;  3INA A;  4ATF A;  4BQX A;  3LA7 A;  4QX1 A;  3EHK A;  1ODM A;  3CF6 E;  4YM1 A;  1VBA 2;  1AYM 1;  1BK1 A;  4ASK A;  1D2Q A;  5HCB A;  3ZDV A;  3VD4 A;  3HJR A;  1M4W A;  1MS5 A;  3ACI A;  5ANQ A;  3VBU A;  3E97 A;  2D6K A;  3M7A A;  1RMU 3;  3ETP A;  5BNN C;  1YI7 A;  5JPN B;  1V6K A;  1MS0 A;  2A6Z A;  2DVD A;  3MLJ A;  2ZZJ A;  4OCT A;  3ZM8 A;  3MHZ A;  4AVS A;  3AKS A;  2E53 A;  1EV1 3;  5C3O A;  2HBU A;  1OBN A;  1IPS A;  5DN2 A;  1OA2 A;  2ETE A;  4HMZ A;  1CAU B;  4ET7 A;  3VDD B;  2Q1M A;  1GQP A;  2PQQ A;  5GAL A;  3ZN4 A;  1R08 2;  1SPP B;  5I91 A;  2RS5 1;  4XF3 A;  1C57 A;  1WCS A;  3WW2 A;  1B35 C;  2W1U A;  5IAV A;  1F5F A;  4FBF A;  2VVE A;  3T09 A;  1QQP 1;  4WZC A;  2XR4 A;  3HNB M;  4XFA A;  5C8C A;  1GBG A;  4LT5 A;  5FYS A;  4CTE A;  3PVB B;  4XDP A;  1XND A;  1U12 A;  5KHH A;  3C7E A;  3FFQ A;  5C3Q A;  4NIH A;  4XBN A;  2XJR A;  4NMI A;  5FMC A;  3D8C A;  1XXN A;  3ZR6 A;  4CP1 A;  1DLC A;  5LY1 A;  2BOI A;  4QX0 A;  5CBL A;  3QH7 A;  1UZ0 A;  1H1I A;  1LCL A;  3SLI A;  3RGB A;  3IB3 A;  1RUF 1;  1RUC 1;  2KM2 A;  2HWF 1;  1UU5 A;  4LBQ D;  4Q4X 3;  3ZYI B;  3SCH A;  4CEW B;  2YBP A;  2XBO 2;  1Q8V A;  2VJX A;  4DRR A;  3OBZ A;  5FLJ A;  5FY7 A;  3D4K A;  3KF5 A;  4QQL A;  1ND2 A;  5FYM A;  5GJ6 A;  1AXY A;  4E4Z A;  1RUJ 2;  2UYB A;  2YV8 A;  4KL1 A;  5C4W B;  5C5U A;  3OUJ A;  1O3S A;  4Q0S A;  5FPV A;  4FTB A;  1J58 A;  5B4N A;  3LSD A;  2F6B A;  4LO5 B;  2JDH A;  2ZEW A;  5C33 A;  2OXB A;  1AYN 2;  1BEV 1;  4AHY A;  3WSO A;  4OMD A;  1FAT A;  2P34 A;  4PLN A;  2FZ2 A;  2WDB A;  1PM7 A;  2QDR A;  4ZON A;  1GNH A;  4LEJ A;  1R09 1;  3AL6 A;  3MFA A;  5IJR A;  3VBH A;  2XJU A;  2G4I A;  2ARB A;  2A5Z A;  4QPI B;  1W8T A;  1AXZ A;  4FOQ A;  3MLK A;  1PK6 B;  4XIK A;  4BK5 A;  5FBJ A;  3VBO A;  3M3E A;  4XF1 A;  4N9H A;  4EJR A;  1N3Q A;  2IXC A;  2ZXQ A;  4NPR A;  1D7P M;  1KDM A;  3I3B A;  3WCR A;  2X09 A;  1WCD J;  2VQU A;  2BRT A;  3ALQ A;  3KHB A;  2GMP A;  4YRD A;  3MEP A;  4Y20 A;  3D3A A;  1JS9 A;  2FCT A;  2E51 A;  2QUO A;  4FVV A;  4NIG A;  3UJO A;  4WM7 A;  1W8F A;  4QDR A;  5A1A A;  2YMZ A;  4XJU A;  3U14 A;  2JIJ A;  1VE0 A;  3BIW E;  4ZY9 A;  4OI1 A;  2DUP A;  3MW4 A;  4I09 A;  2BVV A;  1LAJ A;  2VVF A;  1KD7 A;  1LRH A;  2I07 B;  1RUD 1;  2SLI A;  3Q8E A;  3DYM A;  4J6G A;  2B9U A;  4Q5O A;  3SIT A;  1VAV A;  4NII A;  2YC2 A;  1ZBA 3;  1W28 A;  4YLZ A;  5F5C A;  5C4W C;  5J37 A;  2DWR A;  3LIG A;  4EV0 A;  3O1T A;  4RGG A;  4CDQ B;  3U10 A;  3OD4 A;  2C24 A;  4B3N A;  5A3N A;  4AL9 A;  4BXS V;  2IFW A;  2RV9 A;  3DCQ A;  4BPZ A;  4XUR A;  1CZT A;  4GKX A;  4PJY A;  1VRH 2;  2IXI A;  3SH3 A;  4V1P A;  3MFC A;  1NY7 1;  4O7X A;  5ERL A;  1POV 0;  4CE8 A;  4AVC A;  5KHG A;  1X50 A;  2OPK A;  5JXI A;  1DU3 D;  4DOU A;  4CEY A;  1ASJ 2;  1V9U 1;  4JGY A;  1PK6 C;  1F8V A;  4LK7 A;  2GAL A;  2VCA A;  5LBF A;  3WW4 A;  4AFB A;  2D7F A;  3FLT A;  3BVC A;  3CJI B;  4DY3 A;  4Z2A A;  3USU B;  5A3U A;  5IHR A;  5A7W A;  3KGZ A;  3LCP A;  5JOZ A;  1PO1 3;  2J22 A;  3IZO A;  5I8S A;  1ULG A;  2ZGN A;  2ZX4 A;  3R4D B;  4R8H A;  5K4L A;  3VHO A;  4D94 A;  1HV1 A;  1LEC A;  3WY6 A;  2RMU 3;  5KHI A;  1ZZC A;  4XJA A;  4CUB A;  4X6R B;  5BUV A;  2X5I B;  3UT0 A;  3N4M A;  3TB0 A;  3E5X A;  1WW7 A;  1GQG A;  2CU5 A;  2FCU A;  4C8D A;  3ZYB A;  2D3P A;  3KWV A;  1LHO A;  4CUC A;  4F8A A;  4DUX A;  2VCM A;  4R9A A;  2Q1F A;  5L9V A;  2AR6 A;  5FP8 A;  1MZ5 A;  2BVB A;  3N9M A;  1W8H A;  5EXO A;  4CXW A;  2DBN A;  1UNB A;  3N9O A;  4CCM A;  2R30 A;  1J84 A;  3I3Q A;  4CDQ C;  3PIJ A;  3SQO A;  4JGZ B;  4CCO A;  4NIA A;  4NRQ A;  1ZZB A;  4QXK A;  3S30 A;  2BDR A;  2JB4 A;  5DAB A;  1DFQ A;  1CR7 A;  2PLV 2;  3K4Z A;  4ARX A;  2ZAB A;  4EN6 B;  4WBB A;  2LW8 A;  3P1I A;  2YXS A;  3NNL A;  5HPO A;  2VOW A;  4DEQ A;  5A70 A;  1Q3E A;  2AEN A;  2ZX0 A;  4JKK A;  4KGG A;  5JMC A;  1OH3 A;  1TME 3;  4NHK A;  4YW4 A;  1CPN A;  4OVE A;  1RUH 1;  4IEW A;  1RIR A;  2W9X A;  3IWZ A;  2IZW A;  3GZU C;  3CZU A;  2P3K