3IM0A

Crystal structure of chlorella virus val-1 soaked in 200mm d-glucuronic acid, 10% peg-3350, and 200mm glycine-naoh (ph 10.0)
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
243
structure length
243
Chain Sequence
NVISTLDLNLLTKGGGSWNVDGVNMKKSAVTTFDGKRVVKAVYDKNSGTSANPGVGGFSFSAVPDGLNKNAITFAWEVFYPKGFDFARGGKHGGTFIGHGAASGYQHSKTGASNRIMWQEKGGVIDYIYPPSDLKQKIPGLDPEGHGIGFFQDDFKNALKYDVWNRIEIGTKMNTFKNGIPQLDGESYVIVNGKKEVLKRINWSRSPDLLISRFDWNTFFGGPLPSPKNQVAYFTNFQMKKYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords VAL-1
publication title Crystal structure of family 14 polysaccharide lyase with pH-dependent modes of action
pubmed doi rcsb
source organism Chlorella virus
total genus 59
structure length 243
sequence length 243
ec nomenclature ec 4.2.2.3: Mannuronate-specific alginate lyase.
pdb deposition date 2009-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3im0A00
3OBRA 3AP4A 4Y1ZA 5KXDA 1LGBA 3W58A 3OY8B 1C1LA 4TZDA 1VAVA 1DGLA 2PHUA 2VW0A 3FLPA 4Q8LA 1DQ5A 4H55A 3UK9A 1DIWA 1Q8OA 2UU8A 3WCRA 3QLQA 5JOZA 1ENSA 1S0EA 4ISQA 1G9BA 2JE9A 3N7KA 1GZWA 2WLQA 4OZXA 3V0AA 2OVUA 3HMYA 1IKPA 3WUDA 2P3JA 4XIOA 3INAA 3W59A 1YRZA 2ZHKA 3AJYA 2EXHA 5KXBA 2NN8A 3IPVA 4XMIA 3UJQA 1UL9A 2P3KA 1SBEA 1C1FA 2DVDA 2ZGPA 1KRIA 1Z78A 1X50A 3VKFC 4C1XA 5E8AA 1SLTA 4LBLA 5CB7A 1KDKA 1S0CA 1SBDA 2C9AA 3USUA 3WG4A 2A6ZA 1WBFA 5IK4A 2TEPA 2GMEA 1RINA 1UZYA 3OPZA 1QNWA 1CR7A 2ZACA 4YZ5A 1WCSA 4P9XA 1JBCA 1B09A 1W6NA 3MW2A 1LOFA 1MVEA 1KQRA 1LOFC 1BJQA 3ZPYA 1LOEA 2D6KA 5H9SA 3VKOA 3ATGA 3ILNA 5EWSA 3RQ0A 1YXWA 5JOWA 1MS4A 3SH4A 3FLRA 3WDYA 2PHXA 4Q1PA 1CVNA 2AENA 1WUVA 1DQ4A 3B00A 3T1LA 2V73A 1Y7BA 3ILRA 1MS3A 2YZ4A 4CTEA 3AX4A 1FNYA 1A8DA 1MS1A 2YV8A 3RSJA 2DUOA 1G8WA 1LOGA 4YM3A 4FQZA 2OUJA 3AZZA 4AGGA 2ARBA 4XZPA 3POSA 1UZZA 1AX2A 5EYXA 3ZSKA 4FPLA 2WT2A 1WLDA 1KJRA 1LENA 3NV3A 4Y1XA 1ULCA 4YZ4A 3ZXJA 5GZDA 3JU9A 1WLWA 2R1DA 3VKNA 1C4RA 1KDMA 4PF5A 1N1SA 1GLHA 2G4IA 1YO8A 3N3HA 1MS0A 2JDZA 4YZ2A 3WZ1A 5DZGA 4YZ1A 2C5DA 4R9BA 5DG2A 4Q27A 3V0AB 1HLCA 1O4ZA 3AZVA 3APBA 5KXCA 4LBNA 1W6QB 2A3YA 1GYKA 1QKQA 4PQ9A 2D6MA 2WT1A 1C57A 2EIGA 1ULEA 1WW4A 2HYKA 4XJUA 1GV9A 2H0BA 2CTVA 4R9AA 5EXOA 2D3SA 1G9AA 1DFQA 1LJ7A 4Q1RA 3ZSJA 1KITA 3N35A 1W6OB 2A75A 4YG6A 1ULDA 4FPEA 4HL0A 1FV3A 1GNHA 5E88A 3AZWA 1V6NA 1YYNA 3AXDA 2GNTA 5IK8A 4JC1A 2D7FA 2E53A 4Y24A 5DUVA 4DQAA 1JW6A 2DYCA 2R1BA 3QCWA 4XBLA 5F5QA 5T52A 1F31A 3WHTA 1LOCA 1V6KA 1LU2A 1VAMA 2ZGQA 3AYEA 4U36A 3Q9OA 4C1WA 3LSEA 1W6PA 4YM1A 3NWKA 1RITA 4XTPA 4YW4A 5GZGA 4GKXA 4AVSA 1GKBA 3I8TA 1I3HA 4NOTA 1UAIA 3AP7A 2SBAA 3JUUA 3SH3A 3AK0A 4DRVA 1MR5A 1MS9A 1QDOA 2GALA 2D6LX 3MW3A 2NZ9A 1DLLA 3M3EA 1OQ1A 2WSVA 1D0HA 2JKBA 2PELA 4Y20A 5GM0A 4FPJA 4Y1YA 4P9WA 4RL7A 1JOJA 2R49A 1XQNA 2XG3A 3I4IA 1URXA 1BXHA 3DGTA 3MPPG 4BM8A 2R0HA 2KM2A 1V00A 1Q8SA 2W39A 3VKMA 2SLIA 3M2MA 4BPZA 3B01A 3ZYPA 3UL2A 4D69A 3IKWA 2DVFA 4Q26A 5JDBA 5T5PA 2DVBA 5GZCA 4Q2FA 3WDWA 3WVJA 5CAZA 2WNEA 3ZSMA 3N7LA 1BYHA 3V0BB 1BZWA 2PHRA 1ULFA 5DUXA 3N7JA 3WHUA 1DQ1A 2EXJA 2I2SA 3IMNA 5GALA 1S0BA 2CNAA 3GNEA 1LECA 4UW6A 4ATEA 3R4UA 2NMOA 1MZ5A 1QMJA 1V6LA 1A78A 2DWRA 2UURA 4XXAA 3AXEA 3MEPA 4R9CA 2R16A 1CPNA 5IUQA 4CRQA 4AVTA 1SLAA 4XJ8A 5JVVA 3A0KA 1QNYA 3TB0A 1SCRA 1MACA 2JECA 3B9CA 3RG0A 4BQ1A 3AJZA 3CNAA 3D6EA 3ZYRA 4XJAA 1G9CA 2DURA 4ISRA 4ZXKA 1BQPA 3NV1A 4K21A 1LHWA 1OKQA 2ZHMA 1GSLA 3RMYA 4K1ZA 2OW4A 2A5ZA 5H9RA 1W0PA 4AYUA 1PZ8A 1DHKB 3OYWA 4BLIA 1HQLA 1SCSA 1CN1A 1N1VA 3BOPA 4PBOA 3AZYA 4KBBA 1CPMA 4AGRA 1LODA 2ES3A 3LSDA 1HDKA 2EALA 2GMMA 1AX0A 2P37A 3POWA 4M3CA 1Q8PA 1JYIA 4XMAA 4YG0A 5FRAA 1LCLA 5F9TA 3WDUA 4FPYA 1AXZA 3VV1A 1QU0A 3B69A 4YM2A 5KXEA 2A71A 3O0VA 3WG2A 3A0NA 2GNDA 3T1MA 2JE7A 3R4SA 3BTAA 4Y26A 1W6MB 5DZEA 1JUIA 1DQ0A 4AVVA 4K20A 2E7TA 2A3XA 2D6PA 2OUHA 2NP0A 2ARXA 4YM0A 3ZXFA 3TAYA 4Q8KA 1IS4A 4LBKA 5DZFA 1V6JA 1F5FA 4L8QA 1UX6A 1AZDA 4FPFA 2EF6A 3B3QE 1LESA 4WVVA 3IM0A 4XE9A 1S0DA 1ENQA 2P2KA 4M00A 4XJ9A 4K1YA 4I30A 2AH2A 2DV9A 1GZWB 2A6XA 5CNAA 2P34A 1H9WA 2PHFA 1FYUA 3N7MA 5JOXA 3FUOA 4DPNA 2Z42A 1AX1A 2BQPA 3ILFA 3M3CA 1NXD1 1V6MA 1WBLA 1AJOA 1HKDA 3IPVB 1ONAA 3AP6A 4FP2A 2A6YA 4XHBA 4PCRA 4AGVA 1LGCA 4ATFA 3OY8A 1LTEA 1DQ6A 5LK5A 2FMDA 3USUB 2ZBJA 4FPHA 1QF3A 3RRDA 2ZGNA 4UW5A 3AZXA 2E7QA 3BIWE 1GZCA 1O4YA 2ZGMA 1GZ9A 3WCSA 3WG3A 1WD4A 2GNMA 4MYEA 3RMXA 4Z8BA 2A7AA 3AYDA 1W6NB 3PVEA 4XBNA 2ZGSA 1SLBA 5IK5A 4PBPA 5GLVA 1JHNA 5T5OA 5JLVA 1N1YA 2Q5TA 2D6NA 4W65A 5HCFA 4BOWA 2D3PA 3DUIA 4GWMA 1N47A 3LCPA 5DG1A 1DYKA 3NV2A 2CY6A 1JN2P 2ZHLA 2PHTA 3OGGA 3ASIA 3O5SA 4RA0A 4FOYA 5BYNA 1TEIA 5DUWA 5L73A 1QDCA 1LHOA 4BMBA 4YW1A 1IOAA 3HN1A 4LBQA 4DS0A 3WDVA 5GZFA 3A4UA 3OBTA 1AVBA 4LBMA 4AWDA 1J1TA 1AF9A 4YW3A 3R05A 3AFKA 2DTYA 1GANA 3M3OA 5H9PA 4JRAA 3N36A 1LHNA 4XXPA 4XHXA 4F83A 2ZGLA 4FPOB 4DRRA 1LU1A 4YFZA 1YIFA 2ZGTA 4IQPA 5IT6A 2ZHNA 4WZFA 3WG1A 1DQ2A 5DXDA 2V5YA 1F9KA 1MS8A 2AUYA 2VY0A 1IS3A 2JD4A 1S1AA 1LHVA 4GALA 1SLIA 4HANA 5GJ6A 2A6WA 2NYYA 1FAYA 4YW5A 2ZMNA 1LEDA 1ULGA 3FBYA 4GXLA 3PVOA 2E6VA 1LOAA 1DYPA 3KM5A 4NO4A 3WDTA 4YLZA 4FOQA 5GLZA 5FREA 3IN9A 