3VKOA

Galectin-8 n-terminal domain in complex with sialyllactosamine
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
147
structure length
147
Chain Sequence
b'NLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galectin-8
publication title X-ray structure of a protease-resistant mutant form of human galectin-8 with two carbohydrate recognition domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 31
structure length 147
sequence length 147
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3vkoA00
2AYHA 2ZGQA 5EYYA 3WDUA 1S0DA 1NLSA 2LALA 4ASMB 5GLTA 4UW3A 2DTYA 1WD3A 1YYNA 1LOFA 1MS8A 1G9AA 2BQPA 3HMYA 4Y1ZA 2P3JA 4CTEA 5GM0A 2NN8A 5JDBA 2ZA9A 2DVFA 2D6PA 5CA6A 4XIKA 4XMAA 2A6YA 4YZ1A 3WUCA 5T50A 1I3HA 1UKGA 1ULCA 3AZVA 4Y1YA 4YW5A 1BJQA 2EF6A 1N3QA 1QOOA 1HKDA 1WBFA 1LGNA 1VAMA 1JBCA 2ZKNA 1CONA 1SLIA 3FLRA 4FPHA 1GBGA 2R0FA 4XJ8A 2DVAA 4C1WA 4DRRA 2DU0A 3AYCA 1MS1A 1C1FA 3B9CA 3A4UA 3IKWA 2P3KA 2DVGA 1D0HA 1LGBA 2XB6C 2JECA 3NV2A 5E88A 3B00A 5DG1A 4YGEA 5GJ6A 1B09A 5H9RA 4XJUA 2A70A 1V6JA 1DQ4A 3WHTA 1IS6A 1C4RA 4M01A 2LTNA 3OBRA 3SLIA 4GWNA 3O0WA 1W6OB 1LHNA 3ILNA 1LEDA 3ENRA 2CWMA 3N7LA 3AP7A 4RL7A 4YW4A 5AVAA 1JYIA 3V0AB 3OBTA 4YZ4A 4DFSA 3WDVA 1Q8PA 3D4KA 5LK5A 3ZSJA 3R4UA 3RSJA 2A71A 2PHWA 2VY0A 1YIFA 3MW2A 1IS4A 3H0OA 1J1TA 1SBEA 4Q1PA 3SITA 3SISA 1JOJA 4JCKA 5E89A 3PVNA 2E7TA 1W6OA 1A78A 1JYCA 4XJ9A 5F5QA 5JOZA 1LGCA 2WJSA 1LOBA 4Y1XA 1VLNA 2PHUA 1S0IA 1N1VA 1W6NB 4ISRA 3AP9A 1S0BA 2RHPA 4C1XA 1YI7A 1ULFA 3V0AA 3WDWA 2VXRA 3ZSKA 3IPVA 3VKOA 4DS0A 3IMNA 3MEPA 2NP0A 1YO8A 4FPFA 4Q1RA 1DQ1A 2WSUA 1WW7A 1VALA 3RRDA 3OYWA 1LOGA 1LEMA 1N47A 3USUB 3WDXA 1I1EA 4OZXA 2KM2A 3V0BA 5IUQA 1ULGA 2A7AA 2ZZJA 2ZGTA 3BTAA 1W6NA 3MPPG 1CN1A 2TEPA 3R05A 4YW1A 1W0OA 1LJ7A 1LECA 2D3RA 1CVNA 2JJ6A 3N35A 3VKLA 3AK0A 5GZEA 3SNMA 2ZGKA 5SV8A 1HLCA 1BXHA 5L73A 3HN1A 2NMNA 4FP2A 4YG3A 2PHRA 4H55A 1G7YA 2DUPA 3A0NA 3USUA 2GDFA 2UURA 1V6LA 2OUHA 2ZGUA 5JOWA 4XJWA 1AXZA 3ILFA 2YV8A 3LCPA 1GKBA 3V64A 5EXOA 4BPZA 1Y7BA 2GNDA 4P14A 1AX0A 3AZZA 1WW5A 4WZFA 5GZFA 1WLDA 3O12A 2GN7A 2GALA 3W59A 1JN2P 5DZFA 1WBLA 3N3HA 4BMBA 4K21A 1H9PA 3WZ1A 3N7MA 2VW0A 2ES3A 1H9WA 2WT1A 3N7KA 2YROA 1KDKA 3MW4A 4HANA 3Q9OA 1F9KA 3M2MA 4YM0A 2NM1A 3WUDA 3INAA 2DVBA 4Y1UA 4XBLA 3T1LA 1GNHA 3FUOA 2SBAA 2V73A 4D69A 3AJYA 2XG3A 2A6ZA 2NZ9A 4WVWA 1WLCA 3WCRA 3PVOA 3B3QE 3GALA 1SLTA 3AP5A 2ZHLA 2A5ZA 2I2SA 4XBNA 2D3SA 3RS6A 2E6VA 1S0EA 1AX2A 2G4IA 2GMMA 1KITA 3AZYA 3BIWE 1Z0HA 1KRIA 5DUUA 1N1TA 3VKNA 2AGSA 4FPLA 1UN1A 2GNBA 3VKMA 1LOFC 2W39A 1HQWA 1LOEA 2WNEA 4LBQD 4YZ5A 1NXD1 2ZGRA 3T1MA 2P2KA 4AVSA 1V6KA 3ILRA 3AP4A 1FYUA 1VAVA 4YM2A 1GICA 1Q8VA 4YW2A 4AGVA 5JLVA 3UJQA 1MS3A 3FFZA 1R1ZA 2JKBA 2DURA 3PMEA 3B01A 1BKZA 1DQ5A 2FMDA 1GZWB 1SBFA 4L8QA 2EXJA 3WG1A 2ZGNA 2JE9A 1S0FA 5CBLA 4Y24A 4FQZA 2ZMNA 1ULEA 5IK8A 4YFZA 5EYXA 2GMPA 1YXWA 2WQZC 5T5OA 2DV9A 3QLQA 2CTVA 4FOYA 2FHRA 5KXCA 4YM3A 5H9PA 1GYKA 3PVEA 1N1YA 2EIGA 1G86A 2ZGMA 4FP3A 5DXDA 5CB7A 1CJPA 3AXEA 1DGLA 3ZXJA 2DYCA 2EAKA 3PJQA 4XDQA 5T5JA 2DUOA 1FAYA 5GZDA 1CIWA 2WKKA 3O5SA 4FOWA 5GZCA 1SBDA 3W58A 2YXSA 1GZWA 4FOVA 4ATEA 3AX4A 2NYYA 1G9CA 1DYPA 5DUVA 1AJOA 1APNA 3IPVB 5KXDA 2Q5TA 1QOTA 1S0GA 4UW5A 1UPSA 4AVTA 1VIWB 1KJRA 1MVEA 1DYKA 3I8TA 4P9WA 3OYWB 3WOGA 1W6PA 2WLQA 2P37A 3WLUA 2A6XA 4LBQB 4XZPA 4KBBA 4F83A 1CPMA 1W6MA 4U2AA 3V0BB 2C5DA 1O4YA 5GLWA 1LCLA 4RA0A 4FPEA 1WLWA 2PHTA 3VV1A 1UZZA 4LBJA 3WDTA 2ZABA 1QKQA 4JRAA 3WHUA 1WD4A 2ZGSA 3JUUA 1X50A 4NOTA 1DQ0A 1FATA 1FX5A 4Y26A 4YZ3A 2VH9A 1MACA 3LSEA 5EWSA 2E7QA 2VW1A 4Z8BA 2ERFA 2OVUA 4XTPA 5T52A 2Z42A 4AYUA 1ENSA 1SLLA 2GN3A 2DVDA 3WG3A 3LSDA 5E8AA 1URXA 4LBQA 2EXKA 1C57A 3A0KA 1GV9A 3DGTA 2W68A 2NMOA 1CPNA 4M3CA 1QNWA 2CWSA 3HR9A 1JUIA 2WT0A 3ZSLA 1RINA 1SACA 5IK7A 2VW2A 2UWCA 3FBYA 3M3CA 2ARXA 4R9CA 1W6QA 4FPKA 3L2YA 1FNYA 2ZMLA 1GNZA 3RG0A 1F5FA 1N3PA 1O4ZA 2W52A 5GLUA 3WG2A 2JDZA 2SLIA 2AREA 4FPGA 4JC1A 3WVJA 4BLIA 4HL0A 3IN9A 1AVBA 1WW6A 4PCRA 3O0XA 4LBOA 3O0VA 4IQPA 3AYDA 5GLVA 1KDMA 3OGGA 1Q8SA 5JMCA 5DG2A 3MW3A 1A3KA 1SCRA 4ZXKA 2D6OX 2ZMKA 4AWDA 1WW4A 3ZPYA 1S0CA 3SH5A 5T5LA 5F9TA 1FV3A 3NV3A 3UJOA 1Q8QA 1HDKA 2JE7A 2YMZA 1N3OA 3N36A 2H0BA 3DUIA 2ZACA 4FPOB 1C1LA 2A6WA 2D6MA 3OY8B 2R0HA 2YY1A 5HCFA 1GZ9A 2B7YA 3APBA 1IKPA 4BLJA 4DRVA 1OFSA 1AF9A 5KXBA 1BQPA 1MS0A 2CNAA 1QMJA 1LENA 2YZ4A 1G8WA 4Y22A 1MS4A 3T2TA 2CL2A 1EPWA 1DBNA 3ZXKA 4BM8A 2OW4A 4Y20A 4PF5A 2GNTA 4LBNA 2AR6A 3RQ0A 1LULA 4TYSA 3OY8A 1DZQA 3AYEA 1Z78A 4M00A 4FOQA 1JHNA 2AENA 1AXYA 1PZ8A 1SFYA 3AXDA 2WSVA 4LBLA 4YZ2A 4M3CF 3ZVXA 1YRZA 4CZSA 1HQLA 4UW4A 4BMEA 2PHFA 1MZ6A 1LHUA 4GA9A 3FLPA 4GKYA 1S1AA 4AGGA 3AFKA 3POWA 4XE9A 3WCSA 1QDOA 2A3WA 4XIOA 4YFWA 2CYFA 3M3QA 5T54A 4FPJA 4ATFA 2HYKA 4YW3A 1LU1A 3JU9A 1ZA4A 3UL2A 3AZXA 3AJZA 2CY6A 4XILA 2ZGLA 5H9QA 1QDCA 2A3YA 3N7JA 4PQ9A 1OKQA 2PELA 4Q2FA 2EALA 4YGCA 5JOXA 1S0JA 1W6PB 3AYAA 4R9AA 4WV8A 3UK9A 1AXKA 3B69A 1W6MB 3VKFC 5H9SA 2JD4A 1PZ7A 3WNXA 4XHBA 3I4IA 1MS5A 1CQ9A 4Q26A 3NV4A 1V00A 4R9BA 2ZHKA 3WV6A 4BQ1A 3RMYA 5DZEA 3BODA 