4HSLA

2.00 angstrom x-ray crystal structure of substrate-bound e110a 3-hydroxyanthranilate-3,4-dioxygenase from cupriavidus metallidurans
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
174
structure length
174
Chain Sequence
MLTYGAPFNFPRWIDEHAHLLKPPVGNRQVWQDSDFIVTVVGGPNHRTDYHDDPLEEFFYQLRGNAYLNLWVDGRRERADLKEGDIFLLPPHVRHSPQRPEAGSACLVIARQRPAGMLDGFEWYCDACGHLVHRVEVQLKSIVTDLPPLFESFYASEDKRRCPHCGQVHPGRAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 3-hydroxyanthranilate 3,4-dioxygenase
publication title 2.00 angstrom x-ray crystal structure of substrate-bound E110A 3-hydroxyanthranilate-3,4-dioxygenase from Cupriavidus metallidurans
rcsb
source organism Cupriavidus metallidurans
total genus 39
structure length 174
sequence length 174
ec nomenclature ec 1.13.11.6: 3-hydroxyanthranilate 3,4-dioxygenase.
pdb deposition date 2012-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06052 3-HAO 3-hydroxyanthranilic acid dioxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4hslA01
2CAUA 3FWEA 4AVAA 2B9UA 1EP0A 4LUMA 4I0AA 1O3QA 1DZRA 2IXCA 3BB6A 3H8UA 4E2GA 1YUDA 4XF9A 2ET1A 1CAWB 4QM9A 4D7TA 4N9IA 4XFGA 4IEQA 2C0ZA 3RYRA 1ZZBA 2PTMA 1OFNA 4ZU7A 4JTNA 4GULA 2E9QA 5LRRA 4QMAA 1OMIA 2BNMA 1VR3A 1CAVA 4AVBA 1O3SA 4F7ZA 4XETA 3QACA 1NYWA 3ROUA 3SCFA 5I93A 1QXRA 3WW2A 1O3TA 2BGCA 1RGSA 1Y9QA 2B8MA 2IXHA 4EWDA 2OZJA 3SCHA 5KBFA 3FE5A 5KHJA 4XFIA 1UIKA 4J1XA 4LA3A 4XFBA 4N9HA 1NE4A 5J7MA 1ZRFA 3OF1A 2BEOA 1U12A 3I7DA 4I02A 4LEJA 2CV6A 5C6CA 1G6NA 5CADA 1QWRA 3E5QA 2GAUA 1SEFA 4XFCA 1J58A 3MZHA 2QNKA 2XLGA 1L3JA 1WA4A 4R52A 3HT1A 3H7YA 2UYBA 2QVSB 1Y3TA 2D5FA 5K8SA 4IEZA 4I01A 3LOIA 5CU1A 4AXOA 1CX4A 5FPZA 1NZCA 1ZX5A 3CJXA 3I59A 4LULA 5I0UA 3ZDSA 4META 5EZWA 2MNGA 4MUVA 2HJIA 1XE8A 3QOPA 4HSJA 3CO2A 4O9EA 4AQ2A 5FQ0A 3N4MA 1X82A 2UYAA 3LWCA 5BPXA 2XKPA 3G7DA 1UW8A 2PQQA 2QJVA 2PHLA 2QDRA 4JTOA 5C8WA 2PAEA 1YLLA 2Q30A 2PA7A 1Q5OA 4QX5A 3WW1A 1O5UA 2H6CA 2XL7A 2ZKLA 3H9AA 2IXJA 1RUOA 1O4TA 3USSA 4IETA 4UBHA 1CAVB 4XEZA 5BXXA 1ZZ8A 3EQEA 4HZFA 1X8MA 3B02A 4IEWA 3E6CC 2P17A 3KSCA 1DGRA 1JUHA 4I2OA 4IESA 4LA2A 3RDIA 1QXJA 3CL1A 2PAMA 1YFUA 4FAHA 2K0GA 1DGWA 2BNOA 5E1RA 4WZCA 4Z07A 3IIAA 2GC3A 2Q1ZB 3U0ZA 5I0RA 4MV2A 1J3RA 3H1WA 1XE7A 4KU7A 4L11A 3ST7A 3TNQA 4KWJA 3SXWA 4F8AA 1YFYA 1Q43A 1ZZCA 2VQAA 5JSRA 4MGYE 4XF4A 4XF1A 1NXMA 4YNIA 3HT2A 3I59B 1OD5A 1PMIA 1QY4A 4IEXA 2IC1A 4HVOA 4Q0UA 4AQ6A 1YWKA 3ELNA 2VPVA 1UPIA 3I54A 4HMZA 4ZU4A 1FI2A 3DL3A 5FQ0B 4D7SA 4P9GA 4BHPA 2PAKA 3OCPA 3M3IA 4Q0SA 5FPXA 5J48A 3PLQA 4XFHA 4IERA 1TQ5A 3H50A 2FQPA 4UXAA 4XFAA 2O8QA 3E6BA 3S7EA 4WVZA 1RUNA 2XHKA 3DV8A 1PM7A 4EV0A 2MPFA 5EFUA 4B29A 2ATFA 4YYOA 3GBFA 4EWEA 1EYBA 2F4PA 1LRHA 2CAVA 2FMYA 4YSFA 3ES1A 1IPKA 3MPBA 2IXKA 3KGLA 4ONUA 5LEKA 2WFPA 5I8SA 1WLTA 4XF0A 4BIFA 4LUKA 1CAXA 3PVBB 5KHIA 1VP6A 2B5HA 2Q4SA 3U11A 1FT9A 3DN7A 3ETQA 2UY9A 4ZU5A 3EHKA 3M70A 3CF6E 3GYDA 3D82A 3S7IA 1O5LA 4HN0A 3S0MA 4QXKA 4L2NA 1NE6A 1GQGA 3WW3A 5BY5A 2ZCWA 3LAGA 3O14A 2ET7A 1J59A 1YFWA 5I0TA 3H1YA 1GQHA 1J3QA 4KWKA 3IDBB 4HLTA 2UY8A 3E97A 4MH0E 4EWAA 4LLOA 2IXIA 1I5ZA 1UCXA 4PIXA 4R8HA 3IDCB 4I0BA 3NL1A 2EAAA 4HN1A 2GZWA 3FFQA 3FJSA 4MGZE 3KGZA 4IEPA 1CAUA 2BNNA 5LRSA 3NVCA 1O7FA 2D93A 4WBBA 4LTAA 2XL9A 3L2HA 4E2SA 1YFXA 4KWLA 2GU9A 5KHKA 3UKTA 1ZRDA 2QCSB 4UBGA 2HKXA 5E16A 4IEVA 