3IM0A

Crystal structure of chlorella virus val-1 soaked in 200mm d-glucuronic acid, 10% peg-3350, and 200mm glycine-naoh (ph 10.0)
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
243
structure length
243
Chain Sequence
NVISTLDLNLLTKGGGSWNVDGVNMKKSAVTTFDGKRVVKAVYDKNSGTSANPGVGGFSFSAVPDGLNKNAITFAWEVFYPKGFDFARGGKHGGTFIGHGAASGYQHSKTGASNRIMWQEKGGVIDYIYPPSDLKQKIPGLDPEGHGIGFFQDDFKNALKYDVWNRIEIGTKMNTFKNGIPQLDGESYVIVNGKKEVLKRINWSRSPDLLISRFDWNTFFGGPLPSPKNQVAYFTNFQMKKYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VAL-1
publication title Crystal structure of family 14 polysaccharide lyase with pH-dependent modes of action
pubmed doi rcsb
source organism Chlorella virus
molecule tags Lyase
total genus 59
structure length 243
sequence length 243
ec nomenclature ec 4.2.2.3: Mannuronate-specific alginate lyase.
pdb deposition date 2009-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3im0A00
4AVVA 5HCAA 2GN3A 4LBNA 4FP3A 2CTVA 1BQPA 2R49A 4BM8A 4YZ4A 1MS3A 1LECA 4YW1A 1VAMA 2CWMA 1LCLA 3AZXA 3U4XA 3POYA 1SLBA 3WZ1A 1HQWA 3A0KA 4XJUA 2JDZA 4Q27A 5GALA 4BLJA 1W0PA 1IS4A 1WD4A 2B7YA 3N7MA 4JRAA 2PHUA 4WV8A 4YW5A 3AZZA 1WLCA 5FREA 5GZGA 2LTNA 3O12A 1S0FA 2DV9A 2DUOA 1H30A 1GICA 1C4RA 3BIWE 2RHPA 2AH2A 2AUYA 3UL2A 2ZMLA 5GJ6A 2A7AA 3V65A 3ZSLA 1RITA 1Q8SA 2ZGTA 1DQ0A 4RL7A 1DZQA 1W6OA 1CVNA 1VAVA 1LEDA 2JE7A 1OQ1A 3N35A 2DYCA 4XE9A 3WUDA 1UAIA 1H9PA 4XHXA 2NP0A 4Y1VA 2FHRA 2YZ4A 4DRRA 2DTWA 3LSDA 3W59A 4XIOA 2P37A 1V6IA 1SBEA 2E53A 2ERFA 1N1VA 2GN7A 2P2KA 3N3HA 1OKQA 5KXEA 3ATGA 1R1ZA 1VLNA 1OFSA 1CPMA 1S0EA 3AP9A 1AJOA 4MYEA 3OBTA 1CN1A 1JW6A 2E51A 3HR9A 3B3QE 3ILFA 1O4ZA 4TZDA 4NO4A 2AENA 1HDKA 5GZCA 2VW2A 5DUVA 1LOEA 3LCPA 5H9RA 4Y24A 1G9FA 4FPLA 4LBQA 2UURA 1DQ1A 1IS5A 1AX2A 4FVVA 1A8DA 1CPNA 1ULEA 1GZWB 4YZ3A 1YXWA 2A6VA 3WOGA 4TYSA 1G9DA 5DZGA 3WDUA 5JOZA 2EIGA 1LOFC 1VIWB 3AP4A 5BYNA 2AREA 1UL9A 5T54A 3ZXEA 5DXDA 4Y1UA 3ZVXA 3RRDA 5DUWA 1BXHA 3D4KA 1RINA 3WDXA 2ZAAA 3WUCA 3TAYA 2D6OX 1V6MA 5CB7A 2W68A 1SCRA 2ARXA 1SACA 1S0CA 2GNDA 5T55A 4BLIA 1NLSA 3NV3A 1MS5A 3PMEA 2P3JA 3RQ0A 2DVDA 1PZ8A 4C1WA 4FOWA 2A70A 4L8QA 2GMMA 1ENRA 1ZA4A 1LHOA 3AYEA 3GALA 2DVGA 1KJLA 1LOAA 4YZ2A 1ENSA 4XBQA 1S1AA 2PELA 3QLQA 3V0AB 1JYIA 2JJ6A 3ZYPA 1GBGA 3I4IA 4K1ZA 2V73A 4WZFA 2YV8A 2WJSA 4XJAA 5CNAA 1JOJA 3R05A 4XBNA 1CESA 1UZZA 1Q8QA 2ZZJA 5JLVA 1ZM1A 3NV4A 5DG1A 2PHRA 1BZWA 1TEIA 3WG1A 1QU0A 3O5SA 2ZHLA 2NM1A 4Q8KA 2JECA 5LK5A 3SITA 5GLZA 2VXRA 3ZXKA 2VUAA 1V6LA 1SBFA 2OW4A 4M3CA 5DZEA 5E89A 3RG0A 1QMJA 1HQLA 4RA0A 3IN9A 1SLCA 4LBJA 1F31A 5HCBA 2NMOA 2W39A 2EAKA 3AJYA 1UX6A 3WDYA 4YM3A 1D2SA 1ONAA 1MVEA 4UW5A 3WDTA 1IS6A 3WHUA 1LGCA 4P9WA 2Q5TA 2E6VA 4FPCA 3UK9A 2GMPA 3M1HA 2A6ZA 2ZHNA 4ISRA 4K1YA 2CL2A 3WG3A 3FFZA 4FOVA 1LTEA 2YXSA 2EXKA 3IKWA 3N7LA 3O0VA 3KQRA 3WVJA 3IPVA 5SV8A 4YW3A 3M3QA 4GKXA 1LHWA 5JDBA 4P9YA 3VKOA 2R0HA 4XHBA 4XDQA 3FLRA 2C9AA 2V5YA 3M3CA 4AYUA 1FV2A 3M3EA 4ZXKA 5HCFA 1LENA 1LOFA 1N1TA 1KDKA 1O4YA 4Q1RA 3V0BB 3T1MA 3WV6A 4JCKA 1Q56A 2NYYA 4I30A 1X50A 1WLDA 1U0AA 1WW6A 3Q9OA 4AGGA 1LJ7A 2A5ZA 4Q8LA 2R0FA 1W6PB 4FPOB 1V6KA 2VY0A 4R9BA 3PVEA 2ZHKA 4Z8BA 1QF3A 1SBDA 1ULGA 3DUIA 2WLQA 3JU9A 5H9SA 1WUVA 3DGTA 3VKLA 4DFSA 4AVSA 2D6NA 4XYXA 3NV2A 4AWDA 3AFKA 1UMZA 3AX4A 1GV9A 1SLAA 4M3CF 4YFWA 4ASMB 1MVQA 5EWSA 1FNYA 2KM2A 1FNZA 3MPPG 4DQAA 2P3KA 2Z42A 3AP7A 1N1SA 3N36A 3SLIA 1LODA 2WNEA 1MS8A 1F9KA 1AX1A 2SBAA 3ZSKA 4ATEA 5E88A 4GXLA 3RMYA 1S0IA 2OUHA 2D3PA 4FQ4A 4ATFA 4Y26A 3SH3A 4UW3A 4BOWA 4NOTA 4XJZA 3OPZA 3IMNA 3FLPA 1DBNA 2A3XA 1MS0A 4FPKA 4M00A 1MS1A 2EXHA 2DVAA 1DQ2A 5IK4A 2UWAA 1AXZA 1AJKA 4FPEA 5DUXA 3FBYA 5CAZA 1BJQA 3B69A 4YZ1A 2CWSA 4W65A 1JHNA 4FQZA 1LHNA 1S0BA 5CBLA 5FRAA 5T5JA 3KM5A 3PJQA 1WBFA 2A71A 1W6MB 4FP2A 4JC1A 4YG6A 1WCSA 4M3CE 4BMBA 2DVBA 3LSEA 4CTEA 4YW4A 1DHKB 2ZGMA 4FOQA 2ZBJA 1QNWA 1WD3A 2ZGNA 5IT6A 2WT1A 1KQRA 1N3PA 5AVAA 1UPSA 2D7FA 1HKDA 1QOOA 2DURA 1V6JA 2XG3A 1GZWA 4Y1ZA 2DUPA 3WNXA 2G4IA 3B9CA 3VKNA 2D44A 3L2YA 3NWKA 3UJOA 1IS3A 2EF6A 4U2AA 4D69A 3WDVA 4YG3A 2LALA 3B01A 2JE9A 2W08A 2FMDA 2WT2A 2ZGSA 3GNEA 1LOGA 3SH4A 1JYCA 2WT0A 1DFQA 5T50A 1ULFA 3OY8B 4R9AA 1JN2P 4Q26A 3T1LA 4Y1YA 5IK8A 3OY8A 3VV1A 4OZXA 4XBLA 3OGGA 1GZCA 2AYHA 1APNA 4Q1PA 3ZPYA 1AXYA 4DS0A 3AP6A 3I8TA 3VUOA 1JBCA 2XB6C 4LBLA 1CONA 4FPHA 3V0AA 2GALA 1N1YA 4FPYA 3AYCA 4M01A 4Y20B 4YG0A 5T5LA 4YM1A 1W0OA 1MACA 3AP5A 4YGCA 1JUIA 5H9PA 3ZYRA 4FPGA 1GNHA 3M3OA 3AXEA 1WW5A 4CRQA 3INAA 4F83A 3M2MA 3B00A 4GWNA 2YROA 3CNAA 2ZHMA 4KBBA 1B09A 1I3HA 1YIFA 3WCRA 1N3OA 2YMZA 2ZGLA 4XMIA 2UU8A 2CYFA 2OUJA 1MS9A 1GNZA 3ENRA 1Q8OA 1W6QB 2EXJA 3OYWB 4K21A 1QNYA 1UKGA 1QOTA 1WW4A 4UW6A 2D6LX 1S0DA 2ARBA 1A3KA 1CJPA 1SFYA 5KXBA 4YLZA 3VKFC 3D5OA 3HN1A 1LU2A 3ZSMA 2D3RA 3AK0A 4U36A 2ZGPA 2ZMNA 1SLLA 1GANA 1GKBA 1MZ6A 1UN1A 4UW4A 4Y22B 1ENQA 1QKQA 4FOYA 3FUQA 1V00A 1LESA 2E7TA 2R1BA 5JMCA 1HLCA 2PHXA 1CQ9A 1Z0HA 2R16A 4HL0A 5JOWA 5CA6A 3USUB 4AGRA 4XJ9A 2ZA9A 3NV1A 2VW1A 1D0HA 5JOXA 5GLTA 2NN8A 2PHFA 4YW2A 2H0BA 5E8AA 2WSUA 3FLTA 3SNMA 1DLLA 1QDCA 2HYKA 2PHTA 3ASIA 3WHTA 3V0BA 3A0NA 5L73A 3O0XA 3H0OA 