A;  2WNV A;  3OUH A;  3GXU A;  1G8W A;  1B09 A;  4LIV A;  5FP4 A;  2FHR A;  1AX0 A;  2QCS B;  3MF6 A;  3EYP A;  1TMF 2;  2CWM A;  2X5I C;  3T3Y A;  1UN1 A;  1QOT A;  1W6O A;  3O1V A;  3FWE A;  2J1T A;  3PLQ A;  4FPE A;  5LA1 A;  4GMP 3;  4EQV A;  4PDW C;  3LDB A;  1IS6 A;  1H2M A;  4JTO A;  2R04 1;  2YB7 A;  2XBO 1;  2ZGQ A;  4XW3 A;  4Y1Y A;  2VW1 A;  4ASM B;  1V00 A;  4D0Q A;  2W08 A;  1HJF A;  1LHN A;  4GB3 3;  1SLC A;  4CDU A;  1BJQ A;  3FLR A;  2WLP A;  2RS3 2;  2UWA A;  1AL2 3;  4BA6 A;  5GZD A;  3VKF C;  1JYN A;  2Z5W A;  4JGZ C;  2E6V A;  5LBE A;  3WDW A;  1WD4 A;  4QHZ A;  5FPA A;  4YZ5 A;  1QKQ A;  4P14 A;  5A6Y A;  3LA2 A;  5H9S A;  4QGL A;  4HXC A;  4BH9 A;  3AYD A;  1DGW A;  2GC0 A;  4FQ4 A;  4XVH A;  1V6J A;  1AYM 3;  3WP5 A;  1LOF A;  3AFK A;  4CP2 A;  3BKZ A;  2K0G A;  5LRR A;  3ES1 A;  4MV2 A;  1MEC 1;  1W9Y A;  3C7F A;  2GC1 A;  2RDR A;  4WV8 A;  2JDP A;  3ACH A;  4AED A;  5A1F A;  4C1W A;  4TLF A;  3TN9 2;  1HXS 1;  3ZIW A;  1UX7 A;  5A3L A;  3AYA A;  4UFH A;  1LED A;  2WRA A;  5FOB B;  4RR3 A;  4YM0 A;  3LDR A;  3WR0 A;  3TWI A;  4P00 B;  3B5L B;  1UY3 A;  5GLW A;  4OHZ A;  4CXY A;  1U0A A;  4C0B A;  3JBG 2;  4COU A;  1JXN A;  2PEL A;  3MUZ 1;  2Y26 A;  3WVJ A;  2RS5 3;  1IZ3 A;  1PMH X;  4QD2 A;  2HWC 2;  2RM2 2;  1W6P A;  3ZYJ B;  3SCF A;  4FPL A;  3VDD A;  4CCK A;  3I3D A;  2WL1 A;  1QQP 3;  4LHK A;  4XAE A;  1AR8 1;  1H2L A;  1IHM A;  1PZ9 A;  4AFC A;  3PU3 A;  1OSG A;  2D6O X;  3OYW A;  4GQ7 A;  1I1E A;  3K2O A;  4Q29 A;  4I30 A;  5AFE A;  4P02 B;  1GNY A;  1J3Q A;  1O5U A;  1AR6 1;  4LOS A;  3R05 A;  2WNE A;  3IPV A;  4AR2 A;  5LA9 A;  3DF0 A;  3QLQ A;  3LF7 A;  4A7Z A;  2V73 A;  4IE0 A;  4ZS3 A;  1F4A A;  1VRH 1;  1DGR A;  3ELN A;  5LCW L;  1RUF 3;  1URX A;  2LTN A;  2NM1 A;  1W8O A;  2HWF 3;  3WF2 A;  3KT7 A;  5EJ1 B;  5I0S A;  5CFC A;  5K0U B;  1TG7 A;  1LEN A;  4E2G A;  2RJL A;  4URT A;  3N9P A;  2ZGP A;  1ASJ 1;  5D8A B;  3T2T A;  4MGY E;  1OKO A;  4MXV A;  4XPV A;  2OX0 A;  1OFN A;  2YC4 A;  2GDF A;  3ZFG B;  3H3L A;  2ZGT A;  3VDB A;  3NRU A;  2VG9 A;  3ECQ A;  4PQ9 A;  3NV2 A;  4K1Y A;  1VIW B;  3RNS A;  3ZYP A;  1JZ2 A;  1BEV 3;  4TXW A;  3TNQ A;  5C8W A;  2DUO A;  1D4M 1;  4NOT A;  4E4D X;  2VBP A;  1Q43 A;  1F31 A;  1R09 3;  2OA2 A;  5KHK A;  1G9D A;  4IEQ A;  3CDZ B;  3S7E A;  1KS4 A;  2HYK A;  1LHV A;  3ZR5 A;  3AZV A;  1YRZ A;  3H3U A;  1XRU A;  1V70 A;  1AL0 G;  2FMD A;  3GYD A;  4W50 A;  4BHP A;  4A4A A;  1BXH A;  4TYS A;  4B8E A;  2NQY A;  4KGQ A;  2R0F A;  5IWF A;  1OF4 A;  2XJS A;  2R0H A;  4UI9 L;  1OOP B;  1I3H A;  2EXI A;  1APN A;  3I2D A;  1ULC A;  2B39 A;  2R06 2;  1NCQ B;  4UBH A;  4XMA A;  4N53 C;  2VZT A;  3PJY A;  4NRP A;  3ZVX A;  2WZR 2;  3JUU A;  2F4P A;  3POJ A;  3OGG A;  4WVM B;  4LBQ A;  2B5H A;  3ST7 A;  1VMF A;  3WEZ A;  5A3P A;  2XQX A;  3T0A A;  3ZXF A;  4K8R B;  1V6I A;  2KA3 A;  4PIZ A;  3LFI A;  4BM8 A;  1WCQ A;  4Q0U A;  4PHZ A;  1MR5 A;  5HV0 A;  1C1L A;  2ENR A;  3LEM A;  1VBE 3;  1CVN A;  3IM0 A;  5J1X A;  1RUD 3;  1OHF A;  1AUY A;  4I0A A;  3ILN A;  3M4F A;  3ZYR A;  1YUD A;  4CZS A;  5K0U C;  4URA A;  1POV 1;  1LES A;  4DRV A;  1CAV A;  1LOG A;  2Q5T A;  1FNY A;  1NUK A;  2ZHN A;  2VNG A;  3KT1 A;  5JPM B;  2WZP P;  2NZ9 A;  3T1M A;  1OLR A;  3J8F 3;  1BYH A;  1EAH 1;  2NMN A;  3UYJ A;  3ZFG C;  5FMO S;  4QXH A;  3ZSK A;  2YZ4 A;  4AVA A;  5JWP A;  3O1M A;  2BW8 A;  3OEA A;  4Q0P A;  1FV2 A;  5FOJ B;  3BTX A;  2RR1 2;  2J1U A;  2DCK A;  5IAX A;  1SQ4 A;  4YZ1 A;  1N3P A;  1V9U 3;  2GND A;  2IXJ A;  3WG1 A;  1H8T A;  2A6Y A;  3OY8 A;  1ZBE 1;  3POW A;  3JB4 C;  4OHW A;  4SBV A;  4XIO A;  3U1X A;  1LTE A;  4QM8 A;  4XUO A;  1BBT 2;  4FOY A;  2D3R A;  4Y4Y A;  2A7A A;  2VD7 A;  4Y3O A;  2HBT A;  3VZK A;  1LHW A;  4AFA A;  4D6Q A;  1S0C A;  2PHX A;  2OZ6 A;  4Y22 A;  2RS3 1;  1KEX A;  2ID4 A;  4FPG A;  2VL4 A;  4UW3 A;  4OZX A;  1S0G A;  4XAC A;  4AE2 A;  3GJA A;  1CIY A;  2JG8 B;  4FPJ A;  1R1A 2;  5FZG A;  3RVH A;  3RI8 A;  1JI6 A;  2GH2 A;  4HOO A;  