1CIWA 1MS5A 2D43A 3GALA 5H9QA 4LBJA 2ZABA 3FLTA 1UKGA 2YXSA 4ZKTB 2VH9A 2R0FA 2WKKA 4FOWA 3D5OA 2YY1A 3WUCA 2LTNA 1Z0HA 1W6QA 1WW7A 3T2TA 1UMZA 3HR9A 4YW2A 1GNZA 2DVAA 3M3QA 3OJBA 4XJZA 1W6PB 3PJQA 1SLCA 3SITA 1N3OA 2WT0A 1N3PA 1S0IA 1RIRA 1W6OA 2P3IA 4BLJA 1LULA 2DU1A 1APNA 2VW1A 3WV6A 5AVAA 4FVVA 3O12A 4XTMA 4GWNA 3POYA 1Q8VA 5SV8A 2E51A 1A3KA 1N3QA 3PVNA 4Y20B 4FPKA 5HCBA 3AP5A 2DUPA 3SH5A 2AR6A 2UWBA 4GA9A 4GKYA 5T50A 2CL2A 1JYCA 4LBQB 1WLCA 4YGBA 3SISA 2ZAAA 1H9PA 5T54A 4YGDA 4FPCA 3RS6A 1DBNA 4SLIA 1IS6A 1IS5A 1FX5A 1QOOA 4Y22A 1U0AA 5EYYA 1JXNA 3SLIA 1QOTA 3U4XA 2NM1A 2DUQA 2CWSA 2YMZA 2D6OX 2NMNA 2D44A 5E89A 1WW5A 4XYXA 2D3RA 1UN1A 3BODA 2PHWA 3MW4A 1WD3A 3M1HA 4FP3A 4P14A 2A3WA 2DTWA 2EXIA 2GMPA 3D4KA 1YI7A 1Q8QA 2RHPA 1N1TA 5DUUA 4FQ4A 2GNBA 1H30A 2DVGA 4WV8A 5GZEA 1AJKA 5CA6A 1SACA 1S0FA 4M3CF 5JOYA 4ASMB 2VU9A 4M01A 1SLLA 2ZGOA 2UWAA 3WOGA 1QOSA 3ZXEA 3UJOA 2ZMKA 3V0BA 4FOVA 1G86A 1SBFA 2AYHA 5T5LA 3AP9A 1FATA 3WDXA 1S0JA 2ERFA 1S0GA 1FV2A 3V65A 1ZA4A 2XB6C 1PZ9A 3WLUA 3V64A 1AXKA 3O0XA 2UWCA 2VUAA 2WJSA 2B7YA 5CBLA 2CWMA 1MVQA 4UW4A 3KQRA 2DU0A 3VKLA 3ZXLA 2ZKNA 4TYSA 5T55A 1G9DA 3OYWB 1LHUA 3VUOA 5GLWA 1WW6A 2EAKA 2ZMLA 1NLSA 5GLUA 1LOBA 1MZ6A 1VALA 1W0OA 3C2UA 1UPSA 3O0WA 1LEMA 4M3CB 1LGNA 4XIKA 2CYFA 3FFZA 3L2YA 1DZQA 4ITCA 1ENRA 3H0OA 4YZ3A 2ZGKA 2YROA 5JMCA 2AGSA 3NV4A 2A70A 2ENRA 4XOGA 4Y1UA 1V6IA 2LALA 4YG3A 4YGEA 2GN3A 4FPGA 4LBOA 1KJLA 1I1EA 1GBGA 2ZZJA 2EXKA 2WSUA 4Y1VA 1EPWA 5GLTA 1G7YA 4XDQA 2W52A 1CQ9A 4BMEA 2ZGUA 4XBQA 1FNZA 3WNXA 4XJWA 1G9FA 2ZA9A 1V6OA 1VLNA 1OFSA 1IKQA 3ENRA 4YFWA 1QGLA 4Y22B 3SNMA 4YGCA 1CESA 4WVWA 1Q56A 2VXRA 3ZXKA 5T5JA 4JCKA 4R9DA 4U2AA 5IK7A 1BKZA 3AYAA 2VW2A 1AXYA 4UW3A 3ZVXA 2ZGRA 2GDFA 2W68A 3FUQA 1PZ7A 1CONA 1D2SA 2FHRA 4P9YA 1ZM1A 2AREA 2GN7A 1CJPA 2WQZC 4XILA 1VIWB 4CZSA 1HQWA 1R1ZA 2A6VA 2JJ6A 1GICA 1SFYA 4M3CE 3ZSLA 5HCAA 4LBQD 3AYCA 4DFSA 1W6MA 3PMEA 2W08A
chains in the Genus database with same CATH superfamily
3OBRA 5F3EA 2XKPA 2WYSA 3H50A 5KXDA 1LGBA 1YJLA 2CGOA 2RE9A 3H3UA 3NNLA 1RHI3 4OVEA 4E4HA 3OY8B 5IVFA 2BRTA 2PTMA 3MBWA 3N9NA 4IE4A 1I5PA 1VAVA 2PHUA 3UK9A 5BNNA 1DQ5A 1AYM3 1XJAA 3VZJA 4NIAA 1WKYA 2VCBA 3C7HA 3DYMA 4K8RB 1F35A 2B5HA 2HBUA 4KGQA 3WCRA 5JOZA 3SEPA 2JE9A 3WW4A 4JDMA 5FMOS 1YFYA 1GZWA 4CEYB 3U11A 5IATA 1RMU3 2JKXA 5C3OA 1YRZA 2LROA 1JYXA 3ZFFB 2EXHA 1W2NA 5KXBA 3D3AA 2WN2A 3CJXA 2P3KA 4H2AA 4AEDB 4DOUA 5FY9A 4FTSA 1Q5OA 3PHMA 1VBE1 5FZ3A 4QX0A 4C1XA 4OMCA 4MG2A 2WABA 4LBLA 2DBNA 5CB7A 3WD5A 2D97A 4B7EA 1SBDA 3A7QA 2ZEXA 1UOFA 1XYPA 1BBT3 1OLME 2WS92 5K4LA 3WG4A 2OXBA 1WBFA 4JGZC 4GAZA 5ABJA 4UWDA 1FOD2 1BCXA 3VN4A 3OPZA 1MPXA 1XNTA 2VOWA 2ZACA 4EV0A 4YZ5A 1HRV2 1WCSA 3VL8A 5FQ0B 2B42B 2H6BA 1W6NA 3IB3A 1LOFA 4FT8A 4HKOA 2JENA 2X53S 1LOEA 4CE8A 4X8NA 3HNYM 5A6YA 5C33A 4EJRA 5A3MA 1DGRN 5KHKA 4TLGA 4NIHA 3R0RA 3ZMOA 1WUVA 3CLPA 4B4RA 1W8WA 2V73A 2XJQA 2YZ4A 5ACA1 1CZVA 2QTWB 4NR1A 3PU3A 1GOHA 4MADA 2VAUA 2J1EA 5KHJA 1LOGA 1X7NA 2P1BA 1OPOA 5J36A 5IHRA 1POV3 5E6HA 4AFDA 1UYXA 2ARBA 2GP3A 4XFAA 4XZPA 4DUVA 1SG3A 5LBEA 3ZSKA 1HJGA 3IDAA 1LENA 4RGGA 4Y1XA 1DYOA 1ND3B 1ULCA 1WZXA 3KGZA 4JQRA 2R042 1WLWA 2BJSA 2PMWB 3HQUA 2VZUA 3ZXJA 1KDMA 4PF5A 1RUD1 2ZEWA 4WM7A 5C9AA 1V70A 1HRI2 3HBZA 3I2GA 5DZGA 3WZ1A 5DG2A 3Q8BA 4GB32 3V0AB 1J1LA 4Q4X3 2WZR3 2OS2A 4H7MA 4MGQA 1GOGA 2J42A 2D5FA 1W6QB 3Q8AA 4XZUG 1IQAA 4WVZA 3SEEA 4MXWB 1ULEA 2K2SA 3B94A 4GIQA 4CDQC 1GV9A 2H0BA 5IVBA 1UQXA 3TEXA 1LJ7A 1RUI3 4Q1RA 4TTGA 4MH0E 1W6OB 2CGPA 3JQWA 2B45X 5FZIA 1FV3A 4Y3OA 2R6QA 3J7MA 5IK8A 4JC1A 1H2MA 1GZTA 3NL1A 4AL9A 5JI9A 4Y24A 2RG4A 4TWTA 2YU1A 4XBLA 3LGRA 4XQ4A 1F31A 1KD7A 4RS5C 1HXS3 3UV9A 4Q4W2 4PT6A 3KS7A 1EPZA 4B4PA 3RJRA 1V6KA 3BN6A 3OF1A 3PJYA 4QX7A 3VGIA 3I2KA 3I97A 4C1WA 2Y6KA 3E1F1 3LSEA 3NWKA 4Z1VA 2OA2A 4GKXA 4ZXEA 1GKBA 2RDQA 5FXZA 3I8TA 3LZZA 4QGNA 1I3HA 5FTTC 1E5SA 1OXCA 1S2EA 1C5HA 2SBAA 3ZN6B 4COVA 4CXWA 2K9ZA 1MR5A 4GD4A 1MS9A 1QDOA 2GALA 5I0UA 5LASA 4DXSA 4LHSA 2VJXA 4MZUA 1TG7A 4LOTA 1OQ1A 2WNUC 1VBB3 4DIQA 3KD4A 1AYN2 4FPJA 4Y1YA 4Q4V1 2JDMA 1URXA 5FPBA 3I59A 4QX1A 4WVMA 2JG9A 2J1UA 1AR62 3VD3A 2XHNA 3DXTA 3C7OA 5F3CA 3I3MA 2EIBA 2RS12 3UL2A 3MGUA 4BH9A 2RMU2 2DVFA 3IKWA 3W9AA 4OI1A 1UU4A 2DVBA 5GZCA 3WVJA 3ZSMA 3N7LA 3SCGA 1O91A 4ASKA 2PHRA 3FL7A 5JIUA 3N7JA 4P02B 3DECA 4LO6B 3WHUA 1QQP1 3KVAA 4ZS2A 5EHDA 2W1WA 5GALA 1BEV2 3MIHA 3P1IA 5FAXA 4ES8A 1S0BA 4Q4Y3 1UMIA 4UW6A 3LPFA 5D1IA 4AEKA 2FDJA 2NMOA 5FYSA 5D2AA 2RV9A 3U14A 4OHZA 4A6SA 1A78A 2DWRA 4QU2A 3S6PA 3OOXA 4CU8A 3VBFC 4JZRA 1EV11 1OLQA 5LA9A 4DXTA 5IUQA 2CDOA 1CZTA 1SFPA 1SLAA 4HVQA 1NUKA 3KT1A 5C3RA 3AM2A 1QNYA 4MXVA 3TB0A 3ROUA 2JECA 4WM8A 4XF3A 3RG0A 4G9SB 1ND2A 4XJAA 1G9CA 1OF3A 3O1VA 4I0WB 2VPVA 1R1A3 3FMGA 4K21A 3CJIB 2W1QA 3P3NA 3RMYA 2ZEZA 4Y5SA 1HB2A 2X5IC 4DUXA 2A5ZA 3WW3A 1YIPA 1W0PA 4LO7A 1Y9MA 1ZBA2 3OYWA 5DDJ1 4N43A 1Y43B 3LDKA 1CN1A 2PLV3 4W8JA 1FPN3 4F7ZA 4XVHA 1QXJA 5SV5A 2FDKA 1NLRA 1LODA 5FXXA 4AGRA 4N53A 3LSDA 5JSRA 5A3NA 2GMMA 5FWEA 1AR82 1O3RA 2JIJA 1UOJA 3NJXA 4OFGA 4XMAA 2MNGA 2XQRA 3ZYGA 5K0UC 4EQVA 1NOVA 2O14A 1KS4A 2YDEA 