5AVPA 4FT8A 2ETEA 3SHRA 1UD1A 4DINB 2Z2SB 1J1LA 3RPQA 5T3NA 1HW5A 5JSOA 4TLFA 1VJ2A 4MGIE 1ZZ6A 4AVCA 1H1IA 3BPZA 3MDPA 2WC2A 2GC1A 4OFGA 4QM8A 5JAXA 2OPKA 4Q0QA 2OA2A 3EO6A 2Y0OA 3D0JA 1FXZA 1SFNA 1I6XA 1CAXB 4XF3A 1ZREA 3NKTA 1Q3EA 3HIFA 4E2QA 3SCGA 3D0SA 5BUVA 3EBRA 5JR7B 4K8FA 5KHGA 4HBNA 5JSPA 3H7JA 3H3ZA 5I0SA 3ACLA 3FZ3A 3KMHA 3MYXA 4PJYA 4Z82A 1DZTA 3OGJA 3KCCA 2BYVE 3OTFA 2V09A 3EJKA 1H1MA 3WW4A 3FX3A 1YHFA 2OYZA 3CEWA 2D5HA 3U10A 4MZUA 3BALA 5I91A 4HVRA 2XGXA 3UKVA 1IPJA 2D40A 1CAUB 2EVXA 2XLAA 1ZZ9A 5FLJA 1V70A 3H1MA 3BU7A 4I3PA 2CGPA 5CVRA 3HQXA 5FLIA 4MX3A 3E6DA 4QGNA 1X7NA 3SMHA 4JV4A 3E5XA 4EROA 3RZZA 4H7LA 4BH9A 1RTVA 1X8EA 2GH2A 2GC2A 3FHIB 3H3UA 1OI6A 1CGPA 5I8YA 1RL3A 4KU8A 3E5UA 4KL1A 4PIZA 5F1RA 1CAWA 5KHHA 2DCTA 4A2UA 2PYTA 4FBFA 1EPZA 3RNSA 3CLPA 3R6SA 5FDBA 3NJZA 3BCWA 4NVPA 4O9GA 4XFFA 4Q0PA 5HI0A 4OLLA 1EY2A 3UKNA 2IXLA 3IBMA 4I09A 2H0VA 1SQ4A 1LB2A 1LR5A 3C3VA 5FLHA 5I8TA 5J3UA 1ZRRA 3TNPB 4CYDA 2XLFA 5D1IA 2Z69A 4FAGA 3LA7A 2PFWA 2I45A 3VHRA 1J3PA 2OZ6A 2KXLA 1UIJA 1O3RA 4HSLA 3PNAA 2XKOA 2EA7A 4QGLA 4Q0VA 3NW4A 4QGMA 2VECA 4Q29A 2K9ZA 4IEOA 1XRUA 3IWZA 4YRDA 3LZZA 1LKNA 2N7GA 4YARA 4X6RB 5FCCA 4ORFA 4IEYA 1ZVFA 4PIYA 5BV6A 3LA2A 3RYKA 1WGPA 2PHDA 4RD7A 1ZNPA 3DKWA 2O1QA 2GC0A 1ZRCA 2Q0AA 3OD0A 4X6QB 5LEJA 4HVQA 3RYPA 5JCTA 3JZVA 3NSTA 3LA3A 4IEUA 2H6BA 1ZZ7A 3ES4A 4J1WA 1RC6A 4JVAA 4MGKE 2MHFA 4BYYA
chains in the Genus database with same CATH superfamily
4LBQD 3W58A 5ACA3 5LWBA 1X36A 1TMF3 5FYYA 3V0BA 3WG4A 1RUJ2 3CQOA 2A1XA 3P6BA 1H2LA 5F5AA 1ND2C 1KFXL 4AI2A 1EP0A 1QJZA 5B4NA 3M3CA 2BRTA 5FPAA 1O3QA 1W3XA 1GZWA 2SLIA 3T2TA 2TEPA 2DU1A 3H8UA 1YUDA 4QPIA 4ES9A 1OOPB 5IAXA 4MGSA 3WNXA 3ZN4A 1NLSA 1XU1A 2RR11 4RS5C 4KMQA 2ZHNA 2J1VA 4IXLA 4QM9A 4XOGA 3VBRB 1PK6B 2W9XA 3VBSC 4XW3A 3F2ZA 4XAEA 2PMWB 2C0ZA 2FMDA 4XE9A 4DOUA 3M3OA 2JEMA 2ORZA 2JICA 3WP3A 5FPBA 5HXVA 3VD9A 4ZU7A 2J42A 5JZGA 3VHPA 2G19A 3CJIA 4GULA 4DY3A 4RFRB 4QMAA 2UURA 2UWAA 2WWJA 1ONAA 1WMXA 4C0BA 1GNYA 3OD4A 4BPZA 1VR3A 2WO1A 2JD4A 1OKOA 4OI0A 2D43A 3B5LB 2P3KA 3VZOA 3SCFA 3ROUA 5I93A 4LO4B 2ZAAA 1AL21 1ZBE2 1JHJA 3KB5A 5F5IA 1O59A 5FP3A 2RDRA 2RDSA 2R042 1Y9QA 3C7HA 3K3OA 4Y5Z0 5LW9A 5KXBA 4PLMA 1HX6A 1YQ5A 3ZXJA 4BB3A 2WNUC 3LEKA 3O0XA 2WRAA 4K8RB 3SCHA 4QX0A 1XU2A 4XURA 3S5QA 1QEXA 2UWBA 1NOVA 1GYKA 3GGLA 3BIEA 3EMRA 1GV9A 3O0VA 4XFIA 2XXZA 2Y6HA 4AL9A 1DDLA 1VBE3 2A6ZA 1RUF1 2P2KA 5DDJ1 3POSA 2VG9A 3OF1A 1VBA2 1U12A 3A4UA 2ZEZA 5GZCA 4N53C 4LEJA 3TEYA 4UT5A 4KBBA 1MZ6A 4N43C 2GAUA 1FYUA 3OEBA 5IWFA 3ZDVA 4A44A 2E53A 3Q8FA 3HQUA 2I07B 3VB9A 1UOBA 4GMP3 4HETA 2QNKA 4B8EA 2I2SA 4RHV1 2DVBA 2D6NA 1N1YA 1SBDA 4CU6A 3OPTA 4XDPA 1RVF1 5JR2A 5CG9A 4TN7A 4XUTA 3W9AA 4I0WB 2WN3A 4IEZA 1XNCA 5CU1A 3AYAA 5IVJA 5A7WB 4EN0A 1JS9A 3OGSA 4B1LA 1PGW2 1NZCA 3B7MA 3CJXA 1O4ZA 5I0UA 4TWTA 1CD3G 1RUD3 4JRLA 4HKWA 3ZDSA 2R0HA 5GJ6A 4EZHA 4YGEA 4UYBA 3HD8B 1AHSA 5BNPB 4Z1VA 1YQCA 2HJIA 3IMNA 1D2QA 3QOPA 3CO2A 4O9EA 3WNNA 5FQ0A 5EP9A 1RB8G 4NIGA 1NLQA 2VXJA 3FBYA 1HB4A 1MQTC 2J1AA 3TOJA 5BPXA 3G7DA 3UJQA 3BPSA 4NO4A 1UW8A 2QJVA 3PJYA 2ZACA 2PHLA 5JOWA 4JTOA 2QFEA 1KQRA 2PAEA 1A3KA 5IK7A 5CBLA 1GKBA 5BNOB 1FOD2 3SH4A 1GP6A 2JKXA 3SKJE 1SDDB 2ZX3A 4RR3A 1RUI3 4QX5A 1Y4WA 2ZABA 4UW4A 4COVA 3N9PA 2H6CA 2XL7A 4GZ9A 4HT1T 5F6LB 3MIEA 5B4XA 1D4M3 2HWC2 2VULA 2X5IA 2JG8B 