4PLO A;  1QJY 3;  4OHX A;  2CGP A;  1NCQ A;  4BIS A;  4UT5 A;  1G6N A;  1JTZ X;  3NAP A;  4ISR A;  3A23 A;  4XHB A;  1A8D A;  2DVA A;  4LKE A;  1UQX A;  2HWB 2;  2Q8E A;  1GSL A;  1YJL A;  4H3W A;  4IEV A;  2JB8 A;  1WW5 A;  3SH4 A;  1SLA A;  2VZR A;  3RSJ A;  1WMD A;  4WVW A;  4CP9 A;  1W04 A;  4QX8 A;  1VPH A;  5DAV A;  2IXH A;  4FXG B;  1KXG A;  4MOA A;  4QM9 A;  5E16 A;  4Y26 A;  1NX9 A;  1ONA A;  2WFF 1;  4DMI A;  3WDX A;  4EN9 B;  5JLV A;  2HWE 1;  3K75 B;  5J3U A;  1BVP 1;  2VCB A;  2Y64 A;  3GBF A;  5EV7 A;  1QJX 1;  3RWN A;  3K77 A;  1CD3 G;  2IFR A;  2YGL A;  2OQ7 A;  1LU2 A;  4IE7 A;  5FQ0 B;  1FNZ A;  1RL3 A;  2ORZ A;  3N3H A;  4IEU A;  5EP9 A;  1PIV 2;  3NV1 A;  4XC9 A;  4XFF A;  4AI0 A;  2A6W A;  2YY1 A;  4ZKT B;  1ST8 A;  5BNO C;  1J83 A;  3T2P A;  3OTF A;  5FLH A;  5FZ8 A;  1EUU A;  5LBC A;  4Q4V 1;  3KV6 A;  5FO8 B;  4HET A;  4PI0 A;  1RUH 3;  4L92 A;  2ATF A;  4QKB A;  2I74 A;  4LNV A;  3T4V A;  3MIG A;  4EN8 B;  3B3Q E;  4P08 A;  4FFG A;  2QFE A;  2BQP A;  3J26 N;  4HAN A;  4DIQ A;  3KVB A;  4S2F A;  4D6R A;  1CAX B;  2OII A;  2YRO A;  3I7D A;  3Q8F A;  1CIW A;  4FPC A;  3VBS B;  2JG9 A;  3D82 A;  4WVZ A;  3POF A;  5A3W A;  3RZJ A;  1O4T A;  1JZ8 A;  4Z92 B;  3NJZ A;  1LB2 A;  3AKP A;  5CAD A;  2Y6F A;  3FX3 A;  3O1O A;  1W8N A;  1N47 A;  1UW8 A;  2CHH A;  3ZN6 A;  2A73 B;  2R04 3;  4K8F A;  1O6U A;  2XBO 3;  4WVV A;  2A3X A;  2QTW B;  2VU9 A;  2XUE A;  5FZE A;  2JDU A;  1O3R A;  4MZU A;  2YG0 A;  3WG4 A;  5CG8 A;  1UL9 A;  5T3N A;  2WS9 1;  3HVD A;  4QPG A;  5FK7 A;  3O0X A;  2VUA A;  1US2 A;  3KM5 A;  5F3I A;  2ZMK A;  4HK8 A;  3AB0 A;  3RWK X;  3HBK A;  3NMB A;  4PQQ A;  5LEJ A;  2XOM A;  2G9Z A;  1FMD 2;  3HN1 A;  4RQP B;  1JUH A;  4XQD A;  1C8M 1;  4CSW A;  1N3O A;  1IKQ A;  2ET1 A;  4QDQ A;  3HD8 B;  4YSF A;  1XB9 A;  4HKL A;  2QQM A;  2YBS A;  5DDJ 2;  1ENR A;  1CQ9 A;  3G6J B;  2HKX A;  4QX3 A;  4D7Y A;  1UZZ A;  2AAC A;  1SLL A;  4KWK A;  1W9F A;  5L7O A;  1MEC 3;  2MEV 1;  3APB A;  4A45 A;  2VZS A;  2HWD 2;  2P17 A;  2E26 A;  1HXS 3;  4NPL A;  1K5M A;  1MQT B;  1MPX A;  3VKN A;  5FYZ A;  2I2S A;  5EJ3 A;  4A44 A;  4QHB A;  1VRB A;  1WA6 X;  5F1R A;  4XET A;  2VZV A;  4IER A;  1HRV 2;  1F35 A;  2G1M A;  3DPR A;  1MS3 A;  1VAK A;  1JOJ A;  2ZEY A;  5J98 B;  3WNK A;  1XNB A;  3M70 A;  3ZFF A;  4ES9 A;  1L7L A;  1UY4 A;  2EIG A;  3BUC A;  2Y0O A;  1RYY A;  2FBE A;  3JB8 A;  5A7P A;  2LAL A;  4DQA A;  2OW4 A;  4QB6 A;  1CAX A;  4AAX A;  5FKB A;  5AC9 2;  1GYK A;  3HAG A;  5FCC A;  1COV 2;  1AR8 3;  3C7H A;  1CAW B;  4B4R A;  2XVK A;  5GLT A;  4Q4Y 2;  2YBK A;  4HLT A;  3E5U A;  1HQN A;  3KCX A;  1HQW A;  1AR6 3;  3K46 A;  3HPN A;  4DO0 A;  1SBF A;  1RVF 2;  3V64 A;  5CFD B;  4MX3 A;  3RI9 A;  3OSD A;  5IVY A;  1W03 A;  1WBF A;  4RQP C;  2XVL A;  4ZXE A;  4CDX B;  5FYC A;  1VRH 3;  1GZW B;  1KIT A;  2WT1 A;  3E6D A;  1VR3 A;  2H6C A;  3ACG A;  2ZGL A;  4QGM A;  1FPN 1;  5J7M A;  5D1I A;  4HON A;  5LA0 A;  3VLB B;  3KS7 A;  3VZJ A;  1BLZ A;  3B69 A;  3MGU A;  2P3Y A;  5T5P A;  3LA3 A;  4CCE A;  1UPS A;  2BFU S;  1QEX A;  4LBJ A;  4BJ0 A;  5JZG A;  1PGL 1;  1BBT 1;  2ZMN A;  1QH6 A;  3RZL A;  4HPK B;  3IAP A;  1XSR A;  1T6G C;  5FYT A;  4K20 A;  5D2A A;  5FYV A;  2WO1 A;  2J1R A;  1Y3T A;  4ATE A;  1D4M 3;  3RJR A;  1RUI 2;  1FAY A;  1SHW B;  3OUI A;  4D7S A;  3PTY A;  5C9A A;  4IV1 B;  3LEG A;  1XNC A;  2ZAC A;  3DYO A;  4EWA A;  3H42 B;  4D8M A;  1XNA A;  2CGN A;  2RE9 A;  3B00 A;  4GXL A;  2BV4 A;  4SLI A;  1UOJ A;  2VCC A;  5GZE A;  2Z79 A;  4CCD A;  3VZM A;  5T55 A;  4CP0 A;  1U5Z A;  3WT3 A;  3RMY A;  3AVR A;  2CY6 A;  3WNN A;  3ZYH A;  4CCC A;  3NKT A;  1I5Z A;  3VBU B;  5A3T A;  4P9I A;  5L9B A;  4OI4 A;  4Y33 A;  4IDZ A;  2PMW B;  2XML A;  5F37 A;  5CFD C;  4HBN A;  1JYX A;  3OEB A;  4X6Q B;  1E5R A;  4M00 A;  4Y1X A;  4YVW A;  4NPM A;  1TQ5 A;  4CDX C;  3UGG A;  4M4R A;  2JDZ A;  3H7Y A;  4TLG A;  1YWK A;  2MHF A;  2AH2 A;  4P9X A;  4N7U A;  2GC3 A;  3VHN A;  4JVA A;  3MLL A;  4EZ4 A;  1PX3 A;  