3VKOA

Galectin-8 n-terminal domain in complex with sialyllactosamine
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
147
structure length
147
Chain Sequence
NLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galectin-8
publication title X-ray structure of a protease-resistant mutant form of human galectin-8 with two carbohydrate recognition domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 31
structure length 147
sequence length 147
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3vkoA00
3WG4A 2CWSA 4AGVA 1DYKA 2NM1A 1LU1A 3A0NA 1Z0HA 4FOQA 1EPWA 4BPZA 4LBQD 4GXLA 2DVAA 4AGGA 3M3CA 1MR5A 1RINA 3JUUA 2WJSA 2R16A 1GBGA 1UAIA 1MS0A 5H9RA 3USUA 3D6EA 1DQ1A 2GN3A 4Q26A 1N3QA 4FPFA 1YXWA 2PHRA 3QLQA 2A75A 1YYNA 2CNAA 2XG3A 2ARBA 5KXEA 4AWDA 1ZA4A 2DTYA 2YY1A 3M3QA 3N35A 1BKZA 3FBYA 2WT2A 2CTVA 1AZDA 2E53A 4M3CE 1SLLA 1ULGA 1VLNA 4AVTA 3DGTA 1LTEA 1DFQA 1LGCA 1SLAA 1QU0A 2DWRA 3VKNA 4XBLA 1H9WA 5DG2A 2YMZA 1WD3A 1KJLA 1SLIA 5KXCA 5JLVA 4YW1A 1CR7A 1ULDA 2UURA 4ITCA 4UW3A 1WW4A 1C1LA 2YXSA 4Y20A 4DRRA 3POYA 1LHNA 2VXRA 4LBLA 1H9PA 2GDFA 1GV9A 2A3YA 1LEDA 2D6LX 1UZZA 4XBNA 4YZ4A 2G4IA 5IK7A 3V0BA 1GLHA 5CAZA 1IS3A 2ZMKA 1JYCA 4LBQA 3WDTA 1G9BA 3V0AA 1C4RA 3FLPA 4FQ4A 4Y1ZA 5CB7A 1JXNA 2NMOA 2VU9A 4AYUA 4FP2A 1V6JA 1W6PA 3N3HA 2A6WA 1FX5A 2P34A 3AP5A 5T5LA 4P9YA 3UJQA 1LESA 2A3WA 4NOTA 1F5FA 1JBCA 2W52A 4XBQA 4ATEA 3PVNA 4CRQA 3B3QE 5GALA 1HQWA 2ZGTA 1NXD1 2KM2A 1LOGA 1S1AA 4K20A 4W65A 2OUJA 5JOXA 1PZ9A 3AP7A 3AZZA 1HKDA 2P3JA 5T55A 1ENQA 1UKGA 3WDXA 2AYHA 3PJQA 5BYNA 1SBFA 3SNMA 1W6QA 1JW6A 3NWKA 4PCRA 2RHPA 2DUPA 2ZMLA 3AZWA 3O12A 4DFSA 3W58A 2C5DA 3OYWB 1MZ5A 1S0BA 1LOFC 4Y1XA 4XHBA 3AYDA 1C1FA 2GNMA 5CNAA 3OY8B 1G9DA 3FUQA 3A0KA 3N7MA 1SACA 2DU1A 1GYKA 2R0FA 4YG3A 3WZ1A 1BZWA 3ASIA 3MW4A 1A8DA 1V6NA 5T52A 4ISQA 4M01A 1SLCA 2ZZJA 5IUQA 3AXEA 1GKBA 2P3KA 5E8AA 2GNTA 1IS6A 1WUVA 5E88A 2ZGPA 5GJ6A 2EALA 3AYCA 1Q8VA 4FPCA 1QDCA 4M00A 3WUCA 2ZGLA 1AX0A 2V5YA 4OZXA 1N47A 1QDOA 4XOGA 5DUWA 1SLTA 1V6OA 1MVQA 1DQ5A 1N1YA 2AR6A 3T2TA 1G7YA 5T5JA 2ZMNA 4Q1RA 3WDWA 4YM3A 3IM0A 4LBMA 2ZABA 3DUIA 1I3HA 3WDUA 1VAMA 4FPOB 1NLSA 1DBNA 2WSUA 1AXZA 1O4ZA 2UWAA 3VV1A 2D43A 3WOGA 5JOZA 4BOWA 1CPMA 2PHWA 1AXYA 1WCSA 3T1LA 4K1ZA 2P37A 4AVSA 4FPKA 4YFZA 4FOWA 2GNDA 3ATGA 5FREA 3OJBA 2GMMA 1CJPA 5DZFA 1FNYA 2JKBA 1S0CA 1MS5A 2AGSA 1MS9A 2VH9A 1GNZA 3UK9A 2DV9A 1WW7A 3USUB 2H0BA 3WUDA 4BLIA 5GLUA 5GZGA 4Y1UA 4FPLA 2ARXA 2D44A 2V73A 3IN9A 5GZFA 2B7YA 3B9CA 1HDKA 1LECA 1LODA 3D4KA 1GZCA 2UU8A 4FPYA 2DVGA 4UW4A 3ZPYA 2PHUA 4KBBA 3NV1A 2DUQA 2LTNA 3D5OA 1IS5A 2AUYA 3H0OA 3M1HA 3AYEA 5GM0A 5DZGA 1IKQA 1OKQA 1S0EA 1V6KA 3ENRA 4CZSA 5CA6A 2AENA 2SLIA 2EXHA 5AVAA 2A7AA 1U0AA 2VY0A 3SH3A 1ONAA 5GZEA 1APNA 1Q8QA 1G8WA 1RITA 1S0DA 2WT1A 3GALA 4RA0A 1DQ2A 1MACA 2ZGRA 1SFYA 3N7LA 1CIWA 4BM8A 4XXAA 2CL2A 1ULEA 2JE9A 4SLIA 1JN2P 2DUOA 3FLTA 4UW5A 1D0HA 1VALA 4Y20B 3WCRA 3OBRA 4Y24A 5IT6A 4U36A 1LHUA 3WHUA 3JU9A 1DQ4A 1W6NA 3ZSMA 2DYCA 3BIWE 4YGEA 3LSEA 4ZKTB 1LOBA 3QCWA 2R1BA 4DS0A 3I8TA 3SLIA 4BQ1A 4FVVA 2ZGUA 3RMYA 3V0AB 1A3KA 1LOFA 4M3CA 5GLZA 2E51A 1BYHA 3ZXLA 2NYYA 2W39A 3NV2A 1V6MA 1W6PB 1WBFA 3ZYPA 2HYKA 4YLZA 2OW4A 2ZAAA 2ZHLA 3ZXKA 2WQZC 2OUHA 2EXJA 5DUVA 4RL7A 3O5SA 3NV4A 4XJWA 1DQ0A 5GLVA 5GZDA 3APBA 1ULCA 3IPVA 4YZ1A 3AP6A 4R9CA 2DU0A 2ZKNA 5IK5A 1AX2A 1CVNA 4ZXKA 3VUOA 1SBEA 2AH2A 4PBOA 3FFZA 2JJ6A 3TB0A 1W6QB 2WT0A 4XIKA 3N7JA 1KITA 1Z78A 2EF6A 5T54A 1LGNA 2XB6C 1QKQA 1FV2A 1A78A 1CONA 2PHFA 1Q8SA 2ZHMA 1BQPA 1LOAA 4XXPA 4Z8BA 3VKFC 1AF9A 1N1TA 5DG1A 3MW3A 5GZCA 4YW3A 3ZXFA 1LGBA 4GALA 4F83A 1VAVA 1XQNA 2ERFA 3MPPG 3MEPA 4BMBA 1AJKA 2WSVA 2NN8A 2WNEA 1QNWA 2ZACA 1S0GA 4XJ9A 3U4XA 3ILFA 3HN1A 1R1ZA 4JCKA 3PMEA 3RQ0A 1KDMA 2D3RA 4Q1PA 3SH4A 1Y7BA 2ZGOA 3NV3A 3UL2A 3B69A 1UX6A 2FHRA 2YZ4A 4TYSA 2YROA 3KM5A 4XTPA 5EXOA 5T50A 2NP0A 2EXKA 3RS6A 1KQRA 4P14A 2WKKA 1SBDA 4JRAA 4YGDA 1PZ8A 4YW5A 2Q5TA 4M3CF 2GALA 4XMAA 3UJOA 5EYYA 1WLDA 2JD4A 3AYAA 2CYFA 1DLLA 1W6MB 1N3OA 1MZ6A 4HL0A 4YFWA 5DXDA 5FRAA 2D6NA 1F9KA 4XE9A 1QOSA 3R05A 1AX1A 3A4UA 3AZYA 4R9BA 4YG6A 4XJUA 2A5ZA 4YM2A 3N36A 4LBNA 3PVEA 2D7FA 1GZWA 2I2SA 2W08A 5H9QA 4HANA 3N7KA 1GSLA 3OBTA 5JOWA 4FQZA 4IQPA 3V64A 4FOYA 4XJ8A 2FMDA 2ZA9A 1G86A 3WLUA 5L73A 2ES3A 3WVJA 1AVBA 5H9SA 1ENSA 3IKWA 1FYUA 1YO8A 2VW0A 3WG1A 4YM1A 2GMPA 1IKPA 4GKXA 3HMYA 2EIGA 3L2YA 1DIWA 1G9FA 4YM0A 1ZM1A 1V6LA 4GWMA 5F5QA 1WBLA 1W6OA 3FUOA 3ILNA 3W59A 1W0OA 1LHWA 4XILA 5SV8A 2ZGKA 3BTAA 4GA9A 3RSJA 2PELA 4Y22A 1UN1A 2R1DA 4WV8A 5DUUA 5HCFA 1F31A 1LEMA 3AJZA 3WV6A 2NMNA 3ILRA 1WW5A 1MS8A 4L8QA 1YRZA 1MS3A 2EXIA 1PZ7A 5CBLA 4XIOA 3M2MA 1LULA 2AREA 3V65A 5EWSA 2D3PA 3O0VA 1SCRA 4JC1A 1D2SA 1V6IA 2P2KA 2Z42A 1FV3A 1LENA 2PHTA 4XDQA 5JOYA 1S0FA 2SBAA 1DZQA 4LBKA 1W6NB 2ZGMA 4XJZA 3WCSA 1G9CA 1W0PA 4CTEA 3AZVA 3C2UA 3Q9OA 5T5PA 4BMEA 3ZXEA 3R4UA 4C1WA 1QGLA 2CWMA 4WZFA 1CN1A 2TEPA 4Y26A 1V00A 5HCBA 1UZYA 2R0HA 3AK0A 4M3CB 4DPNA 4NO4A 4XTMA 5LK5A 4K21A 1DYPA 3V0BB 4YZ3A 2D6OX 1JHNA 2BQPA 4LBQB 3AP4A 1IOAA 3RMXA 1GZ9A 2VW2A 