3VKOA

Galectin-8 n-terminal domain in complex with sialyllactosamine
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
147
structure length
147
Chain Sequence
NLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Galectin-8
publication title X-ray structure of a protease-resistant mutant form of human galectin-8 with two carbohydrate recognition domains
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 147
sequence length 147
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3vkoA00
3IM0A 2A3YA 1LGNA 2P3JA 2OUJA 4PF5A 4Q1RA 5EWSA 1A3KA 3C2UA 4Q8LA 2E51A 4UW4A 4XJWA 2B7YA 2NN8A 3OY8A 2AUYA 5GLTA 4AGVA 3WHTA 3GALA 4R9CA 4DPNA 1S0JA 3KM5A 1ENSA 2LALA 3DGTA 3O0XA 1ONAA 2ZGUA 5DUXA 1W6MA 4LBNA 3D6EA 2WKKA 4LBQA 4FOYA 4YLZA 1GNHA 2YV8A 2GNMA 5H9SA 3AP4A 1C57A 2D6MA 3HMYA 1WD3A 5JVVA 4XIKA 4ISQA 4BOWA 3ZXEA 1DQ2A 4XTPA 1MACA 4FQZA 1MS3A 2P2KA 3D5OA 2D43A 3ZPYA 4CTEA 4M01A 1KRIA 3RQ0A 1V00A 3WDTA 4YGBA 3UL2A 1EPWA 4RL7A 1AJKA 1WW5A 2I2SA 2A5ZA 2W68A 3AXDA 4Y1XA 3T1MA 2NP0A 2GNDA 1SCRA 4YW1A 3ZXKA 1LTEA 1UAIA 1UZZA 1ENRA 4C1WA 1GV9A 4UW5A 4XHBA 1OQ1A 3NV3A 1U0AA 3QCWA 4TZDA 3T2TA 3NV1A 2DVFA 4YG0A 4AGRA 3R05A 4DQAA 3OJBA 1WLDA 5T5PA 3SH5A 1W6PB 2NZ9A 3M1HA 4LBJA 4FP3A 5DZEA 3L2YA 5EYXA 2ENRA 2EXJA 3ZXJA 4Y22A 4CZSA 3JUUA 3RMYA 3B9CA 3B01A 4WVWA 3WUDA 3PVEA 1N47A 2ZGNA 1WBLA 2C5DA 2WT1A 3WDXA 1AZDA 1N3OA 3RS6A 5E88A 3V64A 1GSLA 4K1ZA 2D3RA 5GLUA 3A0KA 1V6IA 3R4UA 4ZKTB 3RSJA 4XMIA 1CJPA 1H9PA 1JOJA 4LBKA 4LBOA 1YO8A 4P9WA 1Q8QA 4YZ2A 1G9AA 5HCBA 1YI7A 1JN2P 3WZ1A 3OBTA 1IS5A 4FPOB 4ATEA 3OYWB 4Q1PA 1SLBA 4AWDA 1IKQA 3SNMA 1MS1A 1SLTA 1MZ5A 4CRQA 1VAVA 2P37A 2OW4A 2GMEA 2GALA 1CVNA 2D6NA 4Q26A 4YG6A 1IKPA 4L8QA 4F83A 5JLVA 1N3QA 1BQPA 2FHRA 5CNAA 2A6VA 2E53A 5IK8A 3AYEA 1QDCA 5H9RA 1UMZA 1YIFA 2CYFA 2NMNA 2DU1A 1IS4A 4YZ4A 4Y20A 2KM2A 1DFQA 2EF6A 2E7QA 4GA9A 5GLZA 5T54A 2ZMLA 2A6WA 3PVNA 2P3IA 2A7AA 1G86A 1C1LA 5GALA 3VV1A 3KQRA 2A6XA 2ZA9A 1ZM1A 5LK5A 3W59A 1MS9A 3UK9A 1WCSA 1IS6A 3I8TA 4XDQA 3AZZA 2ZGKA 5DG2A 3D4KA 3ILFA 1VLNA 4YW3A 3RMXA 2ZAAA 3WLUA 1BKZA 4BPZA 4PBPA 4BQ1A 2AYHA 5KXCA 3LCPA 4UW6A 1YXWA 2DURA 1Z78A 1OFSA 5F5QA 3AP6A 1OKQA 4WVVA 1F9KA 5CA6A 2GNBA 2C9AA 3TB0A 4H55A 3OYWA 5E8AA 3VKOA 3O0VA 2W39A 1ENQA 5DZGA 3UJQA 3NV2A 1G9BA 2ARXA 3AP5A 1AXKA 1KJRA 2EXIA 1RIRA 4XHXA 5GZFA 3WV6A 3IN9A 5HCAA 4WZFA 1JYCA 1MS4A 4FPYA 4LBLA 1GZCA 1HDKA 2W08A 3M3EA 1FAYA 1LOEA 2CWMA 5KXBA 1VALA 4YW4A 1LU2A 1ULCA 1LHVA 1LEDA 4FPLA 1W0OA 2FMDA 1W6QA 4DFSA 1FV2A 5GZDA 4R9AA 5JOXA 2GMPA 1N1VA 1V6LA 4GWNA 5GM0A 5CB7A 3WG3A 3POYA 2VH9A 1V6OA 3RG0A 1S0FA 1O4ZA 2DV9A 1I3HA 3N35A 3A4UA 4SLIA 5T5JA 4Q8KA 2CWSA 1MZ6A 4OZXA 1LHUA 3UJOA 3ZSLA 2YMZA 2YZ4A 1CONA 1SBEA 1SLLA 2WLQA 2WNEA 4R9DA 4D69A 1ULEA 3N36A 1AF9A 1ULFA 3USUB 2AR6A 4YZ3A 3FUQA 2PHUA 1SCSA 1V6KA 1UKGA 4GWMA 2R16A 4XIOA 4YGEA 2AGSA 4BLIA 5KXDA 1Q8PA 5E89A 4HANA 4GALA 4XZPA 4GXLA 3M3OA 2TEPA 5IK7A 1N1YA 3BTAA 1GZ9A 3IPVB 3ATGA 2XG3A 1VIWB 2UWAA 3V0AB 1WBFA 2UURA 3WG2A 4AVSA 1LCLA 1FX5A 1GZWA 1URXA 1DQ1A 3AYAA 2ARBA 3I4IA 3V0BB 3AJZA 1G8WA 3IMNA 4JCKA 5DG1A 2ZMKA 2ZHLA 3ZSJA 4M3CE 2NM1A 3ZXLA 1CQ9A 2ZGLA 1D0HA 3INAA 1PZ7A 4MYEA 2ES3A 3GNEA 1LU1A 1S0EA 1TEIA 1SLIA 1C1FA 2ZGRA 1GBGA 2CNAA 1BXHA 1PZ8A 2ZBJA 2OVUA 3N3HA 4PQ9A 1LJ7A 5DUVA 1BYHA 3TAYA 2JE9A 4XXAA 3ZYPA 1JUIA 1JHNA 1QF3A 4BLJA 2PHWA 4FOQA 3Q9OA 4LBQD 3SH3A 4YM1A 4YG3A 2EXKA 3U4XA 3N7LA 1WW4A 2ZGOA 3WNXA 1DLLA 4XJ9A 2DUQA 2R1BA 3O12A 4Q2FA 4JC1A 5IUQA 4AGGA 1H9WA 1MS5A 1WW7A 3FUOA 1G9CA 2SBAA 4FQ4A 3WG1A 1KJLA 5BYNA 1O4YA 2VY0A 2R49A 3MW4A 3USUA 2DU0A 2DTWA 2E6VA 1DYPA 4M00A 4K1YA 1LOCA 5FRAA 3IKWA 4Y1YA 3SISA 4UW3A 3APBA 1W0PA 3MPPG 2YY1A 5JOZA 3MEPA 2RHPA 3DUIA 4XBLA 4PBOA 4BM8A 4XJUA 5JOWA 2R0HA 3WDVA 3H0OA 1I1EA 2WT2A 3ASIA 4U36A 3M3CA 1W6PA 4ITCA 2PHRA 4YFWA 1S0DA 1AX1A 4DS0A 2UWCA 3V0AA 3AFKA 3ZYRA 2AH2A 2OUHA 2WT0A 2DTYA 5DZFA 1V6NA 2ZZJA 1J1TA 1DZQA 3V0BA 2WQZC 1S0IA 3WDYA 4C1XA 1WUVA 2PHFA 1KQRA 2Z42A 1AX0A 4DRRA 1JBCA 1HQWA 2ZABA 2ZGPA 5DXDA 1V6JA 2CL2A 2CTVA 5T50A 2WJSA 1Q8OA 3O5SA 4P9YA 4IQPA 4K20A 1LGBA 2JKBA 2VUAA 1N1SA 1LECA 1YYNA 3POSA 4XTMA 3V65A 4YW2A 3VKNA 3ZSMA 4XJZA 5T52A 2AREA 1CR7A 4ATFA 1IS3A 4XXPA 4AVVA 2ZKNA 1Z0HA 4YGCA 3SITA 4YZ5A 4Q27A 1GANA 2H0BA 4BMBA 1BZWA 1W6NB 3LSDA 3AZXA 1W6OB 5FREA 3VKLA 5GLVA 2GN7A 4ASMB 2A75A 4ZXKA 3AX4A 3VUOA 3CNAA 1D2SA 1WLCA 5CBLA 4GKYA 1QNWA 3AYCA 5IK4A 1AXYA 1RINA 1WD4A 1IOAA 1GICA 2GN3A 1FNZA 3MW3A 4NOTA 2ZHNA 4Y1VA 4FPCA 1CESA 4Y22B 3M3QA 2ZGSA 5GJ6A 1KITA 3R4SA 1UZYA 2JDZA 3MW2A 3LSEA 3ZXFA 5CAZA 4W65A 5GZCA 1BJQA 3BODA 2R0FA 3FLRA 3PMEA 4TYSA 1LOFC 1QOTA 2ZGQA 1NLSA 5EYYA 1PZ9A 4XBQA 1CIWA 4YM0A 1AJOA 1ULGA 1UX6A 1MS8A 1R1ZA 1N3PA 2PHXA 3N7JA 5GZGA 2D6KA 4FVVA 1HQLA 1JW6A 4M3CB 4NO4A 4Y1UA 2DVGA 2R1DA 2UWBA 1UN1A 2JE7A 2WSVA 3SLIA 1UL9A 1Y7BA 3ILRA 2VW1A 2D44A 1LULA 4XOGA 1S0GA 3ILNA 3HR9A 4DRVA 2DUPA 3B69A 1QNYA 4Y24A 1DQ4A 4FPJA 2JD4A 2JECA 5IK5A 1MR5A 5JDBA 4XBNA 3WHUA 2DVAA 5L73A 2VW2A 4YFZA 1GYKA 4BMEA 4R9BA 1A8DA 1G9FA 4AVTA 4XMAA 2ZGMA 1FYUA 2A6ZA 1AX2A 1FATA 