1I1EA 4XMAA 3JUUA 1W6PA 1DGLA 2UWBA 1ULCA 4XXAA 3O0WA 4XOGA 2AR6A 1J1TA 3FUOA 3W58A 4CZSA 1FV3A 2P34A 3MW3A 4R9CA 4AGVA 4ISQA 4XTMA 1SLTA 1Z78A 2GNBA 4GKYA 3WDWA 2A6WA 1NXD1 1QGLA 2YY1A 2ZGQA 1LGNA 4P9XA 5F5QA 1LOCA 2PHWA 4PBOA 3RSJA 1KDMA 3C2UA 5GLWA 2EALA 2P3IA 4BMEA 2CY6A 4DRVA 5GM0A 2JD4A 4BQ1A 1N47A 1QDOA 2DU0A 4PBPA 2ES3A 1GYKA 2DWRA 4YGBA 1SLIA 4PF5A 1CR7A 3APBA 3ZXJA 1W6OB 2NMNA 4XTPA 3AZWA 4FPJA 1DQ4A 5GZEA 1URXA 3HMYA 4C1XA 3A4UA 2GDFA 1DQ5A 4LBMA 2AGSA 4XJ8A 2A3YA 3PVOA 3VKMA 1IKQA 2ZACA 2D3SA 1DIWA 1MS4A 1YRZA 2ZABA 4SLIA 1W6MA 1C57A 3OJBA 4PQ9A 4Y1XA 1GZ9A 1F5FA 1H9WA 2SLIA 1IOAA 3IM0A 2DVFA 5EYXA 4YZ5A 1LEMA 4XJWA 4GWMA 4AVTA 1KITA 1AZDA 1YI7A 1S0GA 4XIKA 1IKPA 5IK5A 4YGEA 1Q8PA 1V6NA 1FAYA 1BKZA 2W52A 3V64A 2GMEA 5GZDA 4FPFA 4LBQB 5JOYA 2WQZC 2R1DA 2JKBA 4ITCA 1GSLA 2NZ9A 4GALA 3WCSA 1VALA 2I2SA 5IUQA 5DZFA 2A3WA 2DU1A 5KXCA 5T5PA 2ZKNA 3D6EA 3BTAA 4Q2FA 1KRIA 3AZYA 3T2TA 1G86A 1AXKA 3AJZA 1UZYA 3MEPA 1G8WA 4PCRA 3UJQA 4H55A 2ZGRA 3MW2A 1V6OA 1Q8VA 4YFZA 4LBKA 2ZGKA 3ILRA 3RS6A 3POWA 1FX5A 2CNAA 1YO8A 5DUUA 2E7QA 4LBQD 5T5OA 1BYHA 1FATA 1LGBA 3N7JA 1KJRA 2GNMA 4Y20A 5DG2A 1DQ6A 4DPNA 2VU9A 1G7YA 3AYDA 1PZ7A 2D43A 1WLWA 1A78A 1MZ5A 3RMXA 2D6PA 3MW4A 4LBOA 4BPZA 1S0JA 1LU1A 2EXIA 5EYYA 1G9CA 3AYAA 3QCWA 1FYUA 2A6XA 2OVUA 2A75A 4GA9A 1QOSA 1Y7BA 3TB0A 2VW0A 1MR5A 2WKKA 1W6QA 4K20A 4XXPA 3OYWA 1W6NB 3WLUA 4YM0A 4HANA 3BODA 1LOBA 5GZFA 2ZMKA 1W6NA 2GNTA 2C5DA 4ZKTB 4WVWA 1LULA 3AXDA 4M3CB 3ZXFA 1G9AA 1CIWA 4Y22A 3WG4A 1JXNA 3OBRA 1ULDA 1EPWA 2ZGUA 1PZ9A 2D6MA 1DYPA 3POSA 3AZVA 3ZSJA 3SISA 1AF9A 1WBLA 5GLVA 1XQNA 1GLHA 3USUA 1RIRA 2DTYA 4YGDA 1AX0A 1N3QA 2BQPA 2TEPA 3R4UA 1AVBA 1SCSA 3PVNA 3N7KA 4WVVA 5F9TA 2D6KA 2UWCA 3R4SA 4YM2A 1LHVA 4R9DA 2ZGOA 1C1LA 1YYNA 4IQPA 5H9QA 3ZXLA 2WSVA 5KXDA 1LHUA 3IPVB 3SH5A 3BOPA 4XILA 1WW7A 3WG2A 5JVVA 4P14A 2VH9A 5GLUA 4XZPA 1G9BA 5IK7A 3ILNA 2A6YA 1DYKA 5EXOA 5T52A 2ENRA 1C1FA 2DUQA
chains in the Genus database with same CATH superfamily
4RQPA 4AVVA 2Y0IA 4UFMA 2G9FA 3THCA 5JI7A 3W21A 2EA7A 4O9GA 1DGRN 4IE6A 2J1AA 2IXIA 1LCLA 3AZXA 4LIUA 3UETA 3UYJA 5JR7B 3U4XA 2VNVA 4XJUA 1ZBE1 1UPIA 2JDZA 4Q27A 4RS5C 5GALA 1W0PA 1ZA7A 2B7YA 4XURA 2BDRA 4IEXA 4BJ0A 5FREA 4ZY9A 3O12A 4JTOA 1MEC1 4N9HA 5HCHA 5GLVA 2DV9A 4BQ5A 2AUYA 4OUMA 5IW0A 1DGWX 3WT3A 1OOPB 1HRI3 2XVGA 2ZGTA 2VZVA 3AFGA 1VBA2 1CWPA 1VAVA 1L7LA 1PVC2 1H1AA 3N35A 5FMCA 1T6BX 1PO11 3WUDA 4EWEA 2WFF3 4QXBA 5FPUA 4AVCA 3H1MA 2CHHA 3H1YA 5BV6A 4Y1VA 3BTXA 1FMD1 1S2EA 3U78A 3W59A 3PLQA 2PAEA 2FCTA 2P37A 1V6IA 2R071 5FOBB 1Y43B 2E53A 1N1VA 2JDPA 4NPLA 1JS9A 2P2KA 1OKQA 3RVHA 5KXEA 4LHSA 3OEAA 4SBVA 3T3YA 5FOJB 5F8PA 1OA2A 2WZR2 1W8NA 5JZGA 5HV4A 1D4VB 3CO2A 4MYEA 3OBTA 3WW1A 5IVBA 1JW6A 1S2KA 2Q30A 3OD4A 2LUWA 2V09A 3PJYA 5LBFA 2ZPXA 3MFCA 2KR2A 5A7NA 1HDKA 5GZCA 2V72A 2VW2A 2RG4A 3LPGA 2Y6HA 1PK6B 4ZZ8A 5J48A 4Y24A 3GZUC 3K3OA 3EQEA 3BU7A 4NMIA 4Q4W1 5FP8A 2Q1ZB 2VVEA 1AX2A 4FVVA 1CPNA 2BGCA 4QHOA 1RUH3 2OYZA 4RQPC 1YXWA 5F3GA 3WOGA 3I2FA 4V2WA 3WDUA 2EIGA 2P6CA 3FWEA 1WA4A 2QQUA 2AREA 1UL9A 2XLGA 4X8PA 3J8F1 2PYTA 4Y1UA 3ZVXA 3O1SA 3L2HA 2RDQA 1RUG3 5LY1A 1VMHA 3VBFA 1HV1A 4QX1A 2E63A 4CXYA 5AC92 2D6OX 1QWRA 5CB7A 3MF9A 2QZ3A 1WCKA 1J3PA 2XDVA 3B7MA 2Z2SB 1F2NA 2GNDA 2VOTA 3LE0A 4BLIA 4Z07A 5IJRA 5F5AA 5FUNA 1NLSA 3PMEA 4N43B 4ZS3A 2P3JA 4CXWA 2XJUA 5I8SA 1T2XA 3LEIA 2OT7A 2MPFA 2Z69A 3MV01 1XC6A 4JQTA 4L8QA 4O7XA 4XEZA 5A3MA 1ZA4A 5A7PA 1CAUB 3MICA 5ABJB 3WD5A 2HBUA 1YQ6A 2Q1MA 4LA3A 4COWA 2VZTA 4CP0A 1W9SA 3ZYPA 2J1TA 2DCZA 2V73A 4WZFA 4DB5A 3LFMA 2WJSA 5CNAA 3R05A 4XBNA 1UZZA 5CISA 4L11A 4AQ2A 1QIQA 2PHRA 4XUQA 4GJYA 1BZWA 1TEIA 3O5SA 5DAPA 2P3YA 4A44A 5JZGC 5CFCB 2VXRA 3VLBB 2AC1A 3O1VA 1RL3A 3ZXKA 5K8SA 3WF4A 4QHZA 2C26A 4M3CA 1OC1A 5E89A 2X05A 3RNSA 4EN8B 4KWLA 3AKTA 2VQ0A 4LBJA 4NIIA 4TWTA 5HCBA 4D7TA 4DUWA 1UX6A 1ONAA 2WFF2 2UYBA 3K4ZA 2VO5A 3GBFA 5FYZA 4PT6A 1OT5A 5GKAC 4AVAA 4P9WA 3MIEA 4I02A 3ZXDA 2GMPA 3M1HA 5FY1A 1OUXA 1ZRCA 1NG0A 4FOVA 2Q8DA 3AM2A 4Q0QA 1K42A 4IEVA 3H3UA 2XMLA 2YXSA 5FYYA 4EE2A 2RM23 3MI8A 3IKWA 3O0VA 1DU3D 4N90A 3KQRA 5AFBA 3WVJA 4DXTA 1BK1A 1VMJA 2W0XA 3BB6A 3M3QA 4MUVA 4ZU5A 1W05A 4YW3A 5FDBA 5JDBA 4P9YA 4F3JA 5A1FA 1UZ0A 2R0HA 4XHBA 4XDQA 2HKXA 4OI1A 1UY0A 2C9AA 2JE8A 3M3CA 3TYJA 1K5JA 3IIIA 2ZS6B 1FV2A 4N53A 2VTXA 4DEVA 4ES8A 1R082 3S30A 4OHYA 1RUH2 2VM9A 3S7EA 3V0BB 3T1MA 4JCKA 4ZS2A 2NYYA 3J7LA 3T4HB 2WNVB 3CZUA 3I2HA 4W4ZA 2A5ZA 4OHZA 4HBNA 4QM8A 4CUBA 1DCSA 3WNMA 2J7MA 4QDQA 4IL7A 5IVCA 3PVEA 3WY6A 1BMV2 1SBDA 1COV1 4OQ9A 1WUVA 1KFXL 3DGTA 4HVQA 2B9UA 3NV2A 4AWDA 4XFFA 3VZLA 1SLAA 1IQAA 4ASMB 5F3CA 1F4HA 1XU2A 1OOPA 1LODA 2WNEA 1RTVA 4NWWA 1JH5A 5E88A 3IDAA 4GXLA 3RMYA 1S0IA 2OQ7A 1A6CA 2XBO1 4AFAA 2W5FA 4AFDA 3MLJA 2PXJA 1DP0A 3BTZA 2VZSA 5I0TA 3OPZA 4JVAA 1K45A 4FFGA 4S2HA 1VAKA 3IMNA 3FLPA 2A3XA 2EXHA 4RR3B 1DQ2A 1OH3A 4FPEA 1U5ZA 2XXZA 1QEXA 3WNOA 2MEV1 5A3PA 5JXJA 4FFIA 3HBKA 3ZR5A 1JHNA 4FQZA 1LHNA 1W28A 2XUMA 4WVZA 3PIGA 4QXCA 4IGOA 3OPWA 1POV3 3FX3A 4R4XA 1P8JA 3K2OA 4FP2A 4YG6A 4M3CE 4BMBA 4FBFA 4HN0A 2ZGMA 2JD9A 2ZGNA 3H50A 5JI9A 2WT1A 3LWCA 