1J83A 5DQ0A 5F2WA 1AXZA 1JODA 5AC92 4HPKA 4QGLA 4CUBA 4LT5A 5FMBA 1RHI1 4GULA 4AEMA 3PUHA 4XW3A 4RGAA 2R073 2GNDA 3T1MA 1W6MB 1PVC3 4CEWA 1QEXA 1DQ0A 3LFIA 4A44A 4AVVA 5HI0A 1ZZ6A 5FP4A 2E7TA 2OUHA 2D6PA 2ARXA 3IMMA 1FI2A 2JG8C 3ZXFA 3IDCB 4F3JA 4LOSA 5DZFA 2G1MA 3K75B 3NNFA 4JQTA 5CEHA 5C8CB 3K48A 5AFEA 1AZDA 3N9OA 3OGJA 3B3QE 3AFGA 3IM0A 1OVSA 2QDNA 2C4XA 3UKVA 4OCTA 2AH2A 5A80A 2DV9A 5CNAA 2P34A 2ZS6B 4AQ6A 2QUOA 1PO13 4O9EA 4DPNA 3S57A 2VMDA 1AX1A 3DN7A 4I0BA 3F95A 4Q0PA 1QJZA 3RVHA 1WA4A 1QJY1 3IPVB 1ONAA 3ZR6A 1BBT1 3C7EA 1IPSA 4BQ5A 4D3WA 5E16A 1LGCA 3OY8A 1GQGA 1LTEA 1ODMA 2RS53 2P5BA 1P8JA 1RUH1 1DQ6A 1XOYA 2VC9A 2XGXA 5I0TA 1UPIA 4EE2A 4UT5A 3WP5A 4AHXA 1OFNA 2ZBJA 1PX4A 3RRDA 4CEYA 3UT0A 2WNOA 5HXVA 3BIWE 1O4YA 3WCSA 1WD4A 3RYPA 4AI0A 5C7GA 1WMFA 5IK5A 4XBNA 5FKBA 5BXXA 3NO8A 1XNCA 2XMLA 3ZFFA 1R091 5GLVA 2VOXA 2B8MA 3QH6A 4AEDA 3O14A 5T5OA 2WN3A 1N1YA 2Q5TA 5FPVA 4BQWA 1NT0A 5DG1A 1DYKA 5FK8A 4ZS3A 4DZGA 2R062 3ASIA 3NMBA 5KWRA 2XUMA 4PJYA 5CFCC 1QDCA 3ZIWA 4IE0A 1EAH3 2BERA 4UFLA 4W6XA 4YW1A 5L7OB 3VZLA 3WXPA 3WDVA 4Q0VA 5GZFA 5CG9A 1QXRA 4XC9A 4Z07A 1AVBA 2I74A 1AF9A 4M0NA 5FQ0A 2JXAA 1DP0A 1GANA 5H9PA 4Q4X1 3O1MA 3MYXA 2XBO2 4LE4A 4KGGA 4LXLA 4IEWA 4LUMA 2W46A 4DRRA 1YIFA 3TEWA 2FQPA 3BIEA 2HWC3 2OKXA 3MLLA 3O1SA 4EWDA 1RUI1 1DQ2A 5F6KA 3NNGA 5FZEA 2BFUL 4HVRA 2FCTA 1F9KA 5IAXA 1EYBA 3GCXA 1S1AA 1GP6A 2VZSA 4NAMA 4UFMA 4XUOA 2OIIA 4GALA 1SLIA 5A7OA 3I49A 2W94A 2WNVB 3U10A 3J7LA 3MLKA 3VD9A 5FMOL 4RQPC 2ZMNA 1EP0A 1COV2 1A34A 5A1AA 3ACFA 1AL0G 3NKTA 3PVOA 4QX5A 4NO4A 4R4ZA 4HLTA 5FR3A 3EO6A 4OUEA 3WF0A 5JZGB 4R52A 4QGMA 2IUWA 4DMIA 1BLZA 4MGTA 4LBJA 4QU1A 3WNKA 4ZKTB 5LBFA 3LIHA 1QJU1 2HWD3 2X5IA 3D5OA 3KF5A 4HETA 2HEVF 2LTNA 3WNMA 1W6QA 4ARYA 5I8TA 3HR9A 4YW2A 5CFDB 2JD9A 2JDUA 3ZFEC 4MXWA 4XJZA 4HXCA 1VBA3 2G19A 1IPKA 3EHKA 4BJ0A 1W2OA 4GMP1 1N3PA 1W6OA 2P3IA 1O4TA 2YBPA 1H4GA 3OTFA 1APNA 4FVVA 2WZ8A 4BK4A 1REFA 4GWNA 5C6CA 3RI8A 3GHNA 4CP9B 1SMVA 1FMD3 1YFXA 3KVBA 5SV8A 3PVNA 4Y20B 3ZO0B 3AP5A 4TN7A 3NAPB 4NIDA 1DGRA 4LBQB 4YGBA 5G05L 2ZAAA 2XQXA 1H8TB 1V0AA 4B8EA 4CCCA 4RHV1 3OGSA 3K77A 1SDDB 2Q8EA 4A4AA 5BNQA 3Q8EA 4Q4Y1 1PVXA 2G9GA 5EYYA 3SLIA 1QOTA 2HJIA 2L9LA 2WUHA 1F4AA 2NM1A 2Z5WA 2CWSA 2W95A 2YMZA 4LO8A 3WT3A 1ZX5A 4E8CA 1GNYA 1UU6A 1WW5A 2CAVA 5CKMA 5ANNA 2IXJA 3MIGA 1OURA 3BODA 1TVGA 4KU8A 4P9LA 4URAA 2A3WA 2DTWA 2GMPA 1H1MA 4Q0UA 4QT6A 1Q8QA 1RGSA 4FQ4A 2GNBA 1RUF3 1H30A 2DVGA 3EQEA 4WV8A 5GZEA 3WF4A 4YARA 3VBHC 1IHMA 1OQEA 2J1TA 2MEV1 1SACA 2P4EA 2JDNA 5L36A 2GP5A 2YGMA 3ZXAC 5FLHA 3RWNA 3WOGA 4KG0A 3UJOA 4CDUC 1RUC2 4FBFA 1SBFA 4NN0A 5T5LA 3AP9A 5IFTA 1MEC2 1K5JA 5B2GB 5JSOA 2ERFA 4FAHA 1FV2A 1Z7S2 4A3XA 1FPN1 4HT1T 1ZA4A 4JHZA 5FLIA 4EN6B 4V1PA 1PZ9A 3WLUA 1AXKA 3MLJA 2UWCA 2WJSA 4DINB 2HKXA 4META 1MVQA 3CO2A 5FYHA 4AAXA 5T55A 2BDRA 4AAPA 3TOJA 3WHTA 3S30A 1W0OA 5B4NA 2NQYA 4LITA 1VMFA 2BUKA 5FPAA 3WR0A 1LEMA 1LGNA 3UETA 1ENRA 5FZ4A 5FP9A 2ZPXA 5JMCA 2AGSA 1PVC1 5EPAA 2Y64A 1E57A 1VE0A 1YQ5A 5FUNA 5FY7A 1POQA 3CJIA 1O3QA 1I1EA 1W9FA 4PHZA 1RUG2 1IPJA 1VBE3 2ZZJA 3G6JB 1SDWA 2W47A 4YVWB 3Q8CA 1K5MA 3ETQA 4CYDA 3THPA 4BMEA 2C6SA 2FDFA 4XBQA 4GH4B 3WNXA 2Y0OA 3C8XA 1HQNA 5BNPA 3MV11 1QGLA 4YGCA 3BYWA 1CESA 4NROA 1NYWA 3IAQA 5FYVA 5CKQA 5IVVA 4LK6A 1ZRCA 3ACLA 3AYAA 2D40A 1AXYA 1I6XA 4XUPA 1HN0A 1B35B 2ZGRA 3JCIA 1PZ7A 1D2SA 4J25A 1ZM1A 2WQZC 2V5DA 4XABA 1T6BX 1VIWB 3KSCA 4UFKA 2JJ6A 2RS51 3LF7A 4OI4A 3ZSLA 2WS91 1ACCA 3KGLA 1WCUA 1W6MA 2J1VA 3LAGA 3NJYA 3URFA 1I9RA 4L99A 4UF0A 2VGDA 1W28A 3VL9A 1FOD1 1PMIA 4Y1ZA 3VZKA 2IFWA 3W58A 3POBA 3U37A 1C1LA 4IV3B 4LHNA 1HRV1 4TZDA 2VW0A 5BNNC 5C8CA 2G9ZA 1DIWA 1Q8OA 1UZVA 1WMDA 2EA7A 3T09A 2UU8A 1NA1C 2P3YA 2ILMA 3QLQA 1ENSA 4CP0A 4E4DX 4JVAA 4K8FA 3VBOB 4QQPA 2VTFA 1TE1B 4BQ4A 1A8MA 2DCJA 4I01A 4LMFA 2OVUA 1AR72 4EWEA 2ZOEB 4GMP0 3INAA 1RUD3 2Y6HA 2QQPA 2NN8A 3IPVA 1OUXA 4DB5A 4NHKA 1VPHA 1SBEA 1T6GC 1GP5A 3T4VA 4UOJA 1EAH1 1ZBE2 3MO4A 3VKFC 4BQYA 1JU4A 5E8AA 1SLTA 4EROA 1TMF2 2VXJA 5FBZA 1CAUB 2P6HA 4HBNA 2R041 5EIYB 2A6ZA 5FO9B 2KR2A 4A41A 4P00B 5ABJC 2GMEA 4CP2A 1HRI1 1CR7A 1K42A 3C7GA 2LRPA 1VB4A 1JBCA 1WCKA 2O1QA 3MW2A 4QXBA 2HWB3 4JDNA 4UI9L 1KQRA 1LOFC 1BJQA 4L92A 3HWJA 3ZPYA 5FCCA 4CUCA 1X9TA 5H9SA 1W90A 3ATGA 3OUHA 1REDA 3POEA 5LRRA 1RXGA 4K9SA 4AFCA 4ZONA 4JTNA 2PHXA 1UOGA 4AQ2A 2AENA 2CHHA 4L97A 3T1LA 5IJRA 2D98A 4BISA 2WBKA 3HEIA 2RS32 4LLFA 3FC0A 2Z69A 4QHOA 4XFIA 4DO0A 3I2HA 3M3IA 4YM3A 5EJ1B 1VMHA 1L7RA 1T2XA 1COV3 1YI9A 4L11A 4Q4W1 3IBMA 4AGGA 3ZDSA 3WNNA 4KU7A 3POSA 1UZZA 2BW8A 1H4HA 4FPLA 3I3EA 4YZ4A 5F39A 1VBD2 2BV4A 2WWUA 1ST8A 3I3BA 1UIJA 3LB9A 1QWRA 3NJVA 5EQUA 1YO8A 3FWEA 4WM7C 5AVPA 5C9AC 5I0DA 3RZLA 1JZ5A 2O8QA 4ZY9A 4YZ1A 1MZFA 2C5DA 1WWYA 3AZVA 1OA3A 1XE0A 3FBMA 3K4ZA 4LBNA 5FZDA 3VBUB 4XFGA 2AZ5A 4CCDA 4AK3A 2D6MA 2VBDA 1RJ8A 1QQP3 1C57A 2J1AA 2HYKA 2WT1A 4BQ3A 1AYN1 3GZEA 1O6UA 2CTVA 1JMUB 3H7YA 4PIZA 4R9AA 5FUPA 1AR61 1BVP1 1DFQA 1G9AA 1NQDA 3MIEA 2IXCA 5A7NA 2A75A 3GZTB 2D93A 1OH3A 4FPEA 1C3HA 3LA3A 5JPMB 4LHLA 5E88A 2RMU1 4LTAA 5JZGA 3L9JT 1JZ7A 3K46A 1H6XA 1DZTA 1EV13 1PO23 2ADDA 