2HYKA 2NYYA 1JXNA 1W6NA 3VKMA 1SBDA 1W6OA 2P34A 3N7KA 1UPSA 1FV3A 4XE9A 4HL0A 3AZWA 2EAKA 4YW5A 5GZEA 2XB6C 4Y20B 1LHOA 1F5FA 5GLWA 2DUOA 1QU0A 3FBYA 1LGCA 4Y26A 2JJ6A 1S0BA 1S1AA 1DHKB 1V6MA 2YROA 4KBBA 5HCFA 3OBRA 4YGDA 1DQ6A 3OGGA 2PHTA 2DYCA 4ISRA 3RRDA 3WUCA 5JMCA 1Q8VA 1WLWA 1LESA 1GLHA 2D7FA 2VU9A 5DUWA 4P14A 1SFYA 2D3SA 1MVQA 2VXRA 4FPEA 3WG4A 5IT6A 4LBMA 2ERFA 4WV8A 1AVBA 1NXD1 2EIGA 1CPMA 1LHNA 2P3KA 4FPFA 2V73A 1CN1A 3W58A 1F31A 2AENA 5SV8A 3JU9A 1SLCA 3AYDA 1MVEA 1FNYA 1H30A 3BOPA 2DWRA 1YRZA 4M3CA 3WVJA 1DBNA 3FFZA 3O0WA 1QGLA 2A3XA 2GMMA 1GZWB 2LTNA 4FP2A 4M3CF 5H9PA 3VKFC 2WSUA 2G4IA 2ZGTA 2EXHA 1APNA 1DQ5A 3FLTA 1LOBA 4P9XA 1Q56A 1JYIA 1B09A 4JRAA 1HLCA 4FOWA 4Z8BA 3PJQA 1LOFA 1QOSA 3AK0A 2NMOA 2EALA 3IPVA 3QLQA 1KDKA 5T5LA 2D6LX 2A71A 2GDFA 2SLIA 1VAMA 1DGLA 3OY8B 2A70A 3WCRA 1LODA 4FPKA 2D6OX 3M2MA 3OPZA 1W6MB 4YM2A 4YZ1A 4LBQB 1DIWA 2D3PA 1KDMA 3ENRA 3N7MA 4YM3A 1W6QB 2A3WA 4FOVA 3ZSKA 1GNZA 1X50A 3AP9A 4FPGA 4I30A 5DUUA 1LEMA 1QMJA 5KXEA 1N1TA 2PELA 2BQPA 1AXZA 1LOGA 1SBFA 2Q5TA 3ZVXA 1LENA 1QDOA 4U2AA 2ZACA 2A6YA 3WDWA 5F9TA 1G9DA 3SH4A 1LHWA 1ULDA 5T55A 1Q8SA 2ZMNA 3AJYA 1RITA 2CY6A 4FPHA 4AYUA 4XJAA 1LOAA 3WDUA 1SACA 2DVBA 3AZVA 3B3QE 4RA0A 1XQNA 1G7YA 3WCSA 3FLPA 2YXSA 2V5YA 4K21A 1MS0A 4Y1ZA 1QOOA 1WW6A 1HKDA 5EXOA 5AVAA 3POWA 1SLAA 1QKQA 2UU8A 4PCRA 1A78A 2W52A 4GKXA 2GNTA 1DQ0A 1CPNA 1GKBA 2E7TA 2D6PA 3AZYA 3BIWE 5T5OA 4XILA 3WOGA 5JOYA 3AXEA 3B00A 3NV4A 4XYXA 1C4RA 1ZA4A 2ZHKA 3HN1A 3PVOA 1DYKA 4XJ8A 3T1LA 5H9QA 3NWKA 2DVDA 3A0NA 1S0CA 3AP7A 2VW0A 2ZHMA
chains in the Genus database with same CATH superfamily
1TME2 3RDIA 4EJRA 1NE6A 3JQXA 4GJZA 1RUE3 1UU4A 2XKOA 4RS5B 3WW1A 1S2KA 5FZ9A 2P3JA 5LRSA 2ILMA 1HRI3 5K0UB 1E57A 4XJWA 2E51A 2AUYA 3ZFEC 3WHTA 1YQCA 1TG7A 4QMAA 4AFDA 3KM5A 3I59A 1AR93 5C4WB 1GOHA 1TNFA 3O0XA 2ZGUA 3MICA 1W6MA 2LRPA 2WN3A 4LBQA 4LBNA 4LHKA 2ZEXA 3ECQA 4FOYA 1GNHA 3VBRC 2H6BA 2YV8A 4RSUA 3OUIA 3K51A 2BOJA 4J1WA 2Q1FA 3DKQA 4MXWA 1JU3A 2ET1A 1UY4A 2FDGA 3HMYA 3DPRC 2AEYA 2C9KA 3ZXEA 1RUE2 2K46A 5IYYA 4CP1A 1W3VA 4IV3A 4XTPA 1MACA 2BNNA 2D43A 4BWOA 2XBO2 4GZ9A 4SBVA 1KRIA 4EQVA 3C7FA 1AJKA 1WW5A 1ZZCA 4WM7A 2YB7A 3VBRB 4EZHA 1VR3A 4P00B 4EROA 2GNDA 3J26N 3OCPA 3T08A 3ZXKA 4PIYA 3LB9A 5FZOB 3WF2A 1ENRA 1G6NA 1GV9A 1F4AA 2BERA 1YFUA 2G9FA 3FHAA 4UF0B 1C5IA 1ZZBA 5FLJA 3DPRB 4E4SA 3T3YA 5LRRA 5L9BA 5E6HA 3WP5A 4YVSA 4AK3A 3NV1A 4YG0A 1QJX1 3R05A 1WLDA 3SH5A 3L9JT 1BEV2 3M1HA 1POV0 4LBJA 4PQQA 2ENRA 2EXJA 4Y22A 4ES8A 2IZWA 2JEMA 3JUUA 1Y4WA 4IXLA 3E5QA 1YHFA 3EYPA 2Y6GA 2WO3A 3DYPA 2VBDA 5BNQA 1XU1A 5C9AC 2C5DA 5FXVA 2VOTA 2JX9A 5K0UA 1CZVA 3LGRA 2RS33 2HWB1 3BVCA 3VBUA 3R4UA 5J7MA 1OA2A 1XB9A 3RSJA 5BNOC 1W8TA 1HB1A 2HWF2 3TN92 1H9PA 1GP4A 5C3RA 3C7HA 1H4HA 4OHXA 4QDRA 1YI7A 3LD8A 3OYWB 1VB4A 3GDBA 1GUIA 1R1A3 5JAXA 1RUF1 3CQOA 3FWEA 4PI0A 4BE3A 2OIIA 3OGSA 2PQSA 3TEXA 1MZ5A 2PLV3 4AFMA 5C9AB 5FAXA 4W6WA 3LEMA 2VMIA 5IVBA 1MZFA 5F7UA 4MG2A 2WNVC 1YFXA 1CVNA 2K0GA 3PJYA 5L19A 1IPKA 2RS32 3JB4C 4YG6A 4LQRA 3OBZA 3ST7A 3ZFEA 1ND2A 2TUNA 5BNOB 5G04L 1P8JA 5JLVA 1AR71 3VBRA 2FHRA 2A6VA 1NCQC 1COV2 2E9QA 3ES4A 4W6XA 4AHYA 3I3DA 2FQPA 2UY9A 5H9RA 2EAAA 3ORJA 1R1A2 1IS4A 4UF0A 3MPBA 4Y20A 4GA9A 2EF6A 4OUMA 5GLZA 1O7FA 2A6WA 2PLV2 4GB33 2D97A 4URTA 3KF5A 5L9VA 4AF9A 5GALA 1C1LA 2A6XA 3T09A 1C8NA 3CKHA 2VR4A 2XWBB 3BTYA 4XCAA 1NCQB 1UYYA 4XDQA 1RVF3 3VL8A 1RUJ3 3VDAA 2ZGKA 2ORZA 5FY4A 1JI6A 4YW3A 3RMXA 3KV5A 1ZBA1 1VAKA 4A3XA 3OGVA 5KXCA 5BV6A 4J6GA 4QPWA 4UW6A 2DURA 5CG8A 1Z78A 3KQ4B 3QOPA 5F5CA 3SC7X 2DCZA 2MEV1 3ZN5A 5CFDC 4H14A 5FZIA 3LFIA 3OYWA 4RGGA 4HLTA 4E4ZA 3NV2A 3DN7A 2ARXA 3AP5A 1AXKA 4J25A 4EE2A 4MZUA 1RIRA 5GZFA 5C9AA 3GBGA 5L7OC 1RVF2 1RUJ2 2PN5A 1RUG1 2WN2A 1MS4A 1VBB2 4QXCA 1GZCA 3BI3A 2BP6A 2W08A 1CAUB 2ZJCA 4CEWB 1OA3A 1XE7A 3HAGA 3ZO0B 4YW4A 4HK9A 3MFCA 5BNOA 1KS5A 1D4M1 1LHVA 2WZ8A 4FPLA 3I2FA 1JS9A 4DFSA 2R063 2ZX4A 5FZDA 3HNYM 3HWJA 4OFGA 1S55A 1XNCA 5FZCA 3IWZA 5CB7A 3OG2A 3WG3A 1V6OA 1HN0A 1S0FA 2FMYA 5LBEA 1JYXA 4OQ9A 1DGWA 3FN9A 2DV9A 2WYFA 1RJ7A 4HETA 5BXXA 3WX5A 5T5JA 3PUQA 2WNVA 4CCKA 1IQDC 2JKXA 5BNNC 3WW2A 1QH6A 2ARAA 3AB0A 3O1RA 2RM22 1FOD1 2YFUA 4WVMA 3THDA 3CBNA 1J59A 3B7MA 1JZ7A 2KR2A 5LEKA 2GC1A 2WLQA 1NCQA 4D69A 3O1SA 3N36A 2AR6A 4GWMA 4XIOA 3ZFFA 2R16A 5KXDA 3BUCA 2QNKA 3WR0A 4NVPA 2WBKA 4HANA 4Q4Y3 4LO6B 4A45A 4CUAA 3M3OA 2JDUA 2TEPA 4IEZA 4PIXA 1VJ2A 5HXVA 3ATGA 2E7AA 2F4PA 2OQ6A 3TEWA 5A3PA 4COUA 2UWAA 3ZXAC 4NHLA 3V0AB 4FT8A 4UFJA 3RFRA 4L11A 3WG2A 3J8F1 2Y8KA 1FX5A 2PMWB 1DQ1A 3U4XA 3V0BB 4JCKA 4NHXA 3UESA 2ZMKA 3AVSA 1H2NA 2UYAA 3ZXDA 3ZXLA 4BXFA 1UD1A 5FBZA 1D0HA 2CAUA 4MYEA 2Y6HA 4KU8A 3HBZA 4Q4Y2 5LBCA 2VUCA 4EYUA 1UQXA 1SDDB 1TEIA 2YG0A 3NRUA 3T2QA 5C5UA 4QHOA 2MHFA 1LRHA 2JDAA 2XQRA 5CFDA 3IB3A 1BXHA 1ACCA 5FV3A 1W39A 4PQ9A 5DUVA 4XFGA 3TAYA 5B4NA 3ZYPA 3ZN6B 1QF3A 4GMP3 5L7OA 4C0HA 1QXJA 2VO5A 3LQCA 3JZVA 5JXHA 4LHNA 1ZBE1 1U5IA 2EXKA 4LJHA 4QPGC 5CU1A 2ZGOA 4P9LA 2E63A 3THPA 3ZDSA 4OULA 4BK4A 5JSPA 3AMQA 3OB8A 3QBQA 4COWA 2R1BA 4AGGA 4DUVA 