3CF6E 3DPRB 1HQNA 1JZ8A 1N3PA 4XUNA 1HKDA 2JIGA 2DURA 2XG3A 4N53C 1EV12 4D6QA 3DEMA 5IVFA 2DUPA 1CZTA 3B9CA 2VZ3A 1AUYA 3RZZA 3VKNA 2ZX2A 4CUGA 4YPJA 3HOBA 4ARXA 1UWWA 4U2AA 2Y38A 3WDVA 4NN0A 2XGXA 4Q4X3 3LDKA 3B01A 1VBA1 1JUHA 2QBXA 2RM22 2ZGSA 1PVC1 1REDA 2FMDA 3H1WA 1F4AA 3VD5A 1LOGA 2DBIA 3DCQA 3CHXA 1JYCA 4LTAA 3H3LA 4MZUA 4OUEA 5T50A 3VBOA 4LORA 1PO22 4XF4A 4R9AA 4N43A 2E9QA 3T1LA 5IK8A 3LEKA 3R4DB 3O1PA 3H8RA 4W6YA 2YBKA 1K12A 5ABJA 1CAUA 4LUKA 2JB8A 4GMP0 1AXYA 1BBT2 1UCXA 3NAPB 1JBCA 1RUD2 1CONA 3MIGA 4K3UA 5FY8A 1OKOA 2GALA 4NR1A 1HB1A 2WZR1 2XJSA 4Q0UA 4QMAA 4KG8A 3QD6A 1NY72 5FAXA 1W3XA 5T5LA 5FXVA 1C28A 1LR5A 3AP5A 4YGCA 1SPPB 5H9PA 3SHRA 4FPGA 4YVWC 3UKVA 2YBSA 4CCMA 5DMYA 3AXEA 1WW5A 4AHYA 4LKDA 2JIJA 3INAA 4F83A 5FUPA 1ASJ3 3EYPA 3B00A 3K51A 3NNMA 2YROA 2Z79A 3CNAA 3WF0A 4BQYA 2VCCA 5CFCA 4KBBA 4UI9L 3WP4A 3MGUA 1F15A 3GJAA 3VZJA 1N3OA 2ET1A 2YMZA 4KMQA 5FP7A 2ZGLA 3ZFFB 3ZR6A 2OUJA 1W8TA 5KWRA 4LK6A 4P9IA 3V56A 3TEZA 1Q8OA 1W6QB 2EXJA 4N9IA 2V5DA 1ACCA 1UNBA 2VQTA 1WW4A 4HK8A 2X09A 5CYYA 1A3KA 1SFYA 3I3DA 4HFSA 4YLZA 4E4ZA 3HN1A 1LU2A 4FCAA 2D3RA 4PHZA 3VDCA 2E7AA 2ZGPA 3AKQA 5AC91 4JDNA 4QKDA 2WS93 2OA2A 3FUQA 4PIXA 1ZREA 1UOBA 4W6XA 5EQUA 2D98A 4LO7A 4UOJA 5LASA 5CA6A 3RGBA 2ZA9A 4UFLA 4D94A 5TSWA 5EJZB 4QM9A 5GLTA 3VBOC 4EYUA 5JOXA 3HJRA 3ZSEA 3H8XA 2XLAA 4N43C 1RUOA 3FLTA 3SNMA 5C8CC 1ZRDA 4PDWC 2G9GA 3IDCB 1JZ3A 1F8VA 3V0BA 3A0NA 5J98B 1O3TA 5ABJC 2PQQA 1QJU2 5L73A 2WNVA 1HB3A 1CZVA 3WQ0A 1ENXA 2UWBA 2IZWA 3DKWA 4O65A 4KG0A 3O0WA 1W39A 4NHYA 1J1TA 4XOGA 3FUOA 4Q4X2 3W58A 2H0VA 2BVBA 1C3HA 3GF6A 1JYWA 3EJKA 4R9CA 3HT1A 4ISQA 3ES1A 1M4WA 1VJ2A 2BWAA 2W9XA 5CEHA 1Z78A 2GNBA 1HX6A 1XNKA 3RWNA 4EZ4A 3VD3A 2WFF1 2ZGQA 3WP3A 3MIHA 1G6NA 4NHMA 4QX3A 5F5QA 4CDXB 3I2OA 4BU2A 2YC2A 4PI0A 3C2UA 1UXXX 1REEA 1OMIA 2NQYA 2P3IA 4IESA 1ZBE3 2CY6A 2JD4A 4BQ1A 1QDOA 3LA3A 2DU0A 2DWRA 5CKNA 3TEYA 1JYXA 4PF5A 1AYN2 5FY9A 3KGLA 1W6OB 4RR3A 5BNPB 1DQ4A 1S55A 4C1XA 5CU1A 3KT7A 5FZMA 1W99A 1XNCA 4MGQA 4LBMA 4V1PA 2AGSA 1ASJ2 4XJ8A 2A3YA 3PVOA 4JAAA 1IKQA 2D3SA 4QWNA 1DIWA 1R081 1PO13 1ST8A 1UOFA 1RUH1 2XJRA 4PQ9A 3IM0A 2SLIA 1IOAA 2DVFA 4ES9A 4YZ5A 2JG9C 2P1BA 3DPRA 4LQRA 4AEDA 3LD8A 5J09A 1YQCA 4AVBA 5FZBA 1OFNA 4AVTA 1J3QA 1HW5A 5FYVA 1AZDA 1BMV1 1S0GA 4YVSC 1IKPA 4BQ3A 4YGEA 1SDWA 4J1XA 2WNVC 4N7UA 2GMEA 5FLHA 1OH4A 1WZXA 4OZOA 4NHKA 3EXUA 5C33A 5JOYA 1GP4A 2R1DA 1W8WA 2JKBA 3URFA 1VRH2 3HEIA 3OBAA 1VALA 2I2SA 2QE3A 3MBWA 2OIIA 4OLLA 4DXSA 4DINB 2JDHA 5KXCA 1D7PM 4AQSA 1KRIA 1RYYA 2VZPA 5EJ3A 4LOSA 3E5UA 1AXKA 4JKLA 2RJKA 5L9VA 4XUPA 2IXKA 2RJLA 4PCRA 5FYBA 4RD7A 5LCWL 3J8F3 2VBBA 4YFZA 2J1SA 2F4LA 3KCXA 3NAPA 2F6BA 3POWA 4E2GA 1YO8A 5DUUA 5HPOA 3ZMNA 3POGA 2FDIA 2GNMA 3I2GA 4HK9A 2VU9A 1SPPA 1IPJA 5CIRA 3T4VA 2D43A 2BU9A 4JDMA 1REFA 4D3WA 4XVHA 4FT8A 1TMF3 1UU4A 4BPZA 4RS5B 4MADA 2FDFA 2IXLA 1FYUA 1X8EA 2A6XA 2OZJA 4BDVB 1EV11 4UBGA 3ZFFA 3M4FA 2WA3A 4MG2A 4GA9A 4UWDA 1QOSA 1Y7BA 4GJZA 2VW0A 4JV4A 3CEWA 1MR5A 1RUF2 1W6QA 4K20A 4I3GA 4HN1A 4MGYE 2IUWA 2YFZA 3ZKYA 1SZBA 3DPRC 4PI2A 4AEDC 1DLCA 1YJKA 3BODA 3N9PA 4ORFA 2ZMKA 2WZEA 4TLGA 3NKTA 4BA6A 3OD0A 1WMEA 2RM21 4R8HA 3WG4A 1JXNA 1U5IA 3OBRA 4JDOA 5A7OA 4MSVA 2PMWB 4JRLA 1VBC3 1ZRRA 3Q8BA 3USSA 3CBNA 1Y3TA 5EJ1B 1OSGA 1PO21 1RVF3 5KC5A 4JQRA 4I2OA 4AFBA 2ORXA 5FYUA 3H7YA 5FCCA 3ZSJA 4LKFA 1C8M2 5FZGA 5FO8B 4HG6B 4QPGA 1N3QA 1AVBA 1BBT1 2GP3A 3AL6A 4INDA 5CVRA 3ZYHA 4COVA 1RUD1 2D6KA 4PJYA 2UWCA 1T6GC 4CE8A 1X9TA 4R9DA 4MXVA 1NY71 2VMDA 3AMPA 1YYNA 1SG3A 4GIQA 4IQPA 1JZ4A 2G9ZA 3I2JA 4META 2YBPA 3N9QA 1O59A 3BGAA 3SH5A 4XILA 1KEXA 1WW7A 3WG2A 4AHWA 2VH9A 3AVRA 1XSQA 2LS6A 2WNUC 4RQPB 3HNYM 4E4SA 5T52A 4DUVA 3NJVA 2HLEA 5M0TA 1PGSA 4RFRB 3TBDA 5HCAA 1OF3A 1OBNA 2GN3A 4JGZC 1QJZA 1BQPA 2R49A 1JI6A 3CDZB 3U11A 1LECA 2W1WA 4YW1A 5LBCA 3ACGA 1VAMA 1SEFA 1SLBA 1XNBA 1OVSA 3PURA 4KU7A 4O9EA 1H8TC 4BLJA 4CDXA 1JZ2A 1IS4A 1J59A 3GZAA 4YW5A 1WLCA 3RYRA 2LTNA 4Z2WA 1OA3A 4RGKA 2JDAA 1COV3 1GICA 4M0NA 1BLZA 1ZBA2 5L9BA 3I3BA 1ZYBA 3U1XA 1RITA 1Q8SA 3ZSLA 4E9KA 2FDHA 1W6OA 3EB7A 5BNPA 1KS5A 1OQ1A 1RXFA 5BNOB 1PGL2 1AHSA 3AMQA 3VB9A 4XE9A 4AE2A 2Y6KA 1UAIA 3NW4A 1TMF2 4QPYA 1E5IA 1GFF2 4XDPA 2HWD3 4B4QA 2YZ4A 3ZYBA 2DTWA 4HZFA 1SBEA 1QJU1 3M7AA 4QPGC 5L19A 3S5AA 2IC1A 2RS53 3SC7X 5JZGB 3K48A 1YQ8A 2HBTA 3VZNA 2JG8B 2WC2A 1OFSA 1CPMA 3T0AA 3NJYA 3HD8B 2XONA 2XHKA 2MEV3 2VVDA 4Q4X1 4TZDA 1UU6A 4P5YA 3H8OA 1WMFA 4HKLA 1GWMA 2WZPP 3LFIA 1LNSA 1VBC2 1ZZ9A 3GCXA 1DQ1A 4XAAA 1RVF2 5FMOL 5DN2A 3I54A 2LW8A 1ULEA 2EICA 1GZWB 2A6VA 4QQHA 2I74A 4TYSA 1UOGA 5JOZA 4IGPA 5BYNA 5JIAA 5T54A 4TXWA 3ZXEA 1JZ7A 5C9AB 1H6XA 2VXJA 4G4FA 1UIKA 3OGJA 4L97A 4PLMA 4AFCA 1AYN1 2Y0OA 4CDXC 3K77A 2QDNA 1H0BA 2BWCA 3WDXA 3PVBB 3CKHA 2HEWF 1V6MA 3WNNA 2W68A 4CCLA 1UYXA 4XZUG 1SACA 4LO6B 3DN7A 3HQRA 1VBA3 3MLKA 1ASJ1 2C4XA 1UF2C 1PVC3 3NV3A 5FP9A 4FTBA 3RQ0A 2DVDA 3H8UA 1V70A 4DY5A 4QB1A 5I93A 1R64A 2A70A 5A7QA 4HKWA 3B9IA 4L9BA 5C3PA 3AYEA 1LHOA 1PNGA 2ETEA 2ID4A 2DVGA 1KJLA 3HAGA 1ENSA 1I9RA 3ZXGA 1H4GA 4XETA 1S1AA 2PELA 4RS5A 1JYIA 2YV8A 3T0DA 4MGSA 1JOJA 2WYSA 5JLVA 4CPBD 