1JS9A

Brome mosaic virus
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
149
structure length
149
Chain Sequence
KAIKAIAGYSISKWEASSDAITAKATNAMSITLPHELSSEKNKELKVGRVLLWLGLLPSVAGRIKACVAEKQAQAEAAFQVALAVADSSKEVVAAMYTDAFRGATLGDLLNLQIYLYASEAVPAKAVVVHLEVEHVRPTFDDFFTPVYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystallographic structure of brome mosaic virus.
pubmed doi rcsb
molecule tags Virus
molecule keywords Coat protein
total genus 18
structure length 149
sequence length 149
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2001-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01318 Bromo_coat Bromovirus coat protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.220 Mainly Beta Sandwich Jelly Rolls Satellite virus coat domain 1js9A00
1YC61 1JS9A 3J7MA 3J7LA 4NIAA 3J7NA 4OQ8A 1STMA 1CWPA 1A34A 1ZA7A 4OQ9A
chains in the Genus database with same CATH superfamily
3FLRA 5E89A 2XBO2 1GU3A 2D98A 3H42B 4JKMA 2Q8OA 3I2HA 4IL7A 2EIEA 4NHYA 4Q8KA 1JZ4A 3O1RA 1ZRCA 5EWSA 1F31A 1QGLA 1W6NA 2VZPA 4RS5A 4ONUA 3H3ZA 4RR3C 5IVCA 2GNDA 1A34A 5IHRA 2BVBA 5FY0A 5FR3A 1PGSA 3Q8AA 4AW7A 2DCYA 3HQRA 4KBZA 3HOBA 5CNAA 4Q0SA 2UWAA 4HPKB 4BK5A 1CR7A 5FP7A 1PVC2 5C3PA 4GD4A 5JSRA 1ACCA 4YM2A 1NLQA 3IN9A 5FUIA 4CTEA 1AYN3 4XIKA 5C7GA 5C3OA 3AKRA 3VHRA 2IC1A 3LAGA 4R9DA 5LRSA 1HW5A 1AYN1 1W6MA 3MUZ1 4G3YC 3ZYHA 3I2GA 2E53A 3O0XA 2WYFA 2Y60A 4I3GA 4LBQA 4MGYE 4OUEA 3ENRA 1OH3A 1PZ7A 3A4UA 4QPGC 1PVC3 4IE0A 4RHV1 4N53A 1GUIA 4D3WA 1R1ZA 5T5OA 1VAKA 2RS32 1QXPA 4HL0A 2LM3A 1K5MB 4XF4A 3RWNA 3CZJA 5CFCA 2PHWA 3ALQA 1H9PA 3MIFA 3C7OA 3WF4A 2CSGA 4NHKA 3RJ2X 3T0AA 4B3NA 4RGKA 5HI0A 3AP5A 1CAWA 5FPZA 1QJU3 1CJPA 4BMBA 5CFDB 2NMNA 3NNGA 4KGGA 3ZSJA 3LIGA 4Q0VA 1WW4A 3BODA 1GR3A 1UOJA 1LAJA 1Q3EA 3H0OA 3CO2A 5LRRA 2OVUA 4E2SA 1DHKB 3HEIA 3OD0A 5EXOA 3D8CA 5FWJA 2JB4A 1V6MA 4DXRA 4NO4A 1CESA 1C8M3 1N1TA 3WNPA 5KHIA 1FV2A 1V70A 3NVCA 2ZXQA 4FFFA 2ZGRA 1JI6A 2ZJCA 1SEFA 2DUOA 3T4HB 5EQUA 2XBO1 2A73B 1I5ZA 4MUVA 2P3IA 4UW4A 4XVHA 3LIHA 4YW4A 5A7WA 1LHNA 3ACIA 4YRDA 5KHJA 4Q4W2 3V0AB 2H6CA 4DFSA 5FQ0B 1K5MC 4XW3A 1JBCA 2RS13 3RMXA 3WEZA 1LOBA 2HWD3 3U75A 1GANA 4Q0UA 1FMD2 4NWWA 2XJQA 3QH7A 4XABA 5DUWA 3RZHA 1U12A 2DTYA 4Y1UA 2JICA 3ACGA 5G05L 4AI9A 3PHMA 4DB5A 4ZZ8A 2XR4A 1UY2A 2WZEA 3ABZA 5K0UA 3ZYJB 4UF0A 4CEYA 1XSRA 1K3IA 2VW2A 5FBJA 3ON7A 2ZHMA 1QJFA 2K2SA 3NQHA 1W0OA 1PK6B 1ODMA 2IXHA 4LHSA 4XTPA 5FK8A 4A6SA 4BXSV 5A6YA 4AWDA 5ACA1 5LA0A 1M06G 4KG0A 5F5CA 4IEPA 4MGQA 2P2KA 2VM9A 4KI5M 4MX3A 4UXAA 4Z92B 1OLQA 5JSOA 3AJYA 1SDWA 3T09A 4LUMA 1LEMA 3ASIA 1QQP2 3S5AA 2E26A 2KD7A 3NKGA 4RHV2 3H1YA 3S30A 5L36A 4MGZE 1DU3D 1JOPA 3MIDA 1WKYA 2VCAA 2LROA 3GHNA 1J59A 3H7JA 1ZX5A 5FRAA 3V0AA 4AXOA 2NQYA 4IE6A 1RUE1 2WT2A 4A6OA 2W3JA 4W6XA 4Y22B 2XL7A 4M3CA 1VB2A 4MOAA 4BLJA 3U37A 4EWDA 3ITQA 2A6WA 4FAHA 3L9JT 4XFCA 3AZVA 1GBGA 1MS8A 2BGPA 4MZUA 3NJZA 4URAA 2FD8A 3WF0A 1ND3C 4AOCA 2V4AA 1VMHA 3A0KA 3K3OA 4CU9A 1MEC1 5DN2A 5HV0A 3OEBA 1UKRA 2HWF2 2IXLA 2VOXA 4D94A 3HVDA 1ZZ8A 2A71A 5FP9A 5GJ6A 4QGMA 4XJAA 2GALA 5EYXA 2VZOA 1T2XA 3V0BA 2PYTA 4FPOB 5JCTA 5APAA 4CXXA 1MS3A 2VMDA 4WZFA 4MHRA 3O5SA 4BMEA 3ZSEA 2PHDA 2AENA 4DNYA 1UZYA 3HNMA 2R041 3VB9A 4YZ1A 1J1LA 1GICA 2HH9A 1V6OA 1H4HA 1NY72 1WWYA 2BGOA 2GC1A 3J8F2 4LBJA 2WJSA 5FZLA 3ZOIA 4KNCA 4TLGA 2P3JA 2Q1MA 4XZUG 2C24A 4AHYA 1KS5A 1BXHA 1ZM1A 1W9FA 1PO23 2OQ7A 4AL9A 4CDWC 4HXCA 4QT6A 1DGLA 3LGRA 5C71A 1UY1A 3T3YA 1H2KA 5I8YA 4BJ0A 2W68A 2XH6A 2VR4A 4BM8A 5C9AC 1GNZA 4EYUA 3I2OA 4JCKA 3IAQA 4ATFA 4NIHA 2J1UA 3WDYA 2BNNA 5D1IA 3VKNA 3ILNA 3LDBA 3I4IA 4AQTA 3JCIA 4K1ZA 1MZ5A 1OXCA 5GLVA 3BALA 4AHXA 5C8CA 1VRH3 2XVGA 1PX4A 1V00A 1ALYA 4PI2A 4XFGA 1S55A 1QJX2 1MS4A 1M4WA 2YMZA 5DAVA 3H8UA 5F3CA 3USUA 4IV1C 4NHXA 2F4LA 5FZ4A 3POBA 2VUDA 4B1LA 2JEMA 4NIDA 1RUF2 5A3LA 1WLTA 4IEYA 1AR61 3H50A 3I2FA 2I74A 5CZKA 2JECA 2VZSA 1NZIA 4QX5A 3J7HA 4GB32 4LOTA 2JD4A 3MDPA 2GP3A 4FFGA 1J84A 1LOGA 5A80A 4BIFA 3UL2A 3E6CC 4KMQA 4Z07A 1DZTA 4RFT0 4XDPA 3O1TA 4ORFA 1XOYA 1GQGA 1G8WA 3EYPA 4H2AA 3BUCA 4CCDA 1ND3A 1POQA 2D93A 3VBOB 4E8CA 2WZPP 3PJQA 3CMGA 4AVVA 5K8SA 3AZWA 2ZGQA 4C0HA 4YW3A 4DZGA 1KFUL 1RC6A 3WR0A 4AEKA 2C0ZA 4I02A 2YBSA 1OOPA 5FYBA 3UGGA 2WZ8A 4IDZA 4XUQA 1X8EA 5DUXA 4ASMB 4JGYA 1UYYA 4CCEA 2R042 4LHLA 1PIV2 2BFUL 2WS93 4L92A 3KV5A 1IKPA 2SBAA 5FMOL 4J1XA 4M4PA 1AL21 4W6WA 1VRBA 2W1WA 2IXIA 2X29A 3I3DA 1MVQA 3NJXA 4N9IA 4XHBA 4XMAA 3P3PA 4L9BA 1VB4A 1CX1A 3AJZA 1LHVA 5CISA 1Y3TA 2YBKA 5FZ9A 5I0UA 1ZBA1 2Y6JA 2Z79A 2RDSA 3C7EA 1LB2A 2B4KA 4UW5A 3KT7A 1OFSA 5LBEA 3K2OA 3OSDA 4V2WA 4P9LA 3M2MA 3VBUC 1UZVA 4AF9A 5I91A 3Q9OA 4Z1VA 3O1SA 1F8VA 1ENRA 4O9GA 3ZN6B 5FY7A 1HXS1 2UYAA 4LT5A 5EJ1B 2HWE2 5HPOA 3ZR5A 1UF2C 1YQ2A 5FTTC 4JRAA 2D6KA 2YHJA 3ZSMA 2P3YA 2VXJA 4Y33A 2D6NA 1CAVB 5KHKA 4IERA 1EV13 2D44A 1OKOA 3VBHB 5IT6A 3PUIA 1UIJA 5IVEA 3NAPA 1AUYA 1MQTC 2VZ1A 5H9PA 2FDFA 3WUCA 5FXVA 2GC2A 3D5OA 1U5ZA 1LOFC 3MLJA 3WW1A 2DCJA 5BUVA 1STMA 1X8MA 5IK7A 3KD4A 4QQHA 2IFWA 3SEPA 1F4HA 2RJ2A 5FCCA 5FFOC 1QH6A 2YY1A 4HK8A 2WNOA 4FP3A 5FUNA 1MZFA 4XBQA 5DXDA 1YIFA 2QQLA 5FZ1A 3VDDC 2A3WA 5EZWA 3TOJA 1KDKA 1EP0A 2WZR1 3KQ4B 2D40A 2GMMA 2WA3A 3FHQA 3T4VA 2RR13 4XQDA 5KWRA 3RZLA 3AMQA 4N7UA 1C57A 2OW4A 3INAA 4FPJA 4JDOA 3UKVA 5FZ0A 4EZHA 5FP4A 3ES4A 1IPKA 3WQ1A 4N43C 4YVWC 2RDQA 5FK7A 4QB6A 2Q8CA 2EAKA 1ZBA3 2GNMA 3M70A 3UJQA 4C90A 4BHPA 4N43A 4N53C 4INDA 1Q8VA 1PHMA 1PGL1 2VQAA 4CDWB 1W8NA 2HEVF 4MADA 1HRV2 2Y6GA 4Y1ZA 4KU8A 1GQPA 2VQTA 2OIIA 3J7NA 1NA1A 4HT1T 1POV3 1ND2A 5JZGB 1VMFA 2VNOA 1WCDJ 4WM8B 2YUEA 2W52A 2WS91 5F7UA 2EIDA 2VU9A 5HCAA 5A3OA 3A22A 1EUTA 2ZGSA 5C4WB 5F3GA 1A8DA 3LPGA 4JV4A 4HG6B 1Y9MA 3RMYA 1B09A 1AXYA 2Y6LA 1QMJA 5FY5A 3RPQA 1NOVA 1IS3A 5L9RA 5JR2A 1Q8OA 2WWSA 3AB0A 1FPN3 3ZVXA 3FJSA 3FX3A 1ENQA 5DAWA 3HR9A 2VW0A 5J37A 1IKQA 1W6PB 2PAEA 1E5SA 4FPFA 4QXCA 4FT8A 5F5AA 3TEZA 4GB33 1H8TA 4PCRA 2K46A 2PELA 1S0EA 4QQPA 4WVVA 3MW3A 4HANA 4OHXA 5H9SA 3V65A 1RUF3 2Z2SB 2B42B 4IGOA 1D0GA 2GDFA 1MQTA 2I07B 4Q27A 4HVQA 3T0DA 3THDA 4GIQA 4CEWA 3G6JB 3B3QE 2X05A 3M3QA 3MIGA 1H8VA 1KXGA 1UW8A 1Z0HA 4QXBA 1QJX3 5C8WA 4WVWA 4RN5A 3T2OA 5CEHA 4ZONA 4XF1A 1QNYA 1W6MB 1DLCA 4FPYA 1N1SA 3E1F1 4DQAA 1O91A 5C4WA 3ZXFA 4CRQA 1G9FA 4YPJA 2EIBA 3AL5A 2H6BA 2V4VA 4CUGA 3LKJA 2XQXA 2D6OX 4LLFA 5I8TA 1DG6A 1S0JA 4FPKA 1NCQA 2JG9C 5FYSA 4FOQA 1OPOA 2QQVA 3VL9A 2E63A 1XNBA 2OX0A 2WT0A 5GM0A 1WMEA 4DINB 3S57A 4FOWA 5E6HA 2ARAA 3EXUA 3HJRA 1LNSA 4KH9A 5FKBA 5IK5A 3AKPA 1H1MA 3GXUA 5FZOA 3BIWE 3PDQA 3U11A 4CSWA 1YWKA 1Z7S1 2LALA 4AQSA 2IVIB 4HKOA 4JVAA 2ZKNA 4X8PA 3VBUB 3U0ZA 4CDQA 1SHWB 3ZFGC 5F37A 2KXLA 4IEVA 1I5PA 1ULFA 4LIVA 5F3IA 4YFZA 2CWSA 4CDXB 3AYEA 1VBE1 5IK8A 3NSTA 1AVBA 2O1QA 5FZDA 4HN1A 5J98B 3WLUA 2G9GA 3AC0A 3WNKA 4UFIA 2ZAHA 1UZZA 1D7PM 3B9CA 4J1WA 3RSJA 2A6YA 3DV8A 4YNIA 2ZEZA 1CX4A 1K5JA 3ZYRA 1UYZA 1Y7BA 3K4DA 2HJIA 4QKNA 4QPIC 2P37A 3PURA 5LK7B 4K9SA 4Q4Y3 4XFAA 5FZFA 1G6NA 1ULOA 4ES9A 3CF6E 4NHMA 4M3CE 5IVVA 1E5IA 4Y5SA 4DUWA 5CFDC 2JG8C 1NLSA 2I2SA 4Q4W1 1A78A 3NMBA 4QQ2A 1RJ8A 1RUE3 2VVDA 3HT2A 1N3OA 1BCXA 1FMD1 2RHPA 4XQ4A 5JUVA 5IVFA 1K42A 1NCRB 2R7EB 3PVBB 1YEWA 4NVPA 4COUA 4PJYA 4QDQA 3M3OA 4IV1A 1XC6A 5E88A 4GALA 5A7NA 2JDZA 1NUKA 5CYYA 2ZCWA 3OPWA 2XHKA 4KU7A 1SFPA 1COV2 2VOWA 1DIWA 1H4GA 2AZ5A 3NV3A 3QACA 4XILA 5EYYA 1HLCA 4CDXA 1DDLA 1UCXA 1JODA 4JGZA 2ZGPA 2QZ2A 3N9OA 2A6VA 2XOMA 3AKSA 2W91A 3DF0A 4QKFA 4AVCA 3NNJA 3BB6A 3IKWA 3C7GA 5IVYA 3OF1A 2VQ0A 4LK6A 1S0FA 4JQTA 4X6QB 5AVAA 3ZYPA 1R1A1 2WWUA 3IPVA 1OA3A 3OYWB 3SLIA 4ZXEA 1ZRIA 3ST7A 3BU0A 2XUEA 2YGMA 1SBEA 2YYOA 4HLTA 1HB4A 4COYA 3D4KA 3H1WA 1G9AA 1XPWA 3JQXA 5L7OB 1BK1A 1CPNA 3EHKA 4MV2A 5FY8A 1MZ6A 4B4QA 2VBPA 4FTEA 1GZCA 3LDRA 3LDKA 4LBKA 2R16A 2RS12 4YW6A 1RUE2 2HWD1 2A70A 2ZAAA 3DECA 4IEZA 1AHSA 3AFGA 4OI4A 5I93A 1D4VB 2BJSA 2ES3A 3CLPA 3MIEA 1YFUA 1A6CA 1XNDA 2E7TA 2JDAA 3OG2A 3WDUA 5FZHA 4MSVA 3OGGA 5EV7A 1ZZ6A 4YG0A 2V09A 3PJYA 4HZFA 2ZGNA 3GHMA 5FLIA 1W2NA 3KGZA 1SLBA 3OOXA 5KXDA 4A3XA 5IVJA 1QU0A 3OY8A 5C3QA 2BDRA 2CDPA 3BTZA 1WLWA 5HCHA 1LENA 1LOCA 1UAIA 2ID4A 2OPWA 3POJA 4RQPA 4FCAA 5JR7B 3MFCA 1SLLA 1DYKA 4K20A 3W59A 2AACA 1W28A 2IZWA 5LK5A 1F15A 2D5FA 5GLZA 2GMPA 3IZOA 5A33B 3O0WA 1ZYBA 2D6MA 4QX7A 2QQPA 4ASKA 3A0NA 3NJYA 3WF1A 3ZDVA 4XBNA 3ROUA 4MO3M 4I0BA 5FPAA 5L19A 4WM8C 1YFXA 2W94A 4FP2A 