1JS9A

Brome mosaic virus
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
149
structure length
149
Chain Sequence
KAIKAIAGYSISKWEASSDAITAKATNAMSITLPHELSSEKNKELKVGRVLLWLGLLPSVAGRIKACVAEKQAQAEAAFQVALAVADSSKEVVAAMYTDAFRGATLGDLLNLQIYLYASEAVPAKAVVVHLEVEHVRPTFDDFFTPVYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystallographic structure of brome mosaic virus.
pubmed doi rcsb
molecule tags Virus
molecule keywords Coat protein
total genus 18
structure length 149
sequence length 149
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2001-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01318 Bromo_coat Bromovirus coat protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.220 Mainly Beta Sandwich Jelly Rolls Satellite virus coat domain 1js9A00
1YC61 4OQ9A 3J7NA 4OQ8A 1CWPA 1STMA 1JS9A 3J7MA 4NIAA 3J7LA 1ZA7A 1A34A
chains in the Genus database with same CATH superfamily
1H30A 4D94A 5IATA 3NMBA 4DEQA 4KGGA 2F4LA 3AL6A 4M00A 5KXDA 2XJSA 3B69A 4YW5A 1AUYA 5B4NA 2ZEXA 1PIV3 3H1YA 5D8AC 1LHUA 5ABJC 1JOJA 4YRDA 1W8OA 2OZ6A 2HWD3 2Z42A 1W8TA 5FLHA 3WZ1A 1UMIA 1CPNA 2VR4A 2DF7A 3CMGA 3T4HB 1W2NA 2VTXA 2YUEA 2JDAA 2WS91 4QX0A 3MPBA 3UESA 1H6XA 3MIDA 5FZAA 4HSLA 1OI6A 5LK7B 2HWD2 4NHXA 3D4KA 3M3CA 5CADA 1RUC2 1RUJ1 4U2AA 1DGLA 3UNPA 3B5LB 1CX4A 3NKGA 3MF9A 1PGL2 1UL9A 2HBUA 1JH5A 2QZ3A 5GZFA 5LEKA 3SMHA 2CDOA 4LT5A 1XSRA 3EHKA 3RJ2X 3GJAA 4XUTA 1GOFA 2D3RA 3ACGA 4JC1A 1PVXA 2VZRA 3N7KA 2R071 3FJSA 3IKWA 5A3WA 4WM8C 3W59A 4LBQA 5F3IA 1W6QA 3P1IA 1GV9A 3BI3A 3UGGA 1RTVA 1CZVA 3X29B 3TN92 1SG3A 3D5OA 3LEKA 2WDBA 2Y0IA 2GU9A 2QQVA 2ZAHA 1QY4A 5FMDA 2XUEA 1DZTA 3DYPA 2YBPA 1GBGA 3JZVA 3OY8A 2GH2A 3B02A 3B00A 3WINE 4BQXA 1PIV1 4ZS3A 5GLUA 1VBC2 2XL9A 3AZYA 1AF9A 3E1F1 1YRZA 3JU9A 3Q8CA 4NPMA 4CXXA 5A7OA 4Q4Y1 4PIZA 2JG9B 1OA3A 1GQHA 3R05A 5CBLA 1JU4A 2FMDA 1RUF2 1AL21 2Z4FA 3OGGA 5T50A 1I6XA 1VMFA 2GP5A 2DFBA 3LAGA 4I02A 5A7WB 3VKLA 5HXVA 1TG7A 1B35C 1R091 1WW5A 2YFZA 4RGKA 4K3UA 4P9WA 4M3CB 3V65A 5A32B 1RVF2 3VZNA 1W2UA 4AXOA 1NQJA 3GNEA 4FI9A 1RUH2 1HRV2 3FBMA 2Q0AA 4DQAA 1VRH2 1UX6A 4XYXA 1TME3 4UW6A 3FL7A 1V6IA 4INDA 1X7NA 5ACA3 5CEHA 1Y7BA 5LA0A 1LU2A 1MQTC 3KF5A 2P3YA 1HRV3 5FKCA 1VB4A 4WM8A 3OBAA 1GQPA 4O65A 3V64A 3Q9OA 1TME2 4ATEA 1UY2A 3WNXA 3AZXA 4RA0A 2XJVA 1W6MB 1MS4A 2QQIA 1JZ7A 3NV2A 2VAUA 1OA4A 3RSJA 2PMWB 4FO9A 4URTA 1VALA 1SFNA 2FZ1A 4W6YA 4C8DA 1RJ7A 2X09A 2Y64A 4LPLA 1WA6X 4RR3A 2XGXA 5KC6A 1UY0A 2J1SA 1O8PA 4BA6A 2C9KA 1RUF1 2ZGLA 1UIKA 2HEVF 2EXHA 3E5QA 4HFSA 4HETA 3H3LA 1US3A 4AEDC 5LY1A 2N7GA 3MV01 1YQCA 2VE1A 4QPIC 3NJXA 2LUWA 2DCZA 1JZ3A 5A33B 2RR13 3U4SA 4LTAA 3H50A 2GN7A 1UIJA 1DGWX 4FFIA 2JXAA 1ULDA 4ARYA 1WMXA 4WM7B 4OUSA 1QNWA 2ZXQA 5A7PA 3WT3A 3WP6A 1UO9A 2P17A 2WNUA 3J26N 3VKMA 1LR5A 4QPYA 4NJ4A 4AQSA 1F5FA 1T2XA 3HVDA 3Q8EA 4S2HA 2R061 4AHYA 1XPWA 2DVDA 1WLDA 3AVRA 3PUQA 4X6RB 5FY4A 1STMA 2ZX4A 3R4UA 1G86A 1C4RA 2MHFA 2Y6FA 4M01A 5FY9A 2A6YA 2BGPA 1HJFA 1UKRA 3L9JT 4BIFA 1WA4A 5KWRA 2QDRA 5FBZA 3TN91 3WUDA 3I2HA 4QHZA 3HR9A 4C90A 2AH2A 5DDJ3 3TRSB 4EJRA 2RS51 1C1FA 3WDXA 4IETA 1QJX1 1G9AA 5LWBA 1NZCA 2HWF1 2YROA 5LW9A 2WZR1 1QU0A 3KM5A 1O6UA 2KD7A 1HLCA 1UU5A 2WQ8A 2X8KA 3N7LA 5FV3A 3ZXLA 3V56A 4LO4B 4XOGA 1CIWA 1EUUA 1QDCA 2ZKNA 3BTXA 5H9PA 1X8MA 4I30A 4XF9A 1GWLA 3F2ZA 3KSCA 3O0XA 5IVBA 2W92A 3VZOA 1UPSA 2YV8A 4K1ZA 2D93A 3NQHA 3D0JA 3NSTA 1PNGA 1QF3A 4PBPA 2CYFA 1BBT2 5LZ6A 1RUG3 2JDYA 1IG3A 1MZ6A 2AZ5A 5FZ1A 1IPSA 1RUD3 2JKBA 3NKTA 4NAMA 2JWPA 2VZOA 1PZ8A 1TMF3 2BVVA 3KT1A 1YWKA 3IDAA 4QDRA 4RGGA 4CDXB 1V9U2 3OBTA 4AHZA 1DBNA 4LBQD 3ES1A 5LA9A 1Q8VA 2WNVA 1W06A 2NP0A 3VHOA 3WG4A 3ZFFB 1TMF2 1J3RA 4HK8A 4XJ8A 3CIHA 2RJ2A 4XTMA 4EN9B 1AX2A 2YPDA 4CDUC 4D8MA 4OI0A 2G1MA 1FT9A 2W87A 4HLTA 2XLFA 4E4ZA 3AX4A 3RZMA 1RUJ3 1K5MA 2W1WA 4RQPA 4ES9A 3HQXA 5JSRA 3VKOA 1LTEA 1VAVA 3WOGA 1LGCA 3W5NA 1TNRA 4MXVA 3PIGA 4AVVA 4K8RB 4W6XA 3UYJA 2R073 3SEEA 1NA1B 3AMNA 1SLIA 5FWJA 5KXCA 2SLIA 3HPNA 2V4AA 1U5IA 5FY0A 5I0SA 5JXJA 1RXFA 4HPKB 4RS5A 1ND3A 1LHOA 4LO7A 5F9TA 2ZMKA 4XF4A 1DYKA 5F5IA 2V72A 3TEXA 2ZPXA 3K46A 1K5JA 1IOAA 1EAH2 2IXHA 3WNOA 2OYZA 3I2IA 5L19A 3M3EA 2FCTA 1YIPA 2Y6KA 5F3GA 1D0HA 4A41A 1LODA 3ZFGC 1MACA 3WY6A 3PJQA 4A6OA 4YVWC 3KHCA 2WZ8A 3DCQA 1Y3TA 1I9RA 1ZA7A 4R4XA 2RMU2 3G7DA 4FFGA 2BZDA 4XFAA 5DAPA 3FHAA 2WA4A 1VJ2A 1FOD1 4P5YA 4B29A 1COV3 1EV13 4IV3B 5A6QA 3V0BA 3HQRA 3AMQA 4MHRA 1JZ2A 3DXTA 2NPIA 3N9NA 4QXHA 2R32A 1R64A 1COV2 2ZGKA 3BTYA 1OH3A 1MS3A 1IQDC 3KV4A 3A7QA 2PA7A 4AVCA 3L2HA 5F5AA 3THDA 1DQ0A 5GLZA 2IWGB 4GMP3 4EZ4A 3NNGA 2VMDA 1XJAA 4O9GA 4E4SA 2CNAA 2JD4A 1EY2A 5FYBA 2ZACA 3KGLA 2XJRA 1WCUA 3UKVA 3N7JA 4QQ2A 2D6OX 5LB6A 4ZS2A 4ISQA 1OFNA 4CXWA 5FYHA 3LEIA 1PGL1 2D40A 1RYYA 2GC3A 4JCKA 4X8PA 4BQYA 2EAKA 3ZFEA 1JOBA 1FV3A 1TEIA 3ZIWA 4CUBA 1ZBE1 3DKWA 3IT8A 4IE4A 1RHI1 3WDUA 3ZFEC 5A6ZA 1XQNA 2JECA 3URFA 1YO8A 2OKXA 1ZBA3 4LJHA 1GNHA 4Z8BA 1AJOA 1EV11 4DMIA 4AVBA 1BK1A 3PL0A 1BLZA 3EB7A 4XIOA 5FMBA 2ERFA 5FP3A 4HSJA 5IK5A 4DY3A 4CU6A 4XJ9A 5EZWA 4IDZA 4Q1PA 4AFMA 4JKKA 2ZGOA 4RYDA 4XF0A 1JN2P 4CDUB 1ULCA 1MS9A 2XBO3 1Q8OA 2GNMA 1C57A 2BV4A 2HWB3 1JYNA 2QNKA 1YUDA 4N8MA 5CKNA 3S7EA 3WDVA 4J6GA 2R042 1N1TA 1AR61 3ETQA 4Y22B 4YG6A 1W9SA 5AFBA 5A1AA 3HQUA 1KRIA 4P08A 4QKFA 3MW3A 4UFJA 2RS11 4HKLA 4FAGA 2VZVA 3OJBA 2E7TA 2Z2SB 4PT6A 4UW3A 4XILA 4OUEA 3WW3A 3VBHA 1HXS2 1XU2A 2DV9A 1BK0A 1AX1A 4D6SA 3DXUA 2W95A 3N35A 4MHUA 4YVWA 2PHRA 3USUA 3M3IA 4CCNA 5J37A 4QB1A 2UWBA 3IDBB 2C6SA 1IKQA 2HWF2 4Y20B 3W5MA 3WNMA 5C7GA 3LB9A 3ELNA 2ID4A 3FLPA 2WZPP 3O1VA 1V6JA 4N43B 2OQ6A 2XONA 2D5HA 4NRMA 5FQ0A 1PVC1 3NVCA 1HN0A 4RS5B 2P6CA 5F7UA 2ZX2A 3ZXEA 4Q8KA 2RS53 3WG3A 5CVRA 3HEIA 3MV11 2UY8A 5BNOA 4Y1XA 4GJYA 4M0HA 1S2BA 2QQKA 2VC9A 2VBPA 2WYFA 4K6BA 1CQ9A 1HB1A 3WV6A 5JR7B 1RUI3 4RGAA 1GKBA 1K5MC 4RQPC 1JYXA 1RINA 2P37A 2RS13 1SEFA 3AP4A 4HXCA 2A1XA 4XW3A 4BPZA 2DDUA 1YHFA 3LEMA 3ILFA 4MXWA 2YZ4A 1G9FA 3BOWA 5FXZA 2W5FA 3ZLIA 3ZXAC 2JE8A 2NM1A 4H7MA 2JDZA 5C6CA 5JPNB 2WUHA 1NAEA 4CEYB 3DV8A 5IK4A 1H2MA 2CHHA 2ZJCA 4WM7A 3VDDC 4ASKA 1BYHA 5F32A 5GLVA 2ZHNA 3T2TA 1L7LA 2WAOA 5F6LB 3ETPA 1EPZA 4W6WA 3RWKX 1FPN3 3IIAA 1W9WA 4LKEA 4E4DX 1CAWB 1IKPA 1HQNA 4XE9A 4XFBA 3WVJA 5DZGA 1XNBA 1BZWA 4I01A 4BYYA 3EXUA 5JSOA 1Q43A 2CAVA 1DLCA 2R1DA 4Q4X1 2GZWA 2ZA9A 2D6LX 3CL1A 5DZFA 1LENA 3VBUA 1RVF1 4IV3C 2WIIB 5HV0A 1UU4A 2LW8A 4FFHA 3BTZA 3K3NA 1PGW1 2Q1MA 3R4DB 1FMD1 2WT0A 2C26A 3WNKA 1NE6A 3QH7A 1O7FA 2D6MA 3HAGA 5EQUA 5FYZA 2VNOA 1GP4A 4R9AA 4NIGA 4CCDA 4IV1C 4YVSA 1JI6A 5DQ0A 1PNFA 5FZ3A 3CQOA 4CPBA 3ZFGB 2BOJA 1DDLA 1RITA 3LKJA 4CSWA 4LIVA 4YYOA 2DBNA 2BBAA 3WCSA 2HBTA 1W6NA 5IHRA 2IXLA 2QUOA 3SCFA 3H9AA 3AKTA 5T54A 3RYKA 5SV8A 4AI9A 2QKDA 2PHTA 4HL0A 5BPXA 4IEYA 1NCQA 1QOSA 1QJEA 4EN6B 3PNAA 3WHUA 3MFCA 4I09A 2BNOA 2XKOA 1CZTA 5GLWA 2GDFA 3J7MA 5A80A 3DKQA 2B9VA 2AGSA 2YMZA 1AR82 3FWEA 4RHV1 4AVAA 5CFCB 4GMP0 3U11A 3MF6A 3GGLA 3VDAA 1RVF3 1WBLA 2BVBA 2JDHA 2K0GA 4FSJA 3OSDA 4V2VA 4C0BA 1RUC1 5JUVA 2WN2A 3GZUC 4HVRA 4CU8A 4YGDA 4LULA 2IUWA 2ZTNA 3KS7A 1FMD3 2XVKA 4K7JA 1GMMA 4LR4A 3FLTA 5CFDC 1JS9A 4FOYA 4MGKE 1FYUA 4BDVB 4IXLA 4I2OA 3MLJA 1ULOA 2C24A 2VZQA 5HCFA 1RHI3 1ZRFA 1FMD2 4QXKA 4LA2A 3WP4A 4KU7A 4CXYA 2DTYA 2WR9A 4QB6A 5BNNA 1H1IA 4RL7A 3KCYA 1R1A3 1UYPA 3UGFA 3FFZA 4QX8A 1RHI2 2VOKA 3GJBA 1ZZBA 3HIFA 4PLOA 1N1VA 1OQEA 3FZ3A 2J1EA 2BUKA 1PO21 2OPKA 4HG6B 5FPLA 5FZ4A 4CP9B 2KXLA 4AE2A 1O3TA 3JD72 1CX1A 2BFUL 4ES8A 4GB32 4LBMA 1CONA 5FZ8A 1UMHA 4NHKA 3WNNA 2FD8A 2XBO1 4AEJA 3VGIA 2GMMA 4RHV3 1OLME 3SHRA 2ZOEB 3CEWA 5FMCA 4GB33 1XE0A 3JCIA 4Y1VA 2W1SA 4Z92B 2YPJA 2JKXA 3GHMA 2HWE1 4IE7A 4TSVA 3VV1A 5K9YA 5D8AB 2WABA 1DQ6A 4UW4A 5JPMB 4Y3OA 1W0PA 3SH3A 3SCHA 4CDQA 2RDRA 4BWOA 3C7OA 4E2QA 5A3UA 3PDQA 2BTVC 1YNAA 4AVTA 5HCHA 1W2TA 2J1TA 3H7YA 1IQAA 1OSGA 3PTRB 1HIXA 5AC92 3TB0A 4OQ8A 5A6XA 1LGBA 2H0BA 1W05A 1M4WA 1Y4WA 4MG2A 3MIBA 1ND2A 2BJSA 1KXGA 1JTZX 2E6VA 4JQRA 4MLOA 1OUXA 1XNAA 2SBAA 3GCXA 5TSWA 1UZYA 2C1FA 1POV1 3OOXA 2WZR2 2EXKA 4YM2A 1SBFA 2BRTA 2E63A 2WNVC 3J7LA 3N7MA 5FXXA 2NQYA 3ASIA 3JBG2 1AR92 1LHVA 5C3SA 2VOXA 1UOJA 1V0AA 4AHXA 4A2UA 3WDTA 1HRI3 4QMAA 5L7OB 3UKTA 1MS8A 3O14A 2Y34A 3HT2A 5FQ0B 2I07B 5JMCA 3SCGA 5K0UC 4FTBA 3E97A 4AEDB 4CA9A 3AZWA 3PUAA 3HN3A 3MFAA 3MIHA 3OGSA 2K2SA 4OMDA 1GZ9A 2EALA 1KJLA 1JBCA 4IL7A 4J1WA 5FREA 3ZSJA 3J4UH 