2VCAA 3NV4A 3JB4C 4E27A 2QQOA 3WG1A 4OYUA 4BZ4A 4LO4B 2JECA 5LY2A 5LEKA 4RFT0 1IHMA 1NZIA 5A3WA 1VRH1 2VUAA 3ZFEA 2OW4A 5DZEA 2MHFA 5LEJA 4LXLA 4RA0A 4QKFA 2QQNA 3B02A 1QQP3 2JDMA 1O4TA 2VNGA 2YU2A 5FBJA 4YARA 2BNMA 5FZIA 5A70A 2ORZA 1JYTA 5F32A 4YM3A 1D2SA 1UMIA 3B5LB 4IEPA 5C3QA 4WZCA 3GHNA 3PIJA 3VZKA 4UW5A 5FLIA 3WDTA 2QQPA 1IS6A 4OI4A 1CD3G 2ADDA 2HWD2 1C5HA 3M8LA 5KC6A 5IWFA 3LB9A 4LOTA 4Z1VA 4LJHA 3LEMA 3FJSA 5C5TA 4FPCA 4LULA 2RS52 2FBEA 4ISRA 2D5HA 4K1YA 5B4XA 3FFZA 1LTEA 4QQOA 5J7MA 5AC93 1PIV1 3TNPB 4JHTA 3VZOA 4AR2A 5K0UB 1BHGA 1NLRA 3N7LA 4A7ZA 1RXGA 5FZ3A 4GKXA 1GU3A 2Y33A 3LA7A 2HEVF 5A32B 2YC0A 3BU0A 4PF1A 2HWC2 3ME2A 1YWKA 3FLRA 3NRUA 4P9JA 3NNGA 4KI5M 3NKGA 3DYMA 1WA6X 5F2WA 3I2IA 4ZXKA 3SCGA 1LENA 3FHIB 5FKCA 5L9RA 5C8WA 1MQTC 1J84A 3DV8A 3GJBA 4CYDA 1UOJA 2F17A 4JKMA 5FZKA 1WLDA 1X50A 1WW6A 1RUF1 2BGOA 3Q9OA 5K7PA 2Q8CA 4Q8LA 2YFUA 5CG9A 1W6PB 2Y6FA 2VUCA 4GZ9A 1V6KA 2VY0A 2CAVA 3AB0A 4QD2A 3U0ZA 3JZVA 3OCPA 1ULGA 3DUIA 1QJFA 3E5XA 5H9SA 4BK5A 1RC6A 2AACA 4XACA 4AVSA 5J96B 1AL0G 2Z4FA 4Y5Z0 1MPXA 2OXBA 3AX4A 1GV9A 4FAHA 1XNTA 4FTSA 4QX0A 2KXLA 3MPPG 4OMCA 4DUXA 4IV1C 3VL8A 2Z42A 3ES4A 1N1SA 4QPIC 2GC0A 4AQ6A 1VB2A 3WNPA 1F9KA 1C8M1 4UFIA 3ZFEC 3ZSKA 4YWAA 2I45A 2ADEA 2D3PA 4FQ4A 4ATFA 4Y26A 5BNOA 1CGPA 3ETQA 4UW3A 4NIGA 1JTZX 4BOWA 4NOTA 5J37A 4BIOA 4M00A 1DBNA 4YVWB 1MS0A 3KWVA 3OOXA 3A21A 5DUXA 4A6OA 3D82A 3FBYA 4J25A 3KV5A 1SHWB 2JG8A 1JZ6A 1RMU3 3JBG3 2CWSA 4W65A 1K5MC 2RS13 2Y6JA 4CP2A 1C5IA 3KM5A 3LOBA 1WBFA 1W6MB 1VR3A 1WCSA 1SFNA 3T2PA 3LSEA 1FOD3 4BIFA 5L7OC 1DHKB 1NYWA 3E1F1 1QQP2 1WD3A 4YSFA 2E31A 1R083 3ORJA 4K9SA 3OUHA 4A45A 3WF3A 4E2SA 1E5RA 1GZWA 3ACHA 5AVPA 3IB3A 4UBHA 2G4IA 2LROA 2VTFA 3NWKA 5C9AA 3UJOA 2RDSA 3S57A 4D69A 1ZBA1 4G3YC 2VVFA 1SDDB 2JICA 3PU8A 5CKMA 2LALA 4YG3A 5EHDA 4ZZ5A 3AVSA 3VHPA 1E5SA 2W08A 3VBOB 5EV7A 3ZFGC 4XC9A 4UF0B 4HT1T 5JXHA 4IETA 4QX2A 4XUTA 1DFQA 5F6LB 5C8CB 1HJFA 5ANNA 2Y34A 1PGL1 1UYPA 3GHMA 4L92A 4PDWB 5FY0A 1TMF1 4Q26A 2IXHA 3T30A 4WM8C 4COUA 3OY8A 4KGGA 4OQ8A 3ST7A 4OZXA 2AYHA 4Q1PA 3Q8EA 4DS0A 5CFDB 5E16A 5BNOC 5D21A 3VUOA 5JCTA 4LBLA 4FPYA 4RGGA 2ZTNA 2GU9A 4Y20B 4W6WA 5FYTA 3O1MA 5FMOS 1QXJA 1JUIA 4F7ZA 1GNHA 4Y4YA 5KHJA 1U5XA 3M2MA 4A7KA 5I0RA 1OLRA 2JG8C 1VBC1 4XF0A 5HBAA 2ZHMA 2V4VA 3GXUA 1RVF1 3MDPA 2UYAA 1J3RA 3WCRA 2JX9A 4KWJA 4XMIA 5A7WB 2CYFA 5IAXA 4QDRA 3ENRA 4K21A 3OYWB 1EV13 1QNYA 1GWLA 1UKGA 2D6LX 4XFAA 3OB8A 1CJPA 4NIDA 3OGRA 4XABA 2WLPA 5JUVA 2CSGA 4U36A 3AK0A 3J4UH 2ZMNA 3GZTB 1MZ6A 4UW4A 1BK0A 2BPA2 3ACFA 4FOYA 3ZKUA 3WQ1A 1HRV3 2VNRA 1XYOA 5C9AC 2H6BA 4AW7A 3BYWA 5LRRA 3VHOA 4ASKA 2JEMA 3FC0A 1RMU2 3JBG2 4DMIA 5K0UA 2RS12 5LRSA 1S4CA 2WO3A 5JOWA 1PO23 3PU3A 2JG9B 4IDZA 4XJ9A 3NV1A 4N8MA 5A32A 2VW1A 4YRDA 3W5NA 2FCUA 1FOD2 2PHFA 3D3AA 2H0BA 4MGKE 2HWF3 5E8AA 4YVSB 3RPQA 1QDCA 1UX7A 2HYKA 2PHTA 3ASIA 1JYVA 1BBT3 4URAA 2FZ2A 1RUD3 4COZA 2VOXA 4CCKA 1RUC2 2BTVC 1I1EA 1XRUA 1R1A2 1UY3A 1W6PA 5FZCA 1PM4A 1C8NA 3T09A 1JU3A 1H2LA 1ULCA 2X29A 5A6QA 1OHFA 2JDYA 2PQSA 3F95A 4RHV2 3Q8AA 2NLRA 4XQ4A 5FXWA 4L0PA 4XTMA 4HSLA 2ARCA 2DF7A 2FCVA 2A6WA 1IG3A 2VAUA 3K3NA 1ZZ8A 3NNJA 1LGNA 4FO9A 4P9XA 1LOCA 2JB4A 4PBOA 4QAWA 1O5UA 2HWD1 2DFBA 2QQLA 3MLLA 4B4RA 5GLWA 1POQA 5A1AA 5GM0A 1N47A 2RS51 5FJHA 5J1XA 4LT5A 2ES3A 1GYKA 3UNPA 2W1UA 4YGBA 4MGZE 1SLIA 2VOWA 2Y26A 4YVWA 1B35B 3OGSA 2RMU3 2NMNA 3J26N 1QXPA 2K9ZA 3AZWA 3SCHA 4CU9A 2XLFA 3A4UA 1U5YA 5FK7A 3RZMA 3UESA 1GZTA 3T0BA 2HWC1 4Z2AA 1IZ3A 2C0ZA 1UKRA 4COYA 1GWKA 3RI9A 1X9PA 3VKMA 5I0SA 4MO3M 5K0UC 2ZZQA 4M4PA 2VZRA 2ZABA 1YRZA 1BCXA 1MS4A 4SLIA 4Q4V2 1W6MA 1C57A 2VUJA 3SCFA 3OJBA 4Y1XA 4AEDB 2HWB2 3I59B 5CKQA 4YW7A 1XYPA 5BNNC 3HT2A 4GWMA 3FZ3A 1QJU3 2O8QA 4Z82A 4JTNA 3W5MA 1YI7A 5IK5A 3DECA 3POIA 4EN0A 3O14A 2DFCA 3ACLA 1FAYA 3ZPOA 4A3XA 2RDRA 1HRV2 1NKGA 1SFPA 2QQMA 3OUIA 3WP5A 4Z92B 1V9U3 1YI9A 3KMHA 5A33B 4NE9A 1VE0A 2WZ8A 5CADA 1H4HA 1ND2A 2A3WA 4CU6A 3AKRA 2BGPA 2GAUA 2Y60A 5E1RA 4KQ7A 1HN0A 4UF0A 5FZ6A 4AI0A 1DG6A 4Q2FA 1GP6A 3S7IA 5C8CA 4FSJA 1YLLA 1G86A 4PDWA 2ZX0A 1O3QA 5FZEA 1UZYA 3N4MA 2HWF2 1G8WA 3UJQA 4CUAA 1YUDA 3MUY1 2ZGRA 5A3LA 2OPWA 1AYM3 2E26A 2EIBA 3LIGA 1OI6A 3PDQA 4GWIA 4EN7B 2WNUB 5LBBA 1E5HA 1AYN3 3RZHA 1QHDA 4LBQD 4XF3A 3C8XA 1JMUB 2G19A 4KWKA 1BYHA 1FATA 1LGBA 1YC61 2VL4A 3G7DA 3N7JA 2VMCA 4HXCA 1Q43A 4JGZB 4Y20A 4OHVA 3TEWA 4DPNA 2RR12 1G7YA 2OX0A 4RYDA 4AI1A 2P17A 3ALQA 2QQKA 4C0HA 1QQP1 2IVIB 2D6PA 2WDBA 3MW4A 2XVKA 2N7GA 3RMXA 5DDJ3 1H8TB 4LR4A 1NT0A 3AYAA 1W9WA 2Z5WA 4OI2A 4ZU7A 4LK7A 1TME1 2MNGA 5C71A 4HOOA 5A7WA 1O8SA 3RZLA 3I49A 2WKKA 5KHKA 5K4LA 3OYWA 2K46A 4LKEA 1ZNPA 1XXNA 4CXXA 3BKZA 3ROUA 1W2TA 4CU8A 3VD4A 2R6QA 5GZFA 5F2SA 1SQ4A 4NIAA 3R6SA 3AKPA 1LULA 5F7UA 5J3UA 1CIWA 2RMU2 2YGLA 5HXMA 2ZOEB 1NCRA 3GBWA 1VRH3 3ACIA 1PZ9A 3POSA 3MV11 3ZO0B 4BH9A 3AZVA 5A3UA 2ZXQA 1RUNA 2ZEYA 4GAZA 3SISA 1AF9A 4GMP1 4QPGB 1XQNA 1GLHA 1ND2C 2JG9A 4FXKB 1RIRA 4NJ4A 4YGDA 1AX0A 2TEPA 3AMHA 3R4UA 3CU7A 3S0MA 3PVNA 1WCUA 4WVVA 4CP1A 1PHMA 3JQXA 3R4SA 2W1QA 4DIQA 1LHVA 4YVSA 2ZGOA 3C3VA 5BPXA 1XE0A 4MHRA 4ET7A 2W3JA 3KV9A 4ZONA 2VC9A 2LRPA 