3AP9A 2D6PA 4XYXA 5DUXA 4ASMB 3BOPA 1VIWB 2DURA 2A6VA 4DRVA 4TZDA 1CQ9A 1KJRA 1Q8PA 4PQ9A 3IPVB 1FAYA 4PF5A 2P3IA 1ULFA 1IS4A 1UPSA 4H55A 2DVBA 3LCPA 1MS1A 5JMCA 4Q8LA 4FOVA 1S0JA 3T1MA 2GN7A 1AXKA 2EAKA 4FPJA 3M3OA 5GLWA 2A6YA 1GNHA 1WD4A 4WVVA 3SH5A 5F9TA 5IK8A 2W68A 3ZSKA 2DVDA 2ZHKA 1OQ1A 2VW1A 3I4IA 1YI7A 3WG3A 3ZSJA 1H30A 2PHXA 4YZ5A 3B01A 5KXBA 1ENRA 4ATFA 4K1YA 1N3PA 2E6VA 1FNZA 4AVVA 2ZGNA 3TAYA 3BODA 1CPNA 1TEIA 3AXDA 4DQAA 3ZXJA 1URXA 3WNXA 1MS4A 3R4SA 3ZSLA 3WDVA 1QOTA 2A3XA 2DTWA 2R49A 3WG2A 1O4YA 1JUIA 1Q8OA 1FATA 1LOCA 3IMNA 1YIFA 1BXHA 2WLQA 1KDKA 3SITA 3VKOA 3CNAA 3B00A 1HLCA 4LBJA 1WLWA 2A6XA 4XHXA 5IK4A 2A70A 4Y1VA 3M3EA 3MW2A 3VKLA 4MYEA 1GICA 4FPGA 1DGLA 3AJYA 3VKMA 2UWBA 1WW6A 4Q2FA 2E7QA 3RRDA 5JDBA 3OGGA 1G9AA 4FPHA 2VUAA 4R9AA 1QF3A 1MVEA 3O0WA 5DZEA 2JECA 1LHVA 2YV8A 3WDYA 3ZYRA 3AFKA 1LOEA 1GZWB 1J1TA 3WHTA 1N1VA 1S0IA 4FP3A 2D6MA 4D69A 1CESA 4Q27A 4YZ2A 1KRIA 2ZGQA 4XZPA 2GMEA 3RG0A 3OYWA 4WVWA 3LSDA 1N1SA 4YGCA 4I30A 1JOJA 3KQRA 2CY6A 3OY8A 1DHKB 3AX4A 1SLBA 4YG0A 2GNBA 2JE7A 1LJ7A 5HCAA 4Q8KA 4AGRA 2NZ9A 4PBPA 5T5OA 1AJOA 4ISRA 4U2AA 2C9AA 2DVFA 1W6OB 5EYXA 2A71A 1X50A 4P9XA 2UWCA 2ZBJA 1I1EA 2ZHNA 4YGBA 4Y1YA 3OPZA 1DQ6A 1W6MA 4FPEA 2A6ZA 4UW6A 4XMIA 5JVVA 4P9WA 3POWA 5E89A 4XJAA 2JDZA 3O0XA 4GKYA 4Y22B 5GLTA 1B09A 1HQLA 1C57A 2ENRA 1SCSA 4YW2A 2D3SA 3HR9A 1LU2A 1JYIA 1BJQA 1Q56A 2ZGSA 2D6KA 1OFSA 1QMJA 1UL9A 3INAA 3ZVXA 3AZXA 1QNYA 1GANA 5H9PA 5KXDA 4R9DA 1LCLA 3POSA 2LALA 1QOOA 3SISA 2OVUA 4C1XA 3FLRA 4BLJA 3PVOA 1UMZA 2E7TA 1RIRA 4GWNA 3GNEA 4LBOA 4YW4A 1WLCA 1LHOA
chains in the Genus database with same CATH superfamily
2CWSA 1WZXA 5A6QA 1Z0HA 5T3NA 4FOQA 1F4AA 1YFYA 1QJFA 1YJLA 4CDUA 4CXXA 1O3SA 4CEWB 3OUJA 2R16A 3GJAA 1ZBA1 3LEMA 5F3EA 1UCXA 4BWOA 2FDHA 1ASJ2 2VZPA 5F2SA 3WY6A 3SCGA 5C71A 2G9GA 4LQRA 4B4PA 4Q26A 1EYBA 1N3QA 1AR73 1BBT3 1RUE3 3QLQA 3I2GA 3A21A 3NO8A 2XG3A 2ARBA 3BU7A 3H42B 4AWDA 4CSWA 3O14A 2DF7A 2D5HA 3GZUC 2PHDA 1K5JA 4AQTA 3B7MA 5BNQA 4PLMA 1Y43B 1ZX5A 5IYYA 4Q4X1 1GQPA 1RUH1 5DAPA 1PVC2 4LO7A 1ULGA 4AVTA 1PGW1 4HK9A 1QU0A 2P4EA 2YMZA 1C8M3 1WA6X 2B39A 2VPVA 2VL4A 5IAVA 5JLVA 4HSLA 5KHGA 1ULDA 4F7ZA 3RVHA 2Z2SB 2VMIA 2JKXA 1VBA3 1DGRA 3LIHA 5IVVA 3TEYA 3W5MA 4UW3A 4GQ7A 4L99A 3H1MA 4DEVA 3ELNA 4LBLA 3TEWA 1NLRA 3RZHA 1GV9A 2A3YA 3VBOC 4E9KA 3HQRA 1Q43A 3VHPA 5FO7B 1ND2C 1UZZA 1RUD2 1ODNA 2GSYA 4P9IA 2ID4A 5FYHA 3BTZA 2VNOA 1GLHA 2JDMA 2ZMKA 3WDTA 4XEZA 4RQPC 2C0ZA 3I3EA 2WNUB 2NMOA 5FP9A 5BPXA 3K4ZA 1H8TA 2F4PA 2JB8A 3M8LA 1O3QA 3JCIA 3TRSB 1BLZA 5ISLA 4I3PA 5D8AA 5HI0A 1BMV2 4BQ3A 3VHRA 5T5LA 3U75A 1RTVA 1LESA 2WA4A 4UFIA 5C3PA 4IW3A 3B3QE 2KM2A 3ZX7A 1S1AA 5FPBA 3MF6A 5IAXA 3AP7A 1GNYA 1HKDA 4AVAA 3A7QA 4FFIA 3LQCA 1UKGA 4QXCA 3WDXA 1Z7S2 4HN0A 3SNMA 3LA2A 2J1RA 2P17A 3HQUA 3NWKA 4KWUA 4PQQA 4R8HA 4RS5C 4CDQB 5LEJA 2DUPA 4DFSA 2B4KA 1LNSA 3OYWB 2OYZA 1S0BA 2HWE1 3CIHA 2HWD1 5IVBA 4Y1XA 3HBKA 1W8TA 1W9FA 4E2SA 3OY8B 4MGSA 1TME1 4RGGA 5A7QA 2MPFA 1JZ5A 2QTWB 3BALA 4D7SA 1OF3A 1GYKA 1CAVA 1TQ5A 1DGWA 2ZTNA 5FP7A 5LB6A 4Y3OA 4IE6A 1PMIA 5T52A 3UV9A 2X09A 1ZYBA 4M01A 2Q1FA 5APAA 3WP6A 1GKBA 1OH3A 1RUF1 3DECA 1XXNA 1IS6A 3KCCA 5FPVA 1YC61 2WZEA 3O1MA 5GJ6A 4W50A 4UWDA 1U5IA 2GP3A 3OD0A 2QDRA 1Q8VA 1UWWA 1NA1C 2ZGLA 4K8FA 4QX1A 5FZFA 2WFF2 2W1SA 4FFHA 4OZXA 1N47A 5DUWA 1OF4A 2V4VA 1SLTA 4AAPA 2CGPA 4MUVA 1H2LA 3T2TA 5FPXA 1FPN3 2JDYA 2YYOA 3MGUA 4YM3A 5FBJA 3P3PA 3RZKA 3DUIA 2Q8EA 1I3HA 4N9IA 3WDUA 1FI2A 1VAMA 1DBNA 1HN0A 5ERLA 3VV1A 2UWAA 3AKPA 3FJSA 5KBFA 3HJRA 2PHWA 3JBG1 1WCSA 5FPLA 3U4SA 4K1ZA 3WT3A 3O1VA 2P37A 2FD8A 3VGIA 2XL9A 1HRV3 2JDKA 3VHNA 4I3GA 1HV0A 3ATGA 2XJSA 2GMMA 3OJBA 5ACA1 4M0NA 4NPLA 1FNYA 4OHXA 1JODA 3LB9A 3UK9A 1GNZA 3USUB 1US2A 2DV9A 2H0BA 3PMSA 4OUEA 1NYWA 5GLUA 4URTA 2X05A 5FXWA 3IN9A 2V73A 3VBOA 1ND2A 3AMMA 3B9CA 4EZ4A 1OA2A 1CGPA 4IUGA 4F8AA 2UU8A 2DVGA 4COUA 3J8F2 5FPAA 3NV1A 3MFAA 5IVFA 4RQPA 3ZDVA 5CADA 4FSJA 2B8MA 5KHJA 1OVPA 4COVA 1IS5A 2AUYA 1POV3 3M1HA 3U11A 3UKTA 4P5YA 4XVHA 1S0EA 4BH9A 3H8OA 2GP5A 2SLIA 5AVAA 5FJHA 3PUIA 1U0AA 2IXLA 1APNA 1Y3TA 1E5HA 1G8WA 2HWB1 4E4ZA 4RA0A 2ILMA 1MACA 3N7LA 1SFYA 2QFEA 3GZTB 4OI1A 3OCPA 1ZRFA 4XXAA 2CL2A 2JE9A 2PLV3 2DBNA 4YSFA 2DUOA 1XYNA 3C7OA 3FLTA 3KVAA 1VALA 4Q4W2 3WNMA 1AYM2 3LEGA 4C0HA 1OHFA 2Y8KA 1DQ4A 1W6NA 2R32A 1FOD2 3NSTA 4OUMA 4ZKTB 3LSEA 4YNIA 3KLSA 4RS5A 4ZU7A 1LOBA 4Q5OA 2Y33A 2QDNA 3UT0A 3ZDSA 2OQ7A 2XDVA 3KT7A 1UPIA 4KGQA 4LKEA 1RVF1 1VBB1 2K0GA 3ACGA 3N9OA 3OF1A 3QACA 3QH7A 4UFLA 4DZGA 2QCSB 1IQAA 2K9ZA 2YBSA 3GHNA 1F4HA 4HSJA 1VJ2A 4XF0A 3ZXLA 2NYYA 5IATA 3N9PA 1MEC2 3WW3A 2IVIB 1VBD1 3OTFA 4KH9A 3ZYPA 4EN6B 2IFRA 4YLZA 4Q0SA 2ZAAA 2ZHLA 2WQZC 2OUHA 4XUTA 4XABA 4XFIA 4XFHA 4HT1T 1OBNA 4Q4Y3 4IDZA 3APBA 4LKFA 1OXCA 1KGYA 5AFBA 1RHI2 3MDPA 4UF0B 4EQVA 4R9CA 2JG9C 1J3RA 4BK4A 3FWEA 2WAAA 3NJZA 1CVNA 4ZXKA 1R1A1 2JB4A 5EJZB 5DMYA 4PBOA 2JJ6A 1ND3B 1OOPB 3N7JA 1NA1A 1OA4A 2PHFA 1CONA 2ZHMA 2HWC1 3I59B 3DYMA 5BNPC 1BQPA 2RS33 5KHIA 3RJRA 1AF9A 1N1TA 1OLMA 1POQA 2R062 2WUHA 3GGLA 1CAUA 3MW3A 5GZCA 