3GXUA 3I7DA 2JX9A 5G04L 1OHFA 3K4DA 3VHRA 1NCQB 3H8RA 1LOCA 2F17A 5A33B 2ZGQA 5EP9A 1Q3EA 1BEV1 4RFRB 4LKSA 4FFFA 3L2HA 4QPGB 1PGL2 4BYYA 4YM1A 1D4M3 1X36A 4YNIA 5GZGA 1TME2 4I09A 4MO3M 1UWWA 2ET1A 1OUSA 4JGYA 4ZU7A 1WGPA 1RUF1 4GJZA 4D7TA 1CAVB 1XBFA 2OZ6A 1NG0A 3S5QA 5J96B 5DDJ3 4NIGA 4BIOA 4XFFA 3T4HB 2RM22 3M70A 4CP9A 2ZEYA 4DEQA 1D0HA 2JKBA 4Y20A 5FWJA 3VDCA 4P9WA 1PMHX 4RL7A 1RUOA 1L3JA 4BM8A 2XG3A 2JWPA 3I4IA 1BXHA 4G3YC 1UY1A 1OQDA 2R0HA 3CZJA 3ELNA 4J1XA 1V00A 2JG9C 2W39A 3RZHA 1W03A 4PDWA 1H8TA 3I2DA 3M2MA 2RJ2A 3ZIXA 4BPZA 2ZX0A 2Z4FA 3ZN4A 4D69A 1XPWA 4CCLA 5CVRA 5IVCA 1JZ2A 2WRAA 3WDWA 1ZBA1 5FY8A 5CAZA 1BYHA 3VLBB 5K7PA 3CU7A 3B9IA 1ULFA 2ET7A 2WWJA 4QKNA 4YW7A 3T08A 1NXMA 4RGKA 1DQ1A 4IGOA 1AL22 2GU9A 4XQDA 1AR81 4CCMA 1NA1A 2RR12 4OHVA 1DF0A 4OZOA 4QHBA 3GNEA 1LECA 3U1XA 3R4UA 1MZ5A 2C26A 1OKOA 1QMJA 3IDEA 5AC91 2EICA 3VD7A 5FZ7A 4FTEA 4XXAA 5CIRA 1OOPA 3S7IA 4R9CA 2XKOA 4LIVA 3OPTA 2R16A 1CPNA 3HNBM 1G6NA 3GGLA 3OG2A 4KI5M 3PL0A 4UBHA 3ZFGB 3KF3A 1UY3A 1GQPA 4WM8C 4BQ1A 3ZYRA 1XSQA 3WP6A 1ND2C 1QJY3 1C28A 1EUUA 2VQAA 1XYNA 4S2DA 3OD0A 5FZ9A 1ZRIA 4TSVA 3DL3A 4ZPIA 1PZ8A 1RUH3 4BA6A 2V4AA 4CUGA 5FY4A 2C9KA 4XFBA 4BLIA 2FDGA 1XNKA 4N43C 3BOPA 5I0SA 2IXKA 1CPMA 3HBKA 4EZHA 2ES3A 2CU5A 2WO2A 4MLOA 4N53C 4PI2A 3ZYIB 4CCNA 2XXZA 1Q8PA 4E4SA 4E8DA 3HT2A 5FRAA 1LCLA 3SCHA 2ZTNA 3CKHA 4FPYA 4C90A 1R093 1ASJ2 2A71A 5A32B 4YVWA 1XYOA 2RJLA 1F5JA 1JUIA 4YRDA 5DZEA 4E2SA 4CEWC 2XWBB 4GH4A 1YQ2A 3A22A 3QACA 5A7PA 4COZA 4OYUA 4EWAA 5FYIA 3ME2A 4LJHA 2NP0A 1H1AA 1XB9A 4MHRA 4NPMA 4XURA 3P5BA 4YM0A 4Q8KA 4W6YA 4XPVA 2QQJA 4XQWA 5A3OA 5AFBA 1RTVA 1LESA 1B35A 2XUEA 2F6BA 3LEMA 3PTYA 3PUIA 4M00A 2VUJA 4I30A 4K1YA 4XJ9A 5F1RA 3KV5A 2A6XA 5BNOA 1H9WA 2R061 1FYUA 4A2UA 5FJKA 3VD5A 3MZHA 5JI7A 2VMHA 3N4MA 2VOTA 2Q1FA 3ILFA 5F3GA 1ZRFA 1HB4A 3AMQA 4MGKE 1NXD1 2VZQA 4OQ9A 2IVIB 2XLFA 5FYTA 1ZBE3 2Y6JA 3OB8A 4FP2A 4L2NA 2A6YA 5JUVA 4XHBA 4PLNA 4ATFA 3JBG2 3FHIB 4KWLA 1X9PA 3MV01 1PGSA 2HWB1 1CAXB 4IEOA 3W5MA 5FY5A 3UYJA 4OLLA 2A73B 3WQ1A 3HJRA 3QH7A 3VBOA 4UW5A 4CEYC 2E7QA 2LM3A 1X8EA 4RN5A 3LEIA 2IZWA 4NHLA 3WG3A 4AR2A 2XDVA 4GWIA 2BP6A 4OI2A 1U5YA 2WFF2 3SC7X 1SLBA 3ZFFC 1W0NA 4R4XA 2XVGA 4AEDC 3TN92 3OCPA 4IV1B 1QJU3 3AKPA 4BOWA 2D3PA 2X09A 4OUMA 1N47A 5K0UB 5FOBB 3JD73 2YB7A 1NE6A 1COV1 1STMA 2PHTA 2Y34A 1JOBA 2WA3A 4M4RA 1CAUA 1YNAA 1TEIA 3DEMA 5L73A 2BWCA 4GMP3 1LHOA 3H1YA 4BMBA 2GSYA 3PIJA 4CVUA 3A4UA 4P5HA 2G9FA 5FO8B 2FZ2A 1J3RA 4YW3A 4IEVA 3R05A 2DTYA 3OEBA 4ZU5A 5FPUA 3D82A 1LHNA 3IZOA 2ZGLA 4FPOB 5DAWA 1JUHA 4RHV3 4IE6A 5IT6A 3KT7A 3GHMA 1JI6A 1HJFA 3H9AA 2IXHA 2AUYA 2VY0A 3BALA 4OUSA 3W20A 4J1WA 5FIXA 1QJX2 4P9GA 4HANA 2XJSA 2PQQA 1PO21 1FAYA 2PYTA 4IDZA 5FYYA 2ETEA 1ULGA 3EMRA 4GXLA 2RVAA 3WDTA 5GLZA 4CUAA 5FREA 2BVVA 4AOCA 4C0BA 3IN9A 5DAXA 5C8WA 2MEV3 1CIWA 3UGGA 3ZXGA 4AVAA 2C24A 1PNGA 2E7AA 1NQJA 5A7SA 5H9QA 3EYPA 1D4M1 1UKGA 2YXSA 2VH9A 2R0FA 1ZYBA 3KQ4B 4X8PA 1RJ7A 2VTXJ 4FOWA 1ULPA 4PIYA 1W8NA 5BPXA 3WUCA 1Z0HA 3IAPA 2ZZQA 4M4PA 5FZOB 3T2TA 3VBUA 3WP3A 2DVAA 2KXLA 4C91A 3POGA 1H8VA 2Q30A 3HAGA 2WR9A 5FUIA 1W05A 5D8AA 2J1SA 1C8M2 3TEZA 1BK1A 2NLRA 2DU1A 3KWVA 2W92A 4AZZA 3O12A 4BWOA 5LCWL 3G7DA 1RUE2 5JSPA 1Q8VA 2E51A 3DPRB 1LR5A 5E1RA 3WNLA 1BMV2 3ON7A 1NCRA 4HSJA 5DAQA 2UWBA 2E26A 1NCQA 4CDXB 1HV0A 1Z7S1 3THDA 3RZKA 5A33A 1H9PA 4UAPA 4YYOA 5T54A 5APAA 4CU6A 1W9SA 2WYFA 4QPGA 4JHTA 2Q8CA 2YC0A 4XUQA 3KCCA 3SXWA 1Y9GA 2PA7A 3OEAA 1U5ZA 4P9JA 2NMNA 1KFUL 4A7YA 1CAVA 5KHHA 5L9RA 2Q8OA 4XYXA 1SFNA 3TWIA 2EXIA 5IWFA 4AVCA 3S5AA 3ZSEA 1O3TA 4YWAA 2RHPA 3E5XA 1N1TA 3KMHA 4CDWB 5CA6A 5C5TA 1AJKA 2FDIA 4HKLA 2ID4A 2BNMA 4IEXA 2FCUA 4ASMB 1RUG1 1HIXA 1SPPB 2VUDA 2UWAA 5JWPA 1QOSA 1W06A 4UYBA 1MZEA 4WBBA 4N7UA 3ZXEA 3LEGA 5A3WA 2VECA 2RJKA 2BBAA 1G86A 3EBRA 4O9GA 2WS93 1UO9A 4QPIB 1S0JA 4H7LA 1W8FA 1S0GA 5LBBA 4MGSA 4MGYE 1HN1A 1L7QA 1FOD3 1UX7A 3V64A 5A3LA 2VUAA 4ARXA 3RNSA 2DFBA 1HRV3 3KZ4C 3KQRA 1F15A 3VHPA 1G9DA 3EJKA 1O8PA 5GLUA 4AXOA 1LOBA 1MZ6A 1VALA 3C2UA 1NY71 2EIDA 4H3WA 3VB9A 5HCHA 3HVDA 3O0WA 1OT5A 3ETPA 2PAKA 4M3CB 4CCKA 1LNSA 2CYFA 4ITCA 2HEWF 3L2YA 2OYZA 5CISA 1W8OA 5FZBA 2IFRA 1R64A 4MX3A 4YZ3A 2ZGKA 1U12A 2YROA 3ZFGA 4CXXA 5ACA2 2A70A 3OPWA 2LALA 3B02A 4YG3A 4YGEA 2GN3A 3N9MA 2YBSA 3CJIC 5A7QA 2DBIA 2UY9A 3T2QA 2ORZA 1EPWA 1K5MC 1J84A 3POFA 1FNZA 2HWE2 1V6OA 1UOBA 3NRUA 5F32A 5BNPC 1AR71 3D8CA 2R043 3CDZB 3ENRA 4PLOA 4Y22B 2W1UA 1KS5A 2QDRA 4YFWA 3RZMA 3T30A 4WVWA 5LY1A 2VXRA 3WW2A 4A7KA 4R9DA 3I2OA 4U2AA 4O61A 1HRI3 4GB33 2W68A 4GQ7A 1ZBE1 1CONA 2FHRA 4FI9A 4P9YA 4KWKA 4Y4RA 5L19A 2GN7A 3PUQA 1YFWA 4XILA 4CZSA 3VZOA 2O0OA 1R1ZA 1SFYA 1GFF2 2GC0A 3N9LA 4BHPA 5A32A 2W9XA 2XPJA 4DFSA 5J3UA 5FP3A 2W08A 5A6QA 4AQTA 2ZX1A 2PHLA 2XJRA 3AVSA 3AP4A 4XDOA 5FY0A 3KT4A 4LA2A 5FXWA 5BV6A 4QDRA 3THTA 4CPBA 4NVPA 3GCWA 4YW6A 1ND3A 4O65A 5FFOC 3LWCA 3AB0A 4QXHA 4BU2A 5C8CC 4L0PA 4Q4W3 5LEJA 2GAUA 1AR92 4P9IA 4AEJA 1UMHA 1S0EA 3BPZA 1UY0A 1ZNPA 4ISQA 3RPQA 5KBFA 4OZXA 5F5CA 3V0AA 2X29A 3TNQA 5JCTA 2VZ3A 2WFF3 1XU1A 2QNKA 4PI0A 4XIOA 3JD71 3VDDB 2DCTA 3W59A 2Y6LA 3AJYA 2RS31 