3VKOA

Galectin-8 n-terminal domain in complex with sialyllactosamine
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
147
structure length
147
Chain Sequence
NLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of a protease-resistant mutant form of human galectin-8 with two carbohydrate recognition domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
molecule keywords Galectin-8
total genus 31
structure length 147
sequence length 147
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3vkoA00
1W6NA 1IS6A 4HANA 1UAIA 5L73A 1H9PA 4OZXA 1S1AA 1G8WA 2DU1A 5GZEA 1DHKB 2EXKA 2JJ6A 3T2TA 4LBQA 1MR5A 3PJQA 3N36A 4PCRA 4YGEA 3B01A 3N7LA 3HN1A 4D69A 1WD4A 2ZMNA 1JYCA 4YM3A 3ZSLA 3A0NA 5JLVA 2E51A 2EALA 1SLBA 1ONAA 4P9XA 1ENSA 1LHOA 3AXDA 3JUUA 4AVTA 1FAYA 4AVVA 3M3OA 1GNZA 2YXSA 3O0VA 2RHPA 4Q1RA 1W6PA 3V0AA 1F5FA 1JBCA 1W0OA 3T1LA 2A3XA 4ISRA 3SH5A 5H9QA 3VKOA 5IK5A 1W6NB 3WG1A 5IK4A 1MS0A 2XG3A 5JOYA 4BM8A 1H9WA 1GYKA 3AZWA 4XBLA 3TAYA 4YM0A 3R05A 4YZ2A 3RS6A 1W0PA 3R4SA 1SBDA 1CONA 4YW2A 3JU9A 4FP2A 2D6NA 1UZZA 4UW3A 1FNYA 2EIGA 5HCBA 4M01A 1RINA 2AUYA 2OUJA 3B3QE 1NLSA 4XJ9A 1BJQA 3V0BB 1LEDA 1BZWA 1GBGA 1MVEA 2EXIA 2EF6A 3UK9A 1HQWA 1SLLA 4GWNA 4FPHA 1GZ9A 2PELA 4Y1ZA 4P9YA 3AYCA 1V6OA 3ATGA 4UW6A 5GM0A 4FPJA 3MW4A 3RQ0A 3ASIA 1W6OA 3O0WA 2R49A 3USUB 4XIKA 3M3CA 2ZKNA 1JN2P 1BXHA 5T54A 3PVNA 2R1DA 2WSVA 3U4XA 1GKBA 1S0GA 3A4UA 5CB7A 4R9AA 1QNYA 2PHTA 3INAA 5T5LA 3WCSA 3ILRA 4C1WA 1AXZA 1S0IA 3FLPA 3SNMA 2WT2A 2ZGQA 2PHXA 3AZZA 3WDWA 1WBLA 1AVBA 1DQ4A 1N1TA 1QOOA 1U0AA 5FRAA 4FOQA 2W52A 4CZSA 1LODA 4Q8LA 1W6MA 2YV8A 2ZGRA 5BYNA 5IT6A 2DV9A 3AYAA 4ZXKA 1LGNA 1D2SA 1V6IA 1DYPA 2UU8A 3ZXEA 1WW5A 1AX0A 2DTWA 1ENQA 1LHNA 1UL9A 2VU9A 1FV3A 2ZA9A 3L2YA 2A6XA 2YY1A 1TEIA 4XHBA 3RSJA 1I1EA 1APNA 4GA9A 2A3YA 5CNAA 1D0HA 4XMIA 4YFWA 1F9KA 3POWA 2D3SA 4YW3A 1LGBA 1CIWA 3A0KA 1ULEA 5GZGA 1V6MA 2CNAA 1MVQA 2ZZJA 3HMYA 3M3QA 5DUVA 5GLWA 4NOTA 4P14A 3O12A 4XJ8A 4YGBA 3GNEA 3VKLA 5IK8A 1CN1A 2NN8A 3FLRA 5DZEA 3WLUA 2TEPA 1OQ1A 3QLQA 1LU2A 4Y22A 2WLQA 2E6VA 1MS4A 2JECA 1LECA 3H0OA 2R1BA 5T5OA 1F31A 1WLDA 4YZ1A 1LOEA 1Q56A 1QU0A 1JXNA 1SLTA 2A6ZA 1O4YA 2P34A 3FUQA 2ARXA 3OYWB 1S0BA 3QCWA 4RL7A 3AP7A 1UX6A 1IKPA 4XOGA 2WSUA 3OYWA 5T5PA 2D44A 2UWAA 4LBOA 3ZXLA 5GZCA 1GNHA 4M00A 3WCRA 1IOAA 1CPMA 1LOBA 1KDKA 1SCRA 2Z42A 4W65A 1SFYA 1V6LA 4YG6A 2ENRA 1C57A 2OUHA 4FPEA 2VUAA 4XJAA 4Q2FA 3V0AB 2GNTA 4U2AA 2ZMLA 2PHUA 2FHRA 1FATA 4YFZA 1O4ZA 4AGVA 2GMPA 3BTAA 3ZXJA 4R9CA 2PHWA 2R0HA 2V5YA 1QDOA 1KJLA 4WVWA 2JDZA 3B00A 3VKNA 1LHWA 3ZVXA 3AYEA 4FOYA 1LJ7A 3RMYA 2ZGUA 1WLWA 2A6WA 4XDQA 1UN1A 1FX5A 1LOFC 2VH9A 3BIWE 4Y20B 4XZPA 3UL2A 3AK0A 1DZQA 2KM2A 2YROA 1PZ9A 2UWCA 1MS9A 4JRAA 4ASMB 2GALA 4FP3A 1N3PA 5DG2A 5KXCA 1JOJA 1LOCA 1AXKA 1PZ7A 3WDUA 1WBFA 2DVAA 3T1MA 4ATEA 1YRZA 1A8DA 1WW6A 1SCSA 4AVSA 5DZGA 2AH2A 1YI7A 3ZYPA 3BOPA 2GNMA 4FPKA 2DUQA 4ITCA 3IPVA 4I30A 2VW2A 3NV4A 1DGLA 4FVVA 2DU0A 2ZACA 5GALA 2UURA 2WQZC 1QKQA 2AGSA 2ZHKA 1W6QB 4BMEA 4WZFA 5SV8A 2A5ZA 1FNZA 2W39A 3RMXA 1LESA 3IN9A 4BPZA 4DS0A 2DVBA 1VLNA 5EYYA 1QDCA 1WCSA 1QMJA 4DRVA 4Y20A 1IS3A 4FPFA 1Q8OA 1RITA 2ZGTA 1DQ0A 3N7KA 2CL2A 2V73A 3ILNA 4FQZA 5AVAA 2ARBA 2PHFA 2XB6C 5KXDA 4YW1A 3WVJA 4Y24A 3LSDA 3IMNA 2A71A 1W6PB 4GXLA 3B69A 2NMOA 4Y1XA 2P37A 4JCKA 2E7QA 3ZPYA 4TZDA 3ZXFA 2A7AA 1R1ZA 1S0CA 4Q27A 4ZKTB 4CTEA 2AREA 2OW4A 4XBNA 2C5DA 4LBNA 4Q26A 4FPGA 4P9WA 3OJBA 1AXYA 2DUPA 1BYHA 2DWRA 2VW1A 3OBTA 1C4RA 2DTYA 3NV2A 1CPNA 2VXRA 2DUOA 5DZFA 2CY6A 5T5JA 2D6OX 3AP6A 2D6PA 5CA6A 2R16A 2D6LX 4GWMA 1RIRA 3V64A 5HCAA 2CWSA 3D6EA 3BODA 1LU1A 3IKWA 3WZ1A 1JHNA 1Z78A 4RA0A 4M3CA 1HDKA 3MW2A 4LBKA 3PVOA 2D3RA 1G9AA 2UWBA 4XMAA 2GMMA 3WDXA 5GJ6A 3VV1A 1AJOA 2NMNA 1KQRA 3ZYRA 1CESA 1Q8VA 2E53A 3KQRA 1AZDA 1AF9A 1LOFA 1DFQA 5GZFA 5JVVA 2JE7A 4AGRA 2W68A 1DQ5A 1GSLA 1HLCA 4Y1YA 3WUCA 2JE9A 4BOWA 4XJUA 4YW4A 1H30A 5EWSA 1GZCA 5DG1A 3WUDA 1W6QA 5F9TA 1WW4A 2ZGMA 3OY8A 4GALA 4YLZA 4FPYA 3SH4A 1A3KA 1DIWA 2G4IA 2A6YA 2D6MA 4YGDA 3ZSKA 2A75A 5GZDA 4FOVA 1MS8A 3FBYA 2WKKA 1QOTA 3AJZA 3NWKA 1YXWA 1CVNA 3WV6A 1W6MB 4M3CB 1LHUA 2YZ4A 1SACA 2VY0A 3R4UA 3WG2A 1G9DA 2DVGA 1LOAA 3AX4A 3SH3A 2E7TA 4AWDA 1YYNA 4C1XA 4LBQB 1LEMA 3KM5A 2ZBJA 1UKGA 4LBJA 4Y22B 1UMZA 4Y1VA 1MACA 3N7MA 3O5SA 1SBEA 3AP9A 2I2SA 4R9DA 3GALA 3CNAA 4FPOB 1AX1A 2D43A 1XQNA 1GANA 4FQ4A 4SLIA 1V6NA 1G7YA 1WUVA 2EAKA 2NZ9A 3OY8B 3ZSMA 4Q8KA 4M3CF 2NYYA 1SLCA 1GV9A 2BQPA 1NXD1 2DVFA 1LHVA 2DYCA 4M3CE 5GLUA 3MPPG 2DURA 4U36A 5H9PA 1N3QA 2VW0A 4XHXA 5H9SA 1BQPA 3UJOA 2NM1A 3IM0A 1SLIA 1G9BA 5JOXA 1C1FA 3WHTA 5HCFA 1UPSA 2ZHLA 3NV1A 4DFSA 5JOZA 1V6JA 4FPLA 4LBMA 5T55A 1VIWB 3M3EA 3OPZA 3V65A 3IPVB 3DGTA 1GICA 2NP0A 4Y1UA 1MS5A 3PMEA 2B7YA 2YMZA 4BMBA 3POYA 2A3WA 4GKXA 3D4KA 3UJQA 4FPCA 4HL0A 2ZGSA 1GZWB 1JUIA 4WVVA 1YIFA 3M1HA 4L8QA 1IS4A 4XBQA 5DXDA 5E88A 1S0FA 3SITA 1ENRA 2ES3A 3AP5A 1ULFA 4JC1A 4K1YA 4PBPA 2P3KA 5H9RA 3AYDA 2R0FA 4YM1A 5DUWA 2D7FA 4YG0A 2ZAAA 1N1VA 4AYUA 4FOWA 4PBOA 1KITA 4XJWA 5FREA 3WDTA 5CAZA 2EXJA 2ZHNA 1VALA 2LALA 2ZABA 