3MUZ1 3ZXLA 1LHUA 4AI8A 1E57A 1PIV3 2E32A 3CJIB 3BOPA 4BB3A 4B3NA 1R093 4DNYA 4P14A 5GLUA 5IVEA 2GH2A 4AQTA 3N9LA 4IERA 2YC4A 1V9U2 5FJKA 1CIYA 1W8ZA 2R063 5IVYA 2XQRA 3BIEA 2CTVA 2XJTA 4YZ4A 4H14A 1H1IA 3PHMA 5DPNA 1M06G 3NSTA 4GULA 1AR82 5FZOB 3POYA 3WZ1A 2QQJA 5FZ7A 1RB8G 4XF9A 4BISA 2YG0A 1RUF3 5FZ0A 3NL1A 5C5UA 2J22A 1J83A 1AYM2 3OEBA 2XJPA 5JSOA 1Y9QA 4QKBA 3BIWE 4CEWB 2DUOA 1C4RA 3ZMOA 2RHPA 3RI8A 4HETA 5FMDA 1XSRA 5BUVA 1RMU1 3JBG1 5FO7B 1RUI3 2RS11 5IATA 1B35A 1DQ0A 1DZQA 5KHIA 4Q0PA 3AKSA 2W94A 3BI3A 2G1MA 2WWJA 2JE7A 1EP0A 1HN1A 4H3WA 2O1QA 5APAA 1NCRC 2JWPA 5F5CA 3E6CC 1FOD1 1C8M3 5EZWA 1H9PA 5FIXA 2I07B 2R7EB 2QTWB 4XHXA 5DDJ2 4CCEA 1RUE2 1XE7A 2NP0A 2FDGA 4DRRA 4ONUA 3ON7A 2BFUL 1RUC1 2XL7A 3VBSB 3ZM8A 2BUKA 4QQPA 2GN7A 2GZWA 3FE5A 3I59A 1R1A1 5FQ0B 4DO0A 2P5BA 3FN9A 1J58A 4Q0VA 3LEGA 5FYIA 3RJ2X 3J7HA 1S0EA 2W46A 3AP9A 1AJOA 1NA1C 3WW4A 3RZKA 4AI9A 2B8MA 2XR4A 2VECA 3B3QE 1O4ZA 3DXTA 4NO4A 4RHV1 5DUVA 1LOEA 5H9RA 1G9FA 4K6BA 2UURA 1IS5A 5A33A 1A8DA 1ODNA 3NNLA 1W2OA 4B7KA 2XL9A 4YZ3A 1AR93 3DL3A 1G9DA 5DZGA 3KVAA 3FBMA 1LOFC 1VIWB 2C6SA 2WO1A 4NVPA 3ZIWA 4QGNA 4IGQA 5DXDA 4GD4A 1TNRA 4NRQA 2A1XA 3VL9A 2C9KA 3PTYA 5IHRA 3D4KA 3MO4A 2ATFA 4OVEA 2ZAAA 3TEXA 2JDNA 3WINE 3TAYA 3ZYJB 2XPJA 3KS7A 1ZBA3 1GQPA 2WNUA 4I0AA 2BV4A 1PIV2 1GP5A 4QDSA 5FWEA 5T55A 2YYOA 1R092 4TSVA 1MS5A 4LITA 1MQTB 1NAEA 4JGZA 4TTGA 1B35C 4CCNA 1QJEA 2NPIA 2ZAHA 4Y5TA 2AEZA 4G9SB 2R062 4Q4V1 2PLV2 3ZYGA 1NLQA 2ZX4A 5LA0A 1JU4A 4YZ2A 2HWB1 1O5LA 4JGYA 3OGVA 4IUGA 3AL5A 4XBQA 3RJRA 2V4AA 1XB9A 1H8TA 1ULOA 2QQWA 2TBVA 2VBPA 3QLQA 4E4DX 4P5HA 2PN5A 1GBGA 1IGOA 4K1ZA 5D8AA 4D7YA 4XJAA 4BQ2A 1ZM1A 5DG1A 4E8DA 4IV1B 4MOAA 2ZHLA 2NM1A 1H2NA 1HRV1 4QPIB 3U37A 5LK5A 3A22A 2A73B 3SITA 4FFFA 5GLZA 3ZFEB 4AI2A 4J6GA 4JHZA 3OUJA 3UGFA 1PVXA 1RUI2 5FFOC 3RG0A 2CV6A 1HQLA 1QMJA 3IN9A 1XNAA 5C6CA 3E97A 2QKDA 1EUTA 2D93A 1W8FA 1F31A 3DXUA 3J7NA 4NWVA 2EAKA 3WDYA 1NUKA 3THDA 1QH6A 2HWF1 1MVEA 2XJQA 4XF1A 3T08A 1OQEA 4D0QA 1PMHX 3DF0A 2CGOA 1DF0A 3WNKA 4HKOA 1OLQA 1GOGA 2DBNA 1K5MB 3K4AA 2X8KA 3OBZA 1AL22 2CL2A 5FPVA 4EWAA 4DXZA 2X53S 2PHDA 2UY9A 4QU2A 3ZDSA 2EIDA 5L7OB 2RR11 4KL1A 5DAVA 3CJIA 1LHWA 1PX3A 3SKVA 4KBZA 3VKOA 1XU1A 4Q4Y2 3TN92 3MIDA 2XWBB 5FK8A 2B42B 4XFBA 2HYXA 3M3EA 5HCFA 1POV0 1N1TA 2X5IA 4MH0E 1L3JA 1O4YA 4UFJA 3WV6A 1AR92 1Q56A 3BN6A 4I30A 1PMJX 4UFKA 4AGGA 4JGYC 4K8FA 1LJ7A 4A6SA 1CX4A 4GH4C 2WQ4A 4CCJA 5FZOA 1QJY3 3LGRA 1XJAA 3NNFA 4A41A 4EROA 5D8AC 4Z8BA 1CJDA 1W06A 2ZHKA 5LA9A 3ZFGB 3NVCA 3JU9A 3KT1A 4QX8A 3VKLA 3U10A 3UKTA 2D6NA 2RMU1 4XYXA 2VCMA 3EBRA 5KHGA 3AFKA 1A8MA 1UMZA 4CEWA 4M3CF 4EQVA 5JXGA 3KSCA 4WM8B 1MVQA 2J1VA 5EWSA 4JZRA 4CP9B 1UQXA 4DQAA 5JSPA 2P3KA 3N36A 3MPBA 1W04A 4DOUA 5FY7A 2SBAA 4YYOA 3VD9A 2YGMA 5I8TA 3MZHA 4UAPA 4C90A 1Q5OA 2P6HA 2PFWA 2W95A 3GM8A 3POJA 3QH6A 4A7YA 4XJZA 4CDWC 5JIUA 1GQHA 2Q0AA 4FPKA 3RDIA 5DAWA 1MS1A 3VBSA 2FMYA 5FQ0A 5IK4A 2UWAA 1AJKA 2WQ8A 1BJQA 3GBGA 3B69A 4UXAA 5HXVA 5C3OA 3KGZA 4YZ1A 1UYYA 4CUCA 1BEV3 5FRAA 1V9U1 5T5JA 1VBB3 1FPN2 1FT9A 1W2AX 5ACA3 2HWC3 4CTEA 5EFUA 2DVBA 3CJIC 1W90A 1OUSA 4YW4A 5IT6A 3UT0A 1QNWA 1WKYA 3FL7A 1KQRA 4JX0A 2VOVA 5ISLA 1AR81 1VBE3 2AZ5A 2XH6A 4W8JA 4Y1ZA 1QOOA 3UGGA 3GGLA 2X5IC 4LIVA 3WNXA 4XFHA 3X29B 1AYM1 3ZN6B 4AEJA 2WO2A 3D8CA 3L2YA 3RYPA 2BOIA 1V0AA 2IXCA 2GC3A 3OF1A 4IV3C 4LHKA 4XDOA 4C0BA 4QHBA 4XW3A 4CPBA 4FAGA 2EAAA 2QFEA 4CEWC 2WT0A 2OQ6A 2W47A 2XHNA 2IWGB 3SMHA 3OY8B 3ITQA 3WF2A 1JN2P 2CDPA 4V2VA 1MQTA 5DDJ1 3KCYA 1RUE1 1XE8A 4LKSA 5F6KA 3BALA 4XBLA 4D6SA 2OPKA 3W20A 3ZPYA 3WQBA 3Q8CA 4BQXA 3R0RA 2VULA 3K46A 1YFWA 4I3PA 1N1YA 1UY2A 4K40A 1XYNA 1O3RA 2WAOA 1QJY2 1VMFA 4M01A 4YG0A 5LWBA 1ZZ6A 4A42A 4YM1A 1MACA 2D5FA 3CL1A 3VBSC 4XAEA 4QU1A 4CEYC 4IE5A 1AR63 4IV1A 4QPIA 3HN3A 2R043 1KXGA 4LHNA 3ZYIB 3PTRB 5FPLA 1YIFA 3ZIXA 1LRHA 1OURA 2UU8A 2XQXA 1IPSA 4NRMA 5LB6A 5JAXA 1Q3EA 1XNDA 1TME3 4P02B 5DAXA 3KZ4C 4UW6A 4XCAA 3VHNA 1Y9GA 1NZCA 2ARBA 4HSJA 4IEQA 3VKFC 3LKJA 3ETPA 2RV9A 1W8HA 4CU7A 2BW8A 1SLLA 1WWYA 1UN1A 1ZX5A 1OQDA 3IT8A 1K5MA 2VPVA 1V00A 4MLOA 4KNCA 5D2AA 2XOMA 2GSYA 4AK3A 5C3RA 5CG8A 1R091 2E7TA 3PUHA 2GH8A 1HLCA 1U12A 1HXS3 2R16A 1BEV2 2W2IA 2VR4A 1VBB2 2B5HA 2XKOA 3I2DA 4HL0A 5ACA2 5L7OA 2QZ2A 2R061 2PLV1 5LA1A 4K8RB 5BNNB 4GMP3 4GWJA 1NQDA 1WCQA 2NN8A 4E8CA 1H6YA 2QCSB 4AHXA 3JD72 1GQGA 1D4M1 3ABZA 3ZOIA 1VBE2 2JDKA 5DAQA 1RJ7A 3BPSA 2P4EA 5I0UA 3T2OA 2EIEA 4YW6A 2ILMA 3PUIA 3AMMA 1OLMA 3H0OA 3B94A 3JUUA 3KV4A 4PQQA 1DGLA 1EAH1 2RVAA 2ZX1A 5FZ8A 2X10A 4I0BA 4QX7A 2AR6A 4H7MA 3VN4A 3ZFGA 1CAXB 5IVVA 3LDBA 1RUI1 1TZOA 5FUIA 4X8NA 4CZSA 1Z7S2 5A6YA 5LK7B 3CMGA 5C4WA 2RS32 1ZZCA 4WM8A 4GKYA 4CP9A 1NXD1 4MGTA 1QGLA 2WN3A 1UZWA 2PTMA 3KB5A 4QX5A 1YQ5A 1OPMA 3RSJA 2DDUA 3JQWA 2WIIB 4LE4A 5D1IA 2VNOA 1EYBA 3OPTA 4RN5A 4BMEA 4DRVA 1WLTA 2LM3A 2YPJA 3HWJA 3PNAA 4XFGA 1AL21 2QJVA 3LZZA 4PBPA 4LEJA 1RHI2 1O6UA 1UU5A 4RSUA 2CGPA 3APBA 3HPNA 4KGQA 5FYCA 4KH9A 3FHQA 5GZEA 4ZXEA 2WWSA 3HMYA 5SV5A 3O1UA 2GDFA 4OI0A 4DEQA 4MGIE 3FFQA 1AR73 1DQ5A 4MVTA 1NCQC 4Q4Y1 5FXXA 3TN91 1AR62 4IEWA 4R4ZA 2R042 3J7MA 2ZACA 2BYVE 3BVCA 