1QXRA 4YW3A 4GALA 3DL3A 3I54A 5IJRA 2HEVF 2QQMA 5I8TA 2WNEA 4LHSA 2XR4A 1RUJ3 1G6NA 4RHV3 4XJ9A 5J98B 2WNVB 3A23A 1KDMA 1ZZ6A 2WC2A 2BOJA 3SH4A 4A7ZA 5E16A 2FHRA 2YZ4A 3I2JA 1XNTA 3ZYBA 3LAGA 1CX1A 4OVEA 5HV4A 4WM8B 3Q8CA 2RS12 1X9TA 3C7FA 1W8ZA 4JRAA 1PZ8A 4YW5A 4M3CF 1X8MA 1J3PA 3VD5A 2B9VA 4XUNA 5EYYA 2BVVA 4ONUA 2XOMA 3OB8A 4WVZA 4YW1A 1LB2A 1W6MB 1N3OA 4IV3B 4YFWA 3W21A 3CZUA 4KNCA 3KB5A 4FAGA 4DNYA 3FZ3A 4GD4A 3R05A 5A7PA 3W20A 5C9AB 2R073 4YG6A 3AZYA 4R9BA 2XGXA 4DIQA 1B35C 4QU2A 1F2NA 5F6KA 3RZJA 2A5ZA 3ZYGA 1K5MC 4LBNA 2Q8DA 1RJ8A 2RMU1 3MUZ1 3THCA 5A1AA 2D7FA 5H9QA 3ZIXA 4QPWA 4Z82A 3DPRB 3BIEA 2XKPA 1GSLA 3N7KA 4B7EA 5HCHA 4HKOA 4IQPA 1VBC3 3NW4A 5EIYB 1PGSA 2BYVE 3S5QA 1G86A 1OKOA 1XNAA 1VP6A 3BB6A 3WLUA 4Q4V2 1AVBA 3VD9A 1ENSA 2VW0A 3H8UA 3MYXA 2JG8C 1D0GA 1FMD2 4AQSA 1IKPA 5G05L 4TWTA 4OHWA 4JAAA 1EAH3 1PK6B 3OGSA 4QMAA 1VRH3 2XUEA 2Y6GA 1G9FA 4XCAA 1PO13 1MQTC 2JIGA 4YM0A 4FO9A 5KHHA 1V6LA 2ZX3A 5F5QA 1QJEA 1W6OA 1YI9A 2C24A 3ILNA 3HNMA 4FXKB 4XETA 1RUNA 1OURA 3AFGA 3T3YA 3W59A 1LHWA 1RUI3 3KV9A 3AKTA 4UBGA 2XBO3 4XILA 2RJKA 5K4LA 4A42A 1F15A 1RUG1 3PU8A 2PELA 5FMCA 4PF1A 4UBHA 4CCDA 5LW9A 5LK7B 4YVWC 3ILRA 5I0TA 1HB1A 1YRZA 1MS3A 2EXIA 1I5PA 1PZ7A 2J42A 4S2FA 4XIOA 5LEKA 1ZZ9A 4FTEA 3U07A 2JG9A 4KI5M 4JC1A 4KG0A 1ZZ8A 2P2KA 5DDJ1 1FV3A 3JD71 4AF9A 1DZQA 1TZOA 3IAPA 2ZGMA 5K8SA 1LKNA 3NNMA 4HBNA 3RZZA 4QQHA 3R6SA 2ZCWA 4DUXA 2WWUA 1WA4A 3NAPB 5BNPA 4KMQA 4YWAA 2Z79A 1QGLA 1UYXA 2CWMA 1CN1A 4Y26A 1V00A 4IGOA 4CDXC 3AK0A 5FIXA 1J1LA 4NO4A 4AEMA 4LITA 5LK5A 1AR72 1BBT2 2ORXA 5L7OC 1DYPA 2J22A 5L19A 1L7QA 3K4DA 4NIHA 4LBQB 2BQPA 4YARA 1JI6A 2Q1ZB 1W8NA 2WO3A 2VW2A 5DUXA 4ASMB 3AKSA 3BOPA 4OQ8A 1SMVA 1WGPA 3V56A 4OULA 4PF5A 1ZBA3 4MGQA 4N8MA 2X5IC 2Y26A 3E6DA 2PMWB 2WABA 4NPMA 4FOVA 1S0JA 1UZ0A 1ZRIA 2FQPA 3KCYA 1C8M2 1BCXA 1AXKA 4WVVA 2LW8A 4NWVA 4RGAA 1VBA2 2PAMA 4OUSA 3VBRB 1OQ1A 2HBUA 3BN6A 2VECA 3ZSJA 5FY7A 2YU1A 2VTFA 5A80A 2PHXA 4XFBA 4Q4X3 4JZRA 4KGGA 4LO6B 1RUH3 1FNZA 4AVVA 1X82A 2Y38A 1ZRDA 1B35A 4NHYA 2Q1MA 3EQEA 4PJYA 1VAKA 4QXHA 2RM21 1K5MA 3SEEA 3T4HB 3AXDA 5JCTA 4JTNA 4JRLA 2J1AA 3WP4A 1OT5A 3SC7X 3VBHC 3WNXA 3ZKYA 1IHMA 4CU6A 3WSOA 1H1AA 3FX3A 2YC4A 3JQXA 3OD4A 4FT8A 2BTVC 4G9SB 1FATA 3AKRA 1H4HA 4AOCA 5A7SA 2ARCA 3LDRA 1DCSA 2E7AA 3SITA 3CNAA 2YG0A 2JG8A 3B00A 4GMP1 3VKOA 3ZFEC 2A6XA 5FY1A 3PVBB 5IK4A 3EYPA 3VKLA 3J7HA 1MQTA 3I2DA 5FLHA 1GICA 3N9QA 3AJYA 4QX3A 3VKMA 2UWBA 3ITQA 4Q2FA 5FDBA 3C7EA 3WNOA 1ODMA 2V4AA 1MVEA 4HMZA 4LK7A 5FY0A 2JECA 3JXSA 3N9LA 4B1LA 1QJY1 1LOEA 1J1TA 1W03A 1N1VA 2D6MA 4YVWA 1CESA 4Q27A 1KRIA 3IZOA 5EHDA 2G1MA 3T2PA 1JOJA 4DY5A 4C90A 2I45A 2CY6A 4MSVA 5FCCA 2VOKA 2WZR2 4LA3A 5JXIA 3AX4A 2XLGA 3M70A 3T09A 4YG0A 3NL1A 1LJ7A 4P00B 1CAXA 3VBUC 4Q8KA 2IC1A 2G19A 3N4MA 1GWLA 2R042 5LZ6A 3M4FA 4W6YA 3AMNA 4QU1A 5T5OA 2HWE3 4ISRA 2HWD3 2C9AA 4ZS3A 2C6SA 3ZFFC 1TME3 4CDXA 4DXZA 4FPEA 5LBFA 5L7OA 4UW6A 4XMIA 4N53B 4QHZA 3V65A 2JDZA 1MZEA 3PIGA 5C4WC 4WBBA 4AI3A 2ENRA 1RUC1 1BJQA 1WLTA 2D6KA 4AHWA 2JDUA 3ZVXA 1UL9A 3INAA 3P6BA 3AZXA 4E2QA 4C0BA 1GANA 1RUF3 2O8OA 3NMBA 3CU7A 1LCLA 2X5IA 3POSA 5CIRA 4IEXA 3CLPA 4J6GA 4YYOA 1UMZA 5FMDA 4GWNA 4L9BA 4YW4A 2BV4A 1OC1A 4LLFA 1LHOA 2VCAA 4XQDA 5FO8B 3WG4A 1HRV2 4AGVA 3E5QA 2NM1A 4DXRA 1W06A 3A0NA 3CJIC 4MOAA 5CFCC 1PO22 4BPZA 5ANQA 4LBQD 3PTYA 3K2OA 4GJZA 1XRUA 5C33A 1H1MA 4IE4A 1L7RA 4TLFA 5FZHA 1UAIA 1MS0A 1YWKA 4EWAA 1NQDA 4ASKA 3EBRA 2JD9A 1XOYA 4M0HA 1OMIA 3JBG3 4AFDA 2VCCA 4FPFA 1NCQB 1YXWA 4O61A 3VBHA 1JYXA 2PHRA 3U14A 3VBSB 2CNAA 4NIGA 5LBCA 1JTZX 5ACA3 4P9GA 5KC6A 1JYNA 3VLBB 2AACA 2DTYA 2YY1A 2YFZA 4N7UA 4GWIA 1EPZA 3I3MA 4LNVA 3VZNA 5ANNA 1BKZA 2GC2A 2P6HA 3PJYA 2OIIA 3FBYA 2WT2A 4MX3A 3ZFEA 2CTVA 1AZDA 2LRPA 4QM8A 4M3CE 3VDDC 2ETEA 5F3IA 1PX4A 1LGCA 1CAWB 2PLV2 3HD8B 1NCRB 3FFQA 4KWLA 1V9U1 1ZZBA 4RFT0 4CXYA 2UURA 3LEKA 2FDKA 4Q0VA 1C1LA 4Y20A 1Y9GA 3I3BA 2IXJA 4DRRA 1W39A 4TLGA 1LHNA 1XNDA 5FZGA 1YFUA 2HWB3 3CJXA 4CA9A 1A8MA 5LA1A 2WA3A 4S2DA 4XBNA 4YZ4A 3ZOIA 5IK7A 5LRSA 3V0AA 1JYCA 5CVRA 4EN8B 4Y1ZA 5CB7A 4JTOA 3S30A 4MGKE 2D97A 5D1IA 1V6JA 1W6PA 4MG2A 5DPNA 2D93A 1YEWA 3AP5A 4Q4Y2 4P9YA 4QHBA 3H1YA 3VBUA 1DZTA 4NHKA 1RVF3 1VBB3 2PHLA 3MIDA 3UJQA 5JI9A 2A3WA 2OZ6A 4NOTA 1JBCA 4CU7A 3HBZA 1XB9A 4AI9A 2LROA 3PVNA 3VZJA 4Z92B 5HV0A 1HQWA 1NXD1 5C3OA 3FE5A 5C3QA 4NRQA 3ZFFA 1PZ9A 1NZCA 1VBD3 2NLRA 2OPKA 3RI9A 5BYNA 3PJQA 3ECQA 1TNFA 3ON7A 1J84A 3KF5A 1W6QA 5C4WA 1J83A 3OUIA 1NAEA 4PCRA 5I0RA 4N43B 3L2HA 3MUY1 2ZMLA 5BNOB 2XKOA 4H14A 1BK1A 2ZZQA 1PIV1 3O12A 4LKDA 3MFCA 3M3IA 4BB3A 4V1PA 1UF2C 1C28A 1R1A3 2Q8CA 5L9BA 2IFWA 3KZ4C 1LOFC 1AR81 4OZOA 1RUJ2 2GNMA 2BDRA 4UXAA 4CUGA 4CXWA 2VMHA 1O4TA 4I01A 4IV1B 5FZIA 1SACA 1SZBA 5K9YA 2HWC3 1AR92 1AHSA 5FWEA 3KV6A 1JS9A 3CJIA 5FK8A 4AEJA 5CFCA 1YLLA 1BZWA 1A8DA 1BVVA 1WMFA 3QOPA 1SLCA 2ZZJA 5IUQA 2K2SA 3PIJA 1R081 2HJIA 5BV6A 2BPA2 2GNTA 2IXCA 1WUVA 2VE1A 4DUVA 1JZ3A 2ZGPA 1REEA 3SCFA 2EALA 4QQLA 3AYCA 4WM7C 3OEAA 4M00A 4XF3A 5CKMA 4L97A 3NNGA 1UOFA 1D4VB 2BGPA 3FL7A 2V5YA 2VVDA 2R072 2WINB 4QXKA 