1UZWA 3POYA 4FPGA 2EIEA 4IETA 1CAVB 3E1F1 1SMVA 4XEZA 3M3EA 1QDCA 1ZZ8A 1PMJX 1UY1A 4B4PA 2ZZJA 1X8MA 3PDQA 3E6CC 3KSCA 1DGRA 1LODA 3QCWA 1YQ8A 1WZXA 4GB33 4LA2A 1MEC1 1QXJA 1U5YA 4CDXB 4AFAA 1H6YA 1Q56A 4NMIA 2EAKA 4LKSA 3GJBA 2PAMA 4NHYA 3ZYBA 2MEV1 4LKDA 2P6CA 1F31A 2BNOA 1GANA 4NAOA 2JDAA 3ZXGA 1N1TA 1VBD1 3VDBA 1S0EA 2XJPA 2EXHA 4GA9A 4CA9A 4P14A 2QQUA 2Q1ZB 3U0ZA 4N8MA 1ACCA 2G4IA 2NM1A 1XB9A 4BQ2A 4XZPA 4MGTA 3CKHA 4NJ4A 1J3RA 2WA4A 4P08A 3IPVB 2RM23 3L2YA 2D6PA 4FFHA 2FCUA 4Q4X1 2HWF2 1EAH3 4XABA 2YG0A 1TVGA 5LY2A 1GWLA 3TNQA 3SXWA 2CGNA 1Z7S2 3RG0A 3OSDA 1Q43A 2QQWA 1WKYA 4A7ZA 4CDUA 4YFZA 3GZUC 2CL2A 2XJSA 1UF2C 5C8CC 2E6VA 3GZTB 5FYVA 5DAXA 5C9AC 5GLWA 2ZEYA 3D8CA 4DB5A 3WDYA 1NXMA 3PVOA 4Y1ZA 3IMMA 3ILNA 2BZDA 2P3JA 4YVSB 1SLCA 3TBDA 1OHFA 5AC91 5C3SA 2YGLA 4ZY9A 4TSVA 2VW0A 3ZSKA 2J7MA 3POJA 4B1MA 1LECA 5FK8A 3USUA 1FI2A 1WW7A 1VBB1 4BHPA 4BQXA 1QJY1 2QTWB 3DKQA 2YDEA 1W8HA 3PUIA 3PLQA 4WV8A 4XFHA 2O8OA 1TE1B 1VRH2 5KXDA 1G9FA 1ST8A 4WM7A 3BI3A 1VBC1 3V0AB 5EV7A 5C7GA 4JKLA 3H50A 3Q8EA 5FZ0A 4GH4C 4LO5B 3VBUC 1W8UA 2O8QA 3O1RA 1RUC3 3PU8A 4H55A 4YW6A 1GBGA 4WM8A 3S7EA 3N3HA 3OY8B 4UW6A 1SCRA 1Z0HA 3I3DA 5K0UA 5DMYA 3ZSJA 1ULFA 1K45A 1V6OA 3KT1A 1HB2A 4XAAA 2MPFA 1U5XA 5AVAA 3KM5A 4MVTA 2ARXA 4LBQA 1EYBA 3MUZ1 4XUQA 2F4PA 3TAYA 4AR2A 2FMYA 2VQ0A 4EN9B 4QT6A 3ENRA 5FRAA 4DXRA 1XYPA 3G6JB 1RJ8A 4L97A 1W6PB 1YC61 1LOBA 1LTEA 4ONUA 4QD2A 4AF9A 1AL22 5LEKA 1D4VB 2LTNA 4FFGA 4BIFA 5CISA 5KHIA 3AL5A 2B5HA 1VBE1 1GOGA 1M4WA 2YBKA 5CFCB 1UZYA 3WDVA 3DN7A 3ETQA 3PVNA 4ZU5A 4H7MA 3M70A 3CF6E 4YM0A 2VCMA 2WQZC 1R081 2JG9C 4LJHA 5F2SA 3N7LA 3T3YA 1YIFA 3THCA 3D82A 4K21A 1DGLA 1UWWA 2R0FA 4XUNA 4BQ5A 4CP2A 1LHWA 4QHOA 5HPOA 3AZWA 5C3OA 4Z92B 1HDKA 4IE4A 4NIDA 1C57A 4AEDB 1WCKA 5IATA 3O1UA 3OGVA 2ET7A 3WF1A 3ZFEB 5L9BA 5DABA 2OQ7A 1CONA 2VH9A 1JYNA 2ZZQA 3H1YA 4CE8A 1PO12 5IK8A 1WBLA 4KWKA 4JGYA 1NG0A 4PLOA 2UY8A 2YXSA 3P5BA 1S0IA 2LM3A 1UMIA 1P8JA 5DN2A 3LEIA 1RVF2 4MH0E 4EWAA 2QE3A 4LLOA 4RA0A 3ZX7A 4XUOA 4R8HA 5JIAA 4COUA 4PDWB 1WCDJ 4Q4V2 5ERLA 4HN1A 4IV1A 1Q8SA 4U2AA 3FJSA 4K40A 5K7PA 2F17A 1POV0 3KGZA 1DF0A 2VBDA 5FYIA 1CAUA 3ZFGA 1J1TA 4MXVA 5C33A 4IV3A 5LRSA 4MLOA 5T54A 4ZS2A 5M0TA 4AZZA 3JUUA 4IL7A 4NROA 5FUPA 2P5BA 4AFDA 4CCOA 4P9JA 1JZ7A 3L2HA 1XNAA 4CP9B 1CQ9A 3WR0A 3UGFA 4CDQC 2EIDA 5C70A 3VBHB 4AHXA 3H8OA 1ZRDA 2QCSB 4UBGA 2FD8A 4O7XA 1TME3 2HKXA 5E16A 2R49A 1JOBA 4UFLA 2CU5A 2PHUA 5AVPA 4CXWA 4XJ8A 2R073 2XQXA 2EICA 3UJOA 1UD1A 4DINB 2W52A 2Y38A 1OT5A 1UQXA 3VDCA 2P37A 1UYZA 4GQ7A 4OVEA 5A1LA 1LOFA 2YV8A 5FZEA 1QQP1 3KWVA 2AR6A 5CA6A 1PGL1 1ND2A 4GB31 5FO8B 4LBOA 5IVCA 1RHI1 4CEWB 4PCRA 1NCRC 1Y9GA 2GMMA 1US2A 5JAXA 4NPMA 2OPKA 1OLRA 4LBJA 1WCQA 2YB7A 4RS5A 4Q4W3 1NQDA 5H9PA 2GP3A 2DURA 2PELA 3VBSA 3BTAA 1MPXA 3I2HA 2EF6A 1CAXB 3RRDA 4CPBA 3EYPA 1V9U2 4CCKA 1ZREA 4JGZC 4MHRA 1W28A 4Y5TA 2YFZA 1ENQA 2HBUA 3UGHA 3HIFA 4UF0A 5D8AC 3SCGA 4AFCA 5A3PA 1S0BA 5BNNA 3KD4A 4WVMB 3VBFB 2RVAA 2NQYA 5BUVA 2HWE3 2VMEA 4Q5OA 4P9YA 5KR7A 4QQHA 2VZ3A 4JAAA 1LULA 2ID4A 1QOSA 5FYTA 3H7JA 4ET7A 3QLQA 4FQ4A 2AEYA 5I0SA 3VHNA 4CEYC 4S2DA 5FOJB 2WBKA 3MHZA 3JQWA 3LDKA 1LOGA 4RSUA 2W47A 3KMHA 4XHXA 1PX3A 3D6EA 3V56A 5LY1A 3TEZA 4RGGA 2WNUA 4DRVA 3LPGA 4Y1UA 2BYVE 2DBIA 3OTFA 4ZONA 5DXDA 4E4HA 2AZ5A 3TEWA 3WP6A 2CY6A 3K51A 3NNGA 4ASMB 1YHFA 1SACA 1UY2A 