4JC1A 2X53S 2DCTA 4CU9A 3KGZA 3ETPA 2FBEA 1H1AA 5FPLA 3VZMA 1E5IA 1G9CA 2SBAA 4DEVA 1H6XA 5DDJ3 2VULA 3ZOIA 1DYPA 5FRAA 4K1YA 3NQHA 5IAXA 1Y9GA 3SISA 1SG3A 4I0WB 4L0PA 1JOPA 2VD7A 1J3QA 5JOZA 3EMRA 4EWDA 3OEAA 3IIAA 1OLQA 3L2HA 1MPXA 4XJUA 4KQ7A 3WDVA 1UYPA 3IT8A 1W6PA 2NQYA 5BNNA 1S0DA 4H7MA 1UOFA 1Y9QA 3V0AA 2Y26A 1YC61 3RJRA 1SMVA 2WT0A 4HK8A 2FDHA 3ZN4A 4IGQA 4F3JA 4W6YA 2HKXA 4QKNA 1EPZA 3HQRA 4CU8A 3ZR5A 3TNQA 3V0BA 1SEFA 4D7YA 5KWRA 2QDRA 2Z42A 4PT6A 3RNSA 2W5FA 3G7DA 3NKGA 5FP7A 1PVC1 3K4ZA 4E4DX 4CUGA 3VDDC 2QUOA 2BNOA 3MIFA 4CXYA 3AL5A 4K20A 2W91A 3POSA 3WSOA 1YYNA 1UIJA 5BNPC 3LWCA 4OI1A 5I0TA 2BW8A 4LUKA 2Q4SA 1HX6A 3GGLA 4CDWC 1ZRRA 1Z0HA 1HN1A 5FO9B 5C3OA 3DXTA 1GANA 3ACHA 2H0BA 3AM2A 4A7KA 3DEMA 1EUUA 4NHMA 4WBBA 2GN7A 1FPN3 3VDDB 5FXWA 4OMDA 4Q0SA 4CCMA 1R093 5BNPB 2Z2SB 3NNJA 5CBLA 5FO8B 3WF3A 3O1MA 5FBJA 1D4VB 3GM8A 1RUC3 5K7PA 1GWLA 4GWJA 1ASJ2 3MW3A 2KA3A 1CESA 1V9U1 4AXOA 4QXBA 5FY5A 2ZGSA 3P1IA 1Y3TA 4GJYA 1KITA 3R4SA 1UZYA 3LSEA 5FIXA 4CCNA 2WLPA 2RS51 4QPGA 2UYBA 3O1TA 1PZ9A 3R6SA 3JCIA 4E2GA 1AJOA 2PHXA 2VBBA 1MS8A 1R1ZA 5IVJA 3IMMA 5CG9A 3PTYA 4ORFA 5LA1A 4YNIA 2W9XA 4NO4A 4Y1UA 2OZ6A 3K3NA 2UWBA 1RUC2 2VQAA 2VTXJ 4FFFA 2VZ1A 5AFBA 2G1MA 5IVVA 1T2XA 4LO8A 1EAH3 2D44A 2P17A 3MLJA 2QQUA 4OI4A 5HBAA 1AUYA 3HR9A 5I93A 1SFPA 2DUPA 2MNGA 3GF6A 3MF9A 1QNYA 1RUI2 1XJAA 2W1QA 1XC6A 3U14A 1AL0G 5IK5A 1J58A 1LKNA 5JDBA 4XBNA 3WHUA 2HLEA 5CFCC 3WF0A 4XDOA 2C0ZA 2VW2A 2W47A 1GYKA 5F3IA 3EBRA 1XNDA 4BMEA 1KD7A 1GP6A 5FPAA 1OF4A 3E5UA 1SHWB 2ZGMA 3LZZA 2PAKA 1JXNA 1W8UA 3F2ZA 3U75A 1EAH2 2GZWA 4HL0A 1W9FA 3AZWA 3VDDA 3ZKYA 1OMIA 3QH6A 4LE3A 5GLWA 5BNPA 3S30A 5FMDA 2G9ZA 2JJ6A 5T3NA 1QXRA 1S1AA 1V6MA 4AEJA 4HVQA 5KHIA 3RZHA 4AQSA 4E9KA 5FDBA 5A3NA 1DQ6A 3OGGA 2J1SA 4CDWA 1AYN3 1UY1A 2Y6JA 1LR5A 2DYCA 4HKWA 2VU9A 1VMFA 4CDQB 4P14A 2HEWF 3J9SA 5LATA 1JYWA 2VXRA 1NCRB 3CLPA 4OQ8A 4ZS3A 1LHNA 2FZ2A 3KV6A 1QEXA 4NRMA 4CP9A 1IPJA 2V73A 3CJXA 5SV8A 2ZX1A 4MGYE 2JENA 1HJGA 2BWAA 3OF1A 5E1RA 3T4VA 3LA3A 2W3JA 2PXJA 3U4SA 1QGLA 2X5IC 2GMMA 2LTNA 3VKFC 3ZX7A 2WSUA 1JHJA 2ZGTA 4JHZA 1AYN2 3I97A 3FL7A 4NE9A 1QJU3 4Y4RA 3FE5A 4P9XA 1L7RA 1JYIA 2C4XA 2R042 4TSVA 2QE3A 3PJQA 4Z8BA 4LUMA 2B8MA 2F17A 3QLQA 2GC2A 4X8NA 4E27A 2A71A 2GDFA 2SLIA 2BVBA 3OY8B 2XLFA 1S2BA 4FPKA 2XHNA 5ACA3 1GWMA 2Q0AA 2X5IB 1KDMA 3ENRA 3PU8A 4YM3A 2A3WA 4D0QA 3ZM8A 1O5UA 4F8AA 1IQAA 1PGL2 1LEMA 5JPMB 1U12A 3POJA 4LITA 4XAAA 1AHSA 4D7TA 5CKQA 1LOGA 5A32B 3VHRA 3ZVXA 4NIDA 1LENA 1QDOA 3RWKX 1Y43B 3FBMA 4U2AA 4YSFA 2RJKA 1RUNA 4NIAA 3JD73 4XUTA 2WINB 4N9HA 1Q8SA 2XJQA 3AJYA 3C7OA 4AYUA 2Q8DA 3BU7A 5LZ6A 4ONUA 5CFCA 2DVBA 1H6YA 2BZDA 3WCSA 3WQ1A 1Z7S1 1VBA3 5ACA2 5FTTC 4IV1C 1SZBA 5IJRA 4DB5A 4LE4A 1QKQA 5FXZA 3H8OA 1EV13 1O3SA 4PCRA 5A33A 2W52A 1UYZA 4AVBA 5FR3A 3HIFA 2XOMA 1CIYA 1CPNA 1GKBA 4FFHA 3BIWE 5T5OA 2IXCA 4JAAA 4BIOA 2IXLA 2W46A 3ZKUA 4Q0QA 5J09A 5FP8A 1QJY3 1TE1B 2B4KA 3JD72 3KSCA 3BCWA 3HJRA 2VMGA 2YUEA 4I02A 2I74A 4E8CA 3A0NA 5D21A 3AP7A 5FZHA 4HSLA 4MSVA 4FAHA 2K2SA 5FJHA 2HWD2 3VGIA 1VBA2 2F4LA 2A3YA 3Q8CA 3CZUA 1C8M1 1O4TA 4XAEA 2QZ3A 4PF5A 1F8VA 3C2UA 2V4VA 4UW4A 2WDBA 1EV12 2NN8A 3OY8A 4M0NA 1ZA7A 4QU2A 5F5AA 3C3VA 1UWWA 1PO13 2DCKA 5F5IA 5FY1A 1NLRA 1US3A 3RI8A 4BH9A 1HV1A 5CISA 3PU3A 2JDPA 1HIXA 1NQDA 3AMMA 3KF3A 3RJ2X 4BXSV 2HWE1 2GNMA 3B94A 4CVUA 1Q5OA 4QKBA 5I0SA 3AP4A 4AR2A 1JH5A 3P6BA 5AVPA 5J1XA 3VD4A 4CSWA 4O9EA 5JVVA 4BISA 1S4CA 3UGFA 1E5RA 3I54A 2ZPXA 4KGGA 4XIKA 2RS12 4Y3OA 3JB8A 4FQZA 1MS3A 3ZPYA 1C3HA 1H2MA 3D5OA 3S7IA 1V00A 3I2JA 1ULOA 3ETQA 4IGOA 4RL7A 3A21A 4TWTA 2I2SA 3A23A 1NOVA 1US2A 3MGUA 3RYKA 1PO12 2O1QA 2ZXQA 5CEHA 1UAIA 4CP0A 4F7ZA 3ABZA 4AEMA 4C1WA 1OURA 2ETEA 2Y6KA 1VBE1 4UW5A 3RYRA 2JDYA 3URFA 3WNMA 5HV0A 1OPOA 1SQ4A 3T2TA 3K4DA 2G9GA 2OQ7A 1CAXB 2DVFA 1WCKA 4P9GA 4AGRA 3CMGA 4AI8A 1BBT3 4FXKB 4QB2A 2VZTA 5DZEA 2DFCA 2VMEA 2VMDA 4R52A 1YQ8A 4CZSA 5FY8A 3TNPB 1POV3 1PX3A 3FHQA 1D0GA 1HRV1 4G3YC 5IVFA 4IV1A 5FZLA 3WW4A 1OT5A 1N47A 4Z2WA 3W5MA 2WT1A 2VZQA 1N3OA 2VPVA 3NJZA 4H7LA 1GSLA 3LAGA 2GH2A 4KG0A 5KBFA 3A0KA 1FMD1 2VUDA 4XURA 1V6IA 4HKLA 2WA4A 4C8DA 3I3BA 4WM8C 1JOJA 4LBKA 1G9AA 4P9WA 1WCDJ 4KWJA 1JN2P 5HCBA 1BBT2 1REEA 2QQNA 3EXUA 1E5SA 4JKLA 1PMIA 1W8FA 4Q4W1 1W05A 1W90A 4JGYC 4AWDA 3SNMA 4QB1A 1UCXA 4DIQA 1I5PA 2VZRA 3AFGA 5JXJA 2J1AA 3JXSA 1VAVA 2P37A 2VZ3A 4RFRB 5EJZB 2GMEA 2B45X 3DV8A 1NKGA 1XOYA 1EY2A 2W94A 2JDNA 4RD7A 3T2PA 2YDEA 3WP4A 4WM8B 3R4DB 1DZTA 2BNMA 2VNVA 3NMBA 4F83A 1OA4A 3KVBA 1N3QA 1IPSA 5CZKA 1YWKA 2E53A 5D1IA 5FQ0B 2WFF1 3AYEA 2RG4A 1ZZ9A 2CYFA 4AQTA 2DU1A 4Q4X1 1DF0A 5BUVA 2GC0A 3GCWA 1B35B 2KM2A 4CUCA 2E7QA 4LMFA 4BIFA 2ZMLA 2A7AA 4XABA 1XNAA 1G86A 3WP3A 4BQWA 3K75B 4UFLA 4Z07A 1GWKA 1JZ4A 4OHVA 5JPNB 2FDJA 3W59A 3UK9A 4DUXA 1RYYA 5F39A 1ALYA 1CAWB 2DFBA 4CCEA 3SCGA 1ZYBA 4RS5C 1AL23 5CVRA 3D4KA 5I8YA 1VLNA 1ZVFA 2QQWA 3BOWA 2OYZA 2IFWA 4AOCA 4COYA 4BPZA 4PBPA 2WNOA 2HBUA 4A42A 3KS7A 3LCPA 3TRSB 3LOBA 1YXWA 2Y64A 5FYHA 1OFSA 4G9SB 5EP9A 1BMV2 1UMIA 1OKQA 3NJYA 1F9KA 5C4WC 4JQTA 4NN0A 2QQJA 