1G9DA 1D2SA 1BZWA 1BYHA 2UU8A 3KM5A 4I30A 1LU2A 2ZBJA 3M3OA 1G9BA 2D6LX 1A8DA 1SLCA 1KJLA 3OJBA 1AX1A 1ULDA 4YLZA 5T5PA 2D43A 1LHVA 5GALA 2P34A 2W08A 4YM1A 1UMZA 4XYXA 1GLHA 3WDYA 3CNAA 4K1YA 4M3CB 4U36A 1UZYA 3ZXLA 1MR5A 1AZDA 4XBQA 1AJKA 1GZCA 1MZ5A 1Q8OA 3RMXA 1Q56A 4XXPA 3ZYRA 2ZHMA 2A75A 1H30A 1UX6A 1W6QB 4Q27A 4BOWA 1KQRA 2WT2A 2R49A 4MYEA 5DUWA 2ENRA 1MVQA 5JOYA 2DTWA 1FNZA 3WG4A 3TAYA 3VUOA 1ENRA 1JW6A 5FREA 2ZGOA 4FPCA 4XOGA 1WUVA 3U4XA 2A6VA 4ITCA 4TZDA 3C2UA 3OPZA 2AH2A 5FRAA 5GZGA 4W65A 1SCSA 3D6EA 1LOAA 4LBKA 4XJZA 1DIWA 3V65A 3QCWA 4FPYA 3POSA 1V6IA 1TEIA 4P9XA 3POYA 4YG6A 5HCBA 4GXLA 1UL9A 4GKXA 4M3CE 3ZXFA 1FV2A 1F31A 1ENQA 1JXNA 1LHOA 1XQNA 2D7FA 4Q8LA 3SH4A 1QOSA 2P3IA 2R1DA 5CNAA 1IS5A 2D3PA 2GMEA 5DZGA 1PZ9A 2GNMA 2VU9A 4XXAA 4K20A 5DUXA 4XMIA 1SLBA 1UAIA 2UWAA 1QGLA 1RIRA 2C9AA 1N1SA 1IS3A 1RITA 5CAZA 1MS9A 2D44A 4WVVA 3KQRA 4XTMA 5IT6A 2R1BA 2EXHA 1V6NA 2ZGPA 4FQ4A 3IM0A 3M1HA 4UW6A 2ZAAA 1DLLA 5IK5A 1QNYA 1QU0A 1LODA 2DWRA 3GNEA 4Y22B 3AZWA 4Q8KA 4CRQA 1ZM1A 4XHXA 4YGBA 1W0PA 1OQ1A 4AVVA 2D6KA 4DPNA 3D5OA 3TB0A 2R16A 4K1ZA 4AGRA 1IKQA 3ASIA 4Y20B 4ZKTB 1DQ6A 4PBPA 2OUJA 1QF3A 1V6OA 5JVVA 1DQ2A 1LTEA 2PHXA 1DHKB 1ONAA 2AUYA 3BOPA 3ZXEA 2E53A 2DU1A 3ZYPA 1WCSA 5IK4A 4FVVA 1CESA 5KXEA 1GSLA 2V5YA 1LESA 1SLAA 2ZHNA 2UWBA 3ATGA 4SLIA 1DFQA 1U0AA 2E51A 2A3XA 2D6NA 4XJAA 1V6MA 4ISQA 4YGDA 4PBOA 1LOCA 2EXIA 3R4SA 5GLZA 5HCAA 3SH3A 1IOAA 4YG0A 3NV1A 4GALA 1G9FA 3AP6A 1LHWA 3ZSMA 4DQAA 5BYNA 1GANA 4NO4A 4P9YA 4Y1VA 3M3EA 2DUQA 4GWMA 4R9DA 1CR7A 3FLTA 4LBMA 2VUAA 3NWKA 5T55A 3FUQA 2ARBA
chains in the Genus database with same CATH superfamily
1ODMA 1OVPA 2AYHA 4AAPA 5GLTA 3ZYBA 2IWGB 3HD8B 4Q4W1 3S5AA 4UXAA 2BERA 2JG8B 3QACA 4HKWA 5FP7A 3THTA 5BV6A 1P8JA 4DOUA 4AL9A 5EJZB 1PO22 3NAPB 5C70A 3BVCA 3DKQA 1LR5A 5C3QA 4MHRA 3OF1A 4XMAA 5A7PA 1ALYA 3WUCA 5T50A 1UKGA 1X9PA 3I2HA 4JKLA 3VL9A 2QQLA 3HEIA 2XBO2 3ZDSA 4H14A 1WBFA 1RB8G 1K5MC 1RUC2 3AL6A 2VMFA 3Q8CA 4NHMA 1I9RA 1OKOA 4NRQA 2I45A 1C5IA 2J1VA 1MS1A 1C1FA 4EN0A 1YFUA 2CGOA 2XBO1 4KU8A 2DVGA 2PQSA 2HWF2 1RUC1 1V9U1 4Q4Y2 1I6XA 3MGUA 4ES9A 5K0UB 1MZFA 2K46A 3ZDVA 5ACA3 3K77A 4UT5A 5LRRA 4XUPA 4Q4Y1 4XJUA 1RVF3 1IS6A 4M01A 2B46X 2BPA2 3SLIA 2GAUA 1RUNA 3O0WA 2OA2A 1HIXA 3ILNA 5J36A 5F5AA 4ZZ5A 1GWMA 3OEAA 3HT2A 3AP7A 3OBAA 4RL7A 5FK8A 4AK3A 3MBWA 5L9VA 1TMF2 4UBHA 4LMFA 3OBTA 1Q8PA 3GCWA 3RSJA 3NNFA 4AI3A 1POQA 1ZNPA 2WNUC 1W2NA 2VNVA 3LDBA 5D21A 2VY0A 4KGGA 5L9BA 4AAXA 1Y9GA 2B45X 3FN9A 3SISA 5E89A 4LO8A 4DO0A 4AFMA 1Y3TA 4XCBA 3NSTA 3I59B 4Y1XA 3UKTA 4ISRA 2ZEZA 4RFT0 1HRI1 2BOJA 1ULFA 1W8HA 1PGW2 5LBFA 3THPA 4RGAA 3IDCB 3IPVA 4NIDA 1AR62 3NO8A 1JU4A 2KA3A 4FPFA 4RYDA 2WBKA 5JCTA 1DQ1A 2WSUA 2XJTA 3RRDA 3OYWA 3WDXA 1LEMA 3USUB 1VRH1 4YVSC 4AQ2A 4OZXA 2QDRA 3P6BA 2W47A 2LS6A 2QE3A 2W1SA 1R64A 2A7AA 2PQQA 2ZZJA 5A6ZA 1AYN1 5FBJA 2V4VA 1W6NA 3F95A 1CAWA 2ZEYA 2TEPA 4YW1A 1QQP1 1W0OA 5C8WA 5FPXA 3PTRB 3ZX7A 1ZZ9A 5GZEA 4JAAA 2ADDA 5SV8A 4I0AA 2W9XA 2RS33 1KS4A 3HN1A 3K48A 2NMNA 4YG3A 2PHRA 5FO8B 4H55A 3ZR5A 1BEV2 4UFHA 2UURA 5IATA 5K0UC 2XPJA 2OUHA 2N7GA 1YFWA 3MFCA 3ILFA 5BY5A 4N90A 5B2GB 5EXOA 2X10A 3VL8A 4BPZA 1HV0A 2C0ZA 4Q0SA 2DBNA 2GN7A 2IXIA 4IE7A 4NHYA 2ZEXA 3O1UA 5FXVA 4ZY9A 5KWRA 1MZEA 2RR13 4YYOA 1H9PA 3MICA 4NE9A 3WNMA 4QPGB 4FXGB 2ES3A 2HWB1 3OUHA 1KDKA 4B3NA 5FZLA 4CXXA 1NY72 3MPBA 3UGHA 4C0HA 1B35B 2LRPA 3WUDA 1X33A 2X5IC 3INAA 4M4RA 4Y1UA 2RDQA 1XU2A 1RHI3 2J7MA 2VECA 4D94A 2V73A 2WZR3 4OMCA 5A3WA 4EN6B 2XG3A 4CU6A 3FC0A 5IVJA 1XSRA 3PVOA 4AEKA 3B3QE 1SLTA 3AP5A 3P3NA 5FZGA 1VBE3 2I2SA 1F35A 1ZBE1 4NVPA 3KHCA 3SHRA 2QQPA 1CAXA 2E6VA 1Z0HA 4GAZA 2ADEA 2YPJA 2ZX4A 5DUUA 4E4ZA 4GWJA 1AR72 2W3JA 2AGSA 4FPLA 2FZ1A 1BMV1 1HV1A 1UN1A 2GNBA 5CKMA 2FDIA 4GMP3 4ARXA 4YZ5A 3KCXA 1NZIA 2P2KA 3I3DA 4AFBA 1FYUA 2LUWA 1VAVA 3H1MA 3T2PA 4XURA 3UJQA 1EAH1 2JKBA 3K46A 4QU1A 2WO2A 5DAWA 2JENA 2BW8A 1DLCA 3B01A 2VQAA 4ORFA 4XDPA 1WCDJ 3X29B 3IMMA 4JQRA 1W9YA 2JE9A 3LAGA 4Y24A 2V72A 3ZYJB 1JZ8A 1L7QA 1ULEA 5IK8A 2HWE3 5FYBA 5EYXA 2GMPA 1YXWA 2JD9A 5FOJB 3IBMA 5T5OA 2DV9A 3Q8BA 2CTVA 1POV0 2FHRA 2V09A 3SCGA 3NAPC 3PIGA 3WD5A 4YM3A 2IXKA 4BCUA 1GYKA 4CP2A 4URAA 1G86A 1W3XA 1WA4A 3Q8EA 5FYVA 5CB7A 1NA1B 1F2NA 2DYCA 3B7MA 3CZUA 5T5JA 1OH3A 4UBGA 4FOWA 2WKKA 3KT7A 5FJHA 3KV4A 1GZWA 1SMVA 2NYYA 1JZ4A 1APNA 3GZTB 3IPVB 3ACHA 1X82A 3CZJA 1ULPA 4GH4B 1KJRA 2HJIA 1K12A 4PDWB 1XE8A 3K3OA 4TLGA 3OYWB 1UZ0A 4K8RB 4OHYA 2JDAA 3WLUA 2A6XA 1VBD3 4KBBA 2UY9A 4JGZC 1CPMA 2RDNA 4X8PA 2RS13 3SEEA 1IQAA 1QJY2 4LNVA 2XHNA 1WLWA 1GP4A 4FPEA 1UZZA 1CAWB 4JX0A 4OVEA 2ZABA 2PLV3 4YSFA 4YPJA 4AFCA 2K9ZA 1W99A 2XONA 3PJYA 1WZXA 1POV3 2VH9A 4D6SA 3LSEA 1RUOA 5EWSA 2E7QA 1FPN2 3VBFA 3VBRA 4Z8BA 1WMEA 1CJDA 3BB6A 5JXIA 1JH5A 4DY3A 1SLLA 2ZAHA 2DVDA 1UIKA 1RUI2 1URXA 1XJAA 1FPN1 2QTWB 3A0KA 1J84A 4K9SA 4LA2A 1RL3A 5IVEA 2NMOA 3ZYGA 4M3CA 2PMWB 1HB4A 5FIXA 2H0VA 3HJRA 2WT0A 4KGQA 4IEXA 4JDOA 4QKFA 2VW2A 3FBYA 4R9CA 4GZ9A 1W6QA 2WS92 3OBZA 4XQDA 5C7GA 2FQPA 1GNZA 1RXGA 3MF9A 1Y9MA 1SG3A 4P9IA 3ZN6A 1NXMA 2YGMA 