2AENA 3SISA 1URXA 2GNBA 2D6KA 4XYXA 3W58A 4NO4A 3FFZA 2OVUA 1DLLA 2CYFA 4XXPA 5DUXA 1LTEA 5GLVA 4KBBA 1MS3A 2Q5TA 3C2UA 2C9AA 1CQ9A 2JKBA 5JDBA 4GKYA 3AFKA 4WV8A 1ZA4A 3AZVA 2A6VA 2ZGNA 1V00A 1ULCA 1VAMA 2WT0A 1SBFA 1ULGA 3AZYA 3O0XA 2GDFA 4BLJA 1JYIA 3AP4A 1C1LA 4AGGA 1PZ8A 1WW7A 2SLIA 4K21A 1Q8QA 4YZ4A 4YM2A 5F5QA 5IUQA 4ATFA 5CBLA 3WNXA 2D3PA 1OKQA 1A78A 1DBNA 3N7JA 1S0DA 1KJRA 5JMCA 2ZHMA 2WT1A 4DQAA 1MZ5A 1WD3A 4CRQA 4K1ZA 3LCPA 2DVDA 5EYXA 1SLAA 1EPWA 2GNDA 3MW3A 5E89A 5GLZA 3Q9OA 3N3HA 1HKDA 5T50A 3ENRA 3PVEA 3V0BA 2ZGPA 1JW6A 2CTVA 3OGGA 1CR7A 4YG3A 5GLTA 1GZWA 1QOSA 2ERFA 4Y26A 5DUUA 1G9CA 5T52A 1KDMA 1MS1A 4XJZA 5KXBA 1J1TA 3WHUA 4F83A 5KXEA 1IS5A 1DYKA 1LULA 2HYKA 1I3HA 2A70A 3I4IA 3HR9A 5EXOA 1WLCA 1HQLA 1W6OB 1IKQA 1G86A 1S0JA 3APBA 2GN7A 4UW5A 1QGLA 2AR6A 2SBAA 4Q1PA 3AJYA 3POSA 1LCLA 2P3IA 1UZYA 1FYUA 4IQPA 3FLTA 2WNEA 1B09A 4XE9A 4DRRA 4YZ5A 3MEPA 4BLIA 2P3JA 3RG0A 2GMEA 3SLIA 2CWMA 2WJSA 3WDVA 3RRDA 4PQ9A 4XILA 1AJKA 3I8TA 1QNWA 1YO8A 4YZ3A 1AX2A 1N3OA 1DQ6A 1GLHA 1Q8SA 3FUOA 3ILFA 3W59A 4K20A 4XXAA 4Z8BA 1N1SA 3OBRA 1OFSA 3WG4A 4BQ1A 2EXHA 1BKZA 1VAVA 1G9FA 1LOGA 5LK5A 3TB0A 5E8AA 1CJPA 3ZXKA 5IK7A 2JD4A 2GN3A 3VUOA 4ISQA 3ZSJA 4H55A 4UW4A 1X50A 2FMDA 3N35A 4LBQD 3WOGA 2ZGKA 2ZGOA 4YW5A 1N1YA 1ULDA 1V6KA 1S0EA 2ZGLA 3DUIA 2H0BA 3AXEA 4XIOA 2PHRA 4YGCA 1Z0HA 3B9CA 1KRIA 1ZM1A 3AZXA 3D5OA 1LENA 1Y7BA 1MZ6A 4R9BA 4MYEA 2W08A 3USUA 4DPNA 4PF5A 3WG3A 5JOWA 2AYHA 1FV2A 3LSEA 3M2MA 3VKFC 1DQ1A 1LGCA 2ZMKA 2LTNA 4LBLA 1Q8PA 3NV3A 2P2KA 4XTPA 4XTMA 4TYSA 1QF3A 3VKMA 3WDYA 1DQ2A 1N47A
chains in the Genus database with same CATH superfamily
1YEWA 3AFGA 4PIZA 4OZXA 1W90A 5J37A 5GZEA 4NWWA 4LBQA 3VZOA 5FZEA 5JPMB 1YHFA 3WF4A 5IVEA 1SDWA 1RMU2 3T0BA 4D3WA 4XABA 3THDA 1DG6A 2YHJA 4AHZA 1JYCA 4CEWC 1IHMA 3ZSLA 1GQHA 3NNMA 3A0NA 4LIUA 5JLVA 5BNOA 3UGFA 2E51A 1GNYA 2VAUA 5FYZA 1LHOA 4WVMA 3AXDA 1UYPA 4BH9A 2H6CA 1PGL2 3OGRA 5DAPA 4A44A 4KNCA 1CAVA 1ZVFA 1UU4A 2RHPA 3WP6A 1ZBE1 1RUI1 4NHKA 1OT5A 1YFWA 4Q4W3 3SH5A 4E4DX 3S5QA 3H8RA 5H9QA 1XPWA 3VKOA 5IK5A 5IK4A 2X09A 3KQ4B 1W05A 5TSWA 5EP9A 4IE4A 5JOYA 1BEV1 4PHZA 4BM8A 2XLGA 5IFPA 3LDRA 4R52A 2XWJB 1MZEA 1WLTA 1XNTA 4E4SA 3R4SA 3IT8A 1SBDA 3DYOA 3P5BA 4YW2A 1XB9A 4FP2A 2D6NA 2DCYA 4EN8B 1FXZA 4M01A 4XJ9A 2PQSA 2R071 1JS9A 1HRI3 1OMIA 2OXBA 1QJY3 2XR4A 1SLLA 3A22A 4CCCA 3M3IA 2PELA 3GZAA 4AFDA 1PMHX 1TZOA 5LZ6A 4PDWC 5EQUA 4UW6A 3NRUA 5BXXA 5A7OA 4CVUA 2YC0A 1NCRC 3CQOA 3MW4A 3ASIA 2BWAA 1W6OA 4FPJA 4QX8A 3O0WA 5F8PA 4NMIA 2Y38A 2R49A 2VUJA 3MLLA 4UAPA 4XIKA 1W8ZA 5HPOA 4QKFA 1JN2P 2R1DA 2WSVA 5JXGA 1CAVB 1S0GA 2W47A 3A4UA 3BGAA 2VOXA 4R9AA 4QQLA 4Z2WA 1H2MA 1X8EA 1P8JA 3WCSA 1WKYA 2DBNA 1O5UA 2WLPA 3LA2A 4YWAA 2R063 2ZGQA 2PHXA 4AZZA 3AZZA 3HNBM 5FMBA 1QOOA 5FY1A 5IWFA 4C0BA 5A7SA 3J7MA 2V5DA 1AR81 3CLPA 1CZSA 1I6XA 2RDQA 3LIGA 1ZX5A 4AFBA 1PK6A 3SKJE 1W3XA 2CDPA 4ZXKA 1LGNA 2GH8A 4PDWA 1HB2A 4UYBA 1V6IA 1VE0A 1DYPA 1RUI2 2WFF2 3RJ2X 4E4ZA 1ENQA 1LHNA 4BIFA 2VU9A 1FV3A 3RSJA 4X6RB 1APNA 5CNAA 2OS2A 1JYNA 2QNKA 4XMIA 3POWA 1H4HA 1BK1A 1LGBA 3DECA 5GZGA 1V6MA 1H8TB 5DUVA 5FKCA 2Q1FA 4NOTA 4P14A 3VBOA 5BNNA 3O12A 5C8CC 2QQOA 4A3XA 5IK8A 1W39A 2NQYA 1CN1A 2JX9A 3AB0A 3MYXA 4M0NA 2NN8A 4NPRA 5A33A 1VMHA 3LA7A 4UBHA 2OPKA 4RFRB 4OYUA 1DGRN 3VZJA 3VDCA 5FJHA 1W99A 3MLJA 2ZKLA 2FCTA 3KV5A 2JECA 2WABA 4ZS3A 4BHPA 1DU3D 2BNNA 3H0OA 3U37A 4K3UA 1UZVA 4O65A 1LOEA 2J1SA 1I5ZA 1O4YA 2VG9A 3CDZB 2ARXA 2Y6JA 1XU1A 3HQXA 3OYWB 5IJRA 1UY0A 1R092 1NCQB 4XOGA 2WSUA 3LKJA 3OYWA 2D44A 4LBOA 4PT6A 5T5PA 3N4MA 1GNHA 4JDOA 5L9RA 1IOAA 5A7WB 1PX4A 3WCRA 5A6ZA 4Q4Y3 4W65A 1MQTC 4LITA 1NQDA 1D2QA 3OD0A 4CE8A 1C57A 2OUHA 2ZX3A 2BZDA 2VUAA 4U2AA 3J8F2 4R4ZA 3P3NA 1FATA 5LW9A 1AL0G 4LHKA 4WZCA 3GDBA 4XCAA 1JMUB 1LAJA 4AGVA 5BNNB 3OD4A 1PO22 1R082 4Q4X3 1IZ3A 4DY5A 1W8WA 5KHIA 3VBRA 1QDOA 2A73B 1MEC3 5E6HA 1W9FA 1KS5A 3BCWA 3D0SA 4P9LA 4PJYA 3J7LA 1RHI3 5CVRA 4FOYA 3JB4C 1D4VB 5FZAA 3RMYA 1WLWA 2A6WA 4CUBA 1QJU2 4HVOA 1OLMA 2Z5WA 4XDQA 3BB6A 3H1WA 4Y20B 4YVWB 1JYIA 3C7GA 1VBE1 3ES4A 3OTFA 3RZJA 2RM22 2Q1MA 1QJY1 3HBZA 1W9WA 1HJGA 2B8MA 1ZZBA 4I01A 3C8XA 1AXKA 3O1MA 3GHMA 1ASJ2 4KWLA 3AKRA 5KC5A 1LKNA 3NVCA 4N43B 1JZ2A 1YRZA 4EN0A 4JHZA 4I3PA 4XUOA 5L9VA 5I93A 4CDUC 5J3UA 3I59B 1OBNA 3RYKA 1C28A 4A3ZA 3PU8A 1DGLA 1ZA7A 4JDMA 3D82A 5FXZA 4A41A 2BGPA 2OZJA 2ZHKA 5K0UB 5A3PA 4NIGA 2VTXA 1AR71 4BPZA 4AFCA 1CJDA 4BQ2A 4E2GA 1NY72 4NPLA 5FPUA 5EYYA 1W0NA 4DXSA 3POIA 2VMHA 3TRSB 4UFIA 1Q8OA 2BYVE 5C3RA 2CL2A 2P4EA 4KWJA 3THTA 5KXDA 3W20A 1J3QA 4RSUA 1WMDA 2VD7A 1JZ3A 4GXLA 2PN5A 2NMOA 1EAH2 2A7AA 3DKWA 3DKQA 1EAH3 1S0CA 5FAXA 4CU7A 2R041 4QM9A 2ZEWA 2RS12 1LNSA 4LHNA 4CUAA 5CG8A 1YLLA 4DXRA 5A3MA 2DUPA 1BYHA 3NJVA 5EHDA 1REFA 2D40A 2E33A 1UOGA 2WL1A 2XLFA 1H8VA 2XQRA 3NV2A 3M8LA 5C6CA 2VXRA 2DUOA 5DZFA 3OPWA 2J1RA 4XFBA 5FZKA 2WA3A 2XBO3 2B46X 5K7PA 1ZBA1 3LF7A 4RHV1 4LO7A 1L7LA 1W2UA 5A70A 2X10A 5FZGA 3D6EA 1LU1A 3R6SA 1JHNA 4J1WA 5FY4A 3BTZA 5EFUA 1HDKA 2E9QA 4M4RA 2UWBA 1UXZA 2GMMA 4QMAA 1YIPA 2NMNA 5IVBA 5FO9B 4I02A 