2F17A 5J1XA 1NCRC 2OUJA 4NWVA 1CAXA 4PQQA 3DGTA 1BHGA 3MO4A 2RJKA 4M3CF 4NROA 4XDPA 5JIAA 4ZZ8A 5AC91 1A8DA 1UOBA 1D0GA 1W8HA 3SC7X 3NJVA 4OI2A 4UBGA 2JB8A 1GWMA 4MGSA 4HVOA 1LOFC 5FCCA 2BPA2 4EV0A 4N9HA 2WJSA 5K0UA 4NO4A 3AZZA 4NN0A 4BLIA 2WYSA 3AJZA 2VQTA 4MGZE 3ACFA 3UK9A 1WD3A 4XQWA 4DS0A 2GAUA 2OX0A 3CO2A 4JX0A 1W0OA 4LITA 4V2WA 5T5PA 2X05A 1XBFA 3WF1A 3NRUA 2FDHA 4IV1B 2ZGSA 1F15A 4AAPA 3K4ZA 2XDVA 1DGWA 1XXNA 2XG3A 4QGLA 5H9QA 3LZZA 1RJ8A 1F4AA 1N1SA 1VR3A 4YNIA 4XFCA 2HYKA 5BY5A 4L99A 3PTYA 5J96B 1C8NA 1CAUA 1QXJA 1U0AA 3FC0A 4QM8A 2QQPA 5F6KA 4D69A 5LBBA 4R9CA 5FP4A 5JR2A 4WZFA 5C70A 1MZFA 1MPXA 1LU1A 1V6LA 2ORXA 2PHWA 3WF0A 4YFWA 1JZ8A 1YI7A 3VUOA 1SBEA 2RV9A 5A7QA 5IUQA 4N43A 4UYBA 1QH6A 2PHLA 3AZVA 4XAEA 5FWEA 2E7AA 2AYHA 4UAPA 4D3WA 2WFF3 2JE7A 2FDKA 1W6MA 1IZ3A 3C7HA 1UN1A 1QOTA 4B1MA 5JI9A 2WLPA 5DG1A 4A7YA 3VBOA 2RDQA 2W08A 1V6NA 3VDDB 1JZ6A 4FPLA 2W94A 5I0DA 2WFF2 3ON7A 4PDWA 4GALA 1JU3A 1OFSA 3QH6A 2LS6A 2O14A 1S0IA 1C28A 4KBBA 2Z69A 2A6WA 1ULFA 5GALA 3MYXA 1OF4A 1UKGA 5FYMA 4DNYA 1ZRDA 1LGNA 3MW2A 1NG0A 1FATA 4O7XA 4BM8A 4NOTA 3OGJA 5B2GB 2XQRA 4HBNA 3O1SA 1OA2A 3WF2A 3VBOC 2P1BA 1S0BA 2JE9A 1OKOA 3RS6A 2UURA 3IPVB 3KMHA 1CAVA 2Y33A 5FMOS 1LOAA 1QJFA 4AK3A 2A5ZA 3Q8BA 4Y1ZA 2HYXA 3WUCA 3RI8A 1PK6C 5LK5A 1R1A1 2R7EB 2ZZQA 5H9RA 4NHLA 5T52A 4OHVA 1CWPA 2VPVA 3D8CA 1DZQA 4CP9A 4GWIA 1NZIA 4WVMB 1RUJ2 2VCAA 3HOBA 4DZGA 1O4ZA 1XSQA 5F3CA 4Q4W3 4DO0A 2D97A 2ES3A 1S0EA 2VQ0A 4LBQB 2JJ6A 1W6QB 4QHBA 3ZXGA 4BH9A 4XJWA 5CAZA 3MIFA 1J83A 2WS92 3NV4A 3I2DA 4G4FA 1FAYA 1ZBA2 4H7LA 1OD5A 1PM4A 4HPKA 4Q4W2 5CNAA 2NMOA 4XF1A 3CJIB 1LJ7A 3AP7A 3P5BA 4C91A 5FZFA 3ZXDA 1QEXA 1WD4A 2C9AA 4AGGA 1XNCA 3AFKA 3ABZA 3VBRB 1FNYA 2CAUA 1WW6A 3U07A 3VBHB 1S4CA 2J1AA 4GWMA 4JGYC 5FZ0A 3J8F1 3KD4A 2ZGMA 1LECA 1WLCA 1K12A 3APBA 3ZM8A 3ZYFA 5HI0A 2ADEA 3UJQA 5D1IA 4Z2WA 1GSLA 2A3WA 2QDNA 4HKOA 2R063 2JD9A 2Y6LA 1JUHA 1SACA 2P34A 4CTEA 2WL1A 1PMHX 4QKDA 2PXJA 1QGLA 1VMJA 5FZGA 3T1LA 4P9LA 4QD2A 5CFCC 4YGCA 3L2YA 5FO8B 2YY1A 3MUY1 5BNNB 2VXJA 3LWCA 4HONA 1G9DA 4FOQA 3LFMA 1HXS3 1GOGA 4ATFA 4KBZA 2CGPA 4AOCA 3MZHA 2XJQA 5LATA 4UI9L 4F3JA 3RDIA 3NO8A 5J48A 1HB3A 1O5LA 4V1PA 5FDBA 3I2FA 1O8SA 1ZBA1 1DZRA 3VBSB 2HWF3 5IVCA 1CAUB 5FYIA 4B7KA 1UOFA 2KR2A 2PN5A 4Q27A 2VO5A 4BCUA 2ZGUA 5FPUA 5IK7A 1MQTA 1YJLA 2ARBA 3FFQA 1OKQA 3ME2A 3DPRC 1BVP1 3JBG1 5G04L 2OZJA 2A3YA 1GNZA 1QJU2 2PHDA 3KCCA 4N9IA 4B7EA 2X5IB 4QPIA 2Y6JA 4PIYA 3TEWA 2J7MA 2CSGA 3FLRA 2ZS6B 3THPA 3W20A 4D7SA 1AR63 1US2A 2VG9A 3B94A 3B9CA 5FY7A 4CDXA 3UL2A 4JDNA 4PIXA 4NPLA 4OHWA 3ZR5A 2RS12 2WSUA 1HJGA 4FAHA 3KHBA 2GN3A 1ZYBA 2JIGA 4FPYA 4LNVA 3ZPYA 1VBE3 1CJDA 3V0AA 4IGPA 2IXCA 3DPRA 3K2OA 4EN7B 4IV1A 4YVSC 2NMNA 5AVAA 4LLFA 2WT1A 1ZX5A 2YDEA 1VBE2 3PIJA 1QJY1 3G6JB 1YCIA 3OYWB 4QGMA 4XCBA 1Z7S2 2XBO2 3DPRB 3WHTA 4LA3A 1S0GA 4R9BA 3N36A 5HCBA 3VZMA 1GANA 4OVEA 5IK8A 4KL1A 2WO2A 2YG0A 4N53C 3ZXFA 4AHWA 3T0DA 2PLV3 2PHFA 1NA1A 1RUE2 4JQTA 5K4LA 3MLKA 1CR7A 1G9CA 4X8NA 1J3PA 5DUWA 2D3SA 1PZ9A 3PJYA 4Q4V1 4W65A 1S0CA 4UF0A 2FDIA 4LUMA 1DGRA 2AUYA 1K5MB 4RQPB 4OI4A 4XUOA 1KITA 3WNLA 1AYM1 3ZO0B 2Y0OA 4XQ4A 5FO9B 2VZUA 2WWJA 1Q3EA 4XACA 4JGYA 5JWPA 2DVFA 1AXZA 1VBE1 4PBOA 1MEC3 5LBFA 3OD4A 4G3YC 4YZ2A 1JZ4A 3RZLA 3T1MA 2PQQA 3GALA 4D6RA 1SFPA 4NMIA 5FFOC 5FLJA 5IFPA 1YFUA 4GKXA 1W8WA 4AEMA 5BNPC 1QJY3 1XNKA 3I59A 4HN0A 2OXBA 4WVMA 2DWRA 1COV1 1SCRA 2VBBA 4IEXA 2QBXA 4Z07A 4XMIA 3SKJE 5KXBA 1SLCA 3WNPA 4CDXC 1QJY2 1E5RA 1QXRA 4CVUA 5FZHA 3ZN5A 4LHSA 5C5TA 3RMXA 4NRPA 4OMCA 1MS5A 1RUI2 3U78A 3N9LA 4IERA 1S1AA 1BCXA 1KFUL 3ATGA 4ZPIA 3MGUA 1KEXA 1DLLA 3K75B 3GDBA 1PO13 2V73A 2ZKLA 3IMMA 1H8TA 4IQPA 4Q2FA 3TYJA 1VP6A 5EFUA 2PYTA 3BODA 4XURA 5A3NA 3EBRA 3A4UA 5EV7A 3ACHA 3NJZA 4KWJA 4LHNA 4CU7A 5FUNA 1RL3A 1GFF2 1QMJA 2OQ7A 4BJ0A 2ZGNA 3MIGA 1SPPA 1LOCA 1QJU1 4QQOA 1REDA 1GU3A 1ZBE3 4Y5Z0 3W58A 2B39A 2VMGA 2B8MA 5F3EA 5JIUA 3MDPA 1S0DA 3KT7A 1VBB2 2VCMA 4P00B 2HLEA 2HWC3 2YC2A 4ISRA 2V5YA 4QXBA 3VBOB 1ASJ2 2ZBJA 2C5DA 4L92A 2WWUA 1SDDB 5FAXA 1AYN3 5EJ3A 4C0HA 2TBVA 1SDWA 2GC2A 4YGEA 2ZEWA 5FPZA 3JB4C 5I0TA 4AI3A 1R082 4KWLA 3LSEA 4EN0A 3O1PA 1VRBA 1ASJ3 3ZFEB 1N47A 3O12A 5L36A 3PVNA 1KQRA 5EJZB 1AYN2 4FPFA 4YM1A 4P9YA 2BWCA 3I4IA 4YM3A 1NE4A 2ZGTA 1MS1A 1YFXA 1H2LA 1OVPA 4LMFA 2H0VA 4N53B 3ROUA 1IPKA 4ZU7A 1SBDA 2W0XA 3E5XA 5EYXA 5FUIA 3PVEA 1KGYA 1SQ4A 3CDZB 2PAMA 4FT8A 1BMV1 1A78A 1BBT1 5CG8A 3H3ZA 2DVAA 3USSA 5JXIA 3AMHA 4BMBA 1EP0A 5DN2A 2OPWA 3BUCA 4XUPA 3O7OA 3ZN6B 4IE0A 3LD8A 4LBJA 4MUVA 5FZ9A 3RWNA 1W9YA 3QOPA 4P14A 2BNMA 5JCTA 1QWRA 4DXSA 2HJIA 1L7QA 3VD7A 1R081 1VRH3 4ZXEA 3V0AB 1ND3B 1PO23 3OPTA 4COWA 3JBG3 2XL7A 3FUOA 2DVBA 3AB0A 4R4ZA 4J1XA 1G6NA 4IEOA 3TEZA 1HX6A 1PVC3 3KLSA 3SITA 1H2KA 3KCXA 4PDWC 4KMQA 3AKRA 4OZOA 3FN9A 4HOOA 4DXTA 1ZREA 3D3AA 2WO3A 5A7NA 3POFA 4DINB 4N90A 1FI2A 3DN7A 4JHTA 3DECA 1JUIA 1PVC2 4CEWB 4UT5A 3OG2A 4YZ5A 1YYNA 1RC6A 3PURA 3VBSC 4JRLA 2WC2A 5CKQA 1ULPA 3INAA 1R1A2 1UYYA 3O1MA 1NQDA 1KS5A 3P3NA 4L9BA 5ABJA 5LRSA 4MO3M 2CWMA 1O5UA 2JICA 4XXPA 3E5UA 5A3LA 4DXRA 2UU8A 5A1FA 4EE2A 1W39A 1B09A 4IEVA 4JGZC 4W4ZA 4CCOA 3AP5A 3VKNA 4MGIE 2K9ZA 3PMEA 5FPVA 4XFGA 4YPJA 4B3NA 5EJ1B 4AAXA 5FOBB 1JOPA 5IT6A 4KU8A 4SLIA 2TEPA 3ZFGA 1OLMA 2VUCA 1ND2C 1VBA2 1WCDJ 1S2KA 1YEWA 4BE3A 1EUTA 1GYKA 1AJKA 3VZKA 5E88A 1AL0G 2PLV1 2YU1A 5GZGA 4LKFA 1HV1A 2RS31 2XQXA 5C8CC 2DCKA 1A6CA 2VZTA 4AR2A 1Y43B 3LDBA 5L7OC 3ZFFC 2Y38A 1D7PM 1OPMA 5I93A 2ZAAA 1WLTA 1RUG1 1QJX3 2UWAA 2UY9A 5EP9A 2HEWF 3VBUB 4CDUA 1C3HA 4LO8A 1WMDA 2Q4SA 4S2GA 4QDSA 4LE4A 4LKDA 1LOFA 5L7OA 2H6BA 2EVXA 1Y9QA 4MVTA 5HBAA 1UZWA 5JVVA 5F5CA 2VZSA 4CPBD 4DRRA 4QX7A 3NAPB 4IE5A 3VL8A 4BQ2A 3PU3A 3ZSMA 1C5HA 2LALA 2RM23 1KDMA 1NCRA 4FQZA 4IE6A 4XBQA 2AR6A 2QZ2A 2R0HA 4LOTA 4LO6B 4Q4V3 1YXWA 4WVWA 2VD7A 1AR93 3B9IA 5AVPA 2PAEA 4GQ7A 4LLOA 2VVDA 4Q0VA 3TEYA 4JHZA 5FYTA 1VMHA 3PUHA 1C8M1 3WF4A 2RM22 1XRUA 2Q1FA 3I54A 2YXSA 1RIRA 3J7NA 2ZEYA 3CLPA 5HV4A 5LASA 3ZKYA 2MPFA 4Q1RA 5DAXA 2IXKA 4NWWA 3K4DA 3HN1A 2GP3A 1HW5A 1ENSA 1K45A 1R092 1XOYA 5J98B 1IPJA 3SISA 1LKNA 4LHLA 3ZIXA 4CUCA 2JDMA 1W03A 3BVCA 2DUPA 3GM8A 2XVLA 1R093 2J1RA 2HH9A 2BP6A 3VHPA 1NLRA 5A3OA 4M4PA 2FBEA 4XFHA 4Y22A 1LAJA 5F37A 3WP3A 2GNDA 3BN6A 3I3BA 4XZUG 5A7WA 3VBFA 3OTFA 4YG0A 1NYWA 1QQP3 5FY1A 3WSOA 2P3JA 1ENQA 1AR91 4IEQA 5C8CB 4IEWA 2XJPA 1PM7A 2BOIA 5EHDA 3TNPB 3AXDA 1W28A 2PHUA 3T2PA 2VVEA 5FXWA 2WFF1 2KM2A 5C9AC 4XUNA 1ULEA 3N9PA 1DCSA 4I0BA 4I3GA 4Q8LA 1ND2B 1HB4A 2BNNA 2O1QA 3KVAA 4RSUA 5IVVA 3RYPA 2HWD1 2HEYF 3AFGA 1BJQA 1OT5A 1AR71 5I0RA 2JDPA 3MUZ1 4FPCA 2VZPA 4FPOB 4DFSA 5C4WB 1NY72 2WS93 3LA7A 2XHKA 3BU0A 2EIBA 2JB4A 1ACCA 1HQWA 1KFXL 4Q29A 1VAMA 2WBKA 3OBRA 1EAH3 2HWC1 5I8TA 2BBVA 4O61A 3KGZA 5DAVA 4XHBA 1QDOA 2QE3A 3LDKA 5FZ7A 5A3MA 2FMYA 1W04A 4QX2A 5B4XA 4DPNA 1KD7A 4A42A 5C9AA 4YW6A 1TZOA 1NLSA 2VCBA 1WMFA 4N53A 2JG9A 2OT7A 4NAOA 3U75A 2W47A 2DCTA 4U36A 3CKHA 3MHZA 4ZY9A 4EN8B 1QQP1 1Z0HA 3NNMA 1J1TA 2C0ZA 3ZMNA 1WBFA 5A70A 3M2MA 1D4M3 4PDWB 3LIHA 1A34A 1FNZA 1EPWA 1W6NB 4M3CA 1EV12 4JAAA 4RR3C 4IGOA 4COZA 4XZPA 2LRPA 2A6VA 1D4M2 1JODA 2E53A 3OBZA 3OB8A 2F4PA 1W2OA 1ZM1A 4B8EA 4P9IA 1AR73 5APAA 5C4WC 3U14A 1NCRB 4LHKA 3UJOA 3WP5A 1AL23 2V09A 4Y24A 4OUMA 2E32A 4Q0UA 5FZIA 4NIHA 3OF1A 3OY8B 4DUXA 4PLNA 4P9XA 4YZ3A 1AR72 4LK6A 4JTOA 1NY71 3T4VA 1NT0A 4UW5A 3MEPA 1RUOA 4XJAA 1NUKA 2WNOA 1I3HA 1UZVA 4FPEA 3VN4A 4NUBA 4LOSA 4L0PA 5BNOC 1VBD3 4RN5A 1RUE1 4A3ZA 3PUSA 1X8EA 2I74A 1LHNA 4EROA 1WW4A 3IWZA 4QWNA 5DPNA 4E8DA 2FDFA 5JXGA 1NCQC 4LQRA 4XAAA 2WNVB 3WLUA 3POBA 4WV8A 1RUD1 5C3QA 2D6KA 5LBEA 3WW4A 1SMVA 2JENA 3C7GA 3K3OA 4NE9A 5CB7A 2VUJA 2G19A 1OMIA 2VW0A 2VUAA 4QU2A 4CU9A 3M8LA 4BU2A 4CP2A 1FV2A 1BEV1 2RS33 3JXSA 1YLLA 3WQBA 2IXJA 5FIXA 2X53S 2Q8EA 1OLRA 3ZFFA 1L3JA 2TNFA 5ABJB 2V4VA 2K46A 2ZX1A 5FZKA 4BQ4A 2P4EA 3HBKA 3U4XA 2OS2A 2WINB 2DUQA 2R0FA 2DCYA 2D6PA 3VHRA 4FXGB 4OHXA 2YC0A 1W8ZA 2LROA 4OYUA 2WZEA 3WG2A 5IVJA 2D6NA 3IMNA 5E89A 3R6SA 3RQ0A 1Q8SA 1RUE3 5GKAC 3VBHC 1D4VB 1UNBA 4BIOA 4B4PA 2R1BA 2UWCA 1GOHA 1V6OA 4MV2A 4FQ4A 3RGBA 3NAPC 4CCJA 3N4MA 2UYAA 5BV6A 4AFCA 5I8YA 4BMEA 4Y20A 3ZDVA 3VHNA 2ATFA 3IDEA 1TE1B 1C8M3 2X5IA 3M70A 5G05L 1ZZ7A 2V5DA 3FX3A 3WG1A 1MZ5A 3VD3A 2AACA 2A75A 3AP9A 4ASMB 4FPHA 4C1XA 3SQOA 5FY5A 3MICA 2QQUA 4DXZA 4NRQA 2GC0A 2XMLA 1Q8PA 4Y26A 1CVNA 2L9LA 5L9VA 