2AR6A 1TVGA 1ENXA 2ZX2A 3VZOA 5A7WB 1QIQA 4L0PA 4BLIA 3ZN5A 2YPDA 4HPKB 4AK3A 3SMHA 1OSGA 2X10A 4YVSB 4HVRA 5EJ3A 3VDDA 1ASJ1 2GU9A 1VBC2 4HN1A 4AFMA 1O4ZA 3GM8A 2D43A 4EYUA 4ARYA 4BOWA 3RYRA 1HXS1 3E5XA 3WF4A 1CPMA 1AXYA 1H2MA 2KA3A 2X29A 4JQTA 3U37A 3KHCA 4IGPA 3FHAA 4CDUB 1XU1A 1BEV1 4FOWA 2GNDA 4QB1A 4YFZA 2N7GA 1UY2A 4XAAA 1CJPA 1EAH2 2RMU3 3EB7A 2JKBA 4CCNA 1VRH2 3AMPA 4L2NA 5HBAA 3KT1A 1QH7A 5AC91 2QNKA 4Y1UA 4FPLA 1PVC1 2ARXA 1O5LA 1QWRA 1UIKA 2XVLA 5GZFA 4AQ6A 3KT4A 1LECA 1S2KA 1Y9MA 2QQVA 4FPYA 1RUI2 2HEWF 4XUQA 5FXVA 4FFGA 2XBO2 4IEQA 4KBBA 3ZXDA 4UAPA 4BU2A 2CAUA 3IDCB 3CF6E 5F5IA 2JDNA 2ZEZA 5GM0A 1IKQA 1VBE3 1V6KA 2AENA 1O3TA 3SXWA 4PLOA 3SH3A 3WX5A 1O6UA 2UY8A 1RUD1 4I09A 3GALA 3RZGA 3T0DA 1S0DA 4JKMA 4CP9A 4QPIB 4SLIA 1ULEA 2XWBB 4XCBA 1RUG3 4UW5A 5A3LA 3TYJA 5CISA 1D0HA 3U10A 3WCRA 4Y33A 1LHUA 2YC2A 2DYCA 1HQNA 1STMA 3PU3A 2QE3A 4YGEA 3SCHA 1AR62 3I8TA 4FVVA 3F95A 1AL23 2ZGUA 3ZN4A 5DDJ3 1YHFA 1PM7A 2WRAA 3G6JB 3JD73 3OGJA 1CIYA 2JDAA 1LOFA 4M3CA 1H8TB 4KU8A 1DLCA 1TMF2 2BRTA 1Y9QA 2WFPA 3NV2A 3H9AA 4OFGA 5D8AB 5EP9A 2Z4FA 1DG6A 4OQ9A 2OW4A 1VB4A 4CUBA 2ZX1A 1ZA7A 1ZBA2 1OD5A 2VTXA 3O5SA 4RL7A 4XC9A 3WNKA 4AZZA 4MV2A 1WMDA 5GZDA 3ME2A 4G3YC 5CG9A 1ZBE3 4BQ1A 1OPOA 3OPTA 4I0AA 3WXPA 5IK5A 2D40A 1KS5A 1GR3A 2L9LA 3NRUA 2MEV2 3BCWA 2AH2A 4J1XA 1W9TA 2Y6HA 4WM7A 5T54A 2WT0A 4XIKA 2ZJCA 1KITA 1W28A 4NE9A 3Q8FA 2XB6C 1T6GC 4Q4X2 1A78A 5C3RA 1LOAA 3VBFB 4DINB 5JZGC 3O1SA 1PGW2 4XXPA 4Z8BA 2FDFA 2O14A 1BK0A 1J58A 2CDOA 2XH6A 4CP0A 4Q0QA 3GZAA 3ZXFA 2FDIA 3MPPG 3MIHA 4DO0A 4AL9A 3MEPA 2P6CA 3IB3A 2ZACA 2EVXA 5K0UB 3ILFA 3HN1A 4JCKA 3RQ0A 2IXIA 1CAVB 3N9NA 3WD5A 3PHMA 3NV3A 4LO4B 4FFFA 2VZVA 4NROA 1UX6A 1W90A 1W3VA 4QX0A 3KM5A 4XTPA 5EXOA 2NP0A 1DYOA 2DDUA 2RM23 5A1FA 2RS51 4QHOA 3T2QA 1KQRA 3EMRA 2OX0A 2WKKA 1J3QA 4PIXA 5B2GB 1SBDA 3TWIA 1EV11 4CEYB 4B29A 1S55A 3HNBM 1DF0A 2VZTA 2VD7A 4XMAA 1XNKA 2JD4A 4LMFA 2WYFA 1MZ6A 3DKWA 2CAVA 1I6XA 2D6NA 4GMP3 3ORJA 1AX1A 1YQ8A 5DABA 2W95A 2ZEYA 4XJUA 2BZDA 4YM2A 2DCTA 5ABJB 1GZWA 1UXXX 2I2SA 4DB5A 1RMU3 3OBTA 3AVRA 2TNFA 1HIXA 1W9SA 2ZX4A 3V64A 4FOYA 3J8F1 5FYBA 5JR7B 2ZA9A 1JOPA 4HLTA 5H9SA 3IKWA 4XDPA 1YO8A 3VHOA 1QJY3 3O1OA 2GMPA 3PTRB 4GKXA 5A6ZA 1PNFA 3TNQA 3D8CA 2HWE2 3CO2A 1DGWX 5I8SA 3L2YA 4KL1A 1HW5A 3VBOB 4JGYB 4HK8A 1R092 2Y6KA 1TME2 2YU2A 1XYPA 4OMCA 4XF9A 4LO8A 4ZU5A 3SQOA 1WBLA 5J36A 1ND3C 4ZPIA 5FZCA 3ZPOA 4FI9A 2KXLA 4UFKA 5LA9A 4Q4W1 4RR3C 5A3PA 1K42A 1AYM1 5SV8A 2ADDA 2I74A 1YFXA 4Y22A 1FOD1 1S4CA 4LLOA 5HCFA 1AUYA 3SKJE 1RUF2 3MO4A 1MS8A 3B5LB 2EIBA 5FZMA 3M2MA 3NQHA 4NHMA 1UOGA 4ZU4A 5IW0A 1NQJA 2ORZA 3WINE 2WNOA 4LUKA 3E6BA 1V6IA 2Z42A 2WWSA 1MEC1 1RUC3 1W6NB 1S2EA 1SPPA 1UY4A 2OT7A 1W0PA 4XJZA 4CP2A 5FY4A 3C2UA 4E4HA 3Q9OA 4CPBD 4BMEA 3ZXEA 1UKRA 3K48A 3R4UA 4JV4A 4BXSV 2NQYA 4G4FA 4WM8C 4LIVA 1YJKA 1VR3A 4WZFA 2WS91 2KR2A 1H0BA 5JZGA 1JYWA 1HX6A 2HKXA 1UZYA 2HLEA 1K12A 3JBG2 4IV3C 3V0BB 4YZ3A 2D6OX 1JHNA 5IFTA 1W9YA 3RMXA 3UGHA 3AP9A 3I2OA 1VIWB 1IZ3A 4CU8A 2A6VA 4DRVA 4TZDA 2GAUA 1Q8PA 4LHNA 1JHJA 2O8QA 5FZ8A 1IS4A 3OOXA 2RG4A 1XJAA 4AE2A 5B4NA 2R061 3LCPA 3WP5A 4AI2A 4BIOA 1OUXA 5C6CA 5JPMB 4D0QA 2ZX0A 3HQXA 2XVKA 1W2NA 5GLWA 2A6YA 3SH5A 3TN91 1NA1B 2VNVA 3DV8A 2ZHKA 4QDQA 3CEWA 1R64A 4JHTA 1QQP1 4B8EA 1XE7A 1H2NA 5FYCA 4YW7A 5LBEA 4Y5SA 3WF3A 3E1F1 5KXBA 1QJU1 3UGGA 2HWB2 4GH4B 1K3IA 1CAUB 4LTAA 2ZGNA 3TAYA 3BODA 4PI0A 2D5FA 1O7FA 3BU0A 4AR2A 4UFMA 5K7PA 3PNAA 1V9U3 2F6BA 4QX8A 1V0AA 1QOTA 2A3XA 4BQWA 2GC1A 2O0OA 1HB4A 3WG2A 1OPMA 5FXZA 2F4LA 2OA2A 2ZS6B 3P1IA 1COV2 2VCMA 1YIFA 1KDKA 1W8HA 1U5XA 1REDA 1VBB2 1WLWA 4H2AA 4JVAA 2QQKA 3AVSA 4RSUA 4XHXA 4LE4A 2OKXA 3ZYIB 4CDWC 2W9XA 4PI2A 4NAOA 4EE2A 3OSDA 2VUCA 1LR5A 1QJX1 1ND3A 2JEMA 4UT5A 2E7QA 5FQ0B 5C8CC 2WYSA 5F39A 1HJFA 4Q4V1 4NMIA 2XJRA 4RR3A 3O0WA 3GF6A 1UXZA 1UZWA 1FMD1 2W3JA 4GB31 5A3MA 2P1BA 3DF0A 4LXLA 4MXWB 5FYIA 3BTXA 4CCKA 3AFKA 3I3QA 2FZ1A 1CZVA 2BU9A 2WR9A 3MI8A 4A3ZA 4D69A 1R1A2 3PUSA 5CKNA 4P9JA 4QKFA 4HONA 2E9QA 3RG0A 3THTA 3ZR5A 2VULA 1W8UA 1OA3A 1WKYA 3KQRA 3LEIA 2ZAHA 3KWVA 3OUHA 3ZKUA 3GHMA 4ZY9A 3UKNA 4OHVA 5SV5A 5HCAA 3IMMA 1PIV3 5A70A 2FCVA 1XSQA 5FP4A 1JOBA 3MLJA 3CL1A 4U2AA 4WM8A 2LUWA 4JX0A 2DVFA 1W6OB 4XFFA 3O1PA 4H3WA 1REFA 2JWPA 2VAUA 3J9SA 2E26A 4YGBA 1SDDB 3OPZA 1DQ6A 1JYVA 1W6MA 4IV3A 2A6ZA 5DN2A 3BTYA 5E89A 3WW4A 2VZ1A 3O0XA 1OI6A 5A32B 3VDCA 1HQLA 1CX4A 1BHGA 1MPXA 1PX3A 1SCSA 5FR3A 2Y0IA 2ZGSA 1UO9A 1R083 5FPUA 1JMUB 1VE0A 2JG9B 2LALA 1V70A 2XPJA 3C3VA 3RWNA 3ZR6A 2OVUA 4C1XA 1UQXA 2QQUA 3S5AA 2VZQA 1XSRA 1AR71 4LBOA 5LBBA 2YC0A 3FN9A 4HVQA 1WLCA 1CPNA 3MIGA 2W1WA 3ZYJB 3GXUA 1RB8G 1DYKA 1LU1A 3W5NA 5BNPB 2AEZA 2B45X 5TSWA 5FMBA 2WO7A 4E8CA 4NR1A 3F2ZA 1ACCA 3C7HA 3JUUA 2WJSA 2CGNA 5BUVA 1OFNA 3CMGA 3D0JA 1GBGA 1XBFA 3ZMOA 5H9RA 5J1XA 4I0WB 3D6EA 1HXS3 1NT0A 2B5HA 2GN3A 4NJ4A 5FUIA 4ZZ5A 1I5ZA 4UYBA 2A75A 1YYNA 2OPWA 1BEV3 1RUE2 4N7IA 1VBE2 1NE6A 1ZA4A 2DCYA 3K77A 3N35A 4X6QB 3T08A 4HOOA 4A41A 5JSPA 5AC93 2VR4A 2XXZA 3J7MA 4URAA 1PVC3 1LRHA 4MHUA 4UFJA 4AW7A 1ULPA 1SLLA 