5D8AC 3ZSEA 4NIHA 2K9ZA 1OPMA 3H3LA 3O1VA 1AF9A 1LOFA 4HK8A 5JVVA 3ZOIA 3NNGA 3LDKA 3ACFA 4AGRA 3H8UA 3FX3A 2W68A 3I2HA 1QQP1 1H0BA 1Z7S1 1NLQA 5A6QA 2JE9A 1J3RA 4KGQA 5G05L 4DZGA 1VRH3 2HWB3 4W6YA 4Q4Y2 4A4AA 1H30A 5A7WA 3J9SA 3POBA 1GZCA 3HWJA 4YW6A 3WUDA 1VBB1 3OY8A 4W50A 4QPIA 4CP9A 4XC9A 4D0QA 1DIWA 2G4IA 1RL3A 4QQOA 2XL7A 3ZIWA 3U78A 2VZ1A 3UKTA 3VBFB 2D93A 2HEWF 3BPZA 4F8AA 5AFEA 3NWKA 1QJX3 3GM8A 2P1BA 1O8SA 1RUE3 2QVSB 3GBGA 4IERA 1VMJA 4M3CB 5FZFA 2ARCA 1SACA 2J1AA 3R4UA 3WG2A 5KHKA 3ME2A 1LOAA 1G9DA 3E6CC 1HW5A 3SH3A 1GOFA 3ZKYA 5FYMA 3KCCA 1YYNA 4C1XA 2DDUA 2FCVA 5APAA 1NE4A 4Q4Y1 3MV11 1MACA 2QQIA 1IQDC 1W06A 2RS51 1UOFA 3KGLA 3O5SA 1QQP2 1Z7S2 5FMDA 4ET7A 3ZLIA 2VZRA 4R9DA 3AKSA 5A7PA 5FR3A 3PTRB 3VBSC 2D43A 1A6CA 1GANA 2YBPA 1ND2A 5LA0A 2F17A 1ND3C 1TNRA 1V6NA 2HWC3 4QU2A 4AVBA 2OA2A 4K9SA 4CDXA 4R8HA 2XPJA 3MHZA 1HRV2 4Q8KA 4B8EA 1GV9A 2Z2SB 2BQPA 3DPRC 2Y6GA 3VDDA 2WZ8A 5A1AA 2DVFA 3SEEA 3ZN6A 4GJYA 2DYCA 4D6RA 1W2TA 4M3CE 2D5HA 3MPPG 4AW7A 3RYPA 4QWNA 4CCMA 3P1IA 5FCCA 1XYPA 2VW0A 5FO7B 4RHV2 3E5QA 2NM1A 3DL3A 1JHJA 3AKQA 5FPZA 4YYOA 1C8M3 4MGZE 1UPSA 1NZIA 2ATFA 5CKQA 4XAAA 4DFSA 4CXYA 5FYUA 3I2OA 5JOZA 1XE0A 5EZWA 3ZYFA 5T55A 1VIWB 2DF7A 1UMIA 2F4LA 3I3QA 3T0AA 1SFPA 1AUYA 4ZY9A 3PMEA 2FMYA 4COWA 3ABZA 1CGPA 1JYVA 1R1A2 3RZKA 1Q43A 2A3WA 4HZFA 1XJAA 2DCJA 2MEV2 2ZGSA 1X33A 3BN6A 4FFHA 3WQ1A 3RZLA 1ENRA 1E5HA 2ES3A 3KCYA 4JC1A 4IW3A 2R062 1ASJ1 3AYDA 2R0FA 1OQDA 4B1MA 3FZ3A 1UY2A 1YQ2A 2X8KA 2ZAAA 4IE5A 4QHOA 3H8XA 4BB3A 4E4HA 2VVDA 5F3IA 3R4DB 4COVA 4D6SA 2XVKA 1TMF1 2A1XA 3DCQA 4IEXA 3KV4A 2W1WA 5FMOL 3BVCA 4L11A 5FUIA 1VALA 5CFDA 3JBG2 3X29B 2WRAA 2PTMA 2ZABA 3FC0A 5FQ0B 2AENA 4CDQA 4JGZB 1ZRFA 2GNBA 4JQTA 5C4WB 4NO4A 4XXPA 5DUXA 5I91A 1VR3A 1LTEA 3MLKA 1NCQC 4I09A 4UFKA 2WN2A 3LIHA 3IIIA 5GLVA 5JXHA 3AMPA 1H6YA 4N90A 2LS6A 4GKYA 2G9GA 3CO2A 3GBFA 1AYM3 3PJYA 1HXS1 1JZ8A 4FAHA 3LOBA 1V00A 2XVGA 4S2FA 1FPN3 1RMU3 4GZ9A 3ZFEB 1PZ8A 1WW7A 2SLIA 2XVLA 3HPNA 3S7EA 5ABJC 2O8OA 5IUQA 3IBMA 5A1LA 4BQWA 1RVF3 1GFF2 1OKQA 1PNGA 1A78A 4OULA 3QACA 1MQTA 1S0DA 2ZHMA 2WT1A 4DQAA 5JSOA 1MZ5A 1WD3A 4XQWA 3WW3A 2PFWA 3LCPA 4QPYA 2DVDA 2QQMA 5FYYA 1EPWA 1FPN2 3PDQA 5E89A 3ZFFB 1DLCA 1ODNA 5DMYA 5T50A 4HK9A 3DYPA 4LKSA 2VZ3A 5FZOB 2VPVA 1ZBA2 1CR7A 1GZWA 1QOSA 2ERFA 1KDMA 3GHNA 1J1TA 4GIQA 4IV1A 4F83A 5A32B 2A70A 2QQVA 1WLCA 1UZWA 1G86A 4LOTA 3APBA 4UW5A 4XF9A 4BQXA 1QXJA 4N43C 2SBAA 2YDEA 2JEMA 4RR3A 4GULA 2P3IA 1UZYA 4IQPA 4NHLA 2X29A 5FPAA 5CISA 1O7FA 1UKRA 2WNVB 2XJUA 4AI8A 2HJIA 4B4QA 1EAH1 4PLOA 3RI8A 4CEYA 3RG0A 2CWMA 2P5BA 3WDVA 4A45A 4XILA 3FJSA 4BU2A 4AEMA 2IC1A 3IDBB 5K0UC 1AX2A 1GLHA 3AKTA 4UWDA 5JR7B 4Z8BA 1UIJA 2V09A 1OFSA 4BQ1A 2EXHA 3GBWA 1VAVA 5LK5A 4FSJA 1OKOA 1H8TC 1ZZ7A 3VZLA 2Y0OA 3UETA 5E8AA 1CJPA 4IV1C 5FMCA 1RUE2 3ZXKA 4B4RA 5LY1A 3VUOA 3KF5A 2VZSA 2JXAA 1QJU3 4GWJA 2ZGKA 1RTVA 2ZGOA 5HV0A 1PNFA 1ULDA 1S0EA 1WGPA 3AXEA 4TTGA 2XOMA 2WBKA 2WO7A 5LRRA 4AF9A 1ZM1A 3D5OA 2V72A 1MZ6A 1PK6B 4MYEA 3DXUA 2EA7A 3USUA 4DPNA 1GMMA 4OQ9A 3SKVA 1IPSA 4NHXA 1XBFA 3EYPA 4UFLA 3VZKA 5CFCA 1LGCA 2IFRA 2ZMKA 3VBUC 2LTNA 3RZGA 2JB8A 2OQ6A 3FHIB 4XTPA 2QBXA 3DYMA 4TYSA 1US3A 1U5XA 4A6SA 2B42B 5FJKA 4AAXA 1IS6A 1UAIA 4JKMA 5CIRA 1NCQA 4NJ4A 4OUMA 5HCHA 2W1QA 1ND2B 4YNIA 2JJ6A 2ILMA 1DDLA 3FWEA 4AQ2A 1VBC3 4QHZA 3PJQA 3N36A 4K6BA 1YUDA 4XFAA 3HN3A 1QHDA 2FD8A 2XBO2 4LUMA 5E1RA 4SBVA 4CCOA 1FPN1 4GH4B 1XXNA 4Z07A 5A1FA 1UF2C 2O1QA 4XPVA 1ONAA 4P9XA 1ENSA 1ZRDA 2Q0AA 3JUUA 2R043 1FAYA 4GB31 4NR1A 3M3OA 4AVVA 3CZUA 4FBFA 4XAEA 2DFCA 2TUNA 1JBCA 4QXKA 2A3XA 4ISRA 3T1LA 3B94A 4WM8A 1UY3A 4Y4RA 4NE9A 4P08A 1RVF2 1W6NB 1R091 3ZDVA 2JD9A 1MS0A 2XG3A 1QXRA 4RQPB 4A7YA 4XDOA 4FO9A 1GYKA 1UIKA 3ACGA 3TAYA 4YZ2A 3R05A 2L9LA 2Q8OA 1NKGA 1OA2A 1CONA 1UY1A 1J83A 1UZZA 2EIGA 2PAMA 4YPJA 4FXGB 4IE7A 3WXPA 5A33B 4DUXA 1BJQA 3V0BB 1PO21 1CAWA 1GBGA 1LEDA 1R081 1WCQA 2EF6A 4S2HA 1RYYA 3NKTA 3BKZA 4D7TA 1HQWA 3RYRA 1GZ9A 4E9KA 1JOPA 2DCZA 3AYCA 2HWF1 1V6OA 3ATGA 5I0UA 2CV6A 1BBT2 1OSGA 3CZJA 4QX0A 1TME3 2VVEA 3RQ0A 3USUB 1VPHA 3M3CA 3ZIXA 5FBZA 1KS4A 4MGKE 4C90A 3ZR5A 4KG8A 1GKBA 4ONUA 2E31A 3GCWA 3GJBA 3WW1A 1QNYA 2ZEZA 5IYYA 1BLZA 1CAXB 3ILRA 1AXZA 1S0IA 4C1WA 1JH5A 3FLPA 4H2AA 4AI1A 3KV6A 4E27A 1Y43B 3BTXA 3VD9A 4ARXA 3KWVA 1W2AX 5IFTA 5LEJA 4QX1A 1C8M1 2X5IC 3HVDA 1HN1A 3D0JA 2DFBA 1WBLA 3WDWA 1VBA1 4LEJA 2W52A 2W2IA 4OFGA 5A3LA 3EBRA 3PUQA 1W6MA 2YV8A 3OEBA 2HYXA 3FL7A 5BYNA 4O9GA 5IT6A 2DV9A 3EB7A 3AYAA 4V1PA 3NNJA 1D2SA 4IEZA 2ZXQA 4CDUA 1UU6A 3ZXEA 1WW5A 2PHLA 5KR7A 2HWF2 2WR9A 2PAKA 4P5YA 4XHBA 2ZA9A 4Q4W2 2YY1A 4GQ7A 4YVSB 3O1SA 3KVBA 5F7UA 4YFWA 3T08A 1KGYA 2D3SA 1JUHA 1YC61 3N9PA 4FT8A 3TN92 3WNMA 5GLWA 2ZZJA 1MVQA 3HMYA 2CAVA 3M3QA 3RGBA 2XQXA 3EHKA 4QGMA 3ZFEA 2Y33A 3GNEA 1ZZ8A 3FMGA 4IETA 4XEZA 5C5TA 3WLUA 3I3MA 2TEPA 2NPIA 3QLQA 2VTXJ 3C3VA 2ZEXA 4Y22A 2QQNA 5A32A 3LEMA 3RJRA 4N53C 1VBC2 2BW8A 3GZUC 4IGOA 4XUTA 5T5OA 3VHPA 1CZVA 1PM7A 1QU0A 1WA6X 3FUQA 5FRAA 2P34A 2JIGA 4Q4V1 3MF9A 1IG3A 4Q0PA 2W9XA 1DP0A 1IKPA 1W8FA 4QX7A 5GZCA 