2JIJA 3WW3A 1KFUL 1WLTA 4JX0A 5JUVA 3P3NA 3VHOA 3PNAA 5E8AA 1G9BA 3O0VA 2W39A 1ENQA 3UJQA 3N9OA 1ZNPA 3GYDA 3RZGA 2JG9B 4I0AA 1JZ5A 4JTOA 2PYTA 1KJRA 1L7LA 2EXIA 5B2GB 1YQ6A 3WV6A 3WQBA 2CV6A 4R4XA 3AKRA 1AL22 4FPYA 1PGW2 3CJIC 2XBO3 1RXGA 2XJTA 2EICA 3PL0A 1VALA 4O61A 5FUPA 2Y38A 4ARXA 1LU2A 4WM8A 5FY7A 4CDUC 2WO2A 5FZ3A 1O3RA 1W0OA 5LEJA 2C26A 5FUIA 2J1RA 1DYOA 5GZDA 4JGYA 5JOXA 3OD0A 1V6LA 4GWNA 5GM0A 2EVXA 4AI9A 4WVZA 3ZLIA 1W0NA 4IE5A 1BEV3 2XL9A 3WD5A 4SLIA 3CJIB 1RMU3 1M06G 2CWSA 1S2EA 1HRI1 5ANQA 2BFUS 3UJOA 3ZSLA 4CDUB 2YMZA 4XFCA 5BPXA 3KCYA 4KU7A 1RB8G 1AR91 2D93A 2EIDA 1CAWA 1TQ5A 2WNEA 3H3UA 3T0AA 1VPHA 3FC0A 4YZ3A 2PHUA 5KXBA 2PA7A 4YGEA 2AGSA 5E89A 4LKSA 1R081 4XZPA 2QQOA 1NLQA 2HWF3 1QJEA 3BPZA 3GJAA 2XLAA 1N1YA 1BLZA 1QJX3 1QHDA 4HZFA 4NRPA 5FJKA 1U5XA 2W1SA 3BGAA 4OMCA 1QY4A 4QU1A 5FFOC 1VIWB 4I0BA 1RMU2 4A3ZA 1WBFA 1GQPA 3PLQA 3N9QA 4DINB 1GZWA 3AYAA 3M7AA 1RL3A 1DGRA 1OI6A 3AJZA 4IEXA 1G8WA 5E16A 4RS5A 1UYXA 4QGNA 2NM1A 4OVEA 1POQA 3RYPA 2HWB3 2WQ4A 3SCHA 2VJXA 5FP3A 2XHKA 3OPTA 3NKTA 1S0EA 1AYM1 1QJX2 5C4WA 2DF7A 1COV3 1JZ6A 5FYSA 5FKCA 1ZRCA 4UAPA 1JODA 1IHMA 3VBFB 2ZBJA 3ZYIB 2OVUA 2L9LA 2PQQA 3UT0A 1LJ7A 1ULPA 3Q8AA 4XXAA 4GWIA 2BBVA 1JHNA 4OHWA 2UY8A 1GMMA 2PHWA 4LBQD 1HQNA 5DQ0A 2B5HA 4H3WA 1YQ5A 3WEZA 5JR2A 5EJ1B 5EHDA 1ST8A 2HWB2 2RS31 2ZZQA 4XJ9A 3W20A 4EWEA 3O12A 4Q2FA 3AKQA 2P3YA 3CHXA 4CDUA 4QQ2A 1AR73 2ET7A 4NROA 1DZRA 1OKOA 1CX1A 1W2AX 4LO4B 3UYJA 3WF4A 4BA6A 3K2OA 4M00A 5FZOA 1LOCA 4Y1YA 3CDZB 2WABA 3ZYHA 4UW3A 1H8TC 1RC6A 3DPRA 4TN7A 5F3CA 3MEPA 3NO8A 2RHPA 3NNFA 3DUIA 5KC5A 3OTFA 1I1EA 1UNBA 4A2UA 2WT2A 5FP4A 3M3CA 4JV4A 2UWCA 2OUHA 2HBTA 1W3XA 1ODMA 1AR72 1S0IA 5FYMA 4C1XA 1VBB3 2B9UA 1AX0A 2VQUA 4DRRA 1ZBA3 1H8TB 1ZRDA 2CL2A 2RJ2A 2XMLA 5T50A 4P9YA 1Q8OA 3O5SA 4CEWC 4IQPA 4AI3A 4URAA 2GC3A 3MO4A 1T6BX 5F2WA 1DDLA 1N1SA 4R4ZA 4Q0PA 3VKNA 3ES1A 2MEV3 4YW2A 1CZTA 4GB31 4XJZA 4QQOA 4FSJA 1I6XA 2AREA 1C5HA 4AVVA 1PNFA 3Q8FA 4P9IA 4XF4A 5FPVA 4B1LA 2ZKNA 1RUD3 4YGCA 3SITA 3HNBM 1BK1A 4YZ5A 5LA0A 1REDA 4Q27A 5FMOL 1G9DA 1W8WA 5F6KA 5HI0A 3MYXA 1BZWA 1RUG3 4DUWA 3KV4A 5FREA 1W6OB 5L9RA 3VKLA 4ASMB 5A6ZA 2VCCA 1V70A 4QHZA 1PMHX 2RM23 1ZBA2 2Z5WA 3AX4A 3LA2A 4ZXKA 3VUOA 1D2SA 1WLCA 3H7JA 3EJKA 1D4M3 1QNWA 2EA7A 4YARA 2O8QA 1HJFA 1WD4A 2VVDA 3AMHA 1IOAA 2MEV2 1FNZA 4B4PA 4NOTA 3MZHA 5FPUA 1OC1A 3M3QA 1MEC3 4GAZA 4LKDA 2R6QA 3GZAA 4S2GA 4EN9B 1RUD2 2RMU1 5LA2A 3FLRA 2CDOA 2VZVA 2WWSA 4N43B 4I2OA 2ZGQA 4N8MA 5EYYA 1RUG2 1W04A 3FZ3A 3GXUA 4RR3C 1CIWA 4XBQA 2XJPA 1ULGA 2R30A 3N7JA 3W9AA 1FOD3 4A6SA 2HYXA 4PLMA 3AMPA 4A6OA 3EQEA 3LKJA 3K48A 2FCTA 4FVVA 3ACFA 5F1RA 2VXJA 1D4M2 3VD3A 1YFYA 2VTXA 2DVGA 1UN1A 3EB7A 2WSVA 3SLIA 2R061 2JDKA 4JKMA 4Z82A 5BY5A 1GNYA 1LULA 3UKVA 1H8TA 4ZPIA 5F3GA 4AVAA 1MEC2 4XF0A 1RJ8A 1YQ2A 4EZ4A 3ILNA 4RQPB 5FYZA 2Z79A 5LK7B 4Y24A 2VQ0A 3O1UA 2O8OA 1WKYA 3R0RA 4RR3B 1UXXX 4LIVA 5FYIA 2LS6A 1L7QA 2QBXA 2DVAA 2QZ2A 1FOD2 4K40A 4MV2A 4CUBA 3N9MA 5A3MA 1WMFA 4CDXB 3WNLA 1W9SA 4E4HA 1XPWA 3NJVA 2Y0IA 4XC9A 1HW5A 5A3UA 5C3PA 2NYYA 5C70A 4EN8B 5KHHA 2W1WA 4CE8A 1W6OA 4L2NA 2WZPP 2QJVA 3CO2A 1CAUA 1UPSA 4XE9A 4CEWA 5IVCA 5JIUA 2B42B 3H8UA 3GBFA 2YPDA 3KB5A 1JTZX 3QH7A 4IERA 2YROA 1DHKB 3H7YA 1YIPA 2CSGA 3FX3A 4LK7A 5HCFA 1VBC1 1WZXA 2AEZA 4LA2A 4Y5TA 3J8F2 1GOGA 2C1FA 2BGCA 1GLHA 2D7FA 3BYWA 4IEWA 4Z2AA 3T0DA 1SFYA 2XL7A 3LDBA 2D3SA 1MVQA 2CU5A 1AR61 3WG4A 4XZUG 1H1MA 4WV8A 1CPMA 2ZOEB 5AC93 4IE7A 1UY2A 1K45A 2VZPA 4QQPA 4AHZA 2A73B 3ZR6A 5I8TA 3W58A 4GH4B 4Q0UA 2GP3A 1H30A 4IEQA 4LO5B 4HN0A 3WVJA 4AEDC 1DBNA 3O0WA 1KGYA 1PVXA 4FP2A 3H3LA 1VMHA 1HB2A 2QQVA 4MGQA 2VW0A 3FLTA 3H1YA 1LOBA 2BBAA 3PMSA 4JRAA 1W2OA 4FOWA 2RR12 4M4RA 4GMP1 3AK0A 4QPIB 1TNRA 4QDQA 5FZ4A 3UV9A 3WT3A 3S0MA 4HT1T 4XFFA 5AFEA 5T5LA 1PM7A 2WZR1 1VAMA 4P5HA 1GZTA 1DGLA 1IGOA 5LBFA 5AC92 5FPZA 5DMYA 4P02B 2JE8A 1F2NA 1LODA 1RXFA 3K3OA 3M2MA 2VOXA 4W8JA 4AEDB 4CPBA 1DIWA 2D3PA 3O1PA 4V1PA 4A4AA 1DP0A 1W6QB 4FOVA 1X50A 5DUUA 4LHSA 5J98B 5DDJ1 1LNSA 1PGSA 3JBG1 4UWDA 4D94A 1DGWX 1PVC3 2BQPA 2PELA 1AR83 4FI9A 1SBFA 4K7JA 4LLOA 5J37A 1O5LA 3GHMA 2ZACA 1PGL1 5K4LA 4PLNA 1ASJ3 5T55A 3TYJA 2ZMNA 1UOGA 1RITA 2CY6A 4XJAA 1LOAA 1NZCA 2VNRA 1W2TA 3LIGA 2QQLA 3AZVA 2J1TA 2WWUA 2QCSB 5FOJB 2JG8B 2V5YA 1KXGA 1ND3C 3K4AA 1MS0A 3OPWA 1QOOA 4LOSA 3ZN6A 4AI1A 5KHGA 2C24A 3HD8B 3DXUA 5AVAA 4NWWA 1WMXA 3VZJA 3IDBB 4HPKB 5FZEA 2LROA 1CZSA 3DCQA 1JZ2A 1PVC2 3KMHA 4QX0A 1AR82 1DQ0A 2Q1ZB 2D6PA 2RE9A 3FFQA 3GHNA 1WMDA 3NSTA 2B46X 4NR1A 3AXEA 3NV4A 5A1AA 1J3PA 1C4RA 2I07B 2IXIA 1QXPA 2JDMA 4MHUA 3VBOB 1DYKA 1CAVB 1V9U3 5DABA 3ZMNA 3H3ZA 2WL1A 2DVDA 5FY0A 3SKJE 3MIBA 5EFUA 4B4RA 1ND3B 2ZX0A 4XUNA 1RHI1 2D40A 3ROUA 1H1IA 1RUI3 5LWBA 2HWC3 3MIDA 4XDPA 4MUVA 2OUJA 4MO3M 2DDUA 3TWIA 4DY5A 1PO21 4O65A 4QQHA 1FPN1 5GLTA 4AGVA 4DPNA 3GALA 4R9CA 2XH6A 1R091 3HQXA 4Q0VA 2E32A 2WNUC 3DGTA 5FY9A 2BOIA 3TN93 4AEDA 4IEPA 3D6EA 4OUSA 4YLZA 3I2IA 5DAQA 4G4FA 2Y60A 3ON7A 2Q8CA 1V9U2 2ADDA 2ADEA 2Q1MA 5A6QA 1OLMA 1ZRIA 5H9SA 4B29A 2D6MA 3U11A 3LE0A 4LEJA 5A3LA 