2YGLA 3A23A 4XMIA 2XJVA 1UL9A 4XDPA 1C1FA 2ZGPA 1PIV2 5F37A 3NKGA 1QHDA 1KDKA 2C9AA 4Q4V2 1AYN3 5FZCA 5C70A 1VBD1 3WQ7A 2VO5A 2BVBA 1AR63 1CAXA 5EV7A 3N9PA 4HKWA 2QJVA 4XF4A 3NW4A 1UZYA 2RS13 4EYUA 3AMPA 2RMU3 2VOKA 4UFJA 4LHKA 4P9XA 5DABA 1B09A 1Y9QA 2VZ1A 1OI6A 3VBSB 3OGRA 2E33A 4COWA 2D6KA 4YVSB 4IV1A 3VKOA 4W4ZA 5C4WB 3ZN6A 3RQ0A 5JOWA 5FZKA 2OQ7A 5LK7B 1BEV3 1GQHA 3VBRB 3WDYA 1RUJ2 2XL9A 3H8XA 3B00A 1W39A 1Y7BA 2HWF2 3ILRA 1VBC2 1H1IA 4I3GA 4EZ4A 4NRPA 1FNYA 2QQVA 2YV8A 3RSJA 1G8WA 3PUAA 5CZKA 1O3SA 4FQZA 2OUJA 5DMYA 2VE1A 3AZZA 3MDPA 2XJTA 1YUDA 3I54A 4N9IA 2Y33A 1AX2A 2Q1ZB 4E2GA 2WT2A 1WLDA 3J26N 3NV3A 5BNNB 3LA7A 4IEQA 3VKNA 2R1DA 3AKQA 5HBAA 1BVVA 1UIKA 1XNDA 2XVKA 1PNFA 2JDZA 1RVF2 4R9BA 4B1MA 4B3NA 1HLCA 1US2A 4XUTA 1ZBA3 5KXCA 4QPWA 4NIIA 4OHWA 5J7MA 2VL4A 2A3YA 1GYKA 2RM21 2FD8A 3CZUA 2KD7A 2WWSA 1WW4A 3ALQA 3V56A 1AR83 3AMNA 2D3SA 4N8MA 3ZSJA 4RR3B 4FSJA 3N35A 2Y8KA 2XR4A 2QQMA 4YG6A 3POJA 4HL0A 1GNHA 4HN0A 4QQ2A 5AC93 2PFWA 2GH8A 1RHI2 5EFUA 5A6ZA 5JZGC 2E53A 5DUVA 3ZXDA 4DQAA 2WQ4A 5T52A 2DYCA 1AYM2 2R7EB 3QCWA 3RI9A 4EN0A 1M06G 1JH5A 4XCAA 1AL21 3PTRB 3CL1A 1VAMA 2RR11 3AYEA 4U36A 2QQNA 5FZOA 3Q9OA 3B5LB 4QX2A 5CFDC 1RMU2 3GZAA 3KLSA 3GDBA 3P6BA 1RITA 4XTPA 4YW4A 1PHMA 5T3NA 4AVSA 2WLPA 1UAIA 3AP7A 3JUUA 4JGYC 3SH3A 4L9BA 5FZGA 2WFPA 4DRVA 2JEMA 4X6QB 3OBZA 1UZ0A 1DLLA 1OH4A 3DPRA 2PELA 1MQTB 1DLCA 2GZWA 1CAWB 4Y33A 2R49A 3MPPG 3NAPC 5I8YA 5FMDA 3DGTA 2PN5A 4CDXA 4DUWA 1K3IA 1NX9A 1D2QA 1Q8SA 5FYBA 2WIIB 3VKMA 5L9VA 3KCXA 1H8TC 2SLIA 2VMEA 4JTOA 4HK9A 4MOAA 3B01A 1CJDA 4PDWC 3ZYPA 2QQUA 2JDAA 1ZZ7A 4Y4YA 3O7OA 4Q26A 5T5PA 1US3A 4Q2FA 3ZOIA 3VDBA 2WNEA 2H6CA 4WM7B 5FZ6A 2XONA 2EXJA 2JDKA 4FO9A 2I2SA 3IMNA 2UY8A 4B1LA 5A70A 5I8SA 2K0GA 4Q0QA 4ATEA 2XOMA 1TQ5A 1UU5A 5FPLA 3HNMA 5CADA 2QE3A 4CDWA 3UESA 1V6LA 2UYBA 2I07B 5J48A 3AXEA 5DAPA 1ASJ1 3MEPA 2ZX2A 1OOPC 1VAKA 1SPPA 2PAMA 4CRQA 3O1TA 4AVTA 3KB5A 4XJ8A 2R063 1PK6B 3A0KA 1UW8A 1K12A 3FHAA 4JKLA 1SCRA 1MACA 5EJZB 3FHQA 3AJZA 3D6EA 2Q8DA 4QPIA 2DURA 5F6LB 2YPDA 1W99A 2GC2A 4ZXKA 1OA4A 1OKQA 2DCKA 4K1ZA 3RFRA 3GBWA 2OW4A 1JYVA 4QDSA 3BCWA 5H9RA 3WF3A 1DGWX 3H7JA 3KV9A 1DHKB 5FZ0A 4Q4X2 4AHZA 1WCQA 2WZR2 4GB31 1SCSA 2VCAA 1D0GA 4KBBA 2XBO3 4CU7A 2VMGA 2WO7A 1HDKA 4M3CA 2P37A 4HN1A 5FZMA 1UYPA 3OD4A 3LA2A 1GUIA 1RUI2 1VB2A 4YG0A 3HIFA 2CDPA 1W2UA 3LOBA 4ORFA 5KHGA 1R082 2B39A 4D0QA 3JBG1 3NQHA 5KC6A 1QU0A 4YM2A 4BB3A 3GM8A 5EJ3A 3I59B 4AI2A 1J58A 5L7OA 2JE7A 4HVOA 1HXS2 2BGOA 1OLRA 3BTAA 4YVWC 3QOPA 4COUA 3VDAA 3MIDA 3AKTA 1SZBA 3RGBA 4GH4C 2DCZA 3AKSA 5FKCA 1U5IA 1IS4A 1S55A 1F5FA 2WFF1 3RZGA 4G4FA 3TBDA 2J22A 2EF6A 4WVVA 1LRHA 3NJZA 3TN91 4W50A 5M0TA 1B35C 1ENQA 1HB3A 1I5ZA 2BGPA 3LOIA 4FFHA 2LS6A 3MUY1 5JOXA 4MSVA 2PHFA 4PF1A 5FO7B 5BNOC 3FUOA 1VBB2 1OBNA 3VZNA 3MICA 2Q4SA 5A3TA 1YQCA 3K3NA 1OLMA 1AJOA 2WNVA 2XLAA 5FV3A 1W8TA 1REEA 2CAUA 3AP6A 3ZYHA 4AW7A 3M8LA 4ZHNA 4FFIA 1GWMA 4PCRA 4KWUA 2Y38A 2BZDA 4IEZA 2QQKA 2RS11 1YC61 2PAEA 3UGHA 2FMDA 4A42A 4KWJA 5FYUA 5JR2A 3RZZA 2N7GA 3USUB 5FZ1A 3WX5A 4JGZB 4XFCA 4EN9B 2ZGNA 5FZFA 3VBOC 3AZXA 3OUJA 2FDHA 2Y6GA 2YPJA 2VMFA 3VDDA 4BIFA 3E6CC 4NHMA 2EAAA 1WMEA 5CFDA 3PVEA 4PIXA 3ACGA 5FOJB 2YG0A 3KCYA 1DCSA 2W87A 3FJSA 4QB1A 3I3QA 2OPKA 4PLMA 5JMOA 3WF2A 1YEWA 3LCPA 4H14A 5LA1A 1RYYA 1JN2P 1UYZA 2OQ6A 3H8UA 3OGGA 3BU7A 3PIGA 3AL5A 4ONUA 3O5SA 4RA0A 4FOYA 4E9KA 2W1SA 2DFCA 3NSTA 5DUWA 3HN3A 4XETA 3NAPA 5A1LA 1R1A2 1IOAA 1IGOA 3HN1A 1IG3A 4LBQA 2WZEA 3J8F2 4DS0A 3USSA 3WF1A 4AWDA 1Q43A 2ZJCA 4K6BA 3IWZA 1J1TA 4QX8A 2MPFA 1ZZ9A 5F7UA 1ENXA 1RUC3 1H2KA 2AACA 4LORA 2XL7A 3AKRA 4NRQA 3VBSA 3AFKA 3M3OA 2PLV2 3A21A 1MEC3 3ZN5A 1FPN2 2VBPA 4YVSA 5C4WA 2X05A 3N36A 1Z7S3 4XXPA 4XHXA 1KFXL 4F83A 1W8ZA 4OMDA 4QQHA 1UZWA 5ANQA 4YFZA 4IQPA 3VBRA 4N90A 4D7YA 4WZFA 4AI8A 4Z82A 4DY5A 1O59A 1OF4A 2V5YA 1MS8A 3PURA 4IERA 1RUE1 4OHYA 2Y6FA 1IS3A 2JD4A 5BUVA 1XC6A 4CDQB 1M4WA 1BMV1 1LHVA 4RD7A 5GJ6A 2R072 2YHJA 4CU9A 4MV2A 2E9QA 1JOPA 2NYYA 4YW5A 4QMAA 5FPZA 1PVC2 4XAEA 1CD3G 4D94A 1LEDA 3BPSA 3FBYA 5FYMA 2VNRA 2E6VA 3I3DA 1LOAA 1JYWA 3GZUC 1E5HA 2BFUS 1BHGA 1XSRA 5FJHA 3R4DB 2VZPA 3LIGA 1D4VB 3PVBB 4HG6B 1RUG3 4RS5B 2ZABA 2ZCWA 3FLTA 5KC5A 2WKKA 5LRSA 1VJ2A 4ET7A 1W9YA 2P6CA 3B93A 3LEKA 4EN7B 5C3PA 2JICA 3VBUC 3U4SA 5CU1A 4BXFA 2DDUA 1PO12 2VULA 1GNZA 3M3QA 4NWVA 4XEZA 1JU3A 1HV1A 1W6PB 2TUNA 4DXZA 1SLCA 2HBTA 1PMJX 2WDBA 4QXCA 2VMIA 4LLOA 2Y26A 4QB2A 1AHSA 5D8AC 4E27A 3CIHA 4JX0A 1QIQA 4RR3A 1RIRA 2K46A 3LDBA 4MHUA 5HV4A 4XTMA 5J98B 3POYA 3J9SA 2RS52 4J6GA 2WNUB 3TEYA 1YQ6A 4FPKA 2DUPA 1NCRC 2AR6A 2FBEA 4GKYA 5T50A 2E31A 1NCQC 3BOWA 3SISA 1WLCA 5F3IA 1YFUA 1CX1A 3H1WA 3ZKYA 4FPCA 4AI1A 3RS6A 3JB4C 4V2VA 2W3JA 1DBNA 4QPGC 1IS6A 1IS5A 3GBGA 1FX5A 5FP7A 1U0AA 4B29A 3HT1A 1J3PA 2D6OX 3SCFA 2D44A 1ZREA 4P14A 3GF6A 3H1MA 2PHWA 3MW4A 4FP3A 4Q29A 2V72A 5CKNA 1AR73 4KH9A 4XCBA 3D4KA 1MQTA 1S2BA 4TLFA 1CAWA 3T2OA 4FTBA 2XJUA 3OUIA 4LO4B 5DUUA 4UFHA 3EB7A 1EAH2 2IWGB 4M3CF 3VBFB 3LFMA 4K40A 2EIEA 1SLLA 4M01A 3WW1A 3ZLIA 3ZX7A 2IVJA 2ATFA 3O1OA 1TMF3 3ACIA 2F4LA 1QJEA 2ZMKA 1LAJA 4IV3A 4LK7A 1JTZX 1DGWA 