2ZCWA 4UT5A 4XCBA 2JE8A 1CPMA 2YGMA 3I59A 2VOWA 1LOBA 1NXMA 1YWKA 4A7ZA 3WQ0A 1UPIA 3H7JA 4YG6A 3KT7A 4LE4A 1SQ4A 2IXJA 1VBB3 4Q2FA 3JZVA 5FZ1A 2OZ6A 5C4WC 2PHUA 2FHRA 1W8HA 3SEPA 3C7FA 3KS7A 3HT2A 1O4ZA 1A8MA 5JI7A 1F8VA 3VN4A 1H1MA 3TEXA 3VD3A 4R9CA 4TLGA 2PHWA 3LZZA 3KV9A 5FPVA 2Y26A 2JDZA 5ISLA 3ZVXA 5IVCA 3ZYJB 5CKMA 1LJ7A 3E6BA 5FLIA 1RUI3 1XNCA 5C5UA 2RJKA 4KU7A 1H1AA 1FX5A 1LOFC 2EAAA 1LRHA 2ETEA 2RMU3 2VH9A 2AEYA 2CU5A 3VBSB 3JD72 3E6DA 4FP3A 2YGLA 4QX3A 2RVAA 3QH7A 3K4AA 2B4KA 4UF0A 3W5NA 2LM3A 3WDUA 2CGPA 2HBUA 3MI8A 1HQNA 3T1MA 1A8DA 3JD73 1ST8A 2XHNA 2RJLA 1JZ4A 3B5LB 1WW6A 3NW4A 5FP4A 3WQBA 3ZFFA 4AVSA 1YI7A 2Q4SA 3BOPA 4FPKA 1IPJA 3VL8A 4BK5A 1US2A 4Q29A 1QJFA 4CEWA 1GWMA 4ITCA 3BI3A 3IPVA 4IV3B 4FVVA 5DQ0A 2J22A 2ZACA 2GC2A 1PVC2 4Y5TA 1GUIA 2AGSA 5CU1A 1W6QB 4IEVA 3T4HB 4WZFA 2ZX4A 4DO0A 1CD3G 1LESA 2BVVA 2EVXA 4GB33 4K7JA 1VLNA 2XJVA 4CEYC 1DGWA 4MH0E 4HOOA 3N9NA 4DRVA 3W9AA 1ZZCA 3BTYA 2RR11 2AC1A 1RITA 1OLRA 3Q8AA 3EQEA 1IGOA 3TNPB 1GP5A 2E63A 2OPWA 5J09A 4YW1A 2VR4A 3WVJA 3IMNA 2A71A 3FBMA 1V9U1 3KSCA 4B7KA 2UYAA 2WINB 2YPDA 5IHRA 5JCTA 2P37A 2E7QA 3ZPYA 3ZXFA 3LOIA 1R1ZA 4Q27A 3POEA 4I0BA 2VCBA 4PF1A 4NPMA 3MPBA 3MIDA 3ETQA 2C5DA 4QPIB 4CP9B 2HWD3 4FPGA 1AXYA 2VW1A 3RPQA 1C8NA 2DWRA 2TNFA 2D97A 2OYZA 3I2IA 1C4RA 4GMP3 1PO13 4TXWA 5LATA 4KMQA 4CXWA 4CUCA 5JZGB 2HH9A 5FZLA 1AR72 2FDHA 2RS33 3Q8EA 2D6OX 5T5JA 4Z2AA 4MGTA 2BJSA 4QXHA 5FZCA 5FOBB 2D6LX 3K2OA 1RIRA 4COUA 2P6HA 2XKPA 2ZAHA 3SHRA 3TN93 5HCAA 3MBWA 1KEXA 5CADA 4OZOA 5FO8B 4PLMA 3IKWA 4DB5A 3EO6A 1B35A 4RA0A 4M3CA 2WZR2 4JZRA 3E5XA 1IQAA 4KU8A 2ADEA 2YU2A 3HNYM 4XMAA 3WDXA 3OBAA 4LULA 2MEV1 1KQRA 2WZR1 3IDCB 3ZYRA 5C8WA 1CESA 3MIHA 2CHHA 4G9SB 1QJY2 3C7EA 1AZDA 1EUTA 1STMA 1O8PA 3NSTA 4MSVA 2Q8CA 2JE7A 5CEHA 1RUH1 3P3PA 3OOXA 4Q4X1 3VZNA 2BFUL 5JUVA 1AR63 1CAUA 1DQ5A 1YJKA 1W2OA 3KF3A 4PI2A 4QHBA 2RM23 2Y64A 5FOJB 1PGW2 1PGW1 4MGSA 4YW4A 3VHNA 1W6QA 1SMVA 4GH4C 5FUPA 5IAVA 1POQA 2XJTA 1RJ7A 3T4VA 4LE3A 1K3IA 1OUSA 1MS8A 3FBYA 2WKKA 1QOTA 3CJIB 2IVJA 5ACA3 4EJRA 1CVNA 3U4SA 4RD7A 1W6MB 2IXIA 2VY0A 3MF6A 4I0AA 4AAPA 5C7GA 3IMMA 4LKFA 3SMHA 3IDEA 2E7TA 1R1A1 1AR73 1RUJ1 2B5HA 2JDYA 2ZBJA 4Y22B 3ZO0B 2XJSA 2QE3A 4Y1VA 5B2GB 4QQ2A 5FZ0A 1QH7A 5FY8A 2YC2A 1OA3A 2HKXA 2PXJA 5LBCA 3AP9A 5C3PA 5JSRA 2F6BA 2KA3A 2QZ3A 3GALA 2XONA 1NE6A 5FZ6A 5C9AC 2RS52 1GP6A 4SLIA 1H6XA 3HIFA 3FHQA 3J4UH 4FQ4A 1HX6A 3SC7X 4IV1B 3TEWA 4MUVA 2XKOA 3I3EA 4D7YA 4E8DA 2EAKA 2EICA 4GJZA 5BV6A 2W92A 4BISA 5GKAC 4CP2A 3LA3A 3ON7A 1O5LA 1FMD1 3ACLA 4LT5A 2BOIA 2IXHA 2RDNA 1RUG3 5LBFA 3O1TA 1QXPA 3CJIA 4XETA 5GLUA 2WZPP 4JV4A 1NA1C 3A21A 1COV3 2JENA 1DGRA 2EIEA 5JOXA 1C1FA 5J36A 3WHTA 5HCFA 2X5IB 3A7QA 1RUF2 4BJ0A 3VBUB 4FPLA 3CU7A 3N9MA 1POV3 4FCAA 5FPXA 4FI9A 1MS5A 1CAUB 2B7YA 5DAQA 3AMQA 2C24A 5FYHA 4BMBA 5BNOB 1T6BX 3HQUA 2GC3A 1NUKA 1D4M1 1PIV2 4GKXA 2WZEA 3PU3A 2LW8A 1GZWB 4XBQA 1IS4A 5DXDA 5FZIA 4INDA 1NCRA 1H2KA 1ULFA 4XDPA 3KB5A 1X82A 2D7FA 4X8PA 1PIV3 4NWVA 3B7MA 4BQ3A 2FQPA 1N1VA 2RJ2A 1L7QA 4LTAA 2IVIB 4XVHA 3LE0A 5BNOC 1ZREA 3NNLA 3HNMA 2VMDA 5FLJA 4V2WA 4V2VA 4CDQB 5FQ0A 2Z69A 4MX3A 1RUOA 5BNQA 4N53B 1QJZA 2EXJA 2TBVA 2ZHNA 1TME1 1B35B 3DN7A 2YUEA 5FZHA 1URXA 4TN7A 2KR2A 3SISA 2D6KA 4Q4V2 4URTA 4NIAA 1OA4A 3J26N 5FMOS 1DLLA 3K4DA 1OH3A 2BEOA 4AHXA 3E5UA 2BGOA 4KBBA 1D4M3 1MS3A 2Q5TA 2C9AA 3C2UA 3GZTB 4MOAA 4RYDA 4WV8A 3AFKA 5FZDA 2C4XA 3S6PA 5A3TA 1O3TA 1ZA4A 2A6VA 4N9HA 4MADA 2ZGNA 2WT0A 3AZYA 1ULGA 4UOJA 2JG9C 4D7SA 1C1LA 1SFNA 3UESA 4QXBA 4YZ4A 2AZ5A 3LAGA 3H8OA 5FZ8A 2HWC1 1VBD1 2BNOA 5FPLA 1NYWA 1PX3A 3ZFFC 3DEMA 2C9KA 3MFAA 4CU8A 4OI0A 1UYXA 5LRSA 1RUC2 1JU3A 1KJRA 1FT9A 2WS92 4CRQA 5LA9A 3H7YA 1YQCA 4AQSA 1SLAA 1I9RA 2GNDA 2VZVA 4W6XA 3Q9OA 1RUG1 3N3HA 1HKDA 4META 3PIGA 3VD7A 3PVEA 1VAKA 3QH6A 3I7DA 2ZGPA 4NVPA 5FUNA 5CFCB 3ZYHA 1OD3A 5AC93 1K12A 5GLTA 1O6UA 4PI0A 4Y26A 5C9AA 1G9CA 2VBBA 1MS1A 3OB8A 1X36A 5KXBA 2BFUS 2P3YA 3MUZ1 4XW3A 4EWAA 1O4TA 1LULA 3ETPA 5FP8A 2HYKA 4MZUA 1I3HA 4EROA 4IGPA 5ABJB 1HQLA 3B02A 1IKQA 4MHRA 1QGLA 4Q1PA 4MG2A 3AJYA 3S0MA 1GZTA 2QQPA 1OFNA 2WFPA 4KQ7A 3ZN4A 4QX2A 2PLV2 2LUWA 1B09A 2VECA 4XE9A 3TN91 4BLIA 1R64A 5FY7A 3PUIA 4XQDA 1HRI1 3ORJA 2R073 5A3OA 1RGSA 3NMBA 3RRDA 2RS31 4MV2A 1GU3A 1K45A 2XJQA 4YZ3A 4K40A 3Q8FA 1N3OA 3FUOA 1Q8SA 4YVSC 5F6LB 3T09A 3W59A 4K20A 4XXAA 1OQEA 1JZ5A 1GQGA 1N1SA 1VRBA 3OBRA 4RFT0 3WG4A 3TB0A 1LOGA 3QBQA 4CEYB 4COZA 1K5JA 4CCEA 2ARAA 2JD4A 4D8MA 2FZ1A 2GN3A 2WQ4A 4LA2A 1X50A 2X5IA 3POGA 3ZXAC 1POV0 2JDKA 1V6KA 3VBOC 2ZGLA 2H0BA 3KHBA 2WN3A 3AL5A 4YGCA 1QJEA 4AHYA 5L19A 2I74A 1AL23 1LENA 1FOD3 2QJVA 4JVAA 3O1OA 3AMHA 2ZEYA 2XDVA 1XNDA 4RHV3 4PF5A 4XZUG 3WNKA 1U5ZA 2RR13 5IATA 2AYHA 4H14A 3J8F3 2GC1A 1DQ1A 2VBPA 3VKFC 3ZXGA 5LB6A 2MEV3 4CDWA 1Q8PA 4Z92B 5G04L 4NIDA 1HXS2 3I3BA 4MGQA 4AHWA 5F39A 1RJ8A 3VKMA 5AC91 1N47A 3UV9A 4OHVA 5L73A 1RUC3 2ZPXA 1G8WA 3ZXDA 3LEIA 2W91A 4OCTA 5F2WA 5DAXA 3JB8A 2EXKA 5LK7B 2ORXA 2JDHA 5F32A 2ADDA 1O3SA 5C8CA 3S57A 4AEDB 4YVSA 3I2DA 5FIXA 2C1FA 2FDIA 3J8F1 3LEGA 5BNPC 1OHFA 3PIJA 