1UZVA 1LTEA 1DFQA 4CDWA 1SLAA 4XBLA 1RUG2 1KJLA 3HT2A 2JDHA 3HT1A 4IGQA 1CR7A 1YCIA 2PTMA 1SQ4A 4N9HA 5C8CA 5F5AA 5FYYA 5JSOA 3HOBA 1PM4A 2YXSA 3H3LA 1JZ2A 3POYA 3GCWA 3POBA 1D4M1 1B35B 2VXRA 2YBKA 5CEHA 1H9PA 1H4GA 4BE3A 1K5MB 1RUD3 2VJXA 3SHRA 4NAMA 1AL22 1UOBA 1MZFA 2WO1A 2RR11 5DDJ2 2ZOEB 5F8PA 3JD72 2VC9A 4PT6A 5A6XA 5FYZA 3T2OA 1OQDA 4N53C 1IG0A 5FYUA 4LBQA 2VOWA 1C4RA 2ATFA 2VOXA 5EV7A 3ZFGC 1JZ7A 1JXNA 5JXGA 1AL0G 2DCJA 2VU9A 2VZ3A 3B94A 5LATA 2P5BA 2JG8B 1ALYA 3I7DA 5A7OA 2A6WA 1FX5A 5FP8A 2P34A 4HFSA 5FZ9A 4OHZA 4XAEA 1ZBE2 4LORA 5A3OA 3UESA 3DN7A 1MQTB 2W52A 1ZRRA 5FYTA 2LM3A 2PA7A 4RYDA 4ATEA 4CRQA 5CFDC 5J09A 2W0XA 3POJA 1LOGA 3POEA 1I9RA 4K20A 2OUJA 5JOXA 3KGZA 3AZZA 4MGIE 1CZSA 1CZTA 3E6CC 2P3JA 1RYYA 2PN5A 1ENQA 2WIIB 5IFPA 2HYXA 2WZR1 1T2XA 2VZOA 2JX9A 4DOUA 2W2IA 5J96B 2V5DA 1JW6A 3ACHA 4EWEA 2A1XA 2RHPA 2XQXA 4W6XA 2J1EA 2R041 4YVWB 2I07B 4IEYA 5FY9A 4AHYA 3W58A 1TNRA 4D6SA 2C5DA 4PLNA 4B4RA 1NLQA 4A4AA 1NCQC 1GUIA 2VXJA 2W1QA 3VBSC 3I2FA 2QQNA 4MHRA 5CNAA 3FBMA 5LCWL 1G9DA 3FUQA 3A0KA 1CAXB 2TBVA 2XJQA 4JKLA 2DU1A 5DAWA 4E2GA 2BVBA 4Z2WA 1NX9A 1H1IA 2R0FA 4ZXEA 5LWBA 1IPSA 3H1WA 3WZ1A 3ASIA 4I0BA 4DXSA 1UMIA 1V6NA 2J1VA 3NNJA 1W2UA 5FZAA 4CDXB 4P08A 4A45A 1HRI1 2P3KA 5E8AA 2XONA 5JI7A 3P5BA 1JUHA 3T0AA 3WP3A 5L9VA 4LPLA 4FPCA 4AXOA 5C7GA 1KEXA 2FMYA 1E5RA 4A6SA 4XURA 4XOGA 4V2WA 1PO21 4EJRA 2E63A 1W2OA 1N1YA 4CCEA 2RS53 5IVJA 4HKWA 1G7YA 2B42B 3ZM8A 1UIJA 2X5IB 2WZPP 3RZMA 3QBQA 5L9RA 3IIAA 3IM0A 1FPN2 3O1RA 2ZABA 4A44A 1EV13 1RMU2 2XJUA 4AVBA 2BFUS 3BI3A 1GMMA 4K3UA 2FDGA 2WSUA 3LIGA 4WVMB 4QPGC 2VQTA 3WOGA 5JOZA 3FC0A 4J25A 2G9ZA 5FZBA 4DY3A 2Y34A 5CU1A 4BXFA 5F1RA 2CSGA 1QJY2 2XMLA 3MPBA 4QM9A 2VMEA 1RGSA 3NNFA 5FO9B 2RDRA 5DZFA 1IPKA 1S0CA 3VL8A 2AGSA 1MS9A 2VH9A 1KS4A 1XE0A 1WW7A 3H50A 5GZGA 1ULOA 2D44A 2B7YA 3VBHB 3J8F3 3LA3A 3PUQA 1GZCA 2Y0OA 4N53A 4XW3A 3ZPYA 1T6BX 1YNAA 2PHUA 3PURA 4OLLA 5IVCA 3ZFGA 2DUQA 2XWJB 2FCTA 3GBGA 4QGMA 4N43C 5BNOC 3H0OA 1ZVFA 4CZSA 2VQUA 1FXZA 1GOGA 1O8PA 1OKQA 3ENRA 5DZGA 3ZFEB 5DAXA 5CA6A 2B46X 2EXHA 3HAGA 4OCTA 3U1XA 4FXGB 1NY72 2Q30A 2VY0A 5FZOA 4NWWA 5FLJA 5GZEA 3MIFA 2OXBA 3OBZA 3VD3A 3JB4C 5CFDA 4IV1C 4Q4W3 1AYM3 4UFHA 1SHWB 3GZEA 2RJLA 1RUC2 1US3A 1JN2P 2PXJA 4JGZC 4GIQA 5FYMA 2QUOA 4Y20B 2E32A 1FOD3 3OBRA 4Y24A 4U36A 3WHUA 2DBIA 3JU9A 2HH9A 3N9MA 3ZSMA 3BIWE 4Q4Y1 1WCDJ 4NRMA 3IDEA 3RGBA 1UNBA 3QCWA 3SLIA 4AEDC 1TE1B 3MZHA 1WCQA 3GYDA 2XQRA 4IEOA 5J3UA 3V0AB 4FAHA 3DCQA 3AMQA 5C5TA 1NCQA 4GAZA 4GWJA 1MEC3 3THPA 3ZLIA 5GLZA 1OVSA 1DDLA 3VBSA 1V6MA 1A6CA 1W6PB 1OLQA 1M4WA 1HB3A 3NNLA 4IE5A 1W9WA 3WW1A 2XJPA 4OI0A 2VOVA 2HYKA 3FMGA 3ZXKA 3VBUB 5DUVA 2B9UA 4MGYE 2ET1A 2WS93 1DQ0A 5GLVA 4YVSC 1J59A 1ULCA 4INDA 3IPVA 2IXKA 4YZ1A 3UNPA 1ZREA 1PGL1 4GJYA 4PDWC 5E6HA 3ZFFB 2ZKNA 1Q3EA 4D8MA 3I2IA 5BNNC 1JH5A 3FFZA 1WCKA 4Y4RA 3TB0A 1W6QB 3IIIA 4JKKA 5C4WB 1OLRA 2EF6A 4BQYA 1LGNA 1AR91 1UY3A 4LKSA 4Z07A 5LA0A 3TEZA 1QKQA 1FV2A 2W92A 3VZKA 4BA6A 2R063 2RJ2A 3ZYFA 1CWPA 4MXVA 3VKFC 4CEWC 5JIUA 2RS32 2HWF1 3J7LA 1UYZA 3RNSA 3TN93 1V9U2 1VAVA 1XQNA 4W6WA 5F3GA 4F83A 2WSVA 2Y64A 2CHHA 2NN8A 5E1RA 1QNWA 4QQOA 1S0GA 4QPGA 5EPAA 5A33A 3OGVA 1R1ZA 3U4XA 4X8NA 1QQP3 2HBTA 4RHV2 5CFCB 2D3RA 3TOJA 4Q1PA 1QJU3 1Y7BA 2ZGOA 4AEKA 1JZ4A 4TYSA 2BWAA 2WDBA 2WN3A 2YROA 5FYSA 5T50A 1LAJA 5KC5A 1AYN1 2GZWA 3Q8AA 3WF0A 4AAXA 4LOSA 4NN0A 3ETPA 1KFXL 1L3JA 2VZSA 4QPIC 5FMOL 1ST8A 5I0DA 1IPJA 4QD2A 2GALA 2DCKA 4ES9A 1XU2A 2PYTA 1WLDA 3D0SA 3POIA 2CYFA 1DLLA 4A2UA 5FZ6A 4XE9A 2XLAA 1QOSA 1RJ7A 4IE0A 4IL7A 4N43A 3TEXA 5BNOA 3VDAA 5D2AA 1F5JA 1QH6A 3S57A 3VDDB 3ABZA 1QXJA 4EN0A 4RFRB 1QJX3 5JOWA 4FQZA 5CKQA 2VOTA 3ZN6A 2H0VA 1O59A 4IV1A 4Q4V3 5I91A 2VMDA 4XDOA 5I0UA 4JQRA 1KXGA 1SEFA 2WNUC 4GB33 4JGZA 4QT6A 4O9GA 1UD1A 1H6XA 2AC1A 4WZCA 5G04L 2EIGA 3D82A 3UGFA 1UU6A 3EO6A 2C9KA 4AEDA 1NE4A 1UYYA 4GWMA 3AM2A 2JICA 1PO12 3FUOA 1EP0A 2GC3A 4CCJA 4BISA 2IUWA 2VBPA 1DP0A 1L7LA 4Y4YA 3U78A 3ES1A 1VMHA 1YIPA 2ZGKA 3BTAA 3VBFC 5FLIA 3ACFA 4I2OA 2WL1A 1UN1A 1UMHA 2R1DA 2R6QA 3LKJA 4CDQC 4COWA 4ZZ8A 1R082 1F31A 3AJZA 3J7NA 2NMNA 4MH0E 2VNRA 1AR61 3RWKX 2ZKLA 3AB0A 4YVSA 4YW6A 4NHLA 4CP9B 1PNGA 5CBLA 5F37A 1LULA 3MLKA 5K0UC 2AREA 5JPNB 4LA2A 1M06G 4PDWA 2D3PA 3O0VA 1SCRA 5EWSA 1RXFA 1D2SA 1E57A 5EFUA 1LENA 5BNNA 4X8PA 1TMF1 4XDQA 5JOYA 2QQPA 1WMXA 5FZ1A 1G9CA 3MIEA 1H6YA 5FUNA 2BOIA 2E33A 3AZVA 3NJYA 5F6LB 2VQ0A 4TTGA 4R52A 1GOHA 5T5PA 3LWCA 4GULA 3LZZA 5JUVA 1RL3A 3PL0A 1KFUL 1BMV1 4CEYC 2TEPA 1W99A 5HCBA 3JB8A 4CEWA 1HXS2 4UI9L 4M3CB 5IWFA 4DPNA 3CQOA 4XTMA 2P3YA 1RXGA 1UU5A 2MEV1 1BEV2 4LJHA 4OYUA 4CVUA 1H2KA 3AP4A 1GZ9A 5F5CA 4XYXA 4LT5A 2D6PA 4QGLA 1NG0A 2VMCA 4BJ0A 4QWNA 2DURA 2FDJA 4LE3A 4E8DA 1CQ9A 4OI2A 5AC92 5ABJC 2ADEA 1ZZCA 1Z7S1 1ULFA 3KV4A 2E31A 3E97A 1SG3A 1W0NA 2VUDA 4OHYA 5HXMA 4QPIA 3THDA 2GN7A 3M3OA 4WM7B 3IAQA 1WD4A 5FP3A 4UOJA 5F9TA 4CE8A 2W68A 3NJXA 5I0SA 2VW1A 1YI7A 5JWPA 4M4RA 1H30A 2BP6A 4YZ5A 3B01A 4FBFA 2E6VA 4JGYC 1JZ6A 2BGCA 4ORFA 3HPNA 4D94A 3BPSA 1E5SA 1GFF2 1YQ6A 4MO3M 1RUH2 3O7OA 4DQAA 