2VBPA 4A42A 4FPGA 1KGYA 5L7OB 3IN9A 4W8JA 1AVBA 5EJ1B 5AC92 3SMHA 3DKWA 3VD5A 1O8PA 2CV6A 4IDZA 3ES1A 4HG6B 1Q8SA 5CFDC 1D2QA 3FX3A 4B1MA 5AC91 1A3KA 3POEA 3CKHA 2D6OX 4NRMA 2ZMKA 2ZKLA 3J7MA 1DDLA 1W8OA 4UAPA 3O1MA 1XB9A 3UJOA 1W06A 2YMZA 1HDKA 2W1UA 2VQ0A 3DUIA 2Z69A 3LA7A 3VZLA 4ASKA 4COWA 3QD6A 5SV5A 2KXLA 3APBA 2VPVA 1IKPA 5JMOA 2QQIA 4LQRA 4XC9A 4LITA 5K9YA 3R0RA 2AZ5A 3MIFA 5FO7B 3GBGA 3N9MA 4EWDA 5HV4A 4OQ8A 4HONA 4Y22A 3T2TA 1RUG2 1W8WA 4QPGC 2R041 3RDIA 1DBNA 2MHFA 3A7QA 4NPLA 1RUF1 2Q8CA 3NJVA 1QJX2 3JXSA 2YG0A 1CZTA 2HLEA 3BKZA 3C7GA 2HEVF 1B35C 1NG0A 1LULA 1GP6A 4YVWC 1D4M3 3OY8A 4RHV3 3FHIB 2DDUA 2PYTA 2VR4A 4M00A 1QJX1 2NPIA 3P3PA 2ZX1A 1AXYA 1OQEA 1GOFA 3ACFA 3AXDA 3DN7A 3ZVXA 4CZSA 2JDPA 2H6BA 2HBTA 2J1AA 2CDPA 3WW3A 3FLPA 4AGGA 5JZGB 3H7JA 3I7DA 3WT3A 3H3ZA 2JXAA 3H50A 1ZREA 4EYUA 3M4FA 3E5UA 4FPJA 4D7SA 1RUH2 2QNKA 2HYKA 3LDKA 3MUY1 4Q4X2 5G05L 3TBDA 4ATFA 4YW3A 3PHMA 4O61A 3KB5A 3AZXA 3AJZA 1VPHA 5C3PA 5T3NA 3N7JA 1RUH1 3LA2A 1PK6A 1X36A 2WZEA 4R4XA 2NLRA 2XLAA 4Q2FA 4RN5A 5FJKA 1RGSA 1O5LA 1VBA2 3AYAA 4MH0E 4TTGA 1K5MA 5FXZA 3ZFFB 4Q4V1 3B69A 3ZIWA 3KCCA 1PZ7A 4F7ZA 5EFUA 4XHBA 2AEZA 4IV3B 4P5HA 3N9NA 2XMLA 4LIVA 3MZHA 5F5IA 1R082 1JODA 2ARBA 2Y60A 3U4SA 4IEVA 1V00A 2ZHKA 1YQ8A 3LDRA 4BQ1A 3RMYA 1G9DA 2OPKA 1BYHA 2WYSA 5F3IA 1H8TC 5FZKA 3VBRB 4XFHA 3DCQA 1G9BA 1HQNA 3BPZA 1SLCA 1O4TA 1AX1A 3OJBA 4YLZA 2D43A 4CCKA 1UMZA 5A7WA 1NA1C 2BUKA 4M3CB 4U36A 3DXTA 1UZYA 3PLQA 3QH7A 4YARA 1AZDA 4AW7A 5IVCA 3TYJA 2VZVA 1Q8OA 4XEZA 5LK7B 1WMFA 2FMYA 2EIDA 1W6QB 4Q27A 1WKYA 1KQRA 2FDKA 2R49A 2WNUA 2ENRA 5CADA 1MVQA 1ZRIA 3VHOA 2DTWA 4RD7A 3WG4A 2E32A 3TAYA 3ZLIA 4LIUA 1UCXA 2A73B 4ZHNA 3RVHA 4PDWC 5D2AA 1M06G 1OQDA 5KHHA 3C2UA 2AH2A 5FRAA 2VVDA 3H1YA 3DL3A 4W65A 3D6EA 4D0QA 1JZ2A 1W8FA 5CAZA 1DIWA 2HKXA 3MLKA 5A32A 1JYVA 1TEIA 2G9GA 3AKTA 5HCBA 3I2FA 5CIRA 4GKXA 2W94A 1OF3A 1JXNA 1ZZCA 4Q8LA 1YFYA 2P3IA 2R1DA 1S4CA 1TG7A 1IS5A 1XU1A 1PO23 3KCYA 4KH9A 4YVSA 1RMU3 2VD7A 2IVJA 1RIRA 4AXOA 3LCPA 5A7OA 1RITA 1MS9A 2WAAA 1WWYA 1R1A3 1RUC3 5F3CA 4S2GA 2ZGPA 2EXHA 2QJVA 3M1HA 4MHUA 3KMHA 4UW6A 1ST8A 1DLLA 1EYBA 5C9AC 1SEFA 1C28A 2DWRA 2HWF3 3GNEA 3WP4A 4Y22B 3AZWA 5B4NA 2CSGA 4CRQA 1UU6A 4DUXA 1ZM1A 4CCOA 3SCHA 1W0PA 5G04L 2D6KA 2VAUA 4UFLA 5KR7A 1U5YA 3ASIA 5K0UA 4CEWA 4AHWA 1DQ6A 1GQHA 4XPVA 5JVVA 3T4VA 2FD8A 2HBUA 4RQPB 1DZRA 4LKSA 5L7OC 1VRBA 3GZEA 1ONAA 1OPOA 1GUIA 1AHSA 2B9VA 2D93A 3FL7A 5A80A 4AI9A 4J1WA 1ZX5A 3ZXEA 3BGAA 5DAXA 2E33A 4Y5SA 3WQBA 1L7LA 2QQJA 3D0JA 3K2OA 1GSLA 1TMF3 2OKXA 3SCFA 3SXWA 1LESA 3KZ4C 3MF6A 3BUCA 1QJU3 2R061 1U0AA 2ATFA 1YC61 1O3TA 1BVVA 2ET7A 3HVDA 3PU3A 3O1RA 1LOCA 2JG9A 5E1RA 3R4SA 2X5IA 1V70A 4RFRB 1MQTB 5EZWA 5F6KA 5LBBA 3U0ZA 3OD0A 4PF1A 3WQ7A 5FO9B 2RMU1 4QMAA 3ZSMA 4NO4A 4Y1VA 5FLHA 1UOGA 2HYXA 5CFCC 1AL0G 4R9DA 4WVZA 1RTVA 3FUQA 3IAPA 3RWKX 2EICA 1LODA 4EV0A 3N4MA 5EYYA 3WY6A 3VZNA 3JD72 4W4ZA 1AR63 3PL0A 2C4XA 3FWEA 4LUKA 4UW3A 4C90A 1YYNA 4BXSV 3E1F1 1RUE1 2BQPA 4AOCA 3AKSA 1F8VA 5LW9A 4XAEA 2WIIB 1Z7S1 2DVFA 4XIKA 4OCTA 2A6YA 2RJKA 3UYJA 4CDUC 4YZ1A 1ULCA 4YW5A 4Y1YA 3AZVA 3HAGA 5HCHA 4GB32 1N3QA 4AQSA 2ZS6B 1LGNA 3NMBA 4GJYA 5IYYA 1CONA 1HRV1 1UWWA 3LOIA 5FZEA 4XJ8A 4DRRA 5JZGC 2DU0A 3AYCA 4FXKB 3B9CA 4GULA 4AEDB 5J1XA 5LZ6A 4GB31 3N9OA 1PO12 3IKWA 4QQ2A 1D0HA 1LGBA 3RZJA 1CX1A 2JECA 1BEV3 3NV2A 3U78A 2RDSA 3B00A 4LUMA 5DG1A 4CUAA 5HI0A 1CAVB 3NAPA 4KNCA 2Q1ZB 4NIAA 1O3SA 2D40A 4META 3WHTA 5LEJA 5FYUA 4Q0PA 2LTNA 3OBRA 1FXZA 3WW4A 1SDDB 3V56A 3HBKA 3ZFFC 1PX3A 3ENRA 2C24A 2JB4A 3SEPA 3S57A 3N7LA 5FZMA 4LK7A 2MEV2 4IV3C 5A32B 3EBRA 1W9TA 1JYIA 1KFXL 2D98A 3NKTA 2VCCA 4QXHA 3MO4A 3V0AB 1YQ5A 1D0GA 1AUYA 3WDVA 5LK5A 3D4KA 3ZSJA 2MEV1 1H6YA 3R4UA 4TLFA 1F4AA 2Y6KA 1ZRRA 2BNOA 3MW2A 1JZ3A 3H0OA 4PLOA 4Q1PA 5FYTA 1YHFA 2WWUA 1A78A 4A7YA 1CAUB 3ZM8A 1COV2 1JYCA 2JIGA 1ULOA 1QJEA 2VUJA 4QKBA 1UOJA 1N1VA 1LB2A 3WQ1A 4Y5TA 5ERLA 2RHPA 3TEZA 2W87A 2Q8DA 3WDWA 2VXRA 3E97A 1C8M2 3VBOC 2GP3A 3LPFA 1AR73 2RJ2A 3ZSKA 4NHLA 4QX7A 3ABZA 1S2EA 3VKOA 4LOTA 1OLRA 4IXLA 1NUKA 1AR92 4UFKA 2DCZA 3FZ3A 1VALA 4XQ4A 2R071 4XW3A 1STMA 2YHJA 1JTZX 5IVVA 5C8CB 3V0BA 5A33B 2GH8A 1ULGA 5LB6A 4UOJA 5DDJ3 2D5FA 1XE7A 2YC4A 2W95A 3LFMA 1NCRC 1CN1A 1QJZA 3A23A 3WF4A 5DMYA 3AMQA 2D3RA 2DCYA 4IEYA 3IZOA 4Z82A 4WM7B 2ID4A 2XKOA 3ZFGB 4CCCA 3W9AA 4DXSA 4FP2A 1AL22 3J4UH 2HWC2 1G7YA 2X5IB 4LLOA 3USUA 2GDFA 1V6LA 1U5ZA 2BP6A 4RGKA 4XJWA 3O1PA 4R4ZA 1XYOA 2WYFA 1HXS1 1GKBA 1U12A 2Z5WA 1J58A 2RS52 1Y7BA 1XNCA 3V64A 5GZFA 1WLDA 3O12A 5CFDA 3VBHB 3POGA 3IDAA 4OI2A 5F8PA 4QX0A 1WCUA 3EO6A 4TWTA 4BMBA 4K21A 1PIV2 4BIFA 3N7MA 1ASJ1 1OD5A 2E63A 2WFF3 5JIAA 1QJFA 2WT1A 2Z79A 3AKRA 4LHNA 3Q9OA 1ZBA1 4ZZ8A 4QHBA 2VOKA 4BQXA 4FT8A 4FCAA 2RM22 2VCMA 3VHPA 4AI8A 1S55A 2WZPP 4RQPC 2J1EA 3FUOA 2SBAA 4D69A 2DCKA 4TSVA 4G4FA 1QJY3 4OHZA 4QPIB 1H2KA 4Q4W2 3BI3A 2F17A 1OURA 2P1BA 4NUBA 4QPGA 1W90A 2R6QA 5FOBB 4XBNA 3I3BA 3URFA 2BBVA 4J25A 4K8FA 3RS6A 1S0EA 2G4IA 1XNDA 1R091 4HK9A 1B35A 4YVWA 4FFFA 5I8TA 4IE4A 1MQTC 2VOXA 1RUI3 1LOFC 5FKCA 2OT7A 5C4WC 