4YGEA 3N7LA 4LA3A 4D69A 2AEZA 1WCKA 1WD4A 1O91A 1TNFA 2WNUB 3OSDA 4YM3A 1F5JA 5FYCA 2EALA 4FAGA 3H3UA 5FXVA 3POFA 2QQJA 1SLBA 4AVTA 2YPJA 3KT4A 1UU5A 4GB32 5C71A 5JWPA 2H0VA 1UYZA 1GNZA 3GF6A 1FI2A 2YXSA 3O0VA 4Q1RA 3THPA 1W6PA 4LHSA 4RQPC 3HQRA 1F5FA 1W0OA 3UGGA 4CXXA 1YCIA 4N9IA 5E16A 1PVXA 3RI9A 5KWRA 1PGSA 2LRPA 5AVPA 4IL7A 5CG9A 4KWUA 1H9WA 3LFIA 5FWJA 4YM0A 3BPSA 1ZZ9A 1W0PA 2XHKA 3RS6A 1SPPB 3ZYBA 2H6BA 3JU9A 4UW3A 2DBIA 3TOJA 5HCBA 1HXS3 1W8UA 1SG3A 3JQXA 4LUKA 4ZHNA 4WBBA 1RINA 4IEOA 4Y4YA 5FZ9A 2OUJA 1BVVA 4EN6B 2FDGA 1RUNA 2HEVF 1BZWA 3ZX7A 1ZRIA 2G1MA 4HG6B 1H2NA 3UK9A 3AM2A 4FPHA 2KD7A 4LQRA 4Y1ZA 4BE3A 4WM8C 1LR5A 4P9YA 5ACA2 3VDBA 3NJYA 4P9GA 4XFFA 4EZHA 3PVNA 3RWKX 1OC1A 3U4XA 5FY9A 3KD4A 5F3GA 2XJPA 4AG4A 3INAA 5T5LA 2Y6FA 5J96B 1O59A 2WT2A 4OHZA 1K42A 1JZ6A 4BIOA 4B29A 1SDDB 2ZTNA 4QPIC 3NAPC 4BXSV 1AVBA 3CL1A 1W28A 2XUEA 4FOQA 4CZSA 5KHGA 4Q8LA 5JZGC 1VB4A 1NA1B 2VZTA 4XFIA 2UU8A 2YBKA 5DABA 3U0ZA 1HV0A 1W8TA 2DTWA 3KT1A 4QX5A 5FK8A 2A6XA 4LLFA 4NAMA 5LWBA 4UFJA 2A3YA 2QZ2A 1D0HA 4JGZA 5FP9A 1F9KA 4YW3A 4ZXEA 5J1XA 1MPXA 3QOPA 3VBHB 1CIWA 1GR3A 1ULEA 2CNAA 3WY6A 5A3WA 1VBA3 1PIV1 4XJ8A 4YGBA 4LHLA 1VBE2 4URAA 4TSVA 1T6GC 2QKDA 1LU2A 3ZMNA 4KG0A 4CSWA 2WLQA 2QTWB 2E6VA 1MS4A 2VNRA 2WDBA 4AI0A 4CEWB 2R1BA 1RUF1 1J58A 4QD2A 1DZRA 4D94A 2A6ZA 1ZNPA 4XF4A 4RL7A 3QCWA 1S0BA 4Y33A 2W0XA 5LA1A 1UX6A 2CSGA 5IVFA 3JBG1 2OT7A 3ZXLA 4LKEA 5IVVA 4M00A 3PHMA 1JYXA 1KDKA 2FZ2A 2Z42A 5FYTA 4NN0A 1SFYA 1V6LA 1B35C 4S2GA 1FMD2 2ENRA 3O14A 1COV1 4AL9A 3E1F1 4XJAA 4JKKA 3V0AB 4EYUA 3HAGA 5FTTC 1D4M2 4DEQA 4P00B 4YFZA 2R061 1VBA2 2PHDA 3T2QA 5KHHA 3ZXJA 5FZ7A 1XE8A 4JTNA 3VBRC 1POV1 4EWEA 1QJX1 1CWPA 1UY4A 5I0TA 3O1RA 4WVWA 3B00A 4PQQA 3RZZA 1JTZX 2ID4A 3KVAA 2WZR3 1V0AA 4KBZA 4J6GA 1NAEA 2ZGUA 2RS11 4S2DA 1UN1A 1REDA 4L0PA 2I45A 3WNNA 2WAAA 3AK0A 2Q8DA 1VP6A 4ASMB 1PZ9A 1MS9A 3H3ZA 1ENXA 2Y0IA 2J42A 3ST7A 1QH6A 1VB2A 1SEFA 2RS32 5DG2A 3SCFA 3OCPA 1JOJA 1LOCA 2VMFA 3MIGA 3ZPOA 2P6CA 2FCUA 4ATEA 4QB6A 3WF2A 4IEQA 3U14A 1CX4A 4AEKA 1VBD2 5F5IA 3BUCA 5DZGA 2WFF1 3ZYPA 5K4LA 2GNMA 3WEZA 4UF0B 2DUQA 4HSLA 5FZOA 2R7EB 4I30A 2JG8B 2VW2A 3LB9A 3VDDC 4CPBA 2DU0A 5GALA 3KMHA 1EV12 1QKQA 2JG8A 4D6QA 1XSRA 1ZBE3 3CF6E 4BMEA 3GJAA 3VBFA 1PO23 1R083 4Q4X2 2A5ZA 3IB3A 3DF0A 3K75B 3IN9A 5SV8A 4DS0A 2DVBA 2QCSB 1C5HA 4MXWB 3WSOA 1BHGA 1QMJA 3H9AA 4QKDA 1K5MA 1V70A 1RUG2 3ALQA 4MXWA 1E5SA 3IZOA 5FWEA 3UKNA 5B4XA 3N7KA 5AVAA 4GAZA 1ODMA 5DPNA 5FPBA 1ZZ6A 2VMEA 4Y24A 1HRV3 3LSDA 1OF3A 3VBUA 4NUBA 1W6PB 2WA4A 1XC6A 1YQ5A 2HWC2 3HJRA 4I0WB 4CCJA 4DNYA 2VNGA 4GMP0 5ANNA 4TZDA 3KHCA 3I2JA 4XQ4A 4CTEA 1O3RA 1QJU1 3LPGA 2AREA 4XBNA 1G6NA 1HRV1 4LBNA 4Q26A 1OPOA 3OJBA 2HEYF 1RUH3 3LWCA 1M06G 3ACHA 3ITQA 5LCWL 4FFIA 1CPNA 2ZX1A 4QB2A 1JI6A 2CY6A 2OIIA 3P6BA 4DUWA 3AP6A 3ZN6B 3RZHA 4WM7A 2XGXA 5CA6A 2R16A 2RMU2 2W1UA 5IW0A 1V9U2 5IVJA 2CWSA 3RZMA 3BODA 3NNFA 2W94A 1XYNA 2VOKA 4LBKA 2BBAA 4BWOA 5BNNC 5FZMA 1W03A 1W2NA 3ZDSA 5GJ6A 4DY3A 1Y3TA 1Q5OA 4JKLA 3KQRA 3MGUA 1AR93 2PYTA 1DFQA 2R6QA 3EXUA 4N43A 4LIVA 1EP0A 1RMU1 2B9VA 1CAWB 1GSLA 1HLCA 2HWD1 2YBSA 4Y1YA 1VBB2 4QKNA 4ORFA 4BOWA 4AEDA 2XL9A 5DG1A 4MVTA 3ZKUA 5F9TA 4GALA 2ZGMA 3BYWA 4DEVA 5EIYB 2YFZA 4FPYA 2Q8EA 5FYIA 3SH4A 2B45X 2PLV3 5C33A 2FDFA 2A6YA 3WW2A 3L9JT 2BUKA 2R32A 3MUY1 3ROUA 4Z1VA 1BBT3 4JAAA 1RUD3 3H1MA 3WV6A 5FY0A 3JD71 4AEJA 2DVGA 1C5IA 3BALA 1IPKA 3OBZA 3AX4A 3WQ7A 1YFUA 4LR4A 1AR82 2F4PA 4GH4A 1LEMA 1W9YA 3CMGA 3EMRA 5JAXA 1UKGA 4K8RB 4LBJA 3WNLA 5FDBA 4NROA 2HWD2 1K5MC 4ASKA 5J7MA 1Y4WA 1OXCA 2HWE1 3AKPA 1F15A 3CNAA 4G4FA 2Y6KA 4FPOB 3LEKA 4ZS2A 4WM8B 1XQNA 1TMF3 2JDAA 4CYDA 2O14A 5F37A 4XFGA 4DIQA 4NIIA 3L2HA 3ZSMA 1XRUA 4M3CF 4HVQA 1ULPA 2NYYA 1SLCA 2R042 4QU1A 3VBOB 1NXD1 1WWYA 3FN9A 4C8DA 3I2GA 1U12A 3ECQA 1LHVA 2DCKA 4H7LA 4K8FA 5HBAA 4M0HA 4IEUA 1RC6A 2VCAA 2DURA 2RMU1 2WYFA 4U36A 1REEA 4J1XA 3UJOA 3IM0A 2WNVC 1G9BA 4RR3C 5F6KA 4PLNA 1HV1A 2ZHLA 3NV1A 4MLOA 1UW8A 3N9OA 5C3QA 3SQOA 2Y6LA 3ZFGA 4AFMA 4AQ6A 5JXJA 3UNPA 3M3EA 3OPZA 3V65A 3IPVB 4CU9A 2NP0A 4ZPIA 1HJFA 3AMMA 3PLQA 1BEV2 3AVSA 1XU2A 4IE0A 2XXZA 1IG0A 3WF1A 5CFDC 5LEKA 2BOJA 3MO4A 4KL1A 1GWLA 4FPCA 4HL0A 1JUIA 1L7RA 1HB4A 3NO8A 3M1HA 4L8QA 4WVVA 5F5QA 3SITA 4Z82A 5E88A 3RNSA 2JDNA 3T3YA 5H9RA 5L9BA 1HIXA 4C0HA 4PBPA 1PGL1 2X05A 4YM1A 5KBFA 2J1TA 1NX9A 3VBHA 3ZYGA 4UI9L 4Q4V3 2GSYA 2WNUC 3MFCA 4CDWC 4FTBA 1W9SA 1KITA 5FREA 5L36A 1UOJA 2WO3A 3VB9A 5CAZA 4IEYA 4QGNA 2ZX2A 3PL0A 4KWKA 2GC0A 2LALA 2HWE3 2JIJA 2K2SA 3PNAA 1F2NA 1RXGA 2VNOA 3SCHA 3LQCA 1C8M2 4XYXA 5FV3A 3W58A 3URFA 3FFZA 2OVUA 1H2LA 3ZM8A 4IDZA 4Y5SA 5I8SA 3VBFC 4NHYA 2JG9B 2E32A 3KGZA 2YG0A 5HV4A 1UNBA 3AZVA 1W9TA 1PMJX 4JRLA 2VM9A 4AI9A 1ULCA 2VULA 4BLJA 2GDFA 5DDJ3 2N7GA 3AP4A 5JSPA 4LORA 3KCXA 4AGGA 1BBT1 4YM2A 1BEV3 2WNUA 1ALYA 3ZR6A 1T2XA 4ATFA 4EZ4A 5CBLA 2IUWA 4IESA 3W5MA 3K3NA 4I2OA 2W46A 1U5IA 2RDSA 2IZWA 2PAEA 2K0GA 4JGYC 2FDJA 4H3WA 4XURA 1XSQA 5FYBA 5FZBA 1NT0A 2VZOA 3FHAA 3JQWA 4QQHA 4QGLA 4RS5B 4YRDA 5DDJ2 5EYXA 4CUGA 4OHWA 1OOPC 2RE9A 3ENRA 4QAWA 