3IDCB 2C4XA 4D7TA 3P1IA 5F5QA 5C9AA 3N9LA 4Z82A 5DQ0A 3VZOA 1SBFA 4P14A 4UI9L 4CCLA 3LPFA 4GULA 2XB6C 4YZ3A 1DP0A 5FY9A 2P34A 3FLTA 4YVWB 1RUC2 3L2HA 1QKQA 3OTFA 4GJYA 4GWMA 2PQQA 3KHCA 3T30A 1S4CA 2EXJA 3DKQA 3ACHA 2JDYA 1SCRA 4XDQA 1DBNA 3CL1A 4DMIA 3EJKA 4JX0A 3VKFC 4BQWA 4NE9A 2VY0A 3I3BA 2CGOA 4RGAA 5GLWA 2XL9A 3GJBA 4Q5OA 3CJIC 1PZ8A 5BXXA 1S1AA 3VHOA 3BU7A 4P9JA 4Y1VA 5JIAA 3VZKA 4HSLA 4M0HA 2SLIA 4OHYA 4PLMA 3VD9A 1GZWB 2PHLA 3ZMOA 3CHXA 5FMOS 2JDUA 3RYKA 4EE2A 3C2UA 5B4NA 1BYHA 1K5MA 4Z2AA 3SCGA 3N9MA 2XBO3 4ES8A 1AZDA 3W5MA 3FZ3A 2A6XA 2H0BA 3LSDA 3WD5A 4CCCA 3KCXA 4L11A 2XXZA 2VCMA 4YGBA 3WQBA 4E2QA 1RUOA 2PHUA 3AMMA 5DAQA 3RYPA 3W21A 1JOJA 3VBFC 3IIIA 4QU1A 4DOUA 4BYYA 2ZGKA 3DPRA 2A3XA 3ZYFA 4Q1RA 3E6DA 3JD71 5A3MA 1RUNA 2ORZA 4FI9A 4RYDA 2VQUA 3MEPA 1RGSA 3RDIA 1QJU1 1RMU1 4CP9B 5LW9A 1FOD1 2VO5A 1R093 2CWMA 3CQOA 1A3KA 4LOSA 5IUQA 3ZR6A 1Z78A 4AVTA 5EJZB 4CPBA 2GP5A 4UBHA 4YSFA 3K51A 2JDNA 2W1QA 4O7XA 1AL22 5A7WB 5LY2A 1ODNA 3X29B 4QX3A 4SLIA 3I59B 4CCOA 4JRLA 1RXFA 1HRV3 1NT0A 5GLTA 3WDTA 4HFSA 5FQ0A 1JZ3A 4KG8A 3KVBA 4AI3A 2J1SA 2D6PA 3JXSA 2IWGB 3RI9A 3URFA 5BV6A 2W95A 3KT1A 1ZBA2 4TLFA 4QPGB 5KXEA 1RUI2 1TME2 2VE1A 2DBIA 5FP8A 1C5IA 4CDUA 4LBQB 4EV0A 4CXYA 1DGWA 3PUHA 5FREA 3NO8A 1JXNA 2W46A 2Y8KA 4B8EA 1H30A 2TNFA 4Z8BA 1R083 1VJ2A 2ILMA 3UJOA 2CTVA 1SG3A 4I0WB 1JUIA 2A7AA 4KBBA 1BEV3 2PAMA 3C3VA 3WNLA 2G19A 3RQ0A 3K4ZA 3AM2A 2G4IA 2OUHA 1HJFA 1AR72 1V6LA 1WCKA 1CAWB 1JYCA 2JIGA 2OT7A 2YB7A 2YG0A 1GMMA 3B00A 3M3CA 3OGRA 4P00B 1OQEA 1KD7A 2QJVA 2VMHA 5FPBA 5CU1A 2FHRA 2KM2A 2Z5WA 5JOYA 2JDHA 5LZ6A 2BRTA 5T50A 4P9GA 2CGPA 1TMF3 1Y9QA 1OPMA 1H0BA 1SDDB 1G9BA 1IOAA 4C8DA 3ZXAC 2BOIA 5FYIA 5BNPC 3WP3A 2XWBB 3ZDSA 4M4RA 4BCUA 1ZNPA 5JOWA 3KM5A 3MYXA 1EAH1 2HEYF 4PT6A 3VD5A 2BYVE 2VZQA 4XHXA 4MXVA 1OUXA 2PXJA 4LBNA 4PDWB 3KV9A 3ZM8A 1JZ6A 3POYA 1VP6A 4D8MA 1VIWB 1UMIA 1FATA 5I8SA 3NNMA 4FFIA 4OHZA 4XE9A 1JH5A 4IUGA 2WC2A 1FOD2 1LHOA 2WQ8A 4IEOA 5FBZA 2ZX0A 3BPSA 1O3QA 5FY1A 4LE3A 3T08A 2LW8A 1SPPB 4YGDA 4M0NA 1PGL2 2DVBA 5GLUA 1LU2A 4G9SB 2W0XA 1RITA 3BN6A 5JPNB 2ADEA 4D7SA 1OLMA 4YG3A 3T1LA 1ND2C 4S2HA 5JMCA 2X5IC 2ZABA 1I3HA 3ZKYA 2LRPA 2WS92 1C3HA 2D97A 3VBHC 3BOWA 2P1BA 3LEKA 3PU8A 2ZGMA 2RMU1 2Q8EA 3GALA 3TBDA 1YNAA 5D21A 3UK9A 2NMOA 1VBD3 4XXPA 3WXPA 1RHI1 3MF6A 2ZPXA 3RGBA 2ZOEB 1OF4A 4N8MA 4NN0A 5CAZA 1H8TB 2VGDA 1RUD2 3VDBA 2PMWB 1P8JA 1H2MA 1PZ9A 4EROA 3CZUA 4A44A 3EO6A 1BJQA 2KR2A 3MIBA 3T0BA 1OMIA 3QLQA 4IW3A 3EQEA 2DURA 4R8HA 1HDKA 3KVAA 4PHZA 2XDVA 2PHXA 4I0AA 1SLAA 4Q4X3 4M3CB 4Y22A 5HCBA 4E4SA 5L7OC 2BTVC 4WVMB 4XZPA 3TWIA 3KV6A 3OGJA 5FZGA 3WINE 3WX5A 3DGTA 1ZA7A 1OF3A 2VNGA 3ZXKA 4XOGA 3WUDA 3K3NA 3FL7A 1EV11 1NYWA 4XUNA 5FO7B 4DO0A 2OQ6A 4A4AA 2A75A 3WF3A 4CP9A 1Q8SA 1QIQA 2B8MA 4K6BA 4M00A 3U4SA 1VRH2 1YJKA 2Y38A 3THPA 4D69A 1GSLA 2AGSA 3O1PA 4LO8A 4SBVA 1SQ4A 3DYMA 4BDVB 5F32A 2MEV2 2ZA9A 5FZ3A 1YJLA 1DQ5A 1OFNA 3N36A 2WL1A 4N9HA 4YZ4A 3WHUA 2F17A 3RZMA 3RZZA 2VUAA 1K45A 4N90A 1BMV1 3VBRA 4O65A 1HV1A 1DQ4A 4MGKE 1PIV1 4YWAA 1DLLA 4BE3A 3HNYM 4XMIA 2H0VA 5GKAC 2JX9A 2UY9A 1FNYA 1CWPA 1XBFA 2A3YA 2N7GA 3ZX7A 1W0PA 2BERA 1G9DA 3TEWA 4GH4C 1S0DA 1UZ0A 2VOTA 3H3LA 5FV3A 4JGYB 5IJRA 2ZMKA 4HETA 1ULPA 1YFYA 4Q4V1 5C70A 4UW6A 4XCBA 1OLME 1W06A 2QNKA 1RUJ3 3DXTA 1OVSA 2RMU2 3JB8A 2ERFA 3S7EA 3WDVA 4ISRA 1UY3A 3BOPA 4S2FA 1B35C 1XQNA 4UF0B 3TNQA 4CEYB 2GH2A 4NMIA 4BK4A 2WNUC 1HRI1 4OFGA 1IG0A 2XGXA 2CAUA 5LATA 3HQXA 2XHNA 4QHOA 4CCJA 1VBC1 1W3VA 4AZZA 1SBDA 1D2SA 4AK3A 2HWF3 5JOZA 5E1RA 1HB3A 1W39A 5A7PA 3TN91 2W1SA 3G7DA 4LO7A 5FKCA 4A7KA 3LEMA 3ZN6A 1AR81 5AC93 3PUQA 3FBMA 2VUJA 4C0BA 2XG3A 3H7YA 3JBG1 1MS5A 4JAAA 3POSA 4KQ7A 1AR63 5FZKA 4LHKA 4KWKA 2WFF1 2X5IB 2HWB2 4BPZA 2WDBA 3D0JA 2B9VA 3IB3A 1ZZCA 5D8AB 2QUOA 3N9PA 2WNVC 4N53B 5CA6A 1ND3B 1W04A 4MGTA 3RI8A 1HV0A 3MUY1 1CPMA 3U1XA 5CFCB 2WIIB 1OA2A 2NZ9A 1SPPA 1J1TA 4AHZA 2EAAA 3IDAA 1LRHA 1QQP3 4LKEA 1F4AA 1COV1 2W9XA 3S6PA 1PVXA 2BPA2 1NX9A 3OD4A 2FCUA 3PIJA 4XAAA 3BCWA 4QXHA 4H14A 2WLPA 2VTFA 2WNUB 5AC92 3DL3A 3J26N 1V9U2 3WG1A 1T6GC 4Q2FA 1PO21 3PMSA 1PMIA 5FO8B 2IXJA 2VH9A 3HBZA 1F2NA 2XMLA 3FBYA 2VMCA 4PI0A 2RM22 3MO4A 1J3QA 3QCWA 4AG4A 3IIAA 3R4DB 1ULEA 2ZX3A 3SH4A 2J1VA 3WVJA 3ZN4A 3NV1A 1XNTA 3POIA 1MVEA 4JGYC 4AAXA 1N3PA 5HBAA 4PF1A 2HWD2 1OOPC 3WQ0A 1C4RA 1QWRA 3F95A 1OKQA 4AAPA 3K46A 2XJVA 1ZZ7A 1RVF1 1NE6A 2ZZQA 4XIOA 4CA9A 4OZOA 1XYOA 4XACA 3VDCA 4CDUC 4BQ3A 2Y0IA 5FZEA 5KBFA 4QMAA 5FZAA 5A6ZA 2VUCA 2J42A 3Q8BA 4P9IA 4UW3A 4RGGA 1RUH3 2RDNA 2FDIA 3LA2A 2OA2A 5FOJB 4NR1A 5CIRA 2C26A 3OGVA 1VALA 1DQ1A 1UL9A 1AX1A 3LOIA 4OZXA 3FN9A 1S2BA 1XRUA 3O14A 3O1OA 3ZKUA 3S0MA 1O8PA 4K21A 1S2KA 1JOBA 5KXBA 1XNKA 5FZ8A 2ZX4A 2MEV3 3K48A 4BQXA 4QPWA 1XYPA 3DUIA 1YO8A 2WT1A 3M1HA 3MHZA 4PIXA 4JTOA 3SCHA 3ZFFC 3K75B 5JDBA 5A7SA 4CUAA 2WNVB 5FXZA 4BA6A 2WO3A 4AGRA 2A6ZA 1VBA1 2RS51 3KT4A 4UOJA 4YZ5A 3C7HA 5FOBB 2VOKA 2VMEA 3NAPC 4QB1A 4UAPA 4CEWB 3VBFA 1MACA 4IEXA 2R1BA 3O1VA 1LOEA 3O1UA 1AJOA 4LQRA 3T1MA 5KHGA 4XJZA 4CXWA 5J48A 1W6OA 4CU7A 3KS7A 2RJLA 4XFHA 5A70A 1Q5OA 3ETQA 5ACA3 2PAKA 4Q29A 1CIWA 4QQLA 4NRQA 4D6RA 1RUC1 1KRIA 4OI2A 3KCYA 5FYTA 5DDJ1 5F5IA 1GZWA 1I1EA 4JGZC 5FMBA 4L97A 1IPSA 4NPLA 1WW7A 1UU5A 2XVLA 3BYWA 4NAMA 1BHGA 4OUSA 4U2AA 4EN9B 2VCCA 3LQCA 4OQ8A 1WW6A 1ZRDA 1SACA 1UYPA 3AP6A 1R64A 1OI6A 5JI7A 4JDMA 3ZIXA 4CEYC 1SFYA 3I54A 1AR91 1AYM2 1QJEA 1LGCA 3UESA 3I2JA 4L99A 1WD4A 5DMYA 3R4UA 2HBUA 3SEEA 1CJDA 1ZRRA 1VBE2 4IESA 4LORA 2PTMA 1UXXX 5FJKA 3S7IA 2XUMA 1FXZA 4KWLA 1QJY2 3AVRA 4LULA 2JE8A 4BIOA 1DFQA 1QXRA 2EALA 3H1MA 1JW6A 1BLZA 4IQPA 2JJ6A 4A7ZA 3P6BA 2VZUA 2IXCA 2X09A 5GZEA 1B35B 3JD72 4IEQA 1FI2A 5FZIA 2YBPA 4YVSA 4D6SA 2DFBA 1W05A 1R091 3IDEA 5D2AA 5IK4A 2LS6A 4YVSC 1U5IA 2HEWF 1O59A 1X33A 2W39A 3D3AA 4AQ6A 1XE0A 4RQPC 3O7OA 2FDHA 1BBT1 4AEDC 5FLHA 2EIGA 5T52A 5C8CB 1L7RA 4NRPA 1US3A 1NE4A 1KJRA 1FNZA 5F3EA 1VBA2 3I2DA 1HN0A 3T2QA 3USUB 2JG9B 1NQDA 4IV3A 1AXZA 1CIYA 5FYZA 4OMCA 1E5HA 1OT5A 2BOJA 3FFZA 4META 1RUI1 1TME1 2VL4A 4BB3A 3OPTA 4KGQA 5A32B 4GKYA 2VOVA 4JHZA 3CBNA 2CY6A 2P4EA 3ELNA 2VZVA 2ATFA 1RB8G 4ARXA 1BKZA 1R1A2 2WO2A 3KCCA 2C6SA 2P5BA 5JXHA 2VCBA 4CE8A 2X53S 3MPPG 1DYPA 4XC9A 2NP0A 2P17A 4YVSB 2FMDA 5C3RA 4KWUA 3AXDA 5JWPA 3UGFA 1G86A 2WR9A 1O4ZA 1JZ5A 1O7FA 4IEUA 3ZFFB 4MVTA 4K3UA 1IGOA 1GWMA 4CDWA 4XEZA 3Q8CA 2F6BA 3MV11 3WHTA 2J1EA 5T3NA 2DUPA 2WQ4A 4F3JA 3MV01 3AYDA 2VC9A 3AZXA 2UWCA 1ND2B 5JZGA 2Q30A 4A45A 4WM8A 2TUNA 4CEWC 3SMHA 1WW5A 4RR3A 4BU2A 4LHNA 4FXKB 1GZ9A 2XWJB 4XJ9A 4ZU5A 2XJUA 4FOVA 1YQCA 3BTXA 3VBOC 1EAH2 2B5HA 1W8TA 2E9QA 1UMZA 1VBA3 2WRAA 4R52A 5F9TA 5KR7A 3A7QA 1W9TA 4QB2A 5F2SA 3PVEA 1H9WA 1YIPA 2CAVA 2NPIA 1YI7A 2W5FA 4LBOA 1LESA 2OXBA 2Y6HA 4XFBA 2HLEA 1PK6C 1R092 2R073 2ZKLA 2P6CA 2R061 2Z69A 3I7DA 2V72A 1O6UA 4AR2A 1OQDA 4LBLA 5J09A 1PMJX 4JQRA 4GMP0 5DPNA 1CZSA 2NM1A 2ZGOA 3NRUA 1X82A 5EPAA 4YW5A 5FYMA 1AXKA 1QHDA 3ILRA 1JYNA 4H7MA 5IATA 3H8XA 3ZFFA 1URXA 1JUHA 4QPIA 1DQ0A 3FUQA 5DG2A 3GM8A 3OB8A 5LB6A 3AZYA 3T2PA 2EA7A 1V6NA 3LA7A 3NWKA 4IXLA 4JZRA 2D43A 4OUMA 4UYBA 4YYOA 2V73A 3BVCA 2W47A 2WWJA 4IGQA 1PGW1 1RIRA 3N3HA 4TSVA 3ZXEA 1MPXA 1YXWA 1OSGA 4PF5A 3D6EA 3ZFEB 1RHI2 3LOBA 1TVGA 3VBSC 1Q8QA 2DU0A 1AYM3 4XJUA 5C9AB 1CN1A 1SFNA 2J1AA 3N35A 4WM7C 2RVAA 4CU8A 2VNVA 3B5LB 5CB7A 2BZDA 3GYDA 3JU9A 5GZFA 4RS5B 3UYJA 3VD7A 5ANNA 4GH4A 2EF6A 4JTNA 3O1MA 1RUC3 2VG9A 4O9EA 4OLLA 2DYCA 2ZHNA 2ETEA 1ENSA 3SISA 4ASLA 5ACA2 3PVOA 3UETA 1UPIA 1ENXA 3PNAA 1LKNA 4XUTA 3O0VA 3FHIB 3ZFGB 1LOFA 4BQ1A 2BU9A 1KS4A 1HQLA 1IS5A 4V1PA 1HIXA 4A7YA 1RTVA 5A6QA 5DZFA 1H2NA 5CVRA 3W58A 5DG1A 4CUCA 1LTEA 3WG4A 1JZ2A 1NXD1 2QBXA 1HN1A 2RS53 3WSOA 2JXAA 5C4WC 4NHLA 3I97A 1CAXB 1JZ8A 3J7LA 3KV4A 2DUQA 1IS4A 1F5FA 2P6HA 2K9ZA 2VBBA 1X9TA 1OD3A 4RQPB 5C33A 1J83A 5GZGA 2MEV1 4E9KA 5JXJA 1PMHX 2BBVA 3UGHA 1RMU2 4QM8A 1WCQA 4UFMA 2R063 1RUG3 5A33A 4AFDA 4GMP1 3DPRB 2W08A 3WW2A 2XJPA 1BMV2 2ENRA 1V6IA 4GQ7A 3POFA 3VBSB 5FPUA 4Y4RA 2YC4A 1XE8A 2GC3A 1NY71 3A23A 3ATGA 3J8F1 4HK9A 2BNMA 2J1TA 2JB8A 4K8RB 4XQWA 3J7MA 1Y43B 1RUH1 3JQWA 4XF3A 1VBC3 3E97A 4PIZA 2D6LX 2IUWA 4MXWB 2VZTA 1UNBA 2YC0A 2HWC3 3ZFGA 3A21A 2YV8A 3HN1A 3FWEA 2DWRA 2HYKA 2ZGLA 3CIHA 2WAAA 4AGGA 5CFCC 4OHVA 5FUPA 4BQ2A 4FPGA 4Y26A 2X8KA 1YCIA 4CP0A 4L0PA 3MFAA 1X50A 5BNNA 3W20A 4OI0A 1CAXA 1IHMA 1O4TA 4LKFA 