3DCQA 4FI9A 1IGOA 2D5HA 1V6KA 4GJYA 2VJXA 5A6ZA 5ACA2 1GFF2 1TMF2 1SFYA 1FPN2 2GDFA 4PQQA 4BMBA 5KXEA 3K48A 5DAQA 2ZHMA 2JDNA 3AVSA 5FJKA 5AFEA 1IPJA 2D40A 4N53A 2PHFA 3ME2A 3NJVA 2ZX0A 2XVGA 4KI5M 4LOTA 4Y20B 5IVEA 5IHRA 3UK9A 4JDMA 4XMIA 2ZEXA 1F2NA 1ZZ9A 4N43A 4W6XA 1DQ2A 3DPRC 1V70A 5E88A 1JYXA 2DVFA 2K46A 2JDMA 3I8TA 1SPPB 3IDAA 3PL0A 3WF2A 3K77A 2WNEA 2VNGA 3K2OA 4XIOA 4XILA 3MIDA 4K1YA 1AR93 4NRPA 2Q8OA 5A33B 5B2GB 5FYUA 3S6PA 1NQJA 4NWWA 5HV0A 2JD9A 1LGCA 4LKEA 2IVJA 3PUHA 1GNZA 4GMP0 4H7LA 1QH7A 1E57A 1BBT1 2BWAA 1R1ZA 3WVJA 1PZ7A 1RINA 4IE7A 3ZYRA 5C5UA 2ZGUA 1ODMA 1K5MB 1XNBA 2Q8CA 3JD71 3ZKYA 1UOFA 4CCJA 1RL3A 3WF4A 2JXAA 1AJOA 2Z42A 5EHDA 2DCTA 2EIBA 1ZBA1 4EN7B 4FBFA 5A3OA 1DQ1A 2RHPA 5FDBA 1XBFA 4NHLA 2JX9A 4UFMA 1MQTA 4XUPA 1N3PA 4XFFA 4WVWA 1YRZA 4YW5A 3C7EA 3GZAA 3PMSA 4NHMA 3RQ0A 5A6QA 1ASJ3 4CUAA 5DG1A 1LGNA 3RFRA 4I09A 1BZWA 4MHUA 2Z5WA 5EIYB 3C3VA 5FLHA 4P9XA 4PI2A 3WZ1A 1ZRRA 5FFOC 2Y64A 1BXHA 1VMHA 3D5OA 2Z69A 2V4VA 3LA7A 3B69A 4NWVA 5CB7A 2HLEA 1U0AA 5IK4A 1SLBA 5GM0A 4BQ3A 1O8PA 2EIGA 1LENA 1CZVA 1HRV2 5A70A 1VAKA 4DXZA 1UZVA 5DUWA 3NW4A 1VRBA 2A5ZA 1YYNA 4QQ2A 4AHYA 3DF0A 3LFIA 3ABZA 1APNA 3K4AA 2WFF3 1E5RA 1A8DA 1Q8QA 3IWZA 1I3HA 4YGDA 3W21A 2D44A 4BIOA 4BXFA 5L36A 1UU6A 4ORFA 2RJLA 1ODNA 1LGBA 4HKLA 1KITA 1L7RA 4IEYA 4DPNA 4I3GA 4OHYA 1WGPA 2FDGA 2PHDA 4S2FA 2R1BA 4L0PA 1ZNPA 1RUD2 3M3QA 4D0QA 1HV1A 1RXGA 4MADA 2D6MA 3OD0A 3VV1A 3THTA 4MO3M 1CX1A 5F2WA 5LEJA 4HVQA 3ZM8A 2RR13 1FMD1 4BISA 3PUSA 2HYXA 3JZVA 5FIXA 1G86A 4OI2A 4R4XA 4PBPA 3U4XA 2GH8A 1ZZ7A 2WNVB 5FMCA 4JVAA 1J84A 1H8TB 2ZEWA 3LIHA 4MGKE 1SLIA 4CTEA 1W99A 5CIRA 3VBOB 4AHWA 2RS51 3AKPA 1W6OB 4AVAA 1LHNA 4XQWA 5HV4A 2R071 5C8CA 5JXIA 1RUI2 1GU3A 2B9UA 5C9AA 4LUMA 1MVQA 4I0AA 4DUXA 3BB6A 4YM1A 2VAUA 5ISLA 2XG3A 1D4M2 4FPCA 1REFA 5J36A 3AYCA 5JLVA 3SH5A 1H2MA 2G9ZA 4CCEA 2PLV1 3WQ1A 3N9LA 2OUJA 2B46X 4D7TA 2W68A 4XFGA 2PQSA 1QJU1 3GHMA 1PGL2 4RN5A 3N7MA 2GALA 3AZYA 4R9CA 2CSGA 5LBBA 2HYKA 2BERA 5A3TA 1B35C 1GICA 2W91A 2WNOA 5GZEA 1T2XA 3PUQA 1LU2A 3B93A 1H2NA 1RUF3 3GZEA 3I2GA 4GH4A 5DDJ3 3VBUA 2BNMA 1UOGA 1O3SA 1PIV1 5HCHA 3QACA 1NYWA 2KM2A 5IFPA 3K4ZA 1JOPA 3LOBA 1AF9A 3A0NA 5DUUA 2HWE1 5JWPA 2BGCA 2VMGA 3VDDB 3IAQA 4K9SA 2BWCA 2IXHA 2XWBB 4RHV3 3FLTA 3DECA 5D21A 4HKOA 3J4UH 1JZ8A 4LIVA 3VD4A 5CZKA 4EWDA 2RM22 3J7HA 1PO21 1F9KA 2GNTA 4XXAA 3ZR5A 4EZ4A 1UU4A 4K7JA 3APBA 4KQ7A 1EAH2 3JBG1 4JC1A 2Z79A 3UT0A 1GWMA 3AJYA 1UIKA 1WD3A 1RITA 2QQJA 2VTFA 3ETPA 4LA3A 3Q9OA 4RQPB 4XFBA 5H9QA 3BTYA 1XOYA 1REDA 4A7KA 5FXWA 4I02A 5L9RA 3ZFFC 1GWKA 2CV6A 2P3IA 3OUJA 4U36A 4YPJA 1QWRA 1JU3A 3POFA 1SEFA 4QXCA 1XQNA 2RS31 4XFCA 3ZLIA 4OCTA 3MZHA 2BJSA 2JG9A 2QDNA 4ARXA 1L3JA 5FBJA 1SDWA 2BVBA 2WUHA 3HT1A 3V65A 1PGSA 2RS11 2R32A 1MVEA 2UYBA 5IUQA 1Y3TA 4AGGA 1CZTA 5FZHA 4I01A 1D2SA 1VE0A 2C9AA 3LF7A 1TG7A 1UPSA 4O65A 1HRI3 4CSWA 3I59A 4LULA 1AYM1 1NZIA 2VW1A 1RUE1 1RUC2 3V0BB 1C5HA 1V00A 2XUMA 5IVBA 4AQ2A 1UMZA 2DBNA 2NYYA 3B9CA 1X82A 3ZIXA 5IVFA 1JMUB 1NT0A 1GZWB 4LLFA 4QPIB 2XKPA 2VVFA 5DAVA 4GJZA 3WT3A 5F37A 2PQQA 4F83A 1JH5A 4YVSC 1MEC3 1TEIA 4M01A 3PMEA 5L7OC 3NV4A 2DDUA 3FC0A 4A3XA 1Q5OA 5APAA 4NUBA 1RUH1 1VBD3 4XQDA 1UO9A 5JZGB 2YHJA 3M1HA 3CJIB 4V2WA 2IXJA 1W6NA 2RJKA 5A3MA 4CDQA 4FPYA 4K1ZA 3VD5A 2AREA 2TNFA 1QJEA 3JB4C 5FZBA 3VZLA 1CN1A 2AYHA 3ZSLA 4D6RA 4UBHA 