3OGGA 3RFRA 1ND3B 1X9TA 3KZ4C 1ZBA3 4HKLA 2RDRA 1WZXA 4Y5Z0 2BPA2 1YNAA 3VDAA 1IS5A 1DYKA 1SPPA 3OEAA 4R4XA 3I4IA 5DAVA 2W87A 3NAPA 2R30A 2E7AA 1PVC1 2G9FA 2GN7A 4NRPA 4FTSA 3NAPB 3POSA 2HWF3 4QKBA 1J84A 4YARA 2RS53 4Y3OA 2CGOA 3HT1A 3MEPA 4OLLA 2BERA 1KFUL 2WO1A 4GD4A 3SLIA 2WJSA 2XBO1 3PURA 5FZ4A 3I8TA 1QNWA 1YO8A 2XLAA 5A6XA 1DQ6A 2BV4A 5L7OC 4X6QB 1S2EA 4QM8A 2VC9A 4LK6A 1YI9A 3HEIA 5IVYA 4OI1A 2R072 4I3GA 1H8TA 4ISQA 4IEPA 1VBC1 3A23A 4UW4A 2FMDA 4LBQD 5A6YA 3DUIA 3M70A 3T2PA 2MPFA 2PHRA 5A7NA 3UKVA 1Z0HA 1EV11 2VOVA 3K46A 5C4WA 1KRIA 3AL6A 2J1UA 2UYBA 5K0UA 4HKWA 3OUJA 5JR2A 2GU9A 4R9BA 2ZOEB 3I97A 1H4GA 4L99A 1VMFA 2ZZQA 4F7ZA 1AYN2 4XF3A 4BQ4A 1CAXA 2BGCA 3K77A 4XUPA 5F3CA 2VCMA 1DF0A 4JGZC 5EPAA 4LK7A 1CIYA 2YYOA 4QPGB 3VZMA 1PO11 4WVZA 3J7NA 1C3HA 2IXKA 1QF3A 1EYBA 4WM7C 2GAUA 3WDYA 1BK0A 1X7NA 5F2SA 5JZGA 5F1RA 1W6NA 4HANA 3FE5A 1H9PA 3S7IA 1S1AA 2DU1A 4AEDC 1DHKB 1D7PM 4FFFA 3T2TA 5FK7A 1V9U3 5L7OA 1MR5A 1YQ6A 3GZEA 4CCLA 4PCRA 3B01A 4AVAA 3HN1A 3I2FA 4H7MA 2VNVA 1AYM2 2ZMNA 4IXLA 4JGYA 4L97A 1NLRA 5DDJ1 5M0TA 3TYJA 4ARYA 4MGIE 2VJXA 4RGGA 3WNPA 3NKGA 5CZKA 2BTVC 3LD8A 1RUD2 1NA1A 2OX0A 2AACA 5I0DA 4OVEA 3V0AA 5BUVA 2YFUA 3MZHA 4MGYE 5EJ3A 4QQPA 2BWCA 3WG1A 4AI2A 4CDXB 3AZWA 4XBLA 2JICA 3Q8BA 4XF0A 2W1SA 3N9QA 3AC0A 5C3OA 2VO5A 2JG8C 3NJXA 1MZFA 2VZUA 1FNYA 3HD8B 3I2KA 3VDDB 4YSFA 2AUYA 5FZ3A 5ABJA 3B3QE 1NLSA 4QB1A 5DN2A 4C91A 1MVEA 1NG0A 2EXIA 2VE1A 2MHFA 4QPWA 2WNVA 4QT6A 4GWNA 1GOHA 3SCGA 2C26A 3H1YA 3K48A 2CGNA 2P17A 1OURA 5GM0A 2CDOA 1JOBA 2YU1A 4AOCA 1PVC3 4W8JA 1RHI2 2ZKNA 3KLSA 3J7HA 1BXHA 5T54A 1XE7A 1MEC2 4F3JA 1NCRB 1RUF3 5HXVA 3PUAA 2UY9A 5CB7A 2C6SA 2PHTA 3PUSA 2VQTA 3SNMA 1VRH2 2HWB2 4EE2A 2VMIA 4DINB 3GGLA 3ZFGC 4L9BA 4CU6A 4DUVA 3NQHA 1N1TA 1DQ4A 1U0AA 4CCDA 3WX5A 4UFHA 3ELNA 4LO6B 1LODA 3IAPA 2VXJA 2ZGRA 3S5AA 4QDRA 1RHI1 4P9JA 1RVF1 5EJ1B 3VD5A 3M4FA 1S55A 2JDPA 2V4VA 3K51A 3VBHC 4P5HA 1AX0A 4RR3B 1DCSA 1UL9A 3L2YA 2WYSA 1TEIA 2VTFA 2PMWB 3DPRA 3LGRA 4GA9A 4KH9A 3H42B 5J98B 1I1EA 2EIDA 5DAWA 1AYM1 4BA6A 4PIXA 3A0KA 3WF3A 1RXFA 1NOVA 4O61A 2VMCA 4PIYA 3WD5A 3U11A 1W8NA 1ND2C 3VKLA 5I0SA 3O1UA 4B3NA 1ND3A 5I0RA 3FLRA 5DZEA 3VHOA 1OQ1A 3W21A 3RDIA 3U1XA 5CFDB 4MO3M 1FMD3 3VBSA 1F4HA 1F35A 5D21A 1WMXA 2VZQA 4NHMA 2QFEA 5FFOC 1OLQA 4AVCA 2XH6A 1LECA 2WWSA 4E2SA 1X8MA 4JTOA 2Y60A 4ZZ8A 1F31A 1WLDA 3F2ZA 4YZ1A 3EJKA 3WP3A 3WHUA 1Q56A 1SLTA 1JXNA 1RUE1 1TMF2 4ZU7A 3O1PA 4Q0UA 1QY4A 1RUD1 2BRTA 3AP7A 2IXLA 3BIEA 4CDWB 3NJZA 1CX1A 1E5IA 1U5YA 2UWAA 1Q3EA 2JWPA 3HOBA 1HB3A 1UCXA 3RVHA 2PLV1 1SCRA 1J59A 2VUCA 5JMOA 3CHXA 4FPEA 4IUGA 4LXLA 1XNKA 2GNTA 3VBRB 4B1LA 3JXSA 4ES8A 5EV7A 2ZMLA 2VQAA 1OD5A 5F5CA 1MQTB 1AYN3 2VOTA 1OUXA 2VL4A 2VQ0A 2O8QA 2GMPA 3BTAA 2Y6HA 4CCNA 4EN7B 5FKBA 5FXXA 4EQVA 5LA2A 2R0HA 2V5YA 2VCCA 1KJLA 2G9ZA 4MXVA 4A7KA 3VKNA 4FFGA 1LHWA 3LFMA 3AYEA 1UXXX 2ET7A 3E97A 4HBNA 1TME2 2GZWA 2QQKA 4X8NA 1S2BA 1K5MB 5JIAA 3BIWE 2IWGB 4XZPA 3UL2A 2KM2A 1DZQA 2YROA 1RUC1 2UWCA 4JRAA 1PM4A 4UFMA 3WNOA 2GALA 1N3PA 1UOBA 5KXCA 3WP5A 1JU4A 1PZ7A 2W5FA 3V56A 3T2OA 3OG2A 1OOPB 1AR92 1PHMA 1WBFA 1YFXA 2DVAA 2JKXA 1BMV1 3I49A 1RB8G 1HB1A 1SCSA 4FTEA 5JIUA 2AH2A 5JPNB 5K8SA 5KHJA 2MNGA 3CJIC 3PUHA 3VL9A 4OMDA 2ORZA 3CIHA 2ZS6B 3NV4A 4DXTA 4HPKA 5ANQA 3MV01 2UURA 2WQZC 4P02B 1XYOA 5IAXA 4W6WA 1I5PA 5A80A 1ZRCA 2BVBA 2VZPA 2Q30A 3VGIA 3DV8A 1JODA 1FNZA 2W39A 3RMXA 4Q5OA 1VRH1 1OVSA 1QDCA 1WCSA 2HWB1 5C3SA 5D8AA 4PDWB 1JYWA 4KGGA 3TEYA 4Y20A 4YVWA 1J1LA 1IS3A 5AC92 5C9AB 2GP5A 4FPFA 2ZGTA 1DQ0A 1BMV2 4GMP1 2V73A 1AR91 2WUHA 2ZX0A 3ILNA 4FQZA 2EIBA 2ARBA 1TG7A 1UYYA 2PHFA 2XB6C 4HN0A 5L7OB 4QDQA 3LPFA 3IAQA 2BNMA 4G3YC 1YFYA 1F4AA 3B69A 4OHYA 2HLEA 4Y1XA 4JCKA 1EY2A 2PQQA 4UBGA 4EN9B 4HMZA 4OI4A 3ZMOA 4DXZA 2E26A 3OUIA 4ZKTB 5ERLA 3LDBA 3VHRA 4OQ8A 2OW4A 2WIIB 3FFQA 4LKDA 4N8MA 4NAOA 1QQP3 1Z7S3 2WAOA 4P9WA 3OBTA 4HPKB 1UZ0A 1DYOA 2DTYA 5C70A 2C0ZA 4UXAA 5CYYA 4LJHA 1DZTA 1Y9QA 2RG4A 3WINE 3T0DA 2PA7A 2FDKA 4A2UA 3UGHA 2D6PA 1JZ7A 2X53S 4CPBD 4GWMA 3V64A 2CAUA 1E5RA 3AVRA 3R0RA 5FY5A 2VBDA 4HLTA 5I8YA 4XFCA 3WZ1A 5A3NA 1EV13 1Z78A 2YC4A 4HKOA 3MW2A 2Y8KA 1ZYBA 4WM7B 3PVOA 4CCKA 4QPGA 2D3RA 4AFAA 4LNVA 1G9AA 3HBKA 3VV1A 1AJOA 3ACIA 3UYJA 1Q8VA 1VBD3 3S30A 2E53A 4CP0A 2J1EA 2GP3A 2QQLA 5GZFA 1X9PA 2VGDA 5FYVA 2Y34A 5D8AB 2XUMA 4AI3A 4HT1T 5LBEA 3WUCA 1FOD1 4EV0A 5FP7A 4GWIA 3MDPA 4XJUA 2XJRA 4Q0QA 5EWSA 3MICA 1FOD2 1WW4A 4YLZA 3RWNA 3M7AA 1A3KA 3D8CA 3TWIA 1WCDJ 4ASLA 1UMHA 1NZCA 2J7MA 2GH2A 4N7IA 1WA4A 2D6MA 5D1IA 1E57A 4YGDA 2A75A 5GZDA 4FOVA 3WR0A 3ZSKA 4AXOA 2NLRA 2WS91 4RN5A 4N7UA 3AJZA 1YXWA 3VLBB 1W8OA 1UWWA 4IV3C 3VD4A 1LHUA 2YZ4A 4Q0SA 1AYN1 1COV2 5EJZB 2QDRA 1UD1A 3PTYA 1S2KA 4CDXC 2WQ8A 4AWDA 4LBQB 3IWZA 3KM5A 1M4WA 3CKHA 1UMZA 4M4PA 4A6OA 2QDNA 3N7MA 4QXCA 4BXFA 1SZBA 1SBEA 4YVWC 1XNBA 2I2SA 5CKNA 2RS13 5HXMA 1TQ5A 3CEWA 3PVBB 2ZJCA 3WF0A 1AX1A 1UQXA 5FYSA 2WFF3 2B9UA 2ET1A 4JQRA 5CFCC 1WUVA 1G7YA 3OY8B 1MEC1 2NZ9A 4TWTA 5KC6A 2RV9A 5K9YA 1QIQA 2I07B 4IEWA 1XNAA 3GCXA 1KFXL 1UX7A 3U07A 4L92A 3AMNA 1GWKA 4OUEA 