1X33A 3ACIA 4BOWA 4FXGB 2HWC2 2RS52 1X9TA 5FZAA 1DQ2A 2Y6FA 1BK0A 2P2KA 3KT4A 4CTEA 5K9YA 4M01A 3RQ0A 1XNBA 4MHRA 1U5ZA 1BHGA 1EPWA 2Q8EA 3UL2A 2WNUB 2A5ZA 1W8NA 2PHLA 3X29B 1W8HA 2CHHA 3T1MA 3U1XA 4CDQC 2NP0A 4JGZB 4YW1A 2BU9A 1LTEA 4K9SA 4D3WA 3RZZA 1NCRC 3UETA 2W2IA 4XHBA 2XR4A 3NV3A 2YFZA 4Z1VA 1QH7A 4ZZ8A 5FKBA 3OJBA 1MQTB 4M0HA 5T5PA 4KNCA 2ZKLA 4FP3A 3L2YA 3ZXJA 2BEOA 1ZREA 4N7IA 2QKDA 1CX4A 3NAPC 1W2UA 2X10A 4I3GA 5JIAA 1ND3A 1RUH1 2R043 4WVWA 2VGDA 1PIV1 2V09A 3WDXA 2FD8A 3HBKA 1OHFA 4LOTA 2IWGB 4A41A 4DXSA 3V64A 4TLGA 1OUXA 4K1ZA 1PK6C 2D3RA 4IE4A 5DUXA 2ZEYA 2Q8OA 4XMIA 1CJPA 3KV9A 4LBOA 1YO8A 4YZ2A 1Q8QA 2OXBA 4CU6A 4ATEA 1YFWA 1IS5A 1UX7A 2BUKA 2P1BA 3OBTA 4FPOB 2JWPA 1HV0A 3NAPB 2VTFA 4GMP0 1CD3G 4KWLA 4Q1PA 3LDRA 3VZNA 1VRH1 4QM9A 3I3QA 4B1MA 3MF6A 1IKQA 4XQ4A 4YVWC 4NHKA 1QJFA 5F2SA 2KXLA 3KHBA 3PURA 4CRQA 2OW4A 4ZXEA 4L9BA 5D8AB 1PK6B 3PUAA 3OGJA 2BPA2 1XBFA 4XF9A 1W28A 2D6NA 4XQDA 4COVA 2HJIA 4QQLA 3IAPA 4L8QA 4QKDA 2WNUA 1D7PM 2XXZA 3IDAA 1BQPA 4INDA 5CNAA 5IK8A 1NE4A 5J48A 1XYNA 3J7LA 1PNGA 1YIFA 2ZAHA 4YVWB 3SXWA 3W5NA 1QJU1 4LO7A 3VN4A 2WAAA 1IZ3A 4BQ3A 4QDSA 1JUHA 5ABJC 4I09A 4QD2A 3VV1A 1WGPA 3KQRA 2WIIB 3WP6A 3FJSA 1NZIA 3J7NA 1Z7S3 5LK5A 4EV0A 5IHRA 3BB6A 1MS9A 3RZJA 2HWD3 1WCSA 1X8MA 2Q30A 1IS6A 1ZX5A 2HEYF 3I8TA 4CDQA 3IBMA 5C5TA 4XFIA 4K6BA 3AZZA 3IAQA 3PUHA 1MZEA 4QHBA 4AHXA 4UXAA 1JYNA 1NCRA 3WLUA 3SQOA 4A7YA 4QB6A 4ZZ5A 2AYHA 4P08A 3KWVA 3UNPA 2FDKA 2WS91 2RDSA 2WZEA 5ABJB 5JSOA 3HT2A 3AP6A 1X36A 4NWVA 5HPOA 5CA6A 2GNBA 3JD71 2WFPA 2VZSA 2C9AA 2XUEA 3SKVA 3VKOA 4S2HA 1JU4A 5DZGA 2BV4A 2XONA 1Z7S2 2BRTA 4B4QA 4XUOA 1NY71 2DBNA 2RS13 1GQGA 5J3UA 5GKAC 5FZGA 1UW8A 2XKPA 4XETA 4WZFA 4BHPA 5HCAA 3GJBA 4LT5A 4J1XA 4LBLA 1PK6A 2H0VA 1HDKA 1UU6A 3M3EA 1EV11 1LOEA 4ET7A 2CWMA 2VUJA 3B9IA 3AL6A 4AL9A 3SHRA 2CDPA 2OS2A 5CKMA 2O0OA 5KHKA 4JDOA 1ZRFA 4YWAA 2W1UA 2X5IA 1IG0A 1QJY1 1UZWA 4ZS2A 1FV2A 1YLLA 1QQP1 1N1VA 4QX3A 4XACA 4Y5Z0 1I9RA 2VH9A 2YBPA 4YVWA 3RG0A 5A32A 4GULA 1DLCA 1O4ZA 3AKSA 3VHNA 3P3PA 1I3HA 3N35A 2J22A 2PTMA 3NNGA 4HVRA 1C8M2 1ZZ7A 1MZ6A 3HQUA 1YEWA 1LHUA 1UPIA 4LIUA 1X7NA 4N53B 2YZ4A 5EZWA 1GP5A 1SBEA 4TXWA 2OKXA 5APAA 3M4FA 2D98A 3NVCA 1AF9A 1BCXA 1ULFA 1YCIA 3USUB 3FUQA 3U37A 1ENXA 1SCSA 1UKGA 1V6KA 1W9YA 1YJKA 1VBE3 3Q8BA 5JI9A 4TLFA 2GSYA 5IFPA 4FAGA 4D8MA 3QD6A 3POGA 3RI9A 3BALA 3IPVB 5ABJA 1HB3A 3F95A 4RHV1 5C3SA 3NW4A 5IAVA 3U10A 4EN0A 4QGLA 2UURA 3D82A 4XW3A 1LCLA 1YUDA 2PHDA 2JD9A 1URXA 4UFKA 2ARBA 3I4IA 4I01A 3IMNA 1EYBA 5DG1A 1UMHA 4YRDA 4M3CE 4QGMA 1CQ9A 2ZGLA 4KH9A 3WNNA 2V4AA 1FMD3 1VBE2 2R073 4HXCA 2Y6LA 2YC2A 2F6BA 5L36A 3GNEA 1M4WA 1E5HA 5FCCA 4M4PA 4Q4V1 1HXS3 1GU3A 3RPQA 4HG6B 1SDWA 4JTNA 3UGHA 4OI0A 2ZGRA 2B9VA 2CNAA 3MUY1 1PZ8A 4XF1A 1YJLA 3S7EA 2JB4A 4BCUA 3Q8EA 1TMF1 5A7WB 4ZY9A 1BYHA 3KD4A 1POV1 3TEZA 1WMEA 5B4XA 5LA9A 4FOQA 1GR3A 1B35C 5CKNA 2FDIA 3SH3A 1NA1C 4YM1A 2NLRA 3WNXA 5FLHA 3HVDA 5C8WA 1FMD2 2K9ZA 2R072 1H9WA 3RWNA 4GQ7A 4CU7A 1HXS2 3MI8A 3WG1A 1KJLA 5HCHA 2R49A 3USUA 2E6VA 4Q4W2 2WR9A 4BQXA 3IKWA 4Q4X3 1HB4A 1W9WA 3MPPG 2YY1A 4CEYC 4BM8A 4PBOA 5JOWA 3BTZA 1CAXA 1NA1B 2R0HA 3H0OA 3H9AA 3ASIA 2QQKA 4ITCA 4DS0A 2IC1A 5FYCA 5A7QA 3DYMA 3I7DA 4PJYA 3VBHC 1OD3A 3AFKA 3LPFA 2AH2A 3ZYRA 2DTYA 2VECA 2BTVC 4UFMA 4QX2A 1LB2A 2JG9C 4QT6A 1DZQA 3VBSC 2WQZC 3SCFA 3WDYA 3ZSEA 1WUVA 2PHFA 3KLSA 3USSA 1DU3D 4CP2A 4CA9A 2LM3A 1JBCA 1UY3A 2ZABA 2ZGPA 4IETA 4LR4A 5DAVA 5DXDA 4MXWB 1OF3A 2CTVA 3ACGA 4Q4X2 4CEYB 3I2HA 4LTAA 5IATA 3OSDA 2X05A 1BMV1 5FYUA 1LGBA 4AG4A 4XTMA 1UY0A 1F5JA 3V65A 1O3TA 4L92A 4IGPA 3VBHB 5F37A 1CR7A 1IS3A 2IXHA 1REFA 4XXPA 1VBD1 1VMJA 1OQDA 4WM7B 1OOPC 2P6HA 2RR11 2ZCWA 1TME1 3J7HA 5EJ3A 5A7WA 1Q43A 3VBSB 5D2AA 3MIEA 3WQ0A 3S5AA 2C6SA 3HN3A 1OSGA 1W6NB 2VOVA 3MV11 3DYOA 3N9NA 2ZTNA 2QQMA 4GKYA 3AYCA 5IK4A 2W0XA 1AXYA 1RINA 3KVAA 3T0BA 4FO9A 4PLOA 1X8EA 2GN3A 5IFTA 4Y1VA 3M3IA 3A7QA 4Y22B 2QTWB 2WQ8A 3DF0A 3P5BA 5FWEA 4B7EA 1OOPB 5FQ0A 4RFT0 1BJQA 3BODA 1B35A 1RUE1 1LOFC 4TYSA 1NA1A 1RTVA 3WINE 4YM0A 4MGZE 2XBO1 1N3PA 1XXNA 1F35A 4YPJA 1X82A 3VBUB 5GZGA 1ND2C 4AEKA 3BN6A 1HQLA 3LEKA 5FK8A 4E2SA 2QFEA 4NPLA 1W2NA 2JE7A 1D2QA 4LHLA 4MOAA 3MLKA 4QX5A 1UL9A 3ILRA 4N90A 1KS4A 4C91A 3H50A 4FFIA 4L99A 1JMUB 1R083 3DL3A 3IDCB 4CEYA 1S0GA 4DRVA 5KC6A 2BGOA 3J4UH 3B69A 3G6JB 3I3EA 5LW9A 1DQ4A 1BEV1 3A22A 1J84A 2VQTA 4FPJA 4XFHA 2R32A 1RMU1 1MR5A 2CGOA 1HRI2 1UKRA 3VBHA 1R64A 3ZFEB 3MBWA 1A34A 3VBFC 1ND2B 1OFNA 3EO6A 3U78A 4YFZA 4LORA 2JICA 2JG9A 4O7XA 4R9BA 1A8DA 3VBSA 1OD5A 4XPVA 2Y33A 1AR92 4XMAA 1OUSA 3LIHA 4GXLA 1FYUA 2A6ZA 1GOFA 2HYKA 1W6NA 5I0DA 3H8RA 5FZ1A 3N7KA 1OVSA 1FV3A 2P4EA 5IVYA 2EAKA 4YW5A 4Y20B 1R082 1LHOA 1F5FA 5I8SA 4CCDA 1AYM3 2HWF1 3FBYA 2OX0A 2QDNA 5ERLA 4Y26A 3TN91 4D6SA 1S0BA 2P5BA 2OT7A 4KBBA 2WWJA 5FXXA 4E2QA 4UOJA 1H2LA 1RUF3 2A1XA 1OOPA 3ELNA 4IEVA 4ISRA 3RRDA 1Q8VA 1LESA 1W99A 1WLWA 5DUWA 5FYYA 1H0BA 3ZYGA 4UFIA 3CJIA 2EIGA 1UZVA 3PUIA 4FPFA 1ZZ6A 1SPPB 3O7OA 1F31A 2AENA 2NPIA 2GP5A 3JU9A 4Y5SA 1SLCA 2OZJA 5KR7A 1MVEA 1AYM2 3BOPA 4HONA 