3U78A 3H9AA 5BNPB 4QPGA 2G9FA 3DKWA 3VBHA 5IFTA 1C8NA 2DU1A 5LA2A 3BGAA 4COVA 2E6VA 5HCFA 2EICA 1LGBA 5BNNC 2ET7A 4NRMA 3APBA 4WV8A 2X5IA 3F2ZA 3TN92 4UFKA 1NCQC 1UD1A 2B45X 4OULA 4WM7A 2RDRA 3L2YA 5A3UA 1QJZA 1V9U3 4QDRA 3NJVA 1E5RA 3H3UA 1YQ8A 3JBG2 1ZBE3 2QFEA 4LO5B 3HIFA 3VBSA 1O3RA 2WINB 4CZSA 4NJ4A 1WBFA 5DAXA 4FTSA 2QQOA 2WFF2 3AFKA 1EYBA 3E5QA 1D4M3 4HBNA 4IEWA 4JKLA 1VBB3 3LD8A 1VAVA 2FQPA 1COV3 3MIHA 4X6RB 1ASJ3 4QWNA 1VAMA 1DGRA 3WZ1A 4KWJA 2ZEYA 5JMOA 1W6QB 2R49A 3LFMA 1PK6A 2J7MA 2XPJA 5A3PA 1SLIA 2UYBA 4R4ZA 3JUUA 2D3SA 2HKXA 5CKMA 3WP5A 4U36A 2YPJA 1UPSA 3ZMNA 4CCNA 3B01A 4HPKA 1BBT3 4K8FA 3UKTA 1YLLA 1HJGA 4LEJA 1VBB1 5C5TA 2XLGA 1RUF1 3ACFA 4QHBA 5BNPA 4XBLA 1L7QA 2VNRA 1AR62 1C1FA 5F6LB 4GB31 1AR83 5AC91 4MG2A 2QDNA 2VXRA 4GA9A 3GBGA 3MZHA 3I59A 4FPEA 2XONA 1SCSA 5FYHA 4FQ4A 4Q4X1 2BEOA 1GKBA 3KWVA 3K4AA 3AK0A 4PQQA 3VUOA 3CU7A 5I0SA 4DXZA 3I2KA 2W92A 4GWIA 3OUJA 1F35A 2PFWA 2UWBA 2QQMA 3IBMA 2C9AA 5FPLA 4LBMA 1NZCA 4Q8LA 5T5PA 1REDA 1U0AA 4LA3A 1O5UA 1HRI3 4NUBA 1I6XA 3BIEA 1S0IA 3T2TA 4Y5Z0 1RVF2 3HQUA 4LXLA 4RSUA 4BQ4A 1YRZA 4DS0A 5FO9B 5JOXA 5JZGC 2R32A 1NA1C 2RMU3 3GZEA 1IPJA 2I45A 3D82A 3WDWA 1DYOA 1MZEA 4F7ZA 1Q43A 3I3EA 1AX2A 2HWC1 4IV1B 1XU1A 2JD9A 4GXLA 3AMNA 3OJBA 1GOFA 3PTRB 4DUVA 2DCTA 1W2AX 2HWE1 2PLV2 4CPBD 5J36A 3LA3A 3U10A 3LWCA 1Y4WA 2KA3A 2UY8A 4YVWA 5DDJ3 4LO6B 1JN2P 1DZRA 3MICA 5F1RA 4BWOA 3CJIB 2QVSB 3V64A 1JU3A 4P08A 4XUOA 2OZ6A 2PN5A 1ULDA 4FSJA 3KMHA 1OC1A 1DZQA 1V0AA 2IVJA 4AEDA 4E2GA 3IPVB 5A1FA 2FDGA 4EN0A 1Q56A 2XKPA 1XSQA 4XETA 1UOGA 4WVMA 3GNEA 3JB4C 3WV6A 3PUSA 2FDJA 4ZU7A 4AFAA 4IV3C 1WLDA 3OBZA 4PDWA 1QDCA 2F4PA 2WA4A 4K7JA 2C1FA 5IFPA 5A3WA 4P9YA 1S0BA 4FVVA 5H9RA 2WQZC 2FDKA 2ARXA 4ZU4A 5AFEA 4AQ2A 1WZXA 1TMF1 4M01A 3WP6A 1V6KA 1MS1A 4A3ZA 4MXWA 4HKLA 4ZY9A 5DDJ2 4Q4X2 1UX6A 5FZMA 3ZPYA 5GZCA 4FBFA 1FPN2 4QD2A 2BFUS 3CJIA 3H8RA 1J58A 3Q8FA 2CGNA 1BQPA 4A42A 4AEDB 2DTWA 4XAEA 4P5YA 5FZ6A 2IXKA 3LSEA 4YW1A 3P5BA 1N3QA 1VBD2 4RD7A 2BWCA 4IE4A 2RG4A 3E6BA 1JZ7A 2DVDA 1HRI2 1NQJA 1W9SA 2PQSA 5LASA 2AEYA 3LCPA 1GNHA 4QU2A 4B7KA 5K9YA 5LY1A 1DQ2A 1ST8A 1O3SA 2LTNA 1OHFA 2ZMNA 1L7LA 4LR4A 2YPDA 2PLV1 5F39A 1UXZA 4YW7A 1MS0A 1W3XA 3RZJA 3LZZA 2JKXA 1XB9A 2GN7A 4YLZA 2C9KA 1QDOA 2ZGTA 2ZMLA 3P3NA 4LK7A 3WDXA 4PDWC 2GNBA 1AR82 5T5LA 3FHAA 5J7MA 1FOD3 1IG3A 2ZZJA 5T54A 3V0BB 4PQ9A 3OEAA 4Y24A 3DPRC 4HVRA 3ZXGA 4HMZA 4ET7A 1WMFA 5DABA 1BBT2 2Y64A 5A7OA 3MW4A 1J3RA 3NNLA 5JXIA 4QAWA 1ZRFA 2W1UA 1XNAA 3OBTA 2JG8B 3OUIA 4JGZB 4QM9A 2VD7A 4QX8A 4YG6A 5AVPA 1OD5A 3B69A 5FZ7A 5GALA 2BP6A 2VZ3A 5L9BA 1HX6A 5A1LA 1APNA 1ASJ2 3MLKA 3K77A 3SHRA 3OGSA 3TRSB 1PO12 3AYCA 3AKTA 2Q1FA 2WFF3 2JE7A 2CYFA 1C5HA 1TMF2 4DXSA 3CEWA 4W50A 4E27A 5K7PA 3MF9A 3JBG3 3SH3A 5C3SA 1GLHA 1ZBE1 2JE9A 4MGIE 1POV0 5C8CC 3B02A 3RWKX 2BNOA 1AR73 4KL1A 3VHPA 3TN93 5BY5A 4M3CF 5I0TA 3ZXDA 3VKMA 5HV4A 2Y0OA 1BEV2 3MW2A 4P9WA 2HWE3 1QH7A 5LBBA 3ZXJA 4QX1A 4FFHA 1GYKA 4RR3B 1CQ9A 4ZS3A 1Z7S2 3AMHA 1R082 3VDAA 2Y33A 4OHWA 5BNQA 4PIYA 4LE4A 4S2DA 1N1YA 5FY4A 4EN6B 5FDBA 1JYWA 2XVKA 2CU5A 4WVZA 5IAVA 1MR5A 2E32A 1RUI3 1TME3 1WGPA 2O8OA 2XLFA 4FXGB 2ET1A 4Y20B 4AVAA 4NROA 5FPXA 3GBFA 1DQ6A 1H6YA 1ONAA 5CADA 1W9YA 1YC61 1TNRA 4COWA 2ARBA 3KGLA 1TZOA 4PBOA 5CKQA 2ZX2A 4QHZA 4Y1XA 1AF9A 1WLCA 1PIV3 2RE9A 2R043 5IWFA 5JVVA 1K12A 4NWVA 3BPZA 1U5YA 2WFPA 2QTWB 4XJ8A 2R062 4GMP3 2VVFA 1RMU3 1CD3G 1GOHA 3WCSA 3POEA 4TYSA 4AYUA 3GZTB 3RYRA 2D7FA 2J1RA 2DCZA 4CCKA 3TAYA 1BZWA 4GWJA 1W8FA 3LFIA 3SNMA 2QQWA 2V5DA 2RS52 5E16A 2XKOA 1JHNA 5A7QA 3B7MA 1OH4A 1TEIA 2DV9A 3RVHA 4AFMA 5IYYA 4GJZA 2B46X 1ASJ1 2NYYA 1SLTA 3VGIA 4UFLA 2JDKA 1PO11 1UO9A 2ORXA 2WNVA 3TEXA 4IE7A 3SXWA 1H2LA 4DRRA 4BZ4A 5A1AA 5F6KA 1N47A 1ULCA 2FCVA 3KZ4C 5CG9A 2AC1A 4QKDA 2CNAA 2WABA 1AR93 1C1LA 4XPVA 1JTZX 2QKDA 3PTYA 3SC7X 3ZXLA 4BLIA 3VN4A 3VZMA 2BWAA 3WG2A 1HQNA 3TYJA 4ZKTB 3AP4A 2BUKA 5FMCA 2FZ1A 1KITA 1AR92 1AYM1 2BVVA 4MYEA 4P9XA 4Y3OA 4AI2A 4ZZ5A 4AFCA 1WCUA 2XJRA 3MBWA 1CAUB 1DGWX 5LEJA 3GCWA 3KB5A 5K0UC 1TQ5A 3LB9A 4P5HA 1UX7A 5DZEA 5FP3A 3MGUA 4BISA 2WKKA 4YM0A 1JS9A 3HBKA 1FYUA 4W6YA 4XCAA 4DIQA 5BNOC 1UOBA 2ZACA 1FX5A 4R9CA 4QGLA 4URTA 5J3UA 4LJHA 1FAYA 4OI1A 2GC0A 2GSYA 2QQJA 2ZEWA 1UWWA 1UU4A 2VW1A 4EZ4A 2JG8A 4FPHA 3WT3A 1UU6A 1W2UA 4XDOA 4UT5A 4MGSA 3KF3A 5CKNA 1UYXA 4R9AA 3VBRC 1KQRA 3AYAA 5ANQA 1GQHA 5T5JA 4F83A 1H1IA 3VL8A 2R071 5DAPA 5JI9A 1T6BX 2GU9A 2XJTA 2CDOA 5E8AA 3RNSA 1GOGA 1BK0A 4ZHNA 4Q4Y1 2EXHA 1UY4A 2ZX1A 1C8M1 4FOYA 3PU3A 4N43B 3ZPOA 5FYYA 1EAH3 3IAPA 3M7AA 4MHUA 4GAZA 1REFA 2MHFA 3IM0A 1CAUA 2BGCA 1KEXA 3AKQA 4PBPA 4YGCA 1OVPA 3ACLA 2VVEA 3TB0A 4XUPA 4LIUA 1XXNA 3BTYA 5BNOA 1U5XA 4Y5TA 5C6CA 1MS9A 2AH2A 1W99A 4EJRA 1W90A 4LO4B 5ISLA 5K0UB 1CONA 2OS2A 3HMYA 3VD3A 1QXJA 2PHTA 1W8UA 4LUKA 2ZGUA 1Z7S3 5A3NA 3O12A 4D7YA 4EWEA 4FPLA 4RHV3 1QF3A 5BYNA 1KFXL 1QOTA 2WNUA 3MLLA 4N7IA 3WCRA 1R1A3 4YW2A 4C1XA 2ZS6B 4CDQC 3WW3A 3B93A 1W6PA 3WY6A 3VBRB 1BVP1 2Q8DA 5F2WA 2QCSB 3SITA 4J6GA 1GP5A 1PO13 3WNOA 1GNYA 1LJ7A 1CAVA 2VPVA 3ME2A 3I49A 1SZBA 1X9PA 2PHRA 2XLAA 2NLRA 5ABJA 3QD6A 3NKTA 5K4LA 5LCWL 3NAPB 2G1MA 1UQXA 2VTXA 4TXWA 4YZ2A 4LKSA 4XFFA 3BTAA 5AFBA 5EIYB 1FMD3 5B2GB 5A6XA 2JIJA 1EY2A 3WP4A 1WA4A 4XURA 1DCSA 3PMEA 2NN8A 5LEKA 4Q1PA 2W87A 5L7OA 1EUUA 4B1MA 2BW8A 4OCTA 1YQ5A 4DY3A 3JD73 2R0FA 2ZBJA 3Q8EA 4ZPIA 4Q4Y2 4BQYA 4QX2A 4ATEA 2BQPA 1C8M2 2WN3A 1TE1B 2OYZA 3UNPA 4H7LA 1HKDA 2AR6A 2EXIA 4UWDA 2GZWA 2MPFA 2ARCA 1QJY3 1UMHA 3DN7A 5A32A 3VBOA 4LLOA 4DUXA 4LMFA 1PM7A 1VBE3 2WYSA 1PGW2 3LE0A 4BXFA 3B9IA 4Z2WA 4NAOA 1I9RA 1QJU2 4HVOA 4O61A 3VBUA 4AFBA 1F5JA 1LECA 3CJXA 3HNBM 4EN7B 5D8AA 3RZGA 4AI1A 1VE0A 3UV9A 3HWJA 2D3RA 1OOPB 2TBVA 3C7FA 4JKKA 1DF0A 4NIAA 3KLSA 4X8NA 3M3EA 5CBLA 3ZSKA 2VECA 1JU4A 2RS33 5I0DA 1LODA 3WNNA 4K40A 1W8WA 3ZFEA 2WO7A 3OPZA 3ZYIB 3WNXA 1W6NB 2X10A 3LEGA 2UURA 2WAOA 3V56A 1ZZBA 4ZXKA 1AR71 2QDRA 1DGRN 2VAUA 3PL0A 5FZBA 2D5HA 3N9NA 4HOOA 1UZWA 3GCXA 3DYPA 4BOWA 1XE7A 5HXMA 3M3IA 3AX4A 2VMIA 3DCQA 3PIGA 3R4SA 4UFHA 1AYN2 4TTGA 4RL7A 1GFF2 3BI3A 2DFCA 1VMJA 4FTBA 4XYXA 2RR11 3IMMA 3VDDA 5JAXA 4OMDA 4TN7A 3S5QA 2Q0AA 4FQZA 4QXKA 2B7YA 1UOFA 1NCRA 4W8JA 5FYCA 2DF7A 4E4HA 2Q5TA 5LWBA 4BQ5A 2E51A 5DUUA 5F8PA 4B4RA 1YFWA 5FMDA 2E7AA 5EP9A 3GDBA 5TSWA 5LBCA 5FJHA 1RXGA 4Y4YA 2YFUA 2QZ3A 4AVBA 3NV4A 1HQWA 4MH0E 4QDSA 1XYNA 5DZGA 5KC5A 1PNFA 2JKBA 1WMXA 1FT9A 4RA0A 3POGA 2RV9A 1LULA 4QPIB 4W65A 4AGVA 3FLPA 3E5UA 4CU6A 4IETA 2YXSA 1FPN1 1RUH2 2WO1A 4LITA 2PLV3 5GZDA 3WQ7A 3UKNA 1JYXA 1ZVFA 1NCQB 2GMEA 3J9SA 3N7KA 2MNGA 2YU1A 2HYXA 3GJAA 4QGNA 1VBD1 1CZVA 3R0RA 3VDDB 4YM3A 4AEMA 1GP6A 1WBLA 5HXVA 3KQRA 1RVF3 4I3PA 3M4FA 1JYIA 2DCKA 1UIKA 3ZIWA 1UKGA 3DEMA 4XFIA 1QOSA 1QEXA 3TEYA 1O4YA 2OKXA 4CDQB 2Q4SA 1S0CA 3VBFB 1OBNA 3THTA 2RM23 4B4PA 3W5NA 2QE3A 4NOTA 5FLJA 5L9VA 4NPRA 1RJ7A 4IGPA 2K0GA 3OBRA 5ABJB 1OLRA 4RFRB 3RZKA 2GH8A 3OY8B 5BPXA 3GZAA 4B7EA 4E4DX 2HBTA 1EPWA 2IFRA 2JDPA 3QH6A 1PM4A 3I2IA 5FIXA 4AI0A 2RR12 4L2NA 3FFQA 2BV4A 1RUD1 1QQP1 1D0HA 3I8TA 3NW4A 1HXS2 4LPLA 2TEPA 3I3QA 3KF5A 1CVNA 3OUHA 4B29A 3C8XA 3E5XA 5IW0A 1GV9A 5I0RA 3U4XA 4EWAA 3ILFA 2B39A 3ETPA 1SLCA 2HWB3 3ECQA 3CDZB 1VBB2 1W6QA 2BBAA 1D4M2 1VPHA 3GZUC 4OVEA 1GP4A 2R1DA 1LCLA 2Y6FA 4FPCA 1ZBE2 5L73A 4CP1A 5LA9A 4COZA 3HT1A 3AP9A 4PLNA 4D0QA 1RYYA 1EV12 2VULA 4C91A 1FV3A 3GBWA 4QQOA 2YFZA 1QNWA 4HSJA 1MEC2 2YROA 4YGEA 1YI9A 5IVBA 4FAGA 1BEV1 3D0SA 3WOGA 3RG0A 3VV1A 4CVUA 1ULGA 2HWF1 1C28A 1VRH1 4LKDA 2Z42A 5JIUA 4TWTA 5SV8A 2WZR2 1CGPA 2C5DA 3KHBA 1TNFA 2QQKA 3AVSA 1IQDC 5CG8A 3LF7A 5FPVA 2YC2A 1RINA 3IT8A 1IS6A 1GWLA 3U07A 2G9ZA 5BNNB 1XNCA 1O3TA 1RUJ2 5EFUA 3VKOA 3AXEA 4UBGA 3N7JA 1OUSA 1KGYA 1NA1B 2DVAA 4QPYA 1J3PA 2CHHA 2HWC2 1GZTA 1QY4A 1WA6X 3LEIA 3ORJA 2AUYA 5D8AC 1A8MA 4K1YA 4EN8B 3B94A 5B4XA 1VBC2 3HN3A 4E4ZA 4GKXA 3FC0A 2JENA 4S2GA 1OQ1A 4IV3B 1HRV1 3WF2A 2VMGA 4WM7B 5T55A 2VTXJ 3SKJE 3UT0A 4AE2A 4DEVA 2E33A 4XF0A 2R6QA 3MI8A 4Q4V2 1VLNA 5FZOB 3THCA 1NG0A 2VJXA 3TNPB 1S2EA 4QKBA 3MPBA 1UY0A 5KC6A 5FZCA 1RUG2 2QQUA 1JMUB 3PLQA 4OYUA 1UN1A 2P3KA 1YHFA 2A1XA 4DY5A 3AZZA 1YYNA 3GGLA 2V5YA 2R0HA 1W6OB 3RJRA 4DXTA 1PX3A 2E31A 1LHWA 1H6XA 2OUJA 2J22A 4DPNA 1W03A 1QJX1 2R30A 5LBFA 2L9LA 3ZYGA 3BKZA 2A5ZA 5G04L 3QOPA 1MQTB 2YGLA 4CYDA 5JLVA 4ISQA 1W8OA 1D4M1 1L3JA 3FMGA 1PNGA 1X36A 3OCPA 3SH5A 3DXUA 4Q0QA 3IDBB 1NAEA 