4FFI A;  1POV 3;  1S1A A;  3PHM A;  3POE A;  4K3U A;  4RHV 1;  1SG3 A;  2W94 A;  1JYW A;  3VB9 A;  2QQN A;  3I2G A;  4M3C E;  1SEF A;  1HRI 1;  4FXK B;  3CO2 A;  1KDK A;  5FRA A;  2VBB A;  1EAH 3;  3ACF A;  2IUW A;  2IWG B;  2ZJC A;  1MZE A;  1GP4 A;  5C8C B;  3I54 A;  3N36 A;  4CCN A;  1FT9 A;  1UKG A;  2QDN A;  3E5Q A;  3GZT B;  4IEY A;  4IV1 C;  3OCP A;  4K1Z A;  5A6X A;  3OD0 A;  1PM4 A;  4BE3 A;  2QZ2 A;  2WR9 A;  4LO6 B;  5FZL A;  5J96 B;  4XFB A;  4ZU7 A;  2JIC A;  2BGO A;  4CPB D;  1ZBE 3;  1AHS A;  2ILM A;  4YW2 A;  1N1T A;  4XBL A;  3E6B A;  4COZ A;  4UFI A;  1VLN A;  1XPW A;  1FXZ A;  2NN8 A;  2QVS B;  5FXX A;  2BU9 A;  2XLA A;  1K45 A;  3ZO0 B;  3PNA A;  4OFG A;  5EFU A;  1IG0 A;  1ND2 B;  2WT2 A;  4XYX A;  2FDI A;  4QDS A;  3VBU C;  1H9P A;  2RS3 3;  1JUI A;  1YNA A;  1FOD 2;  1H4G A;  4XUP A;  4DPN A;  2RDS A;  5HV4 A;  1YFW A;  2JDY A;  3LQC A;  4MET A;  3ZYG A;  3BIE A;  4YFZ A;  4S2H A;  2VME A;  1XE0 A;  1OUR A;  2WO7 A;  2PAK A;  3ZXE A;  4EN0 A;  5G04 L;  1WW6 A;  2RS1 2;  3VBH B;  2D3S A;  2V4V A;  2Q30 A;  1DQ5 A;  3PME A;  4LE3 A;  2H6B A;  5FMB A;  1RUE 2;  2UY8 A;  4MG2 A;  3RFR A;  5BY5 A;  2JE8 A;  1DP0 A;  3VBO B;  1UY2 A;  3RYK A;  3P6B A;  4AHW A;  1DBN A;  3RZG A;  5I0T A;  3M1H A;  2CNA A;  4AHX A;  3Q8C A;  2WFF 3;  5C8C C;  4FPY A;  2HWE 3;  3S0M A;  2JD4 A;  1C5H A;  3KQR A;  3MI8 A;  5IW0 A;  4MGS A;  4Y20 B;  5JI7 A;  4YW3 A;  5A33 A;  4XXA A;  4MGZ E;  4YG6 A;  1QJX 3;  1YHF A;  1K5J A;  1LGC A;  4LBL A;  4WM7 B;  1ULE A;  1AR9 1;  4GAL A;  3OPZ A;  4G9S B;  3BTA A;  1GLH A;  1RED A;  3FZ3 A;  1UD1 A;  4LPL A;  3WW1 A;  5HXM A;  2Y6H A;  4UFK A;  2DV9 A;  4GH4 A;  4BIO A;  3AYE A;  3RYP A;  3IT8 A;  4Q4V 3;  1MS9 A;  5AC9 1;  3PJQ A;  2VBD A;  5FO9 B;  5FJH A;  1RHI 2;  1IS5 A;  1COV 1;  1ODN A;  1QWR A;  4Z8B A;  4WM8 A;  5LBB A;  1ND2 C;  5C3S A;  4M0H A;  4ARY A;  2BWC A;  4DUW A;  5BNN A;  1S0B A;  5FY4 A;  1GWM A;  2D93 A;  4N90 A;  4DS0 A;  1Y9M A;  2VC9 A;  1TE1 B;  3FC0 A;  1T6B X;  1Y43 B;  2I45 A;  1Q8P A;  3AMH A;  3DV8 A;  5DG1 A;  1FV3 A;  2X8K A;  5DAQ A;  5E1R A;  1ZRR A;  2XQR A;  4I02 A;  1D0H A;  4CU9 A;  4IEZ A;  1SFP A;  2DUQ A;  2OVU A;  4BME A;  4CEY B;  4YGC A;  2BP6 A;  2PHL A;  4JGY B;  4LUM A;  2WS9 3;  1O91 A;  3VBO C;  4UF0 A;  2WO3 A;  1UZV A;  5FY1 A;  2VXR A;  5A7W B;  4MUV A;  2K46 A;  4JDM A;  2Y6L A;  1RXF A;  4XFC A;  4EZH A;  5IVB A;  5T5J A;  2D97 A;  3SIS A;  1US3 A;  1VBD 2;  1C8M 3;  1NLQ A;  3V0B A;  1GMM A;  1QHD A;  2R1D A;  4QX7 A;  4RD7 A;  2B7Y A;  4WM7 C;  3A7Q A;  1HB2 A;  5FXV A;  1VBC 2;  3N7M A;  2C9K A;  2JEN A;  4X8P A;  1AR7 2;  1NCR A;  2MEV 3;  2V5D A;  3H8X A;  4RFR B;  2P1B A;  3ZDS A;  1PVX A;  2W5F A;  3VBF A;  1OQD A;  2TNF A;  3DYP A;  4XTM A;  4GWJ A;  2YU1 A;  2WN3 A;  4NHX A;  4YGD A;  2CWS A;  2RDN A;  1QJU 2;  3H1Y A;  3HQR A;  3DUI A;  2JDM A;  3I3E A;  4IE4 A;  4IES A;  1PO2 1;  1WGP A;  4CEW C;  4A7Y A;  4XCA A;  5EWS A;  2H0B A;  1ZA4 A;  1VJ2 A;  3AZW A;  2YUE A;  4GD4 A;  2VMI A;  5HCA A;  5IK7 A;  4PF1 A;  3MUY 1;  1C4R A;  3TRS B;  4MHR A;  4KH9 A;  5I0U A;  1Q8O A;  2EAA A;  3GHN A;  5A32 A;  5DZF A;  2ZGS A;  3WG2 A;  1UYP A;  4CEY C;  1XC6 A;  2WC2 A;  3R4U A;  1Z0H A;  4JGY C;  3K51 A;  5F9T A;  2B45 X;  3THT A;  4NWV A;  1QNW A;  1YJK A;  3K48 A;  1RUN A;  2C9A A;  3I8T A;  4XJW A;  4QX5 A;  3N9Q A;  4Q4W 2;  4R9C A;  2WNV B;  1QXP A;  4QPI C;  4BQ1 A;  3WQ7 A;  1OKQ A;  1S2E A;  4Q26 A;  1UU4 A;  3AVS A;  2XUM A;  3JQX A;  2D98 A;  1FPN 3;  3KF3 A;  4G3Y C;  3HBZ A;  5JR2 A;  3LDK A;  1W6O B;  4FTE A;  3N7J A;  2GP3 A;  4XBQ A;  2WYS A;  3AC0 A;  4FPH A;  4CXX A;  4PF5 A;  4E2Q A;  4BU2 A;  4LHN A;  2WWU A;  1JN2 P;  2V5Y A;  4M4P A;  1BZW A;  2PFW A;  1BBT 3;  3MW2 A;  4QQP A;  2G9F A;  4W6W A;  5DAX A;  4KBZ A;  5HCH A;  4QU2 A;  1GOH A;  1HW5 A;  2Y0I A;  2VUD A;  3ITQ A;  3D6E A;  4OLL A;  4XEZ A;  2BPA 2;  1H2K A;  1NLR A;  1SLT A;  1BQP A;  1NYW A;  1XJA A;  3BYW A;  4KWL A;  4XOG A;  4CDU B;  3POB