1UXZA 1J83A 1COV1 2A3XA 2E26A 5I0UA 1GZWB 4LKFA 4M3CF 5A7PA 4DNYA 1UOJA 1R1A1 1W8OA 2X8KA 1APNA 1QIQA 1RUF2 2BGPA 2N7GA 1B09A 2JXAA 4IE0A 2PLV1 1LOFA 1QOSA 2EALA 4LA3A 4ZU5A 4AQ6A 3N9LA 2W95A 3H1MA 4IEUA 2D6LX 1A8MA 4RYDA 4HOOA 3FMGA 3I2GA 4XF3A 4GD4A 2V72A 2VAUA 3OPZA 4YZ1A 4BZ4A 1QJZA 4CCCA 3N7MA 4OCTA 3ZSKA 4PIZA 4BQ2A 1GNZA 3AP9A 4AE2A 1STMA 1NYWA 4Y4YA 1BVP1 3ZFFC 4OHZA 2Q5TA 3DKWA 3LPGA 4DEQA 5JSRA 3AKTA 1BVVA 4AVCA 3SEEA 4RN5A 4BU2A 5FUNA 4O9GA 2WNVB 3O1OA 3C7GA 1C28A 3WNPA 3ZYBA 5A1LA 2ZX3A 4FPHA 2LW8A 3PVBB 3DECA 4COZA 3S57A 3KCXA 1SACA 3VBFA 4WVMB 3B3QE 4RA0A 4XFBA 5A7SA 2WA3A 2WUHA 3OOXA 4W50A 3AC0A 4Y1ZA 1XNTA 1WW6A 1UOBA 1XNKA 1RVF1 1RUJ1 1VBB1 3POWA 4N43C 4QKFA 3ZFFB 1SLAA 4EN6B 5JXIA 5M0TA 1U5YA 1O91A 3VDBA 4GKXA 2GNTA 4KWKA 4XVHA 2FCVA 4NIHA 2J42A 2XDVA 1SPPA 1PX4A 1K42A 3U07A 3PHMA 5FOBB 4QX7A 2ZHKA 4GB32 4XJ8A 2PAEA 4XFAA 1O8SA 3T1LA 3I2KA 3ME2A 1F15A 2XVGA 2DBIA 1RUD1 2RMU3 2ZHMA 5LASA 2W92A 4AFAA 3IM0A 4JVAA 3N4MA 4KG8A 3K46A 4RQPC 4DO0A 1LGNA 1K3IA 4JDMA 4XCBA 4Q1RA 2Z4FA 4N9IA 5EWSA 1A3KA 4Q8LA 1OH4A 5FMBA 2B7YA 2RM21 3ZYJB 3NNLA 1IG3A 4NRQA 2YC4A 5DN2A 5FYVA 1S0JA 1ENSA 2LALA 4YYOA 1TZOA 1ONAA 2Y34A 2IVIB 3KCCA 4UYBA 4CDXC 5CFDB 2WKKA 4UBHA 3ZXGA 1O3QA 5LBBA 4CCLA 2AZ5A 4HVOA 4LPLA 4QXKA 1CGPA 1EP0A 1MEC1 4A7ZA 5C33A 2WC2A 1C57A 5FWJA 1WD3A 2RMU2 4AI2A 4QPYA 5L7OB 1XSRA 4HFSA 4ISQA 5CADA 2YHJA 3VDCA 4OI2A 5A7OA 2VMHA 4IESA 1JZ8A 4V2VA 4OUEA 3GZEA 3B02A 3J8F3 3WDTA 4YGBA 5EIYB 2W68A 3NNMA 3AXDA 4Y1XA 4FTEA 1SCRA 1XRUA 3ZDVA 5FO7B 1UZZA 2R062 3C7EA 5C3QA 3VZLA 1OQ1A 1OQEA 2XJUA 4Q4Y1 1NQJA 1U0AA 3QCWA 4TZDA 3ZMOA 5FLIA 4DQAA 4GH4C 1UF2C 1W6PB 2NZ9A 3VLBB 5BNNB 4KBZA 3WF1A 1VBC3 5EYXA 1LAJA 1YNAA 4L97A 1F4HA 3UKTA 3RMYA 3B9CA 4DXRA 3W21A 2VL4A 3B01A 3UGGA 4RGKA 2BDRA 3WUDA 3PVEA 2ZGNA 1WBLA 2E33A 1CJDA 1AR63 1AZDA 1ZBE3 4QPIC 4N43A 4AHWA 5A6YA 2VM9A 3RS6A 4Q5OA 2YBKA 5E88A 1WA6X 5IVEA 5A3TA 1JYTA 3MDPA 3HT1A 5GLUA 4MADA 4S2FA 4EWAA 1O59A 3OBAA 4NAOA 4ZKTB 3VZOA 5FZ8A 4LULA 3RZKA 3WZ1A 3D0JA 1VBC2 3POIA 4V2WA 5A3WA 3SMHA 1VE0A 1SLBA 3UKNA 5FZMA 1MS1A 1SLTA 4NIGA 1QWRA 4RQPA 5G05L 2P6CA 4IUGA 3QACA 3T4HB 2HH9A 1AR62 1ZBE2 2GALA 2WZR3 2YC0A 2ZS6B 4RR3A 5DAPA 2YPJA 5AC91 1NAEA 4Q26A 3PTRB 5KHJA 3E6CC 4S2DA 1IKPA 5CYYA 3WY6A 4AW7A 2JG8C 2AC1A 4CDXA 3JBG3 1W8ZA 2RVAA 5FK7A 1QDCA 1UMZA 2NMNA 4EN7B 2IXKA 4DZGA 4IE6A 4MGSA 4K8FA 4YZ4A 1DFQA 4KL1A 4LNVA 2X29A 3FHIB 5FZKA 5T54A 4QPGB 3PVNA 2P3IA 5FZBA 2ZEWA 3SEPA 3IDEA 1H4GA 1NX9A 2B39A 1OXCA 5FPBA 3VBOC 4UBGA 2WZR2 5C71A 2ZA9A 1ZM1A 5FYTA 4ES9A 4OHYA 4RGAA 3POEA 4FBFA 3J7MA 3M8LA 3WQ7A 5DG2A 4QWNA 3ILFA 5HV4A 2HEVF 4IDZA 4FTBA 2ZAAA 5DDJ2 1BKZA 3JBG2 4BQ1A 3D0SA 2VNOA 1AR81 2VBPA 3AVRA 4IL7A 5F5QA 4GH4A 4WVVA 4DY3A 1ASJ1 4BK5A 2MPFA 1KFXL 4XUQA 4YW6A 1UZ0A 5C8CC 3TB0A 4H55A 4CYDA 1CWPA 3T30A 3BU0A 2XLGA 2OPWA 1RHI3 1YI9A 4WZCA 3VZKA 5IW0A 5A6XA 4NMIA 3NJXA 4XHXA 4QPIA 2RS53 3BKZA 1EUTA 2ZX2A 2VMCA 3IN9A 1JYCA 1NT0A 2E31A 2J1VA 2PFWA 2VMFA 3B93A 4K3UA 2CGNA 1PO23 3MLLA 1FAYA 5J36A 1JOBA 5A7NA 2R7EB 2VCMA 1O8PA 1OLME 4OLLA 4D6QA 1ULCA 5DPNA 1LEDA 1J1LA 5A80A 5JCTA 5I91A 5C8CB 1RUC1 2FMDA 5DAWA 1W6QA 2EIBA 4JGZC 2GU9A 4KMQA 1NG0A 4NAMA 2VZOA 4R9AA 5FMCA 4CDWB 1UO9A 2GMPA 2ZEZA 4FFGA 4LXLA 4CCOA 3AKPA 3POYA 1DCSA 1PMJX 1OLRA 3H1WA 3LFMA 1RHI2 4QM8A 4CPBD 2J1UA 4BB3A 2W87A 1RUI1 2WRAA 2HWC1 2XJVA 3A4UA 3HNMA 4Q8KA 1ZZ8A 4QAWA 1MQTC 3I2OA 2ORXA 3POBA 4OZXA 4B8EA 4CP9B 2XGXA 4NHYA 2ARCA 4ARYA 4XEZA 1PO22 4AAXA 1FPN2 5HXMA 2VVEA 1OPMA 4OYUA 1CONA 1R092 2JG8A 1SLLA 1OBNA 4R9DA 3BPSA 1ULEA 2XJSA 3TEYA 4HPKA 4BLIA 4BDVB 1EAH1 1Q8PA 4A44A 4D6RA 3E1F1 3OD4A 2D5FA 4GALA 3BTAA 1GZ9A 3EHKA 4MLOA 2WAOA 4HSJA 2XG3A 4UFHA 3VBOA 2RDRA 5SV5A 1CAVA 2ATFA 4HN1A 4R8HA 2AACA 5FMOS 4BYYA 4AVSA 2VNGA 1RUH3 5IWFA 4KI5M 1T6GC 2BJSA 1PIV3 4K8RB 2EIEA 3ZSJA 2ZHLA 4AAPA 3OUJA 5J96B 5F6LB 3CU7A 1I5ZA 3INAA 5D8AC 1PZ7A 2FZ1A 2VCBA 3KHCA 4FTSA 3KZ4C 2ES3A 4PHZA 1LU1A 5FZ6A 3WXPA 1V0AA 4OZOA 3WNKA 4META 3ZPOA 3M70A 1DGRN 1Q3EA 1SLIA 2D5HA 3V56A 1C1FA 4Y33A 3MV01 4LKEA 5C8CA 2YU2A 2RDNA 1GBGA 3OUHA 4PF1A 4YW7A 3MIGA 5CFCB 1NXMA 1VRH3 3N3HA 3I49A 2JB8A 1AYN1 2Z69A 2YGLA 2BVVA 2JE9A 3E97A 1RUH2 1JUIA 2R041 3HEIA 4BLJA 3Q9OA 3S6PA 2VC9A 1XSQA 1PIV2 4AI0A 4CCJA 4YG3A 3N7LA 1WW4A 4XUPA 3ACLA 3ZFGC 4IW3A 4CXWA 1W06A 5A33B 3I2DA 1DLLA 2VOKA 5LY1A 1L3JA 2DUQA 2WO7A 3LF7A 5IUQA 4HBNA 1MS5A 5IK7A 3THTA 3OGRA 1WW7A 3MHZA 3ZIXA 4UT5A 3FUOA 4DXTA 4FQ4A 4DMIA 5BYNA 4X6QB 1O4YA 2VY0A 2XVLA 3MW4A 4HMZA 2DU0A 2DTWA 1NUKA 4JGZA 4ASLA 3O14A 1WCUA 4FCAA 1RGSA 2YGMA 1VRH2 3APBA 2IVJA 1W0PA 3H8XA 1XYPA 4XBLA 3HOBA 5DAXA 3MFAA 4BJ0A 1DG6A 3N9PA 1MQTA 4U36A 3ZFGB 2PHRA 2WYSA 4YFWA 1AX1A 1VB2A 2X09A 2OA2A 1VP6A 5FP9A 3PIGA 5DZFA 1V6NA 2BFUL 2ZZJA 4C0BA 1J1TA 4NUBA 5ACA1 2H6CA 3CZJA 2JIGA 4NJ4A 4JDNA 1K5MC 4W4ZA 4JQRA 4ZONA 3RVHA 1KQRA 4UI9L 5LB6A 4LK6A 4JZRA 4XQWA 1WWYA 1HQWA 3E6DA 1SFNA 2XJRA 1V6JA 3KGLA 2ID4A 2WJSA 4MH0E 2WS93 4MXVA 2XPJA 1QJU2 4X8PA 5A3OA 5ANNA 3U0ZA 2VUAA 2JKBA 1LECA 2VZUA 4QX8A 3WNOA 3GBWA 3VB9A 3ZSMA 5T52A 2FDFA 