2WC2A 1QEXA 2K46A 4CDUB 4RS5A 5B4NA 1QWRA 3MIBA 1O3QA 1AR83 1J3PA 3G7DA 1VBE3 3C7OA 2RR12 3BOWA 5H9PA 1N3QA 4XHXA 4LO5B 4WVMB 1BQPA 3I54A 4NRMA 5H9SA 1SLIA 3G6JB 3ZN5A 2VMGA 3ZFGB 2IFWA 2OQ7A 2JG9A 2UY8A 5F3EA 3U75A 1V6JA 3D3AA 3JBG3 3CJXA 4LBMA 4QDSA 3DGTA 1GICA 2QQWA 2HBTA 2WNOA 4Y1UA 1A34A 4LPLA 4HSJA 5C8CB 1LB2A 4YW7A 4NRQA 1D0GA 2YMZA 3POYA 1W3VA 3UJQA 3D4KA 2QUOA 2Q1ZB 2W3JA 4KI5M 1ASJ3 5JOWA 1JYTA 1OH4A 1YIFA 1EUUA 4LO4B 1PMIA 5LBBA 1S0FA 4JDNA 3OGJA 3AP5A 3U10A 4E2QA 5A3UA 4K1YA 1AHSA 2P3KA 5DUWA 4YG0A 3JCIA 3WP4A 1R1A3 4AYUA 2Z4FA 3OF1A 4FOWA 4AE2A 4HXCA 4PBOA 3O7OA 3CBNA 1UO9A 4XJWA 4RGAA 3N9LA 3WDTA 2J1VA 3Q8CA 5ACA1 2G19A 2KXLA 4P9IA 4W4ZA 5AFBA 4XACA 4O7XA 1S4CA 4B4PA 2B39A 4ZU4A 4BZ4A 1DGWX 4MHUA 1NY71 2CYFA 3BU7A 3V0BA 1WMFA 4Q0VA 4HN1A 5JDBA 3WW4A 2JKBA 1CQ9A 1Y9MA 4OMCA 5BY5A 1SHWB 4AR2A 1KD7A 2JDMA 2WWUA 3MIFA 4RQPA 1PO12 4CP1A 1RUH2 1VAMA 1GQPA 1OF4A 1SBFA 3O0XA 5A7QA 1RUJ2 4A42A 4DOUA 3I3DA 3TBDA 2WS93 4K21A 1Q8QA 3THCA 4JGYB 4ES9A 1XOYA 3DXTA 1R093 2LROA 5BNPB 3WNXA 2D3PA 4BQYA 4RS5C 3ZFEC 4BYYA 1DBNA 5HI0A 3N7JA 1CZTA 5F5AA 4B7EA 4XFHA 4ZU5A 5BNPA 5JMCA 1Y9GA 1EPZA 1H1IA 4HFSA 5FXWA 4K1ZA 4XUNA 4LO8A 2VQUA 3MW3A 4JHTA 3K3OA 3PMSA 5GLZA 4DMIA 1W04A 2RM21 5J48A 2WO2A 3OGSA 3TEZA 1L3JA 2FBEA 2JDUA 3ZYIB 4LLOA 2CTVA 1JW6A 1WCUA 5SV5A 4YG3A 4JX0A 2VUDA 1BVP1 5LY2A 1OI6A 5DUUA 3SXWA 4COYA 1YJLA 1ACCA 4HVRA 2VVFA 1KXGA 4O9EA 4OUSA 4XJZA 2IXCA 5T52A 4AK3A 4BCUA 5KXEA 2QQUA 3BU0A 4N53A 3HR9A 3GYDA 5EXOA 2D5FA 1W6OB 3OGVA 5T3NA 1S0JA 1ZBE2 1TVGA 2AR6A 3OUHA 4LMFA 1LCLA 3QD6A 5BPXA 1GP4A 1FYUA 3MIEA 1OOPA 3GXUA 3FLTA 2WNEA 4Q4W1 3F95A 5I8TA 4YZ5A 4DRRA 4HONA 3IIAA 1RUJ3 3NL1A 2P3JA 4ZONA 2GMEA 4XUQA 2W95A 4BQ5A 4XF1A 4E8CA 4PQ9A 4OHXA 1AJKA 1YQ8A 3B93A 5FP3A 2BP6A 3ILFA 4J25A 2XMLA 4CA9A 4RGKA 2Z79A 1BKZA 1G9FA 4IE6A 4L2NA 3TNQA 5JI9A 1HN0A 3OPTA 4FXKB 5IK7A 3ZSJA 1NQJA 4H55A 4HETA 1QJX2 1ULOA 1AL22 3IDAA 2BBVA 3N35A 3WOGA 5JXIA 2HWE2 2O0OA 2YB7A 4YW5A 1N1YA 1ZRRA 4BDVB 3H50A 3DPRB 4XIOA 5D2AA 3UT0A 3B9CA 3K4ZA 2BU9A 4BK4A 5FLHA 2JB4A 1OLME 4LOSA 3AZXA 4AQTA 4TLFA 3T30A 2V4AA 1Y7BA 1AR61 3WT3A 3C7HA 1VJ2A 4CDQC 2W08A 3POJA 4QPGC 2OKXA 2DCTA 4IV3A 3WG3A 2BDRA 2XWBB 1AR62 1FV2A 1HRI2 1GOGA 1WMEA 1PK6C 3LSEA 2WWJA 3ES1A 3M2MA 5FBJA 2D98A 4IGQA 4LBLA 3NV3A 2P2KA 4XTMA 5LASA 1OVPA 1TE1B 4EWDA 1BCXA 3B9IA 3USSA 1DQ2A 4ZZ5A 1AL21 4OI2A
chains in the Genus database with same CATH topology
3AFGA 4PIZA 4OZXA 5J37A 5GZEA 4NWWA 4LBQA 3VZOA 5JPMB 1YHFA 1SDWA 1RMU2 4D3WA 1DG6A 2YHJA 4AHZA 1JYCA 4CEWC 1IHMA 3ZSLA 1GQHA 3A0NA 5JLVA 5BNOA 2E51A 1LHOA 4WVMA 3AXDA 4BH9A 2H6CA 1PGL2 4KNCA 1CAVA 1ZVFA 1UU4A 2RHPA 3WP6A 1ZBE1 1RUI1 4NHKA 1YFWA 4Q4W3 3SH5A 4E4DX 5H9QA 3VKOA 5IK5A 5IK4A 5TSWA 5JOYA 1BEV1 4BM8A 2XLGA 4R52A 2XWJB 1MZEA 1WLTA 4E4SA 3R4SA 3IT8A 1SBDA 4YW2A 4FP2A 2D6NA 2DCYA 4EN8B 1FXZA 4M01A 4XJ9A 2R071 1HRI3 1OMIA 1QJY3 1SLLA 3M3IA 2PELA 3GZAA 4AFDA 4PDWC 5BXXA 4UW6A 5ABJB 2YC0A 1NCRC 3MW4A 4FPJA 3ASIA 2BWAA 1W6OA 3RJRA 3O0WA 2Y38A 2R49A 2VUJA 3MLLA 4XIKA 1JN2P 2R1DA 2WSVA 1CAVB 1S0GA 3A4UA 2VOXA 4R9AA 4QQLA 4Z2WA 1H2MA 1X8EA 3WCSA 1O5UA 2WLPA 3LA2A 2R063 2ZGQA 2PHXA 3AZZA 1QOOA 4C0BA 1AR81 3CLPA 1I6XA 1ZX5A 4AFBA 1PK6A 4ZXKA 1LGNA 2GH8A 4PDWA 1V6IA 1DYPA 1RUI2 2WFF2 3RJ2X 4E4ZA 1ENQA 1LHNA 4BIFA 2VU9A 1FV3A 3RSJA 4X6RB 1APNA 5CNAA 2QNKA 4XMIA 3POWA 1H4HA 1BK1A 1LGBA 5GZGA 1V6MA 1H8TB 5DUVA 4NOTA 4P14A 3VBOA 5BNNA 3O12A 5C8CC 4A3XA 5IK8A 1W39A 2NQYA 1CN1A 2JX9A 3AB0A 3MYXA 4M0NA 2NN8A 4NPRA 5A33A 3LA7A 4UBHA 2OPKA 3VZJA 1DGRN 3MLJA 2ZKLA 2JECA 4BHPA 1DU3D 2BNNA 3H0OA 4K3UA 1LOEA 3OYWB 1I5ZA 1O4YA 2VG9A 2ARXA 3HQXA 1XU1A 1R092 1NCQB 4XOGA 2WSUA 3LKJA 3OYWA 2D44A 4LBOA 5T5PA 3N4MA 1GNHA 4JDOA 3WCRA 1IOAA 4Q4Y3 4W65A 1MQTC 5K9YA 1NQDA 1D2QA 3OD0A 1C57A 2OUHA 2ZX3A 2VUAA 4U2AA 3J8F2 4R4ZA 3P3NA 1FATA 1AL0G 4LHKA 4WZCA 4AGVA 5BNNB 3OD4A 1PO22 1R082 4Q4X3 1IZ3A 4DY5A 5KHIA 3VBRA 1QDOA 2A73B 1MEC3 1KS5A 3BCWA 3D0SA 4P9LA 4PJYA 1RHI3 5CVRA 4FOYA 3JB4C 1D4VB 3RMYA 1WLWA 2A6WA 1QJU2 4HVOA 2Z5WA 4XDQA 3BB6A 3H1WA 4Y20B 4YVWB 1JYIA 1VBE1 3ES4A 3OTFA 2RM22 2Q1MA 1QJY1 3HBZA 2B8MA 4I01A 1ZZBA 1AXKA 3GHMA 1ASJ2 4KWLA 3AKRA 5KC5A 1LKNA 3NVCA 4N43B 1YRZA 4EN0A 4I3PA 5I93A 4CDUC 5J3UA 3I59B 3RYKA 1C28A 1DGLA 4JDMA 3D82A 2OZJA 2ZHKA 5K0UB 1AR71 4BPZA 4AFCA 1CJDA 4E2GA 1NY72 5EYYA 2VMHA 3TRSB 1Q8OA 2BYVE 2CL2A 4KWJA 3THTA 5KXDA 1J3QA 4RSUA 1WMDA 4GXLA 2PN5A 2NMOA 1EAH2 2A7AA 3DKWA 5FAXA 1EAH3 1S0CA 2R041 4QM9A 2RS12 4LHNA 5CG8A 1YLLA 5A3MA 2DUPA 1BYHA 1REFA 2D40A 2WL1A 2XLFA 1H8VA 3NV2A 3M8LA 5C6CA 2VXRA 2DUOA 5DZFA 4XFBA 2WA3A 2XBO3 2B46X 5K7PA 1ZBA1 4RHV1 4LO7A 1W2UA 3D6EA 1LU1A 3R6SA 1JHNA 4J1WA 5EFUA 1HDKA 2E9QA 2UWBA 4QMAA 2GMMA 1YIPA 2NMNA 5FO9B 4I02A 5D8AC 3ZSEA 2K9ZA 1OPMA 1AF9A 1LOFA 4HK8A 5JVVA 4AGRA 3H8UA 3FX3A 2W68A 1QQP1 1H0BA 1Z7S1 2JE9A 1J3RA 4KGQA 4DZGA 1VRH3 2HWB3 4W6YA 4Q4Y2 1H30A 3J9SA 1GZCA 3HWJA 3WUDA 1VBB1 3OY8A 4QPIA 1DIWA 2G4IA 1RL3A 4QQOA 2XL7A 3ZIWA 3UKTA 3VBFB 2D93A 2HEWF 3BPZA 4F8AA 5AFEA 3NWKA 1QJX3 1RUE3 2QVSB 3GBGA 