4Z1VA 1C8M2 1H8VA 5A7SA 4YG3A 3ZYIB 1RUH1 4ZZ5A 3ZR6A 2D5FA 5BNPB 1MVEA 2A70A 1KJRA 5DDJ1 4RD7A 1L7RA 1HQLA 4P9GA 5F2WA 4FPGA 1EYBA 3QACA 2EXJA 2P3KA 4LORA 1YFWA 1UW8A 4H3WA 1S0FA 4NIIA 3THTA 2VOTA 3P3PA 1OPOA 4KGQA 4EWEA 1NXMA 5BUVA 3H8XA 4OHZA 5JXHA 3LIGA 3FHIB 3ACIA 5JOWA 4XHXA 3M1HA 3VBRA 1GZWA 3TWIA 1FPN1 5JSPA 1CAXB 1UXZA 3HBZA 1UQXA 4R8HA 4HT1T 1POV0 1FX5A 1LNSA 2PAKA 4P9JA 1VBA1 1LOEA 2EXIA 2VBDA 1AZDA 2D98A 2NYYA 3E6DA 3OD0A 4FP2A 2WNUB 4Y1UA 4CP1A 3ILNA 1XB9A 2C4XA 2PTMA 3OCPA 5JI7A 1T6GC 1W9TA 4FVVA 1OOPA 2OW4A 5DXDA 1W90A 1MR5A 4AFBA 4D0QA 3EJKA 4CE8A 1N3PA 3I2OA 1GWKA 3B7MA 2FQPA 4ZONA 2F6BA 1ZNPA 3BB6A 4KG0A 3LDRA 4GWNA 4XFFA 5JMOA 4IV3A 3VKFC 1C5IA 3VBFC 4BXFA 2XXZA 2ZMLA 5FK8A 3VD5A 1RUH3 4PLMA 4FPKA 5IYYA 5DUXA 4QPWA 1N1YA 3AKSA 3TBDA 3T3YA 1OH4A 2RE9A 2HWC2 2XUMA 5LCWL 3AC0A 2DU1A 2VJXA 3ECQA 2NLRA 2WRAA 5CIRA 5C3RA 2B5HA 3AYDA 2AENA 2AC1A 4E4HA 2ZABA 3BALA 3IBMA 3LSDA 3VD9A 1F2NA 1MVQA 2W1UA 4UWDA 3GCWA 5CZKA 4GULA 2E7QA 2JG8B 4JVAA 2CWSA 3B01A 4E9KA 5KC5A 3T30A 4ORFA 3OEBA 4XIKA 4AQTA 2VVFA 5JOYA 1LESA 1J59A 1WW7A 3VB9A 2FZ2A 1PHMA 2YBKA 5LA1A 2WKKA 4S2DA 5SV5A 1UX7A 2VW1A 2R041 3C8XA 4FPJA 3ZXJA 1SLBA 4COYA 3ZYBA 1PX3A 1HB2A 4CEYC 4EZHA 2CV6A 1IS4A 1RXGA 4Z82A 1LHWA 2GSYA 4EWAA 4QX5A 4CCMA 4YW7A 5IJRA 1REEA 4IEZA 1F31A 4E8CA 3BKZA 1AR83 5FKBA 1JYTA 4CUGA 3LQCA 2VTXJ 4NIDA 2X10A 4QX1A 4E2SA 1TNFA 1UY4A 1SPPB 4BOWA 2JX9A 2CL2A 4N7UA 1WLWA 4DIQA 3TNQA 4UFMA 2E31A 1SLAA 2IZWA 3RRDA 3HNBM 1I1EA 2TUNA 4AFDA 2E26A 2PELA 3PUIA 4BQWA 4ONUA 2G4IA 1UXXX 4I0AA 2IXIA 4I3PA 2DTWA 2Z79A 2QVSB 2LM3A 5IVEA 3LOBA 4E2GA 5J09A 1OLQA 4TN7A 1QXPA 1UOGA 4F83A 5CG9A 1OVSA 1VBB3 2ET7A 5DUVA 1JW6A 1H9WA 2X29A 4L2NA 4YGBA 1VBD1 1YFYA 5JDBA 3RPQA 4AI0A 4K9SA 1REFA 1F4HA 1PX4A 3ZYGA 4ASLA 5HPOA 2BGOA 2VMFA 3WDYA 4QU1A 3KT4A 3O5SA 4RHV2 1O4YA 1V6KA 2BYVE 5FZLA 4A7ZA 1T6BX 1IGOA 4XBLA 4AG4A 1CAWA 4JV4A 4DY5A 1ENRA 5JOXA 4TLGA 3HMYA 4XEZA 4XJZA 3A21A 1QIQA 4MX3A 3AL5A 1RUD2 3RI9A 2XJUA 3PMSA 1POQA 1S0JA 3FMGA 3FHQA 4XABA 3Q8AA 5IWFA 3RZHA 4K40A 4M0NA 1W6OA 4NVPA 2W2IA 4YW4A 1PK6B 4CZSA 4Q0PA 1D2QA 4QXCA 2MEV1 2EIGA 4XDOA 3O1UA 1XYPA 2D43A 4SBVA 5AC93 3I2JA 4BQ1A 1UF2C 2VMIA 5L9RA 1OQ1A 4TXWA 1X33A 4S2FA 5F5QA 1AYM3 3I49A 1GZWB 2J22A 4CEYA 4QDQA 2A6ZA 3BOPA 2WZR3 3N9MA 2YFUA 4AYUA 3K51A 2QQMA 1SLLA 4LIUA 1UWWA 5EIYB 2O8QA 5JLVA 1X36A 2FCVA 4Y5SA 1AYM2 1JYCA 2D44A 5EYYA 4ZU4A 2ETEA 3RMYA 3WR0A 4FOWA 1DQ1A 1UPIA 1PO22 3OYWA 4Q4V2 2BEOA 4QQHA 2AEYA 3NV1A 4BLJA 1ZRIA 4QT6A 2QQWA 2JDUA 4AGRA 2J1VA 2ARCA 1WCKA 3KZ4C 5IW0A 4CCCA 2XVGA 1AX0A 4QGNA 4RFRB 1VPHA 1VLNA 3QCWA 1WKYA 4IUGA 5GLTA 1ZVFA 1I5ZA 1LOBA 4TYSA 5BNOB 5FMOL 2Q8OA 4CUAA 1N3OA 4QX3A 3IIIA 3POWA 5DABA 4BQ5A 1W8NA 4QPIB 5KR7A 3P6BA 4QPGC 1DU3D 4MXWB 3ZX7A 4UF0B 1AHSA 5D8AA 4HKWA 1UCXA 2MNGA 1LEMA 2WNEA 3USUB 3OGVA 4TZDA 4XF3A 2EF6A 3TOJA 4X6QB 3WX5A 2ORZA 2QFEA 5IAVA 2FDGA 1PO11 2YYOA 5FZEA 1MS0A 2OUHA 4D7TA 3E6BA 5L9BA 1OBNA 4DOUA 5T5OA 1VE0A 4MADA 4MSVA 2Y26A 1O3SA 2E51A 3O0WA 5KHHA 5BNQA 1S2EA 3ZMOA 5FZCA 2FDJA 5F1RA 5M0TA 1E5SA 3V0BB 1W3XA 5A3PA 1VBA3 1PMJX 4R52A 3I2KA 4YVWB 4YW2A 1MQTB 4FTEA 5F8PA 4FOVA 5FZMA 1H8TC 1OQDA 1CJPA 2BQPA 4AEKA 3I8TA 5HCAA 3O1RA 3AXEA 4B4RA 1JMUB 5CISA 1O3RA 1AYN1 3NNFA 2QQLA 1QJX2 4BK4A 1QJZA 1W2AX 3GBWA 1GZCA 1YQ2A 2WLQA 3MLLA 1F8VA 2DBIA 3TAYA 4MGTA 1B35B 5FYSA 2WNUC 3BCWA 2VW2A 3I3MA 1X50A 2W68A 4TLFA 3MI8A 4UOJA 2GH8A 1IS3A 2W46A 4YLZA 3AVSA 3MPPG 3CHXA 4QQLA 4KWUA 1FOD3 3FBYA 5FPBA 4JKMA 3BIWE 1ODMA 2PHXA 3POIA 2ZGPA 4KNCA 5C9AB 1HV0A 1Y9MA 2VMHA 3OEAA 3ZYRA 4AW7A 1BMV2 3IZOA 3S30A 4J25A 5FPAA 3I59B 4BQ3A 4YARA 3SNMA 3E6CC 4EQVA 1G7YA 3MIEA 1Q56A 5CA6A 2LTNA 5GJ6A 2VMCA 1WMEA 2RVAA 2R043 1M06G 1DG6A 1I5PA 1J58A 3M3OA 4GZ9A 1LCLA 1POV3 1UY1A 2VH9A 3H8UA 4ET7A 3JQWA 1WGPA 2R16A 3BTAA 3JB8A 4Q4W1 2RDSA 3GZAA 2BGCA 4XTPA 3I7DA 3LA2A 1IHMA 3IAQA 3ZYJB 1UZ0A 2PFWA 4FTSA 2W9XA 3GZEA 4JZRA 5DMYA 2G9FA 1LOGA 1QQP2 1O91A 3IN9A 4YZ1A 3POYA 5C33A 1ST8A 3VDCA 4WVVA 1VBB1 2P2KA 3KVBA 4ARXA 4META 1ZA4A 1A3KA 1IS5A 3RZJA 1GR3A 1K42A 1TME1 2W91A 1SCSA 2VY0A 2CDPA 5FYYA 5D2AA 1XYNA 2JG8A 4XQDA 1HRV1 4Y4RA 5J3UA 4KWKA 3D82A 5DAWA 2YC4A 1XYOA 2Y6HA 2I45A 2RS52 2XH6A 2IVJA 1OC1A 4CP0A 4L11A 3DEMA 1XE7A 1PMIA 2B9UA 1CIYA 3J9SA 3ZVXA 4YFZA 4N7IA 5T5JA 4OULA 3DL3A 5C8CA 5I91A 2RS32 3I97A 4IEUA 4UFKA 3AK0A 5F39A 5CYYA 4G9SB 2ZZJA 3ZYPA 1VAKA 5JAXA 4OI1A 1JYIA 1CGPA 2R062 2A3XA 3S57A 5EWSA 3KV9A 1CN1A 5CFDB 4YW3A 4B1LA 4IESA 2P6HA 3CU7A 3RZGA 2QQJA 1X82A 5T3NA 4O9EA 3DYOA 5KHGA 2ZX3A 3NW4A 5FPXA 3H3UA 1GLHA 2O8OA 4XJUA 4K21A 5E16A 3OUJA 5IFTA 1YQ6A 1ZZCA 4QPGA 1FPN2 3C2UA 3WQ7A 3B3QE 1OXCA 5JOZA 3N9OA 4K8FA 3UV9A 4JGZB 4HVQA 2JIJA 3H8RA 1VB2A 3I3EA 1WWYA 3VDDA 2P5BA 4QKBA 3EYPA 2OIIA 3ST7A 3ZDSA 5J7MA 3WF3A 4HN1A 4XC9A 1UYZA 4FP3A 4RR3B 4LBLA 2XLGA 5A6YA 4H14A 4KQ7A 4LO5B 4Y4YA 3FE5A 3NL1A 1AXKA 2DU0A 3DF0A 5FLIA 3AMPA 2B45X 1H1AA 1OHFA 5FYUA 1UMZA 1OURA 3TN93 3PHMA 2DURA 3EO6A 3OUHA 3W21A 3VZLA 1G9BA 3O1OA 3AKQA 3LF7A 1QOOA 3BYWA 1F9KA 2DUOA 2WT2A 3H1MA 1JHJA 1AR62 1PGW2 2AEZA 4Q4X3 1JYVA 4K1YA 1VIWB 2VL4A 4MH0E 2KA3A 3I3DA 3JUUA 3SKVA 1ONAA 2VU9A 5GZDA 1U5YA 1ND3C 2XWBB 3HD8B 4CRQA 1ALYA 3IAPA 4Q4X2 1ZZ6A 1V9U1 3T2QA 1Q8QA 1PGSA 3ACLA 3RZZA 5C3OA 2ENRA 2D7FA 4Y5TA 3JD71 4ITCA 4AQ2A 3BPSA 5KHJA 5T55A 5ANNA 3ZN4A 1RMU1 3S6PA 4A45A 4CYDA 4AEDA 2YBSA 1W6OB 5K7PA 3VDBA 2EIDA 1PK6A 4UFIA 2QJVA 4GKYA 5LBCA 5IAXA 4YW1A 2A6XA 4H2AA 5K0UB 2E9QA 2OVUA 2NN8A 3GBFA 4KH9A 3OGRA 3GZTB 2WN3A 1JHNA 4Q4Y2 2XB6C 3ZN6A 2ZGRA 2PLV2 2W1QA 3SH4A 5ACA2 4YM0A 5GZEA 2GALA 3ZOIA 4W50A 4GAZA 1IS6A 1PIV2 1DYPA 2IFWA 1MEC1 2WAAA 4Q4Y3 4FXKB 4JGZA 4WM8B 5FP7A 1UU6A 1CD3G 3T0AA 5A33A 2WO1A 3HWJA 2W3JA 3WEZA 2VNRA 1QNYA 1EAH1 5DZEA 3T08A 1DQ2A 2ZHMA 5FZOB 3POGA 1GUIA 2J42A 1RUC3 3LPGA 1HN1A 5FZ6A 1G8WA 1NXD1 1W3VA 2IFRA 4YZ4A 1MEC2 4LEJA 3D6EA 1DQ4A 2ZEZA 5FJKA 3Q8FA 3SLIA 1BXHA 2GC1A 2Z5WA 1URXA 2A7AA 5IVYA 3VLBB 2W39A 3JD73 3UKNA 3N9QA 5ACA1 4MYEA 2ZGQA 3BGAA 1RMU3 1BQPA 5AFEA 2ZHKA 4YSFA 5FXVA 1B35A 2Q30A 3ENRA 4M4RA 4OCTA 5E8AA 3RNSA 4AZZA 4BB3A 3W9AA 5FRAA 4D6QA 2J1UA 3LEGA 4N43C 2RR12 1W8UA 1RMU2 2Q5TA 2JDNA 4M3CE 2R49A 3CJIA 3CZJA 5E1RA 4L97A 3AP6A 3DUIA 4MGYE 4XXAA 1Q5OA 2VECA 1CZSA 3ZSLA 2WWSA 1VBC3 2HKXA 2ZHLA 3PVOA 2XLAA 5J36A 1K3IA 3IPVA 4OLLA 4FBFA 2VZ1A 1UD1A 2HWE2 1PO12 1ZZ8A 4Q0QA 4AF9A 4ZHNA 4COUA 1RUF3 2QTWB 4AL9A 2Q1ZB 5DAQA 2VZ3A 4GJZA 3K4AA 2VM9A 1HKDA 1DP0A 2HWE3 2P3IA 5LRRA 3EMRA 4R9DA 1H2NA 3HNYM 4CDQC 2Y8KA 3D0SA 4QM9A 2O0OA 3CJXA 2EA7A 4PQ9A 3VBUC 2ZX0A 3HT1A 3FUQA 3KB5A 4Q5OA 2FHRA 3BU7A 3KF3A 5DDJ2 3NWKA 1NOVA 4IGQA 5GM0A 4URAA 1W0NA 4P5HA 3OPZA 1ZBE2 1CAVB 3O1TA 5DUUA 3IM0A 1QKQA 2VNGA 2DYCA 3A23A 4LXLA 4TWTA 5FUPA 2YGMA 1WUVA 3ORJA 3H7JA 4GMP1 4AI2A 3S5QA 5KHKA 1HRI2 2XR4A 4GB31 3WQ0A 2B42B 1UYXA 2B7YA 2VQAA 2VCCA 3R0RA 3ZKUA 4ZKTB 1R083 1VRH1 3C7EA 3ES4A 2PQSA 2BWAA 2VOVA 2WA3A 1JZ5A 3LGRA 5FP9A 3MBWA 4AGVA 2ARXA 5C4WA 3CBNA 3A0KA 4CCLA 3NNLA 3RFRA 3CNAA 2W52A 1BBT3 3I2GA 3AJYA 3UETA 1GICA 4PF1A 5JZGC 5BYNA 4COVA 1JYWA 1YIFA 3OPWA 1X9TA 2I2SA 1O3QA 1E5IA 1J84A 1NKGA 2GMPA 1W6PA 3WQ1A 1TQ5A 5ANQA 1OOPC 4BK5A 1J1LA 1KS4A 1Z7S1 2A73B 4AFAA 1UZZA 4CEWC 1H8TB 1ULGA 2AREA 1DFQA 3PVBB 1PZ7A 2RMU1 2VMEA 4OQ9A 3H8OA 1U5ZA 2G9ZA 2R6QA 4LE3A 1YI9A 4JRAA 2YB7A 4WZCA 1UAIA 2WQZC 2RHPA 3EQEA 1RGSA 3KV5A 4NPRA 2A71A 1RB8G 1BKZA 2HWB1 4LUKA 5FP8A 5K8SA 1E57A 2IC1A 2R072 2VXRA 2JG8C 2NZ9A 4BXSV 3HJRA 4GH4B 5FR3A 4CCEA 3S5AA 1E5HA 3WCRA 4HK9A 4GH4C 4MZUA 4HZFA 3IDCB 1DF0A 3M3QA 4CDWB 1YC61 1HXS1 1DQ5A 1APNA 4EYUA 3T0BA 2IVIB 1Z78A 4F7ZA 4QHOA 4JDMA 4LBKA 1W99A 3M4FA 4XETA 5FK7A 1AXYA 1ZRRA 2B46X 1SFYA 2X5IC 4QPGB 1F35A 3PU8A 5LA2A 5A3TA 1ENXA 5LEJA 4D7YA 3WD5A 5FBJA 1GNYA 2OA2A 4A6SA 5F2SA 4DUWA 4Y33A 4LKSA 3QBQA 5JZGA 5KXEA 2RMU3 3KWVA 3H1WA 4AWDA 2CU5A 3AKPA 2QQOA 3S7IA 3KV6A 3VBSA 3AYCA 4AI1A 1YQ8A 4GIQA 5FZDA 5EPAA 5JZGB 1NA1C 3ZSKA 2YU2A 1RUG2 5FO7B 3RYRA 1O59A 5BNNC 3BPZA 1O4TA 4XDQA 3A0NA 1S55A 3UGHA 3POEA 5ERLA 1H4HA 4NIAA 3U0ZA 1V9U3 5CFDA 4MGQA 1OUSA 3CZUA 3KQ4B 2VUDA 4CCKA 2UYBA 4KI5M 3ILRA 2GNBA 4RS5C 3NV3A 2GMEA 2RM21 4I0WB 4WVZA 5DG2A 4KG8A 4LBNA 1V6MA 1DIWA 2VOWA 4OZXA 3VBRC 4GH4A 4UBHA 5I8SA 1U5XA 4DRVA 5C5UA 1SLTA 3B93A 1IG0A 5EXOA 4XCAA 4LK7A 1ASJ1 2CY6A 4XVHA 3GBGA 3BIEA 2QQNA 3WDWA 4OHYA 2ARAA 2DCJA 3AMMA 3RG0A 1H4GA 5FZBA 