3KT7A 4ATFA 3LA7A 3LOIA 5C7GA 3NAPA 4D7SA 2VE1A 1X9PA 3RZLA 1H2KA 3H42B 5A70A 2HWD1 1K5MB 1VBA1 3ITQA 4BMBA 1C8M3 4DOUA 3CF6E 1PHMA 3LSDA 3AZXA 5FZ0A 5D8AA 3LEIA 5GLVA 5JWPA 2A75A 2RJLA 3VD7A 2FCUA 3CNAA 2VCAA 4AQ2A 4N53C 5FPXA 4I3PA 1FT9A 2WS92 2XWJB 1XE8A 2TBVA 4MVTA 5F32A 4C90A 2WO1A 1GICA 2CAVA 2GH8A 2ZHNA 4FPCA 1QQP3 2HWE3 3GZUC 4P9JA 1PM4A 5GJ6A 3E5XA 3PDQA 3TOJA 3ZXFA 4KWUA 2JDZA 3MW2A 4IV1B 5CAZA 5GZCA 4W65A 4ZHNA 1WCQA 2R0FA 5FZFA 3PMEA 1NY72 2RS11 3B5LB 3OEBA 3POFA 5EV7A 1QOTA 3VL9A 1NLSA 3ZFGA 5C6CA 1XE0A 1WA4A 5A1FA 1UX6A 4TTGA 4PDWC 3MUZ1 2D6KA 4PI2A 2XUMA 3NL1A 1W9TA 1JW6A 1PO11 4M3CB 2R1DA 3VHPA 3O1VA 1RUOA 4E8DA 1QJY2 4GIQA 1Y7BA 2VW1A 1QQP2 2HWE2 4XOGA 1XU2A 1TVGA 5ISLA 2XQXA 3D8CA 4RHV3 2BYVE 2JD4A 3K77A 3D3AA 2JECA 3CL1A 1K5JA 4Q29A 4MGTA 4PDWB 4JKKA 4CXXA 5L73A 5JXGA 3E6BA 1HRV3 3VD9A 3I3MA 4IEOA 1O6UA 4NPRA 1G9FA 4ZU4A 4AVTA 1K5MA 1UU5A 2XVKA 3VKMA 1AX2A 1FATA 5F3EA 1SBDA 2P34A 1FXZA 5JR7B 3BIEA 5GZEA 2XB6C 4JHTA 1Y9MA 3ZYFA 4Q4V3 2DUOA 1QU0A 1LGCA 5CIRA 3BTXA 5K8SA 4RHV2 3IIIA 3IZOA 1BBT1 2GAUA 1W03A 3OBRA 4NIIA 4IEYA 4Q4W3 1H8VA 4YGDA 3GCXA 4HKOA 2O14A 1J3RA 2PHTA 1TMF3 5F8PA 4ASKA 5JZGC 2BWCA 3WUCA 5JMCA 1VRBA 4MGKE 4KGQA 2IUWA 3CIHA 1HRV2 2IXJA 5JI7A 1JZ3A 4BQYA 5IT6A 4FPEA 1JYVA 5LY2A 4LBMA 2ERFA 2YU1A 1AVBA 1NXD1 4X6RB 5JMOA 2P3KA 4N53A 1CN1A 2R071 4QX1A 2YYOA 3AYDA 4N7UA 2JDHA 2QQPA 4Q4V2 1FNYA 1HXS1 2DWRA 1YRZA 3PIJA 2J1EA 4M3CA 3FFZA 1GFF2 2WFF3 1KEXA 3TBDA 1OVPA 2RV9A 5H9PA 2G4IA 5JZGB 4AFBA 1GQHA 2Y0OA 2EXHA 1TMF2 3AMNA 3GZTB 1DQ5A 1Q56A 3MIHA 1HLCA 2J7MA 2NMOA 2V5DA 3IPVA 3T2OA 1KDKA 3CEWA 4IV3C 2G19A 3LEGA 4PDWA 2A70A 3WCRA 4NPMA 4QXHA 5LCWL 2RDQA 3I59B 2D6OX 4WM7C 3PUSA 1W6MB 4YM2A 4LBQB 2IFRA 3JQWA 4LLFA 2VVFA 3C8XA 3ALQA 4FPGA 4I30A 5KXEA 1QMJA 4JGYB 2WFF2 4JRLA 4AZZA 4ZU7A 1N1TA 4BQ4A 2CGPA 1AXZA 3RZMA 2QVSB 1UIKA 2YBSA 2A6YA 4YVSC 3WDWA 5TSWA 5EQUA 3SH4A 5F9TA 1LHWA 3THCA 1ULDA 1XYOA 2TNFA 4IV3B 4BQ5A 4DXZA 1OH3A 2DCYA 3WDUA 1VBD3 3ZIWA 4B7KA 1ODNA 1G7YA 1XQNA 1TME3 2RR13 3FLPA 2YXSA 4AFCA 4MX3A 4K21A 3RGBA 2OPKA 1HKDA 4Z92B 3LDKA 5EXOA 1K12A 1AL21 2PAMA 4MGIE 1PGW1 5I0RA 4H2AA 3VD5A 3S5QA 5K0UC 2UU8A 1A78A 2KD7A 2VG9A 5FYBA 2E7TA 4YVSB 3AZYA 3VBUC 2I45A 4XILA 3WOGA 5JOYA 3B00A 1A6CA 4XYXA 4B3NA 1ZA4A 3HN1A 3PVOA 5FZ7A 2DCJA 5H9QA 3NWKA 5JZGA 1VBD2 2VOWA 4P5YA 3HPNA 2QQIA 1S0CA 2LUWA 5EPAA 3KT1A 1FI2A
chains in the Genus database with same CATH topology
1TME2 3RDIA 4EJRA 1NE6A 3JQXA 1RUE3 1UU4A 2XKOA 4RS5B 3WW1A 1S2KA 2P3JA 5LRSA 2ILMA 1HRI3 5K0UB 1E57A 4XJWA 2E51A 2AUYA 3ZFEC 3WHTA 4QMAA 4AFDA 3KM5A 3I59A 1AR93 5C4WB 1TNFA 3O0XA 5DUXA 2ZGUA 3MICA 1W6MA 4LBNA 4LHKA 4LBQA 3VBRC 3ECQA 4FOYA 1GNHA 2H6BA 2YV8A 4RSUA 3K51A 4J1WA 4MXWA 2ET1A 3HMYA 3DPRC 3ZXEA 1RUE2 4CP1A 4IV3A 4XTPA 1MACA 2BNNA 2D43A 4BWOA 2XBO2 1KRIA 4SBVA 1AJKA 1WW5A 1ZZCA 4WM7A 3VBRB 1VR3A 4EROA 2GNDA 3J26N 3OCPA 3ZXKA 4PIYA 3LB9A 1ENRA 1G6NA 1GV9A 2G9FA 1YFUA 1C5IA 1ZZBA 5FLJA 3DPRB 4E4SA 5LRRA 3WP5A 4YVSA 4AK3A 3NV1A 4YG0A 1QJX1 3R05A 1WLDA 3SH5A 3L9JT 1BEV2 3M1HA 1POV0 4LBJA 2ENRA 2EXJA 4Y22A 4ES8A 2IZWA 2JEMA 3JUUA 4IXLA 3E5QA 1YHFA 5BNQA 1XU1A 5C9AC 2C5DA 2JX9A 5K0UA 3LGRA 2RS33 2HWB1 3VBUA 3R4UA 5J7MA 1OA2A 3RSJA 5BNOC 2HWF2 3TN92 1H9PA 4OHXA 1H4HA 1YI7A 3OYWB 1VB4A 1R1A3 5JAXA 1RUF1 3FWEA 4BE3A 2OIIA 5C9AB 1MZ5A 2PLV3 4AFMA 5FAXA 4W6WA 2VMIA 1MZFA 2WNVC 1YFXA 1CVNA 2K0GA 3PJYA 5L19A 1IPKA 2RS32 3JB4C 4YG6A 3ST7A 3ZFEA 5BNOB 1ND2A 2TUNA 5JLVA 1AR71 3VBRA 2FHRA 2A6VA 1NCQC 1COV2 2E9QA 3ES4A 4W6XA 4AHYA 2FQPA 2UY9A 5H9RA 2EAAA 1R1A2 1IS4A 3MPBA 4Y20A 4GA9A 2EF6A 4OUMA 5GLZA 1O7FA 2A6WA 2PLV2 4GB33 2D97A 4URTA 4AF9A 5GALA 1C1LA 2A6XA 1C8NA 2XWBB 1NCQB 4XDQA 1RVF3 3VL8A 1RUJ3 2ZGKA 4YW3A 3RMXA 1ZBA1 1VAKA 4A3XA 5KXCA 5BV6A 4J6GA 4UW6A 2DURA 5CG8A 1Z78A 3QOPA 2DCZA 2MEV1 3ZN5A 5CFDC 4H14A 4E4ZA 3OYWA 4RGGA 4HLTA 3NV2A 3DN7A 2ARXA 3AP5A 1AXKA 4MZUA 1RIRA 5GZFA 5C9AA 3GBGA 5L7OC 1RVF2 1RUJ2 2PN5A 1RUG1 1MS4A 1VBB2 1GZCA 2ZJCA 2W08A 1CAUB 4CEWB 1OA3A 1XE7A 3HAGA 3ZO0B 4YW4A 4HK9A 3MFCA 5BNOA 1KS5A 1D4M1 1LHVA 4FPLA 4DFSA 2R063 2ZX4A 3HWJA 4OFGA 1S55A 1XNCA 3IWZA 5CB7A 3WG3A 1V6OA 1S0FA 2FMYA 1DGWA 2DV9A 4HETA 1RJ7A 5BXXA 3WX5A 5T5JA 2WNVA 5BNNC 3WW2A 1QH6A 3AB0A 2RM22 1FOD1 4WVMA 1J59A 3B7MA 5LEKA 2GC1A 2WLQA 1NCQA 4D69A 3N36A 2AR6A 4GWMA 4XIOA 3ZFFA 2R16A 5KXDA 2QNKA 3WR0A 4NVPA 4HANA 4Q4Y3 4LO6B 3M3OA 2TEPA 4IEZA 4PIXA 1VJ2A 5HXVA 3ATGA 2E7AA 2F4PA 4COUA 2UWAA 3ZXAC 4NHLA 3V0AB 4FT8A 4L11A 3WG2A 3J8F1 1FX5A 1DQ1A 3U4XA 3V0BB 4JCKA 2ZMKA 1H2NA 2UYAA 3ZXDA 3ZXLA 1UD1A 5FBZA 1D0HA 2CAUA 4MYEA 4KU8A 3HBZA 4Q4Y2 1TEIA 2MHFA 1LRHA 5CFDA 1BXHA 1W39A 4PQ9A 5DUVA 4XFGA 3TAYA 3ZYPA 3ZN6B 1QF3A 4GMP3 5L7OA 4C0HA 1QXJA 3JZVA 4LHNA 1ZBE1 1U5IA 2EXKA 4QPGC 5CU1A 3THPA 2ZGOA 4P9LA 2E63A 3ZDSA 4OULA 5JSPA 3AMQA 4COWA 3QBQA 2R1BA 4AGGA 4JC1A 2X53S 2DCTA 3KGZA 2FBEA 1H1AA 3VZMA 1G9CA 2SBAA 5DDJ3 2VULA 1DYPA 5FRAA 4K1YA 3SISA 4I0WB 5JOZA 1J3QA 4EWDA 3IIAA 1OLQA 3L2HA 4XJUA 4KQ7A 3WDVA 3IT8A 1W6PA 2NQYA 5BNNA 1S0DA 4H7MA 1Y9QA 3V0AA 2Y26A 3RJRA 