A;  5BNQ A;  4YW5 A;  1OA4 A;  1DYO A;  3MIF A;  4OHV A;  1UAI A;  3NNJ A;  1VBA 1;  4PCR A;  4MXW A;  1GZT A;  1OXC A;  4KBB A;  4GIQ A;  3T0B A;  3X29 B;  4K40 A;  1UIJ A;  2VQA A;  3O0V A;  3JD7 2;  5FXW A;  5SV8 A;  1EYB A;  4AQT A;  3N9N A;  2ORX A;  4DXT A;  4J1X A;  5F6L B;  2JKX A;  4DIN B;  1W6Q B;  1RUG 2;  4YGB A;  3ZSM A;  2EXJ A;  2C6S A;  4AED B;  2R07 2;  4XMI A;  4DXR A;  5FZD A;  1KFX L;  3IMN A;  1W06 A;  4Y4R A;  1S0F A;  5IVV A;  1SZB A;  1WLW A;  2ZOE B;  2YPD A;  2ZX2 A;  4RR3 B;  2R32 A;  3R0R A;  2L9L A;  5FP9 A;  4AI8 A;  3MBW A;  3LEI A;  2GSY A;  1R08 1;  3S5Q A;  2WKK A;  3WF4 A;  3ES4 A;  2WYF A;  3M3I A;  1PVC 2;  4CUG A;  4ERO A;  3CJI C;  4M01 A;  1KJL A;  1BHG A;  2QJV A;  4YAR A;  5JCT A;  3K4A A;  4HN0 A;  3H9A A;  4RHV 3;  3THC A;  4NAO A;  3LWC A;  4W6X A;  1W6P B;  4OUM A;  3QD6 A;  4IEO A;  1HRI 3;  1PGW 2;  1P8J A;  2LRO A;  2VMD A;  3GDB A;  3RMX A;  3U78 A;  3EJK A;  5KXC A;  4R4X A;  1VMJ A;  2JD9 A;  5EZW A;  5L36 A;  5TSW A;  1GWL A;  3OYW B;  3PDQ A;  2OPW A;  4IET A;  3O14 A;  4AK3 A;  4CDU C;  2W92 A;  3RDI A;  3AFG A;  3KLS A;  5GZF A;  2MNG A;  4HL0 A;  1GP6 A;  1YQ6 A;  1RIT A;  2DVB A;  4O65 A;  1DF0 A;  2ZKL A;  1PGS A;  5H9P A;  5L9R A;  3IPV B;  1ND3 A;  2PTM A;  4XHX A;  3WCS A;  1OVP A;  2GNT A;  5C7G A;  3AKT A;  3AX4 A;  1X7N A;  2YYO A;  2JKB A;  3BOP A;  2WII B;  3J7H A;  1E5I A;  1X9P A;  1ENQ A;  2WT0 A;  4I3P A;  5DPN A;  5LA2 A;  1RUJ 1;  2W2I A;  1HV0 A;  5LK5 A;  1OLM A;  2WFP A;  2ZAH A;  1DGR N;  1LOF C;  3IIA A;  5BV6 A;  5CFC B;  1AXK A;  4IXL A;  4NRO A;  2BEO A;  3AP4 A;  1IS3 A;  5F5A A;  5F6K A;  2VZQ A;  5JIU A;  1QY4 A;  4LUK A;  4YM3 A;  4GJY A;  1AYN 1;  2Y6J A;  1CON A;  3IAQ A;  1JMU B;  3J4U H;  4ONU A;  4RR3 C;  5A7S A;  2PN5 A;  3AMN A;  1SDD B;  5T5L A;  1A6C A;  2FD8 A;  5CVR A;  4XQW A;  1W6Q A;  3AKQ A;  4EWE A;  4TZD A;  4CU6 A;  2ARA A;  4UFL A;  3O1S A;  3WDV A;  4LJH A;  4OUS A;  5HCF A;  1VBB 2;  2GH8 A;  2WAA A;  4DB5 A;  2PHW A;  3PUR A;  2WIN B;  2WWS A;  2XJV A;  4YG3 A;  5FZH A;  4LO8 A;  3TNP B;  1JU4 A;  1AR7 1;  4MLO A;  2R49 A;  4K21 A;  1O5L A;  4LBO A;  2WLQ A;  3VD7 A;  1YIF A;  3VDD C;  4PDW A;  5FK8 A;  5IVJ A;  1E5H A;  1L7Q A;  3VDA A;  4KG0 A;  1HX6 A;  5IFP A;  3WNL A;  4XCB A;  1SMV A;  4Q2F A;  1ZRE A;  1IQD C;  1PZ7 A;  1UXX X;  3KQ4 B;  4Q8L A;  4UXA A;  1RMU 2;  3UKT A;  1R64 A;  1JYC A;  1SLI A;  4QAW A;  5FY8 A;  4CPB A;  3AJY A;  1YQ2 A;  5A6Q A;  4BIF A;  1ZVF A;  1ZRD A;  4LBQ B;  3FFZ A;  2DCT A;  1AR9 3;  3PUH A;  2B46 X;  3H1W A;  4P9W A;  4A2U A;  2C0Z A;  1EV1 2;  2HYX A;  5FMD A;  1SCR A;  5E6H A;  5LRS A;  2O0O A;  4UBG A;  3THP A;  4FFF A;  1W90 A;  1VAL A;  2V4A A;  3BAL A;  4LE4 A;  3FMG A;  1VB2 A;  3OB8 A;  5KXB A;  3V0A A;  1ALY A;  5AC9 3;  5CFC C;  2GME A;  4JHZ A;  4A3X A;  1O4Z A;  4RGK A;  4JQT A;  1CAV B;  4L0P A;  1RUO A;  1NKG A;  5CNA A;  4LLO A;  4QKD A;  3TEX A;  2VOV A;  2YDE A;  4XIL A;  5FPX A;  1RUC 3;  1GP5 A;  5JSP A;  2SBA A;  2VOT A;  5FYU A;  4B29 A;  2OYZ A;  2JIG A;  1IQA A;  3VUO A;  2GMM A;  1IG3 A;  5JOW A;  1CZV A;  1W8W A;  5KC5 A;  4YG0 A;  5I8T A;  2ZGM A;  3CBN A;  3LOB A;  2VPV A;  1JOP A;  4Y5Z 0;  4NUB A;  4U36 A;  3USS A;  4OMC A;  1XNT A;  1UXZ A;  1U5Y A;  4XAB A;  3LAG A;  1UU6 A;  4NHL A;  5F3E A;  1H8T B;  1RXG A;  4I0B A;  4Q4X 2;  3OY8 B;  4U2A A;  4YGE A;  3ILR A;  5FUP A;  1SFY A;  3URF A;  1ZM1 A;  3VHR A;  4ZHN A;  1OFS A;  3PTR B;  1ZX5 A;  3VHP A;  2DDU A;  4HT1 T;  1HB4 A;  1CX4 A;  1WKY A;  2QBX A;  1UIK A;  2P3J A;  4Y22 B;  3T2O A;  5FZC A;  3O1P A;  1FYU A;  3KSC A;  4NAM A;  5AVP A;  4YM2 A;  2AUY A;  2CDO A;  4DUV A;  5C5T A;  5IVF A;  2UU8 A;  3BTY A;  4PT6 A;  3NAP B;  2QQP A;  1OLM E;  3T0D A;  3L2H A;  1YO8 A;  2UUR A;  4JKM A;  4FSJ A;  2IXL A;  3T30 A;  1OD3 A;  5DUW A;  5LEK A;  1YEW A;  1W6M A;  1YFU A;  1LOD A;  3KGL A;  3NV3 A;  4JRA A;  2XLG A;  1ACC A;  2W52 A;  2XHK A;  3J9S A;  4LKF A;  4CP9 B;  1QJE A;  2P5B A;  2LUW A;  3BN6 