2HWB1 3POWA 1V9U1 3NNFA 1LHUA 1O8SA 4PLOA 1G7YA 3WNMA 4CUBA 2FMYA 5JXGA 2YDEA 3HPNA 3H8OA 2FBEA 3ZLIA 4XF9A 1G9CA 2WBKA 3HAGA 5DUVA 4H3WA 3AP7A 4LBQD 1D2QA 3R6SA 3W9AA 2EVXA 2VBDA 2WUHA 1RUD3 1X7NA 1ZA4A 4OQ9A 2ZHLA 4A2UA 1N1VA 2WSVA 1E57A 2WNEA 4Y1YA 1RHI3 1W2TA 4XXAA 4JC1A 4EQVA 1F9KA 1RUJ1 1W2OA 1XJAA 2LUWA 3CKHA 1ZZ9A 1B35A 4TZDA 4A41A 1KJLA 2DVGA 1YQ6A 1HB2A 2PA7A 4Q4V3 5FYUA 1PO22 3NL1A 2GNTA 1POV1 2JDMA 4MLOA 4YM1A 2RM21 3EMRA 3VZNA 5IAXA 2DBNA 4HONA 4AEJA 5ERLA 4JHTA 3ZFEC 4J25A 4WBBA 5SV5A 4C1WA 2B9UA 2CL2A 2JWPA 3J8F3 2DDUA 3DYOA 4DEQA 1V6JA 5FXWA 3IMNA 5FXXA 1NXMA 3VZLA 1AX0A 3OBAA 1JYVA 1Q8PA 4V2VA 4CDXC 1RUG1 4LA2A 1VR3A 4YFWA 1WMDA 5A3TA 2O8QA 3N7LA 1WCSA 2JG9A 1JHJA 1W9WA 2R072 4RS5C 3WW4A 3U14A 3SQOA 1IQAA 2DVFA 3VKLA 3SKVA 4I01A 4I30A 3AMPA 5J1XA 2RJKA 2WZR3 4AI8A 5BNOB 1QOOA 3ZO0B 1H8TC 1YUDA 4NIGA 3VD4A 3R05A 4L8QA 4GH4B 2PHFA 1LU1A 1MEC3 2QQNA 3WG3A 2YZ4A 5CFDA 2W2IA 4R4XA 1S0GA 2ADDA 3USSA 2Y6KA 4BH9A 4XJWA 3PUAA 1HB1A 3SCFA 3M8LA 5FYVA 3EB7A 4DRVA 3GF6A 1TG7A 3RRDA 3I3MA 4ZS2A 3N4MA 1NCRC 4NPMA 4R9BA 5LA1A 1OURA 1Y9GA 5FAXA 5C5UA 4FO9A 3FUOA 4I2OA 4W4ZA 5M0TA 5KHHA 5JSPA 3KSCA 3HD8B 1BVVA 3NV2A 1HXS3 4UFJA 4H55A 2ZEXA 2ZHKA 1IZ3A 3VLBB 4CDUB 2EXKA 1PVC1 5KXCA 5ABJC 1R081 3J4UH 1LR5A 2FZ2A 2GN3A 3FE5A 2AEZA 3ZSLA 2Y34A 3OYWA 4CCMA 1REEA 5H9QA 3VZJA 1H1AA 4HKWA 4QX0A 2O14A 2WLQA 4D6QA 1LEDA 1OA4A 4IE5A 5EJ3A 2FCTA 4ITCA 2XJSA 2ZTNA 2AREA 1JYTA 1CZTA 4P02B 4ARYA 1KDMA 3AL6A 2E7QA 1US2A 3QBQA 3ZN5A 1AJKA 2YU2A 4XTMA 2VZRA 4Q0PA 5JPMB 2VMFA 2OPKA 2Z4FA 2OZJA 2RS31 2WN2A 4G4FA 5EHDA 1AL23 3N9QA 4YARA 4NIIA 4Y20A 4JDNA 3ZYBA 2O0OA 4HN0A 4E8DA 4GWNA 2CV6A 4AVSA 2RS11 4LNVA 1ZREA 1W8HA 3CNAA 5FWEA 4F8AA 4Q4W3 1W8ZA 1WD3A 3EBRA 2GAUA 1WUVA 3JZVA 4Q26A 2AYHA 3VHNA 1SMVA 3PVNA 1GWKA 1O5LA 2WSUA 3RFRA 3N7MA 2XQRA 1LOAA 1QJY1 4CP2A 2D3PA 1NLRA 1EPZA 3IWZA 1XU2A 2Q1ZB 4LTAA 1W0NA 3RS6A 5J96B 3ES1A 1RL3A 2Y26A 4GZ9A 4AHWA 1LGNA 1NKGA 2QQIA 2UU8A 4WZCA 1AL0G 4I09A
chains in the Genus database with same CATH topology
1YC61 1JS9A 3J7MA 3J7LA 4NIAA 3J7NA 4OQ8A 1STMA 1CWPA 1A34A 1ZA7A 4OQ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YC6 1;  1JS9 A;  3J7M A;  3J7L A;  4NIA A;  3J7N A;  4OQ8 A;  1STM A;  1CWP A;  1A34 A;  1ZA7 A;  4OQ9 A; 
#chains in the Genus database with same CATH topology
 3FLR A;  5E89 A;  2XBO 2;  1GU3 A;  2D98 A;  3H42 B;  4JKM A;  2Q8O A;  3I2H A;  4IL7 A;  2EIE A;  4NHY A;  4Q8K A;  1JZ4 A;  3O1R A;  1ZRC A;  5EWS A;  1F31 A;  1QGL A;  1W6N A;  2VZP A;  4RS5 A;  4ONU A;  3H3Z A;  4RR3 C;  5IVC A;  2GND A;  1A34 A;  5IHR A;  2BVB A;  5FY0 A;  5FR3 A;  1PGS A;  3Q8A A;  4AW7 A;  2DCY A;  3HQR A;  4KBZ A;  3HOB A;  5CNA A;  4Q0S A;  2UWA A;  4HPK B;  4BK5 A;  1CR7 A;  5FP7 A;  1PVC 2;  5C3P A;  4GD4 A;  5JSR A;  1ACC A;  4YM2 A;  1NLQ A;  3IN9 A;  5FUI A;  4CTE A;  1AYN 3;  4XIK A;  5C7G A;  5C3O A;  3AKR A;  3VHR A;  2IC1 A;  3LAG A;  4R9D A;  5LRS A;  1HW5 A;  1AYN 1;  1W6M A;  3MUZ 1;  4G3Y C;  3ZYH A;  3I2G A;  2E53 A;  3O0X A;  2WYF A;  2Y60 A;  4I3G A;  4LBQ A;  4MGY E;  4OUE A;  3ENR A;  1OH3 A;  1PZ7 A;  3A4U A;  4QPG C;  1PVC 3;  4IE0 A;  4RHV 1;  4N53 A;  1GUI A;  4D3W A;  1R1Z A;  5T5O A;  1VAK A;  2RS3 2;  1QXP A;  4HL0 A;  2LM3 A;  1K5M B;  4XF4 A;  3RWN A;  3CZJ A;  5CFC A;  2PHW A;  3ALQ A;  1H9P A;  3MIF A;  3C7O A;  3WF4 A;  2CSG A;  4NHK A;  3RJ2 X;  3T0A A;  4B3N A;  4RGK A;  5HI0 A;  3AP5 A;  1CAW A;  5FPZ A;  1QJU 3;  1CJP A;  4BMB A;  5CFD B;  2NMN A;  3NNG A;  4KGG A;  3ZSJ A;  3LIG A;  4Q0V A;  1WW4 A;  3BOD A;  1GR3 A;  1UOJ A;  1LAJ A;  1Q3E A;  3H0O A;  3CO2 A;  5LRR A;  2OVU A;  4E2S A;  1DHK B;  3HEI A;  3OD0 A;  5EXO A;  3D8C A;  5FWJ A;  2JB4 A;  1V6M A;  4DXR A;  4NO4 A;  1CES A;  1C8M 3;  1N1T A;  3WNP A;  5KHI A;  1FV2 A;  1V70 A;  3NVC A;  2ZXQ A;  4FFF A;  2ZGR A;  1JI6 A;  2ZJC A;  1SEF A;  2DUO A;  3T4H B;  5EQU A;  2XBO 1;  2A73 B;  1I5Z A;  4MUV A;  2P3I A;  4UW4 A;  4XVH A;  3LIH A;  4YW4 A;  5A7W A;  1LHN A;  3ACI A;  4YRD A;  5KHJ A;  4Q4W 2;  3V0A B;  2H6C A;  4DFS A;  5FQ0 B;  1K5M C;  4XW3 A;  1JBC A;  2RS1 3;  3RMX A;  3WEZ A;  1LOB A;  2HWD 3;  3U75 A;  1GAN A;  4Q0U A;  1FMD 2;  4NWW A;  2XJQ A;  3QH7 A;  4XAB A;  5DUW A;  3RZH A;  1U12 A;  2DTY A;  4Y1U A;  2JIC A;  3ACG A;  5G05 L;  4AI9 A;  3PHM A;  4DB5 A;  4ZZ8 A;  2XR4 A;  1UY2 A;  2WZE A;  3ABZ A;  5K0U A;  3ZYJ B;  4UF0 A;  4CEY A;  1XSR A;  1K3I A;  2VW2 A;  5FBJ A;  3ON7 A;  2ZHM A;  1QJF A;  2K2S A;  3NQH A;  1W0O A;  1PK6 B;  1ODM A;  2IXH A;  4LHS A;  4XTP A;  5FK8 A;  4A6S A;  4BXS V;  5A6Y A;  4AWD A;  5ACA 1;  5LA0 A;  1M06 G;  4KG0 A;  5F5C A;  4IEP A;  4MGQ A;  2P2K A;  2VM9 A;  4KI5 M;  4MX3 A;  4UXA A;  4Z92 B;  1OLQ A;  5JSO A;  3AJY A;  1SDW A;  3T09 A;  4LUM A;  1LEM A;  3ASI A;  1QQP 2;  3S5A A;  2E26 A;  2KD7 A;  3NKG A;  4RHV 2;  3H1Y A;  3S30 A;  5L36 A;  4MGZ E;  1DU3 D;  1JOP A;  3MID A;  1WKY A;  2VCA A;  2LRO A;  3GHN A;  1J59 A;  3H7J A;  1ZX5 A;  5FRA A;  3V0A A;  4AXO A;  2NQY A;  4IE6 A;  1RUE 1;  2WT2 A;  4A6O A;  2W3J A;  4W6X A;  4Y22 B;  2XL7 A;  4M3C A;  1VB2 A;  4MOA A;  4BLJ A;  3U37 A;  4EWD A;  3ITQ A;  2A6W A;  4FAH A;  3L9J T;  4XFC A;  3AZV A;  1GBG A;  1MS8 A;  2BGP A;  4MZU A;  3NJZ A;  4URA A;  2FD8 A;  3WF0 A;  1ND3 C;  4AOC A;  2V4A A;  1VMH A;  3A0K A;  3K3O A;  4CU9 A;  1MEC 1;  5DN2 A;  5HV0 A;  3OEB A;  1UKR A;  2HWF 2;  2IXL A;  2VOX A;  4D94 A;  3HVD A;  1ZZ8 A;  2A71 A;  5FP9 A;  5GJ6 A;  4QGM A;  4XJA A;  2GAL A;  5EYX A;  2VZO A;  1T2X A;  3V0B A;  2PYT A;  4FPO B;  5JCT A;  5APA A;  4CXX A;  1MS3 A;  2VMD A;  4WZF A;  4MHR A;  3O5S A;  4BME A;  3ZSE A;  2PHD A;  2AEN A;  4DNY A;  1UZY A;  3HNM A;  2R04 1;  3VB9 A;  4YZ1 A;  1J1L A;  1GIC A;  2HH9 A;  1V6O A;  1H4H A;  1NY7 2;  1WWY A;  2BGO A;  2GC1 A;  3J8F 2;  4LBJ A;  2WJS A;  5FZL A;  3ZOI A;  4KNC A;  4TLG A;  2P3J A;  2Q1M A;  4XZU G;  2C24 A;  4AHY A;  1KS5 A;  1BXH A;  1ZM1 A;  1W9F A;  1PO2 3;  2OQ7 A;  4AL9 A;  4CDW C;  4HXC A;  4QT6 A;  1DGL A;  3LGR A;  5C71 A;  1UY1 A;  3T3Y A;  1H2K A;  5I8Y A;  4BJ0 A;  2W68 A;  2XH6 A;  2VR4 A;  4BM8 A;  5C9A C;  1GNZ A;  4EYU A;  3I2O A;  4JCK A;  3IAQ A;  4ATF A;  4NIH A;  2J1U A;  3WDY A;  2BNN A;  5D1I A;  3VKN A;  3ILN A;  3LDB A;  3I4I A;  4AQT A;  3JCI A;  4K1Z A;  1MZ5 A;  1OXC A;  5GLV A;  3BAL A;  4AHX A;  5C8C A;  1VRH 3;  2XVG A;  1PX4 A;  1V00 A;  1ALY A;  4PI2 A;  4XFG A;  1S55 A;  1QJX 2;  1MS4 A;  1M4W A;  2YMZ A;  5DAV A;  3H8U A;  5F3C A;  3USU A;  4IV1 C;  4NHX A;  2F4L A;  5FZ4 A;  3POB A;  2VUD A;  4B1L A;  2JEM A;  4NID A;  1RUF 2;  5A3L A;  1WLT A;  4IEY A;  1AR6 1;  3H50 A;  3I2F A;  2I74 A;  5CZK A;  2JEC A;  2VZS A;  1NZI A;  4QX5 A;  3J7H A;  4GB3 2;  4LOT A;  2JD4 A;  3MDP A;  2GP3 A;  4FFG A;  1J84 A;  1LOG A;  5A80 A;  4BIF A;  3UL2 A;  3E6C C;  4KMQ A;  4Z07 A;  1DZT A;  4RFT 0;  4XDP A;  3O1T A;  4ORF A;  1XOY A;  1GQG A;  1G8W A;  3EYP A;  4H2A A;  3BUC A;  4CCD A;  1ND3 A;  1POQ A;  2D93 A;  3VBO B;  4E8C A;  2WZP P;  3PJQ A;  3CMG A;  4AVV A;  5K8S A;  3AZW A;  2ZGQ A;  4C0H A;  4YW3 A;  4DZG A;  1KFU L;  1RC6 A;  3WR0 A;  4AEK A;  2C0Z A;  4I02 A;  2YBS A;  1OOP A;  5FYB A;  3UGG A;  2WZ8 A;  4IDZ A;  4XUQ A;  1X8E A;  5DUX A;  4ASM B;  4JGY A;  1UYY A;  4CCE A;  2R04 2;  4LHL A;  1PIV 2;  2BFU L;  2WS9 3;  4L92 A;  3KV5 A;  1IKP A;  2SBA A;  5FMO L;  4J1X A;  4M4P A;  1AL2 1;  4W6W A;  1VRB A;  2W1W A;  2IXI A;  2X29 A;  3I3D A;  1MVQ A;  3NJX A;  4N9I A;  4XHB A;  4XMA A;  3P3P A;  4L9B A;  1VB4 A;  1CX1 A;  3AJZ A;  1LHV A;  5CIS A;  1Y3T A;  2YBK A;  5FZ9 A;  5I0U A;  1ZBA 1;  2Y6J A;  2Z79 A;  2RDS A;  3C7E A;  1LB2 A;  2B4K A;  4UW5 A;  3KT7 A;  1OFS A;  5LBE A;  3K2O A;  3OSD A;  4V2W A;  4P9L A;  3M2M A;  3VBU C;  1UZV A;  4AF9 A;  5I91 A;  3Q9O A;  4Z1V A;  3O1S A;  1F8V A;  1ENR A;  4O9G A;  3ZN6 B;  5FY7 A;  1HXS 1;  2UYA A;  4LT5 A;  5EJ1 B;  2HWE 2;  5HPO A;  3ZR5 A;  1UF2 C;  1YQ2 A;  5FTT C;  4JRA A;  2D6K A;  2YHJ A;  3ZSM A;  2P3Y A;  2VXJ A;  4Y33 A;  2D6N A;  1CAV B;  5KHK A;  4IER A;  1EV1 3;  2D44 A;  1OKO A;  3VBH B;  5IT6 A;  3PUI A;  1UIJ A;  5IVE A;  3NAP A;  1AUY A;  1MQT C;  2VZ1 A;  5H9P A;  2FDF A;  3WUC A;  5FXV A;  2GC2 A;  3D5O