4BLJA 4AAXA 3ZSMA 2R063 2C5DA 3HNBM 3J7LA 5LZ6A 4Q4X3 1KJRA 2P17A 5CKNA 3LQCA 4IESA 4CCCA 5A32A 1C8NA 2LRPA 2JWPA 2RMU1 2E7TA 2VZRA 4LR4A 4OQ9A 2Q1MA 4ATEA 2A7AA 3ACHA 2K0GA 2YC4A 1DGWA 2VNVA 4YW1A 1U5ZA 4OMDA 3NV3A 3AFKA 3IIAA 1NCRA 2J1RA 2WFF1 4NIAA 2BW8A 1OBNA 3ZMNA 2ES3A 5C4WC 2Y34A 1DGWX 5AC93 2WAAA 4INDA 3KVBA 4Y1VA 3DUIA 3NNFA 3W5MA 3ZXLA 1C1FA 4JGZA 2VUAA 4A4AA 4XTPA 1VBB3 2DFBA 2WZ8A 2AACA 2XVLA 4KWJA 1ENRA 4FPOB 5LBCA 1QJY3 4C91A 3MI8A 4M4PA 5D8AA 5DG2A 4DXTA 4F8AA 5LB6A 3CDZB 4FTSA 1VBC3 3FFZA 3M4FA 3U37A 3EXUA 3NKGA 2XH6A 4Y1YA 2WZEA 4FPEA 1F5JA 3FHQA 1RJ7A 2D6LX 4YNIA 3HT2A 1FX5A 4P5YA 4YGBA 3NAPB 4CEYA 4IEXA 3MF9A 5FREA 4HVOA 4QB1A 4W6YA 5FYBA 2D3SA 3RWKX 1TME2 2VZQA 3NO8A 4HMZA 3I54A 5JOXA 5FQ0B 2R072 2DV9A 1W8ZA 1H1AA 2R30A 3SH3A 3OCPA 3ZO0B 4YW3A 1WWYA 5FPXA 3MPPG 3IIIA 3OBZA 4IERA 3I3BA 4C90A 5FMBA 1I9RA 2FQPA 4UXAA 4ASLA 2W95A 3IB3A 1N3OA 4COWA 1RUNA 4J25A 3O1MA 2XHKA 4YG6A 4CUGA 3D4KA 4RR3B 5G04L 5JI7A 3DPRA 4EV0A 3I3MA 3R4UA 4XCBA 3ZXKA 3RZJA 3IKWA 3ACGA 1W06A 4M3CF 4FPLA 4Q4W2 2ATFA 1R083 2X5IB 1HQLA 1QNWA 5FMOS 4HL0A 3SEEA 3I2JA 4EWEA 2VZOA 3BODA 1DQ5A 2CAVA 2W1QA 4YSFA 4N7IA 3ES1A 4XDOA 3WHTA 4AK3A 2WWSA 2CTVA 1IPKA 4K20A 4GWNA 1IKQA 3KGLA 4QXHA 1DYOA 4YVWC 1PHMA 1UZ0A 3I2KA 1DYPA 1SG3A 5FYSA 4AGRA 4CP1A 1ULGA 3N9QA 4XF0A 4FTEA 3PVBB 1R091 1VP6A 1WCSA 1PMHX 2H0BA 3T0DA 3WDXA 2A6VA 5G05L 2UY9A 3HMYA 3MUY1 4PLNA 4COZA 1DFQA 1HQNA 4CEWC 3GYDA 3U07A 4Q4Y3 1BVP1 1S2BA 3U14A 4URAA 5HBAA 2W0XA 4HN0A 4WZFA 1S0DA 1GSLA 2W46A 3S0MA 1NE6A 1OD3A 3V64A 1JZ5A 1AL0G 3LAGA 3O14A 5FZ7A 4QX7A 3SQOA 1J59A 3L9JT 1YFWA 3AC0A 1PZ9A 3OB8A 2JDYA 3FN9A 3IDBB 1DHKB 2OT7A 2WT1A 2BBVA 3BN6A 1G9DA 3ATGA 4HLTA 1CESA 4CDUB 1AX0A 4LHLA 1MS0A 3E97A 5GZDA 3R0RA 4YG0A 4MXWA 5E89A 1NCQC 5EPAA 1HRI1 5T55A 3RGBA 4EN6B 1W2OA 1HN0A 2IXIA 2BP6A 1I5ZA 1UCXA 3J8F2 4I0BA 2WAOA 1LHOA 1OPMA 2FCVA 4H3WA 3NL1A 1AR92 2Q1FA 4MGZE 1ZYBA 3WP4A 1AR73 3USUB 1W8WA 2WSVA 1R1A3 3C7OA 1DG6A 1QQP3 1QH6A 4XJAA 2D93A 4XACA 3ECQA 1LOEA 1RHI3 4DEVA 2YFUA 4F3JA 4WM7B 1YFXA 3IDEA 4KG0A 4SLIA 2RJ2A 4B7EA 5CEHA 4DO0A 3AXDA 5JOYA 3UKTA 2YZ4A 5KHKA 3DXUA 3OGGA 4WM8B 4Q8KA 4BXSV 2XJTA 1COV1 1AR62 3LCPA 5TSWA 3A7QA 4QXBA 5K0UB 4M00A 4AI8A 3WF0A 3SLIA 4LO6B 4D7YA 5BYNA 1V6IA 1ASJ2 2WIIB 2Y6FA 3RPQA 1G7YA 2R061 4LBQB 2VUCA 2VU9A 2NMNA 2E33A 2L9LA 4CCNA 1VJ2A 2W92A 4MGIE 4BJ0A 4E27A 4P9LA 5C3RA 2ZGMA 4HK8A 1UN1A 2GC1A 4QM8A 4JKKA 4LBNA 1KS5A 4ZKTB 4QQOA 4FFFA 1MS3A 4ZPIA 5T5OA 2A6YA 5FZDA 4AQSA 3D0JA 1FXZA 2VE1A 4HXCA 1PNFA 4CU9A 2GNDA 4Q27A 4Z2WA 1DZQA 4HPKA 3URFA 2JDZA 1MS9A 4IW3A 4MG2A 2YU1A 1XYNA 1B35A 4DRRA 3A22A 3OPZA 2QQLA 1QJFA 2WABA 2VR4A 3MICA 4XZUG 4LIUA 3OGRA 4M0HA 4B4RA 1TNFA 2FBEA 4JDOA 2UWCA 4GXLA 3ZXEA 5JSPA 3BIWE 2ZAHA 1HXS3 3TN93 1C4RA 1UXZA 1VAMA 2ZMKA 3NV2A 2X29A 3T1LA 4JGYB 3GJAA 2VQUA 2RR12 4Z82A 3AFGA 1OC1A 3ON7A 1OQ1A 4QU2A 4Z2AA 1LU1A 4P9WA 3EJKA 1H1MA 3WW4A 1UAIA 3FX3A 4NHKA 1C3HA 3SNMA 1BMV1 4EYUA 4Z8BA 1BBT3 3ZFFA 1Y43B 3I2FA 1G9CA 2CNAA 4IV1B 3JD73 4E8DA 1URXA 3INAA 4AI0A 3ZFGB 2DU0A 2HWD1 1CAUB 2EVXA 4XJWA 1AR81 5FXVA 1ZBA3 1UU5A 1CJPA 4IV3B 1SLTA 2F4LA 5A3WA 3BU7A 5LASA 4MSVA 2A73B 2DCKA 3WX5A 4W8JA 3AP4A 2JKBA 3KF3A 1QOTA 4MX3A 3PUAA 4B3NA 3LKJA 1CVNA 3AKTA 2OS2A 4PT6A 3NMBA 3M8LA 1JYTA 3MW3A 2FDJA 3AKQA 3E5XA 5CFDC 5GLZA 3PTYA 3NJYA 3MFCA 2JJ6A 3NNJA 2QQMA 