4BISA 1V70A 4BZ4A 5FYVA 5CKMA 1C1LA 4CEWA 3PLQA 4UFLA 1J3QA 2BU9A 2JDKA 1SHWB 4Z2AA 2ADDA 5BXXA 4A7KA 1GP5A 2B4KA 2R30A 1VBC1 1UY3A 2WSVA 3GF6A 2HWB2 3LFIA 3U10A 3JQXA 1JXNA 4H55A 5C8WA 4PHZA 3LE0A 3LCPA 1AR81 1CPMA 3T09A 2FCUA 4FFFA 3ZXKA 1Y9GA 2RG4A 2VNVA 3QD6A 3GXUA 4IEPA 4DUVA 4XBNA 2Q8CA 1W8FA 3WW1A 1D2SA 3RJRA 2VGDA 4GWJA 5FTTC 2DVGA 5IVFA 3J8F3 5FZOA 3SXWA 1U12A 2EICA 1NCQB 3VL9A 4A44A 2WO7A 1OF3A 4JKLA 2Y60A 4MOAA 4WM7C 3CF6E 2XWJB 4TTGA 1GP6A 1YJKA 4C1WA 3J8F2 5FY8A 3S0MA 4Q0SA 2CGNA 2E33A 2EAAA 2RJLA 3I3QA 4LBOA 4OFGA 2Q8DA 5T5LA 5A32A 4QKNA 4PJYA 4NHYA 3C3VA 4UFHA 2DFCA 5D21A 2BDRA 1XU1A 3K77A 4YVSB 5LY2A 4AQ6A 5A1LA 4P02B 3RZKA 5KHIA 4AI8A 1QJU3 4DB5A 4GA9A 2XJTA 1NX9A 5CU1A 3T2OA 4PI2A 3H0OA 3GYDA 3K48A 1D4M1 4CDWC 3LA3A 2VTFA 3VZJA 4A3XA 2WFPA 5BNPA 2XPJA 1GQGA 2XOMA 3C7FA 4QQPA 3AYEA 3AYAA 5E6HA 3MW4A 1FXZA 1XNDA 3ZPOA 1DYOA 4K20A 4UXAA 1FOD2 1KDKA 2ILMA 2YHJA 4YWAA 5I0UA 2XKPA 2BERA 4ZU5A 5FOJB 2MEV3 1R1ZA 1OD3A 3LPFA 3DYMA 4ZXKA 4JDOA 1GZTA 3VBFB 1NLQA 1A8MA 1WCSA 4E27A 2G9GA 4XUQA 2MEV2 4PCRA 1BEV2 1MZEA 1H6YA 2H6CA 3N3HA 5C3PA 4PF5A 5CFCA 1H9PA 2Y6GA 1OOPB 1V00A 1Z7S3 2ET1A 3POSA 1BVVA 1RUI1 2YGLA 5FYCA 1CESA 2VQUA 2RR11 1DHKB 3ITQA 2ZCWA 4QAWA 3SH5A 4B4QA 4GXLA 1BEV3 4DEVA 1XC6A 1AL22 2D3PA 4WBBA 2GNTA 2CGOA 3NNJA 1ODNA 4NHMA 1H1MA 1XE8A 4XPVA 3NAPA 3H42B 1QHDA 4QB2A 3POJA 2JG9C 3UT0A 3KQRA 3QLQA 4CDWA 2BFUS 2CTVA 5GZCA 1YQ5A 1TVGA 2XHNA 3U37A 3U1XA 4EWDA 4AVSA 2EIEA 1VBD2 1LB2A 3F95A 3VD4A 5H9SA 3J7HA 1LULA 1ZZ9A 2QCSB 2JEMA 4A4AA 1WZXA 1N3QA 4Y1YA 3WXPA 3ZYHA 5FJHA 1HDKA 4JGYB 1XNTA 3ALQA 4JTNA 1HRI1 4W8JA 3WW2A 3SEPA 5C71A 3THCA 3OUIA 5KBFA 1DGRN 4CDQB 1QH7A 1TMF1 3A22A 3CJIC 4PI0A 1LEDA 2BW8A 1LRHA 3O0VA 4F8AA 1W6PB 2VULA 2WQ4A 3GHNA 4IW3A 5HXMA 1RUNA 3LOIA 4RFT0 1SZBA 3RVHA 4L8QA 5ISLA 3ZSEA 3NJYA 3R4SA 4HANA 4XMAA 3AM2A 4XFIA 1ZRCA 4HMZA 1X9PA 3M7AA 4GD4A 1W9FA 4BHPA 1H0BA 1F5JA 1AVBA 2ZMNA 3HNMA 1P8JA 4NR1A 4FCAA 4Q26A 5L73A 3IB3A 1WCQA 2RDNA
chains in the Genus database with same CATH topology
1YC61 4OQ9A 3J7NA 4OQ8A 1CWPA 1STMA 1JS9A 3J7MA 4NIAA 3J7LA 1ZA7A 1A34A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YC6 1;  4OQ9 A;  3J7N A;  4OQ8 A;  1CWP A;  1STM A;  1JS9 A;  3J7M A;  4NIA A;  3J7L A;  1ZA7 A;  1A34 A; 
#chains in the Genus database with same CATH topology
 1H30 A;  4D94 A;  5IAT A;  3NMB A;  4DEQ A;  4KGG A;  2F4L A;  3AL6 A;  4M00 A;  5KXD A;  2XJS A;  3B69 A;  4YW5 A;  1AUY A;  5B4N A;  2ZEX A;  1PIV 3;  3H1Y A;  5D8A C;  1LHU A;  5ABJ C;  1JOJ A;  4YRD A;  1W8O A;  2OZ6 A;  2HWD 3;  2Z42 A;  1W8T A;  5FLH A;  3WZ1 A;  1UMI A;  1CPN A;  2VR4 A;  2DF7 A;  3CMG A;  3T4H B;  1W2N A;  2VTX A;  2YUE A;  2JDA A;  2WS9 1;  4QX0 A;  3MPB A;  3UES A;  1H6X A;  3MID A;  5FZA A;  4HSL A;  1OI6 A;  5LK7 B;  2HWD 2;  4NHX A;  3D4K A;  3M3C A;  5CAD A;  1RUC 2;  1RUJ 1;  4U2A A;  1DGL A;  3UNP A;  3B5L B;  1CX4 A;  3NKG A;  3MF9 A;  1PGL 2;  1UL9 A;  2HBU A;  1JH5 A;  2QZ3 A;  5GZF A;  5LEK A;  3SMH A;  2CDO A;  4LT5 A;  1XSR A;  3EHK A;  3RJ2 X;  3GJA A;  4XUT A;  1GOF A;  2D3R A;  3ACG A;  4JC1 A;  1PVX A;  2VZR A;  3N7K A;  2R07 1;  3FJS A;  3IKW A;  5A3W A;  4WM8 C;  3W59 A;  4LBQ A;  5F3I A;  1W6Q A;  3P1I A;  1GV9 A;  3BI3 A;  3UGG A;  1RTV A;  1CZV A;  3X29 B;  3TN9 2;  1SG3 A;  3D5O A;  3LEK A;  2WDB A;  2Y0I A;  2GU9 A;  2QQV A;  2ZAH A;  1QY4 A;  5FMD A;  2XUE A;  1DZT A;  3DYP A;  2YBP A;  1GBG A;  3JZV A;  3OY8 A;  2GH2 A;  3B02 A;  3B00 A;  3WIN E;  4BQX A;  1PIV 1;  4ZS3 A;  5GLU A;  1VBC 2;  2XL9 A;  3AZY A;  1AF9 A;  3E1F 1;  1YRZ A;  3JU9 A;  3Q8C A;  4NPM A;  4CXX A;  5A7O A;  4Q4Y 1;  4PIZ A;  2JG9 B;  1OA3 A;  1GQH A;  3R05 A;  5CBL A;  1JU4 A;  2FMD A;  1RUF 2;  1AL2 1;  2Z4F A;  3OGG A;  5T50 A;  1I6X A;  1VMF A;  2GP5 A;  2DFB A;  3LAG A;  4I02 A;  5A7W B;  3VKL A;  5HXV A;  1TG7 A;  1B35 C;  1R09 1;  1WW5 A;  2YFZ A;  4RGK A;  4K3U A;  4P9W A;  4M3C B;  3V65 A;  5A32 B;  1RVF 2;  3VZN A;  1W2U A;  4AXO A;  1NQJ A;  3GNE A;  4FI9 A;  1RUH 2;  1HRV 2;  3FBM A;  2Q0A A;  4DQA A;  1VRH 2;  1UX6 A;  4XYX A;  1TME 3;  4UW6 A;  3FL7 A;  1V6I A;  4IND A;  1X7N A;  5ACA 3;  5CEH A;  1Y7B A;  5LA0 A;  1LU2 A;  1MQT C;  3KF5 A;  2P3Y A;  1HRV 3;  5FKC A;  1VB4 A;  4WM8 A;  3OBA A;  1GQP A;  4O65 A;  3V64 A;  3Q9O A;  1TME 2;  4ATE A;  1UY2 A;  3WNX A;  3AZX A;  4RA0 A;  2XJV A;  1W6M B;  1MS4 A;  2QQI A;  1JZ7 A;  3NV2 A;  2VAU A;  1OA4 A;  3RSJ A;  2PMW B;  4FO9 A;  4URT A;  1VAL A;  1SFN A;  2FZ1 A;  4W6Y A;  4C8D A;  1RJ7 A;  2X09 A;  2Y64 A;  4LPL A;  1WA6 X;  4RR3 A;  2XGX A;  5KC6 A;  1UY0 A;  2J1S A;  1O8P A;  4BA6 A;  2C9K A;  1RUF 1;  2ZGL A;  1UIK A;  2HEV F;  2EXH A;  3E5Q A;  4HFS A;  4HET A;  3H3L A;  1US3 A;  4AED C;  5LY1 A;  2N7G A;  3MV0 1;  1YQC A;  2VE1 A;  4QPI C;  3NJX A;  2LUW A;  2DCZ A;  1JZ3 A;  5A33 B;  2RR1 3;  3U4S A;  4LTA A;  3H50 A;  2GN7 A;  1UIJ A;  1DGW X;  4FFI A;  2JXA A;  1ULD A;  4ARY A;  1WMX A;  4WM7 B;  4OUS A;  1QNW A;  2ZXQ A;  5A7P A;  3WT3 A;  3WP6 A;  1UO9 A;  2P17 A;  2WNU A;  3J26 N;  3VKM A;  1LR5 A;  4QPY A;  4NJ4 A;  4AQS A;  1F5F A;  1T2X A;  3HVD A;  3Q8E A;  4S2H A;  2R06 1;  4AHY A;  1XPW A;  2DVD A;  1WLD A;  3AVR A;  3PUQ A;  4X6R B;  5FY4 A;  1STM A;  2ZX4 A;  3R4U A;  1G86 A;  1C4R A;  2MHF A;  2Y6F A;  4M01 A;  5FY9 A;  2A6Y A;  2BGP A;  1HJF A;  1UKR A;  3L9J T;  4BIF A;  1WA4 A;  5KWR A;  2QDR A;  5FBZ A;  3TN9 1;  3WUD A;  3I2H A;  4QHZ A;  3HR9 A;  4C90 A;  2AH2 A;  5DDJ 3;  3TRS B;  4EJR A;  2RS5 1;  1C1F A;  3WDX A;  4IET A;  1QJX 1;  1G9A A;  5LWB A;  1NZC A;  2HWF 1;  2YRO A;  5LW9 A;  2WZR 1;  1QU0 A;  3KM5 A;  1O6U A;  2KD7 A;  1HLC A;  1UU5 A;  2WQ8 A;  2X8K A;  3N7L A;  5FV3 A;  3ZXL A;  3V56 A;  4LO4 B;  4XOG A;  1CIW A;  1EUU A;  1QDC A;  2ZKN A;  3BTX A;  5H9P A;  1X8M A;  4I30 A;  4XF9 A;  1GWL A;  3F2Z A;  3KSC A;  3O0X A;  5IVB A;  2W92 A;  3VZO A;  1UPS A;  2YV8 A;  4K1Z A;  2D93 A;  3NQH A;  3D0J A;  3NST A;  1PNG A;  1QF3 A;  4PBP A;  2CYF A;  1BBT 2;  5LZ6 A;  1RUG 3;  2JDY A;  1IG3 A;  1MZ6 A;  2AZ5 A;  5FZ1 A;  1IPS A;  1RUD 3;  2JKB A;  3NKT A;  4NAM A;  2JWP A;  2VZO A;  1PZ8 A;  1TMF 3;  2BVV A;  3KT1 A;  1YWK A;  3IDA A;  4QDR A;  4RGG A;  4CDX B;  1V9U 2;  3OBT A;  4AHZ A;  1DBN A;  4LBQ D;  3ES1 A;  5LA9 A;  1Q8V A;  2WNV A;  1W06 A;  2NP0 A;  3VHO A;  3WG4 A;  3ZFF B;  1TMF 2;  1J3R A;  4HK8 A;  4XJ8 A;  3CIH A;  2RJ2 A;  4XTM A;  4EN9 B;  1AX2 A;  2YPD A;  4CDU C;  4D8M A;  4OI0 A;  2G1M A;  1FT9 A;  2W87 A;  4HLT A;  2XLF A;  4E4Z A;  3AX4 A;  3RZM A;  1RUJ 3;  1K5M A;  2W1W A;  4RQP A;  4ES9 A;  3HQX A;  5JSR A;  3VKO A;  1LTE A;  1VAV A;  3WOG A;  1LGC A;  3W5N A;  1TNR A;  4MXV A;  3PIG A;  4AVV A;  4K8R B;  4W6X A;  3UYJ A;  2R07 3;  3SEE A;  1NA1 B;  3AMN A;  1SLI A;  5FWJ A;  5KXC A;  2SLI A;  3HPN A;  2V4A A;  1U5I A;  5FY0 A;  5I0S A;  5JXJ A;  1RXF A;  4HPK B;  4RS5 A;  1ND3 A;  1LHO A;  4LO7 A;  5F9T A;  2ZMK A;  4XF4 A;  1DYK A;  5F5I A;  2V72 A;  3TEX A;  2ZPX A;  3K46 A;  1K5J A;  1IOA A;  1EAH 2;  2IXH A;  3WNO A;  2OYZ A;  3I2I A;  5L19 A;  3M3E A;  2FCT A;  1YIP A;  2Y6K A;  5F3G A;  1D0H A;  4A41 A;  1LOD A;  3ZFG C;  1MAC A;  3WY6 A;  3PJQ A;  4A6O A;  4YVW C;  3KHC A;  2WZ8 A;  3DCQ A;  1Y3T A;  1I9R A;  1ZA7 A;  4R4X A;  2RMU 2;  3G7D A;  4FFG A;  2BZD A;  4XFA A;  5DAP A;  3FHA A;  2WA4 A;  1VJ2 A;  1FOD 1;  4P5Y A;  4B29 A;  1COV 3;  1EV1 3;  4IV3 B;  5A6Q A;  3V0B A;  3HQR A;  3AMQ A;  4MHR A;  1JZ2 A;  3DXT A;  2NPI A;  3N9N A;  4QXH A;  2R32 A;  1R64 A;  1COV 2;  2ZGK A;  3BTY A;  1OH3 A;  1MS3 A;  1IQD C;  3KV4 A;  3A7Q A;  2PA7 A;  4AVC A;  3L2H A;  5F5A A;  3THD A;  1DQ0 A;  5GLZ A;  2IWG B;  4GMP 3;  4EZ4 A;  3NNG A;  2VMD A;  1XJA A;  4O9G A;  4E4S A;  2CNA A;  2JD4 A;  1EY2 A;  5FYB A;  2ZAC A;  3KGL A;  2XJR A;  1WCU A;  3UKV A;  3N7J A;  4QQ2 A;  2D6O X;  5LB6 A;  4ZS2 A;  4ISQ A;  1OFN A;  4CXW A;  5FYH A;  3LEI A;  1PGL 1;  2D40 A;  1RYY A;  2GC3 A;  4JCK A;  4X8P A;  4BQY A;  2EAK A;  3ZFE A;  1JOB A;  1FV3 A;  1TEI A;  3ZIW A;  4CUB A;  1ZBE 1;  3DKW A;  3IT8 A;  4IE4 A;  1RHI 1;  3WDU A;  3ZFE C;  5A6Z A;  1XQN A;  2JEC A;  3URF A;  1YO8 A;  2OKX A;  1ZBA 3;  4LJH A;  1GNH A;  4Z8B A;  1AJO A;  1EV1 1;  4DMI