A;  1U5Z A;  1LOF C;  3MLJ A;  3WW1 A;  2DCJ A;  5BUV A;  1STM A;  1X8M A;  5IK7 A;  3KD4 A;  4QQH A;  2IFW A;  3SEP A;  1F4H A;  2RJ2 A;  5FCC A;  5FFO C;  1QH6 A;  2YY1 A;  4HK8 A;  2WNO A;  4FP3 A;  5FUN A;  1MZF A;  4XBQ A;  5DXD A;  1YIF A;  2QQL A;  5FZ1 A;  3VDD C;  2A3W A;  5EZW A;  3TOJ A;  1KDK A;  1EP0 A;  2WZR 1;  3KQ4 B;  2D40 A;  2GMM A;  2WA3 A;  3FHQ A;  3T4V A;  2RR1 3;  4XQD A;  5KWR A;  3RZL A;  3AMQ A;  4N7U A;  1C57 A;  2OW4 A;  3INA A;  4FPJ A;  4JDO A;  3UKV A;  5FZ0 A;  4EZH A;  5FP4 A;  3ES4 A;  1IPK A;  3WQ1 A;  4N43 C;  4YVW C;  2RDQ A;  5FK7 A;  4QB6 A;  2Q8C A;  2EAK A;  1ZBA 3;  2GNM A;  3M70 A;  3UJQ A;  4C90 A;  4BHP A;  4N43 A;  4N53 C;  4IND A;  1Q8V A;  1PHM A;  1PGL 1;  2VQA A;  4CDW B;  1W8N A;  2HEV F;  4MAD A;  1HRV 2;  2Y6G A;  4Y1Z A;  4KU8 A;  1GQP A;  2VQT A;  2OII A;  3J7N A;  1NA1 A;  4HT1 T;  1POV 3;  1ND2 A;  5JZG B;  1VMF A;  2VNO A;  1WCD J;  4WM8 B;  2YUE A;  2W52 A;  2WS9 1;  5F7U A;  2EID A;  2VU9 A;  5HCA A;  5A3O A;  3A22 A;  1EUT A;  2ZGS A;  5C4W B;  5F3G A;  1A8D A;  3LPG A;  4JV4 A;  4HG6 B;  1Y9M A;  3RMY A;  1B09 A;  1AXY A;  2Y6L A;  1QMJ A;  5FY5 A;  3RPQ A;  1NOV A;  1IS3 A;  5L9R A;  5JR2 A;  1Q8O A;  2WWS A;  3AB0 A;  1FPN 3;  3ZVX A;  3FJS A;  3FX3 A;  1ENQ A;  5DAW A;  3HR9 A;  2VW0 A;  5J37 A;  1IKQ A;  1W6P B;  2PAE A;  1E5S A;  4FPF A;  4QXC A;  4FT8 A;  5F5A A;  3TEZ A;  4GB3 3;  1H8T A;  4PCR A;  2K46 A;  2PEL A;  1S0E A;  4QQP A;  4WVV A;  3MW3 A;  4HAN A;  4OHX A;  5H9S A;  3V65 A;  1RUF 3;  2Z2S B;  2B42 B;  4IGO A;  1D0G A;  2GDF A;  1MQT A;  2I07 B;  4Q27 A;  4HVQ A;  3T0D A;  3THD A;  4GIQ A;  4CEW A;  3G6J B;  3B3Q E;  2X05 A;  3M3Q A;  3MIG A;  1H8V A;  1KXG A;  1UW8 A;  1Z0H A;  4QXB A;  1QJX 3;  5C8W A;  4WVW A;  4RN5 A;  3T2O A;  5CEH A;  4ZON A;  4XF1 A;  1QNY A;  1W6M B;  1DLC A;  4FPY A;  1N1S A;  3E1F 1;  4DQA A;  1O91 A;  5C4W A;  3ZXF A;  4CRQ A;  1G9F A;  4YPJ A;  2EIB A;  3AL5 A;  2H6B A;  2V4V A;  4CUG A;  3LKJ A;  2XQX A;  2D6O X;  4LLF A;  5I8T A;  1DG6 A;  1S0J A;  4FPK A;  1NCQ A;  2JG9 C;  5FYS A;  4FOQ A;  1OPO A;  2QQV A;  3VL9 A;  2E63 A;  1XNB A;  2OX0 A;  2WT0 A;  5GM0 A;  1WME A;  4DIN B;  3S57 A;  4FOW A;  5E6H A;  2ARA A;  3EXU A;  3HJR A;  1LNS A;  4KH9 A;  5FKB A;  5IK5 A;  3AKP A;  1H1M A;  3GXU A;  5FZO A;  3BIW E;  3PDQ A;  3U11 A;  4CSW A;  1YWK A;  1Z7S 1;  2LAL A;  4AQS A;  2IVI B;  4HKO A;  4JVA A;  2ZKN A;  4X8P A;  3VBU B;  3U0Z A;  4CDQ A;  1SHW B;  3ZFG C;  5F37 A;  2KXL A;  4IEV A;  1I5P A;  1ULF A;  4LIV A;  5F3I A;  4YFZ A;  2CWS A;  4CDX B;  3AYE A;  1VBE 1;  5IK8 A;  3NST A;  1AVB A;  2O1Q A;  5FZD A;  4HN1 A;  5J98 B;  3WLU A;  2G9G A;  3AC0 A;  3WNK A;  4UFI A;  2ZAH A;  1UZZ A;  1D7P M;  3B9C A;  4J1W A;  3RSJ A;  2A6Y A;  3DV8 A;  4YNI A;  2ZEZ A;  1CX4 A;  1K5J A;  3ZYR A;  1UYZ A;  1Y7B A;  3K4D A;  2HJI A;  4QKN A;  4QPI C;  2P37 A;  3PUR A;  5LK7 B;  4K9S A;  4Q4Y 3;  4XFA A;  5FZF A;  1G6N A;  1ULO A;  4ES9 A;  3CF6 E;  4NHM A;  4M3C E;  5IVV A;  1E5I A;  4Y5S A;  4DUW A;  5CFD C;  2JG8 C;  1NLS A;  2I2S A;  4Q4W 1;  1A78 A;  3NMB A;  4QQ2 A;  1RJ8 A;  1RUE 3;  2VVD A;  3HT2 A;  1N3O A;  1BCX A;  1FMD 1;  2RHP A;  4XQ4 A;  5JUV A;  5IVF A;  1K42 A;  1NCR B;  2R7E B;  3PVB B;  1YEW A;  4NVP A;  4COU A;  4PJY A;  4QDQ A;  3M3O A;  4IV1 A;  1XC6 A;  5E88 A;  4GAL A;  5A7N A;  2JDZ A;  1NUK A;  5CYY A;  2ZCW A;  3OPW A;  2XHK A;  4KU7 A;  1SFP A;  1COV 2;  2VOW A;  1DIW A;  1H4G A;  2AZ5 A;  3NV3 A;  3QAC A;  4XIL A;  5EYY A;  1HLC A;  4CDX A;  1DDL A;  1UCX A;  1JOD A;  4JGZ A;  2ZGP A;  2QZ2 A;  3N9O A;  2A6V A;  2XOM A;  3AKS A;  2W91 A;  3DF0 A;  4QKF A;  4AVC A;  3NNJ A;  3BB6 A;  3IKW A;  3C7G A;  5IVY A;  3OF1 A;  2VQ0 A;  4LK6 A;  1S0F A;  4JQT A;  4X6Q B;  5AVA A;  3ZYP A;  1R1A 1;  2WWU A;  3IPV A;  1OA3 A;  3OYW B;  3SLI A;  4ZXE A;  1ZRI A;  3ST7 A;  3BU0 A;  2XUE A;  2YGM A;  1SBE A;  2YYO A;  4HLT A;  1HB4 A;  4COY A;  3D4K A;  3H1W A;  1G9A A;  1XPW A;  3JQX A;  5L7O B;  1BK1 A;  1CPN A;  3EHK A;  4MV2 A;  5FY8 A;  1MZ6 A;  4B4Q A;  2VBP A;  4FTE A;  1GZC A;  3LDR A;  3LDK A;  4LBK A;  2R16 A;  2RS1 2;  4YW6 A;  1RUE 2;  2HWD 1;  2A70 A;  2ZAA A;  3DEC A;  4IEZ A;  1AHS A;  3AFG A;  4OI4 A;  5I93 A;  1D4V B;  2BJS A;  2ES3 A;  3CLP A;  3MIE A;  1YFU A;  1A6C A;  1XND A;  2E7T A;  2JDA A;  3OG2 A;  3WDU A;  5FZH A;  4MSV A;  3OGG A;  5EV7 A;  1ZZ6 A;  4YG0 A;  2V09 A;  3PJY A;  4HZF A;  2ZGN A;  3GHM A;  5FLI A;  1W2N A;  3KGZ A;  1SLB A;  3OOX A;  5KXD A;  4A3X A;  5IVJ A;  1QU0 A;  3OY8 A;  5C3Q A;  2BDR A;  2CDP A;  3BTZ A;  1WLW A;  5HCH A;  1LEN A;  1LOC A;  1UAI A;  2ID4 A;  2OPW A;  3POJ A;  4RQP A;  4FCA A;  5JR7 B;  3MFC A;  1SLL A;  1DYK A;  4K20 A;  3W59 A;  2AAC A;  1W28 A;  2IZW A;  5LK5 A;  1F15 A;  2D5F A;  5GLZ A;  2GMP A;  3IZO A;  5A33 B;  3O0W A;  1ZYB A;  2D6M A;  4QX7 A;  2QQP A;  4ASK A;  3A0N A;  3NJY A;  3WF1 A;  3ZDV A;  4XBN A;  3ROU A;  4MO3 M;  4I0B A;  5FPA A;  5L19 A;  4WM8 C;  1YFX A;  2W94 A;  4FP2 A;  3IDC B;  2C4X A;  4D7T A;  3P1I A;  5F5Q A;  5C9A A;  3N9L A;  4Z82 A;  5DQ0 A;  3VZO A;  1SBF A;  4P14 A;  4UI9 L;  4CCL A;  3LPF A;  4GUL A;  2XB6 C;  4YZ3 A;  1DP0 A;  5FY9 A;  2P34 A;  3FLT A;  4YVW B;  1RUC 2;  3L2H A;  1QKQ A;  3OTF A;  4GJY A;  4GWM A;  2PQQ A;  3KHC A;  3T30 A;  1S4C A;  2EXJ A;  3DKQ A;  3ACH A;  2JDY A;  1SCR A;  4XDQ A;  1DBN A;  3CL1 A;  4DMI A;  3EJK A;  4JX0 A;  3VKF C;  4BQW A;  4NE9 A;  2VY0 A;  3I3B A;  2CGO A;  4RGA A;  5GLW A;  2XL9 A;  3GJB A;  4Q5O A;  3CJI C;  1PZ8 A;  5BXX A;  1S1A A;  3VHO A;  3BU7 A;  4P9J A;  4Y1V A;  5JIA A;  3VZK A;  4HSL A;  4M0H A;  2SLI A;  4OHY A;  4PLM A;  3VD9 A;  1GZW B;  2PHL A;  3ZMO A;  3CHX A;  5FMO S;  2JDU A;  3RYK A;  4EE2 A;  3C2U A;  5B4N A;  1BYH A;  1K5M A;  4Z2A A;  3SCG A;  3N9M A;  2XBO 3;  4ES8 A;  1AZD A;  3W5M A;  3FZ3 A;  2A6X A;  2H0B A;  3LSD A;  3WD5 A;  4CCC A;  3KCX A;  4L11 A;  2XXZ A;  2VCM A;  4YGB A;  3WQB A;  4E2Q A;  1RUO A;  2PHU A;  3AMM A;  5DAQ A;  3RYP A;  3W21 A;  1JOJ A;  3VBF C;  3III A;  4QU1 A;  4DOU A;  4BYY A;  2ZGK A;  3DPR A;  2A3X A;  3ZYF A;  4Q1R A;  3E6D A;  3JD7 1;  5A3M A;  1RUN A;  2ORZ A;  4FI9 A;  4RYD A;  2VQU A;  3MEP A;  1RGS A;  3RDI A;  1QJU 1;  1RMU 1;  4CP9 B;  5LW9 A;  1FOD 1;  2VO5 A;  1R09 3;  2CWM A;  3CQO A;  1A3K A;  4LOS A;  5IUQ A;  3ZR6 A;  1Z78 A;  4AVT A;  5EJZ B;  4CPB A;  2GP5 A;  4UBH A;  4YSF A;  3K51 A;  2JDN A;  2W1Q A;  4O7X A;  1AL2 2;  5A7W B;  5LY2 A;  1ODN A;  3X29 B;  4QX3 A;  4SLI A;  3I59 B;  4CCO A;  4JRL A;  1RXF A;  1HRV 3;  1NT0 A;  5GLT A;  3WDT A;  4HFS A;  5FQ0 A;  1JZ3 A;  4KG8 A;  3KVB A;  4AI3 A;  2J1S A;  2D6P A;  3JXS A;  2IWG B;  3RI9 A;  3URF A;  5BV6 A;  2W95 A;  3KT1 A;  1ZBA 2;  4TLF A;  4QPG B;  5KXE A;  1RUI 2;  1TME 2;  2VE1 A;  2DBI A;  5FP8 A;  1C5I A;  4CDU A;  4LBQ B;  4EV0 A;  4CXY A;  1DGW A;  3PUH A;  5FRE A;  3NO8 A;  1JXN A;  2W46 A;  2Y8K A;  4B8E A;  1H30 A;  2TNF A;  4Z8B A;  1R08 3;  1VJ2 A;  2ILM A;  3UJO A;  2CTV A;  1SG3 A;  4I0W B;  1JUI A;  2A7A A;  4KBB A;  1BEV 3;  2PAM A;  3C3V A;  3WNL A;  2G19 A;  3RQ0 A;  3K4Z A;  3AM2 A;  2G4I A;  2OUH A;  1HJF A;  1AR7 2;  1V6L A;  1WCK A;  1CAW B;  1JYC A;  2JIG A;  2OT7 A;  2YB7 A;  2YG0 A;  1GMM A;  3B00 A;  3M3C A;  3OGR A;  4P00 B;  1OQE A;  1KD7 A;  2QJV A;  2VMH A;  5FPB A;  5CU1 A;  2FHR A;  2KM2 A;  2Z5W A;  5JOY A;  2JDH A;  5LZ6 A;  2BRT A;  5T50 A;  4P9G A;  2CGP A;  1TMF 3;  1Y9Q A;  1OPM A;  1H0B A;  1SDD B;  1G9B A;  1IOA A;  4C8D A;  3ZXA C;  2BOI A;  5FYI A;  5BNP C;  3WP3 A;  2XWB B;  3ZDS A;  4M4R A;  4BCU A;  1ZNP A;  5JOW A;  3KM5 A;  3MYX A;  1EAH 1;  2HEY F;  4PT6 A;  3VD5 A;  2BYV E;  2VZQ A;  4XHX A;  4MXV A;  1OUX A;  2PXJ A;  4LBN A;  4PDW B;  3KV9 A;  3ZM8 A;  1JZ6 A;  3POY A;  1VP6 A;  4D8M A;  1VIW B;  1UMI A;  1FAT A;  5I8S A;  3NNM A;  4FFI A;  4OHZ A;  4XE9 A;  1JH5 A;  4IUG A;  2WC2 A;  1FOD 2;  1LHO A;  2WQ8 A;  4IEO A;  5FBZ A;  2ZX0 A;  3BPS A;  1O3Q A;  5FY1 A;  4LE3 A;  3T08 A;  2LW8 A;  1SPP B;  4YGD A;  4M0N A;  1PGL 2;  2DVB A;  5GLU A;  1LU2 A;  4G9S B;  2W0X A;  1RIT A;  3BN6 A;  5JPN B;  2ADE A;  4D7S A;  1OLM A;  4YG3 A;  3T1L A;  1ND2 C;  