3KSCA 1NXD1 2ZGRA 4HSLA 3T1MA 4W6XA 3ILRA 3AP4A 4BA6A 2GH2A 4YM2A 1Q8VA 4QXKA 4YW2A 3I2DA 2V5DA 5LA2A 4JQTA 2NQYA 3FMGA 4IE0A 1V9U2 5KBFA 2BOIA 2WS93 1D7PM 4CEYC 3J7NA 3PMEA 2EIBA 1GR3A 4QAWA 1DQ5A 2FMDA 2VTFA 2EXJA 4MO3M 5CEHA 4L92A 2ZMNA 1OH4A 4KU7A 4Y3OA 2D97A 2WQZC 3KD4A 3QLQA 1Q43A 1LAJA 4LKDA 3FE5A 2VTXA 1PVC1 5FY7A 4AQ6A 5KXCA 4FAGA 3MUZ1 5H9PA 4JGZB 4K7JA 2GC1A 1N1YA 3PVEA 3RPQA 1W3VA 2OPWA 3G7DA 3AXEA 3RI9A 5FMBA 5IAVA 3PJQA 5A7SA 1FAYA 1CIWA 5A3TA 3O5SA 3W58A 2YXSA 1E5RA 1G9CA 5FZ4A 3VGIA 5DN2A 4AEDC 4JTOA 2OQ6A 2WWJA 1H8TA 3T0AA 4A7KA 3TEWA 1QOTA 3AKPA 4I09A 1VBC1 4IGQA 1RYYA 3BU0A 3JQWA 1NT0A 3M70A 1MVEA 4E9KA 3I8TA 1OT5A 3WOGA 4B4QA 2P37A 1HRI2 4XZPA 4LBQB 1NA1A 2JWPA 3AC0A 5FZDA 3V0BB 1YUDA 4S2DA 1J3RA 1RUG3 4RSUA 1YCIA 4MZUA 5APAA 5A7QA 3VV1A 2JDYA 1QKQA 3I2JA 2ARAA 1X50A 3N9QA 4KG8A 1FATA 1FX5A 1JU3A 3FHQA 3GCXA 4QGMA 1VRH2 1MACA 5CG8A 4DUVA 3C7FA 4LO5B 2WFPA 4GH4A 4XTPA 2LM3A 3GF6A 3RZZA 3VBUB 4AYUA 3RZGA 4PDWA 1AYN2 1JZ7A 1REEA 5FYSA 2DCJA 2XJUA 1FT9A 4HFSA 5FPAA 1WA6X 1NX9A 1QQP2 1UMIA 4XFFA 2EAAA 3GYDA 4OI0A 5TSWA 4D3WA 3HQUA 4XF1A 4DEVA 3BPSA 2CWSA 4WVMB 3HR9A 1VE0A 1JUIA 3ZSLA 5CFDB 3J7LA 1DYOA 1S2BA 2IXHA 1PM7A 2QQUA 2HWD1 4OULA 2UWCA 2Q4SA 5J3UA 1RUH3 5KC5A 4Q4X3 2Y26A 4XF9A 3L2YA 2EA7A 1FNYA 2ZMLA 1JS9A 1C5HA 2J1UA 2W52A 2JDZA 1O8SA 4IGPA 3GGLA 1UX7A 4JC1A 1VBA3 4OQ9A 2A1XA 2ORZA 4HL0A 5CYYA 1WW6A 3O0XA 1LRHA 2QZ2A 1EV12 3IDEA 4I3GA 2CGNA 3O0VA 5C8CC 1KD7A 3CL1A 2HWB2 5C9AA 1AR81 4AR2A 1R083 5DG2A 3H9AA 3MW3A 1SCRA 1OMIA 1EV11 3C7OA 3HBZA 4IEQA 2DF7A 2E9QA 4WM7C 3ALQA 3ZFGC 1FV3A 3NV3A 4P00B 2LROA 1N3OA 1YIPA 4YVWB 1ZYBA 1JZ6A 5L7OA 2ZACA 1W05A 2D6MA 2R0HA 2YY1A 5FPZA 3J8F2 2TNFA 4BLJA 1ZBE2 1OBNA 4HMZA 5LBCA 2VZSA 3LB9A 5FCCA 1IPJA 3VBHC 1BQPA 2CNAA 1MS0A 1LENA 1OUSA 1J1LA 2WLPA 4LHKA 5FLJA 1XNBA 4CVUA 3J8F1 3WNOA 1BMV2 5BNPC 5E6HA 3WP5A 1EPWA 1UY4A 3CHXA 2VMIA 4XVHA 5FAXA 4IEOA 2Y8KA 5A3LA 3KGZA 4UYBA 3H42B 1AYM1 4FTBA 4JZRA 3AYEA 5AVPA 1EAH2 2XGXA 1Z78A 3H8OA 1J59A 1ZRCA 3C8XA 4LBLA 1XYPA 1PM4A 1UW8A 1HQLA 3B02A 4UW4A 4F3JA 2PHFA 2FDGA 2G1MA 3P1IA 4QPIC 1OLQA 4C91A 3B9IA 4D7TA 3ZYIB 1FOD1 1K42A 1IPKA 1WGPA 5T54A 5F2WA 4LHLA 4DXRA 2Y38A 4XF0A 5FY4A 3NNLA 1H8TB 4KWKA 1ZA4A 3UL2A 2CY6A 3FHAA 2MPFA 4L0PA 2A3YA 1OLMA 4CDUA 2XJSA 5A70A 1VBB2 2EALA 4HKLA 4YGCA 3OPTA 5F32A 4LTAA 5JOXA 4NROA 4E27A 3OGSA 2GSYA 4H3WA 5IWFA 3I2OA 3VKFC 5JZGA 3EHKA 5H9SA 3KT1A 1VBB1 2K2SA 2XVGA 5LATA 1HN1A 1SPPA 1CQ9A 2XQRA 4BE3A 4CA9A 3WNKA 4R9BA 3WV6A 2BU9A 3KV6A 3PUQA 3O14A 5A3NA 4RGGA 1D2SA 1F4HA 1FMD1 3ZN5A 4IEUA 4L11A 4HVRA 5IW0A 1LU2A 1Q3EA 2VE1A 2B5HA 2YBPA 3M3OA 2XKPA 3BOWA 5JXHA 1KJLA 4FTEA 1O6UA 3IIAA 1HB3A 1IHMA 4P9LA 3ZFFA 1C3HA 2BWAA 2W08A 4JTNA 4MXVA 4QKNA 4XYXA 4TXWA 1GLHA 2XJVA 4YM1A 3WDYA 1RUJ2 3TN91 1XRUA 4A44A 4IV3A 4MXWB 1HB1A 2XJQA 3ZPOA 1AJKA 3MIBA 3RMXA 1HW5A 5FZ6A 1U5XA 4XXPA 2B9UA 1RUJ1 2ZHMA 4XFBA 1TME1 1UYXA 2OQ7A 1MEC2 1DGWX 2WT2A 2GC3A 5DUWA 1FNZA 1ENRA 1JW6A 2ET1A 5BNNC 3W5MA 1MEC1 2FCTA 4FPCA 1GMMA 4NMIA 1SHWB 3WQ0A 2YBKA 3GM8A 4QDRA 4RS5C 2QQWA 4I02A 1LOAA 4LBKA 2C6SA 4CP1A 1LKNA 3JD73 3VZMA 4BJ0A 5C9AB 2F4LA 2P6CA 4FPYA 4CU9A 1K5JA 3VDCA 4Z1VA 1S2KA 4GXLA 3M7AA 4FTSA 1IGOA 1VAKA 2VMCA 1X8MA 3SH4A 5FZBA 4B4PA 1QOSA 2ZEWA 2WWSA 3ZYHA 1W2TA 4NHXA 5D8AB 3GHNA 2D3PA 5FMOS 4KQ7A 5DZGA 1A6CA 1PZ9A 5FTTC 5BUVA 5I93A 1LNSA 4XXAA 4ZS2A 4K20A 5DABA 5DUXA 3VBUC 1SLBA 5KXEA 3PIJA 5ANQA 2C9AA 3JBG3 4OHVA 3K4DA 4XF4A 3RYPA 4DUWA 4WVVA 4N7UA 4QXBA 2KR2A 1NCRA 2VZTA 1H8VA 2R1BA 1V6NA 2VMEA 5F7UA 1T2XA 2ZX0A 4N43C 4J6GA 1PO13 1QNYA 4JDMA 1DGRA 2PHLA 3KVAA 1W03A 4CP9B 1JOPA 3TB0A 2R16A 2VBBA 5FZOB 4AGRA 3UV9A 3NNJA 4LE3A 4MADA 1XNTA 3J7HA 4AG4A 5IFTA 5LY2A 3SC7X 1US2A 1V6OA 1WCQA 1DQ2A 2P3YA 1GWLA 5ACA2 3DPRC 3RZMA 2VULA 2AUYA 3G6JB 3T08A 4QX5A 5CG9A 3E5QA 4EN9B 5CFCB 3S7IA 1WCSA 5C33A 2HH9A 2R042 2WUHA 5ACA1 3LF7A 1RUF2 4FVVA 1XYNA 4GWIA 1GZTA 1RVF1 3PUSA 1VMHA 2E51A 2D6NA 4FO9A 4YGDA 1GOGA 1W8UA 4CCJA 4N7IA 1O3RA 2VO5A 5ABJB 2WNVC 4RQPA 2YYOA 5LWBA 4I3PA 3NV1A 4GALA 4NAMA 4NR1A 5CISA 1G9FA 1COV3 4CDUB 5LA1A 5FXWA 1LHWA 5DAPA 2VBDA 4DQAA 1GANA 4P9YA 4XFIA 3IWZA 3LOBA 3WNNA 2P6HA 5T55A 3FLTA 3W5NA 2VUAA 4N8MA 3OOXA 1C8M3 1UO9A 3WDUA 1S0DA 1SPPB 1NLSA 3GXUA 5L36A 3K51A 4UF0A 2KD7A 1IPSA 4XETA 2R32A 5FUNA 1AR93 5FZAA 2DTYA 5FZ8A 1MQTA 1WD3A 4BQ5A 1GFF2 1LOFA 1MS8A 1G9AA 3E6CC 3HMYA 4Y1ZA 5C4WA 2IUWA 2P3JA 4CTEA 3JCIA 2YB7A 2B39A 4Q4V2 5I0SA 2VMDA 5JDBA 5FLIA 3NNGA 2TBVA 2D6PA 2VVEA 4CUCA 3LIGA 3HN3A 4QQHA 4BIOA 2O8OA 1IQDC 3T0DA 3OGRA 1KFUL 3UGFA 4AFDA 3FJSA 3RFRA 4Z2WA 4WM8C 2ZJCA 4CEYA 1JBCA 2ZKNA 4V1PA 4KWJA 1GBGA 2R0FA 4C1WA 2DVAA 3GZAA 3EQEA 3UT0A 2Q1MA 2Y6HA 1AL23 2P3KA 4JHTA 1WLTA 2HWC3 4D8MA 4ET7A 2XB6C 5GJ6A 2X09A 4ZU4A 5H9RA 4CSWA 2RS53 5FY0A 3KVBA 1DQ4A 2OX0A 1C4RA 5FPBA 3WNLA 2JDKA 1PHMA 1ZZBA 2RS31 4MGZE 4CCDA 2HEYF 3TRSB 5JAXA 1W6OB 3CBNA 2G9FA 5A7NA 5CZKA 1PIV3 3USSA 3KLSA 5IFPA 2PTMA 4AEDA 2RR12 3VBOB 5A6QA 2GC0A 3DYOA 4YZ4A 2Y0IA 1ZZ6A 3AL5A 4DFSA 3VD7A 4EWAA 2VXJA 5A1LA 2VG9A 4HOOA 1CAVA 2RG4A 2RM23 