A;  4O9E A;  1A8M A;  4UW6 A;  2VNV A;  1PO2 3;  1ENS A;  2PLV 1;  1YYN A;  4K6B A;  4XAA A;  2XKO A;  3RRD A;  1MVQ A;  3RPQ A;  3DGT A;  1W2O A;  3JXS A;  3HOB A;  2A6V A;  2PA7 A;  5D8A C;  3C2U A;  3QCW A;  1T2X A;  1Z78 A;  1GV9 A;  3WP4 A;  1DZT A;  4COW A;  2FDG A;  2QQW A;  3ZFE A;  4XUQ A;  4FI9 A;  4WZF A;  2VR4 A;  1H8T C;  4O61 A;  3A0N A;  2LS6 A;  3GJB A;  1ZZ6 A;  5DZG A;  1X82 A;  4AF9 A;  5ACA 1;  1UPI A;  2ZBJ A;  3UV9 A;  4AVT A;  4CCJ A;  5FWJ A;  3Q8A A;  1ZBA 2;  4LIU A;  4LK6 A;  2WQ8 A;  2XWJ B;  3PUS A;  2E7Q A;  3WUD A;  3RG0 A;  1KGY A;  1TMF 1;  4N53 A;  3ZXJ A;  3WLU A;  2WZ8 A;  1NE4 A;  4Y1U A;  2D6P A;  2Y34 A;  2YGM A;  1ZRI A;  4Q8K A;  1D2S A;  2JG9 B;  3MPB A;  5GLV A;  1JYT A;  5ABJ A;  4FTS A;  2W1W A;  4Q27 A;  3HNY M;  1OOP C;  1AF9 A;  4HSJ A;  5K7P A;  5FY5 A;  4F7Z A;  2E31 A;  1ZNP A;  2HEY F;  1NCQ C;  2GZW A;  2WO2 A;  5FPL A;  4HVQ A;  3NAP C;  2QQL A;  4BQW A;  2HLE A;  3ZN6 B;  1IKP A;  2AZ5 A;  4Q0V A;  4XF0 A;  4GWI A;  3NKG A;  4QWN A;  4D69 A;  3BU7 A;  3DKW A;  3QBQ A;  1JU3 A;  4QPG B;  4FT8 A;  1F4H A;  5JIA A;  1DQ4 A;  3U75 A;  2YU2 A;  3EBR A;  4HKO A;  5LAS A;  1PO1 2;  1F15 A;  4XUN A;  4EE2 A;  4D6S A;  1VBA 3;  1GAN A;  2ZCW A;  4X8N A;  5FJK A;  3I2K A;  2Z4F A;  4CU7 A;  2Y6G A;  1JYI A;  4CDW A;  4N9I A;  5K9Y A;  2RMU 2;  5AFB A;  4MGK E;  2DCZ A;  5F5I A;  2PHD A;  3TN9 1;  1VBB 1;  1NA1 A;  1LUL A;  2TEP A;  2WJS A;  5J09 A;  5L7O B;  1WWY A;  1E57 A;  5I8Y A;  1NLS A;  2BGC A;  3OGS A;  3WDT A;  1ULP A;  3TEY A;  2DFC A;  5JSR A;  5IK5 A;  1O3Q A;  1K5M B;  4E8C A;  1JZ5 A;  1Q56 A;  1RJ7 A;  3IDE A;  5C3R A;  2X05 A;  3JBG 1;  4GUL A;  2WNU A;  3OBT A;  1R08 3;  1WLD A;  2VUL A;  3W59 A;  5I93 A;  3FHQ A;  1STM A;  2HWC 1;  2RM2 1;  2JG9 C;  1W9W A;  2WWJ A;  5CKQ A;  3DPR B;  4AVV A;  2MPF A;  3ZFF B;  3BPS A;  3AP6 A;  2J1S A;  5KR7 A;  3VZL A;  4LOT A;  4BMB A;  3GBW A;  2BOJ A;  5CA6 A;  5J48 A;  1C1F A;  4Y1V A;  1UZY A;  4UW4 A;  4BOW A;  1UMH A;  1LEM A;  4KQ7 A;  4AI2 A;  4COY A;  1WW4 A;  1OC1 A;  4NR1 A;  1CPM A;  1V6L A;  3H7J A;  2YC0 A;  1I6X A;  4Z07 A;  5FO7 B;  3C7O A;  2JG8 C;  3MIH A;  3MYX A;  1TME 2;  4QPG C;  1YI9 A;  3TOJ A;  4L8Q A;  4DXZ A;  5L73 A;  2BER A;  1WCU A;  5DUV A;  1JHN A;  2JDK A;  3HQX A;  4I2O A;  1NOV A;  3VBR A;  3OBA A;  2EAK A;  3FHA A;  2A71 A;  3N35 A;  4B7E A;  2J1A A;  1H9W A;  2WBK A;  4Y24 A;  2W39 A;  1JH5 A;  4NID A;  1RUJ 3;  4IV3 A;  1J3R A;  3WX5 A;  1OQE A;  3POS A;  1LKN A;  3TEZ A;  4KI5 M;  3AZY A;  3ORJ A;  4TN7 A;  2VOK A;  2ZA9 A;  5L7O C;  2CYF A;  2WSU A;  5BNO A;  3GF6 A;  1OMI A;  1J3P A;  4XJ8 A;  3M8L A;  1CN1 A;  3H1M A;  3LB9 A;  4C91 A;  2BNN A;  1W6N A;  2Q4S A;  1S4C A;  1AYN 3;  5JZG B;  4NJ4 A;  2ZZQ A;  4NHY A;  3WNO A;  3FE5 A;  1X36 A;  3B9I A;  3DEM A;  4GB3 2;  3I59 A;  2WUH A;  4QB2 A;  3I2O A;  3U37 A;  1AL2 2;  5F2W A;  5CKM A;  3KT4 A;  5IK8 A;  1DZQ A;  3NO8 A;  1ZZ7 A;  4QXC A;  3RYR A;  3T2Q A;  1GZ9 A;  1Q5O A;  4DZG A;  3DPR C;  2EAL A;  4M3C A;  3NNF A;  3H0O A;  3HEI A;  5FIX A;  1QJZ A;  4LOR A;  3ZFF C;  4GWM A;  5C9A B;  2K9Z A;  3CLP A;  4QB1 A;  1AR7 3;  3ENR A;  5DAP A;  3IBM A;  3ON7 A;  5F8P A;  4D3W A;  2WAO A;  3VD3 A;  2R06 1;  1AYM 2;  2TBV A;  1TVG A;  5T5O A;  2WZR 1;  3N7L A;  1XU1 A;  3VBS C;  5FFO C;  4A42 A;  1KQR A;  4MGI E;  1WMF A;  3VV1 A;  5BNP A;  3IMM A;  1D4V B;  1YFX A;  3ZXD A;  4LLF A;  2CSG A;  3GGL A;  1DDL A;  4KU7 A;  1X33 A;  2X29 A;  4YYO A;  1A3K A;  2WAB A;  3W58 A;  1KJR A;  4LO4 B;  1O8S A;  1H2N A;  1WBL A;  4YVW B;  1E5S A;  1WUV A;  5FZ0 A;  3ABZ A;  1C3H A;  2QQI A;  4NWW A;  2NPI A;  2P6H A;  3III A;  4RN5 A;  5FWE A;  3BOD A;  5IYY A;  2OT7 A;  1KS5 A;  1S0I A;  2DVG A;  2YHJ A;  1O3T A;  2AEZ A;  1SBD A;  2RS5 2;  5B2G B;  3WQ0 A;  4JCK A;  1RJ8 A;  1XOY A;  5EPA A;  4C90 A;  1WMX A;  5FP7 A;  1QQP 2;  1GQH A;  1GUI A;  1IOA A;  3CIH A;  2FDK A;  2RR1 1;  4J25 A;  2JXA A;  1ZRF A;  3D0J A;  1I9R A;  1YXW A;  3I2I A;  