4S2H A;  5JMC A;  2X5I C;  2ZAB A;  1I3H A;  3ZKY A;  2LRP A;  2WS9 2;  1C3H A;  2D97 A;  3VBH C;  3BOW A;  2P1B A;  3LEK A;  3PU8 A;  2ZGM A;  2RMU 1;  2Q8E A;  3GAL A;  3TBD A;  1YNA A;  5D21 A;  3UK9 A;  2NMO A;  1VBD 3;  4XXP A;  3WXP A;  1RHI 1;  3MF6 A;  2ZPX A;  3RGB A;  2ZOE B;  1OF4 A;  4N8M A;  4NN0 A;  5CAZ A;  1H8T B;  2VGD A;  1RUD 2;  3VDB A;  2PMW B;  1P8J A;  1H2M A;  1PZ9 A;  4ERO A;  3CZU A;  4A44 A;  3EO6 A;  1BJQ A;  2KR2 A;  3MIB A;  3T0B A;  1OMI A;  3QLQ A;  4IW3 A;  3EQE A;  2DUR A;  4R8H A;  1HDK A;  3KVA A;  4PHZ A;  2XDV A;  2PHX A;  4I0A A;  1SLA A;  4Q4X 3;  4M3C B;  4Y22 A;  5HCB A;  4E4S A;  5L7O C;  2BTV C;  4WVM B;  4XZP A;  3TWI A;  3KV6 A;  3OGJ A;  5FZG A;  3WIN E;  3WX5 A;  3DGT A;  1ZA7 A;  1OF3 A;  2VNG A;  3ZXK A;  4XOG A;  3WUD A;  3K3N A;  3FL7 A;  1EV1 1;  1NYW A;  4XUN A;  5FO7 B;  4DO0 A;  2OQ6 A;  4A4A A;  2A75 A;  3WF3 A;  4CP9 A;  1Q8S A;  1QIQ A;  2B8M A;  4K6B A;  4M00 A;  3U4S A;  1VRH 2;  1YJK A;  2Y38 A;  3THP A;  4D69 A;  1GSL A;  2AGS A;  3O1P A;  4LO8 A;  4SBV A;  1SQ4 A;  3DYM A;  4BDV B;  5F32 A;  2MEV 2;  2ZA9 A;  5FZ3 A;  1YJL A;  1DQ5 A;  1OFN A;  3N36 A;  2WL1 A;  4N9H A;  4YZ4 A;  3WHU A;  2F17 A;  3RZM A;  3RZZ A;  2VUA A;  1K45 A;  4N90 A;  1BMV 1;  3VBR A;  4O65 A;  1HV1 A;  1DQ4 A;  4MGK E;  1PIV 1;  4YWA A;  1DLL A;  4BE3 A;  3HNY M;  4XMI A;  2H0V A;  5GKA C;  2JX9 A;  2UY9 A;  1FNY A;  1CWP A;  1XBF A;  2A3Y A;  2N7G A;  3ZX7 A;  1W0P A;  2BER A;  1G9D A;  3TEW A;  4GH4 C;  1S0D A;  1UZ0 A;  2VOT A;  3H3L A;  5FV3 A;  4JGY B;  5IJR A;  2ZMK A;  4HET A;  1ULP A;  1YFY A;  4Q4V 1;  5C70 A;  4UW6 A;  4XCB A;  1OLM E;  1W06 A;  2QNK A;  1RUJ 3;  3DXT A;  1OVS A;  2RMU 2;  3JB8 A;  2ERF A;  3S7E A;  3WDV A;  4ISR A;  1UY3 A;  3BOP A;  4S2F A;  1B35 C;  1XQN A;  4UF0 B;  3TNQ A;  4CEY B;  2GH2 A;  4NMI A;  4BK4 A;  2WNU C;  1HRI 1;  4OFG A;  1IG0 A;  2XGX A;  2CAU A;  5LAT A;  3HQX A;  2XHN A;  4QHO A;  4CCJ A;  1VBC 1;  1W3V A;  4AZZ A;  1SBD A;  1D2S A;  4AK3 A;  2HWF 3;  5JOZ A;  5E1R A;  1HB3 A;  1W39 A;  5A7P A;  3TN9 1;  2W1S A;  3G7D A;  4LO7 A;  5FKC A;  4A7K A;  3LEM A;  3ZN6 A;  1AR8 1;  5AC9 3;  3PUQ A;  3FBM A;  2VUJ A;  4C0B A;  2XG3 A;  3H7Y A;  3JBG 1;  1MS5 A;  4JAA A;  3POS A;  4KQ7 A;  1AR6 3;  5FZK A;  4LHK A;  4KWK A;  2WFF 1;  2X5I B;  2HWB 2;  4BPZ A;  2WDB A;  3D0J A;  2B9V A;  3IB3 A;  1ZZC A;  5D8A B;  2QUO A;  3N9P A;  2WNV C;  4N53 B;  5CA6 A;  1ND3 B;  1W04 A;  4MGT A;  3RI8 A;  1HV0 A;  3MUY 1;  1CPM A;  3U1X A;  5CFC B;  2WII B;  1OA2 A;  2NZ9 A;  1SPP A;  1J1T A;  4AHZ A;  2EAA A;  3IDA A;  1LRH A;  1QQP 3;  4LKE A;  1F4A A;  1COV 1;  2W9X A;  3S6P A;  1PVX A;  2BPA 2;  1NX9 A;  3OD4 A;  2FCU A;  3PIJ A;  4XAA A;  3BCW A;  4QXH A;  4H14 A;  2WLP A;  2VTF A;  2WNU B;  5AC9 2;  3DL3 A;  3J26 N;  1V9U 2;  3WG1 A;  1T6G C;  4Q2F A;  1PO2 1;  3PMS A;  1PMI A;  5FO8 B;  2IXJ A;  2VH9 A;  3HBZ A;  1F2N A;  2XML A;  3FBY A;  2VMC A;  4PI0 A;  2RM2 2;  3MO4 A;  1J3Q A;  3QCW A;  4AG4 A;  3IIA A;  3R4D B;  1ULE A;  2ZX3 A;  3SH4 A;  2J1V A;  3WVJ A;  3ZN4 A;  3NV1 A;  1XNT A;  3POI A;  1MVE A;  4JGY C;  4AAX A;  1N3P A;  5HBA A;  4PF1 A;  2HWD 2;  1OOP C;  3WQ0 A;  1C4R A;  1QWR A;  3F95 A;  1OKQ A;  4AAP A;  3K46 A;  2XJV A;  1ZZ7 A;  1RVF 1;  1NE6 A;  2ZZQ A;  4XIO A;  4CA9 A;  4OZO A;  1XYO A;  4XAC A;  3VDC A;  4CDU C;  4BQ3 A;  2Y0I A;  5FZE A;  5KBF A;  4QMA A;  5FZA A;  5A6Z A;  2VUC A;  2J42 A;  3Q8B A;  4P9I A;  4UW3 A;  4RGG A;  1RUH 3;  2RDN A;  2FDI A;  3LA2 A;  2OA2 A;  5FOJ B;  4NR1 A;  5CIR A;  2C26 A;  3OGV A;  1VAL A;  1DQ1 A;  1UL9 A;  1AX1 A;  3LOI A;  4OZX A;  3FN9 A;  1S2B A;  1XRU A;  3O14 A;  3O1O A;  3ZKU A;  3S0M A;  1O8P A;  4K21 A;  1S2K A;  1JOB A;  5KXB A;  1XNK A;  5FZ8 A;  2ZX4 A;  2MEV 3;  3K48 A;  4BQX A;  4QPW A;  1XYP A;  3DUI A;  1YO8 A;  2WT1 A;  3M1H A;  3MHZ A;  4PIX A;  4JTO A;  3SCH A;  3ZFF C;  3K75 B;  5JDB A;  5A7S A;  4CUA A;  2WNV B;  5FXZ A;  4BA6 A;  2WO3 A;  4AGR A;  2A6Z A;  1VBA 1;  2RS5 1;  3KT4 A;  4UOJ A;  4YZ5 A;  3C7H A;  5FOB B;  2VOK A;  2VME A;  3NAP C;  4QB1 A;  4UAP A;  4CEW B;  3VBF A;  1MAC A;  4IEX A;  2R1B A;  3O1V A;  1LOE A;  3O1U A;  1AJO A;  4LQR A;  3T1M A;  5KHG A;  4XJZ A;  4CXW A;  5J48 A;  1W6O A;  4CU7 A;  3KS7 A;  2RJL A;  4XFH A;  5A70 A;  1Q5O A;  3ETQ A;  5ACA 3;  2PAK A;  4Q29 A;  1CIW A;  4QQL A;  4NRQ A;  4D6R A;  1RUC 1;  1KRI A;  4OI2 A;  3KCY A;  5FYT A;  5DDJ 1;  5F5I A;  1GZW A;  1I1E A;  4JGZ C;  5FMB A;  4L97 A;  1IPS A;  4NPL A;  1WW7 A;  1UU5 A;  2XVL A;  3BYW A;  4NAM A;  1BHG A;  4OUS A;  4U2A A;  4EN9 B;  2VCC A;  3LQC A;  4OQ8 A;  1WW6 A;  1ZRD A;  1SAC A;  1UYP A;  3AP6 A;  1R64 A;  1OI6 A;  5JI7 A;  4JDM A;  3ZIX A;  4CEY C;  1SFY A;  3I54 A;  1AR9 1;  1AYM 2;  1QJE A;  1LGC A;  3UES A;  3I2J A;  4L99 A;  1WD4 A;  5DMY A;  3R4U A;  2HBU A;  3SEE A;  1CJD A;  1ZRR A;  1VBE 2;  4IES A;  4LOR A;  2PTM A;  1UXX X;  5FJK A;  3S7I A;  2XUM A;  1FXZ A;  4KWL A;  1QJY 2;  3AVR A;  4LUL A;  2JE8 A;  4BIO A;  1DFQ A;  1QXR A;  2EAL A;  3H1M A;  1JW6 A;  1BLZ A;  4IQP A;  2JJ6 A;  4A7Z A;  3P6B A;  2VZU A;  2IXC A;  2X09 A;  5GZE A;  1B35 B;  3JD7 2;  4IEQ A;  1FI2 A;  5FZI A;  2YBP A;  4YVS A;  4D6S A;  2DFB A;  1W05 A;  1R09 1;  3IDE A;  5D2A A;  5IK4 A;  2LS6 A;  4YVS C;  1U5I A;  2HEW F;  1O59 A;  1X33 A;  2W39 A;  3D3A A;  4AQ6 A;  1XE0 A;  4RQP C;  3O7O A;  2FDH A;  1BBT 1;  4AED C;  5FLH A;  2EIG A;  5T52 A;  5C8C B;  1L7R A;  4NRP A;  1US3 A;  1NE4 A;  1KJR A;  1FNZ A;  5F3E A;  1VBA 2;  3I2D A;  1HN0 A;  3T2Q A;  3USU B;  2JG9 B;  1NQD A;  4IV3 A;  1AXZ A;  1CIY A;  5FYZ A;  4OMC A;  1E5H A;  1OT5 A;  2BOJ A;  3FFZ A;  4MET A;  1RUI 1;  1TME 1;  2VL4 A;  4BB3 A;  3OPT A;  4KGQ A;  5A32 B;  4GKY A;  2VOV A;  4JHZ A;  3CBN A;  2CY6 A;  2P4E A;  3ELN A;  2VZV A;  2ATF A;  1RB8 G;  4ARX A;  1BKZ A;  1R1A 2;  2WO2 A;  3KCC A;  2C6S A;  2P5B A;  5JXH A;  2VCB A;  4CE8 A;  2X53 S;  3MPP G;  1DYP A;  4XC9 A;  2NP0 A;  2P17 A;  4YVS B;  2FMD A;  5C3R A;  4KWU A;  3AXD A;  5JWP A;  3UGF A;  1G86 A;  2WR9 A;  1O4Z A;  1JZ5 A;  1O7F A;  4IEU A;  3ZFF B;  4MVT A;  4K3U A;  1IGO A;  1GWM A;  4CDW A;  4XEZ A;  3Q8C A;  2F6B A;  3MV1 1;  3WHT A;  2J1E A;  5T3N A;  2DUP A;  2WQ4 A;  4F3J A;  3MV0 1;  3AYD A;  2VC9 A;  3AZX A;  2UWC A;  1ND2 B;  5JZG A;  2Q30 A;  4A45 A;  4WM8 A;  2TUN A;  4CEW C;  3SMH A;  1WW5 A;  4RR3 A;  4BU2 A;  4LHN A;  4FXK B;  1GZ9 A;  2XWJ B;  4XJ9 A;  4ZU5 A;  2XJU A;  4FOV A;  1YQC A;  3BTX A;  3VBO C;  1EAH 2;  2B5H A;  1W8T A;  2E9Q A;  1UMZ A;  1VBA 3;  2WRA A;  4R52 A;  5F9T A;  5KR7 A;  3A7Q A;  1W9T A;  4QB2 A;  5F2S A;  3PVE A;  1H9W A;  1YIP A;  2CAV A;  2NPI A;  1YI7 A;  2W5F A;  4LBO A;  1LES A;  2OXB A;  2Y6H A;  4XFB A;  2HLE A;  1PK6 C;  1R09 2;  2R07 3;  2ZKL A;  2P6C A;  2R06 1;  2Z69 A;  3I7D A;  2V72 A;  1O6U A;  4AR2 A;  1OQD A;  4LBL A;  5J09 A;  1PMJ X;  4JQR A;  4GMP 0;  5DPN A;  1CZS A;  2NM1 A;  2ZGO A;  3NRU A;  1X82 A;  5EPA A;  4YW5 A;  5FYM A;  1AXK A;  1QHD A;  3ILR A;  1JYN A;  4H7M A;  5IAT A;  3H8X A;  3ZFF A;  1URX A;  1JUH A;  4QPI A;  1DQ0 A;  3FUQ A;  5DG2 A;  3GM8 A;  3OB8 A;  5LB6 A;  3AZY A;  3T2P A;  2EA7 A;  1V6N A;  3LA7 A;  3NWK A;  4IXL A;  4JZR A;  2D43 A;  4OUM A;  4UYB A;  4YYO A;  2V73 A;  3BVC A;  2W47 A;  2WWJ A;  4IGQ A;  1PGW 1;  1RIR A;  3N3H A;  4TSV A;  3ZXE A;  1MPX A;  1YXW A;  1OSG A;  4PF5 A;  3D6E A;  3ZFE B;  1RHI 2;  3LOB A;  1TVG A;  3VBS C;  1Q8Q A;  2DU0 A;  1AYM 3;  4XJU A;  5C9A B;  1CN1 A;  1SFN A;  2J1A A;  3N35 A;  4WM7 C;  2RVA A;  4CU8 A;  2VNV A;  3B5L B;  5CB7 A;  2BZD A;  3GYD A;  3JU9 A;  5GZF A;  4RS5 B;  3UYJ A;  3VD7 A;  5ANN A;  4GH4 A;  2EF6 A;  4JTN A;  3O1M A;  1RUC 3;  2VG9 A;  4O9E A;  4OLL A;  2DYC A;  2ZHN A;  2ETE A;  1ENS A;  3SIS A;  4ASL A;  5ACA 2;  3PVO A;  3UET A;  1UPI A;  1ENX A;  3PNA A;  1LKN A;  4XUT A;  3O0V A;  3FHI B;  3ZFG B;  1LOF A;  4BQ1 A;  2BU9 A;  1KS4 A;  1HQL A;  1IS5 A;  4V1P A;  1HIX A;  4A7Y A;  1RTV A;  5A6Q A;  5DZF A;  1H2N A;  5CVR A;  3W58 A;  5DG1 A;  4CUC A;  1LTE A;  3WG4 A;  1JZ2 A;  1NXD 1;  2QBX A;  1HN1 A;  2RS5 3;  3WSO A;  2JXA A;  5C4W C;  4NHL A;  3I97 A;  1CAX B;  1JZ8 