5FQ0B 1UOFA 2RR11 5CKQA 5F3GA 1YIFA 5CKNA 1QXJA 3FFQA 4BH9A 5KC6A 4NIHA 4XABA 5FXXA 3SITA 1JOJA 4JCKA 3PVNA 2E7TA 3B93A 1RHI2 4ZONA 2PAMA 4Q4W3 3MLLA 4XJ9A 4MGSA 3OGVA 1LGCA 3RWNA 5JOZA 1LOBA 1NCRB 2Y6LA 4C1XA 1YI7A 1RHI1 3V0AA 2WZR1 2XVKA 3N9PA 1TE1B 1Y4WA 5L9RA 5FZ7A 4DS0A 2WN2A 5LBEA 2Q8EA 2NP0A 1RUD2 1QH6A 3POJA 4M0HA 1NQJA 2QFEA 1VBE1 3RZLA 1WW7A 2VQTA 5I8YA 3ES4A 4A3ZA 4O65A 4O7XA 3VN4A 1BK0A 5LRSA 2YU1A 4ZPIA 1RUD1 5EV7A 1CAUA 2KM2A 2XBO3 3MIEA 4LR4A 4ZS3A 1V9U3 4Q0VA 1XC6A 5FR3A 5A6YA 1UY0A 3DV8A 4CUBA 1H1IA 4BB3A 2YU2A 3R05A 4GMP1 3VKLA 4AQTA 1CVNA 3MV01 4NHKA 4Q4Y3 3SNMA 2ZGKA 4E4SA 4BWOA 1BXHA 3CLPA 4JV4A 5L73A 3I49A 4PIXA 3OEBA 5D8AC 5FYYA 2DUPA 1RJ7A 3A0NA 1WCKA 2HWE2 1TQ5A 2ZGUA 4AVBA 3PDQA 5JOWA 1ODNA 5C8CA 3HIFA 4IW3A 5A33A 1RC6A 5I0RA 4P14A 4WZFA 3ETQA 1IG0A 1WW5A 2R062 1YQ6A 2I07B 4CXYA 3HWJA 4OYUA 2HWE1 2GALA 1HJGA 1JN2P 2WINB 4IE5A 4NJ4A 4YW6A 5FMDA 3N3HA 3J9SA 4PI0A 4WM7A 4HLTA 2VW0A 3OCPA 5B4XA 4JGYB 2JX9A 3ZFGA 1O5UA 4DINB 3N7KA 3LE0A 2W1QA 1PMHX 3MW4A 4UF0B 3PU8A 2XOMA 4HANA 1GU3A 2RMU2 3MV11 4IERA 4XUTA 3M2MA 4YM0A 5EPAA 2VZ3A 2X05A 5C4WB 4XBLA 1HRI3 3T1LA 2WNOA 5A3OA 2W92A 3U07A 1ND3B 3AJYA 5FP9A 4E2GA 2A6ZA 3VBHA 1W8ZA 4WVWA 1WLCA 1VBD2 4O9GA 3T3YA 3EB7A 2ZHLA 4X8NA 5BNPA 4CEYB 2VZ1A 2Y34A 1RUE2 4LOSA 5GKAC 5A3PA 1VRH3 2ZOEB 5FZHA 4BK4A 3BIWE 2XWJB 3AZYA 1VBD1 1KITA 1Z7S2 2X53S 1N1TA 2RS11 4HT1T 1AYN3 4QHZA 3VKNA 1NE4A 1FI2A 3K3NA 5BNOB 3EYPA 1OC1A 3VKMA 2W39A 1DGWA 3PUAA 5ABJC 1HQWA 2PLV1 2WNEA 3GJBA 1QQP3 4K6BA 4JKKA 4LBQD 4CDWB 4CPBA 3EJKA 1HRV2 2AC1A 1KXGA 4DXZA 2ILMA 3HQXA 2ZCWA 4QQOA 4A6OA 1YJLA 1GICA 2PN5A 3M3IA 4AGVA 1OOPB 4QGLA 4QPIA 5JLVA 4EN8B 1DCSA 5IVFA 4L8QA 2VOWA 2WR9A 5FKBA 1XSQA 3WG1A 4BQ4A 2VL4A 3RZKA 5CBLA 3HT1A 4FQZA 2CAVA 1QXRA 3CJXA 4A4AA 4YFZA 2XUMA 5DPNA 3ZXGA 4ONUA 3MIDA 4AI1A 5FZ1A 4FOYA 1OI6A 2GC2A 3ZFEC 4XAAA 5FWJA 2HWB3 1F15A 2VUCA 4FP3A 4RR3B 1CJPA 3ZXJA 1DGLA 2EAKA 4KBZA 4PJYA 4XDQA 4IEWA 1YFXA 4F8AA 2DUOA 3PMSA 4DRVA 4Q5OA 4ARYA 4FOVA 3CMGA 1TNFA 1BVP1 3PUHA 1DYPA 5F37A 5DUVA 4HN1A 4N53C 1EUTA 2Q5TA 1S0GA 4GQ7A 2PHDA 5FP8A 3HPNA 4AVTA 1VIWB 5HBAA 1DYKA 1UQXA 2XHKA 2VMGA 3J8F3 1ZBE3 4JGZA 4YW7A 1W6PA 2WLQA 1CD3G 2O14A 5LA9A 1YQCA 4RA0A 2PHTA 3VDDB 1GWKA 1XNKA 4LBJA 4QD2A 4XFAA 4K40A 2YUEA 3D0SA 5KHGA 4Y26A 4YZ3A 2R072 1ND2C 3VD3A 3BU7A 1OXCA 2VW1A 1UNBA 5HXVA 1EAH3 2OVUA 3MLJA 2Z42A 5BNNA 3BN6A 3TWIA 1ENSA 2GN3A 5F1RA 4Q29A 3WG3A 3ZXAC 4LBQA 2EXKA 5FYHA 1QHDA 4FFIA 2O1QA 1GV9A 3DGTA 3OPWA 3TEYA 1CPNA 2GU9A 1D4M1 1SACA 4RHV1 5IK7A 1CZSA 3M3CA 2ARXA 2WQ4A 3I3EA 3DYPA 1EP0A 1O59A 2YFUA 4QQLA 3WX5A 2BV4A 3POFA 4CDXC 3T2OA 3RG0A 4V2VA 4EQVA 1O4ZA 1HXS2 3VBUA 2IXCA 4B8EA 3VDBA 4KWUA 2WL1A 4CDQC 1I5ZA 4PHZA 5FZCA 1OPMA 3WVJA 5JSPA 3WF0A 4P08A 4PCRA 5CU1A 2XL7A 4N9IA 4DZGA 4IQPA 3AYDA 4WVMA 1ASJ2 3S30A 1EUUA 4N43A 5GLVA 3BTXA 1NE6A 2WA4A 3OGGA 4P02B 4H2AA 3BTYA 5JMCA 2FDHA 2BDRA 1ZBA2 4L2NA 4ZXKA 5BNPB 3WR0A 4DB5A 2PAEA 5A6XA 1WW4A 3ZPYA 1S0CA 3SH5A 4PIZA 5C3OA 1KEXA 5FZFA 5F9TA 3D3AA 1ENXA 2JE7A 5JXGA 3N36A 2PXJA 1PNFA 3F2ZA 3DPRA 3POBA 2OZ6A 4CP0A 4FPOB 1C1LA 2A6WA 5HCFA 1OUXA 1GZ9A 1RUJ3 2W91A 2VNOA 2UY8A 2VCAA 1JOBA 2XQXA 1OFSA 1DGRN 3ORJA 4KWLA 3ACIA 1AF9A 1U5IA 2CDOA 3D8CA 2BGCA 4FFGA 1R092 4HXCA 1XPWA 4L99A 2W0XA 1NLRA 4IV1C 2YZ4A 1G8WA 3NRUA 5JXJA 1QEXA 5JPNB 3RNSA 3H7YA 4BQWA 3A21A 5EQUA 1QWRA 1FPN3 4JGYC 4OI4A 4QB6A 3RJ2X 4AZZA 3ZXKA 4E4HA 2OW4A 4G9SB 2WNVA 5FYCA 4CU8A 2WO3A 2G19A 2GNTA 3MHZA 4PF5A 3O1SA 2JDUA 2AR6A 4LLFA 3RQ0A 3C3VA 4TYSA 4QX8A 5LY1A 4BQ3A 1OF4A 2XWBB 2AENA 2YC0A 5I0UA 3DXUA 2WSVA 4YZ2A 1ND3C 4LEJA 4M3CF 4M4PA 5IVYA 4JRLA 2WA3A 1MZ6A 4GA9A 1JYTA 4GKYA 2QZ3A 2Q1FA 1QXPA 1NZCA 2Y6JA 1H1MA 3AFKA 3EXUA 3NJZA 3WCSA 1VP6A 2A3WA 4XIOA 4YFWA 3ROUA 3U75A 2DBIA 2CYFA 3CQOA 3M3QA 1W8TA 3W20A 1WMDA 3CJIB 4A2UA 5C6CA 1ZRDA 2JIJA 4IEZA 4QPYA 1PVC2 2BNNA 1LU1A 3JU9A 3UGGA 2LW8A 4CYDA 1NYWA 5A3MA 5BNOC 4QX3A 4XILA 2ZGLA 2ETEA 3S0MA 2WZ8A 4S2HA 2ZZQA 2IXJA 4PQ9A 1OKQA 2PELA 2WABA 5FFOC 5AC93 4NPMA 4CDWC 1PK6C 2VZOA 5J98B 3SKVA 1W6PB 4WM8A 1GNYA 1ZVFA 5FBZA 1OLME 1OOPC 1PO21 2QQVA 3K75B 3UK9A 4GD4A 1R1A2 3WINE 2JD4A 3WNXA 5FUIA 1VBC2 5FUPA 3OB8A 4QDSA 1OHFA 4ES8A 4Q26A 1UIJA 5D1IA 5FWEA 5FK7A 2PA7A 1R1A1 3L2HA 4J1XA 4OLLA 3THDA 5DZEA 3BODA 5HXMA 4I30A 1BZWA 1PGSA 2UU8A 3KM5A 3NVCA 3T30A 2XLFA 3BYWA 2E31A 2ZBJA 1E5IA 5BNNB 4XFCA 2HWF1 4LO6B 4O9EA 4IEPA 3EMRA 4HZFA 4XQWA 5T5PA 4RS5B 2R043 2BJSA 1QIQA 1RUF3 2P34A 2V4AA 3HNYM 3WF1A 4RR3C 5C5UA 4UFJA 4XDOA 5FY8A 3ZXLA 3WEZA 2RJLA 2BRTA 3U1XA 5C5TA 4XBQA 3RJRA 1GZCA 1MZ5A 2ARCA 3ZKUA 1Q56A 1QJX3 2Z2SB 3ZYRA 1UX6A 1QJU2 4BOWA 3A22A 2BWCA 4AVAA 4COVA 4JKMA 5JOYA 4COUA 3VUOA 4E8CA 1TMF1 4QB2A 3U37A 4MSVA 4MGYE 3OUIA 3AVRA 1QJU1 2ZGOA 4KI5M 5FREA 3VLBB 1XBFA 4R8HA 1W9FA 2HWD2 4QT6A 2VTXJ 2A6VA 3PNAA 4XCAA 3U4XA 5F39A 3UNPA 2XUEA 5GZGA 4TZDA 5I0TA 1SCSA 4MXWA 2MNGA 3TOJA 4N43B 1SZBA 3V65A 4IETA 3QCWA 2QDNA 1O7FA 4FBFA 3VDDC 3MDPA 4C8DA 4P9XA 3POYA 4LXLA 1UL9A 4M3CE 2X29A 2D7FA 1F31A 1LHOA 5J7MA 2JDNA 4DEQA 2VC9A 1T6BX 2GMEA 2XH6A 