1RTVA 3S30A 4QPGC 1H8TC 5I8YA 1RUF2 1A8MA 1IQAA 4PIZA 1RUG1 4KL1A 5DDJ2 5F1RA 1CAWA 2BPA2 1BEV3 5KHHA 4AEMA 2PYTA 2VOTA 3MFAA 4CZSA 2E51A 1EPZA 1OSGA 4JZRA 3R6SA 3CBNA 1N47A 3NRUA 4NVPA 3HWJA 4CUCA 5JPMB 2D6OX 3M7AA 4RHV2 1S0FA 1BHGA 3KT7A 5T52A 4RS5B 4CDWC 1JUIA 5HI0A 4OLLA 3C8XA 4OYUA 4QKNA 1C5IA 3I4IA 2O0OA 3VBSB 3UKNA 1H4GA 5L7OA 2IXLA 3IBMA 4X8NA 4XCAA 1H4HA 2ZGLA 3ACIA 2H0VA 2AH2A 4Q4Y1 1F4HA 1SQ4A 5FP8A 1LR5A 1S2EA 3FLPA 1AUYA 5IK5A 1W6QA 2G9FA 4E4DX 5I8TA 1LHVA 2V5DA 4GWMA 1QKQA 3LE0A 4KG8A 5A7SA 1RMU1 4DMIA 3O12A 4UF0B 1YJLA 2XONA 3TNPB 2XLFA 2GP5A 5BNNB 5C71A 2XHNA 5D1IA 2J1EA 4FAGA 1GZ9A 1ND3C 2I45A 2PFWA 1HB3A 2ZKNA 2JDPA 2KR2A 2KXLA 1FMD3 5JXJA 3O1OA 1O3RA 4HSLA 1EPWA 1S2KA 1IQDC 2V4AA 2XKOA 1MS5A 2EA7A 3JQXA 4QGLA 5FZGA 4CUBA 4ISQA 5JMCA 2X8KA 4LKFA 5F5CA 2JB8A 2ZX4A 4KBZA 2VOXA 4YRDA 2WNUB 1GP5A 4OHXA 4YARA 3RZLA 2RS53 2DTWA 4PF5A 4LE4A 2HEVF 5DUXA 1W6MA 1UKRA 2W1UA 2WZPP 5C3PA 1ULPA 4Y22A 3VUOA 1V0AA 4GWIA 1W2NA 3DKWA 1AR71 3UNPA 1ZRCA 3HN1A 1R1A1 3POWA 3R4DB 4GAZA 4N7UA 4RQPC 2DTYA 4X6QB 5C4WA 4AWDA 3ZOIA 4IE5A 4N53B 4A6SA 5FZ6A 1VAVA 1OKQA 2PLV3 2ZMLA 5IYYA 2VMIA 2Z4FA 4N43B 1ULDA 2H6BA 2NMOA 4LHSA 1QJU3 3VL9A 2W94A 1KJLA 4J1WA 1KRIA 3UYJA 3VZMA 2KD7A 3FBMA 1W9TA 3K75B 3KCXA 4LK7A 1CR7A 4BYYA 2CAUA 2IWGB 5FZOA 3FWEA 1MEC2 4D94A 3BKZA 1V6NA 1AYN1 4CXXA 2R043 2YGMA 2MEV2 1OUXA 4XJ9A 2V5YA 3TB0A 2HWB1 1OA3A 1H0BA 1VBD2 3K46A 1XE0A 1PIV3 3P1IA 1DZRA 1MACA 2WO3A 2W1SA 4XTMA 1FV2A 4XF9A 2JB4A 3PVEA 3HOBA 4UFKA 2ET1A 1Q8VA 1YQ6A 3HBZA 1V6MA 5F5QA 2J1UA 4N9IA 1UMHA 2O14A 4IEQA 5F6KA 3WUCA 1PO23 1VBA3 1ZZBA 2BOJA 2C26A 2VMFA 1RYYA 4Q4X2 5FWEA 3BTZA 1MQTB 3JBG3 2DFCA 1OFNA 3P3NA 5ABJC 1K5JA 3AMQA 3R4SA 4RYDA 4DEQA 4D3WA 1X33A 3BUCA 1OMIA 4LPLA 4LHKA 4CP0A 3RMXA 1NA1C 1UKGA 1ULOA 2FCTA 3AKRA 4XETA 1O6UA 4F7ZA 1DYKA 4FPJA 5FZ9A 3LIGA 4FOVA 4JDNA 3FUOA 2AENA 2WS93 2RS33 2VMHA 4M3CE 5AC92 3WD5A 3AB0A 2B8MA 1OH3A 5A6YA 4PQ9A 1C28A 1HXS1 1OF3A 4CP9A 1XNDA 3TN91 1PVC1 2XQRA 3JU9A 1JXNA 3WDUA 5KBFA 2DUOA 2RS13 1VBB2 4KGGA 3RZKA 2CWMA 4M3CA 5JPNB 3WHUA 3GCXA 3WCSA 1QJY2 1V6LA 2HBTA 4N9HA 2J22A 2RV9A 3VL8A 3ORJA 3I2IA 1VBC2 4YVWA 1AYM3 5J7MA 5LBEA 2BEOA 1ZRFA 3ASIA 3T0AA 3KS7A 5A3LA 1LHUA 4OUEA 4MOAA 1RUE3 5HCBA 5C6CA 1G6NA 4QAWA 5CADA 5A7PA 3RWNA 3KQRA 1H9PA 5FZ3A 1J58A 1YJKA 3LFMA 4BE3A 1BMV2 5FZ8A 2XLGA 5FP9A 3GDBA 1BKZA 1QMJA 3GHNA 4XIKA 3H8RA 3TYJA 1S55A 1WA4A 3H7YA 4XJUA 1SHWB 4QQLA 5K8SA 5FP4A 3OYWA 2CDOA 4AXOA 1AXZA 5FPZA 1H30A 1QIQA 4QWNA 1KS4A 4ZXEA 3JCIA 3ILFA 1OOPC 1RUH3 3O1SA 3U75A 4META 3J7NA 3I3EA 1NY71 3VBRC 1C8M1 3NQHA 1PK6C 3DYOA 4E8CA 2MNGA 5FY4A 2ZGKA 1NCQA 2WZR1 4MUVA 4S2HA 4C0HA 5C8CB 1GZTA 3ZPOA 1STMA 1VBE2 5C9AB 3N4MA 2FDIA 2QUOA 4XHBA 3ZYIB 5FZAA 1BEV1 3DYPA 1J83A 1R082 1QJX1 5FYZA 4OUMA 1DIWA 3NAPC 1KDMA 3T4HB 5CNAA 2FDFA 4FSJA 5C8WA 4PI0A 4QX8A 1W39A 2RMU3 2VTXA 1YLLA 2Q30A 4L8QA 2YBPA 4OHWA 3ZN5A 4BWOA 1FNYA 3AP7A 1YI9A 4S2GA 1ZRIA 2ARCA 2XR4A 1O5UA 2ZOEB 3WW1A 4BQWA 2DUPA 2ZKLA 4GWJA 2FZ2A 2PHXA 4BMEA 2F6BA 2P6HA 2WQ4A 4GH4B 2EXJA 3VBUB 4FO9A 2IZWA 3VZKA 1EV13 5KXCA 3EB7A 1GLHA 1MS8A 4BA6A 1W90A 1POQA 3EQEA 3N9NA 4HZFA 2WYSA 3B94A 2ADEA 3B02A 1HIXA 4IEWA 5JXGA 3S5AA 1YEWA 1JUHA 2YY1A 3ZYHA 1GOHA 2GMPA 2ZGQA 3RDIA 5C5TA 2OPWA 3I49A 3CL1A 2WO2A 3CIHA 3MLLA 1RUJ1 4YW7A 3HEIA 1YFUA 4FAHA 3BVCA 4LORA 5LCWL 4WZCA 4ZZ8A 