A;  3J7L A;  3KV4 A;  2DUQ A;  1IS4 A;  1F5F A;  2P6H A;  2K9Z A;  2VBB A;  1X9T A;  1OD3 A;  4RQP B;  5C33 A;  1J83 A;  5GZG A;  2MEV 1;  4E9K A;  5JXJ A;  1PMH X;  2BBV A;  3UGH A;  1RMU 2;  4QM8 A;  1WCQ A;  4UFM A;  2R06 3;  1RUG 3;  5A33 A;  4AFD A;  4GMP 1;  3DPR B;  2W08 A;  3WW2 A;  2XJP A;  1BMV 2;  2ENR A;  1V6I A;  4GQ7 A;  3POF A;  3VBS B;  5FPU A;  4Y4R A;  2YC4 A;  1XE8 A;  2GC3 A;  1NY7 1;  3A23 A;  3ATG A;  3J8F 1;  4HK9 A;  2BNM A;  2J1T A;  2JB8 A;  4K8R B;  4XQW A;  3J7M A;  1Y43 B;  1RUH 1;  3JQW A;  4XF3 A;  1VBC 3;  3E97 A;  4PIZ A;  2D6L X;  2IUW A;  4MXW B;  2VZT A;  1UNB A;  2YC0 A;  2HWC 3;  3ZFG A;  3A21 A;  2YV8 A;  3HN1 A;  3FWE A;  2DWR A;  2HYK A;  2ZGL A;  3CIH A;  2WAA A;  4AGG A;  5CFC C;  4OHV A;  5FUP A;  4BQ2 A;  4FPG A;  4Y26 A;  2X8K A;  1YCI A;  4CP0 A;  4L0P A;  3MFA A;  1X50 A;  5BNN A;  3W20 A;  4OI0 A;  1CAX A;  1IHM A;  1O4T A;  4LKF A;  3U78 A;  3H9A A;  5BNP B;  4QPG A;  2G9F A;  3DKW A;  3VBH A;  5IFT A;  1C8N A;  2DU1 A;  5LA2 A;  3BGA A;  4COV A;  2E6V A;  5HCF A;  2EIC A;  1LGB A;  5BNN C;  2ET7 A;  4NRM A;  3APB A;  4WV8 A;  2X5I A;  3F2Z A;  3TN9 2;  4UFK A;  1NCQ C;  1UD1 A;  2B45 X;  4OUL A;  4WM7 A;  2RDR A;  3L2Y A;  5A3U A;  1QJZ A;  1V9U 3;  4QDR A;  3NJV A;  1E5R A;  3H3U A;  1YQ8 A;  3JBG 2;  1ZBE 3;  2QFE A;  4LO5 B;  3HIF A;  3VBS A;  1O3R A;  2WIN B;  4CZS A;  4NJ4 A;  1WBF A;  5DAX A;  4FTS A;  2QQO A;  2WFF 2;  3AFK A;  1EYB A;  3E5Q A;  1D4M 3;  4HBN A;  4IEW A;  4JKL A;  1VBB 3;  3LD8 A;  1VAV A;  2FQP A;  1COV 3;  3MIH A;  4X6R B;  1ASJ 3;  4QWN A;  1VAM A;  1DGR A;  3WZ1 A;  4KWJ A;  2ZEY A;  5JMO A;  1W6Q B;  2R49 A;  3LFM A;  1PK6 A;  2J7M A;  2XPJ A;  5A3P A;  1SLI A;  2UYB A;  4R4Z A;  3JUU A;  2D3S A;  2HKX A;  5CKM A;  3WP5 A;  4U36 A;  2YPJ A;  1UPS A;  3ZMN A;  4CCN A;  3B01 A;  4HPK A;  1BBT 3;  4K8F A;  3UKT A;  1YLL A;  1HJG A;  4LEJ A;  1VBB 1;  5C5T A;  2XLG A;  1RUF 1;  3ACF A;  4QHB A;  5BNP A;  4XBL A;  1L7Q A;  2VNR A;  1AR6 2;  1C1F A;  5F6L B;  4GB3 1;  1AR8 3;  5AC9 1;  4MG2 A;  2QDN A;  2VXR A;  4GA9 A;  3GBG A;  3MZH A;  3I59 A;  4FPE A;  2XON A;  1SCS A;  5FYH A;  4FQ4 A;  4Q4X 1;  2BEO A;  1GKB A;  3KWV A;  3K4A A;  3AK0 A;  4PQQ A;  3VUO A;  3CU7 A;  5I0S A;  4DXZ A;  3I2K A;  2W92 A;  4GWI A;  3OUJ A;  1F35 A;  2PFW A;  2UWB A;  2QQM A;  3IBM A;  2C9A A;  5FPL A;  4LBM A;  1NZC A;  4Q8L A;  5T5P A;  1RED A;  1U0A A;  4LA3 A;  1O5U A;  1HRI 3;  4NUB A;  1I6X A;  3BIE A;  1S0I A;  3T2T A;  4Y5Z 0;  1RVF 2;  3HQU A;  4LXL A;  4RSU A;  4BQ4 A;  1YRZ A;  4DS0 A;  5FO9 B;  5JOX A;  5JZG C;  2R32 A;  1NA1 C;  2RMU 3;  3GZE A;  1IPJ A;  2I45 A;  3D82 A;  3WDW A;  1DYO A;  1MZE A;  4F7Z A;  1Q43 A;  3I3E A;  1AX2 A;  2HWC 1;  4IV1 B;  1XU1 A;  2JD9 A;  4GXL A;  3AMN A;  3OJB A;  1GOF A;  3PTR B;  4DUV A;  2DCT A;  1W2A X;  2HWE 1;  2PLV 2;  4CPB D;  5J36 A;  3LA3 A;  3U10 A;  3LWC A;  1Y4W A;  2KA3 A;  2UY8 A;  4YVW A;  5DDJ 3;  4LO6 B;  1JN2 P;  1DZR A;  3MIC A;  5F1R A;  4BWO A;  3CJI B;  2QVS B;  3V64 A;  1JU3 A;  4P08 A;  4XUO A;  2OZ6 A;  2PN5 A;  1ULD A;  4FSJ A;  3KMH A;  1OC1 A;  1DZQ A;  1V0A A;  2IVJ A;  4AED A;  4E2G A;  3IPV B;  5A1F A;  2FDG A;  4EN0 A;  1Q56 A;  2XKP A;  1XSQ A;  4XET A;  1UOG A;  4WVM A;  3GNE A;  3JB4 C;  3WV6 A;  3PUS A;  2FDJ A;  4ZU7 A;  4AFA A;  4IV3 C;  1WLD A;  3OBZ A;  4PDW A;  1QDC A;  2F4P A;  2WA4 A;  4K7J A;  2C1F A;  5IFP A;  5A3W A;  4P9Y A;  1S0B A;  4FVV A;  5H9R A;  2WQZ C;  2FDK A;  2ARX A;  4ZU4 A;  5AFE A;  4AQ2 A;  1WZX A;  1TMF 1;  4M01 A;  3WP6 A;  1V6K A;  1MS1 A;  4A3Z A;  4MXW A;  4HKL A;  4ZY9 A;  5DDJ 2;  4Q4X 2;  1UX6 A;  5FZM A;  3ZPY A;  5GZC A;  4FBF A;  1FPN 2;  4QD2 A;  2BFU S;  3CJI A;  3H8R A;  1J58 A;  3Q8F A;  2CGN A;  1BQP A;  4A42 A;  4AED B;  2DTW A;  4XAE A;  4P5Y A;  5FZ6 A;  2IXK A;  3LSE A;  4YW1 A;  3P5B A;  1N3Q A;  1VBD 2;  4RD7 A;  2BWC A;  4IE4 A;  2RG4 A;  3E6B A;  1JZ7 A;  2DVD A;  1HRI 2;  1NQJ A;  1W9S A;  2PQS A;  5LAS A;  2AEY A;  3LCP A;  1GNH A;  4QU2 A;  4B7K A;  5K9Y A;  5LY1 A;  1DQ2 A;  1ST8 A;  1O3S A;  2LTN A;  1OHF A;  2ZMN A;  1L7L A;  4LR4 A;  2YPD A;  2PLV 1;  5F39 A;  1UXZ A;  4YW7 A;  1MS0 A;  1W3X A;  3RZJ A;  3LZZ A;  2JKX A;  1XB9 A;  2GN7 A;  4YLZ A;  2C9K A;  1QDO A;  2ZGT A;  2ZML A;  3P3N A;  4LK7 A;  3WDX A;  4PDW C;  2GNB A;  1AR8 2;  5T5L A;  3FHA A;  5J7M A;  1FOD 3;  1IG3 A;  2ZZJ A;  5T54 A;  3V0B B;  4PQ9 A;  3OEA A;  4Y24 A;  3DPR C;  4HVR A;  3ZXG A;  4HMZ A;  4ET7 A;  1WMF A;  5DAB A;  1BBT 2;  2Y64 A;  5A7O A;  3MW4 A;  1J3R A;  3NNL A;  5JXI A;  4QAW A;  1ZRF A;  2W1U A;  1XNA A;  3OBT A;  2JG8 B;  3OUI A;  4JGZ B;  4QM9 A;  2VD7 A;  4QX8 A;  4YG6 A;  5AVP A;  1OD5 A;  3B69 A;  5FZ7 A;  5GAL A;  2BP6 A;  2VZ3 A;  5L9B A;  1HX6 A;  5A1L A;  1APN A;  1ASJ 2;  3MLK A;  3K77 A;  3SHR A;  3OGS A;  3TRS B;  1PO1 2;  3AYC A;  3AKT A;  2Q1F A;  2WFF 3;  2JE7 A;  2CYF A;  1C5H A;  1TMF 2;  4DXS A;  3CEW A;  4W50 A;  4E27 A;  5K7P A;  3MF9 A;  3JBG 3;  3SH3 A;  5C3S A;  1GLH A;  1ZBE 1;  2JE9 A;  4MGI E;  1POV 0;  5C8C C;  3B02 A;  3RWK X;  2BNO A;  1AR7 3;  4KL1 A;  3VHP A;  3TN9 3;  5BY5 A;  4M3C F;  5I0T A;  3ZXD A;  3VKM A;  5HV4 A;  2Y0O A;  1BEV 2;  3MW2 A;  4P9W A;  2HWE 3;  1QH7 A;  5LBB A;  3ZXJ A;  4QX1 A;  4FFH A;  1GYK A;  4RR3 B;  1CQ9 A;  4ZS3 A;  1Z7S 2;  3AMH A;  1R08 2;  3VDA A;  2Y33 A;  4OHW A;  5BNQ A;  4PIY A;  4LE4 A;  4S2D A;  1N1Y A;  5FY4 A;  4EN6 B;  5FDB A;  1JYW A;  2XVK A;  2CU5 A;  4WVZ A;  5IAV A;  1MR5 A;  2E32 A;  1RUI 3;  1TME 3;  1WGP A;  2O8O A;  2XLF A;  4FXG B;  2ET1 A;  4Y20 B;  4AVA A;  4NRO A;  5FPX A;  3GBF A;  1DQ6 A;  1H6Y A;  1ONA A;  5CAD A;  1W9Y A;  1YC6 1;  1TNR A;  4COW A;  2ARB A;  3KGL A;  1TZO A;  4PBO A;  5CKQ A;  2ZX2 A;  4QHZ A;  4Y1X A;  1AF9 A;  1WLC A;  1PIV 3;  2RE9 A;  2R04 3;  5IWF A;  5JVV A;  1K12 A;  4NWV A;  3BPZ A;  1U5Y A;  2WFP A;  2QTW B;  4XJ8 A;  2R06 2;  4GMP 3;  2VVF A;  1RMU 3;  1CD3 G;  1GOH A;  3WCS A;  3POE A;  4TYS A;  4AYU A;  3GZT B;  3RYR A;  2D7F A;  2J1R A;  2DCZ A;  4CCK A;  3TAY A;  1BZW A;  4GWJ A;  1W8F A;  3LFI A;  3SNM A;  2QQW A;  2V5D A;  2RS5 2;  5E16 A;  2XKO A;  1JHN A;  5A7Q A;  3B7M A;  1OH4 A;  1TEI A;  2DV9 A;  3RVH A;  4AFM A;  5IYY A;  4GJZ A;  2B46 X;  1ASJ 1;  2NYY A;  1SLT A;  3VGI A;  4UFL A;  2JDK A;  1PO1 1;  1UO9 A;  2ORX A;  2WNV A;  3TEX A;  4IE7 A;  3SXW A;  1H2L A;  4DRR A;  4BZ4 A;  5A1A A;  5F6K A;  1N47 A;  1ULC A;  2FCV A;  3KZ4 C;  5CG9 A;  2AC1 A;  4QKD A;  2CNA A;  2WAB A;  1AR9 3;  1C1L A;  4XPV A;  1JTZ X;  2QKD A;  3PTY A;  3SC7 X;  3ZXL A;  4BLI A;  3VN4 A;  3VZM A;  2BWA A;  3WG2 A;  1HQN A;  3TYJ A;  4ZKT B;  3AP4 A;  2BUK A;  5FMC A;  2FZ1 A;  1KIT A;  1AR9 2;  1AYM 1;  2BVV A;  4MYE A;  4P9X A;  4Y3O A;  4AI2 A;  4ZZ5 A;  4AFC A;  1WCU A;  2XJR A;  3MBW A;  1CAU B;  1DGW X;  5LEJ A;  3GCW A;  3KB5 A;  5K0U C;  1TQ5 A;  3LB9 A;  4P5H A;  1UX7 A;  5DZE A;  5FP3 A;  3MGU A;  4BIS A;  2WKK A;  4YM0 A;  1JS9 A;  3HBK A;  1FYU A;  4W6Y A;  4XCA A;  4DIQ A;  5BNO C;  1UOB A;  2ZAC A;  1FX5 A;  4R9C A;  4QGL A;  4URT A;  5J3U A;  4LJH A;  1FAY A;  4OI1 A;  2GC0 A;  2GSY A;  2QQJ A;  2ZEW A;  1UWW A;  1UU4 A;  2VW1 A;  4EZ4 A;  2JG8 A;  4FPH A;  3WT3 A;  1UU6 A;  1W2U A;  4XDO A;  4UT5 A;  4MGS A;  3KF3 A;  5CKN A;  1UYX A;  4R9A A;  3VBR C;  1KQR A;  3AYA A;  5ANQ A;  1GQH A;  5T5J A;  4F83 A;  1H1I A;  3VL8 A;  2R07 1;  5DAP A;  5JI9 A;  1T6B X;  2GU9 A;  2XJT A;  2CDO A;  5E8A A;  3RNS A;  1GOG A;  1BK0 A;  4ZHN A;  4Q4Y 1;  2EXH A;  1UY4 A;  2ZX1 A;  1C8M 1;  4FOY A;  3PU3 A;  4N43 B;  3ZPO A;  5FYY A;  1EAH 3;  3IAP A;  3M7A A;  4MHU A;  4GAZ A;  1REF A;  2MHF A;  3IM0 A;  1CAU A;  2BGC A;  1KEX A;  3AKQ A;  4PBP A;  4YGC A;  1OVP A;  3ACL A;  2VVE A;  3TB0 A;  4XUP A;  4LIU A;  1XXN A;  3BTY A;  5BNO A;  1U5X A;  4Y5T A;  5C6C A;  1MS9 A;  2AH2 A;  1W99 A;  4EJR A;  1W90 A;  4LO4 B;  5ISL A;  5K0U B;  1CON A;  2OS2 A;  3HMY A;  3VD3 A;  1QXJ A;  2PHT A;  1W8U A;  4LUK A;  2ZGU A;  1Z7S 3;  5A3N A;  3O12 A;  4D7Y A;  4EWE A;  4FPL A;  4RHV 3;  1QF3 A;  5BYN A;  1KFX L;  1QOT A;  2WNU A;  3MLL A;  4N7I A;  3WCR A;  1R1A 3;  4YW2 A;  4C1X A;  2ZS6 B;  4CDQ C;  3WW3 A;  