A;  4AVB A;  1BK1 A;  3PL0 A;  1BLZ A;  3EB7 A;  4XIO A;  5FMB A;  2ERF A;  5FP3 A;  4HSJ A;  5IK5 A;  4DY3 A;  4CU6 A;  4XJ9 A;  5EZW A;  4IDZ A;  4Q1P A;  4AFM A;  4JKK A;  2ZGO A;  4RYD A;  4XF0 A;  1JN2 P;  4CDU B;  1ULC A;  1MS9 A;  2XBO 3;  1Q8O A;  2GNM A;  1C57 A;  2BV4 A;  2HWB 3;  1JYN A;  2QNK A;  1YUD A;  4N8M A;  5CKN A;  3S7E A;  3WDV A;  4J6G A;  2R04 2;  1N1T A;  1AR6 1;  3ETQ A;  4Y22 B;  4YG6 A;  1W9S A;  5AFB A;  5A1A A;  3HQU A;  1KRI A;  4P08 A;  4QKF A;  3MW3 A;  4UFJ A;  2RS1 1;  4HKL A;  4FAG A;  2VZV A;  3OJB A;  2E7T A;  2Z2S B;  4PT6 A;  4UW3 A;  4XIL A;  4OUE A;  3WW3 A;  3VBH A;  1HXS 2;  1XU2 A;  2DV9 A;  1BK0 A;  1AX1 A;  4D6S A;  3DXU A;  2W95 A;  3N35 A;  4MHU A;  4YVW A;  2PHR A;  3USU A;  3M3I A;  4CCN A;  5J37 A;  4QB1 A;  2UWB A;  3IDB B;  2C6S A;  1IKQ A;  2HWF 2;  4Y20 B;  3W5M A;  3WNM A;  5C7G A;  3LB9 A;  3ELN A;  2ID4 A;  3FLP A;  2WZP P;  3O1V A;  1V6J A;  4N43 B;  2OQ6 A;  2XON A;  2D5H A;  4NRM A;  5FQ0 A;  1PVC 1;  3NVC A;  1HN0 A;  4RS5 B;  2P6C A;  5F7U A;  2ZX2 A;  3ZXE A;  4Q8K A;  2RS5 3;  3WG3 A;  5CVR A;  3HEI A;  3MV1 1;  2UY8 A;  5BNO A;  4Y1X A;  4GJY A;  4M0H A;  1S2B A;  2QQK A;  2VC9 A;  2VBP A;  2WYF A;  4K6B A;  1CQ9 A;  1HB1 A;  3WV6 A;  5JR7 B;  1RUI 3;  4RGA A;  1GKB A;  1K5M C;  4RQP C;  1JYX A;  1RIN A;  2P37 A;  2RS1 3;  1SEF A;  3AP4 A;  4HXC A;  2A1X A;  4XW3 A;  4BPZ A;  2DDU A;  1YHF A;  3LEM A;  3ILF A;  4MXW A;  2YZ4 A;  1G9F A;  3BOW A;  5FXZ A;  2W5F A;  3ZLI A;  3ZXA C;  2JE8 A;  2NM1 A;  4H7M A;  2JDZ A;  5C6C A;  5JPN B;  2WUH A;  1NAE A;  4CEY B;  3DV8 A;  5IK4 A;  1H2M A;  2CHH A;  2ZJC A;  4WM7 A;  3VDD C;  4ASK A;  1BYH A;  5F32 A;  5GLV A;  2ZHN A;  3T2T A;  1L7L A;  2WAO A;  5F6L B;  3ETP A;  1EPZ A;  4W6W A;  3RWK X;  1FPN 3;  3IIA A;  1W9W A;  4LKE A;  4E4D X;  1CAW B;  1IKP A;  1HQN A;  4XE9 A;  4XFB A;  3WVJ A;  5DZG A;  1XNB A;  1BZW A;  4I01 A;  4BYY A;  3EXU A;  5JSO A;  1Q43 A;  2CAV A;  1DLC A;  2R1D A;  4Q4X 1;  2GZW A;  2ZA9 A;  2D6L X;  3CL1 A;  5DZF A;  1LEN A;  3VBU A;  1RVF 1;  4IV3 C;  2WII B;  5HV0 A;  1UU4 A;  2LW8 A;  4FFH A;  3BTZ A;  3K3N A;  1PGW 1;  2Q1M A;  3R4D B;  1FMD 1;  2WT0 A;  2C26 A;  3WNK A;  1NE6 A;  3QH7 A;  1O7F A;  2D6M A;  3HAG A;  5EQU A;  5FYZ A;  2VNO A;  1GP4 A;  4R9A A;  4NIG A;  4CCD A;  4IV1 C;  4YVS A;  1JI6 A;  5DQ0 A;  1PNF A;  5FZ3 A;  3CQO A;  4CPB A;  3ZFG B;  2BOJ A;  1DDL A;  1RIT A;  3LKJ A;  4CSW A;  4LIV A;  4YYO A;  2DBN A;  2BBA A;  3WCS A;  2HBT A;  1W6N A;  5IHR A;  2IXL A;  2QUO A;  3SCF A;  3H9A A;  3AKT A;  5T54 A;  3RYK A;  5SV8 A;  4AI9 A;  2QKD A;  2PHT A;  4HL0 A;  5BPX A;  4IEY A;  1NCQ A;  1QOS A;  1QJE A;  4EN6 B;  3PNA A;  3WHU A;  3MFC A;  4I09 A;  2BNO A;  2XKO A;  1CZT A;  5GLW A;  2GDF A;  3J7M A;  5A80 A;  3DKQ A;  2B9V A;  2AGS A;  2YMZ A;  1AR8 2;  3FWE A;  4RHV 1;  4AVA A;  5CFC B;  4GMP 0;  3U11 A;  3MF6 A;  3GGL A;  3VDA A;  1RVF 3;  1WBL A;  2BVB A;  2JDH A;  2K0G A;  4FSJ A;  3OSD A;  4V2V A;  4C0B A;  1RUC 1;  5JUV A;  2WN2 A;  3GZU C;  4HVR A;  4CU8 A;  4YGD A;  4LUL A;  2IUW A;  2ZTN A;  3KS7 A;  1FMD 3;  2XVK A;  4K7J A;  1GMM A;  4LR4 A;  3FLT A;  5CFD C;  1JS9 A;  4FOY A;  4MGK E;  1FYU A;  4BDV B;  4IXL A;  4I2O A;  3MLJ A;  1ULO A;  2C24 A;  2VZQ A;  5HCF A;  1RHI 3;  1ZRF A;  1FMD 2;  4QXK A;  4LA2 A;  3WP4 A;  4KU7 A;  4CXY A;  2DTY A;  2WR9 A;  4QB6 A;  5BNN A;  1H1I A;  4RL7 A;  3KCY A;  1R1A 3;  1UYP A;  3UGF A;  3FFZ A;  4QX8 A;  1RHI 2;  2VOK A;  3GJB A;  1ZZB A;  3HIF A;  4PLO A;  1N1V A;  1OQE A;  3FZ3 A;  2J1E A;  2BUK A;  1PO2 1;  2OPK A;  4HG6 B;  5FPL A;  5FZ4 A;  4CP9 B;  2KXL A;  4AE2 A;  1O3T A;  3JD7 2;  1CX1 A;  2BFU L;  4ES8 A;  4GB3 2;  4LBM A;  1CON A;  5FZ8 A;  1UMH A;  4NHK A;  3WNN A;  2FD8 A;  2XBO 1;  4AEJ A;  3VGI A;  2GMM A;  4RHV 3;  1OLM E;  3SHR A;  2ZOE B;  3CEW A;  5FMC A;  4GB3 3;  1XE0 A;  3JCI A;  4Y1V A;  2W1S A;  4Z92 B;  2YPJ A;  2JKX A;  3GHM A;  2HWE 1;  4IE7 A;  4TSV A;  3VV1 A;  5K9Y A;  5D8A B;  2WAB A;  1DQ6 A;  4UW4 A;  5JPM B;  4Y3O A;  1W0P A;  3SH3 A;  3SCH A;  4CDQ A;  2RDR A;  4BWO A;  3C7O A;  4E2Q A;  5A3U A;  3PDQ A;  2BTV C;  1YNA A;  4AVT A;  5HCH A;  1W2T A;  2J1T A;  3H7Y A;  1IQA A;  1OSG A;  3PTR B;  1HIX A;  5AC9 2;  3TB0 A;  4OQ8 A;  5A6X A;  1LGB A;  2H0B A;  1W05 A;  1M4W A;  1Y4W A;  4MG2 A;  3MIB A;  1ND2 A;  2BJS A;  1KXG A;  1JTZ X;  2E6V A;  4JQR A;  4MLO A;  1OUX A;  1XNA A;  2SBA A;  3GCX A;  5TSW A;  1UZY A;  2C1F A;  1POV 1;  3OOX A;  2WZR 2;  2EXK A;  4YM2 A;  1SBF A;  2BRT A;  2E63 A;  2WNV C;  3J7L A;  3N7M A;  5FXX A;  2NQY A;  3ASI A;  3JBG 2;  1AR9 2;  1LHV A;  5C3S A;  2VOX A;  1UOJ A;  1V0A A;  4AHX A;  4A2U A;  3WDT A;  1HRI 3;  4QMA A;  5L7O B;  3UKT A;  1MS8 A;  3O14 A;  2Y34 A;  3HT2 A;  5FQ0 B;  2I07 B;  5JMC A;  3SCG A;  5K0U C;  4FTB A;  3E97 A;  4AED B;  4CA9 A;  3AZW A;  3PUA A;  3HN3 A;  3MFA A;  3MIH A;  3OGS A;  2K2S A;  4OMD A;  1GZ9 A;  2EAL A;  1KJL A;  1JBC A;  4IL7 A;  4J1W A;  5FRE A;  3ZSJ A;  3J4U H;  2F17 A;  5J1X A;  1NCR C;  2OUJ A;  4NWV A;  1CAX A;  4PQQ A;  3DGT A;  1BHG A;  3MO4 A;  2RJK A;  4M3C F;  4NRO A;  4XDP A;  5JIA A;  4ZZ8 A;  5AC9 1;  1A8D A;  1UOB A;  1D0G A;  1W8H A;  3SC7 X;  3NJV A;  4OI2 A;  4UBG A;  2JB8 A;  1GWM A;  4MGS A;  4HVO A;  1LOF C;  5FCC A;  2BPA 2;  4EV0 A;  4N9H A;  2WJS A;  5K0U A;  4NO4 A;  3AZZ A;  4NN0 A;  4BLI A;  2WYS A;  3AJZ A;  2VQT A;  4MGZ E;  3ACF A;  3UK9 A;  1WD3 A;  4XQW A;  4DS0 A;  2GAU A;  2OX0 A;  3CO2 A;  4JX0 A;  1W0O A;  4LIT A;  4V2W A;  5T5P A;  2X05 A;  1XBF A;  3WF1 A;  3NRU A;  2FDH A;  4IV1 B;  2ZGS A;  1F15 A;  4AAP A;  3K4Z A;  2XDV A;  1DGW A;  1XXN A;  2XG3 A;  4QGL A;  5H9Q A;  3LZZ A;  1RJ8 A;  1F4A A;  1N1S A;  1VR3 A;  4YNI A;  4XFC A;  2HYK A;  5BY5 A;  4L99 A;  3PTY A;  5J96 B;  1C8N A;  1CAU A;  1QXJ A;  1U0A A;  3FC0 A;  4QM8 A;  2QQP A;  5F6K A;  4D69 A;  5LBB A;  4R9C A;  5FP4 A;  5JR2 A;  4WZF A;  5C70 A;  1MZF A;  1MPX A;  1LU1 A;  1V6L A;  2ORX A;  2PHW A;  3WF0 A;  4YFW A;  1JZ8 A;  1YI7 A;  3VUO A;  1SBE A;  2RV9 A;  5A7Q A;  5IUQ A;  4N43 A;  4UYB A;  1QH6 A;  2PHL A;  3AZV A;  4XAE A;  5FWE A;  2E7A A;  2AYH A;  4UAP A;  4D3W A;  2WFF 3;  2JE7 A;  2FDK A;  1W6M A;  1IZ3 A;  3C7H A;  1UN1 A;  1QOT A;  4B1M A;  5JI9 A;  2WLP A;  5DG1 A;  4A7Y A;  3VBO A;  2RDQ A;  2W08 A;  1V6N A;  3VDD B;  1JZ6 A;  4FPL A;  2W94 A;  5I0D A;  2WFF 2;  3ON7 A;  4PDW A;  4GAL A;  1JU3 A;  1OFS A;  3QH6 A;  2LS6 A;  2O14 A;  1S0I A;  1C28 A;  4KBB A;  2Z69 A;  2A6W A;  1ULF A;  5GAL A;  3MYX A;  1OF4 A;  1UKG A;  5FYM A;  4DNY A;  1ZRD A;  1LGN A;  3MW2 A;  1NG0 A;  1FAT A;  4O7X A;  4BM8 A;  4NOT A;  3OGJ A;  5B2G B;  2XQR A;  4HBN A;  3O1S A;  1OA2 A;  3WF2 A;  3VBO C;  2P1B A;  1S0B A;  2JE9 A;  1OKO A;  3RS6 A;  2UUR A;  3IPV B;  3KMH A;  1CAV A;  2Y33 A;  5FMO S;  1LOA A;  1QJF A;  4AK3 A;  2A5Z A;  3Q8B A;  4Y1Z A;  2HYX A;  3WUC A;  3RI8 A;  1PK6 C;  5LK5 A;  1R1A 1;  2R7E B;  2ZZQ A;  5H9R A;  4NHL A;  5T52 A;  4OHV A;  1CWP A;  2VPV A;  3D8C A;  1DZQ A;  4CP9 A;  4GWI A;  1NZI A;  4WVM B;  1RUJ 2;  2VCA A;  3HOB A;  4DZG A;  1O4Z A;  1XSQ A;  5F3C A;  4Q4W 3;  4DO0 A;  2D97 A;  2ES3 A;  1S0E A;  2VQ0 A;  4LBQ B;  2JJ6 A;  1W6Q B;  4QHB A;  3ZXG A;  4BH9 A;  4XJW A;  5CAZ A;  3MIF A;  1J83 A;  2WS9 2;  3NV4 A;  3I2D A;  4G4F A;  1FAY A;  1ZBA 2;  4H7L A;  1OD5 A;  1PM4 A;  4HPK A;  4Q4W 2;  5CNA A;  2NMO A;  4XF1 A;  3CJI B;  1LJ7 A;  3AP7 A;  3P5B A;  4C91 A;  5FZF A;  3ZXD A;  1QEX A;  1WD4 A;  2C9A A;  4AGG A;  1XNC A;  3AFK A;  3ABZ A;  3VBR B;  1FNY A;  2CAU A;  1WW6 A;  3U07 A;  3VBH B;  1S4C A;  2J1A A;  4GWM A;  4JGY C;  5FZ0 A;  3J8F 1;  3KD4 A;  2ZGM A;  1LEC A;  1WLC A;  1K12 A;  3APB A;  3ZM8 A;  3ZYF A;  5HI0 A;  2ADE A;  3UJQ A;  5D1I A;  4Z2W A;  1GSL A;  2A3W A;  2QDN A;  4HKO A;  2R06 3;  2JD9 A;  2Y6L A;  1JUH A;  1SAC A;  2P34 A;  4CTE A;  2WL1 A;  1PMH X;  4QKD A;  2PXJ A;  1QGL A;  1VMJ A;  5FZG A;  3T1L A;  4P9L A;  4QD2 A;  5CFC C;  4YGC A;  3L2Y A;  5FO8 B;  2YY1 A;  3MUY 1;  5BNN B;  2VXJ A;  3LWC A;  4HON A;  1G9D A;  4FOQ A;  3LFM A;  1HXS 3;  1GOG A;  4ATF A;  4KBZ A;  2CGP A;  4AOC A;  3MZH A;  2XJQ A;  5LAT A;  