2HWE1 1V9U2 2AYHA 2XHKA 2XVLA 1FATA 3DKWA 4QB6A 3WDXA 4DNYA 3GJBA 1QY4A 1XU2A 1F8VA 2XBO1 3IT8A 1OD3A 5FP8A 1W2TA 2X5IB 3O0XA 2HWC2 3MF6A 1H0BA 1UNBA 3MIBA 4OHXA 4URTA 4UW4A 4NJ4A 3VKLA 1JYNA 3BKZA 1LHUA 3VUOA 4QXKA 5GLWA 2ZMLA 3HD8B 4NHXA 2QQIA 2R32A 5DAVA 3SQOA 1LKNA 5F8PA 2AC1A 1W2AX 1PK6A 3ECQA 1R083 3H0OA 4A45A 4ES9A 2KA3A 4LKDA 3ZFGC 1JZ4A 2W2IA 3NV4A 4I2OA 4LO5B 4Y1UA 4XF1A 1VP6A 1V6IA 2RS33 1QJFA 2JIGA 4XFHA 5JXJA 3IIAA 5IYYA 4LBOA 1KJLA 2JB4A 4IEYA 1DDLA 2J7MA 1X8MA 3AMMA 1GBGA 2WSUA 2BWAA 4Y1VA 3GJAA 1AR91 1G7YA 4BDVB 1TNFA 4XDQA 2W52A 1CQ9A 2HWD2 4CCJA 2ZGUA 5FPXA 4XJWA 1G9FA 4XF9A 3PLQA 1VBD3 3LPGA 4D8MA 2JG8B 5CG8A 4COYA 4QWNA 1PX3A 2A1XA 3VZMA 3T0DA 1VBA2 1Q56A 2WQ8A 5FZ8A 3ZXKA 5T5JA 2VR4A 4JCKA 5JAXA 4HFSA 4HMZA 1BKZA 4HOOA 3ZVXA 4UW3A 1PIV1 3KHCA 3D0JA 3WEZA 1ALYA 2CV6A 2AREA 1CJPA 4MUVA 1BK0A 1FMD2 1XNAA 2B4KA 5C71A 3WNOA 4CCOA 1GICA 3KHBA 4QKFA 1FXZA 4BZ4A 4C8DA 3FFQA 3AYCA 4PQ9A 5F2SA 3PMEA 1U5XA 3TNPB 3C3VA 2VUCA 5D21A 4GWJA 5ERLA 1EY2A 5HPOA 1PGW2 3MPBA 1XRUA 2VOVA 1VRH2 3WINE 2VZOA 2WO3A 1DGLA 1ZRRA 1ND3C 2ARAA 3FLPA 4Q8LA 4H55A 1RB8G 1K45A 1RUNA 2Y60A 2WAOA 4NPLA 2QZ3A 5GKAC 4JAAA 1NKGA 1C8NA 3VHOA 2WZPP 1G9BA 2QQOA 3AVRA 3N7KA 4IW3A 3NNJA 2WLQA 4N7IA 1JZ3A 4AHYA 1RUJ1 4JV4A 3HMYA 1IKPA 3WUDA 1A6CA 4AQSA 2P3JA 4RYDA 1TME3 2HWF1 1VBC1 2ZHKA 3DF0A 1RUF2 3POIA 4NAOA 3UJQA 2YFUA 3LKJA 2VBBA 3H42B 2DVDA 3ZDVA 1KRIA 4QM9A 1Z78A 1X50A 4NWWA 1GR3A 2RM23 2QQLA 4KG8A 4QD2A 3FN9A 2YC2A 1S0CA 3IDBB 3MIFA 1RUC1 3USUA 1S4CA 5CFCB 2X10A 1VMJA 3J8F3 2VZVA 1W3XA 4JGZA 3K3OA 5IK4A 2TEPA 1MEC1 1CX4A 3R6SA 3WQ0A 1RINA 1K5MB 1QNWA 4MGZE 1RVF1 2O8OA 5BNPB 2GC3A 4DXRA 1MVEA 4D6SA 1CWPA 4QM8A 4FXKB 4UXAA 3ILNA 2VZRA 4IV1C 2W5FA 3I2FA 1AL23 1YXWA 2VNOA 3GYDA 5EWSA 2RR13 1MS4A 3SH4A 3ZM8A 3FLRA 1JZ8A 4Q1PA 1CVNA 2LUWA 1DQ4A 3BU0A 4IEPA 4Y5Z0 1MS3A 5FYCA 4ASLA 4Y5TA 4D6RA 5JPNB 4CTEA 3ES4A 4IGQA 3AX4A 3QBQA 1WA6X 1A8DA 1AYM1 1MS1A 2DUOA 1IG0A 5EZWA 1VBE2 4UF0B 2B46X 2ADEA 4RQPB 5FBJA 1VR3A 2W0XA 3AC0A 5EYXA 4D7SA 1JZ6A 1KJRA 1ZRDA 4FXGB 1RMU1 5GZDA 3JU9A 3PNAA 4LKFA 4Q0SA 1C4RA 1N1SA 1GLHA 2G4IA 1ULOA 2Z2SB 3N3HA 2QFEA 5LATA 1MS0A 3BTZA 1W8HA 4YZ2A 2ZX4A 4Q27A 2OX0A 1O4ZA 1UKRA 3APBA 5A6XA 1YLLA 4W6WA 4AVBA 3UNPA 4JRLA 1E5RA 3JZVA 2GH2A 3U0ZA 1NZCA 1QKQA 3ZFEB 2EIGA 4NRMA 4XJUA 3ZYFA 4CDQA 1OMIA 3ZYBA 3BGAA 1H2NA 1O7FA 5EXOA 2WA4A 3RYRA 1UCXA 1KITA 2HYXA 1ULDA 1XE7A 4BCUA 3AZWA 1EUTA 1V6NA 1YYNA 2V4VA 1W04A 3AXDA 2GNTA 4S2HA 4QQOA 2D7FA 1ASJ3 4IUGA 1JW6A 2R1BA 4Q5OA 3HOBA 3AMHA 5F5QA 5LZ6A 4RS5A 2HLEA 4QHZA 2B9UA 5F5AA 3NVCA 4P5YA 4NUBA 3GBFA 3E6DA 3CBNA 3ZMNA 1LU2A 4B4QA 4MGIE 4Z2AA 2BU9A 2YU2A 4BQ2A 2RDRA 2JE8A 1OVPA 2MHFA 1W6PA 3CF6E 1RUD2 2GC1A 4XF0A 1ZZCA 4AF9A 4NOTA 5L9BA 1NLQA 3DYOA 3AK0A 3E5QA 3DXUA 5K8SA 1RL3A 2D6LX 3MW3A 1POV1 3I2JA 4LA3A 2NZ9A 3M7AA 4XAAA 3M3EA 4CP1A 2ZX3A 2WNUA 2WSVA 5GM0A 3DPRC 3RJ2X 3J4UH 1OSGA 1TMF1 4I0AA 1JOJA 4KBZA 1XQNA 5FZLA 4K3UA 3PUSA 3VBHB 4CDXC 2KM2A 4CSWA 3CMGA 3C7FA 3SKVA 3JBG3 5JDBA 1GU3A 2DF7A 1V9U3 4CDUB 1WMXA 2BOJA 3V0BB 2WZR1 2XLGA 2HWB2 1BZWA 3DV8A 4HSLA 1Y4WA 2R30A 2YFZA 5DUXA 5J1XA 3D0SA 3MFCA 4BQXA 2VZTA 2BOIA 3T0AA 1F4HA 5FK7A 1ZVFA 1SEFA 3RYKA 3UGFA 2CNAA 5JXGA 5FZHA 5DPNA 5FYZA 1R081 4IESA 4CDWC 1JHJA 2UURA 2V09A 4AI3A 3TN93 5A3PA 3WY6A 3VBFA 5FLJA 1XNBA 1HXS1 1PM4A 1W9WA 3Q8FA 5JVVA 4Z2WA 4TXWA 1OA2A 5FDBA 2C0ZA 1YHFA 4CPBD 4AHWA 5C3SA 3O1RA 3VHNA 3B9CA 3CNAA 1PM7A 1VRBA 3KV4A 3PU8A 4QPIC 4ISRA 4IL7A 1BQPA 2JDPA 3NV1A 4MVTA 1LHWA 1DG6A 1W8UA 1GSLA 1H6YA 2ZHMA 5LEKA 3EXUA 2P17A 2I45A 2HEYF 2Q1MA 4HK8A 4KQ7A 2XH6A 2FCVA 2BEOA 4AYUA 2FZ1A 1HQLA 1C5IA 1H2LA 1N1VA 2YBKA 4PBOA 5A7WB 3ORJA 3AZYA 3U07A 4CXYA 4AFMA 1VBB1 1QQP2 2BNOA 4JGYB 2EALA 3OBAA 1AX0A 3POWA 2YYOA 3RDIA 2OZJA 4DY3A 5J09A 1JYIA 3T3YA 5K0UA 5F9TA 3WDUA 5KHIA 1XE8A 1OD5A 1YQ8A 4YPJA 3VV1A 3SMHA 3B69A 5KXEA 5K9YA 1QJX3 4IE5A 3O0VA 4LKEA 2VTXA 1EV12 1PO22 2VQTA 3WG2A 3WSOA 1YCIA 3A0NA 3R4SA 5L7OC 4PDWB 4Y26A 5IAVA 2EVXA 2FMYA 1GP4A 1VRH3 2A3XA 4K20A 3E6BA 2JG8A 4QKDA 4P08A 3DYPA 3TAYA 5LA2A 2VD7A 5CYYA 1D4M2 4LBKA 1V6JA 1PGL1 2HH9A 3CEWA 1ZA7A 2TNFA 4L8QA 1UX6A 1Y3TA 1TME1 4FPFA 4E4ZA 3WP4A 1NA1B 3THCA 1GWLA 3MI8A 1S0DA 2P2KA 4XE9A 3B7MA 1GZWB 5DDJ2 1L7LA 4A6OA 4C0HA 3N7MA 1GMMA 4DEVA 2Z42A 5IVJA 4RSUA 3W21A 2BQPA 3BVCA 3M3CA 4A7ZA 4V2WA 1V6MA 1DU3D 3E5UA 1OOPB 1WBLA 1HKDA 1C8M3 4HZFA 4UFIA 1D7PM 2WNVC 1R1A1 2ZKLA 4QDQA 4N9HA 3J8F1 2BTVC 4NE9A 4AGVA 4GJYA 1O5LA 1RUE3 4EN8B 5LK5A 3U75A 2ARCA 2BGCA 2PLV1 1CIYA 1S2KA 4FPHA 1QF3A 4ZU4A 3TYJA 5ABJB 4I3PA 4IEUA 2QVSB 3T2PA 1GZCA 3J7HA 2ZGMA 1GZ9A 4NMIA 4LE3A 4CA9A 3RMXA 2GNMA 2WINB 4MYEA 4OULA 5FZAA 4KL1A 2A7AA 4Z8BA 5A1FA 1NZIA 3AYDA 3VDDC 2AEYA 5C3QA 2BBVA 1FT9A 1W6NB 2B9VA 2VNGA 2ZGSA 3LE0A 3M4FA 2RDSA 3HQXA 3OSDA 4PBPA 1JHNA 1POV0 4ZZ8A 1TZOA 5JLVA 2CGNA 1HB1A 2D6NA 2R071 3CHXA 4W65A 5HCFA 3DUIA 4GWMA 4XOGA 1ZZBA 3NV2A 2CY6A 4QAWA 2ZHLA 1UYYA 4AG4A 1ODNA 5BYNA 2PXJA 1O5UA 5CFCA 1X33A 3TRSB 1QJY2 2NPIA 5J37A 2VCCA 1W9TA 1BBT2 4RFT0 3ZKUA 2J1RA 3U78A 3OBTA 4LBMA 4O7XA 3H3ZA 3BUCA 2LW8A 1RUH2 4FFGA 3CQOA 3BTYA 5ISLA 3F2ZA 1CGPA 