3IB3A 4Q4V3 3H3LA 1PGW1 3POIA 2FZ2A 1UAIA 2J1TA 1QGLA 3DPRB 3IIIA 3JB8A 1PVXA 2P17A 1AR61 1AR82 1N1SA 1IS3A 1W04A 2JICA 2XJPA 3O7OA 2D44A 4W6WA 4XFGA 4XUNA 5FV3A 1OFNA 3MFAA 2J1RA 5FPLA 4EWEA 5FP3A 4FQ4A 4CCLA 3IM0A 2ZAAA 2OZJA 5IAXA 1E5SA 2VJXA 3PURA 1QU0A 5J37A 4QM8A 4Q8KA 1NCQC 1JYWA 5CVRA 4XHXA 5D8AA 4LKEA 3VHRA 1OQ1A 4OZOA 4HSJA 3D5OA 4IGOA 1H6XA 3H3UA 4L97A 4DMIA 4R52A 1IKQA 2WNVB 4ZKTB 1QF3A 1VMJA 1Y43B 3NKGA 4EJRA 4CEWC 5LCWL 4LT5A 4QXCA 2PHXA 1DHKB 2W2IA 3CO2A 1W2OA 3ETPA 2FCUA 4DNYA 1H0BA 4Y33A 5DAVA 1BEV1 2DU1A 2JKXA 1W28A 3U14A 5IK4A 4GMP0 4M0NA 3TEXA 1CESA 3Q8AA 1UXZA 4URTA 3VBSC 2V5YA 1UY2A 2VOTA 1UU4A 2UWBA 3ATGA 4SLIA 1AYM2 1DFQA 2A3XA 4CP9A 1XOYA 1UYPA 1V6MA 1DG6A 4ISQA 1W0NA 2YFZA 1UPIA 4XUOA 4LULA 1L7RA 5FZOA 3Q8FA 2YGLA 5GLZA 5HCAA 5J96B 1BBT2 2JG9C 3LPGA 4JVAA 1MPXA 1GOHA 5FPVA 1NY71 1XNAA 1H2MA 5IVBA 3AP6A 5CFCA 1BBT1 1FOD2 1YQ2A 2FCVA 3KHBA 1ZA7A 1JI6A 3M3EA 4NWWA 1OD3A 4WM8B 5FZIA 4DY5A 3AFGA 3CIHA 4LBMA 2Y6FA 4AF9A 1GQPA 1CX4A 3LFIA 2ZGQA 4B1LA 1RUD3 2LALA 4ASMB 1VMFA 4QHOA 4HK8A 2GP5A 5ABJA 4UFIA 4X6RB 5A1AA 1W8NA 2NN8A 4YRDA 4XUQA 5GM0A 5JI7A 1YI9A 4FSJA 2ZA9A 1SFPA 5CA6A 1AR71 5E16A 1PNGA 3SKJE 1I3HA 3I3MA 1BJQA 3C7HA 2EF6A 1QOOA 1XXNA 1HKDA 2B8MA 3KV9A 1VAMA 3FLRA 1SLIA 4QKDA 5DDJ2 2IXLA 3KV5A 2F4PA 4FPHA 5FY1A 1FMD2 4EN7B 2ORXA 2Q0AA 4NIIA 1UKRA 3A4UA 3GZUC 5F2SA 3CJIC 1EPZA 3VHNA 3KT4A 5DDJ1 3HQRA 4X6QB 5E88A 2JG8C 1UYZA 2VZUA 4YGEA 1B09A 5K4LA 5LASA 3ZFEA 3TN92 4BHPA 3KWVA 1NOVA 2A70A 1V6JA 2R063 1F5JA 1HB2A 1ACCA 4GWNA 4AEJA 2X8KA 3H8UA 4MX3A 1LHNA 1LEDA 2CWMA 1TME2 2WO1A 5FPUA 4YW4A 5AVAA 4N53A 1DF0A 2J42A 1DU3D 2XL9A 2CGPA 2RMU3 3E6BA 3H1WA 3ZOIA 2WFF2 4TN7A 1J3QA 1UXXX 3LD8A 3TNQA 2A71A 2PHWA 2QKDA 3ZMOA 2W5FA 4COZA 1IS4A 3DEMA 1J1TA 1SBEA 1ZZ7A 2CAUA 2WFF1 4MOAA 1A8MA 3U10A 4CU7A 1YWKA 3I3QA 1W6OA 2BGOA 1HX6A 3DYMA 5F5QA 4COYA 2WJSA 2FDFA 3WSOA 1RUE3 1VLNA 1S0IA 2PHUA 3T0BA 1W6NB 3I2KA 3AP9A 4OUMA 1S0BA 3I54A 5F6LB 1L3JA 1Q5OA 4LO4B 3VBOA 5I91A 1Z7S3 3CDZB 1ND2A 1RMU2 5JWPA 3ON7A 2Q30A 1QJY1 2YDEA 2VGDA 3IMNA 3MEPA 5FQ0A 5JR2A 1PX4A 2O8QA 3R4DB 1YO8A 5F5CA 3LGRA 4Q1RA 1M4WA 4Z07A 4AFAA 4CCEA 1RMU1 1HRV3 4DIQA 1LOGA 1N47A 4IL7A 2PFWA 1I1EA 3ITQA 3ACLA 4GB33 4ZU7A 5IUQA 4HKOA 2K0GA 2ZGTA 3BTAA 4I01A 2RDRA 1W9WA 3MI8A 2QQOA 3NJXA 1RUI1 3MPPG 3H8RA 1DP0A 4AHZA 2Y33A 1LJ7A 1LECA 2IZWA 2JJ6A 2WC2A 3N35A 3UKNA 2ZX3A 3AK0A 4CDXA 5I8SA 1BLZA 4BDVB 1J83A 2RVAA 1HLCA 4CDQA 4PLNA 4BK5A 2HEWF 2VZPA 1CWPA 1E57A 2WS91 3ZSEA 4QQPA 2CU5A 2XR4A 3N9LA 4E2QA 1CGPA 1AXZA 2YV8A 4QDQA 4P9JA 2GNDA 1RVF2 1AX0A 3AZZA 2F6BA 5KHIA 2MEV3 3WF2A 3W59A 4XACA 5DZFA 1WBLA 3P5BA 3CEWA 5FP4A 2IFWA 2L9LA 4QWNA 3WZ1A 4XZUG 4D6RA 3NNMA 2C9KA 3L9JT 1Y9QA 1H9WA 2YROA 1CAXB 1KS5A 5M0TA 2OIIA 4OMDA 3AB0A 4Y4RA 4B7KA 1F9KA 4NN0A 1TVGA 4KMQA 2NM1A 4KL1A 3T4HB 2VNRA 3KS7A 2DVBA 4W50A 3KQ4B 1GNHA 4K3UA 3TNPB 5LA0A 4H7MA 5C71A 2NZ9A 3NW4A 2WAOA 5FYZA 1REDA 3J26N 4IV1A 3WCRA 3GALA 2A5ZA 4P5YA 4MGTA 4UWDA 4NIGA 4JGYA 1W2UA 2D3SA 2R073 2DCTA 1KRIA 1AX2A 2GMMA 4BXFA 3I2GA 4HPKA 1O3QA 5EJ3A 4NWVA 4FI9A 3PTYA 1RUG1 2QQNA 4EE2A 4ZU5A 1PGL2 3S5QA 1LOEA 3GHMA 4PT6A 3ZFEB 1TNRA 1ND3A 3LEKA 4B7EA 4FAHA 1UF2C 4AVSA 1SDWA 1V6KA 3RI8A 2CHHA 1PGL1 1UZWA 4GJZA 5AFEA 1MS3A 3FFZA 4LKFA 3WP3A 3ACGA 1R1ZA 4AVCA 1VB4A 1BCXA 3ZO0B 4SBVA 1JHJA 5JPMB 1BKZA 1GZWB 1SBFA 1HXS3 2ZGNA 1HJFA 4N53B 1S0FA 4PLMA 4S2FA 5BNOA 1PMJX 2Y0OA 2RS32 3AVSA 3CF6E 3M8LA 2BEOA 2JEMA 4CDWA 1IZ3A 5C3SA 4Q4X1 2JDMA 3C7EA 1YLLA 1NAEA 2ZTNA 4Y5Z0 1ASJ3 3JZVA 2BFUS 2QUOA 1SFNA 2W1WA 1OOPA 3NJYA 3OSDA 2EIGA 1NQDA 2PAKA 2ZGMA 3LZZA 4MV2A 4Y4YA 5DXDA 1BHGA 2DFBA 5EP9A 1EY2A 1ZBA3 3IDBB 4A41A 5GZDA 5GZCA 1VBA1 1SBDA 4IESA 4ATEA 3AX4A 1H1AA 4E4DX 2VM9A 1AJOA 1ND2B 2W46A 3HNMA 3IT8A 1X9TA 5AFBA 4LORA 2WN3A 5KXDA 1QH7A 4L9BA 4UW5A 3MYXA 1UPSA 3VBFB 1UU5A 1R081 3B5LB 3WXPA 2J1SA 3QH6A 5IJRA 1JYNA 3JQXA 4P9WA 4QM9A 5JI9A 4RR3A 1NLQA 3UETA 3BIEA 4B4RA 4CUGA 1OA2A 1R093 2OYZA 1W6MA 1UD1A 4U2AA 4F83A 2C5DA 2WZR2 1O4YA 5GLWA 1LCLA 2JDHA 3AMNA 4E2SA 4W6YA 1X7NA 2VVFA 3WDTA 2XLGA 4JRAA 5EHDA 3WHUA 2Y64A 1WD4A 2ZGSA 4GIQA 3ECQA 4QPWA 1VBE2 3JUUA 2JE8A 1DQ0A 4NOTA 5DQ0A 4CDXB 2QQKA 1A34A 2UYBA 3E5XA 1W2AX 1UOBA 1OA4A 2ERFA 5T52A 4CDQB 3ZN6B 5FZ0A 1REFA 4CPBD 3GBFA 4GH4C 4A3XA 4Q0QA 3LEGA 4P9GA 3LSDA 5E8AA 4D7YA 3AMHA 3I2IA 4MGQA 1JUHA 5FMOL 3VD9A 1C57A 3O1OA 2Q8OA 3PVBB 3ZIXA 2W68A 1JYXA 3ZMNA 1BK1A 2BVVA 1QNWA 3VDDA 1RINA 2VOVA 4LJHA 1YNAA 3LWCA 4CE8A 2O0OA 2BYVE 4MUVA 4FPKA 1PVC3 1JZ5A 4CCNA 4OUEA 1F5FA 4NAOA 4OI1A 1N3PA 2AACA 2JB8A 3AMMA 4HN0A 3GJAA 4MGIE 4MG2A 2BTVC 3QBQA 1TZOA 2SLIA 4YWAA 5GLUA 2AREA 3WG2A 5HV0A 4WZCA 2QCSB 3WW1A 4QX2A 4BLIA 2QBXA 5FY9A 5JSRA 3VD4A 2BBAA 4LBOA 2XXZA 4BU2A 5C3RA 2ZXQA 2BNMA 2OXBA 3OGJA 3ZXDA 4INDA 1KDMA 3LEIA 4OHXA 4OHWA 1VBC3 4IV1B 1E5HA 3OG2A 3U11A 2TUNA 2XJRA 3KGLA 1NCQA 5FZ3A 2YC2A 4AWDA 4MGKE 2C26A 4QX1A 5T5LA 4E8DA 1Q8QA 3UESA 4A45A 4HPKB 2H0BA 1H4HA 4BQ2A 3OY8B 5BNQA 1T6GC 2Z4FA 3VZJA 2B7YA 5IHRA 5JSOA 3HNBM 4ASLA 1CIYA 3K4ZA 5A3UA 2WO7A 2IFRA 3VBSA 5KXBA 4HETA 1US3A 