3T4VA 4XUPA 3ZXJA 1C5IA 4IERA 4FCAA 3ZSLA 4OMDA 2EICA 5DQ0A 3RJ2X 3WDVA 4CPBA 2R49A 1OLME 3VZLA 4S2HA 5BY5A 1JUIA 4K7JA 1LOCA 2YPJA 1D4M3 2QQIA 2WNUA 2X8KA 2YGMA 4D3WA 2WLQA 3LDBA 3ACIA 4LO5B 4LBJA 2WFF1 2RR13 1OD3A 2WQ4A 4CUCA 4QKBA 3H8XA 1EY2A 4QX5A 4Y1VA 1VMJA 3ZSEA 4IEWA 5FUPA 2BNOA 2XJVA 3FHIB 1K45A 5A3WA 2XUMA 1WW6A 4B7KA 3RRDA 3ZMNA 5JDBA 3OGGA 4FTBA 4H7LA 3KV5A 4FPHA 2VUAA 1QF3A 4BHPA 3BPZA 5DZEA 2H6CA 1LHVA 3VBFA 5J37A 3ZYRA 1GZWB 2DFCA 4HVOA 1S0IA 3AMHA 3HEIA 4CDQA 2V72A 4IEPA 5FY5A 1R091 4K6BA 2GMEA 3WQBA 4QPYA 3OYWA 5DAQA 3LSDA 1N1SA 5FJKA 5K0UA 1P8JA 4YGCA 4XACA 4I30A 1W8OA 1W8WA 1U5ZA 2QZ2A 2WZR3 2EAAA 4NPRA 3OY8A 5D21A 5FAXA 1DHKB 2BEOA 1SFNA 3M7AA 5LRRA 3RPQA 1SLBA 3RZLA 2GNBA 2JE7A 2R043 3POFA 1PMHX 3D3AA 1UY0A 5A3UA 3RI8A 4B1MA 1ZRCA 4ES8A 3MV11 5JMOA 4AI0A 4D6RA 3NJVA 1QHDA 2BBAA 4CEYA 1X50A 1I1EA 2HWD2 2UWCA 2ZBJA 3J4UH 1ND2B 5FY8A 4CCOA 1GP4A 2VBBA 3KCXA 4HG6B 5JVVA 4P9WA 3POWA 4MADA 4XJAA 4GKYA 4Y22B 1OOPC 1B09A 2BWCA 2LS6A 4RQPB 1C57A 4YW2A 2K46A 2RS52 2D3SA 3HR9A 1LU2A 4GH4C 1JYIA 3EHKA 5FPZA 1OFSA 2IZWA 4QDRA 5ABJA 2HEYF 4NVPA 1HRI3 1EV12 5KXDA 5FTTC 3ETQA 1QOOA 4MGZE 1PMJX 4QB6A 4QB2A 4A6OA 4K40A 4BLJA 4R4ZA 1VPHA 4QXBA 5BXXA 2Z69A 1SPPB 4N90A 5J7MA 1C5HA 2BBVA 1O3RA 1PO23 3JZVA 2WNVC 3CZJA 3MICA 4HZFA 1EPWA 3H3UA 4XF4A 2W94A 3TNPB 4GXLA 2DVAA 2BNMA 2NPIA 3K75B 1DZRA 4AGGA 3M3CA 4D7YA 1MR5A 3AKQA 3DKQA 1RINA 3FHQA 4JDNA 3C7GA 4RS5B 4JGYA 5F3CA 5AVPA 4AG4A 4SBVA 3IBMA 3USUA 1DQ1A 3PUHA 4A7YA 1RHI1 1W05A 2OS2A 2W1UA 3OGRA 4CYDA 1OH4A 2X53S 4K8RB 2VVFA 5M0TA 3B9IA 5KXEA 3AC0A 5ACA2 3M3QA 4AFCA 4EROA 4GMP0 4RN5A 5C9AC 4ZHNA 4EV0A 2OZJA 5FOJB 2E53A 1NKGA 2VZUA 3KMHA 2YHJA 4BQXA 1VLNA 2WN2A 3DGTA 2DWRA 3DPRC 5HXVA 3VKNA 4P5HA 2Y6LA 1H9WA 5DG2A 5KXCA 1WD3A 1SLIA 4XPVA 4R4XA 3CDZB 3P3NA 4DMIA 4ITCA 4NIDA 1COV1 1WW4A 2YB7A 5A3TA 2GDFA 3LE0A 3QD6A 5C3SA 4AFAA 1LEDA 4V2VA 1PK6C 2D6LX 4Q0PA 4COZA 3HN3A 3JQWA 3NKTA 3ROUA 4J1WA 2G4IA 2C4XA 3Q8BA 5JSRA 3V0BA 5CAZA 1IS3A 2ET7A 1C3HA 2RS11 3FLPA 3H3ZA 4FQ4A 3SEPA 1G9BA 3K3OA 2BNNA 4AYUA 4FP2A 1SDWA 3N3HA 3BOWA 5CZKA 4QX7A 2WS92 1H8VA 2JDPA 5F2WA 3DXUA 2YGLA 1NXMA 4KG8A 1F5FA 1GP5A 2YBPA 4XBQA 4NIIA 1QJZA 1RVF2 4EZHA 4LIUA 1POV0 5GALA 4D6QA 2ZGTA 1JZ8A 2CV6A 2VQAA 2XHNA 4UF0A 4W65A 4AI1A 3K51A 4QKNA 4RR3B 5T55A 3VL9A 1VBD2 2AYHA 1SBFA 4BIFA 2PAEA 3MF9A 1OOPA 1IQDC 2VNGA 4XQWA 2RDNA 4GH4A 5FBZA 2ZPXA 3NAPC 4XFAA 3I59A 3AZWA 5FZ7A 3LOBA 1Q5OA 5C70A 2QQLA 2MHFA 1UW8A 2GC0A 5FFOC 3TN92 1MZ5A 1CJDA 4NIAA 3MLLA 4TSVA 4XHBA 3AYDA 1C1FA 1QQP2 4O9EA 2Y6JA 1AR93 3N7MA 1QJU2 3UKVA 1W2AX 1YQCA 2WNVA 5FV3A 4ZONA 3H8RA 2HWC2 4YG3A 1RC6A 4JHZA 4FTSA 3MW4A 4QKDA 2HWF3 1XNBA 2G9FA 4GZ9A 3LFIA 4KWKA 4PIZA 4ISQA 2Q0AA 3AL5A 3AXEA 1ZZ7A 4JDOA 2RE9A 5E88A 4AQ2A 2UYBA 2UY9A 5FQ0A 2YUEA 5GKAC 1AR83 1QDCA 1GWMA 2QJVA 4IEZA 3WUCA 1AX0A 2EIDA 3VBRC 3J26N 1QDOA 1JU3A 4MXWA 1AYN3 1V6OA 1MVQA 1DQ5A 3IWZA 2H6BA 1DU3D 3HNYM 4XZUG 4E4DX 5T5JA 2ZMNA 5C9AA 2BERA 3WQ0A 4Q1RA 3WDWA 4LBMA 2RDQA 1O8SA 3MHZA 1UY1A 3UYJA 1QJX2 4CCCA 5FOBB 4FPOB 2WQ8A 1NLSA 4YRDA 1AXZA 3DPRA 3ZYHA 4M4PA 4GB32 3T1LA 1BBT1 1RUE1 4AVSA 1HB2A 2J1TA 1VBE1 2MNGA 4FPKA 4O7XA 2CU5A 3DYOA 5DAVA 5FREA 1E5IA 5LA2A 4KBZA 2ARAA 1MS5A 2RMU2 1VB2A 1W2TA 3B93A 3WUDA 5IHRA 3BUCA 3S7EA 3KS7A 4QQPA 1PK6A 2W91A 3PLQA 2EA7A 1HDKA 2VUJA 3I3DA 5KHKA 1LODA 1ASJ3 1W04A 1GQGA 3D4KA 4UW4A 4EN9B 3ZXGA 4W8JA 4B4QA 5A32A 3BYWA 1Y4WA 2XJTA 4Q0UA 1C8M1 3PUAA 2LTNA 3E5UA 3D5OA 2IVJA 2VO5A 4XQ4A 5LY1A 3AYEA 4BDVB 1VBA1 4EWDA 1UOJA 2A7AA 1WWYA 3LA7A 1AL21 1ONAA 3LPFA 4CDWB 5I8YA 1Q8QA 1RITA 2JXAA 2WT1A 2FZ2A 1DQ2A 2ZGRA 4BM8A 3CBNA 1CIWA 2WO2A 5FXXA 5LY2A 4YPJA 5C8CB 2V09A 4X6RB 2DFBA 4KQ7A 3MBWA 3U0ZA 3HIFA 4ASLA 5IT6A 3ST7A 1NOVA 1AR63 3GJBA 4A7KA 3WR0A 3HWJA 3LD8A 5L36A 2R1BA 1ZBE1 3NAPA 4DS0A 1X7NA 4NRPA 3RMYA 1QEXA 1A3KA 5FZDA 1TMF3 1NUKA 2PQSA 1GOFA 3BGAA 2E51A 1BYHA 3EXUA 3KD4A 5IVEA 2W39A 4P9LA 4A3XA 1HJGA 2PQQA 1TG7A 1WBFA 2TUNA 1VRBA 2J7MA 3KQ4B 4QX2A 2PAKA 1GWKA 2EXJA 2JIJA 3NV4A 4XJWA 3URFA 1SFPA 3AP6A 3R0RA 2BJSA 3VD7A 3RDIA 3LPGA 3WF1A 5AFEA 1XYOA 2DU0A 4ZS2A 4C8DA 2MEV3 1AX2A 2DCZA 2BGOA 3VUOA 1SBEA 4O65A 3RYKA 3OG2A 5JXJA 2W87A 3NKGA 4QDSA 3WF2A 2VCBA 4COYA 1Z78A 3K3NA 4JDMA 3LDKA 1Z7S3 1GQHA 4H7MA 5IVYA 3VBRA 1Q8SA 1JYTA 4Q29A 1YQ2A 4IEVA 3WQ7A 2IWGB 5A3NA 2VGDA 4IETA 3POGA 5DG1A 2Y6FA 3OBAA 1LGBA 2QVSB 4BMBA 2ERFA 4DXTA 1AJKA 2QQWA 3WEZA 5A6YA 3K46A 4ARXA 2AZ5A 5FZ0A 3PMEA 3CKHA 1D4M2 5FZEA 1XNCA 2Y60A 2JE8A 2ZEXA 1W3XA 3UL2A 5EZWA 1GZTA 3B69A 3VB9A 1NZIA 4NHXA 1S2BA 1XE8A 2RR12 2WAOA 1YUDA 4D7TA 2EXKA 3T30A 2FBEA 3RS6A 1FPN1 4P14A 2RM22 1RMU1 1BVP1 1GP6A 3USSA 2QKDA 3KSCA 3Q8EA 4YGDA 3HVDA 2Q5TA 3UJOA 4RD7A 2AEYA 3H7JA 3AYAA 1DGRN 1NCRC 4HL0A 5DXDA 1YQ5A 4AHXA 5L7OB 1X8EA 4LK6A 5FRAA 1F9KA 1ZNPA 2WFF3 3AL6A 3A4UA 2BFUL 1HRV1 2R7EB 5FZKA 2IXHA 1O5UA 5KWRA 4Z2AA 2QBXA 4AVCA 3N36A 1PVXA 1QY4A 3PVEA 3S0MA 2W08A 2QQOA 3CHXA 4HANA 3I49A 4AHZA 1W8FA 4XJ8A 2VG9A 1F35A 2CDPA 1C8NA 1X9PA 2FMDA 5JR2A 3WVJA 5L73A 2ES3A 4IESA 1FYUA 3MIBA 2W47A 3WG1A 4YM1A 