3AKR A;  3Q8B A;  3U4X A;  4YPJ A;  5D21 A;  3KB5 A;  2BUK A;  2BZD A;  3NVC A;  2ZHL A;  5FUI A;  3O7O A;  1ASJ 3;  3B93 A;  3HR9 A;  2FQP A;  4XDO A;  3KZ4 C;  4CCL A;  1M06 G;  1DGL A;  3RQ0 A;  1W9T A;  4AGR A;  5C9A C;  1MQT C;  4L2N A;  4ZU5 A;  1AX1 A;  1RUF 2;  1H6X A;  1L7R A;  5FY0 A;  3BI3 A;  2HWF 2;  4A41 A;  2V09 A;  1OD5 A;  3MPP G;  1YC6 1;  3MIB A;  2ZGU A;  3HIF A;  3ZSL A;  3QH6 A;  3IKW A;  3TBD A;  3MZH A;  5SV5 A;  1VP6 A;  1R1A 1;  2BBA A;  1CZS A;  4KG8 A;  2X53 S;  3OG2 A;  4LBN A;  1XE7 A;  4LR4 A;  3WNM A;  1C5I A;  5LB6 A;  3ZKU A;  1N1Y A;  3MIC A;  4KWU A;  1Q8S A;  2XB6 C;  3AJZ A;  1QGL A;  4QQ2 A;  4FP3 A;  4ZPI A;  1BEV 2;  4JQR A;  3PIG A;  5ANN A;  4Z2W A;  4NN0 A;  3T4H B;  1GR3 A;  1NQD A;  1BK0 A;  2HWB 1;  4ZS2 A;  5FMO L;  5F7U A;  4DFS A;  1R09 2;  2D5F A;  4Q1R A;  3MF9 A;  3OGJ A;  4RYD A;  1KFU L;  4MSV A;  2BTV C;  2FCV A;  3SH5 A;  4LA3 A;  4MYE A;  4HK9 A;  4LHS A;  5DUX A;  2ZGK A;  3WHU A;  5FV3 A;  5BPX A;  3D0S A;  2WZE A;  1BMV 2;  4XZU G;  2PLV 3;  3ZOI A;  3J7L A;  3FBM A;  2VMF A;  3N7K A;  4KWJ A;  3W21 A;  1DCS A;  1X9T A;  1W3X A;  3GBG A;  1OLQ A;  1UOF A;  1PIV 1;  3GAL A;  4CRQ A;  5A33 B;  4IND A;  2VO5 A;  1GFF 2;  2R6Q A;  5FZO A;  3O1R A;  3DEC A;  2R7E B;  4HVO A;  3AL5 A;  2P4E A;  5JI9 A;  2ZGR A;  4V2V A;  3TAY A;  4FAG A;  2JJ6 A;  1VBE 2;  1RUD 2;  1ULF A;  4N43 A;  2O1Q A;  2A6X A;  2ZPX A;  3E1F 1;  4GH4 B;  5ACA 3;  2DUR A;  5BXX A;  4OQ8 A;  2JDA A;  3UGF A;  1O8P A;  1ZA7 A;  1NAE A;  4OYU A;  4WM8 B;  1SLB A;  4YVS A;  3ATG A;  3LGR A;  1TMF 3;  4JAA A;  4KMQ A;  5FZF A;  5LW9 A;  5JXJ A;  5BNN B;  1TME 1;  4L9B A;  3J8F 2;  3BGA A;  4JRL A;  3UET A;  4EN7 B;  3EQE A;  2ZML A;  5KBF A;  3GM8 A;  1VMH A;  3GCW A;  3WNX A;  2R1B A;  2WN2 A;  4XQ4 A;  2BNM A;  1OVS A;  2VNO A;  4YNI A;  5JOX A;  3JCI A;  4OUE A;  3VL8 A;  3N9L A;  1OPO A;  4GWN A;  5FZB A;  4DY5 A;  4GAZ A;  1NT0 A;  1XSQ A;  4H7L A;  3SKJ E;  1Y7B A;  2P2K A;  3GZA A;  2VEC A;  2PAM A;  1PMI A;  1IS4 A;  3LZZ A;  1FMD 1;  2W68 A;  5EYY A;  4CA9 A;  4UF0 B;  2HEV F;  4IEP A;  3UKN A;  3LKJ A;  1PNF A;  2N7G A;  1S2K A;  5FAX A;  4RS5 A;  5DDJ 1;  3RZK A;  3OPW A;  1IPK A;  2Q8O A;  1AX2 A;  3V0B B;  3ZX7 A;  3AMP A;  4XXP A;  3MID A;  1Y9G A;  4B4Q A;  2HWD 1;  2O8Q A;  1QXJ A;  3TN9 3;  4XFI A;  1QJY 2;  3IDC B;  5FZK A;  3AZZ A;  1NCR B;  1PZ8 A;  1QDO A;  3BOW A;  4GH4 C;  5JR7 B;  1PHM A;  3VBF B;  1QNY A;  4WM8 C;  2IVI B;  1HRV 1;  3M3O A;  3AMM A;  3JBG 3;  2ZAA A;  3S7I A;  5FR3 A;  3ZPO A;  1K12 A;  2RVA A;  1V6N A;  4IGP A;  4Q0Q A;  4YFW A;  2HWC 3;  2RM2 3;  3CL1 A;  4HZF A;  1UF2 C;  2JDN A;  4B4P A;  5C3P A;  3AXD A;  1HN0 A;  2JEM A;  2P6C A;  1SDW A;  2EVX A;  1LR5 A;  2JEC A;  3LD8 A;  5IUQ A;  4AI3 A;  1G9A A;  4ASL A;  4FAH A;  5J36 A;  2HEW F;  4IL7 A;  2QQV A;  3BPZ A;  4Q4Y 1;  1NZI A;  1JOD A;  1QJF A;  4XZP A;  1YIP A;  1RGS A;  4P9L A;  1V6M A;  5A32 B;  4LMF A;  2EXH A;  2E7T A;  1JOB A;  5CYY A;  1RVF 1;  1W3V A;  3NJY A;  4FOW A;  1JBC A;  5FYY A;  1RUH 2;  4NO4 A;  3AZX A;  4YW7 A;  1Z7S 2;  4IGQ A;  1ZZ8 A;  4OUL A;  2XL7 A;  1CES A;  3DL3 A;  3KV4 A;  3VBH C;  2AC1 A;  4F3J A;  1JZ6 A;  3TYJ A;  4YZ4 A;  4YWA A;  1K3I A;  2XGX A;  3KV5 A;  5LY2 A;  4AW7 A;  2EF6 A;  1UMZ A;  1B35 A;  3TEW A;  3FL7 A;  5JSO A;  3NJX A;  3ZSJ A;  1YQ8 A;  2VMC A;  2B42 B;  1NCR C;  2CAU A;  3LEK A;  1ENX A;  1S0D A;  3VN4 A;  4BQ2 A;  4TTG A;  2XWB B;  4L11 A;  1HDK A;  2R04 2;  1W0N A;  2ES3 A;  3KD4 A;  5FRE A;  3MDP A;  4C1X A;  4ZZ5 A;  1UO9 A;  3VBF C;  4AI1 A;  5FZM A;  4IE6 A;  1RUI 1;  4J1W A;  5CAZ A;  4HN1 A;  5FZ9 A;  2XPJ A;  4BXF A;  2XL9 A;  3H8R A;  4BYY A;  2D40 A;  4D7T A;  2O14 A;  2J1E A;  2Q8D A;  3HMY A;  4JDN A;  4OHY A;  2VZ3 A;  2J1V A;  4MXW B;  4A6S A;  3WF0 A;  1MVE A;  1VAM A;  2R06 3;  4BK4 A;  2WZR 3;  4Y1Z A;  1MEC 2;  3K4D A;  1JYV A;  4C0H A;  2W3J A;  1JZ7 A;  4JKL A;  4N8M A;  4RFT 0;  1HXS 2;  4MHU A;  4TWT A;  2QKD A;  2E7A A;  3KCY A;  