3N9MA 4DXRA 3BUCA 4CCCA 4EZHA 1H8VA 1AR91 1KD7A 5EYXA 1GZ9A 1F5FA 3P3NA 2Y64A 1VB4A 4BYYA 3KD4A 4NROA 1TME2 4MV2A 2B45X 1RUC3 4EWDA 1KITA 1R1A3 1CAVB 2J1RA 3WW2A 3RZJA 4QKNA 4WM7C 1RUJ2 3MIBA 3ZN6A 2GC2A 1BKZA 1LAJA 3F2ZA 5GZDA 1JODA 4LBQB 3IBMA 4RHV3 2WQZC 4B8EA 3IDEA 4LNVA 1ND2B 2VTXJ 2ET7A 4ITCA 5FLJA 2NZ9A 3SXWA 5FZFA 1HXS2 1ZRIA 1EY2A 2B39A 3HVDA 5A80A 2BNOA 4BQ4A 4WBBA 5JPNB 2D97A 2C1FA 1QXRA 2DU1A 4A4AA 5C4WC 2ZKNA 3D6EA 3BTAA 2GP5A 1O8PA 2CGNA 3AJZA 1YNAA 3MEPA 5BY5A 4L99A 1O91A 3MIFA 4H55A 5E6HA 4D6RA 5J36A 1Q8VA 2IVJA 4LBKA 2VMHA 1FX5A 5IFTA 1OLME 2BNNA 2E7QA 2ZKLA 3H42B 3C7EA 2YPDA 5T5OA 1KJRA 1C1FA 4AG4A 1DQ6A 4WVMB 3FMGA 1FPN1 4OHWA 4EJRA 1HV0A 3I3EA 4AHZA 1PZ7A 3NMBA 1WLWA 5IAVA 2HWE2 4LE3A 3U07A 4LBOA 5A7SA 5KHHA 2VUDA 1LU1A 1QJX3 2EXIA 4IW3A 4Q4V3 1LKNA 5EYYA 2HWB3 5FXZA 2A75A 4XXPA 1TNFA 4URTA 5C70A 3POEA 4PIYA 1W3VA 4UFHA 1W6NA 2C5DA 4ZKTB 3ZYFA 4IE7A 3ZXFA 1G9AA 2VMEA 1NCRB 1NXMA 4CCOA 1VPHA 3IZOA 1HRI2 1ULDA 3GDBA 3KF3A 2ZGUA 1CAWA 1AR72 2D6MA 1O3SA 2WA4A 1RJ8A 1W2NA 4BXFA 5FPBA 1WBLA 4AAXA 4CDUB 4H7LA 3EMRA 3G6JB 2DTYA 3M70A 4PLOA 3RWKX 5BNNA 2XVLA 4LHLA 4Y33A 1YIPA 1NA1B 5F9TA 4P00B 4D7SA 1DGWA 3MYXA 1J1LA 1QJY1 2PHLA 2B4KA 4CDQB 2JKXA 5H9QA 4AI3A 2WSVA 2VJXA 1GOHA 1CZSA 3IPVB 1KS4A 4LA2A 4AAPA 4KWUA 4IEUA 2BERA 4UT5A 3SEEA 1YEWA 4XZPA 2W1SA 2RR13 2VZ1A 3ILNA 1DYKA 5EXOA 5F1RA 4BWOA 3LQCA 3JB8A 2DUQA 1CAXA 2O0OA 5FKBA 2CDOA 4LBNA 4FP3A 5F3EA 5I8YA 4W50A 4HMZA 5JXIA 1GR3A 1QY4A 4BM8A 1MS3A 4A3ZA 2OZ6A 2CWMA 4EN6B 1HQWA 3A0KA 3A23A 2WR9A 3U14A 3N7MA 1WD4A 4QQLA 2ARAA 2YHJA 4JRAA 1GNYA 1RUG2 2K2SA 2PHUA 4OULA 4WV8A 1TVGA 2YDEA 3AZZA 4AZZA 4BK4A 5GZGA 1UMHA 2QUOA 5G05L 1RGSA 1S0FA 1H30A 1TQ5A 3HNBM 2AH2A 1DGRA 1IQDC 3UL2A 2ZMLA 5LBEA 3E6DA 4OCTA 1EPZA 5GJ6A 2A7AA 3V65A 3VDBA 2FD8A 1BEV1 1STMA 3IDBB 4RL7A 3P6BA 1VBB1 4HPKB 1BVVA 1CVNA 1HJGA 1LEDA 2Q4SA 5ACA1 1JZ5A 2CU5A 5I91A 4GB33 4LPLA 3PUAA 2O14A 2DYCA 3HQXA 5FZ9A 4QGLA 3JD71 2QVSB 1DZTA 5F3IA 1QJX2 1VBE1 2EVXA 3KCCA 4OMDA 3VBRB 3NQHA 2FHRA 3KVBA 5FPZA 3LSDA 4NRPA 4B1LA 4XIOA 2XWJB 2ERFA 3N3HA 1I5ZA 5FR3A 2J1EA 3VDDB 3ATGA 1R1ZA 4E2QA 2H6CA 3H3ZA 1VLNA 3TNQA 2VZQA 3L9JT 3ZN4A 4R52A 1CN1A 2BBVA 1PM7A 1CAVA 2E51A 3HR9A 3UGHA 3ILFA 4L2NA 3VBFB 1Z7S1 1NX9A 2AENA 3LCPA 2XUEA 4AEKA 2RS31 3AMNA 2WO7A 3MFAA 2VCBA 1X36A 4FPLA 4LBQA 2QQIA 1PK6A 1S2BA 3EHKA 3H7JA 1SMVA 3QBQA 4AL9A 3S6PA 3AC0A 5L36A 2J42A 4CA9A 1BVP1 1AR83 3AP4A 5IFPA 3ZX7A 4X6QB 1JOBA 1ND3B 4ZHNA 3RRDA 5DUWA 1BXHA 1EUUA 4QGMA 1RHI1 1RINA 2YUEA 3WUCA 1X8MA 2R30A 2B46X 3WEZA 1SCRA 2ARXA 1Y9MA 1S0CA 1DYOA 1ZZ7A 2Y6GA 2DCKA 3D0JA 3PMSA 3SEPA 1AR61 4TLFA 2D40A 3U4SA 1W03A 2R041 4HONA 4PIZA 5C7GA 1PZ8A 1PMIA 1W9TA 4WVMA 4KU8A 4FOWA 4C1WA 5B2GB 3WSOA 2GMMA 1ENRA 1D2QA 1OOPC 4JGYB 3C7FA 2VGDA 3GALA 4GH4B 1LOAA 1YJLA 1RUE3 3D0SA 5D8AB 3V0AB 3K75B 2JJ6A 1UO9A 3CQOA 4TN7A 3I4IA 3P5BA 2VQUA 3NJXA 4FXGB 1US3A 3MHZA 2VQAA 3I3QA 1CESA 1Q8QA 1RUJ1 1UD1A 2ZZJA 1OA4A 2E33A 3IMMA 3ZLIA 1YFXA 1WCDJ 3JXSA 4IEOA 5F5IA 1QU0A 4FFHA 4Q8KA 4EV0A 1NE4A 2JENA 2WWUA 4QQ2A 3WQ7A 4P9GA 1Y4WA 4LMFA 4IE4A 1V6LA 4B1MA 1SBFA 1XPWA 1HXS1 2TUNA 2VMGA 1VBD3 1ODMA 4S2DA 4RGAA 5FYHA 4CDWB 1SLCA 2WN2A 1VRBA 4FI9A 2NMOA 4GB32 2W39A 3AJYA 3SKJE 3WR0A 1PK6C 3N9OA 3LPFA 5FZLA 4BE3A 3POBA 2WAAA 2PAMA 3WHUA 4CDUA 1LGCA 3KLSA 5KR7A 3PL0A 2Q5TA 3OTFA 5EIYB 2E6VA 1HIXA 1ULPA 1NA1A 2WYFA 3UK9A 2A6ZA 2ZHNA 3BCWA 3WG3A 2VE1A 2Y6LA 3HQUA 4CDQA 5ANQA 4YNIA 3KQ4B 1I6XA 3RYKA 2EXKA 3IPVA 5SV8A 5DABA 4D8MA 2HWE1 2VMFA 3KHBA 4QT6A 1HB4A 4BHPA 3VBHB 2V5YA 2X5IB 4IEYA 5JPMB 2PLV3 4AYUA 2DCJA 3HBZA 1LOFA 4BQWA 1KDKA 4Q1RA 2AEYA 4HVRA 3N9NA 5FBZA 4ASLA 1D4M3 1FXZA 1U0AA 4IV3B 2R32A 1YFYA 2B9VA 2R0FA 1OD3A 3ZDVA 3HIFA 1JYNA 4FPOB 2ZJCA 4ZPIA 4FTEA 4R9BA 3M3IA 1QF3A 1A34A 4HLTA 5LA2A 2WLQA 4LO5B 4QB6A 1W9YA 1EAH3 4DFSA 2IFRA 3VBUB 4XUOA 4M4RA 1HRI1 5FV3A 4YFWA 4AEMA 4CVUA 3LIHA 1X7NA 1AR71 1FNYA 1FNZA 2KM2A 2VMIA 3WF1A 3AP7A 3SLIA 4F8AA 1MS8A 5CFCC 1AX1A 4HPKA 4ATEA 4IXLA 5G04L 3THPA 2BBAA 2OUHA 5HV0A 3SH3A 5FZAA 1OXCA 3LA2A 3E6BA 4OHXA 3PUSA 2ZEXA 3UV9A 3T2QA 3VBRA 4CEYB 4CDUC 3DYPA 4NAOA 3O1TA 1AL23 1WGPA 1CX1A 5FP4A 1MEC3 1NQJA 2DVAA 5IYYA 3I7DA 3LF7A 4OFGA 1AXZA 5F39A 5CAZA 3VDDA 1HB2A 3CZJA 4MXWB 4BCUA 4NPMA 5A6ZA 1S0BA 5CBLA 4CDQC 1FI2A 4B29A 4NHLA 1H2KA 1OVPA 3PJQA 4Q4Y3 3PUQA 3TN93 2HH9A 2A71A 1PGW2 3NJZA 3NO8A 4JC1A 2WFPA 1MZEA 1VBD2 1UIJA 3POFA 2BJSA 2TNFA 4FOQA 2ZBJA 2Q8OA 1D0GA 3B93A 4EN9B 5AVAA 1UPSA 1JOPA 2D7FA 3VDAA 1FMD3 1V6JA 5DQ0A 1NOVA 2JDUA 3K4DA 2R073 2FQPA 5BNQA 5A6XA 1UY1A 1RUG1 2HJIA 3KHCA 2ZX3A 4A2UA 4Y3OA 2D44A 1ND3A 1IS3A 3O7OA 4Y4RA 2EF6A 3Q8FA 1LB2A 2WS92 3U75A 3GYDA 3A7QA 5FP3A 2JE9A 2WT2A 2RDNA 3KT4A 3GNEA 5LATA 3SH4A 4Q4W3 2Q8EA 1W9FA 1UXZA 3S5QA 2BRTA 1DZRA 1ULFA 2GC1A 3QACA 5ERLA 4Y1YA 1QJX1 3IIAA 1X33A 3VV1A 5B4NA 3OGGA 1WMXA 1GZCA 4GH4A 1APNA 5JMOA 2WUHA 2YB7A 2FZ1A 5T3NA 3CJXA 1D4M2 1TG7A 1XOYA 2WINB 3AP6A 2XB6C 3I8TA 1UY4A 4FPHA 3V0AA 5FYMA 2VOKA 2QQVA 3AYCA 2VD7A 4ZU4A 4ARYA 3O1RA 2CAUA 3VBRC 2QDRA 1W0OA 2O8OA 3IWZA 4NHXA 5FY4A 1JHJA 3ZYRA 4Q5OA 1EAH2 2IFWA 4NAMA 3M3OA 3TWIA 1X82A 