5FZ3A 1POV1 3HMYA 4MZUA 4HKLA 2J1UA 1NY71 1R093 2O1QA 3LFMA 1DIWA 2Q4SA 5FKCA 1ZM1A 2XL7A 2R30A 4NUBA 2VMFA 4LOTA 3ZFGB 3EJKA 1W0OA 2PLV1 3LGRA 4GA9A 1IGOA 3RSJA 4QGNA 4TN7A 3LOIA 5FZOB 2ZXQA 3GCXA 4WV8A 5DUUA 3WV6A 2YDEA 1HRI2 1LEMA 1XPWA 2VTXJ 4HXCA 1WW5A 2KD7A 3DEMA 2JENA 2WZ8A 3H7YA 4L8QA 4C91A 5CFDB 4KWJA 2W46A 4WVMA 3SKVA 3S6PA 3WW2A 1WMEA 4IE7A 1X33A 2OQ6A 2PHTA 5FZ4A 4CCLA 1S0FA 2SBAA 4LBKA 3WCSA 1OQEA 4CTEA 3WNLA 2VM9A 2XVGA 2BW8A 3RYPA 4C1WA 4META 3VZMA 4KU7A 1OUSA 2A73B 4OI4A 3WNNA 2R0HA 4ET7A 3I2HA 4E27A 1O91A 1JU4A 4K21A 4W4ZA 4LULA 3C8XA 3ZO0B 1IOAA 1F8VA 3QH6A 4MVTA 4CU9A 1PHMA 2EIEA 3UETA 4BYYA 5JAXA 5F32A 2J1SA 3BVCA 3L9JT 1KJRA 4PQ9A 3IPVB 1FAYA 4BQ2A 2P3IA 5EJ1B 1UPSA 4H55A 4EN7B 2DVBA 2RS31 1MS1A 3GBWA 3NVCA 3K4AA 5FK7A 4Q8LA 5FKBA 5JMCA 1RHI3 4AFBA 4QQ2A 3KHBA 3T1MA 2EAKA 4FPJA 1X36A 2W5FA 3IDAA 3KGLA 1GNHA 3X29B 4Y5Z0 1CAWA 5IK8A 3ZSKA 4XF1A 2DVDA 3WNPA 5A1LA 1RUJ1 4RHV1 1NCRA 2WLPA 3I4IA 2FCUA 3WG3A 3O1TA 4CDUC 2F17A 5JZGB 5I93A 1UU4A 1ENRA 4ATFA 4CCMA 4K1YA 1N3PA 4XFCA 2GH2A 4AI8A 4LUMA 1TEIA 5KR7A 4L92A 3GBFA 3KVBA 2PFWA 4K9SA 4QPGB 5A33B 1URXA 4DUWA 3RFRA 5HPOA 1MS4A 3PDQA 3R4SA 5A7NA 2Q8OA 3DYPA 2DTWA 1A34A 1COV3 4IEUA 1UYPA 2YFUA 4CUAA 1O4YA 1Q8OA 3IMNA 1BXHA 1HLCA 3A22A 5FZLA 3CJIB 2QZ3A 1HV1A 2R071 3VN4A 3KF3A 2VZRA 1FT9A 3MV01 2A70A 1RUOA 5C5UA 3M3EA 3MW2A 4MYEA 4PIYA 4Y5TA 1IG3A 2RS13 4FPGA 1DGLA 4I02A 5JXHA 4LR4A 3O1UA 5EQUA 5JIAA 1G9AA 2VBDA 1XC6A 4XUOA 3TBDA 1VBC1 4R9AA 5C8WA 1YFWA 2C1FA 3WQ1A 1PGL2 3WDYA 2YV8A 3ALQA 3VD4A 1D2QA 1U12A 3WHTA 3VDBA 4FP3A 5LASA 3I97A 3OPWA 4YZ2A 1EUTA 1EAH1 2VMGA 1GU3A 2ZGQA 4XZPA 3ZN6B 4F3JA 1VRH1 2BUKA 2CGOA 4WVWA 2RV9A 1PO11 2WWJA 3LF7A 5B4XA 4JGZB 3ZIWA 3GDBA 1H8TC 1CD3G 1HN1A 5CYYA 4BZ4A 2RDSA 2QQJA 4E4SA 3T0BA 3DXTA 2ZEWA 3IT8A 5D8AC 3W9AA 1RUI1 5J48A 5FYVA 2XBO1 2D98A 5CG8A 1FMD3 4AGRA 4DEQA 2HWF2 3I2KA 2RVAA 1QXPA 3R4DB 4CP1A 4BK5A 2NZ9A 1PIV2 4MLOA 1AJOA 4PBPA 4XFGA 4AEDB 4LEJA 4BQ5A 4LHKA 1UX7A 4B3NA 1D7PM 2WBKA 2A71A 4L11A 5EYXA 3ACLA 4P9XA 5FMOS 1AR82 2ZHNA 4Y1YA 2C26A 3B02A 2UYAA 1EUUA 4S2GA 5F7UA 4HETA 3G7DA 5GLTA 1AYN2 2XLFA 4P02B 4BQ4A 1WCUA 2VVEA 4PHZA 1KD7A 1Q56A 4IXLA 5FWJA 1U5YA 2Z5WA 4LHLA 1QMJA 3BKZA 1QNYA 5H9PA 4Z1VA 4R9DA 1VMFA 5A7WA 4PDWB 4TXWA 3SISA 4HPKA 4MGTA 3FLRA 4QAWA 5BNNB 3S7IA 3ZXAC 3PVOA 2E7TA 2XHKA 1RIRA 2GH8A 3GNEA 3IDBB 4RGKA 3OEBA 4BCUA 3ES4A
chains in the Genus database with same CATH topology
2CWSA 1Z0HA 5T3NA 4FOQA 1YFYA 1YJLA 4CDUA 1O3SA 4CEWB 2R16A 1ZBA1 1UCXA 4BWOA 1ASJ2 3WY6A 3SCGA 2G9GA 4B4PA 4Q26A 1EYBA 1N3QA 1AR73 1BBT3 1RUE3 3QLQA 3NO8A 2XG3A 2ARBA 3BU7A 4AWDA 3O14A 2DF7A 2D5HA 3GZUC 2PHDA 4AQTA 3B7MA 5BNQA 4PLMA 1Y43B 1ZX5A 4Q4X1 1RUH1 1PVC2 4LO7A 1ULGA 4AVTA 1PGW1 4HK9A 1QU0A 2YMZA 1C8M3 2B39A 2VPVA 5JLVA 4HSLA 5KHGA 1ULDA 4F7ZA 2Z2SB 2VMIA 1VBA3 1DGRA 4UW3A 4GQ7A 4L99A 3H1MA 3ELNA 4LBLA 1NLRA 1GV9A 2A3YA 3VBOC 4E9KA 1Q43A 3VHPA 5FO7B 1ND2C 1UZZA 1RUD2 2GSYA 4P9IA 2VNOA 1GLHA 2ZMKA 3WDTA 4XEZA 4RQPC 2C0ZA 2WNUB 2NMOA 5BPXA 1H8TA 2F4PA 3M8LA 1O3QA 3JCIA 3TRSB 4I3PA 5D8AA 5HI0A 1BMV2 3VHRA 5T5LA 1RTVA 1LESA 2WA4A 3B3QE 2KM2A 3ZX7A 1S1AA 3MF6A 3AP7A 1HKDA 4AVAA 1UKGA 3WDXA 1Z7S2 4HN0A 3SNMA 3LA2A 3NWKA 2P17A 4R8HA 4RS5C 4CDQB 5LEJA 2DUPA 4DFSA 3OYWB 2OYZA 1S0BA 2HWE1 2HWD1 4Y1XA 4E2SA 3OY8B 1TME1 4RGGA 2MPFA 3BALA 4D7SA 1GYKA 1CAVA 1TQ5A 1DGWA 2ZTNA 1PMIA 5T52A 3UV9A 4M01A 1ZYBA 3WP6A 1GKBA 1RUF1 1XXNA 1IS6A 3KCCA 5GJ6A 1U5IA 3OD0A 2QDRA 1Q8VA 1NA1C 2ZGLA 4K8FA 2WFF2 4OZXA 1N47A 5DUWA 2CGPA 1SLTA 4MUVA 1H2LA 3T2TA 5FPXA 1FPN3 2YYOA 3MGUA 4YM3A 3P3PA 3DUIA 1I3HA 4N9IA 3WDUA 1FI2A 1VAMA 1DBNA 3VV1A 2UWAA 3AKPA 3FJSA 5KBFA 2PHWA 3JBG1 1WCSA 3WT3A 4K1ZA 2P37A 3VGIA 2XL9A 1HRV3 3VHNA 4I3GA 1HV0A 3ATGA 2XJSA 2GMMA 3OJBA 5ACA1 4M0NA 1FNYA 4OHXA 3LB9A 3UK9A 1GNZA 3USUB 2DV9A 2H0BA 3PMSA 3VBOA 1NYWA 5GLUA 4URTA 4BLIA 5JZGB 3IN9A 2V73A 1CGPA 1ND2A 3AMMA 3B9CA 1OA2A 4F8AA 2UU8A 2DVGA 4COUA 3J8F2 3NV1A 3MFAA 4RQPA 5CADA 4FSJA 2B8MA 5KHJA 4COVA 1IS5A 2AUYA 1POV3 3M1HA 3U11A 3UKTA 4BH9A 1S0EA 2SLIA 5AVAA 1U0AA 2IXLA 1APNA 1Y3TA 1G8WA 2HWB1 4E4ZA 4RA0A 2ILMA 1MACA 3N7LA 1SFYA 2QFEA 3GZTB 4OI1A 3OCPA 1ZRFA 4XXAA 2CL2A 2JE9A 2PLV3 4YSFA 2DUOA 1XYNA 3FLTA 4Q4W2 4C0HA 1VALA 1AYM2 1OHFA 1DQ4A 1W6NA 2R32A 1FOD2 3NSTA 4OUMA 4ZKTB 3LSEA 4YNIA 3KLSA 4RS5A 4ZU7A 1LOBA 2QDNA 3ZDSA 3KT7A 4BQ1A 1UPIA 4KGQA 1RVF1 1VBB1 2K0GA 3OF1A 3QH7A 3QACA 4DZGA 2QCSB 1IQAA 2K9ZA 3GHNA 4XF0A 4HSJA 1VJ2A 3ZXLA 2NYYA 1MEC2 3WW3A 1VBD1 3OTFA 4KH9A 3ZYPA 4EN6B 2IFRA 4YLZA 4Q0SA 2ZAAA 2ZHLA 2WQZC 2OUHA 4XFIA 4XFHA 4HT1T 4Q4Y3 3APBA 5AFBA 1RHI2 3MDPA 4R9CA 2JG9C 1J3RA 3FWEA 3NJZA 1CVNA 4ZXKA 1R1A1 4PBOA 2JJ6A 1ND3B 1OOPB 3N7JA 1NA1A 1OA4A 2PHFA 1CONA 2ZHMA 2HWC1 3I59B 5BNPC 1BQPA 2RS33 5KHIA 3RJRA 1AF9A 1N1TA 2R062 3MW3A 1CAUA 5GZCA 1QXRA 4YW3A 4GALA 3DL3A 3I54A 2HEVF 5I8TA 2WNEA 1RUJ3 1G6NA 4RHV3 4XJ9A 5J98B 2WNVB 1KDMA 1ZZ6A 2WC2A 3SH4A 4A7ZA 5E16A 2FHRA 2YZ4A 3LAGA 4OVEA 4WM8B 2RS12 4JRAA 1PZ8A 4YW5A 4M3CF 1X8MA 1J3PA 5EYYA 2BVVA 4ONUA 4WVZA 4YW1A 1LB2A 1W6MB 