3OPT A;  2DF7 A;  1F2N A;  1S0E A;  5FZI A;  3OGV A;  1BMV 1;  1CAU A;  2BFU L;  2Z2S B;  3CJX A;  1REE A;  1SPP A;  3A4U A;  3DN7 A;  3KVA A;  1G86 A;  4L97 A;  3A22 A;  1H1A A;  2VW0 A;  4UOJ A;  3LFM A;  3Q9O A;  4EYU A;  4DNY A;  2E9Q A;  5KHJ A;  4B1M A;  1Q8Q A;  1FX5 A;  1BVV A;  5ISL A;  1VBE 1;  4R4Z A;  1QIQ A;  3D5O A;  2O8O A;  2XH6 A;  4ISQ A;  1AR8 2;  5FYH A;  1GIC A;  1F5J A;  2RR1 3;  3SC7 X;  3SXW A;  2GC2 A;  3ZXA C;  1LOC A;  1MS1 A;  3K3N A;  3LSE A;  2ZX3 A;  1O4Y A;  3CEW A;  4AXO A;  2W95 A;  2EIE A;  1NE6 A;  3POI A;  5I0D A;  1S0J A;  2ZHK A;  4BLI A;  1IGO A;  1W2T A;  3J7M A;  3J8F 1;  4RGA A;  1AR6 2;  2UYA A;  4CEW A;  1ULD A;  5F2S A;  1ND3 B;  3FUO A;  2FMY A;  1AJK A;  2QQU A;  3NNM A;  5IAT A;  2GN7 A;  5C4W A;  1W8U A;  4P9J A;  3AP9 A;  4BWO A;  5E88 A;  3PVE A;  2IXK A;  5FY9 A;  3U07 A;  1A78 A;  1L3J A;  4OZO A;  2NYY A;  3R6S A;  5A7O A;  1FOD 1;  3PVO A;  3WDU A;  1UMI A;  1R1A 3;  1XNK A;  5JXH A;  2QQK A;  1WA4 A;  3I2F A;  2FDF A;  5FBZ A;  1XQN A;  2VUJ A;  2A75 A;  1C28 A;  2EIB A;  3CNA A;  4UAP A;  2EID A;  3U4S A;  4R9D A;  1HKD A;  5CIS A;  4BQ3 A;  1W99 A;  2XKP A;  4QPI A;  1UWW A;  2RS1 1;  2VE1 A;  3VZO A;  1PK6 A;  2HWB 3;  3MIE A;  2VTF A;  3JU9 A;  1D4M 2;  2Q8C A;  1YFY A;  2GAU A;  1RUE 1;  4CYD A;  4QMA A;  2VZO A;  2DVF A;  2PQS A;  3FBY A;  5KWR A;  5DMY A;  3KV9 A;  4S2G A;  3M3Q A;  1QJY 1;  1D0G A;  2AEY A;  3HWJ A;  3IN9 A;  3NST A;  5FPU A;  2WNV C;  2E63 A;  1EP0 A;  2CV6 A;  4PDW B;  2QQJ A;  5CG9 A;  1H0B A;  3NL1 A;  2VTX J;  4H55 A;  5FTT C;  2C5D A;  2CAV A;  1N1S A;  3ZKY A;  1EUT A;  1TEI A;  3I97 A;  5C71 A;  5L19 A;  1NG0 A;  2RJK A;  2G19 A;  1PIV 3;  4FP2 A;  3W5N A;  4UFJ A;  3AXE A;  3CMG A;  4H14 A;  1C8N A;  4YZ3 A;  5H9R A;  2HH9 A;  2BNO A;  1ND3 C;  1SBE A;  1W39 A;  2QZ3 A;  2ZX1 A;  3L9J T;  5IFT A;  1RHI 1;  2DCY A;  2GNM A;  4M3C F;  3VGI A;  2RG4 A;  3BU0 A;  3ACL A;  5HXV A;  1WLC A;  1W2N A;  1PNG A;  3B94 A;  1DQ2 A;  2ARC A;  3MV0 1;  3S57 A;  4CDQ A;  1YCI A;  1V6O A;  3V0A B;  3M3C A;  2UWC A;  1H8V A;  3HN3 A;  1ULO A;  2QNK A;  4HFS A;  3VKO A;  4BDV B;  3CKH A;  2C1F A;  5A1L A;  1UY0 A;  2RHP A;  3SNM A;  1EAH 2;  1G7Y A;  5AVA A;  5HBA A;  1Z7S 1;  4FOV A;  1X8E A;  1UKR A;  5DQ0 A;  1QH7 A;  3ZYF A;  2W87 A;  4MO3 M;  5A3O A;  2HJI A;  2NP0 A;  2Y60 A;  5FZ6 A;  1XYN A;  1DIW A;  1RC6 A;  3CJI A;  3LPG A;  4P9G A;  3USU A;  4AED C;  4BCU A;  4YZ2 A;  5GZG A;  2VXJ A;  2W1Q A;  4BZ4 A;  4NRM A;  5FPB A;  5LZ6 A;  2D44 A;  1ZBE 2;  2A1X A;  4RSU A;  2A70 A;  2QQO A;  1FMD 3;  2DU0 A;  2W0X A;  4Q1P A;  1VBD 1;  5CIR A;  2XXZ A;  3ASI A;  3P3N A;  4GA9 A;  4P5H A;  3ZIX A;  3SEE A;  2X5I A;  1RTV A;  5DDJ 3;  1VBC 1;  2D6M A;  3PUI A;  2OUH A;  4S2D A;  2DYC A;  3CQO A;  1N1V A;  3VKM A;  2Y6K A;  4I3G A;  1LGN A;  2HWD 3;  3PVN A;  2FDH A;  4ZXK A;  4HKW A;  4AQS A;  4AG4 A;  4MAD A;  1CX1 A;  4PIX A;  4BB3 A;  3RZH A;  4E4H A;  2PHF A;  1OF3 A;  1H6Y A;  3AM2 A;  3FLP A;  5ACA 2;  5KXD A;  4LBK A;  1QJU 1;  2C4X A;  4JGZ A;  5JVV A;  5EQU A;  1HRV 3;  2E32 A;  2VM9 A;  3W9A A;  3WZ1 A;  1DG6 A;  4AEM A;  1W6M B;  5FYI A;  4M0N A;  2D6N A;  1HLC A;  2PHT A;  2OKX A;  3VD5 A;  2WFF 2;  3WHT A;  4AWD A;  3I49 A;  2HWE 2;  2KR2 A;  1XYP A;  2YFZ A;  4FO9 A;  3PU8 A;  1COV 3;  2ZS6 B;  4JDO A;  3J7N A;  1QJX 2;  5FKC A;  1WZX A;  2F4L A;  4R52 A;  4Q4Y 3;  2J7M A;  1AZD A;  2VY0 A;  5F32 A;  4Z1V A;  1V0A A;  3V65 A;  2H0V A;  3OGR A;  1SAC A;  4A7K A;  3ZFE B;  2JE7 A;  4DEV A;  1RVF 3;  4MGQ A;  3OJB A;  4Q4W 1;  4Q4V 2;  2ARX A;  3DXU A;  4W4Z A;  2EA7 A;  2G9G A;  3P3P A;  4JC1 A;  5CU1 A;  2BJS A;  1W05 A;  2UWB A;  2ZHM A;  3WNP A;  1HN1 A;  3ZMN A;  2W47 A;  2XDV A;  5FYB A;  4N53 B;  3VD9 A;  4BQ5 A;  1NXD 1; 
#chains in the Genus database with same CATH homology
 3J7L A;  4NIA A;  1JS9 A;  1STM A;  1YC6 1;  4OQ9 A;  3J7M A;  1A34 A;  4OQ8 A;  1CWP A;  1ZA7 A;  3J7N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...