1QMJA 2BVBA 1W39A 2RS12 2IC1A 2P4EA 1MS4A 2UYAA 5ISLA 3VZOA 2CL2A 2WRAA 3AKQA 5J48A 2PLV2 1OSGA 3D82A 4QB1A 3ME2A 3SQOA 1GP5A 2RV9A 2BGPA 3MIGA 4I0WB 4Q0UA 1GQGA 4Y20A 4BM8A 4ZXEA 5EIYB 2H6CA 4LBNA 5I0DA 1PMIA 5JUVA 4G3YC 3O1VA 1DZQA 3ELNA 3K4AA 2HWD3 3LKJA 4FOQA 4FFHA 4YNIA 1JHNA 1PK6B 3W21A 1PZ8A 1SFYA 1POV1 3NQHA 4IE6A 1YRZA 2ZX2A 3QOPA 3KF5A 4BMEA 3ZN4A 1K5MB 1LHUA 2XDVA 1S1AA 4XE9A 3POWA 1QDOA 4LA3A 2BZDA 1ZRFA 3I97A 1UYYA 4BYYA 4KG0A 4LHSA 2VQUA 3FBMA 5BXXA 3BTZA 4OFGA 4QGNA 3JD71 1AR83 2FDJA 3ZKYA 5H9QA 1QDCA 4EROA 4OUSA 3VDAA 1EV13 1UY3A 3DECA 4UFMA 1YJKA 4PQQA 1S0JA 2XVLA 2Y6GA 3JBG2 4JHZA 4NPRA 4Z2AA 4R9AA 4WV8A 4Z92B 5ANNA 1AXKA 1C8NA 1W6MB 1OA3A 2DFCA 5A7WB 4AHYA 4LO7A 1XE0A 3ZR6A 3I4IA 4LE4A 2BFUL 1MS5A 3CJIA 3JBG1 4AE2A 3NV4A 4V2WA 2R30A 2J22A 2EIEA 1IG3A 5LEKA 4HVOA 4PI2A 2JG8A 3O1TA 4DXTA 2YPDA 2G9ZA 5J09A 2WNUB 4A7ZA 3R6SA 5K7PA 4MVTA 1PO11 2D6LX 1A8DA 1OVSA 5FZ9A 4CXWA 1ULDA 3KF3A 1LHVA 5GALA 4LK6A 1G6NA 3CNAA 4K1YA 1D4VB 4JDNA 1AYM3 1MR5A 2QQMA 3JB4C 4HBNA 3CU7A 1W9SA 4EZHA 4AHXA 2IVIB 3T09A 1I5PA 2A75A 1QY4A 1H30A 1VB2A 5L19A 3RZHA 1H2LA 2D5HA 1BBT3 4MYEA 4UI9L 2VZQA 3LEMA 3B94A 5FY5A 2OS2A 5KHKA 3H8XA 3ZYFA 3VBFC 3VBRC 4YVSB 3THCA 4AI2A 4D6QA 1FOD3 4RS5A 1D4M2 4RHV2 4PIYA 4XOGA 1WUVA 3OUJA 3WP6A 4ITCA 5DAQA 1V0AA 3OPZA 3WW2A 1X8EA 2WQ8A 3GDBA 3IAQA 4H7LA 4XJZA 1UMHA 1DZTA 3LQCA 1K45A 3E6DA 2VMHA 3POSA 1V6IA 1VR3A 3AM2A 3LIHA 4YG6A 4B29A 2AEYA 1COV1 1NCQB 2P5BA 3ZXFA 1FV2A 1ENQA 1XQNA 1RXFA 3AMPA 3DF0A 4XF3A 2I74A 3HOBA 1K3IA 4QU2A 5CNAA 4BQYA 5FDBA 2EVXA 2WDBA 2GNMA 2VUDA 2VU9A 1VBB3 1C8M1 2C1FA 4XMIA 2YBSA 1NKGA 4CEWB 2E26A 2UWAA 5JIUA 5K8SA 4C0BA 1YEWA 1UY1A 1AR91 3NL1A 3LA3A 1CZVA 3I59A 4MLOA 3KQRA 4XTMA 4NRPA 5IT6A 1FMD3 2RE9A 5FMCA 5FYMA 3OTFA 3VBSB 4A6SA 1HN0A 5IK5A 2GZWA 3RYKA 3MIHA 3WNPA 5JR7B 2FBEA 4YGBA 5HPOA 4DPNA 4AVVA 4I0BA 1H4GA 4K1ZA 3S7EA 2JG9B 4Y20B 5BPXA 3TN93 4PBPA 2OUJA 3BALA 1RJ8A 1LTEA 3VB9A 4I2OA 1AL21 2HWC1 3WF3A 3BOPA 4LPLA 1TME3 1VJ2A 2E53A 3ZYPA 3RGBA 2R7EB 4BZ4A 3OD4A 4EZ4A 2RS51 2VZRA 1JMUB 1SLAA 2ZHNA 3PUIA 4N9HA 4AI0A 1MEC3 4XJAA 3GBWA 2VNGA 4PBOA 2B4KA 5FYIA 3RYRA 5A1FA 2EXIA 5F3EA 2QVSB 3T2QA 1J3PA 4IUGA 1WMXA 1PIV1 3SH3A 3VZKA 1IOAA 4BISA 3BCWA 4YG0A 4HVQA 2E7AA 3S6PA 2ZPXA 1ZZ8A 2VCBA 4CCMA 4AEMA 5BYNA 2DUQA 1UZVA 2RM21 4GWMA 4WBBA 1SQ4A 5KHJA 1CR7A 3ST7A 3NWKA 2B42B 3UKVA 2DURA 1H2NA 1O91A
chains in the Genus database with same CATH topology
2AYHA 5GLTA 2IWGB 3HD8B 4Q4W1 4UXAA 2JG8B 3QACA 4HKWA 3THTA 5BV6A 4DOUA 1PO22 3NAPB 1LR5A 3OF1A 4XMAA 1ALYA 3WUCA 5T50A 1UKGA 3VL9A 2XBO2 3ZDSA 4H14A 1WBFA 1RB8G 1K5MC 1RUC2 4NHMA 1I9RA 2I45A 1C5IA 1MS1A 1C1FA 4EN0A 1YFUA 2CGOA 2XBO1 4KU8A 2DVGA 4Q4Y2 2HWF2 1RUC1 1V9U1 1I6XA 3MGUA 4ES9A 1MZFA 5ACA3 5LRRA 4Q4Y1 4XJUA 1RVF3 1IS6A 4M01A 2B46X 2BPA2 3SLIA 2GAUA 1RUNA 3O0WA 2OA2A 1HIXA 3ILNA 5J36A 3HT2A 3AP7A 4RL7A 1TMF2 4UBHA 3OBTA 1Q8PA 3RSJA 4AI3A 1ZNPA 2WNUC 2VY0A 4KGGA 2B45X 3SISA 5E89A 4LO8A 4AFMA 1Y3TA 3NSTA 3I59B 4Y1XA 3UKTA 4ISRA 4RFT0 1HRI1 1ULFA 1PGW2 3THPA 4RGAA 3IDCB 3IPVA 1AR62 3NO8A 2KA3A 4FPFA 5JCTA 1DQ1A 2WSUA 2XJTA 3RRDA 3OYWA 3WDXA 1LEMA 3USUB 1VRH1 4YVSC 4AQ2A 4OZXA 2QDRA 2QE3A 2A7AA 2PQQA 2ZZJA 1AYN1 1W6NA 1CAWA 2TEPA 4YW1A 1QQP1 1W0OA 5C8WA 5FPXA 3ZX7A 1ZZ9A 5GZEA 4JAAA 5SV8A 4I0AA 2RS33 1KS4A 3HN1A 3K48A 2NMNA 4YG3A 2PHRA 5FO8B 4H55A 1BEV2 5K0UC 2UURA 2XPJA 2OUHA 2N7GA 1YFWA 3MFCA 3ILFA 5BY5A 4N90A 5B2GB 5EXOA 3VL8A 4BPZA 1HV0A 2C0ZA 4Q0SA 2IXIA 2GN7A 5KWRA 1MZEA 2RR13 4YYOA 1H9PA 3MICA 4QPGB 4FXGB 2ES3A 2HWB1 1KDKA 4B3NA 1NY72 3MPBA 4C0HA 1B35B 3WUDA 1X33A 2X5IC 3INAA 4Y1UA 1XU2A 1RHI3 4D94A 2VECA 2V73A 2WZR3 4EN6B 2XG3A 3FC0A 3PVOA 4AEKA 3B3QE 1SLTA 3AP5A 3P3NA 1VBE3 2I2SA 1ZBE1 4NVPA 2QQPA 3SHRA 1CAXA 2E6VA 1Z0HA 2ZX4A 2YPJA 5DUUA 4E4ZA 1AR72 2AGSA 4FPLA 2FZ1A 1BMV1 1HV1A 1UN1A 2GNBA 4GMP3 4YZ5A 3KCXA 2P2KA 4AFBA 1FYUA 2LUWA 1VAVA 3H1MA 3UJQA 1EAH1 2JKBA 2JENA 2BW8A 3B01A 2VQAA 4ORFA 1WCDJ 3X29B 4JQRA 2JE9A 3LAGA 4Y24A 3ZYJB 1ULEA 5IK8A 2HWE3 5EYXA 2GMPA 1YXWA 5FOJB 3IBMA 5T5OA 2DV9A 2CTVA 1POV0 2FHRA 2V09A 3SCGA 3NAPC 3WD5A 4YM3A 2IXKA 4BCUA 1GYKA 4CP2A 1G86A 1WA4A 5CB7A 1NA1B 1F2NA 2DYCA 3B7MA 5T5JA 4UBGA 4FOWA 2WKKA 3KT7A 1GZWA 1SMVA 2NYYA 1APNA 3GZTB 3IPVB 1X82A 4GH4B 1KJRA 2HJIA 4PDWB 1XE8A 3OYWB 4OHYA 3WLUA 2A6XA 1VBD3 4KBBA 2UY9A 4JGZC 1CPMA 4X8PA 2RS13 1IQAA 1QJY2 4LNVA 4FPEA 1WLWA 1UZZA 1CAWB 4OVEA 2ZABA 2PLV3 4YSFA 4AFCA 2K9ZA 3PJYA 1POV3 2VH9A 3LSEA 1RUOA 5EWSA 2E7QA 1FPN2 3VBFA 3VBRA 4Z8BA 1WMEA 1CJDA 3BB6A 1JH5A 4DY3A 1SLLA 2ZAHA 2DVDA 1UIKA 1RUI2 1URXA 1FPN1 4K9SA 3A0KA 4LA2A 1RL3A 2NMOA 3ZYGA 4M3CA 2H0VA 2WT0A 4KGQA 4IEXA 4JDOA 2VW2A 3FBYA 4R9CA 1W6QA 2WS92 4XQDA 2FQPA 1GNZA 3MF9A 4P9IA 3ZN6A 1NXMA 2YGMA 4FPGA 5L7OB 3IN9A 1AVBA 5AC92 3SMHA 3DKWA 2CV6A 3ES1A 1Q8SA 5CFDC 1D2QA 3FX3A 5AC91 1A3KA 2D6OX 2ZMKA 2ZKLA 1DDLA 3UJOA 2YMZA 1HDKA 2VQ0A 3DUIA 2Z69A 3LA7A 3VZLA 4COWA 3QD6A 5SV5A 2KXLA 3APBA 2VPVA 1IKPA 5K9YA 3R0RA 2AZ5A 3MIFA 5FO7B 3GBGA 4EWDA 4Y22A 3T2TA 1RUG2 4QPGC 2R041 3RDIA 1DBNA 2MHFA 1RUF1 