4IERA 3WG2A 4M3CB 5KHKA 3R4UA 1SACA 1G9DA 3E6CC 3ME2A 1LOAA 1HW5A 3SH3A 3KCCA 1YYNA 4C1XA 1NE4A 4Q4Y1 1MACA 2RS51 3KGLA 3O5SA 1QQP2 1Z7S2 4R9DA 3AKSA 3VBSC 2D43A 1A6CA 1GANA 1ND2A 1ND3C 1TNRA 1V6NA 2HWC3 4QU2A 4AVBA 2OA2A 4K9SA 4CDXA 4R8HA 2XPJA 1HRV2 4Q8KA 4B8EA 1GV9A 2Z2SB 2BQPA 3DPRC 3VDDA 2DVFA 3ZN6A 2DYCA 4M3CE 2D5HA 3MPPG 4AW7A 3RYPA 5FCCA 1XYPA 2VW0A 5FO7B 4RHV2 3E5QA 2NM1A 3DL3A 3AKQA 5FPZA 4YYOA 1C8M3 4MGZE 1UPSA 2ATFA 4DFSA 5JOZA 5EZWA 5T55A 1VIWB 2DF7A 1AUYA 3PMEA 2FMYA 4COWA 1CGPA 1R1A2 1Q43A 2A3WA 4HZFA 2DCJA 2MEV2 2ZGSA 1X33A 3WQ1A 1ENRA 2ES3A 3KCYA 4JC1A 2R062 1ASJ1 3AYDA 2R0FA 1OQDA 3FZ3A 2ZAAA 2X8KA 2VVDA 3R4DB 4COVA 2XVKA 1TMF1 4IEXA 5FMOL 4L11A 1VALA 5CFDA 3JBG2 3X29B 3FC0A 2PTMA 2ZABA 5FQ0B 4CDQA 2AENA 4JGZB 1ZRFA 2GNBA 5C4WB 4NO4A 4XXPA 5DUXA 5I91A 1VR3A 1LTEA 3MLKA 1NCQC 4I09A 5GLVA 3AMPA 4N90A 4GKYA 2G9GA 3CO2A 3GBFA 1AYM3 3PJYA 1HXS1 4FAHA 3LOBA 1V00A 2XVGA 4S2FA 1FPN3 1RMU3 3ZFEB 1PZ8A 1WW7A 2SLIA 2XVLA 3S7EA 2O8OA 5IUQA 3IBMA 1RVF3 1GFF2 1OKQA 1PNGA 1A78A 4OULA 3QACA 1MQTA 1S0DA 2ZHMA 2WT1A 4DQAA 5JSOA 1MZ5A 1WD3A 4XQWA 3WW3A 2PFWA 3LCPA 4QPYA 2DVDA 3ZFFB 5ABJC 1EPWA 1FPN2 5E89A 5T50A 4HK9A 2VPVA 1ZBA2 1CR7A 1GZWA 1QOSA 2ERFA 1KDMA 3GHNA 1J1TA 4GIQA 4IV1A 4F83A 5A32B 2A70A 1WLCA 1G86A 3APBA 4UW5A 4XF9A 1QXJA 4N43C 2SBAA 2YDEA 2JEMA 4RR3A 4GULA 2P3IA 1UZYA 4IQPA 4NHLA 2X29A 1O7FA 1UKRA 2WNVB 2XJUA 4AI8A 2HJIA 1EAH1 4PLOA 3RI8A 4CEYA 3RG0A 2CWMA 3WDVA 4XILA 3FJSA 4AEMA 2IC1A 3IDBB 5K0UC 1AX2A 1GLHA 3AKTA 5JR7B 4Z8BA 1UIJA 2V09A 1OFSA 4BQ1A 2EXHA 3GBWA 1VAVA 5LK5A 4FSJA 1ZZ7A 1H8TC 3VZLA 2Y0OA 4B4RA 5E8AA 1CJPA 4IV1C 3ZXKA 1RUE2 3VUOA 2JXAA 1QJU3 2ZGKA 1RTVA 2ZGOA 1PNFA 1ULDA 1S0EA 1WGPA 3AXEA 5LRRA 4AF9A 1ZM1A 3D5OA 1MZ6A 1PK6B 4MYEA 2EA7A 3USUA 4DPNA 5CFCA 3VZKA 1LGCA 2IFRA 2ZMKA 3VBUC 2LTNA 3FHIB 4XTPA 4TYSA 1U5XA 2B42B 1IS6A 1UAIA 5CIRA 1NCQA 4OUMA 1ND2B 4YNIA 2JJ6A 2ILMA 1DDLA 3FWEA 4AQ2A 1VBC3 3PJQA 3N36A 4K6BA 1YUDA 4XFAA 1QHDA 2XBO2 4LUMA 5E1RA 4SBVA 1FPN1 4GH4B 1XXNA 4Z07A 1UF2C 2O1QA 4XPVA 1ONAA 4P9XA 1ENSA 1ZRDA 2Q0AA 3JUUA 2R043 1FAYA 4GB31 4NR1A 3M3OA 4AVVA 4FBFA 2DFCA 2TUNA 1JBCA 4QXKA 2A3XA 4ISRA 3T1LA 3B94A 4WM8A 1RVF2 1W6NB 1R091 1MS0A 2XG3A 1QXRA 4RQPB 4A7YA 4FO9A 1GYKA 1UIKA 3TAYA 4YZ2A 3R05A 2Q8OA 1OA2A 1CONA 1UZZA 2EIGA 2PAMA 4FXGB 3WXPA 5A33B 1BJQA 3V0BB 1PO21 1CAWA 1GBGA 1LEDA 1R081 2EF6A 4S2HA 3NKTA 4D7TA 1HQWA 3RYRA 1GZ9A 4E9KA 2DCZA 3AYCA 2HWF1 1V6OA 3ATGA 5I0UA 2CV6A 1BBT2 1OSGA 3RQ0A 1TME3 2VVEA 3USUB 3M3CA 3ZIXA 5FBZA 1KS4A 4MGKE 4C90A 4KG8A 1GKBA 4ONUA 3WW1A 1QNYA 1CAXB 3ILRA 1AXZA 1S0IA 4C1WA 1JH5A 3FLPA 4AI1A 4E27A 1Y43B 5LEJA 1C8M1 2X5IC 3D0JA 2DFBA 1WBLA 3WDWA 1VBA1 4LEJA 2W52A 4OFGA 5A3LA 3EBRA 1W6MA 2YV8A 5BYNA 4O9GA 5IT6A 2DV9A 3AYAA 4V1PA 1D2SA 4IEZA 4CDUA 1UU6A 3ZXEA 1WW5A 2PHLA 2HWF2 2PAKA 4XHBA 2ZA9A 4Q4W2 2YY1A 4GQ7A 4YVSB 4YFWA 2D3SA 1JUHA 3TN92 4FT8A 5GLWA 2ZZJA 1MVQA 3HMYA 2CAVA 3M3QA 3ZFEA 3EHKA 4QGMA 3GNEA 1ZZ8A 3FMGA 4IETA 4XEZA 3WLUA 2TEPA 2NPIA 3QLQA 3C3VA 4Y22A 5A32A 4N53C 1VBC2 2BW8A 3GZUC 5T5OA 3VHPA 1PM7A 1QU0A 5FRAA 3FUQA 2P34A 4Q4V1 3MF9A 4Q0PA 1IKPA 5GZCA 2ZCWA 3I59A 1CPMA 2YGMA 2VOWA 1LOBA 1NXMA 1YWKA 4A7ZA 3WQ0A 1UPIA 3H7JA 4YG6A 3KT7A 4LE4A 1SQ4A 2IXJA 1VBB3 4Q2FA 3JZVA 2OZ6A 5C4WC 2PHUA 2FHRA 3KS7A 3HT2A 1O4ZA 1A8MA 5JI7A 1F8VA 3VN4A 1H1MA 4R9CA 2PHWA 3LZZA 2Y26A 2JDZA 3ZVXA 3ZYJB 1LJ7A 3E6BA 5FLIA 1RUI3 1XNCA 2RJKA 4KU7A 1H1AA 1FX5A 1LOFC 2EAAA 1LRHA 2RMU3 2ETEA 2VH9A 3VBSB 3JD72 3E6DA 4FP3A 2YGLA 3QH7A 2LM3A 3WDUA 2CGPA 3MI8A 3T1MA 1HQNA 1A8DA 3JD73 2RJLA 3B5LB 1WW6A 3NW4A 3ZFFA 4AVSA 1YI7A 2Q4SA 3BOPA 4FPKA 1IPJA 3VL8A 4Q29A 4CEWA 4ITCA 3IPVA 4IV3B 4FVVA 2ZACA 2GC2A 1PVC2 2AGSA 5CU1A 1W6QB 4IEVA 4WZFA 2ZX4A 1CD3G 1LESA 2BVVA 2EVXA 4GB33 4K7JA 1VLNA 2XJVA 4CEYC 1DGWA 4MH0E 4DRVA 3W9AA 1ZZCA 2RR11 1RITA 1OLRA 3EQEA 1IGOA 3TNPB 2E63A 5J09A 4YW1A 3WVJA 3IMNA 2A71A 3FBMA 1V9U1 3KSCA 4B7KA 2UYAA 2WINB 5JCTA 2P37A 2E7QA 3ZPYA 3ZXFA 3LOIA 1R1ZA 4Q27A 4I0BA 3MPBA 3MIDA 3ETQA 2C5DA 4QPIB 2HWD3 4FPGA 1AXYA 2VW1A 3RPQA 1C8NA 2DWRA 2TNFA 2D97A 2OYZA 1C4RA 4GMP3 1PO13 5JZGB 1AR72 2RS33 5T5JA 2D6OX 5FOBB 2D6LX 4COUA 1RIRA 5HCAA 2XKPA 2ZAHA 3SHRA 3TN93 5CADA 5FO8B 4PLMA 3IKWA 4DB5A 3EO6A 1B35A 4RA0A 4M3CA 2WZR2 3E5XA 1IQAA 4KU8A 4XMAA 3WDXA 4LULA 2MEV1 1KQRA 2WZR1 3IDCB 3ZYRA 5C8WA 1CESA 3MIHA 4G9SB 1QJY2 1AZDA 3NSTA 4MSVA 2JE7A 1RUH1 3P3PA 4Q4X1 3VZNA 2BFUL 1AR63 1CAUA 1DQ5A 1YJKA 4QHBA 2RM23 5FOJB 1PGW2 1PGW1 4YW4A 3VHNA 1W6QA 1SMVA 4GH4C 2XJTA 1RJ7A 4LE3A 1MS8A 3FBYA 2WKKA 1QOTA 3CJIB 5ACA3 4EJRA 1CVNA 4RD7A 1W6MB 2IXIA 2VY0A 3MF6A 4I0AA 3SMHA 3IDEA 2E7TA 1R1A1 1AR73 1RUJ1 2B5HA 2ZBJA 4Y22B 3ZO0B 2XJSA 2QE3A 4Y1VA 5B2GB 4QQ2A 1QH7A 1OA3A 2HKXA 3AP9A 5JSRA 2F6BA 2KA3A 2QZ3A 3GALA 1NE6A 5C9AC 2RS52 4SLIA 3HIFA 3J4UH 4FQ4A 1HX6A 4IV1B 4MUVA 2XKOA 4D7YA 5BV6A 2EAKA 4CP2A 5GKAC 3LA3A 1O5LA 1FMD1 3ACLA 4LT5A 2IXHA 1RUG3 1QXPA 3CJIA 4XETA 5GLUA 2WZPP 4JV4A 1NA1C 1COV3 2JENA 1DGRA 5JOXA 1C1FA 5J36A 3WHTA 5HCFA 2X5IB 1RUF2 3VBUB 4FPLA 3CU7A 1POV3 4FCAA 5FPXA 1MS5A 1CA