1SMVA 2WT0A 4HK8A 3ZN4A 4F3JA 4W6YA 2HKXA 1EPZA 3V0BA 3TNQA 1SEFA 4D7YA 5KWRA 2QDRA 2Z42A 3RNSA 3G7DA 3NKGA 1PVC1 4E4DX 3VDDC 2QUOA 2BNOA 3MIFA 4K20A 5BNPC 3POSA 1YYNA 1UIJA 3LWCA 4OI1A 5I0TA 2BW8A 4LUKA 1FI2A 2Q4SA 1HX6A 4CDWC 1ZRRA 1Z0HA 5FO9B 1GANA 2H0BA 3AM2A 4A7KA 4NHMA 4WBBA 2GN7A 1FPN3 3VDDB 4Q0SA 1R093 5BNPB 2Z2SB 5CBLA 5FO8B 1D4VB 1RUC3 5K7PA 1ASJ2 3MW3A 2KA3A 1CESA 1V9U1 4AXOA 2ZGSA 1Y3TA 1KITA 3R4SA 1UZYA 3LSEA 2WLPA 2RS51 4QPGA 2UYBA 1PZ9A 3R6SA 3JCIA 4E2GA 1AJOA 2PHXA 1MS8A 1R1ZA 5CG9A 3PTYA 4ORFA 4YNIA 4NO4A 4Y1UA 2OZ6A 2UWBA 1RUC2 2VQAA 5AFBA 4LO8A 1EAH3 2D44A 2P17A 3MLJA 4OI4A 5HBAA 1AUYA 3HR9A 5I93A 3MF9A 2DUPA 2MNGA 3GF6A 1QNYA 1RUI2 1AL0G 5IK5A 1J58A 1LKNA 5JDBA 4XBNA 3WHUA 5CFCC 2C0ZA 2VW2A 1GYKA 3EBRA 1XNDA 4BMEA 1KD7A 3E5UA 2ZGMA 3LZZA 2PAKA 1JXNA 1EAH2 2GZWA 4HL0A 3AZWA 3VDDA 1OMIA 3QH6A 4LE3A 5GLWA 5BNPA 3S30A 4AEJA 2JJ6A 4HVQA 5T3NA 1QXRA 1S1AA 1V6MA 5KHIA 4AQSA 4E9KA 5FDBA 1DQ6A 3OGGA 4CDWA 1AYN3 1LR5A 2DYCA 4HKWA 2VU9A 4CDQB 4P14A 2HEWF 3J9SA 2VXRA 1NCRB 3CLPA 1LHNA 2FZ2A 1IPJA 2V73A 3CJXA 5SV8A 2ZX1A 4MGYE 2JENA 2BWAA 3OF1A 5E1RA 3LA3A 1QGLA 2X5IC 2GMMA 2LTNA 3VKFC 3ZX7A 2WSUA 2ZGTA 1AYN2 1QJU3 3FE5A 4P9XA 1JYIA 2R042 4TSVA 2QE3A 3PJQA 4Z8BA 4LUMA 2B8MA 3QLQA 2GC2A 4X8NA 4E27A 2A71A 2GDFA 2SLIA 2BVBA 3OY8B 2XLFA 1S2BA 4FPKA 5ACA3 2Q0AA 2X5IB 1KDMA 3ENRA 4YM3A 2A3WA 4F8AA 1O5UA 1IQAA 1PGL2 1LEMA 5JPMB 1U12A 4D7TA 1AHSA 1LOGA 5A32B 3VHRA 3ZVXA 1LENA 1QDOA 1Y43B 3FBMA 4U2AA 4YSFA 2RJKA 1RUNA 3JD73 2WINB 4N9HA 1Q8SA 2XJQA 3AJYA 4AYUA 3BU7A 4ONUA 5CFCA 2DVBA 3WCSA 3WQ1A 1Z7S1 1VBA3 5ACA2 5FTTC 4IV1C 4DB5A 4LE4A 1QKQA 1O3SA 1EV13 4PCRA 5A33A 2W52A 4AVBA 3HIFA 1CPNA 1GKBA 3BIWE 5T5OA 2IXCA 4JAAA 4BIOA 2IXLA 5J09A 4Q0QA 1QJY3 1TE1B 3JD72 3KSCA 3BCWA 2VMGA 2YUEA 4I02A 2I74A 3A0NA 3AP7A 4HSLA 4MSVA 4FAHA 2K2SA 2HWD2 3VGIA 1VBA2 2A3YA 1C8M1 1O4TA 2QZ3A 4PF5A 1F8VA 3C2UA 4UW4A 1EV12 2NN8A 3OY8A 4M0NA 4QU2A 3C3VA 2DCKA 1PO13 3RI8A 1NLRA 4BH9A 1HV1A 1HIXA 1NQDA 3AMMA 3RJ2X 2HWE1 2GNMA 3B94A 5I0SA 1Q5OA 3AP4A 1JH5A 5AVPA 4O9EA 5JVVA 3I54A 2ZPXA 4KGGA 4XIKA 2RS12 3JB8A 4FQZA 1MS3A 3ZPYA 1C3HA 1H2MA 3D5OA 3S7IA 1V00A 4TWTA 3ETQA 4RL7A 2I2SA 1NOVA 3MGUA 3RYKA 1PO12 2O1QA 1UAIA 4CP0A 4F7ZA 4AEMA 4C1WA 2ETEA 1VBE1 4UW5A 3RYRA 3URFA 1OPOA 1SQ4A 3T2TA 2G9GA 4P9GA 1CAXB 2DVFA 1WCKA 4AGRA 4AI8A 1BBT3 4FXKB 5DZEA 2DFCA 4R52A 4CZSA 3TNPB 1POV3 1D0GA 1HRV1 4G3YC 4IV1A 3WW4A 1N47A 4Z2WA 2WT1A 1N3OA 2VPVA 3NJZA 4H7LA 1GSLA 3LAGA 2GH2A 4KG0A 5KBFA 3A0KA 1FMD1 1V6IA 4HKLA 2WA4A 4WM8C 1JOJA 4LBKA 1G9AA 4P9WA 1WCDJ 4KWJA 1JN2P 5HCBA 1BBT2 1REEA 3EXUA 4Q4W1 1PMIA 4JGYC 4AWDA 3SNMA 1UCXA 3AFGA 1VAVA 2P37A 2GMEA 2B45X 3DV8A 1EY2A 4RD7A 2YDEA 3WP4A 4WM8B 3R4DB 1DZTA 2BNMA 4F83A 1OA4A 1N3QA 1YWKA 2E53A 5D1IA 5FQ0B 2WFF1 3AYEA 4AQTA 1ZZ9A 2CYFA 2DU1A 4Q4X1 1DF0A 5BUVA 2GC0A 1B35B 2KM2A 2E7QA 2LUWA 4BIFA 2ZMLA 2A7AA 1G86A 3WP3A 4Z07A 4OHVA 5JPNB 3W59A 3UK9A 1ALYA 1CAWB 2DFBA 3SCGA 1ZYBA 4RS5C 1AL23 5CVRA 3D4KA 5I8YA 1VLNA 1ZVFA 3BOWA 2OYZA 2IFWA 4COYA 4BPZA 4PBPA 3KS7A 3LCPA 3TRSB 3LOBA 1YXWA 1OFSA 4G9SB 1BMV2 1OKQA 1F9KA 5C4WC 4NN0A 3WW3A 1KFUL 1WLTA 3P3NA 3VHOA 3PNAA 5E8AA 1G9BA 3O0VA 2W39A 1ENQA 3UJQA 1ZNPA 3GYDA 2JG9B 4I0AA 4JTOA 2PYTA 1KJRA 2EXIA 5B2GB 3WV6A 2CV6A 4R4XA 3AKRA 1AL22 4FPYA 1PGW2 3CJIC 2XBO3 2XJTA 1VALA 2Y38A 1LU2A 4WM8A 4CDUC 1O3RA 1W0OA 5LEJA 5GZDA 4JGYA 5JOXA 3OD0A 1V6LA 4GWNA 5GM0A 2EVXA 4WVZA 1BEV3 2XL9A 3WD5A 4SLIA 3CJIB 1RMU3 1M06G 2CWSA 1HRI1 2BFUS 3UJOA 3ZSLA 4CDUB 2YMZA 4XFCA 5BPXA 3KCYA 4KU7A 1RB8G 1AR91 2D93A 1CAWA 1TQ5A 2WNEA 3H3UA 3FC0A 4YZ3A 2PHUA 5KXBA 2PA7A 4YGEA 2AGSA 5E89A 1R081 4XZPA 3BPZA 4GXLA 2HWF3 4HZFA 3TN93 5IK7A 2XLAA 1N1YA 1QJX3 1QHDA 1U5XA 1QY4A 5FFOC 1VIWB 4I0BA 1RMU2 1WBFA 3PLQA 4DINB 1GZWA 3AYAA 3M7AA 1RL3A 1DGRA 1OI6A 3AJZA 4IEXA 1G8WA 5E16A 4RS5A 4QGNA 2NM1A 4OVEA 3RYPA 2HWB3 2WQ4A 3SCHA 2XHKA 3NKTA 1S0EA 1AYM1 1QJX2 5C4WA 2DF7A 1COV3 1ZRCA 1IHMA 3VBFB 2ZBJA 3ZYIB 2OVUA 2PQQA 1LJ7A 4XXAA 2BBVA 1JHNA 4OHWA 2UY8A 2PHWA 4LBQD 1HQNA 2B5HA 4H3WA 2RS31 2HWB2 2ZZQA 4XJ9A 4EWEA 3O12A 4Q2FA 3AKQA 4CDUA 4QQ2A 1AR73 2ET7A 1DZRA 4LO4B 4BA6A 4M00A 1LOCA 4Y1YA 4UW3A 1H8TC 1RC6A 3DPRA 3MEPA 3NO8A 2RHPA 3DUIA 5KC5A 3OTFA 1I1EA 4A2UA 2WT2A 3M3CA 4JV4A 2UWCA 2OUHA 1AR72 1S0IA 4C1XA 1VBB3 2B9UA 1AX0A 4DRRA 1ZBA3 1H8TB 1ZRDA 2CL2A 4CEWC 5T50A 4P9YA 1Q8OA 3O5SA 4IQPA 4AI3A 1DDLA 2GC3A 1N1SA 4R4ZA 4Q0PA 3VKNA 3ES1A 2MEV3 4YW2A 4GB31 4XJZA 4QQOA 4FSJA 1I6XA 2AREA 1C5HA 4AVVA 1PNFA 4XF4A 4P9IA 2ZKNA 1RUD3 4YGCA 3SITA 4YZ5A 1BK1A 1REDA 4Q27A 5FMOL 5F6KA 5HI0A 3MYXA 1BZWA 1RUG3 5FREA 1W6OB 3VKLA 4ASMB 1V70A 4ZXKA 3LA2A 2RM23 1ZBA2 2Z5WA 3AX4A 3VUOA 1D2SA 1WLCA 3H7JA 3EJKA 1D4M3 1QNWA 2EA7A 4YARA 2O8QA 1WD4A 2VVDA 3AMHA 1IOAA 2MEV2 1FNZA 4B4PA 4NOTA 3MZHA 3M3QA 1MEC3 2R6QA 3GZAA 4S2GA 4EN9B 1RUD2 2RMU1 3FLRA 2WWSA 4N43B 4I2OA 2ZGQA 5EYYA 1RUG2 3FZ3A 4RR3C 4XBQA 1CIWA 2XJPA 1ULGA 2R30A 3N7JA 3W9AA 1FOD3 4PLMA 3AMPA 3EQEA 3LKJA 3K48A 4FVVA 5F1RA 1D4M2 1YFYA 2DVGA 1UN1A 2WSVA 3SLIA 2R061 5BY5A 4Z82A 1LULA 3UKVA 1H8TA