1QJX2 2HEVF 1B35C 1NG0A 1LULA 4YVWC 1D4M3 3OY8A 4RHV3 3FHIB 2PYTA 4M00A 1QJX1 2NPIA 3P3PA 2ZX1A 1AXYA 1OQEA 3AXDA 3DN7A 3ZVXA 4CZSA 2H6BA 3WW3A 3FLPA 4AGGA 5JZGB 3H7JA 3I7DA 3WT3A 3H3ZA 2JXAA 3H50A 1ZREA 3M4FA 3E5UA 4FPJA 4D7SA 1RUH2 2QNKA 2HYKA 4Q4X2 3TBDA 4ATFA 4YW3A 3PHMA 3KB5A 3AZXA 3AJZA 5T3NA 3N7JA 1RUH1 3LA2A 1PK6A 1X36A 4R4XA 2NLRA 2XLAA 4Q2FA 1RGSA 1O5LA 1VBA2 3AYAA 4MH0E 1K5MA 3ZFFB 4Q4V1 3B69A 3ZIWA 3KCCA 1PZ7A 4F7ZA 5EFUA 4XHBA 4IV3B 4P5HA 3MZHA 1R082 2ARBA 4IEVA 1V00A 2ZHKA 4BQ1A 3RMYA 1G9DA 2OPKA 1BYHA 1H8TC 3VBRB 4XFHA 1G9BA 1HQNA 3BPZA 1SLCA 1O4TA 1AX1A 3OJBA 4YLZA 2D43A 1UMZA 1NA1C 2BUKA 4M3CB 4U36A 1UZYA 3PLQA 3QH7A 4YARA 1AZDA 4AW7A 3TYJA 1Q8OA 4XEZA 5LK7B 1WMFA 2FMYA 1W6QB 4Q27A 1KQRA 2R49A 2WNUA 2ENRA 5CADA 1MVQA 3VHOA 2DTWA 4RD7A 3WG4A 3TAYA 1UCXA 2A73B 4PDWC 1M06G 1OQDA 5KHHA 3C2UA 2AH2A 5FRAA 2VVDA 3H1YA 3DL3A 4W65A 3D6EA 1DIWA 2HKXA 3MLKA 5A32A 1TEIA 2G9GA 3AKTA 5HCBA 5CIRA 4GKXA 1JXNA 1ZZCA 4Q8LA 1YFYA 2P3IA 2R1DA 1IS5A 1XU1A 1PO23 3KCYA 4KH9A 4YVSA 1RMU3 1RIRA 4AXOA 1RITA 1MS9A 1R1A3 1RUC3 4S2GA 2ZGPA 2EXHA 2QJVA 3M1HA 4UW6A 3KMHA 5C9AC 1DLLA 1EYBA 1SEFA 1C28A 2DWRA 2HWF3 3GNEA 3WP4A 4Y22B 3AZWA 4CRQA 1UU6A 1ZM1A 3SCHA 1W0PA 2D6KA 1U5YA 3ASIA 5K0UA 4CEWA 4AHWA 1DQ6A 1GQHA 4XPVA 5JVVA 4RQPB 1DZRA 5L7OC 1ONAA 1OPOA 2D93A 1AHSA 4J1WA 1ZX5A 3ZXEA 3D0JA 3SXWA 3SCFA 5KXEA 1GSLA 1TMF3 1LESA 3KZ4C 3MF6A 1QJU3 2R061 1U0AA 2ATFA 1O3TA 1BVVA 2ET7A 1LOCA 2JG9A 5E1RA 3R4SA 2X5IA 1V70A 1MQTB 5EZWA 5F6KA 3U0ZA 3OD0A 3WQ7A 5FO9B 2RMU1 4QMAA 3ZSMA 4NO4A 4Y1VA 5FLHA 5CFCC 1AL0G 4R9DA 4WVZA 1RTVA 3FUQA 3N4MA 1LODA 4EV0A 5EYYA 3WY6A 3VZNA 3JD72 1AR63 4LUKA 3FWEA 4UW3A 4C90A 1YYNA 1RUE1 2BQPA 3AKSA 1F8VA 2WIIB 1Z7S1 2DVFA 4XIKA 4YZ1A 2A6YA 2RJKA 4CDUC 1ULCA 4YW5A 4Y1YA 3AZVA 3HAGA 4GB32 1N3QA 4AQSA 2ZS6B 1LGNA 1CONA 1HRV1 3LOIA 4DRRA 4XJ8A 5JZGC 2DU0A 3AYCA 4FXKB 3B9CA 4GULA 4AEDB 4GB31 1PO12 3IKWA 4QQ2A 1D0HA 1LGBA 2JECA 1BEV3 3NV2A 5HI0A 3B00A 4LUMA 5DG1A 1CAVB 3NAPA 4KNCA 2Q1ZB 1O3SA 2D40A 4META 3WHTA 5LEJA 4Q0PA 2LTNA 3OBRA 1FXZA 3WW4A 3V56A 3ZFFC 3ENRA 3N7LA 2MEV2 4IV3C 5A32B 3EBRA 1JYIA 1KFXL 2D98A 3NKTA 3V0AB 1D0GA 1AUYA 3WDVA 5LK5A 3D4KA 3ZSJA 2MEV1 3R4UA 4TLFA 1ZRRA 2BNOA 3MW2A 3H0OA 4PLOA 4Q1PA 1YHFA 1A78A 4A7YA 1CAUB 1COV2 1JYCA 1LB2A 2VUJA 1N1VA 3WQ1A 2RHPA 3WDWA 2VXRA 3E97A 1C8M2 3VBOC 3ZSKA 1AR73 4NHLA 3VKOA 1OLRA 4IXLA 1AR92 2DCZA 3FZ3A 1VALA 4XQ4A 2R071 4XW3A 2YHJA 1JTZX 5C8CB 3V0BA 5A33B 2GH8A 1ULGA 5DDJ3 2D5FA 1XE7A 1NCRC 1CN1A 1QJZA 3AMQA 2D3RA 2DCYA 4IEYA 4Z82A 4WM7B 2XKOA 3ZFGB 3W9AA 4FP2A 1AL22 3J4UH 2HWC2 1G7YA 2X5IB 4LLOA 3USUA 2GDFA 1V6LA 1U5ZA 4XJWA 4R4ZA 1XYOA 3LCPA 1HXS1 1GKBA 1U12A 2Z5WA 1J58A 2RS52 1Y7BA 1XNCA 3V64A 5GZFA 1WLDA 3O12A 5CFDA 3VBHB 4OI2A 3EO6A 4TWTA 4BMBA 4K21A 1PIV2 4BIFA 3N7MA 1ASJ1 1OD5A 2E63A 2WFF3 5JIAA 2WT1A 2Z79A 3AKRA 4LHNA 3Q9OA 1ZBA1 4QHBA 2VOKA 4FT8A 4FCAA 2RM22 4AI8A 3VHPA 1S55A 2WZPP 4RQPC 3FUOA 2SBAA 4D69A 2DCKA 4TSVA 4G4FA 1QJY3 4OHZA 4QPIB 1H2KA 4Q4W2 5FOBB 4QPGA 2R6QA 4XBNA 3URFA 2BBVA 4K8FA 3RS6A 1S0EA 2G4IA 1XNDA 1R091 4HK9A 1B35A 4YVWA 5I8TA 1MQTC 2VOXA 1RUI3 1LOFC 5C4WC 3KSCA 1NXD1 2ZGRA 4HSLA 3T1MA 4W6XA 3ILRA 3AP4A 4BA6A 2GH2A 4YM2A 1Q8VA 4QXKA 4YW2A 3I2DA 2NQYA 3FMGA 1V9U2 5KBFA 2WS93 4CEYC 3PMEA 1GR3A 1DQ5A 2FMDA 2EXJA 4L92A 2ZMNA 4KU7A 2D97A 2WQZC 3KD4A 3QLQA 1Q43A 3FE5A 5KXCA 1PVC1 4AQ6A 4FAGA 5H9PA 4JGZB 4K7JA 2GC1A 1N1YA 3PVEA 3RPQA 3G7DA 3AXEA 3RI9A 3PJQA 1FAYA 1CIWA 3O5SA 3W58A 2YXSA 1G9CA 3VGIA 4AEDC 4JTOA 1H8TA 4A7KA 1QOTA 3AKPA 4I09A 1VBC1 3JQWA 3M70A 1MVEA 3I8TA 3WOGA 4B4QA 2P37A 1HRI2 4XZPA 4LBQB 1NA1A 3V0BB 1YUDA 4S2DA 1J3RA 1RUG3 4RSUA 1YCIA 4MZUA 3VV1A 1QKQA 1X50A 4KG8A 1FATA 1FX5A 4QGMA 1VRH2 1MACA 5CG8A 4LO5B 2WFPA 4GH4A 4XTPA 2LM3A 3GF6A 3RZZA 3VBUB 4AYUA 4PDWA 1AYN2 1REEA 2DCJA 2XJUA 1FT9A 4HFSA 1QQP2 4XFFA 4OI0A 2EAAA 3GYDA 5TSWA 4D3WA 4XF1A 2CWSA 4WVMB 3HR9A 1JUIA 3ZSLA 5CFDB 2IXHA 1S2BA 4OULA 1PM7A 2HWD1 2UWCA 2Q4SA 5J3UA 1RUH3 5KC5A 4Q4X3 2Y26A 4XF9A 3L2YA 2EA7A 1FNYA 2ZMLA 1C5HA 2W52A 2JDZA 4JC1A 1VBA3 4HL0A 1WW6A 3O0XA 1LRHA 2QZ2A 1EV12 3IDEA 4I3GA 2CGNA 3O0VA 5C8CC 1KD7A 3CL1A 2HWB2 5C9AA 1AR81 1R083 5DG2A 3H9AA 3MW3A 1SCRA 1OMIA 1EV11 3HBZA 4IEQA 2DF7A 2E9QA 4WM7C 3ALQA 3ZFGC 1FV3A 3NV3A 1N3OA 1YIPA 4YVWB 1ZYBA 5L7OA 2ZACA 2D6MA 2R0HA 2YY1A 5FPZA 3J8F2 2TNFA 4BLJA 1ZBE2 4HMZA 3LB9A 5FCCA 1IPJA 3VBHC 1BQPA 1MS0A 2CNAA 1LENA 1J1LA 2WLPA 4LHKA 5FLJA 1XNBA 3J8F1 1BMV2 5BNPC 3WP5A 1EPWA 2VMIA 5FAXA 4IEOA 5A3LA 3KGZA 1AYM1 4FTBA 3AYEA 5AVPA 1EAH2 2XGXA 1Z78A 1J59A 1ZRCA 4LBLA 1XYPA 1UW8A 1HQLA 3B02A 4UW4A 4F3JA 2PHFA 4QPIC 1OLQA 4C91A 3B9IA 4D7TA 3ZYIB 1FOD1 1IPKA 1WGPA 5T54A 4LHLA 2Y38A 4XF0A 1H8TB 4KWKA 1ZA4A 3UL2A 2CY6A 2MPFA 2A3YA 4CDUA 2XJSA 1VBB2 2EALA 4HKLA 4YGCA 5JOXA 4LTAA 4E27A 4H3WA 2GSYA 3VKFC 5JZGA 3EHKA 5H9SA 3KT1A 1VBB1 2K2SA 2XVGA 1CQ9A 4BE3A 4R9BA 3WV6A 3O14A 4RGGA 1D2SA 1FMD1 3ZN5A 4IEUA 4L11A 4HVRA 1LU2A 1Q3EA 2B5HA 3M3OA 2XKPA 3BOWA 1KJLA 4FTEA 3IIAA 1IHMA 4P9LA 3ZFFA 1C3HA 2BWAA 2W08A 4JTNA 4MXVA 4YM1A 4XYXA 1GLHA 2XJVA