2ZGPA 4NRMA 1GP4A 1O4YA 1X9TA 1N1VA 2BOIA 4AW7A 2BVVA 1FNZA 2GC3A 1QF3A 3GCWA 4HANA 4QX2A 1IHMA 5I0RA 4LMFA 4MV2A 5FXXA 2VNOA 1ENSA 2Y33A 1ENXA 4Q26A 4XVHA 3WNLA 1W8NA 2FHRA 1LEDA 3LDRA 4GKXA 1H2KA 1UX7A 4L11A 2JIJA 2R1DA 2LS6A 2PN5A 3N7JA 5IFTA 3ST7A 3WQ0A 5A1AA 4BU2A 2JG9B 2VZVA 1KDKA 3NJXA 3UL2A 5FZLA 2ZGNA 4URTA 4IGQA 4AFMA 2BUKA 1JBCA 2ZGRA 4FOWA 1ZZCA 5IT6A 3B01A 4FP2A 3ZXAC 4NIHA 4QX3A 5F3EA 3RMYA 5BNPC 1QQP2 5JSRA 2HEYF 2W39A 4XF4A 4GB32 4Y24A 1GR3A 3FMGA 4XF1A 1ULCA 1RHI2 3AYDA 5A7QA 1ZBE1 2A75A 3I59B 1OD5A 1PMIA 2D3RA 3PIGA 2LUWA 2R041 1QY4A 2A3WA 5FZ4A 4DUWA 1AX1A 3T2OA 2VM9A 2WA3A 4N90A 4Q0UA 5DPNA 3WUDA 3SKVA 4FXKB 5J96B 2VXRA 1YWKA 2VPVA 4A41A 4ZU4A 4CDUC 3DL3A 3VKNA 4HFSA 5IJRA 5BNOC 2W3JA 4IDZA 2PAKA 3CZJA 3X29B 2ADDA 1XSQA 4Q0SA 5J48A 2VUJA 5FP7A 5AFBA 1JOJA 1TQ5A 1VBA1 2JG8C 4NN0A 3WCRA 1D0GA 3KCYA 5JMOA 4TLGA 3N9OA 4G9SB 4XFAA 4E4SA 4ZZ5A 4ZHNA 3DXTA 3ZPYA 3DV8A 1OUSA 1R093 3OBRA 4XXPA 3KHCA 4LK6A 1GZCA 5EFUA 1W6NB 4YYOA 4CDQB 5FZCA 4CDXC 2QQIA 2XUEA 2W5FA 5FO9B 4KWUA 5FY8A 4YLZA 5CFDA 1LRHA 3MIBA 2WS91 4NR1A 2JE9A 1W3VA 2D6KA 1EUTA 3VD3A 3GM8A 2OUHA 4IGOA 2XVKA 3MPBA 1LOAA 4QPGA 1FV3A 3SC7X 5A32B 2X10A 1W8OA 3IAPA 2WFPA 3ZXFA 1Y9MA 3MV11 1L7QA 4R4ZA 5FKBA 3VD7A 3T08A 2PHTA 1CIWA 2JDHA 2VVDA 4LUKA 3ZIWA 1NCRB 2ZA9A 3C2UA 1AX2A 1BJQA 5EYXA 5F3GA 1S1AA 3Q8AA 4WVVA 3BU0A 2QQVA 4CDWA 3S7IA 1WLWA 1W0PA 3HNYM 5FY7A 3A21A 1LNSA 5A1FA 4ITCA 4FOYA 5HXMA 2Y6JA 1UZZA 3NNLA 1Q8OA 2AC1A 4FVVA 4Y4YA 1FOD1 1WW5A 3WW3A 3U78A 5IW0A 4JGZB 1BBT2 1TNRA 2BFUL 2NZ9A 4CCDA 3WXPA 3I2OA 4JCKA 1NUKA 4MGQA 1GQHA 1J3QA 3JD72 5D8AB 5KWRA 2HWC1 5GZGA 1QOOA 1IS3A 1IS5A 1ND3A 1ZBA2 3MEPA 5CKMA 5FYMA 3WNPA 2Y6KA 1SCSA 1IZ3A 4PIXA 4EQVA 3IDCB 3ZYPA 1COV3 4CEYB 3O1TA 2WLPA 3HR9A 3UGGA 4DFSA 1O91A 4UOJA 2B42B 1H8VA 4BQYA 4W65A 4NRQA 4V2VA 1IOAA 3KT4A 2VO5A 1YCIA 4B7KA 1PX4A 5LA0A 1DGRN 3NVCA 1O7FA 2EXKA 2ZGTA 5GALA 4YG3A 4LTAA 4AVVA 4H14A 3WNMA 5SV8A 4E2SA 1BEV2 1MS4A 4M0NA 4NAMA 3CMGA 1NLRA 4IV1C 3ZR6A 2GN3A 5LA1A 2IUWA 3HAGA 4COYA 1WUVA 2VCCA 3DPRB 4FT8A 4A6OA 3WNKA 3SHRA 4NHXA 2ZS6B 3CHXA 1EV11 1CIYA 1Z7S1 2JE7A 5EYYA 1OVSA 4HONA 5EWSA 1S0CA 2VMCA 1HW5A 1JTZX 2P34A 5EJZB 3RJRA 3MLJA 4YGCA 1K3IA 5JSOA 2VQTA 1OPOA 1OA4A 1ZZ6A 5CFCC 3BPZA 2WKKA 3MDPA 2G9GA 2WC2A 2VBPA 2IFRA 5KC6A 3LEGA 4YZ1A 4Q0QA 2LALA 2OA2A 1PVXA 3EO6A 4FFIA 3RVHA 2CWSA 2DWRA 3AXEA 5GKAC 2ZGSA 1A34A 4C1XA 3POEA 1FMD2 1FPN3 4AEDC 1UYYA 3PTRB 1LOFC 1JZ6A 4OZOA 4QB2A 1VPHA 3ZFEC 1Q3EA 3ZN6A 3PU3A 4DS0A 1VRH1 1W2TA 5ABJA 2ZJCA 5IAVA 1EUUA 2QZ3A 1AXYA 2ZX2A 2LW8A 2RS52 2I74A 3CNAA 3D0SA 3T1MA 4TTGA 3EBRA 1ALYA 3FHAA 2OVUA 2QKDA 3OBAA 4K8FA 1NA1A 1VB2A 3HBKA 2HWD3 1BK1A 1SBFA 2BDRA 1GQPA 3IN9A 1AR83 3OBTA 5FY1A 3WQ7A 5F9TA 3H3ZA 3H42B 4PDWC 3VZJA 1KFUL 2YYOA 4CRQA 2WLQA 4L99A 1A6CA 3FZ3A 2BGPA 1WMFA 1HB1A 2GSYA 4KNCA 4PJYA 4ZXKA 1WCUA 3WG2A 3O1PA 2PLV2 3IZOA 5BNNC 4MXWB 2V09A 3T4VA 5L9VA 1QJU2 5GLVA 3JB8A 4W6WA 1UNBA 4BM8A 2VD7A 1XSRA 4JKMA 2X09A 2QBXA 3BALA 3OJBA 1W8TA 2XGXA 4QHZA 4AQTA 3VBHC 4BLIA 1RUG3 1VB4A 1W0NA 4QU1A 5JI9A 4BZ4A 1PIV2 2P4EA 5FV3A 4AHZA 5FLJA 2WL1A 3AP9A 2OW4A 4Y26A 3H8XA 2VGDA 4I3PA 4QHBA 2YC2A 1VMFA 3HQXA 3LEMA 5FJHA 2HWE2 2A70A 5FLIA 3ZYJB 2QQPA 4NPLA 1UY0A 2XOMA 3E6DA 4QGNA 5LK5A 1JZ4A 1X7NA 2OQ6A 1QU0A 4TXWA 3LPFA 3GF6A 1X9PA 1PO22 4EROA 3RZZA 2GN7A 3POGA 3JBG2 3I2DA 