1N3OA 4IV3B 4YFWA 4KNCA 3KB5A 4FAGA 4DNYA 3FZ3A 3R05A 5C9AB 2R073 4YG6A 3AZYA 4R9BA 2XGXA 1B35C 4QU2A 1F2NA 5F6KA 2A5ZA 3ZYGA 1K5MC 4LBNA 3LOBA 1RJ8A 2RMU1 2D7FA 5H9QA 3ZIXA 4Z82A 3DPRB 2XKPA 1GSLA 3N7KA 4B7EA 4HKOA 4IQPA 1VBC3 3NW4A 1PGSA 2BYVE 1G86A 3WLUA 1VP6A 3BB6A 4Q4V2 1AVBA 1ENSA 2VW0A 3H8UA 3MYXA 2JG8C 1D0GA 1FMD2 4AQSA 1IKPA 4TWTA 4OHWA 4JAAA 1EAH3 1PK6B 4QMAA 1VRH3 1G9FA 1PO13 1MQTC 4YM0A 4FO9A 5KHHA 1V6LA 2ZX3A 5F5QA 1W6OA 1YI9A 3ILNA 4FXKB 4XETA 1RUNA 3AFGA 3W59A 1LHWA 1RUI3 3AKTA 4UBGA 2XBO3 4XILA 2RJKA 1RUG1 2PELA 4UBHA 5LK7B 4YVWC 3ILRA 5I0TA 1YRZA 1MS3A 2EXIA 1PZ7A 4S2FA 5LEKA 4XIOA 1ZZ9A 4FTEA 3U07A 2JG9A 4JC1A 4KG0A 1ZZ8A 2P2KA 5DDJ1 1FV3A 3JD71 4AF9A 1DZQA 5K8SA 2ZGMA 1LKNA 4HBNA 3RZZA 4QQHA 3R6SA 2ZCWA 1WA4A 3NAPB 5BNPA 2Z79A 1QGLA 2CWMA 1CN1A 4Y26A 1V00A 4CDXC 3AK0A 1J1LA 4NO4A 4AEMA 5LK5A 1AR72 1BBT2 5L7OC 1DYPA 5L19A 4LBQB 2BQPA 4YARA 2Q1ZB 2VW2A 5DUXA 4ASMB 3AKSA 3BOPA 1SMVA 1WGPA 3V56A 4OULA 4PF5A 1ZBA3 2X5IC 2Y26A 3E6DA 4FOVA 1S0JA 2FQPA 3KCYA 1C8M2 1BCXA 1AXKA 4WVVA 4NWVA 4RGAA 1VBA2 2PAMA 4OUSA 3VBRB 1OQ1A 2VECA 3ZSJA 2PHXA 4XFBA 4Q4X3 4KGGA 4LO6B 1RUH3 1FNZA 4AVVA 1X82A 2Y38A 1ZRDA 1B35A 2Q1MA 3EQEA 4PJYA 1VAKA 2RM21 1K5MA 3AXDA 5JCTA 4JTNA 4JRLA 3WP4A 3VBHC 3WNXA 1IHMA 1H1AA 3FX3A 3JQXA 3OD4A 4FT8A 2BTVC 4G9SB 1FATA 3AKRA 1H4HA 3VKOA 3SITA 2E7AA 3CNAA 3B00A 2JG8A 4GMP1 3ZFEC 2A6XA 3PVBB 5IK4A 3VKLA 1MQTA 3I2DA 5FLHA 1GICA 3AJYA 3VKMA 2UWBA 4Q2FA 5FDBA 1MVEA 4HMZA 2JECA 1QJY1 1LOEA 1J1TA 1N1VA 2D6MA 4YVWA 1CESA 4Q27A 1KRIA 1JOJA 4DY5A 4C90A 2I45A 2CY6A 4MSVA 5FCCA 2VOKA 2WZR2 4LA3A 3AX4A 2XLGA 3M70A 4YG0A 3NL1A 1LJ7A 1CAXA 3VBUC 4Q8KA 2IC1A 3N4MA 2R042 3M4FA 4W6YA 3AMNA 5T5OA 2HWE3 4ISRA 2HWD3 2C9AA 3ZFFC 1TME3 4CDXA 4DXZA 4FPEA 5L7OA 4UW6A 4XMIA 4N53B 3V65A 2JDZA 1MZEA 5C4WC 4WBBA 4AI3A 2ENRA 1RUC1 1BJQA 1WLTA 2D6KA 4AHWA 3ZVXA 1UL9A 3INAA 4E2QA 3AZXA 4C0BA 1GANA 1RUF3 2O8OA 3CU7A 1LCLA 2X5IA 3POSA 5CIRA 4IEXA 3CLPA 4J6GA 4YYOA 1UMZA 4GWNA 4L9BA 4YW4A 4LLFA 1LHOA 4XQDA 5FO8B 3WG4A 1HRV2 4AGVA 3E5QA 2NM1A 3CJIC 3A0NA 5CFCC 1PO22 4BPZA 4LBQD 3PTYA 1XRUA 5C33A 1H1MA 4TLFA 1UAIA 1MS0A 1YWKA 4EWAA 1NQDA 3EBRA 4AFDA 4M0HA 1OMIA 3JBG3 4FPFA 1NCQB 1YXWA 3VBHA 2PHRA 3VBSB 2CNAA 1JTZX 5ACA3 4P9GA 5KC6A 3VLBB 2DTYA 2YY1A 4N7UA 1EPZA 4LNVA 3VZNA 1BKZA 2GC2A 3PJYA 3ZFEA 2OIIA 3FBYA 2WT2A 4MX3A 2CTVA 1AZDA 4QM8A 3VDDC 4M3CE 2ETEA 1LGCA 1CAWB 2PLV2 3HD8B 1NCRB 3FFQA 4KWLA 1V9U1 1ZZBA 4RFT0 2UURA 4Q0VA 1C1LA 4Y20A 4DRRA 2IXJA 1W39A 1LHNA 1XNDA 1YFUA 2HWB3 3CJXA 1A8MA 2WA3A 4S2DA 4XBNA 4YZ4A 5IK7A 5LRSA 3V0AA 1JYCA 5CVRA 4EN8B 4Y1ZA 5CB7A 4JTOA 3S30A 4MGKE 2D97A 5D1IA 1V6JA 1W6PA 2D93A 3AP5A 4Q4Y2 4P9YA 4QHBA 3H1YA 3VBUA 1DZTA 4NHKA 1RVF3 1VBB3 2PHLA 3MIDA 3UJQA 5JI9A 2A3WA 2OZ6A 4NOTA 1JBCA 3HBZA 3PVNA 3VZJA 4Z92B 1HQWA 1NXD1 3FE5A 3ZFFA 1PZ9A 1NZCA 1VBD3 2NLRA 2OPKA 3RI9A 5BYNA 3PJQA 3ECQA 1TNFA 1W6QA 5C4WA 4PCRA 5I0RA 4N43B 3L2HA 2ZMLA 5BNOB 2XKOA 4H14A 1BK1A 2ZZQA 1PIV1 3O12A 3MFCA 3M3IA 4V1PA 1UF2C 1C28A 1R1A3 2IFWA 3KZ4C 1LOFC 1AR81 1RUJ2 2GNMA 4UXAA 2VMHA 1O4TA 4I01A 4IV1B 1SACA 5K9YA 2HWC3 1AR92 1AHSA 3CJIA 4AEJA 5CFCA 1YLLA 1BZWA 1A8DA 1BVVA 1WMFA 3QOPA 1SLCA 2ZZJA 5IUQA 2K2SA 1R081 2HJIA 5BV6A 2BPA2 2GNTA 2IXCA 1WUVA 2ZGPA 1REEA 3SCFA 2EALA 4QQLA 3AYCA 4WM7C 4XF3A 4M00A 4L97A 1D4VB 2V5YA 2VVDA 2R072 2WINB 4QXKA 2AR6A 1ENXA 2ZX2A 3VZOA 3ZN5A 4HPKB 4AK3A 3SMHA 1OSGA 4YVSB 4HVRA 5EJ3A 3VDDA 1ASJ1 2GU9A 1VBC2 4HN1A 4AFMA 1O4ZA 2D43A 4BOWA 3RYRA 1HXS1 3E5XA 1CPMA 1AXYA 1H2MA 2KA3A 2X29A 4CDUB 1XU1A 1BEV1 4FOWA 2GNDA 4YFZA 2N7GA 1CJPA 1EAH2 2RMU3 2JKBA 1VRH2 3AMPA 4L2NA 5HBAA 3KT1A 1QH7A 5AC91 2QNKA 4Y1UA 4FPLA 1PVC1 2ARXA 1O5LA 1QWRA 1UIKA 2XVLA 5GZFA 4AQ6A 3KT4A 1LECA 1S2KA 4FPYA 1RUI2 2HEWF 4IEQA 2XBO2 4KBBA 3ZXDA 2CAUA 3IDCB 3CF6E 5GM0A 1IKQA 1VBE3 1V6KA 2AENA 1O3TA 3SXWA 4PLOA 3SH3A 3WX5A 2UY8A 4I09A 1RUD1 3GALA 1S0DA 4QPIB 4SLIA 1ULEA 2XWBB 1RUG3 4UW5A 5A3LA 3TYJA 1D0HA 3U10A 3WCRA 1LHUA 2DYCA 1HQNA 2QE3A 4YGEA 3SCHA 1AR62 3I8TA 4FVVA 1AL23 2ZGUA 3ZN4A 5DDJ3 1YHFA 1PM7A 3G6JB 3JD73 3OGJA 1LOFA 4M3CA 1H8TB 4KU8A 1TMF2 3NV2A 4OFGA 1Y9QA 2WFPA 3H9AA 5D8AB 1DG6A 2OW4A 1VB4A 2ZX1A 1ZBA2 1OD5A 3O5SA 4RL7A 4MV2A 1WMDA 5GZDA 3ME2A 4G3YC 5CG9A 1ZBE3 1OPOA 4I0AA 3WXPA 5IK5A 2D40A 1KS5A 1GR3A 2MEV2 3BCWA 2AH2A 4J1XA 4WM7A 5T54A 2WT0A 4XIKA 2ZJCA 1KITA 2XB6C 1T6GC 4Q4X2 1A78A 1LOAA 3VBFB 4DINB 5JZGC 1PGW2 4XXPA 4Z8BA 1J58A 2XH6A 4CP0A 4Q0QA 3GZAA 3ZXFA 3MPPG 3MIHA 3MEPA 2ZACA 2EVXA 5K0UB 3ILFA 3HN1A 4JCKA 3RQ0A 2IXIA 1CAVB 3WD5A 3PHMA 3NV3A 4LO4B 1UX6A 5EXOA 4XTPA 3KM5A 2NP0A 2RM23 2RS51 1KQRA 2WKKA 1J3QA 4PIXA 5B2GB 1SBDA 3TWIA 1EV11 4CEYB 4B29A 1S55A 4XMAA 1DF0A 1XNKA 2JD4A 3DKWA 1MZ6A 2CAVA 1I6XA 2D6NA 4GMP3 1AX1A 4XJUA 4YM2A 2DCTA 5ABJB 1GZWA 2I2SA 4DB5A 1RMU3 3OBTA 2TNFA 1HIXA 2ZX4A 3V64A 4FOYA 3J8F1 5JR7B 2ZA9A 4HLTA 5H9SA 3IKWA 1YO8A 3VHOA 1QJY3 2GMPA 4GKXA 1PNFA 3TNQA 3D8CA 2HWE2 3CO2A 1DGWX 5I8SA 3L2YA 4KL1A 1HW5A 3VBOB 4JGYB 4HK8A 1R092 4ZU5A 1TME2 1XYPA 4XF9A 4LO8A 1WBLA 5J36A 1ND3C 2KXLA 4Q4W1 4RR3C 1AYM1 5SV8A