4UI9 L;  4F3J A;  3RDI A;  3NO8 A;  5J48 A;  1HB3 A;  1O5L A;  4V1P A;  5FDB A;  3I2F A;  1O8S A;  1ZBA 1;  1DZR A;  3VBS B;  2HWF 3;  5IVC A;  1CAU B;  5FYI A;  4B7K A;  1UOF A;  2KR2 A;  2PN5 A;  4Q27 A;  2VO5 A;  4BCU A;  2ZGU A;  5FPU A;  5IK7 A;  1MQT A;  1YJL A;  2ARB A;  3FFQ A;  1OKQ A;  3ME2 A;  3DPR C;  1BVP 1;  3JBG 1;  5G04 L;  2OZJ A;  2A3Y A;  1GNZ A;  1QJU 2;  2PHD A;  3KCC A;  4N9I A;  4B7E A;  2X5I B;  4QPI A;  2Y6J A;  4PIY A;  3TEW A;  2J7M A;  2CSG A;  3FLR A;  2ZS6 B;  3THP A;  3W20 A;  4D7S A;  1AR6 3;  1US2 A;  2VG9 A;  3B94 A;  3B9C A;  5FY7 A;  4CDX A;  3UL2 A;  4JDN A;  4PIX A;  4NPL A;  4OHW A;  3ZR5 A;  2RS1 2;  2WSU A;  1HJG A;  4FAH A;  3KHB A;  2GN3 A;  1ZYB A;  2JIG A;  4FPY A;  4LNV A;  3ZPY A;  1VBE 3;  1CJD A;  3V0A A;  4IGP A;  2IXC A;  3DPR A;  3K2O A;  4EN7 B;  4IV1 A;  4YVS C;  2NMN A;  5AVA A;  4LLF A;  2WT1 A;  1ZX5 A;  2YDE A;  1VBE 2;  3PIJ A;  1QJY 1;  3G6J B;  1YCI A;  3OYW B;  4QGM A;  4XCB A;  1Z7S 2;  2XBO 2;  3DPR B;  3WHT A;  4LA3 A;  1S0G A;  4R9B A;  3N36 A;  5HCB A;  3VZM A;  1GAN A;  4OVE A;  5IK8 A;  4KL1 A;  2WO2 A;  2YG0 A;  4N53 C;  3ZXF A;  4AHW A;  3T0D A;  2PLV 3;  2PHF A;  1NA1 A;  1RUE 2;  4JQT A;  5K4L A;  3MLK A;  1CR7 A;  1G9C A;  4X8N A;  1J3P A;  5DUW A;  2D3S A;  1PZ9 A;  3PJY A;  4Q4V 1;  4W65 A;  1S0C A;  4UF0 A;  2FDI A;  4LUM A;  1DGR A;  2AUY A;  1K5M B;  4RQP B;  4OI4 A;  4XUO A;  1KIT A;  3WNL A;  1AYM 1;  3ZO0 B;  2Y0O A;  4XQ4 A;  5FO9 B;  2VZU A;  2WWJ A;  1Q3E A;  4XAC A;  4JGY A;  5JWP A;  2DVF A;  1AXZ A;  1VBE 1;  4PBO A;  1MEC 3;  5LBF A;  3OD4 A;  4G3Y C;  4YZ2 A;  1JZ4 A;  3RZL A;  3T1M A;  2PQQ A;  3GAL A;  4D6R A;  1SFP A;  4NMI A;  5FFO C;  5FLJ A;  5IFP A;  1YFU A;  4GKX A;  1W8W A;  4AEM A;  5BNP C;  1QJY 3;  1XNK A;  3I59 A;  4HN0 A;  2OXB A;  4WVM A;  2DWR A;  1COV 1;  1SCR A;  2VBB A;  4IEX A;  2QBX A;  4Z07 A;  4XMI A;  3SKJ E;  5KXB A;  1SLC A;  3WNP A;  4CDX C;  1QJY 2;  1E5R A;  1QXR A;  4CVU A;  5FZH A;  3ZN5 A;  4LHS A;  5C5T A;  3RMX A;  4NRP A;  4OMC A;  1MS5 A;  1RUI 2;  3U78 A;  3N9L A;  4IER A;  1S1A A;  1BCX A;  1KFU L;  3ATG A;  4ZPI A;  3MGU A;  1KEX A;  1DLL A;  3K75 B;  3GDB A;  1PO1 3;  2V73 A;  2ZKL A;  3IMM A;  1H8T A;  4IQP A;  4Q2F A;  3TYJ A;  1VP6 A;  5EFU A;  2PYT A;  3BOD A;  4XUR A;  5A3N A;  3EBR A;  3A4U A;  5EV7 A;  3ACH A;  3NJZ A;  4KWJ A;  4LHN A;  4CU7 A;  5FUN A;  1RL3 A;  1GFF 2;  1QMJ A;  2OQ7 A;  4BJ0 A;  2ZGN A;  3MIG A;  1SPP A;  1LOC A;  1QJU 1;  4QQO A;  1RED A;  1GU3 A;  1ZBE 3;  4Y5Z 0;  3W58 A;  2B39 A;  2VMG A;  2B8M A;  5F3E A;  5JIU A;  3MDP A;  1S0D A;  3KT7 A;  1VBB 2;  2VCM A;  4P00 B;  2HLE A;  2HWC 3;  2YC2 A;  4ISR A;  2V5Y A;  4QXB A;  3VBO B;  1ASJ 2;  2ZBJ A;  2C5D A;  4L92 A;  2WWU A;  1SDD B;  5FAX A;  1AYN 3;  5EJ3 A;  4C0H A;  2TBV A;  1SDW A;  2GC2 A;  4YGE A;  2ZEW A;  5FPZ A;  3JB4 C;  5I0T A;  4AI3 A;  1R08 2;  4KWL A;  3LSE A;  4EN0 A;  3O1P A;  1VRB A;  1ASJ 3;  3ZFE B;  1N47 A;  3O12 A;  5L36 A;  3PVN A;  1KQR A;  5EJZ B;  1AYN 2;  4FPF A;  4YM1 A;  4P9Y A;  2BWC A;  3I4I A;  4YM3 A;  1NE4 A;  2ZGT A;  1MS1 A;  1YFX A;  1H2L A;  1OVP A;  4LMF A;  2H0V A;  4N53 B;  3ROU A;  1IPK A;  4ZU7 A;  1SBD A;  2W0X A;  3E5X A;  5EYX A;  5FUI A;  3PVE A;  1KGY A;  1SQ4 A;  3CDZ B;  2PAM A;  4FT8 A;  1BMV 1;  1A78 A;  1BBT 1;  5CG8 A;  3H3Z A;  2DVA A;  3USS A;  5JXI A;  3AMH A;  4BMB A;  1EP0 A;  5DN2 A;  2OPW A;  3BUC A;  4XUP A;  3O7O A;  3ZN6 B;  4IE0 A;  3LD8 A;  4LBJ A;  4MUV A;  5FZ9 A;  3RWN A;  1W9Y A;  3QOP A;  4P14 A;  2BNM A;  5JCT A;  1QWR A;  4DXS A;  2HJI A;  1L7Q A;  3VD7 A;  1R08 1;  1VRH 3;  4ZXE A;  3V0A B;  1ND3 B;  1PO2 3;  3OPT A;  4COW A;  3JBG 3;  2XL7 A;  3FUO A;  2DVB A;  3AB0 A;  4R4Z A;  4J1X A;  1G6N A;  4IEO A;  3TEZ A;  1HX6 A;  1PVC 3;  3KLS A;  3SIT A;  1H2K A;  3KCX A;  4PDW C;  4KMQ A;  3AKR A;  4OZO A;  3FN9 A;  4HOO A;  4DXT A;  1ZRE A;  3D3A A;  2WO3 A;  5A7N A;  3POF A;  4DIN B;  4N90 A;  1FI2 A;  3DN7 A;  4JHT A;  3DEC A;  1JUI A;  1PVC 2;  4CEW B;  4UT5 A;  3OG2 A;  4YZ5 A;  1YYN A;  1RC6 A;  3PUR A;  3VBS C;  4JRL A;  2WC2 A;  5CKQ A;  1ULP A;  3INA A;  1R1A 2;  1UYY A;  3O1M A;  1NQD A;  1KS5 A;  3P3N A;  4L9B A;  5ABJ A;  5LRS A;  4MO3 M;  2CWM A;  1O5U A;  2JIC A;  4XXP A;  3E5U A;  5A3L A;  4DXR A;  2UU8 A;  5A1F A;  4EE2 A;  1W39 A;  1B09 A;  4IEV A;  4JGZ C;  4W4Z A;  4CCO A;  3AP5 A;  3VKN A;  4MGI E;  2K9Z A;  3PME A;  5FPV A;  4XFG A;  4YPJ A;  4B3N A;  5EJ1 B;  4AAX A;  5FOB B;  1JOP A;  5IT6 A;  4KU8 A;  4SLI A;  2TEP A;  3ZFG A;  1OLM A;  2VUC A;  1ND2 C;  1VBA 2;  1WCD J;  1S2K A;  1YEW A;  4BE3 A;  1EUT A;  1GYK A;  1AJK A;  3VZK A;  5E88 A;  1AL0 G;  2PLV 1;  2YU1 A;  5GZG A;  4LKF A;  1HV1 A;  2RS3 1;  2XQX A;  5C8C C;  2DCK A;  1A6C A;  2VZT A;  4AR2 A;  1Y43 B;  3LDB A;  5L7O C;  3ZFF C;  2Y38 A;  1D7P M;  1OPM A;  5I93 A;  2ZAA A;  1WLT A;  1RUG 1;  1QJX 3;  2UWA A;  2UY9 A;  5EP9 A;  2HEW F;  3VBU B;  4CDU A;  1C3H A;  4LO8 A;  1WMD A;  2Q4S A;  4S2G A;  4QDS A;  4LE4 A;  4LKD A;  1LOF A;  5L7O A;  2H6B A;  2EVX A;  1Y9Q A;  4MVT A;  5HBA A;  1UZW A;  5JVV A;  5F5C A;  2VZS A;  4CPB D;  4DRR A;  4QX7 A;  3NAP B;  4IE5 A;  3VL8 A;  4BQ2 A;  3PU3 A;  3ZSM A;  1C5H A;  2LAL A;  2RM2 3;  1KDM A;  1NCR A;  4FQZ A;  4IE6 A;  4XBQ A;  2AR6 A;  2QZ2 A;  2R0H A;  4LOT A;  4LO6 B;  4Q4V 3;  1YXW A;  4WVW A;  2VD7 A;  1AR9 3;  3B9I A;  5AVP A;  2PAE A;  4GQ7 A;  4LLO A;  2VVD A;  4Q0V A;  3TEY A;  4JHZ A;  5FYT A;  1VMH A;  3PUH A;  1C8M 1;  3WF4 A;  2RM2 2;  1XRU A;  2Q1F A;  3I54 A;  2YXS A;  1RIR A;  3J7N A;  2ZEY A;  3CLP A;  5HV4 A;  5LAS A;  3ZKY A;  2MPF A;  4Q1R A;  5DAX A;  2IXK A;  4NWW A;  3K4D A;  3HN1 A;  2GP3 A;  1HW5 A;  1ENS A;  1K45 A;  1R09 2;  1XOY A;  5J98 B;  1IPJ A;  3SIS A;  1LKN A;  4LHL A;  3ZIX A;  4CUC A;  2JDM A;  1W03 A;  3BVC A;  2DUP A;  3GM8 A;  2XVL A;  1R09 3;  2J1R A;  2HH9 A;  2BP6 A;  3VHP A;  1NLR A;  5A3O A;  4M4P A;  2FBE A;  4XFH A;  4Y22 A;  1LAJ A;  5F37 A;  3WP3 A;  2GND A;  3BN6 A;  3I3B A;  4XZU G;  5A7W A;  3VBF A;  3OTF A;  4YG0 A;  1NYW A;  1QQP 3;  5FY1 A;  3WSO A;  2P3J A;  1ENQ A;  1AR9 1;  4IEQ A;  5C8C B;  4IEW A;  2XJP A;  1PM7 A;  2BOI A;  5EHD A;  3TNP B;  3AXD A;  1W28 A;  2PHU A;  3T2P A;  2VVE A;  5FXW A;  2WFF 1;  2KM2 A;  5C9A C;  4XUN A;  1ULE A;  3N9P A;  1DCS A;  4I0B A;  4I3G A;  4Q8L A;  1ND2 B;  1HB4 A;  2BNN A;  2O1Q A;  3KVA A;  4RSU A;  5IVV A;  3RYP A;  2HWD 1;  2HEY F;  3AFG A;  1BJQ A;  1OT5 A;  1AR7 1;  5I0R A;  2JDP A;  3MUZ 1;  4FPC A;  2VZP A;  4FPO B;  4DFS A;  5C4W B;  1NY7 2;  2WS9 3;  3LA7 A;  2XHK A;  3BU0 A;  2EIB A;  2JB4 A;  1ACC A;  1HQW A;  1KFX L;  4Q29 A;  1VAM A;  2WBK A;  3OBR A;  1EAH 3;  2HWC 1;  5I8T A;  2BBV A;  4O61 A;  3KGZ A;  5DAV A;  4XHB A;  1QDO A;  2QE3 A;  3LDK A;  5FZ7 A;  5A3M A;  2FMY A;  1W04 A;  4QX2 A;  5B4X A;  4DPN A;  1KD7 A;  4A42 A;  5C9A A;  4YW6 A;  1TZO A;  1NLS A;  2VCB A;  1WMF A;  4N53 A;  2JG9 A;  2OT7 A;  4NAO A;  3U75 A;  2W47 A;  2DCT A;  4U36 A;  3CKH A;  3MHZ A;  4ZY9 A;  4EN8 B;  1QQP 1;  1Z0H A;  3NNM A;  1J1T A;  2C0Z A;  3ZMN A;  1WBF A;  5A70 A;  3M2M A;  1D4M 3;  4PDW B;  3LIH A;  1A34 A;  1FNZ A;  1EPW A;  1W6N B;  4M3C A;  1EV1 2;  4JAA A;  4RR3 C;  4IGO A;  4COZ A;  4XZP A;  2LRP A;  2A6V A;  1D4M 2;  1JOD A;  2E53 A;  3OBZ A;  3OB8 A;  2F4P A;  1W2O A;  1ZM1 A;  4B8E A;  4P9I A;  1AR7 3;  5APA A;  5C4W C;  3U14 A;  1NCR B;  4LHK A;  3UJO A;  3WP5 A;  1AL2 3;  2V09 A;  4Y24 A;  4OUM A;  2E32 A;  4Q0U A;  5FZI A;  4NIH A;  3OF1 A;  3OY8 B;  4DUX A;  4PLN A;  4P9X A;  4YZ3 A;  1AR7 2;  4LK6 A;  4JTO A;  1NY7 1;  3T4V A;  1NT0 A;  4UW5 A;  3MEP A;  1RUO A;  4XJA A;  1NUK A;  2WNO A;  1I3H A;  1UZV A;  4FPE A;  3VN4 A;  4NUB A;  4LOS A;  4L0P A;  5BNO C;  1VBD 3;  4RN5 A;  1RUE 1;  4A3Z A;  3PUS A;  1X8E A;  2I74 A;  1LHN A;  4ERO A;  1WW4 A;  3IWZ A;  4QWN A;  5DPN A;  4E8D A;  2FDF A;  5JXG A;  1NCQ C;  4LQR A;  4XAA A;  2WNV B;  3WLU A;  3POB A;  4WV8 A;  1RUD 1;  5C3Q A;  2D6K A;  5LBE A;  3WW4 A;  1SMV A;  2JEN A;  3C7G A;  3K3O A;  4NE9 A;  5CB7 A;  2VUJ A;  2G19 A;  1OMI A;  2VW0 A;  2VUA A;  4QU2 A;  4CU9 A;  3M8L A;  4BU2 A;  4CP2 A;  1FV2 A;  1BEV 