4BXSV 3NNMA 3VBSC 3HPNA 2ZAHA 1PO11 4JRAA 3UKTA 3BB6A 4YVSC 5C4WC 4XUNA 2BPA2 1AUYA 2DCYA 4F8AA 4M0HA 1UD1A 5C9AB 1LU1A 3OGVA 4IE7A 2ZGTA 3VBRC 1OC1A 2ZHNA 3WG1A 1RXFA 3DKQA 5BNOB 2E32A 2E63A 5DXDA 1NY72 1RC6A 1UXZA 2IXIA 1R092 5LBCA 3S0MA 5LWBA 4Z92B 1O8SA 2A6WA 4RQPA 5JXIA 4LQRA 4D6QA 1KGYA 5ACA3 2X8KA 1DYPA 3KM5A 4IETA 5LY2A 4YLZA 4FOQA 3KV6A 2VQUA 5LA0A 1MS5A 2D43A 4QKBA 3GALA 3PMSA 5DN2A 2ZXQA 1HW5A 2VMCA 3QD6A 2YY1A 5I93A 4LULA 4S2GA 2HWE3 3X29B 1WW7A 3ZPOA 1UMZA 1UXXX 3ZFEA 1CZSA 3OJBA 4KMQA 3MF9A 4NHYA 3PJQA 1ZZ8A 1HX6A 2TBVA 3SITA 5HV0A 1UY2A 1N3OA 2WT0A 3ZR5A 1S0IA 2IXLA 1OPMA 4RR3C 4BLJA 2W91A 2WO1A 3ACHA 1LULA 2VVFA 2QCSB 2D5HA 2VW1A 3WV6A 5AVAA 4NPRA 3ST7A 1F2NA 4LEJA 3JXSA 1A3KA 1N3QA 3LD8A 4LPLA 3MHZA 4FAGA 1IZ3A 2VG9A 3K2OA 1V9U1 4IXLA 5HCBA 4LIUA 3SH5A 4GA9A 4OI0A 3SKJE 1E5IA 4IGPA 2CL2A 4XACA 1JYCA 2JB8A 2JG9B 4WVMB 3RWKX 5B4XA 5LB6A 5FY1A 4X6RB 4OQ8A 4YGDA 1GOFA 2Q0AA 2HWC1 4AFBA 3I2IA 4GZ9A 4KNCA 4SLIA 2VM9A 3FE5A 5IVEA 1QOOA 4Y22A 1YWKA 4QX3A 1JXNA 3U4XA 5JR7B 1JYTA 5KR7A 2OPWA 2ORXA 1AR93 2DUQA 3FZ3A 3H3LA 2Z79A 5E89A 4S2FA 2JDYA 1QJU2 2BYVE 2H0VA 2D3RA 1UN1A 2JDHA 3AL6A 1WD3A 3ES1A 1IQDC 3JD72 3K4AA 2QZ2A 3M1HA 3P3PA 1YI7A 4INDA 4JDOA 1MQTC 2WL1A 5JXHA 3VBHA 5I91A 5FXVA 3K51A 1TNRA 1S0FA 5FMCA 3H8OA 4BK5A 3LDRA 5JOYA 1PIV3 2VU9A 4PQQA 3W5NA 3BTXA 3MUZ1 2ZGOA 1J59A 4JKKA 2CSGA 3SHRA 5BY5A 1GWKA 2HWD1 2WC2A 4CDUA 4Q4V3 3V0BA 4BE3A 4IV3C 4WM8B 2PQSA 4FOVA 4AFAA 1KXGA 3JB8A 1ND2B 5I0RA 2F4PA 3ZYJB 2XWJB 1LB2A 4AE2A 1WCDJ 3WNPA 1VBA1 5JIAA 3V65A 2XJPA 2Y0IA 2IC1A 2UYAA 2XB6C 3RZJA 3JQXA 4RHV2 2VQ0A 2B7YA 4LR4A 2RDNA 5CBLA 4A3ZA 2CWMA 2DU0A 1SQ4A 2OT7A 2ZKNA 4Q4Y2 4QQLA 4TYSA 4R8HA 3OYWB 3ZXLA 4N43B 3J7NA 4SBVA 1WW6A 2EAKA 3HQRA 1NLSA 4E2QA 2YC4A 1FMD1 1UPSA 3FX3A 4CCEA 2QBXA 2VVEA 4N53B 5D8AB 3O1UA 5IW0A 4XIKA 1QJX1 2C1FA 3FFZA 5IVYA 1DZQA 1PK6C 1QXPA 1RUJ3 3T0BA 3VD4A 4AI9A 2VNVA 1XXNA 2YUEA 2HWF3 2ENRA 1NAEA 1VBC3 1QH6A 1PGW1 1YJKA 2QQWA 2WAAA 3LQCA 4HPKB 4LUKA 4B7KA 4ZZ5A 1VRH1 5IFPA 5TSWA 2MEV2 1NCRB 4FPGA 1QH7A 3ABZA 3UKNA 4FCAA 2EXKA 1W3VA 1SHWB 4QPYA 5GLTA 4CEWB 1UF2C 3ITQA 1X82A 3IIIA 4WZCA 2ZA9A 1J3QA 5A7WA 1VLNA 2PHDA 1OFSA 1IKQA 1KEXA 3SNMA 4LNVA 2QKDA 2VCMA 1UY4A 3DCQA 3MFAA 2BNNA 4UBGA 2VVDA 2AEZA 3WQBA 5IK7A 1RVF3 2VW2A 3PDQA 2GDFA 1C8M1 1WLTA 3FUQA 5F5IA 5HXMA 3BI3A 4JKMA 1JS9A 4I02A 5A3UA 1NE4A 3N9QA 1HQWA 1DZRA 4K7JA 3E97A 5LW9A 2A6VA 4HONA 4YSFA 4M3CE 3S7EA 5HCAA 5C5UA 4LBQD 3O1PA
chains in the Genus database with same CATH topology
3OBRA 2XKPA 3H50A 5KXDA 1LGBA 1YJLA 2CGOA 2RE9A 3H3UA 4OVEA 1RHI3 3OY8B 2PTMA 1VAVA 2PHUA 3UK9A 5BNNA 1DQ5A 1AYM3 3VZJA 3WCRA 4KGQA 2B5HA 5JOZA 4CEYB 2JE9A 3WW4A 4JDMA 5FMOS 1YFYA 1GZWA 3U11A 1RMU3 1YRZA 3ZFFB 2EXHA 5KXBA 4DOUA 3CJXA 4AEDB 2P3KA 4FTSA 1Q5OA 3PHMA 1VBE1 4C1XA 4LBLA 3WD5A 5CB7A 2D97A 4B7EA 1SBDA 1XYPA 1BBT3 2WS92 3WG4A 1WBFA 4JGZC 5ABJA 1FOD2 1BCXA 3VN4A 3OPZA 2VOWA 2ZACA 4EV0A 4YZ5A 1HRV2 1WCSA 3VL8A 5FQ0B 2B42B 2H6BA 1W6NA 4FT8A 1LOFA 4HKOA 2JENA 2X53S 1LOEA 4X8NA 5C33A 4EJRA 5A3MA 1DGRN 5KHKA 3R0RA 3ZMOA 1WUVA 3CLPA 4B4RA 2V73A 2XJQA 2YZ4A 5ACA1 4NR1A 5KHJA 1LOGA 1X7NA 1OPOA 5J36A 1POV3 4AFDA 2ARBA 4XFAA 4XZPA 3ZSKA 4RGGA 1LENA 4Y1XA 1ND3B 1ULCA 3KGZA 4JQRA 3ZXJA 4E27A 2R042 1WLWA 1KDMA 4PF5A 1RUD1 4WM7A 5C9AA 1V70A 1HRI2 3HBZA 5DZGA 3WZ1A 5DG2A 4GB32 3V0AB 1J1LA 4Q4X3 2WZR3 4H7MA 2D5FA 1W6QB 1IQAA 4WVZA 4MXWB 1ULEA 2K2SA 3B94A 4GIQA 4CDQC 1GV9A 2H0BA 1LJ7A 1RUI3 4Q1RA 4MH0E 1W6OB 2CGPA 3JQWA 2B45X 1FV3A 2R6QA 5IK8A 4JC1A 1H2MA 3NL1A 5JI9A 4Y24A 4TWTA 4XBLA 3LGRA 4XQ4A 1F31A 1KD7A 4RS5C 1HXS3 3UV9A 4Q4W2 4B4PA 3KS7A 1EPZA 3RJRA 1V6KA 3OF1A 3PJYA 3VGIA 4C1WA 3LSEA 3NWKA 4Z1VA 2OA2A 4GKXA 1GKBA 3I8TA 3LZZA 4QGNA 1I3HA 5FTTC 3ZN6B 4COVA 1C5HA 2SBAA 2K9ZA 1MR5A 1MS9A 1QDOA 2GALA 5I0UA 4MZUA 1OQ1A 2WNUC 1VBB3 3KD4A 1AYN2 4FPJA 4Y1YA 4Q4V1 1URXA 3I59A 4WVMA 1AR62 2JG9A 2RS12 3UL2A 3MGUA 4BH9A 2RMU2 2DVFA 3IKWA 3W9AA 4OI1A 1UU4A 2DVBA 5GZCA 3WVJA 3ZSMA 3N7LA 3SCGA 1O91A 2PHRA 5JIUA 3N7JA 4LO6B 3WHUA 1QQP1 5GALA 1BEV2 3MIHA 5FAXA 4ES8A 1S0BA 4Q4Y3 4UW6A 5D1IA 4AEKA 2NMOA 4OHZA 1A78A 2DWRA 4QU2A 3S6PA 3VBFC 1EV11 1OLQA 5IUQA 1SLAA 4HVQA 3KT1A 3AM2A 1QNYA 4MXVA 3TB0A 3ROUA 2JECA 4WM8A 4XF3A 3RG0A 4G9SB 1ND2A 4XJAA 1G9CA 4I0WB 2VPVA 1R1A3 3FMGA 4K21A 3CJIB 3P3NA 3RMYA 2X5IC 2A5ZA 3WW3A 1YIPA 1W0PA 4LO7A 1ZBA2 3OYWA 5DDJ1 4N43A 1Y43B 1CN1A 2PLV3 1FPN3 4F7ZA 1QXJA 5SV5A 1NLRA 1LODA 4AGRA 4N53A 3LSDA 5JSRA 1O3RA 2GMMA 1AR82 4OFGA 4XMAA 2MNGA 3ZYGA 5K0UC 1NOVA 1KS4A 2YDEA 1AXZA 5AC92 4HPKA 4QGLA 4LT5A 1RHI1 4GULA 4AEMA 4XW3A 4RGAA 2R073 2GNDA 3T1MA 1W6MB 1PVC3 4CEWA 1DQ0A 5HI0A 4AVVA 1ZZ6A 2E7TA 2OUHA 2D6PA 2ARXA 1FI2A 2JG8C 3ZXFA 3IDCB 4F3JA 5DZFA 5C8CB 3K48A 5AFEA 1AZDA 3OGJA 3B3QE 3AFGA 3IM0A 2QDNA 3UKVA 2AH2A 2DV9A 5CNAA 2P34A 2ZS6B 4AQ6A 2QUOA 1PO13 4O9EA 4DPNA 1AX1A 3DN7A 4I0BA 4Q0PA 1QJZA 1WA4A 1QJY1 3IPVB 1ONAA 1BBT1 4D3WA 5E16A 1LGCA 3OY8A 1GQGA 1LTEA 2RS53 1RUH1 1DQ6A 5I0TA 2XGXA 1UPIA 3WP5A 4AHXA 1OFNA 2ZBJA 3RRDA 4CEYA 5HXVA 3BIWE 1O4YA 3WCSA 1WD4A 3RYPA 4AI0A 1WMFA 5IK5A 4XBNA 5BXXA 3NO8A 1XNCA 3ZFFA 1R091 5GLVA 2VOXA 2B8MA 3QH6A 4AEDA 3O14A 5T5OA 1N1YA 2Q5TA 5DG1A 1DYKA 4DZGA 2R062 3ASIA 5KWRA 2XUMA 4PJYA 5CFCC 1QDCA 3ZIWA 1EAH3 4W6XA 4YW1A 5L7OB 3VZLA 3WXPA 3WDVA 4Q0VA 5GZFA 5CG9A 1QXRA 4Z07A 1AVBA 2I74A 1AF9A 4M0NA 5FQ0A 2JXAA 1GANA 5H9PA 4Q4X1 3MYXA 2XBO2 4LE4A 4KGGA 4IEWA 4LUMA 4DRRA 1YIFA 2FQPA 2HWC3 3MLLA 4EWDA 1RUI1 1DQ2A 5F6KA 2BFUL 4HVRA 1F9KA 1EYBA 1S1AA 2OIIA 4GALA 1SLIA 2WNVB 3U10A 3MLKA 5FMOL 4RQPC 2ZMNA 1EP0A 1COV2 1AL0G 3NKTA 3PVOA 4QX5A 4NO4A 4R4ZA 4HLTA 3EO6A 5JZGB 4R52A 4QGMA 4DMIA 4LBJA 4ZKTB 1QJU1 2HWD3 2X5IA 3D5OA 4HETA 2HEVF 2LTNA 1W6QA 5I8TA 3HR9A 4YW2A 5CFDB 3ZFEC 4MXWA 4XJZA 1VBA3 1IPKA 3EHKA 4GMP1 1N3PA 1W6OA 2P3IA 1O4TA 1H4GA 3OTFA 1APNA 4FVVA 1REFA 4GWNA 5C6CA 3RI8A 3GHNA 1SMVA 1FMD3 1YFXA 5SV8A 3ZO0B 3PVNA 4Y20B 3AP5A 3NAPB 1DGRA 4LBQB 4YGBA 2ZAAA 1H8TB 4B8EA 4RHV1 5BNQA 4Q4Y1 1PVXA 2G9GA 5EYYA 3SLIA 1QOTA 2HJIA 2NM1A 2Z5WA 2CWSA 4LO8A 2YMZA 3WT3A 1ZX5A 1UU6A 1WW5A 2CAVA 2IXJA 3MIGA 3BODA 4KU8A 4P9LA 2A3WA 2DTWA 2GMPA 1H1MA 4Q0UA 4QT6A 1Q8QA 1RGSA 4FQ4A 2GNBA 1RUF3 1H30A 2DVGA 3EQEA 4WV8A 5GZEA 4YARA 3VBHC 1IHMA 1OQEA 2MEV1 1SACA 5L36A 2YGMA 3ZXAC 5FLHA 3RWNA 3WOGA 4KG0A 3UJOA 4CDUC 1RUC2 4FBFA 1SBFA 4NN0A 5T5LA 3AP9A 1MEC2 5B2GB 5JSOA 2ERFA 4FAHA 1FV2A 1Z7S2 4A3XA 1FPN1 4HT1T 1ZA4A 5FLIA 4EN6B 4V1PA 1PZ9A 3WLUA 1AXKA 3MLJA 2UWCA 2WJSA 4DINB 2HKXA 4META 1MVQA 3CO2A 5T55A 3TOJA 3WHTA 3S30A 1W0OA 2NQYA 2BUKA 3WR0A 1LEMA 1LGNA 1ENRA 2ZPXA 5JMCA 2AGSA 1PVC1 1E57A 1O3QA 3CJIA 1I1EA 1RUG2 1IPJA 1VBE3 2ZZJA 3G6JB 1SDWA 4YVWB 1K5MA 3ETQA 4CYDA 4BMEA 4XBQA 4GH4B 3WNXA 2Y0OA 1HQNA 5BNPA 1QGLA 4YGCA 1CESA 1NYWA 1ZRCA 3ACLA 3AYAA 2D40A 1AXYA 1I6XA 1B35B 2ZGRA 3JCIA 1PZ7A 1D2SA 1ZM1A 2WQZC 1VIWB 3KSCA 2JJ6A 2RS51 4OI4A 3ZSLA 2WS91 3KGLA 1W6MA 3LAGA 3URFA 1I9RA 4L99A 2VGDA 3VL9A 1FOD1 1PMIA 4Y1ZA 3VZKA 2IFWA 3W58A 1C1LA 4IV3B 4LHNA 1HRV1 4TZDA 2VW0A 5BNNC 5C8CA 1DIWA 1Q8OA 1WMDA 2EA7A 2UU8A 1NA1C 4CP0A 2ILMA 3QLQA 1ENSA 4E4DX 4JVAA 4K8FA 3VBOB 4QQPA 1TE1B 1A8MA 2DCJA 4I01A 2OVUA 1AR72 4EWEA 2ZOEB 4GMP0 3INAA 1RUD3 2QQPA 2NN8A 3IPVA 4DB5A 4NHKA 1SBEA 1T6GC 1EAH1 1ZBE2 3VKFC 5E8AA 1SLTA 4EROA 1TMF2 5FBZA 1CAUB 4HBNA 2R041 2A6ZA 5FO9B 5ABJC 2GMEA 4CP2A 1HRI1 1CR7A 1VB4A 1JBCA 1WCKA 2O1QA 3MW2A 2HWB3 4JDNA 1KQRA 1LOFC 1BJQA 4L92A 3HWJA 3ZPYA 5FCCA 5H9SA 3ATGA 1REDA 5LRRA 4K9SA 4AFCA 4JTNA 2PHXA 4AQ2A 2AENA 4L97A 3T1LA 2D98A 2RS32 4LLFA 3FC0A 2Z69A 4XFIA 3M3IA 4YM3A 1COV3 1YI9A 4L11A 4Q4W1 3IBMA 4AGGA 3ZDSA 4KU7A 3POSA 1UZZA 2BW8A 1H4HA 4FPLA 4YZ4A 1VBD2 1UIJA 3LB9A 1QWRA 1YO8A 3FWEA 4WM7C 5AVPA 5C9AC 2O8QA 4YZ1A 1MZFA 2C5DA 3AZVA 1OA3A 3FBMA 4LBNA 3VBUB 4XFGA 2AZ5A 4AK3A 2D6MA 1RJ8A 1QQP3 1C57A 2WT1A 2HYKA 1AYN1 2CTVA 3H7YA 4PIZA 4R9AA 1G9AA 1AR61 1BVP1 1DFQA 1NQDA 3MIEA 2IXCA 2A75A 3GZTB 2D93A 4FPEA 1C3HA 3LA3A 5JPMB 4LHLA 5E88A 2RMU1 4LTAA 5JZGA 3L9JT 1DZTA 1EV13 1PO23 3I7DA 2JX9A 1OHFA 3VHRA 1NCQB 1LOCA 5A33B 2ZGQA 1Q3EA 1BEV1 3L2HA 4QPGB 1PGL2 4BYYA 4YM1A 1D4M3 1X36A 4YNIA 5GZGA 1TME2 4I09A 2ET1A 4JGYA 4ZU7A 1WGPA 1RUF1 4D7TA 1CAVB 2OZ6A 1NG0A 5J96B 5DDJ3 4BIOA 4XFFA 2RM22 3M70A 1D0HA 2JKBA 4Y20A 4P9WA 4RL7A 1RUOA 1L3JA 4BM8A 2XG3A 3I4IA 1BXHA 4G3YC 1OQDA 2R0HA 3ELNA 4J1XA 1V00A 2JG9C 2W39A 4PDWA 1H8TA 3I2DA 3M2MA 3ZIXA 4BPZA 2ZX0A 3ZN4A 4D69A 5CVRA 3WDWA 5CAZA 1ZBA1 1BYHA 3VLBB 5K7PA 3CU7A 3B9IA 1ULFA 2ET7A 1NXMA 1DQ1A 1AL22 2GU9A 4XQDA 1AR81 1NA1A 2RR12 4OHVA 1DF0A 4QHBA 3GNEA 1LECA 3R4UA 1MZ5A 1QMJA 3IDEA 5AC91 4FTEA 4XXAA 5CIRA 1OOPA 3S7IA 4R9CA 2XKOA 2R16A 1CPNA 1G6NA 4UBHA 3ZFGB 4WM8C 4BQ1A 3ZYRA 3WP6A 1ND2C 1QJY3 1C28A 2VQAA 1XYNA 4S2DA 3OD0A 4TSVA 3DL3A 1PZ8A 1RUH3 4BA6A 4XFBA 4BLIA 1XNKA 4N43C 3BOPA 5I0SA 2IXKA 1CPMA 2ES3A 4MLOA 4N53C 3ZYIB 1Q8PA 4E4SA 3HT2A 5FRAA 1LCLA 3SCHA 2ZTNA 4FPYA 4C90A 1R093 1ASJ2 2A71A 5A32B 4YVWA 1XYOA 2RJLA 1F5JA 1JUIA 4YRDA 5DZEA 4E2SA 4CEWC 2XWBB 4GH4A 3QACA 4COZA 4EWAA 3ME2A 2NP0A 1H1AA 4YM0A 4Q8KA 4W6YA 4XPVA 4XQWA 5AFBA 1RTVA 1LESA 1B35A 2F6BA 3PTYA 4M00A 4XJ9A 2VUJA 4I30A 4K1YA 5F1RA 2A6XA 5BNOA 1H9WA 2R061 1FYUA 4A2UA 3MZHA 3N4MA 5JI7A 2VMHA 1ZRFA 3ILFA 3AMQA 4MGKE 1NXD1 2XLFA 1ZBE3 4FP2A 4L2NA 2A6YA 4XHBA 4PLNA 4ATFA 3JBG2 3FHIB 4KWLA 1PGSA 2HWB1 1CAXB 4IEOA 4OLLA 2A73B 3WQ1A 3QH7A 3VBOA 4UW5A 4CEYC 2E7QA 2LM3A 1X8EA 2IZWA 4NHLA 3WG3A 4OI2A 1U5YA 2WFF2 1SLBA 3ZFFC 4R4XA 2XVGA 4AEDC 3TN92 3OCPA 4IV1B 1QJU3 3AKPA 4BOWA 2D3PA 4OUMA 1N47A 5K0UB 5FOBB 3JD73 1NE6A 1COV1 2PHTA 2WA3A 1CAUA 1YNAA 1TEIA 5L73A 2BWCA 4GMP3 1LHOA 3H1YA 4BMBA 2GSYA 3A4UA 4P5HA 2G9FA 5FO8B 2FZ2A 1J3RA 4YW3A 4IEVA 3R05A 2DTYA 4ZU5A 3D82A 1LHNA 2ZGLA 4FPOB 1JUHA 4RHV3 5IT6A 3KT7A 3GHMA 3H9AA 2IXHA 2AUYA 2VY0A 3BALA 4OUSA 4J1WA 1QJX2 4P9GA 4HANA 2XJSA 2PQQA 1PO21 1FAYA 2PYTA 2ETEA 1ULGA 4GXLA 3WDTA 5GLZA 5FREA 2BVVA 4C0BA 3IN9A 5C8WA 2MEV3 1CIWA 3ZXGA 4AVAA 1PNGA 2E7AA 1NQJA 5H9QA 1D4M1 1UKGA 2YXSA 2VH9A 2R0FA 1ZYBA 4X8PA 1RJ7A 4FOWA 4PIYA 5BPXA 3WUCA 1Z0HA 3VBUA 2ZZQA 3T2TA 3WP3A 2DVAA 2KXLA 4C91A 1H8VA 2Q30A 3HAGA 5D8AA 1C8M2 1BK1A 2NLRA 2DU1A 3O12A 4BWOA 3G7DA 1RUE2 5JSPA 1Q8VA 2E51A 3DPRB 1LR5A 5E1RA 1BMV2 1NCRA 4HSJA 2UWBA 1NCQA 4CDXB 1HV0A 1Z7S1