3GZEA 2BEOA 3IAPA 4RR3C 3VDDC 4CRQA 1FPN3 4GWNA 1IPKA 4XFIA 5CFDA 4B7EA 1B09A 1I3HA 5FZ1A 4GQ7A 5FWJA 3KF5A 3IAQA 2BZDA 3VHRA 3VBFC 2QNKA 3I97A 1MS9A 1MZFA 1GNZA 2Y8KA 4CDWA 2FDJA 4I01A 1QOTA 5A3TA 1S0DA 5KXBA 1ZBE2 4NUBA 3D5OA 3ZSMA 1GANA 1GKBA 5I0DA 4LO8A 4Y22B 1ENQA 1NCQB 1OD5A 1QKQA 1MEC2 2PA7A 3ZXAC 1LESA 5FYSA 1ND3C 2XKPA 2UY8A 1GOFA 5FTTC 3O1OA 1W8OA 2R1BA 3UKNA 2PHXA 5JMCA 4N7IA 1CQ9A 1Z0HA 2ZEWA 5BXXA 1YHFA 4I09A 5K9YA 3USUB 1IG0A 4AGRA 1GUIA 3QH7A 3C7HA 1D0HA 1F35A 1PO12 4B4PA 3JCIA 4YW2A 3VBHA 3MF6A 2WSUA 3SQOA 5FPAA 1DLLA 4WM7B 2ZCWA 3WHTA 1FMD2 1OF4A 2JXAA 2VZUA 4IE0A 2R072 4E4HA 3O0XA 3OG2A 4IV3A 2J1UA 4XMAA 5F37A 2BP6A 3NAPC 4XXAA 1QH7A 1K3IA 1TE1B 5C4WB 1FV3A 2P34A 3MW3A 5C3SA 4K7JA 5CZKA 3VBUA 3ELNA 4AGVA 1PX4A 3DYOA 5IVJA 4AXOA 3CIHA 1SLTA 4Q4W2 4GB31 3WDWA 3WNLA 2HEYF 4BXSV 4AOCA 3KV6A 5CFDC 2W87A 1H1MA 2YY1A 2W91A 2PHWA 4MHUA 4S2FA 1UW8A 4P08A 3TOJA 3ZN5A 4AF9A 1KDMA 3BTYA 4H2AA 4Y5SA 4NIHA 5HI0A 2EALA 4OUSA 3ZFFC 3LDRA 4HVOA 3FHAA 5LZ6A 3J8F2 1H2MA 1XBFA 4Q0SA 3WP6A 3W9AA 1CR7A 3HNMA 4CEYA 3WW3A 2ZEZA 2KD7A 3ZXJA 5A1LA 4XTPA 4XQDA 5FZ4A 4FPJA 2W92A 1URXA 5JWPA 2OKXA 4S2GA 4QB2A 1POV1 4MXWA 3GCWA 5JR2A 3P1IA 2WABA 3I2KA 1WMDA 2XBO3 4Q29A 3JD73 1H9WA 1ALYA 1LEMA 1UZVA 3QOPA 4XJWA 1NE6A 4XQWA 3VBHC 1I5PA 1O7FA 1KFUL 1VP6A 4XIKA 2PAKA 1L7QA 1Q8PA 1V6NA 4XCBA 4I0WB 2C24A 2W52A 3V64A 2RJ2A 1F5JA 4FPFA 4IEZA 4QXHA 3ECQA 1Z7S3 3P3PA 3TRSB 4DZGA 1GSLA 1ZVFA 4GALA 3WCSA 2BFUS 2RS33 5IUQA 5DZFA 5A3NA 2Q1FA 3C7GA 4QPWA 3VBUC 5T5PA 1US2A 4QXKA 4J1WA 4UYBA 3AZYA 3T2TA 5A3OA 4PLNA 4P9LA 3DKQA 4LLFA 3THTA 3RZGA 3I3MA 3MW2A 1KGYA 1V6OA 1ZRFA 5FO9B 4O61A 3RFRA 2ZGKA 4X6RB 3ILRA 3VD7A 3RS6A 2L9LA 2CNAA 1RHI3 2F4PA 3LAGA 5FMBA 4CCDA 2DCYA 1UYZA 3LOIA 5DG2A 2WNOA 3OSDA 4C91A 1PGW1 3AYDA 2IXJA 2BVVA 2DCTA 1A78A 1VBD1 3EO6A 1MZ5A 5BNPC 2RE9A 1S0JA 4MX3A 4LUMA 3QCWA 1G9CA 3BPZA 4CSWA 2OVUA 2KA3A 5EP9A 3TB0A 2WBKA 2WZR3 4AFMA 1YQ2A 1W6NB 2WRAA 2YU1A 5FZDA 3WLUA 1RUJ3 4DY3A 4YM0A 4HANA 1LOBA 2WS91 2OS2A 2GNTA 2VZOA 5FZHA 4LLOA 1COV2 4WVWA 3AXDA 4M3CB 5KBFA 1W8UA 1GMMA 1ZZBA 4Y22A 1NCQA 4XFCA 1CAWB 2BOJA 1EPWA 3VGIA 1YFUA 4C8DA 2VBDA 1DYPA 1PNFA 3C7OA 1OPOA 2K0GA 5AFEA 5JSRA 4XPVA 1YCIA 3USUA 3WXPA 2BQPA 2XBO2 1SCSA 1DDLA 3N7KA 1L7RA 3E5QA 3H9AA 4YM2A 3BOWA 5LW9A 4M0HA 4WM7A 3VZMA 1C1LA 2VG9A 5FY5A 2FDKA 5KXDA 2WL1A 1W0NA 3WX5A 1W2UA 4NPRA 4JKKA 5EPAA 2MEV2 2XJVA 3J9SA 5JVVA 1G9BA 5IK7A 2A6YA 3CLPA 2ENRA 2HWE3 4N53B 5FPXA
chains in the Genus database with same CATH topology
4RQPA 4AVVA 2Y0IA 2G9FA 5JI7A 2EA7A 4O9GA 1DGRN 2IXIA 1LCLA 3AZXA 3U4XA 5JR7B 4XJUA 1ZBE1 1UPIA 2JDZA 4Q27A 4RS5C 5GALA 1W0PA 2B7YA 4IEXA 5FREA 3O12A 4JTOA 1MEC1 4N9HA 5GLVA 2DV9A 2AUYA 4OUMA 1DGWX 3WT3A 1OOPB 1HRI3 2XVGA 2ZGTA 3AFGA 1VBA2 1VAVA 1PVC2 1H1AA 3N35A 1PO11 3WUDA 4EWEA 2WFF3 4AVCA 3H1MA 3H1YA 5BV6A 4Y1VA 1FMD1 3W59A 3PLQA 2PAEA 2P37A 1V6IA 2R071 5FOBB 1Y43B 2E53A 1N1VA 2P2KA 1OKQA 5KXEA 4SBVA 5FOJB 1OA2A 2WZR2 5JZGA 1D4VB 3CO2A 4MYEA 3OBTA 3WW1A 1JW6A 1S2KA 2Q30A 3OD4A 2LUWA 2V09A 3PJYA 2ZPXA 3MFCA 1HDKA 5GZCA 2VW2A 1PK6B 5J48A 4Y24A 3GZUC 4Q4W1 3EQEA 3BU7A 2Q1ZB 2VVEA 1AX2A 4FVVA 1CPNA 2BGCA 1RUH3 2OYZA 4RQPC 1YXWA 3WOGA 3WDUA 2EIGA 3FWEA 1WA4A 4X8PA 2AREA 1UL9A 2XLGA 3J8F1 2PYTA 4Y1UA 3ZVXA 3L2HA 1RUG3 1HV1A 2E63A 5AC92 2D6OX 1QWRA 5CB7A 3MF9A 2QZ3A 1WCKA 1J3PA 3B7MA 2Z2SB 1F2NA 2GNDA 4BLIA 4Z07A 1NLSA 3PMEA 4N43B 2P3JA 2XJUA 5I8SA 2Z69A 2MPFA 4L8QA 4XEZA 5A3MA 1ZA4A 5ABJB 1CAUB 3MICA 3WD5A 2Q1MA 4LA3A 4COWA 4CP0A 3ZYPA 2DCZA 2V73A 4WZFA 4DB5A 2WJSA 5CNAA 3R05A 4XBNA 1UZZA 4L11A 4AQ2A 2PHRA 1BZWA 1TEIA 3O5SA 5JZGC 5CFCB 2VXRA 3VLBB 1RL3A 3ZXKA 5K8SA 4M3CA 5E89A 3RNSA 4EN8B 4KWLA 3AKTA 2VQ0A 4LBJA 4TWTA 5HCBA 4D7TA 1UX6A 1ONAA 2WFF2 2UYBA 3GBFA 4AVAA 5GKAC 4P9WA 3MIEA 4I02A 3ZXDA 2GMPA 3M1HA 1ZRCA 1NG0A 4FOVA 3AM2A 4Q0QA 4IEVA 3H3UA 2YXSA 2RM23 3MI8A 3IKWA 3O0VA 1DU3D 4N90A 3KQRA 5AFBA 3WVJA 1BK1A 2W0XA 3M3QA 3BB6A 4MUVA 4ZU5A 4YW3A 5FDBA 5JDBA 4P9YA 4F3JA 2R0HA 4XHBA 4XDQA 2HKXA 4OI1A 2C9AA 3M3CA 3TYJA 2ZS6B 1FV2A 4N53A 4ES8A 1R082 3S30A 4OHYA 1RUH2 3V0BB 3S7EA 3T1MA 4JCKA 2NYYA 2WNVB 2A5ZA 4OHZA 4HBNA 4QM8A 4IL7A 3PVEA 3WY6A 1BMV2 1SBDA 1COV1 1WUVA 1KFXL 3DGTA 4HVQA 2B9UA 3NV2A 4AWDA 4XFFA 3VZLA 1SLAA 1IQAA 4ASMB 1XU2A 1OOPA 1LODA 2WNEA 1RTVA 4NWWA 1JH5A 5E88A 4GXLA 3RMYA 1S0IA 1A6CA 2XBO1 4AFAA 4AFDA 3MLJA 5I0TA 3OPZA 4JVAA 4S2HA 1VAKA 3IMNA 3FLPA 2A3XA 2EXHA 4RR3B 1DQ2A 4FPEA 1U5ZA 2MEV1 1JHNA 4FQZA 1LHNA 2XUMA 4WVZA 1POV3 3FX3A 4R4XA 4FP2A 4YG6A 4M3CE 4BMBA 4FBFA 4HN0A 2ZGMA 2ZGNA 3H50A 5JI9A 2WT1A 3LWCA 3CF6E 3DPRB 1HQNA 1N3PA 1HKDA 2DURA 2XG3A 4N53C 1EV12 2DUPA 3B9CA 1AUYA 3RZZA 3VKNA 2ZX2A 4U2AA 2Y38A 3WDVA 4NN0A 2XGXA 4Q4X3 3B01A 1VBA1 1JUHA 2RM22 2ZGSA 1PVC1 1REDA 2FMDA 3H1WA 1LOGA 1JYCA 4LTAA 4MZUA 5T50A 3VBOA 1PO22 4XF4A 4R9AA 4N43A 2E9QA 3T1LA 5IK8A 3R4DB 4W6YA 5ABJA 1CAUA 4LUKA 4GMP0 1AXYA 1BBT2 1UCXA 3NAPB 1JBCA 1RUD2 1CONA 3MIGA 4K3UA 2GALA 4NR1A 2WZR1 2XJSA 4Q0UA 4QMAA 4KG8A 3QD6A 1NY72 5FAXA 5T5LA 1C28A 1LR5A 3AP5A 4YGCA 5H9PA 3SHRA 3UKVA 4FPGA 4YVWC 3AXEA 1WW5A 4AHYA 5CFDB 3INAA 4F83A 