1;  2RS3 3;  3JXS A;  1YLL A;  3WQB A;  2IXJ A;  5FIX A;  2X53 S;  2Q8E A;  1OLR A;  3ZFF A;  1L3J A;  2TNF A;  5ABJ B;  2V4V A;  2K46 A;  2ZX1 A;  5FZK A;  4BQ4 A;  2P4E A;  3HBK A;  3U4X A;  2OS2 A;  2WIN B;  2DUQ A;  2R0F A;  2DCY A;  2D6P A;  3VHR A;  4FXG B;  4OHX A;  2YC0 A;  1W8Z A;  2LRO A;  4OYU A;  2WZE A;  3WG2 A;  5IVJ A;  2D6N A;  3IMN A;  5E89 A;  3R6S A;  3RQ0 A;  1Q8S A;  1RUE 3;  5GKA C;  3VBH C;  1D4V B;  1UNB A;  4BIO A;  4B4P A;  2R1B A;  2UWC A;  1GOH A;  1V6O A;  4MV2 A;  4FQ4 A;  3RGB A;  3NAP C;  4CCJ A;  3N4M A;  2UYA A;  5BV6 A;  4AFC A;  5I8Y A;  4BME A;  4Y20 A;  3ZDV A;  3VHN A;  2ATF A;  3IDE A;  1TE1 B;  1C8M 3;  2X5I A;  3M70 A;  5G05 L;  1ZZ7 A;  2V5D A;  3FX3 A;  3WG1 A;  1MZ5 A;  3VD3 A;  2AAC A;  2A75 A;  3AP9 A;  4ASM B;  4FPH A;  4C1X A;  3SQO A;  5FY5 A;  3MIC A;  2QQU A;  4DXZ A;  4NRQ A;  2GC0 A;  2XML A;  1Q8P A;  4Y26 A;  1CVN A;  2L9L A;  5L9V A;  4Z1V A;  1C8M 2;  1H8V A;  5A7S A;  4YG3 A;  3ZYI B;  1RUH 1;  4ZZ5 A;  3ZR6 A;  2D5F A;  5BNP B;  1MVE A;  2A70 A;  1KJR A;  5DDJ 1;  4RD7 A;  1L7R A;  1HQL A;  4P9G A;  5F2W A;  4FPG A;  1EYB A;  3QAC A;  2EXJ A;  2P3K A;  4LOR A;  1YFW A;  1UW8 A;  4H3W A;  1S0F A;  4NII A;  3THT A;  2VOT A;  3P3P A;  1OPO A;  4KGQ A;  4EWE A;  1NXM A;  5BUV A;  3H8X A;  4OHZ A;  5JXH A;  3LIG A;  3FHI B;  3ACI A;  5JOW A;  4XHX A;  3M1H A;  3VBR A;  1GZW A;  3TWI A;  1FPN 1;  5JSP A;  1CAX B;  1UXZ A;  3HBZ A;  1UQX A;  4R8H A;  4HT1 T;  1POV 0;  1FX5 A;  1LNS A;  2PAK A;  4P9J A;  1VBA 1;  1LOE A;  2EXI A;  2VBD A;  1AZD A;  2D98 A;  2NYY A;  3E6D A;  3OD0 A;  4FP2 A;  2WNU B;  4Y1U A;  4CP1 A;  3ILN A;  1XB9 A;  2C4X A;  2PTM A;  3OCP A;  5JI7 A;  1T6G C;  1W9T A;  4FVV A;  1OOP A;  2OW4 A;  5DXD A;  1W90 A;  1MR5 A;  4AFB A;  4D0Q A;  3EJK A;  4CE8 A;  1N3P A;  3I2O A;  1GWK A;  3B7M A;  2FQP A;  4ZON A;  2F6B A;  1ZNP A;  3BB6 A;  4KG0 A;  3LDR A;  4GWN A;  4XFF A;  5JMO A;  4IV3 A;  3VKF C;  1C5I A;  3VBF C;  4BXF A;  2XXZ A;  2ZML A;  5FK8 A;  3VD5 A;  1RUH 3;  4PLM A;  4FPK A;  5IYY A;  5DUX A;  4QPW A;  1N1Y A;  3AKS A;  3TBD A;  3T3Y A;  1OH4 A;  2RE9 A;  2HWC 2;  2XUM A;  5LCW L;  3AC0 A;  2DU1 A;  2VJX A;  3ECQ A;  2NLR A;  2WRA A;  5CIR A;  5C3R A;  2B5H A;  3AYD A;  2AEN A;  2AC1 A;  4E4H A;  2ZAB A;  3BAL A;  3IBM A;  3LSD A;  3VD9 A;  1F2N A;  1MVQ A;  2W1U A;  4UWD A;  3GCW A;  5CZK A;  4GUL A;  2E7Q A;  2JG8 B;  4JVA A;  2CWS A;  3B01 A;  4E9K A;  5KC5 A;  3T30 A;  4ORF A;  3OEB A;  4XIK A;  4AQT A;  2VVF A;  5JOY A;  1LES A;  1J59 A;  1WW7 A;  3VB9 A;  2FZ2 A;  1PHM A;  2YBK A;  5LA1 A;  2WKK A;  4S2D A;  5SV5 A;  1UX7 A;  2VW1 A;  2R04 1;  3C8X A;  4FPJ A;  3ZXJ A;  1SLB A;  4COY A;  3ZYB A;  1PX3 A;  1HB2 A;  4CEY C;  4EZH A;  2CV6 A;  1IS4 A;  1RXG A;  4Z82 A;  1LHW A;  2GSY A;  4EWA A;  4QX5 A;  4CCM A;  4YW7 A;  5IJR A;  1REE A;  4IEZ A;  1F31 A;  4E8C A;  3BKZ A;  1AR8 3;  5FKB A;  1JYT A;  4CUG A;  3LQC A;  2VTX J;  4NID A;  2X10 A;  4QX1 A;  4E2S A;  1TNF A;  1UY4 A;  1SPP B;  4BOW A;  2JX9 A;  2CL2 A;  4N7U A;  1WLW A;  4DIQ A;  3TNQ A;  4UFM A;  2E31 A;  1SLA A;  2IZW A;  3RRD A;  3HNB M;  1I1E A;  2TUN A;  4AFD A;  2E26 A;  2PEL A;  3PUI A;  4BQW A;  4ONU A;  2G4I A;  1UXX X;  4I0A A;  2IXI A;  4I3P A;  2DTW A;  2Z79 A;  2QVS B;  2LM3 A;  5IVE A;  3LOB A;  4E2G A;  5J09 A;  1OLQ A;  4TN7 A;  1QXP A;  1UOG A;  4F83 A;  5CG9 A;  1OVS A;  1VBB 3;  2ET7 A;  5DUV A;  1JW6 A;  1H9W A;  2X29 A;  4L2N A;  4YGB A;  1VBD 1;  1YFY A;  5JDB A;  3RPQ A;  4AI0 A;  4K9S A;  1REF A;  1F4H A;  1PX4 A;  3ZYG A;  4ASL A;  5HPO A;  2BGO A;  2VMF A;  3WDY A;  4QU1 A;  3KT4 A;  3O5S A;  4RHV 2;  1O4Y A;  1V6K A;  2BYV E;  5FZL A;  4A7Z A;  1T6B X;  1IGO A;  4XBL A;  4AG4 A;  1CAW A;  4JV4 A;  4DY5 A;  1ENR A;  5JOX A;  4TLG A;  3HMY A;  4XEZ A;  4XJZ A;  3A21 A;  1QIQ A;  4MX3 A;  3AL5 A;  1RUD 2;  3RI9 A;  2XJU A;  3PMS A;  1POQ A;  1S0J A;  3FMG A;  3FHQ A;  4XAB A;  3Q8A A;  5IWF A;  3RZH A;  4K40 A;  4M0N A;  1W6O A;  4NVP A;  2W2I A;  4YW4 A;  1PK6 B;  4CZS A;  4Q0P A;  1D2Q A;  4QXC A;  2MEV 1;  2EIG A;  4XDO A;  3O1U A;  1XYP A;  2D43 A;  4SBV A;  5AC9 3;  3I2J A;  4BQ1 A;  1UF2 C;  2VMI A;  5L9R A;  1OQ1 A;  4TXW A;  1X33 A;  4S2F A;  5F5Q A;  1AYM 3;  3I49 A;  1GZW B;  2J22 A;  4CEY A;  4QDQ A;  2A6Z A;  3BOP A;  2WZR 3;  3N9M A;  2YFU A;  4AYU A;  3K51 A;  2QQM A;  1SLL A;  4LIU A;  1UWW A;  5EIY B;  2O8Q A;  5JLV A;  1X36 A;  2FCV A;  4Y5S A;  1AYM 2;  1JYC A;  2D44 A;  5EYY A;  4ZU4 A;  2ETE A;  3RMY A;  3WR0 A;  4FOW A;  1DQ1 A;  1UPI A;  1PO2 2;  3OYW A;  4Q4V 2;  2BEO A;  4QQH A;  2AEY A;  3NV1 A;  4BLJ A;  1ZRI A;  4QT6 A;  2QQW A;  2JDU A;  4AGR A;  2J1V A;  2ARC A;  1WCK A;  3KZ4 C;  5IW0 A;  4CCC A;  2XVG A;  1AX0 A;  4QGN A;  4RFR B;  1VPH A;  1VLN A;  3QCW A;  1WKY A;  4IUG A;  5GLT A;  1ZVF A;  1I5Z A;  1LOB A;  4TYS A;  5BNO B;  5FMO L;  2Q8O A;  4CUA A;  1N3O A;  4QX3 A;  3III A;  3POW A;  5DAB A;  4BQ5 A;  1W8N A;  4QPI B;  5KR7 A;  3P6B A;  4QPG C;  1DU3 D;  4MXW B;  3ZX7 A;  4UF0 B;  1AHS A;  5D8A A;  4HKW A;  1UCX A;  2MNG A;  1LEM A;  2WNE A;  3USU B;  3OGV A;  4TZD A;  4XF3 A;  2EF6 A;  3TOJ A;  4X6Q B;  3WX5 A;  2ORZ A;  2QFE A;  5IAV A;  2FDG A;  1PO1 1;  2YYO A;  5FZE A;  1MS0 A;  2OUH A;  4D7T A;  3E6B A;  5L9B A;  1OBN A;  4DOU A;  5T5O A;  1VE0 A;  4MAD A;  4MSV A;  2Y26 A;  1O3S A;  2E51 A;  3O0W A;  5KHH A;  5BNQ A;  1S2E A;  3ZMO A;  5FZC A;  2FDJ A;  5F1R A;  5M0T A;  1E5S A;  3V0B B;  1W3X A;  5A3P A;  1VBA 3;  1PMJ X;  4R52 A;  3I2K A;  4YVW B;  4YW2 A;  1MQT B;  4FTE A;  5F8P A;  4FOV A;  5FZM A;  1H8T C;  1OQD A;  1CJP A;  2BQP A;  4AEK A;  3I8T A;  5HCA A;  3O1R A;  3AXE A;  4B4R A;  1JMU B;  5CIS A;  1O3R A;  1AYN 1;  3NNF A;  2QQL A;  1QJX 2;  4BK4 A;  1QJZ A;  1W2A X;  3GBW A;  1GZC A;  1YQ2 A;  2WLQ A;  3MLL A;  1F8V A;  2DBI A;  3TAY A;  4MGT A;  1B35 B;  5FYS A;  2WNU C;  3BCW A;  2VW2 A;  3I3M A;  1X50 A;  2W68 A;  4TLF A;  3MI8 A;  4UOJ A;  2GH8 A;  1IS3 A;  2W46 A;  4YLZ A;  3AVS A;  3MPP G;  3CHX A;  4QQL A;  4KWU A;  1FOD 3;  3FBY A;  5FPB A;  4JKM A;  3BIW E;  1ODM A;  2PHX A;  3POI A;  2ZGP A;  4KNC A;  5C9A B;  1HV0 A;  1Y9M A;  2VMH A;  3OEA A;  3ZYR A;  4AW7 A;  1BMV 2;  3IZO A;  3S30 A;  4J25 A;  5FPA A;  3I59 B;  4BQ3 A;  4YAR A;  3SNM A;  3E6C C;  4EQV A;  1G7Y A;  3MIE A;  1Q56 A;  5CA6 A;  2LTN A;  5GJ6 A;  2VMC A;  1WME A;  2RVA A;  2R04 3;  1M06 G;  1DG6 A;  1I5P A;  1J58 A;  3M3O A;  4GZ9 A;  1LCL A;  1POV 3;  1UY1 A;  2VH9 A;  3H8U A;  4ET7 A;  3JQW A;  1WGP A;  2R16 A;  3BTA A;  3JB8 A;  4Q4W 1;  2RDS A;  3GZA A;  2BGC A;  4XTP A;  3I7D A;  3LA2 A;  1IHM A;  3IAQ A;  3ZYJ B;  1UZ0 A;  2PFW A;  4FTS A;  2W9X A;  3GZE A;  4JZR A;  5DMY A;  2G9F A;  1LOG A;  1QQP 2;  1O91 A;  3IN9 A;  4YZ1 A;  3POY A;  5C33 A;  1ST8 A;  3VDC A;  4WVV A;  1VBB 1;  2P2K A;  3KVB A;  4ARX A;  4MET A;  1ZA4 A;  1A3K A;  1IS5 A;  3RZJ A;  1GR3 A;  1K42 A;  1TME 1;  2W91 A;  1SCS A;  2VY0 A;  2CDP A;  5FYY A;  5D2A A;  1XYN A;  2JG8 A;  4XQD A;  1HRV 1;  4Y4R A;  5J3U A;  4KWK A;  3D82 A;  5DAW A;  2YC4 A;  1XYO A;  2Y6H A;  2I45 A;  2RS5 2;  2XH6 A;  2IVJ A;  1OC1 A;  4CP0 A;  4L11 A;  3DEM A;  1XE7 A;  1PMI A;  2B9U A;  1CIY A;  3J9S A;  3ZVX A;  4YFZ A;  4N7I A;  5T5J A;  4OUL A;  3DL3 A;  5C8C A;  5I91 A;  2RS3 2;  3I97 A;  4IEU A;  4UFK A;  3AK0 A;  5F39 A;  5CYY A;  4G9S B;  2ZZJ A;  3ZYP A;  1VAK A;  5JAX A;  4OI1 A;  1JYI A;  1CGP A;  2R06 2;  2A3X A;  3S57 A;  5EWS A;  3KV9 A;  1CN1 A;  5CFD B;  4YW3 A;  4B1L A;  4IES A;  2P6H A;  3CU7 A;  3RZG A;  2QQJ A;  1X82 A;  5T3N A;  4O9E A;  3DYO A;  5KHG A;  2ZX3 A;  3NW4 A;  5FPX A;  3H3U A;  1GLH A;  2O8O A;  4XJU A;  4K21 A;  5E16 A;  3OUJ A;  5IFT A;  1YQ6 A;  1ZZC A;  4QPG A;  1FPN 2;  3C2U A;  3WQ7 A;  3B3Q E;  1OXC A;  5JOZ A;  3N9O A;  4K8F A;  3UV9 A;  4JGZ B;  4HVQ A;  2JIJ A;  3H8R A;  1VB2 A;  3I3E A;  1WWY A;  3VDD A;  2P5B A;  4QKB A;  3EYP A;  2OII A;  3ST7 A;  3ZDS A;  5J7M A;  3WF3 A;  4HN1 A;  4XC9 A;  1UYZ A;  4FP3 A;  4RR3 B;  4LBL A;  2XLG A;  5A6Y A;  4H14 A;  4KQ7 A;  4LO5 B;  4Y4Y A;  3FE5 A;  3NL1 A;  1AXK A;  2DU0 A;  3DF0 A;  5FLI A;  3AMP A;  2B45 X;  1H1A A;  1OHF A;  5FYU A;  1UMZ A;  1OUR A;  3TN9 3;  3PHM A;  2DUR A;  3EO6 A;  3OUH A;  3W21 A;  3VZL A;  1G9B A;  3O1O A;  3AKQ A;  3LF7 A;  1QOO A;  3BYW A;  1F9K A;  2DUO A;  2WT2 A;  3H1M A;  1JHJ A;  1AR6 2;  1PGW 2;  2AEZ A;  4Q4X 3;  1JYV A;  4K1Y A;  1VIW B;  2VL4 A;  4MH0 E;  2KA3 A;  3I3D A;  3JUU A;  3SKV A;  1ONA A;  2VU9 A;  5GZD A;  1U5Y A;  1ND3 C;  2XWB B;  3HD8 B;  4CRQ A;  1ALY A;  3IAP A;  4Q4X 2;  1ZZ6 A;  1V9U 1;  3T2Q A;  1Q8Q A;  1PGS A;  3ACL A;  3RZZ A;  5C3O A;  2ENR A;  2D7F A;  4Y5T A;  3JD7 1;  4ITC A;  4AQ2 A;  3BPS A;  5KHJ A;  5T55 A;  5ANN A;  3ZN4 A;  1RMU 1;  3S6P A;  4A45 A;  4CYD A;  4AED A;  2YBS A;  1W6O B;  5K7P A;  3VDB A;  2EID A;  1PK6 A;  4UFI A;  2QJV A;  4GKY A;  5LBC A;  5IAX A;  4YW1 A;  2A6X A;  4H2A A;  5K0U B;  2E9Q A;  2OVU A;  2NN8 A;  3GBF A;  4KH9 A;  3OGR A;  3GZT B;  2WN3 A;  1JHN A;  4Q4Y 2;  2XB6 C;  3ZN6 A;  2ZGR A;  2PLV 2;  2W1Q A;  3SH4 A;  5ACA 2;  4YM0 A;  5GZE A;  2GAL A;  3ZOI A;  4W50 A;  4GAZ A;  1IS6 A;  1PIV 2;  1DYP A;  2IFW A;  1MEC 1;  2WAA A;  4Q4Y 3;  4FXK B;  4JGZ A;  4WM8 B;  5FP7 A;  1UU6 A;  1CD3 G;  3T0A A;  5A33 A;  2WO1 A;  3HWJ A;  2W3J A;  3WEZ A;  2VNR A;  1QNY A;  1EAH 1;  5DZE A;  3T08 A;  1DQ2 A;  2ZHM A;  5FZO B;  3POG A;  1GUI A;  2J42 A;  1RUC 3;  3LPG A;  1HN1 A;  5FZ6 A;  1G8W A;  1NXD 1;  1W3V A;  2IFR A;  4YZ4 A;  1MEC 2;  4LEJ A;  3D6E A;  1DQ4 A;  2ZEZ A;  5FJK A;  3Q8F A;  3SLI A;  1BXH A;  2GC1 A;  2Z5W A;  1URX A;  2A7A A;  5IVY A;  3VLB B;  2W39 A;  3JD7 3;  3UKN A;  3N9Q A;  5ACA 1;  4MYE A;  2ZGQ A;  3BGA A;  1RMU 3;  1BQP A;  5AFE A;  2ZHK A;  4YSF A;  5FXV A;  1B35 A;  2Q30 A;  3ENR A;  4M4R A;  4OCT A;  5E8A A;  3RNS A;  4AZZ A;  4BB3 A;  3W9A A;  5FRA A;  4D6Q A;  2J1U A;  3LEG A;  4N43 C;  2RR1 2;  1W8U A;  1RMU 2;  2Q5T A;  2JDN A;  4M3C E;  2R49 A;  3CJI A;  3CZJ A;  5E1R A;  4L97 A;  3AP6 A;  3DUI A;  4MGY E;  4XXA A;  1Q5O A;  2VEC A;  1CZS A;  3ZSL A;  2WWS A;  1VBC 3;  2HKX A;  2ZHL A;  3PVO A;  2XLA A;  5J36 A;  1K3I A;  3IPV A;  4OLL A;  4FBF A;  2VZ1 A;  1UD1 A;  2HWE 2;  1PO1 2;  1ZZ8 A;  4Q0Q A;  4AF9 A;  4ZHN A;  4COU A;  1RUF 3;  2QTW B;  4AL9 A;  2Q1Z B;  5DAQ A;  2VZ3 A;  4GJZ A;  3K4A A;  2VM9 A;  1HKD A;  1DP0 A;  2HWE 3;  2P3I A;  5LRR A;  3EMR A;  4R9D A;  1H2N A;  3HNY M;  4CDQ C;  2Y8K A;  3D0S A;  4QM9 A;  2O0O A;  3CJX A;  2EA7 A;  4PQ9 A;  3VBU C;  2ZX0 A;  3HT1 A;  3FUQ A;  3KB5 A;  4Q5O A;  2FHR A;  3BU7 A;  3KF3 A;  5DDJ 2;  3NWK A;  1NOV A;  4IGQ A;  5GM0 A;  4URA A;  1W0N A;  4P5H A;  3OPZ A;  1ZBE 2;  1CAV B;  3O1T A;  5DUU A;  3IM0 A;  1QKQ A;  2VNG A;  2DYC A;  3A23 A;  4LXL A;  4TWT A;  5FUP A;  2YGM A;  1WUV A;  3ORJ A;  3H7J A;  4GMP 1;  4AI2 A;  3S5Q A;  5KHK A;  1HRI 2;  2XR4 A;  4GB3 1;  3WQ0 A;  2B42 B;  1UYX A;  2B7Y A;  2VQA A;  2VCC A;  3R0R A;  3ZKU A;  4ZKT B;  1R08 3;  1VRH 1;  3C7E A;  3ES4 A;  2PQS A;  2BWA A;  2VOV A;  2WA3 A;  1JZ5 A;  3LGR A;  5FP9 A;  3MBW A;  4AGV A;  2ARX A;  5C4W A;  3CBN A;  3A0K A;  4CCL A;  3NNL A;  3RFR A;  3CNA A;  2W52 A;  1BBT 3;  3I2G A;  3AJY A;  3UET A;  1GIC A;  4PF1 A;  5JZG C;  5BYN A;  4COV A;  1JYW A;  1YIF A;  3OPW A;  1X9T A;  2I2S A;  1O3Q A;  1E5I A;  1J84 A;  1NKG A;  2GMP A;  1W6P A;  3WQ1 A;  1TQ5 A;  5ANQ A;  1OOP C;  4BK5 A;  1J1L A;  1KS4 A;  1Z7S 1;  2A73 B;  4AFA A;  1UZZ A;  4CEW C;  1H8T B;  1ULG A;  2ARE A;  1DFQ A;  3PVB B;  1PZ7 A;  2RMU 1;  2VME A;  4OQ9 A;  3H8O A;  1U5Z A;  2G9Z A;  2R6Q A;  4LE3 A;  1YI9 A;  4JRA A;  2YB7 A;  4WZC A;  1UAI A;  2WQZ C;  2RHP A;  3EQE A;  1RGS A;  3KV5 A;  4NPR A;  2A71 A;  1RB8 G;  1BKZ A;  2HWB 1;  4LUK A;  5FP8 A;  5K8S A;  1E57 A;  2IC1 A;  2R07 2;  2VXR A;  2JG8 C;  2NZ9 A;  4BXS V;  3HJR A;  4GH4 B;  5FR3 A;  4CCE A;  3S5A A;  1E5H A;  3WCR A;  4HK9 A;  4GH4 C;  4MZU A;  4HZF A;  3IDC B;  1DF0 A;  3M3Q A;  4CDW B;  1YC6 1;  1HXS 1;  1DQ5 A;  1APN A;  4EYU A;  3T0B A;  2IVI B;  1Z78 A;  4F7Z A;  4QHO A;  4JDM A;  4LBK A;  1W99 A;  3M4F A;  4XET A;  5FK7 A;  1AXY A;  1ZRR A;  2B46 X;  1SFY A;  2X5I C;  4QPG B;  1F35 A;  3PU8 A;  5LA2 A;  5A3T A;  1ENX A;  5LEJ A;  4D7Y A;  3WD5 A;  5FBJ A;  1GNY A;  2OA2 A;  4A6S A;  5F2S A;  4DUW A;  4Y33 A;  4LKS A;  3QBQ A;  5JZG A;  5KXE A;  2RMU 3;  3KWV A;  3H1W A;  4AWD A;  2CU5 A;  3AKP A;  2QQO A;  3S7I A;  3KV6 A;  3VBS A;  3AYC A;  4AI1 A;  1YQ8 A;  4GIQ A;  5FZD A;  5EPA A;  5JZG B;  1NA1 C;  3ZSK A;  2YU2 A;  1RUG 2;  5FO7 B;  3RYR A;  1O59 A;  5BNN C;  3BPZ A;  1O4T A;  4XDQ A;  3A0N A;  1S55 A;  3UGH A;  3POE A;  5ERL A;  1H4H A;  4NIA A;  3U0Z A;  1V9U 3;  5CFD A;  4MGQ A;  1OUS A;  3CZU A;  3KQ4 B;  2VUD A;  4CCK A;  2UYB A;  4KI5 M;  3ILR A;  2GNB A;  4RS5 C;  3NV3 A;  2GME A;  2RM2 1;  4I0W B;  4WVZ A;  5DG2 A;  4KG8 A;  4LBN A;  1V6M A;  1DIW A;  2VOW A;  4OZX A;  3VBR C;  4GH4 A;  4UBH A;  5I8S A;  1U5X A;  4DRV A;  5C5U A;  1SLT A;  3B93 A;  1IG0 A;  5EXO A;  4XCA A;  4LK7 A;  1ASJ 1;  2CY6 A;  4XVH A;  3GBG A;  3BIE A;  2QQN A;  3WDW A;  4OHY A;  2ARA A;  2DCJ A;  3AMM A;  3RG0 A;  1H4G A;  5FZB A;  4BIS A;  1V70 A;  4BZ4 A;  5FYV A;  5CKM A;  1C1L A;  4CEW A;  3PLQ A;  4UFL A;  1J3Q A;  2BU9 A;  2JDK A;  1SHW B;  4Z2A A;  2ADD A;  5BXX A;  4A7K A;  1GP5 A;  2B4K A;  2R30 A;  1VBC 1;  1UY3 A;  2WSV A;  3GF6 A;  2HWB 2;  3LFI A;  3U10 A;  3JQX A;  1JXN A;  4H55 A;  5C8W A;  4PHZ A;  3LE0 A;  3LCP A;  1AR8 1;  1CPM A;  3T09 A;  2FCU A;  4FFF A;  3ZXK A;  1Y9G A;  2RG4 A;  2VNV A;  3QD6 A;  3GXU A;  4IEP A;  4DUV A;  4XBN A;  2Q8C A;  1W8F A;  3WW1 A;  1D2S A;  3RJR A;  2VGD A;  4GWJ A;  5FTT C;  2DVG A;  5IVF A;  3J8F 3;  5FZO A;  3SXW A;  1U12 A;  2EIC A;  1NCQ B;  3VL9 A;  4A44 A;  2WO7 A;  1OF3 A;  4JKL A;  2Y60 A;  4MOA A;  4WM7 C;  3CF6 E;  2XWJ B;  4TTG A;  1GP6 A;  1YJK A;  4C1W A;  3J8F 2;  5FY8 A;  3S0M A;  4Q0S A;  2CGN A;  2E33 A;  2EAA A;  2RJL A;  3I3Q A;  4LBO A;  4OFG A;  2Q8D A;  5T5L A;  5A32 A;  4QKN A;  4PJY A;  4NHY A;  3C3V A;  4UFH A;  2DFC A;  5D21 A;  2BDR A;  1XU1 A;  3K77 A;  4YVS B;  5LY2 A;  4AQ6 A;  5A1L A;  4P02 B;  3RZK A;  5KHI A;  4AI8 A;  1QJU 3;  4DB5 A;  4GA9 A;  2XJT A;  1NX9 A;  5CU1 A;  3T2O A;  4PI2 A;  3H0O A;  3GYD A;  3K48 A;  1D4M 1;  4CDW C;  3LA3 A;  2VTF A;  3VZJ A;  4A3X A;  2WFP A;  5BNP A;  2XPJ A;  1GQG A;  2XOM A;  3C7F A;  4QQP A;  3AYE A;  3AYA A;  5E6H A;  3MW4 A;  1FXZ A;  1XND A;  3ZPO A;  1DYO A;  4K20 A;  4UXA A;  1FOD 2;  1KDK A;  2ILM A;  2YHJ A;  4YWA A;  5I0U A;  2XKP A;  2BER A;  4ZU5 A;  5FOJ B;  2MEV 3;  1R1Z A;  1OD3 A;  3LPF A;  3DYM A;  4ZXK A;  4JDO A;  1GZT A;  3VBF B;  1NLQ A;  1A8M A;  1WCS A;  4E27 A;  2G9G A;  4XUQ A;  2MEV 2;  4PCR A;  1BEV 2;  1MZE A;  1H6Y A;  2H6C A;  3N3H A;  5C3P A;  4PF5 A;  5CFC A;  1H9P A;  2Y6G A;  1OOP B;  1V00 A;  1Z7S 3;  2ET1 A;  3POS A;  1BVV A;  1RUI 1;  2YGL A;  5FYC A;  1CES A;  2VQU A;  2RR1 1;  1DHK B;  3ITQ A;  2ZCW A;  4QAW A;  3SH5 A;  4B4Q A;  4GXL A;  1BEV 3;  4DEV A;  1XC6 A;  1AL2 2;  2D3P A;  4WBB A;  2GNT A;  2CGO A;  3NNJ A;  1ODN A;  4NHM A;  1H1M A;  1XE8 A;  4XPV A;  3NAP A;  3H42 B;  1QHD A;  4QB2 A;  3POJ A;  2JG9 C;  3UT0 A;  3KQR A;  3QLQ A;  4CDW A;  2BFU S;  2CTV A;  5GZC A;  1YQ5 A;  1TVG A;  2XHN A;  3U37 A;  3U1X A;  4EWD A;  4AVS A;  2EIE A;  1VBD 2;  1LB2 A;  3F95 A;  3VD4 A;  5H9S A;  3J7H A;  1LUL A;  1ZZ9 A;  2QCS B;  2JEM A;  4A4A A;  1WZX A;  1N3Q A;  4Y1Y A;  3WXP A;  3ZYH A;  5FJH A;  1HDK A;  4JGY B;  1XNT A;  3ALQ A;  4JTN A;  1HRI 1;  4W8J A;  3WW2 A;  3SEP A;  5C71 A;  3THC A;  3OUI A;  5KBF A;  1DGR N;  4CDQ B;  1QH7 A;  1TMF 1;  3A22 A;  3CJI C;  4PI0 A;  1LED A;  2BW8 A;  1LRH A;  3O0V A;  4F8A A;  1W6P B;  2VUL A;  2WQ4 A;  3GHN A;  4IW3 A;  5HXM A;  1RUN A;  3LOI A;  4RFT 0;  1SZB A;  3RVH A;  4L8Q A;  5ISL A;  3ZSE A;  3NJY A;  3R4S A;  4HAN A;  4XMA A;  3AM2 A;  4XFI A;  1ZRC A;  4HMZ A;  1X9P A;  3M7A A;  4GD4 A;  1W9F A;  4BHP A;  1H0B A;  1F5J A;  1AVB A;  2ZMN A;  3HNM A;  1P8J A;  4NR1 A;  4FCA A;  4Q26 A;  5L73 A;  3IB3 A;  1WCQ A;  2RDN A; 
#chains in the Genus database with same CATH homology
 1YC6 1;  4OQ9 A;  3J7N A;  4OQ8 A;  1CWP A;  1STM A;  1JS9 A;  3J7M A;  4NIA A;  3J7L A;  1ZA7 A;  1A34 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...