3B93 A;  1W6P A;  3WY6 A;  3VBR B;  1BVP 1;  2Q8D A;  5F2W A;  2QCS B;  3SIT A;  4J6G A;  1GP5 A;  1PO1 3;  3WNO A;  1GNY A;  1LJ7 A;  1CAV A;  2VPV A;  3ME2 A;  3I49 A;  1SZB A;  1X9P A;  2PHR A;  2XLA A;  2NLR A;  5ABJ A;  3QD6 A;  3NKT A;  5K4L A;  5LCW L;  3NAP B;  2G1M A;  1UQX A;  2VTX A;  4TXW A;  4YZ2 A;  4LKS A;  4XFF A;  3BTA A;  5AFB A;  5EIY B;  1FMD 3;  5B2G B;  5A6X A;  2JIJ A;  1EY2 A;  3WP4 A;  1WA4 A;  4XUR A;  1DCS A;  3PME A;  2NN8 A;  5LEK A;  4Q1P A;  2W87 A;  5L7O A;  1EUU A;  4B1M A;  2BW8 A;  4OCT A;  1YQ5 A;  4DY3 A;  3JD7 3;  2R0F A;  2ZBJ A;  3Q8E A;  4ZPI A;  4Q4Y 2;  4BQY A;  4QX2 A;  4ATE A;  2BQP A;  1C8M 2;  2WN3 A;  1TE1 B;  2OYZ A;  3UNP A;  4H7L A;  1HKD A;  2AR6 A;  2EXI A;  4UWD A;  2GZW A;  2MPF A;  2ARC A;  1QJY 3;  1UMH A;  3DN7 A;  5A32 A;  3VBO A;  4LLO A;  4DUX A;  4LMF A;  1PM7 A;  1VBE 3;  2WYS A;  1PGW 2;  3LE0 A;  4BXF A;  3B9I A;  4Z2W A;  4NAO A;  1I9R A;  1QJU 2;  4HVO A;  4O61 A;  3VBU A;  4AFB A;  1F5J A;  1LEC A;  3CJX A;  3HNB M;  4EN7 B;  5D8A A;  3RZG A;  4AI1 A;  1VE0 A;  3UV9 A;  3HWJ A;  2D3R A;  1OOP B;  2TBV A;  3C7F A;  4JKK A;  1DF0 A;  4NIA A;  3KLS A;  4X8N A;  3M3E A;  5CBL A;  3ZSK A;  2VEC A;  1JU4 A;  2RS3 3;  5I0D A;  1LOD A;  3WNN A;  4K40 A;  1W8W A;  3ZFE A;  2WO7 A;  3OPZ A;  3ZYI B;  3WNX A;  1W6N B;  2X10 A;  3LEG A;  2UUR A;  2WAO A;  3V56 A;  1ZZB A;  4ZXK A;  1AR7 1;  2QDR A;  1DGR N;  2VAU A;  3PL0 A;  5FZB A;  2D5H A;  3N9N A;  4HOO A;  1UZW A;  3GCX A;  3DYP A;  4BOW A;  1XE7 A;  5HXM A;  3M3I A;  3AX4 A;  2VMI A;  3DCQ A;  3PIG A;  3R4S A;  4UFH A;  1AYN 2;  4TTG A;  4RL7 A;  1GFF 2;  3BI3 A;  2DFC A;  1VMJ A;  4FTB A;  4XYX A;  2RR1 1;  3IMM A;  3VDD A;  5JAX A;  4OMD A;  4TN7 A;  3S5Q A;  2Q0A A;  4FQZ A;  4QXK A;  2B7Y A;  1UOF A;  1NCR A;  4W8J A;  5FYC A;  2DF7 A;  4E4H A;  2Q5T A;  5LWB A;  4BQ5 A;  2E51 A;  5DUU A;  5F8P A;  4B4R A;  1YFW A;  5FMD A;  2E7A A;  5EP9 A;  3GDB A;  5TSW A;  5LBC A;  5FJH A;  1RXG A;  4Y4Y A;  2YFU A;  2QZ3 A;  4AVB A;  3NV4 A;  1HQW A;  4MH0 E;  4QDS A;  1XYN A;  5DZG A;  5KC5 A;  1PNF A;  2JKB A;  1WMX A;  1FT9 A;  4RA0 A;  3POG A;  2RV9 A;  1LUL A;  4QPI B;  4W65 A;  4AGV A;  3FLP A;  3E5U A;  4CU6 A;  4IET A;  2YXS A;  1FPN 1;  1RUH 2;  2WO1 A;  4LIT A;  2PLV 3;  5GZD A;  3WQ7 A;  3UKN A;  1JYX A;  1ZVF A;  1NCQ B;  2GME A;  3J9S A;  3N7K A;  2MNG A;  2YU1 A;  2HYX A;  3GJA A;  4QGN A;  1VBD 1;  1CZV A;  3R0R A;  3VDD B;  4YM3 A;  4AEM A;  1GP6 A;  1WBL A;  5HXV A;  3KQR A;  1RVF 3;  4I3P A;  3M4F A;  1JYI A;  2DCK A;  1UIK A;  3ZIW A;  1UKG A;  3DEM A;  4XFI A;  1QOS A;  1QEX A;  3TEY A;  1O4Y A;  2OKX A;  4CDQ B;  2Q4S A;  1S0C A;  3VBF B;  1OBN A;  3THT A;  2RM2 3;  4B4P A;  3W5N A;  2QE3 A;  4NOT A;  5FLJ A;  5L9V A;  4NPR A;  1RJ7 A;  4IGP A;  2K0G A;  3OBR A;  5ABJ B;  1OLR A;  4RFR B;  3RZK A;  2GH8 A;  3OY8 B;  5BPX A;  3GZA A;  4B7E A;  4E4D X;  2HBT A;  1EPW A;  2IFR A;  2JDP A;  3QH6 A;  1PM4 A;  3I2I A;  5FIX A;  4AI0 A;  2RR1 2;  4L2N A;  3FFQ A;  2BV4 A;  1RUD 1;  1QQP 1;  1D0H A;  3I8T A;  3NW4 A;  1HXS 2;  4LPL A;  2TEP A;  3I3Q A;  3KF5 A;  1CVN A;  3OUH A;  4B29 A;  3C8X A;  3E5X A;  5IW0 A;  1GV9 A;  5I0R A;  3U4X A;  4EWA A;  3ILF A;  2B39 A;  3ETP A;  1SLC A;  2HWB 3;  3ECQ A;  3CDZ B;  1VBB 2;  1W6Q A;  2BBA A;  1D4M 2;  1VPH A;  3GZU C;  4OVE A;  1GP4 A;  2R1D A;  1LCL A;  2Y6F A;  4FPC A;  1ZBE 2;  5L73 A;  4CP1 A;  5LA9 A;  4COZ A;  3HT1 A;  3AP9 A;  4PLN A;  4D0Q A;  1RYY A;  1EV1 2;  2VUL A;  4C91 A;  1FV3 A;  3GBW A;  4QQO A;  2YFZ A;  1QNW A;  4HSJ A;  1MEC 2;  2YRO A;  4YGE A;  1YI9 A;  5IVB A;  4FAG A;  1BEV 1;  3D0S A;  3WOG A;  3RG0 A;  3VV1 A;  4CVU A;  1ULG A;  2HWF 1;  1C28 A;  1VRH 1;  4LKD A;  2Z42 A;  5JIU A;  4TWT A;  5SV8 A;  2WZR 2;  1CGP A;  2C5D A;  3KHB A;  1TNF A;  2QQK A;  3AVS A;  1IQD C;  5CG8 A;  3LF7 A;  5FPV A;  2YC2 A;  1RIN A;  3IT8 A;  1IS6 A;  1GWL A;  3U07 A;  2G9Z A;  5BNN B;  1XNC A;  1O3T A;  1RUJ 2;  5EFU A;  3VKO A;  3AXE A;  4UBG A;  3N7J A;  1OUS A;  1KGY A;  1NA1 B;  2DVA A;  4QPY A;  1J3P A;  2CHH A;  2HWC 2;  1GZT A;  1QY4 A;  1WA6 X;  3LEI A;  3ORJ A;  2AUY A;  5D8A C;  1A8M A;  4K1Y A;  4EN8 B;  3B94 A;  5B4X A;  1VBC 2;  3HN3 A;  4E4Z A;  4GKX A;  3FC0 A;  2JEN A;  4S2G A;  1OQ1 A;  4IV3 B;  1HRV 1;  3WF2 A;  2VMG A;  4WM7 B;  5T55 A;  2VTX J;  3SKJ E;  3UT0 A;  4AE2 A;  4DEV A;  2E33 A;  4XF0 A;  2R6Q A;  3MI8 A;  4Q4V 2;  1VLN A;  5FZO B;  3THC A;  1NG0 A;  2VJX A;  3TNP B;  1S2E A;  4QKB A;  3MPB A;  1UY0 A;  5KC6 A;  5FZC A;  1RUG 2;  2QQU A;  1JMU B;  3PLQ A;  4OYU A;  1UN1 A;  2P3K A;  1YHF A;  2A1X A;  4DY5 A;  3AZZ A;  1YYN A;  3GGL A;  2V5Y A;  2R0H A;  1W6O B;  3RJR A;  4DXT A;  1PX3 A;  2E31 A;  1LHW A;  1H6X A;  2OUJ A;  2J22 A;  4DPN A;  1W03 A;  1QJX 1;  2R30 A;  5LBF A;  2L9L A;  3ZYG A;  3BKZ A;  2A5Z A;  5G04 L;  3QOP A;  1MQT B;  2YGL A;  4CYD A;  5JLV A;  4ISQ A;  1W8O A;  1D4M 1;  1L3J A;  3FMG A;  1PNG A;  1X36 A;  3OCP A;  3SH5 A;  3DXU A;  4Q0Q A;  3IDB B;  1NAE A;  2HWB 1;  3POW A;  1V9U 1;  3NNF A;  1LHU A;  1O8S A;  4PLO A;  1G7Y A;  3WNM A;  4CUB A;  2FMY A;  5JXG A;  2YDE A;  3HPN A;  3H8O A;  2FBE A;  3ZLI A;  4XF9 A;  1G9C A;  2WBK A;  3HAG A;  5DUV A;  4H3W A;  3AP7 A;  4LBQ D;  1D2Q A;  3R6S A;  3W9A A;  2EVX A;  2VBD A;  2WUH A;  1RUD 3;  1X7N A;  1ZA4 A;  4OQ9 A;  2ZHL A;  4A2U A;  1N1V A;  2WSV A;  1E57 A;  2WNE A;  4Y1Y A;  1RHI 3;  1W2T A;  4XXA A;  4JC1 A;  4EQV A;  1F9K A;  1RUJ 1;  1W2O A;  1XJA A;  2LUW A;  3CKH A;  1ZZ9 A;  1B35 A;  4TZD A;  4A41 A;  1KJL A;  2DVG A;  1YQ6 A;  1HB2 A;  2PA7 A;  4Q4V 3;  5FYU A;  1PO2 2;  3NL1 A;  2GNT A;  1POV 1;  2JDM A;  4MLO A;  4YM1 A;  2RM2 1;  3EMR A;  3VZN A;  5IAX A;  2DBN A;  4HON A;  4AEJ A;  5ERL A;  4JHT A;  3ZFE C;  4J25 A;  4WBB A;  5SV5 A;  4C1W A;  2B9U A;  2CL2 A;  2JWP A;  3J8F 3;  2DDU A;  3DYO A;  4DEQ A;  1V6J A;  5FXW A;  3IMN A;  5FXX A;  1NXM A;  3VZL A;  1AX0 A;  3OBA A;  1JYV A;  1Q8P A;  4V2V A;  4CDX C;  1RUG 1;  4LA2 A;  1VR3 A;  4YFW A;  1WMD A;  5A3T A;  2O8Q A;  3N7L A;  1WCS A;  2JG9 A;  1JHJ A;  1W9W A;  2R07 2;  4RS5 C;  3WW4 A;  3U14 A;  3SQO A;  1IQA A;  2DVF A;  3VKL A;  3SKV A;  4I01 A;  4I30 A;  3AMP A;  5J1X A;  2RJK A;  2WZR 3;  4AI8 A;  5BNO B;  1QOO A;  3ZO0 B;  1H8T C;  1YUD A;  4NIG A;  3VD4 A;  3R05 A;  4L8Q A;  4GH4 B;  2PHF A;  1LU1 A;  1MEC 3;  2QQN A;  3WG3 A;  2YZ4 A;  5CFD A;  2W2I A;  4R4X A;  1S0G A;  2ADD A;  3USS A;  2Y6K A;  4BH9 A;  4XJW A;  3PUA A;  1HB1 A;  3SCF A;  3M8L A;  5FYV A;  3EB7 A;  4DRV A;  3GF6 A;  1TG7 A;  3RRD A;  3I3M A;  4ZS2 A;  3N4M A;  1NCR C;  4NPM A;  4R9B A;  5LA1 A;  1OUR A;  1Y9G A;  5FAX A;  5C5U A;  4FO9 A;  3FUO A;  4I2O A;  4W4Z A;  5M0T A;  5KHH A;  5JSP A;  3KSC A;  3HD8 B;  1BVV A;  3NV2 A;  1HXS 3;  4UFJ A;  4H55 A;  2ZEX A;  2ZHK A;  1IZ3 A;  3VLB B;  4CDU B;  2EXK A;  1PVC 1;  5KXC A;  5ABJ C;  1R08 1;  3J4U H;  1LR5 A;  2FZ2 A;  2GN3 A;  3FE5 A;  2AEZ A;  3ZSL A;  2Y34 A;  3OYW A;  4CCM A;  1REE A;  5H9Q A;  3VZJ A;  1H1A A;  4HKW A;  4QX0 A;  2O14 A;  2WLQ A;  4D6Q A;  1LED A;  1OA4 A;  4IE5 A;  5EJ3 A;  2FCT A;  4ITC A;  2XJS A;  2ZTN A;  2ARE A;  1JYT A;  1CZT A;  4P02 B;  4ARY A;  1KDM A;  3AL6 A;  2E7Q A;  1US2 A;  3QBQ A;  3ZN5 A;  1AJK A;  2YU2 A;  4XTM A;  2VZR A;  4Q0P A;  5JPM B;  2VMF A;  2OPK A;  2Z4F A;  2OZJ A;  2RS3 1;  2WN2 A;  4G4F A;  5EHD A;  1AL2 3;  3N9Q A;  4YAR A;  4NII A;  4Y20 A;  4JDN A;  3ZYB A;  2O0O A;  4HN0 A;  4E8D A;  4GWN A;  2CV6 A;  4AVS A;  2RS1 1;  4LNV A;  1ZRE A;  1W8H A;  3CNA A;  5FWE A;  4F8A A;  4Q4W 3;  1W8Z A;  1WD3 A;  3EBR A;  2GAU A;  1WUV A;  3JZV A;  4Q26 A;  2AYH A;  3VHN A;  1SMV A;  3PVN A;  1GWK A;  1O5L A;  2WSU A;  3RFR A;  3N7M A;  2XQR A;  1LOA A;  1QJY 1;  4CP2 A;  2D3P A;  1NLR A;  1EPZ A;  3IWZ A;  1XU2 A;  2Q1Z B;  4LTA A;  1W0N A;  3RS6 A;  5J96 B;  3ES1 A;  1RL3 A;  2Y26 A;  4GZ9 A;  4AHW A;  1LGN A;  1NKG A;  2QQI A;  2UU8 A;  4WZC A;  1AL0 G;  4I09 A; 
#chains in the Genus database with same CATH homology
 1YC6 1;  1JS9 A;  3J7M A;  3J7L A;  4NIA A;  3J7N A;  4OQ8 A;  1STM A;  1CWP A;  1A34 A;  1ZA7 A;  4OQ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...