1ASJ3 3K51A 3B00A 2YROA 2Z79A 3CNAA 5CFCA 4KBBA 3WP4A 3MGUA 3VZJA 1N3OA 2ET1A 2YMZA 2ZGLA 3ZFFB 2OUJA 5KWRA 4P9IA 3V56A 1Q8OA 1W6QB 2EXJA 4N9IA 1WW4A 4HK8A 1A3KA 1SFYA 4HFSA 4YLZA 4E4ZA 3HN1A 1LU2A 4FCAA 2D3RA 2E7AA 2ZGPA 3AKQA 5AC91 4JDNA 2WS93 2OA2A 3FUQA 4PIXA 1ZREA 4W6XA 2D98A 4LO7A 5CA6A 2ZA9A 4D94A 5TSWA 3VBOC 4QM9A 5GLTA 5JOXA 3ZSEA 2XLAA 4N43C 1RUOA 3FLTA 3SNMA 5C8CC 1ZRDA 4PDWC 2G9GA 3IDCB 1F8VA 3V0BA 3A0NA 5J98B 1O3TA 5ABJC 2PQQA 1QJU2 5L73A 2WNVA 3WQ0A 1ENXA 2UWBA 2IZWA 3DKWA 4KG0A 3O0WA 1W39A 4XOGA 1J1TA 3FUOA 4Q4X2 3W58A 2H0VA 2BVBA 1C3HA 3GF6A 3EJKA 4R9CA 3HT1A 4ISQA 3ES1A 1M4WA 1VJ2A 2BWAA 1Z78A 2GNBA 1HX6A 1XNKA 3RWNA 2WFF1 2ZGQA 3WP3A 3MIHA 1G6NA 4NHMA 5F5QA 4CDXB 3C2UA 1REEA 1OMIA 2NQYA 2P3IA 4IESA 1ZBE3 2CY6A 2JD4A 4BQ1A 1QDOA 3LA3A 2DU0A 2DWRA 4PF5A 1AYN2 3KGLA 1W6OB 4RR3A 5BNPB 1DQ4A 1S55A 4C1XA 5CU1A 3KT7A 1XNCA 4LBMA 4V1PA 2AGSA 1ASJ2 4XJ8A 2A3YA 3PVOA 4JAAA 1IKQA 2D3SA 1DIWA 1R081 1PO13 1RUH1 2XJRA 4PQ9A 3IM0A 2SLIA 1IOAA 2DVFA 4ES9A 4YZ5A 2JG9C 3DPRA 4AEDA 5J09A 4AVBA 1OFNA 4AVTA 1J3QA 1HW5A 1AZDA 1BMV1 1S0GA 4YVSC 1IKPA 4YGEA 1SDWA 4J1XA 2WNVC 4N7UA 2GMEA 5FLHA 4NHKA 3EXUA 5C33A 5JOYA 2R1DA 2JKBA 3URFA 1VRH2 1VALA 2QE3A 2I2SA 2OIIA 4OLLA 4DINB 5KXCA 4AQSA 1KRIA 5EJ3A 3E5UA 1AXKA 2RJKA 2IXKA 2RJLA 4PCRA 4RD7A 3J8F3 4YFZA 3KCXA 3NAPA 2F6BA 3POWA 4E2GA 1YO8A 5DUUA 3ZMNA 2GNMA 4HK9A 2VU9A 1IPJA 5CIRA 2D43A 4JDMA 1REFA 4D3WA 4FT8A 1TMF3 1UU4A 4BPZA 4RS5B 2IXLA 1FYUA 1X8EA 2A6XA 2OZJA 1EV11 4UBGA 3ZFFA 3M4FA 2WA3A 4GA9A 1QOSA 1Y7BA 2VW0A 4JV4A 3CEWA 1MR5A 1RUF2 1W6QA 4K20A 4I3GA 4HN1A 4MGYE 3DPRC 4AEDC 4ORFA 1YJKA 3BODA 2ZMKA 3NKTA 4BA6A 3OD0A 1WMEA 2RM21 4R8HA 3WG4A 1JXNA 1U5IA 3OBRA 4JDOA 4MSVA 4JRLA 1VBC3 1ZRRA 3USSA 1Y3TA 1OSGA 1PO21 1RVF3 5KC5A 4JQRA 4I2OA 4AFBA 3H7YA 5FCCA 3ZSJA 1C8M2 5FO8B 4QPGA 1N3QA 1AVBA 1BBT1 4INDA 5CVRA 4COVA 1RUD1 2D6KA 4PJYA 2UWCA 1T6GC 4R9DA 4MXVA 1NY71 3AMPA 1YYNA 4GIQA 4IQPA 4META 3SH5A 4XILA 1WW7A 3WG2A 4AHWA 2VH9A 2WNUC 4RQPB 4E4SA 5T52A 1PGSA 3TBDA 5HCAA 2GN3A 4JGZC 1QJZA 1BQPA 2R49A 3U11A 1LECA 4YW1A 1VAMA 1SEFA 1SLBA 1XNBA 4KU7A 4O9EA 1H8TC 4BLJA 4CDXA 1IS4A 1J59A 3GZAA 4YW5A 1WLCA 3RYRA 2LTNA 4Z2WA 1OA3A 1COV3 1GICA 4M0NA 1ZBA2 1ZYBA 3ZSLA 1RITA 1Q8SA 4E9KA 1W6OA 5BNPA 1KS5A 1OQ1A 5BNOB 1PGL2 1AHSA 3AMQA 4AE2A 4XE9A 1UAIA 3NW4A 1TMF2 4QPYA 1GFF2 2HWD3 4B4QA 2YZ4A 2DTWA 4HZFA 1SBEA 1QJU1 3M7AA 4QPGC 5L19A 2IC1A 2RS53 5JZGB 3K48A 3VZNA 2JG8B 2WC2A 1OFSA 1CPMA 3HD8B 2XHKA 2MEV3 2VVDA 4Q4X1 4TZDA 1UU6A 1WMFA 4HKLA 2WZPP 1VBC2 1ZZ9A 1DQ1A 1RVF2 5FMOL 3I54A 1ULEA 1GZWB 2A6VA 4QQHA 2I74A 4TYSA 5JOZA 5BYNA 5JIAA 5T54A 3ZXEA 5C9AB 4G4FA 1UIKA 3OGJA 4L97A 4PLMA 4AFCA 1AYN1 2Y0OA 4CDXC 2QDNA 1H0BA 2BWCA 3WDXA 3PVBB 2HEWF 1V6MA 2W68A 1SACA 4LO6B 3DN7A 1VBA3 3MLKA 1ASJ1 3NV3A 1UF2C 1PVC3 4FTBA 3RQ0A 2DVDA 3H8UA 1V70A 4DY5A 5I93A 2A70A 4HKWA 3B9IA 4L9BA 3AYEA 1LHOA 1PNGA 2ETEA 2DVGA 1KJLA 3HAGA 1ENSA 1I9RA 3ZXGA 1H4GA 4XETA 1S1AA 2PELA 4RS5A 1JYIA 2YV8A 1JOJA 5JLVA 3NV4A 3JB4C 4E27A 3WG1A 4BZ4A 4LO4B 2JECA 5LEKA 4RFT0 1IHMA 1VRH1 2VUAA 3ZFEA 2OW4A 5DZEA 2MHFA 5LEJA 4RA0A 3B02A 1QQP3 2VNGA 1O4TA 4YARA 2BNMA 4YM3A 1D2SA 3B5LB 4IEPA 4WZCA 3GHNA 3VZKA 4UW5A 5FLIA 3WDTA 2QQPA 1IS6A 4OI4A 1CD3G 3M8LA 2HWD2 1C5HA 5KC6A 3LB9A 4Z1VA 3FJSA 4FPCA 4LULA 2RS52 2FBEA 4ISRA 2D5HA 4K1YA 3FFZA 1LTEA 4QQOA 5J7MA 5AC93 1PIV1 3TNPB 3VZOA 5K0UB 1NLRA 3N7LA 4A7ZA 4GKXA 3LA7A 5A32B 2HEVF 2YC0A 2HWC2 3ME2A 1YWKA 3FLRA 4P9JA 3NKGA 4ZXKA 3SCGA 1LENA 3FHIB 5C8WA 1MQTC 3DV8A 4CYDA 1WLDA 1X50A 1WW6A 1RUF1 3Q9OA 5K7PA 4Q8LA 5CG9A 1W6PB 1V6KA 2VY0A 2CAVA 3AB0A 4QD2A 3U0ZA 3JZVA 3OCPA 1ULGA 3DUIA 3E5XA 5H9SA 1RC6A 4AVSA 5J96B 1AL0G 4Y5Z0 3AX4A 1GV9A 4FAHA 4FTSA 2KXLA 3MPPG 4IV1C 3VL8A 2Z42A 3ES4A 1N1SA 4QPIC 2GC0A 4AQ6A 1VB2A 3ZFEC 1F9KA 1C8M1 3ZSKA 2I45A 2D3PA 4FQ4A 4ATFA 1CGPA 4Y26A 5BNOA 3ETQA 4UW3A 1JTZX 4BOWA 4NOTA 5J37A 4BIOA 4M00A 1DBNA 4YVWB 1MS0A 5DUXA 3D82A 3FBYA 2JG8A 1RMU3 3JBG3 2CWSA 4W65A 1K5MC 2RS13 4CP2A 1C5IA 3KM5A 3LOBA 1WBFA 1W6MB 1VR3A 1WCSA 1SFNA 3LSEA 1FOD3 4BIFA 5L7OC 1DHKB 1NYWA 1QQP2 1WD3A 4YSFA 1R083 4K9SA 4E2SA 1GZWA 5AVPA 4UBHA 2G4IA 3NWKA 5C9AA 3UJOA 4D69A 1ZBA1 4G3YC 2VVFA 4YG3A 2JICA 2LALA 3VHPA 2W08A 3VBOB 5EV7A 3ZFGC 4HT1T 4IETA 1DFQA 5F6LB 5C8CB 1PGL1 4L92A 3GHMA 4PDWB 1TMF1 4Q26A 2IXHA 4WM8C 4COUA 3OY8A 4KGGA 3ST7A 4OZXA 2AYHA 4Q1PA 4DS0A 5E16A 5BNOC 3VUOA 5JCTA 4LBLA 4FPYA 4RGGA 2ZTNA 2GU9A 4Y20B 4W6WA 5FMOS 1QXJA 1JUIA 4F7ZA 1GNHA 4Y4YA 5KHJA 1U5XA 3M2MA 4A7KA 5I0RA 1OLRA 2JG8C 1VBC1 4XF0A 5HBAA 2ZHMA 1RVF1 3MDPA 2UYAA 1J3RA 3WCRA 2JX9A 4KWJA 4XMIA 2CYFA 3ENRA 4K21A 3OYWB 1EV13 1QNYA 1UKGA 2D6LX 4XFAA 1CJPA 2WLPA 4U36A 3AK0A 3J4UH 2ZMNA 3GZTB 1MZ6A 4UW4A 2BPA2 4FOYA 3WQ1A 1HRV3 2VNRA 1XYOA 5C9AC 2H6BA 4AW7A 3VHOA 5LRRA 2JEMA 3FC0A 1RMU2 3JBG2 4DMIA 5K0UA 2RS12 5LRSA 5JOWA 1PO23 2JG9B 4XJ9A 3NV1A 5A32A 2VW1A 4YRDA 1FOD2 2PHFA 2H0BA 4MGKE 2HWF3 5E8AA 4YVSB 3RPQA 1QDCA 2HYKA 2PHTA 3ASIA 2FZ2A 1BBT3 1RUD3 4COZA 2VOXA 1RUC2 2BTVC 1I1EA 1XRUA 1R1A2 1W6PA 1C8NA 1H2LA 1ULCA 2X29A 1OHFA 4RHV2 2NLRA 4XQ4A 4XTMA 4HSLA 2DF7A 2A6WA 1ZZ8A 1LGNA </