2RG4A 1E5IA 3NWKA 4XQ4A 4ES8A 4A45A 2GH2A 2B7YA 2VCBA 3OG2A 3FHIB 1PO11 3H3UA 1OI6A 1NXD1 4PBOA 1OOPA 2E63A 4QQPA 3PIJA 1CGPA 2NPIA 1HKDA 2CDPA 3Q8CA 4Y3OA 2HH9A 1IG0A 3E5UA 1RMU3 5FMDA 4IGPA 5T5LA 1HRV3 2ARBA 5FK7A 3VBRA 3VHOA 3THDA 2E7QA 1PK6A 3W20A 2HEWF 3RNSA 5FZIA 3W59A 2NP0A 3CLPA 4OUSA 1NKGA 3BCWA 4Y1XA 3T2PA 2WS92 3AZZA 2RS32 4O9GA 2TUNA 4Q4V1 3WNOA 5FR3A 4YWAA 4OZXA 1QNYA 2BV4A 1ULEA 3NAPA 5FMOL 1LJ7A 3KQ4B 5GZFA 1ZA7A 1AZDA 3VBFC 2W08A 1HLCA 2VZUA 3ALQA 3J7MA 4BK4A 2RS12 4DZGA 5HCAA 3CZUA 5E8AA 1W0OA 3P3PA 4JQTA 1KEXA 3HQRA 4YW4A 4HPKB 5J37A 1G9AA 2V73A 3WINE 4RFT0 1B35B 1WW6A 3LSEA 5K4LA 3K4DA 3WOGA 4J6GA 1AYM2 5IVYA 4CYDA 2DVDA 2ERFA 1RUE2 3QBQA 3VHRA 4AYUA 1HQWA 1LESA 1NAEA 4XMAA 5DZEA 3HVDA 2R6QA 1UIJA 5F32A 4CPBD 4HK9A 4C8DA 3LB9A 3ZKUA 2VZSA 1SFPA 5L73A 2VECA 2K9ZA 3LSDA 2ENRA 4IEOA 1XRUA 1S0JA 1YQ2A 2N7GA 3J26N 1HJFA 4EE2A 5FCCA 2QQOA 4OULA 1AYN3 1ZVFA 4PIYA 3LA2A 3N35A 2E31A 2ZMNA 4BCUA 3RYKA 2K2SA 2OIIA 5EXOA 4UI9L 2HWB3 1RUH2 3ZFFB 4M4RA 5CG8A 4GIQA 2GC0A 3HN3A 1US3A 1H9WA 1OQEA 3M2MA 3FL7A 5EQUA 3RYPA 4R9DA 1POV1 1OXCA 3VLBB 2UU8A 4KH9A 1V9U1 3NSTA 3LA3A 4K6BA 3THPA 4AI1A 4AOCA 2VUDA 4IQPA 5A7WA 1BCXA 4IE0A 1YNAA 1K5MC 4AI9A 1I1EA 4L9BA 4AEKA 3MV01 4JHTA 2GNMA 3Q8BA 2RMU2 4QX1A 1LCLA 5CAZA 1IS6A 4I30A 5BNPA 1MZFA 1K42A 1LEMA 1IKPA 1YIPA 2IXCA 2WFF2 4QPYA 1REEA 4BDVB 4E2GA 3K3NA 1N1SA 1MS1A 2YPDA 2ZX1A 3NNMA 3OOXA 3KV6A 5FTTC 1CAWB 1EV12 4UFJA 3O0WA 1YI7A 2Q8DA 2JIGA 3A23A 5H9SA 3WY6A 1RXFA 2OXBA 1M06G 2Y26A 1BVVA 2D7FA 2EALA 2Y0IA 1PVC3 1CPNA 3RYRA 5BNOA 4Y33A 2PTMA 3ZVXA 4OI1A 3QD6A 1C1LA 4X8PA 5ACA1 3PURA 4LNVA 4JTNA 1TMF1 2E9QA 1FPN1 1FATA 4JQRA 5LRRA 4LT5A 3GXUA 2JG8A 4Y4RA 4AVTA 4ASKA 5L7OB 1CAVA 2VVEA 4AVBA 5EJ1B 4LBMA 5DQ0A 5T5JA 4AFBA 1W9WA 1WLCA 4JRAA 5F7UA 1QXRA 1T6BX 1W6QB 1A78A 4LOSA 3WW2A 1O3TA 1RGSA 2CYFA 2ZPXA 1G9BA 1E5SA 1ZM1A 4CXYA 2P3YA 4CDXA 5LBFA 3CU7A 4Q8LA 2OZJA 1DLLA 5K9YA 3FE5A 5LK7B 1LOCA 1Y7BA 2XBO3 5KC5A 5KHJA 1UYXA 2WT0A 4J1XA 3OEAA 2WDBA 1SLAA 1PNGA 2E7AA 2VC9A 4UAPA 3SITA 1JYVA 1UXXX 4FCAA 2B4KA 3MBWA 4XJZA 1NE4A 1GMMA 2ZHLA 1W2AX 4CCMA 3I7DA 4YZ5A 3MF6A 4UW5A 5JIUA 2VZTA 2DVAA 3RZMA 1C8M3 3IPVA 5FZFA 1W6MB 3GBWA 3E5QA 5J98B 2WZR3 2WNVC 4Y22B 4XBLA 3N9MA 4BQ4A 3H3LA 4A3ZA 1UOJA 2ZTNA 3KV9A 4XDQA 4C1WA 5C4WB 3B3QE 1XNKA 2BQPA 5FYHA 1QJX3 3VBOC 1CWPA 5FOBB 4R52A 1ND2B 2Q5TA 3POBA 1F15A 2QVSB 2B9VA 2D5FA 3ZYGA 4FXGB 4XBNA 3LOIA 1CX4A 2Y60A 1XYOA 2DVGA 1ZX5A 4YVSA 3VDAA 4FPKA 5FZOB 4DNYA 3N36A 2Y6GA 5EZWA 2XJRA 5T50A 1XE8A 2C24A 1R092 4HSJA 2KA3A 4XBQA 4FP3A 4PF1A 4GMP1 5A3UA 3OUHA 1HRV1 2DYCA 2UYAA 3LWCA 4UFIA 2TBVA 4DXSA 1RIRA 2XJVA 1T6GC 3V0AA 2QDRA 2A6WA 4QDQA 3POIA 3T30A 4BQ1A 1IPSA 3AM2A 1RUJ3 2JDKA 2PA7A 3OY8A 1WMDA 2WT2A 5JOZA 1RUD1 2YC0A 2YPJA 3VDDC 3H9AA 5DAPA 3VGIA 1RUOA 4FPFA 5J1XA 4QKFA 3DEMA 5FZKA 3BTXA 1O4TA 3USSA 2VCAA 1XC6A 3ITQA 3ILRA 1VMJA 1SZBA 1HRI2 1UYPA 3LGRA 5BXXA 2D3PA 4CU7A 2C6SA 4DIQA 4A7YA 1JYIA 4YZ3A 3WG3A 4I2OA 2RE9A 1F4AA 2XB6C 1W6PA 5FUNA 2VY0A 3UV9A 1L7LA 2WO7A 3ZMOA 1LAJA 1RUI1 2JECA 5E1RA 5C3QA 5CFCA 4M3CB 4YW2A 4Z07A 1JZ2A 1JZ3A 3DGTA 1D4M1 3FLRA 4GKYA 1ZBE3 4OHZA 4QPWA 1CZSA 2XJUA 1IS4A 4LO7A 3MGUA 4SBVA 4YVWB 3RSJA 3WEZA 1QXPA 2IVIB 3H1WA 1XE7A 1DQ0A 4KU7A 4AEDA 2W87A 3KF5A 1COV2 3ZFEA 1KD7A 4Q1PA 3WQBA 4LE3A 2AEZA 3F95A 4O61A 4LO8A 1YFYA 3PHMA 5FPLA 4AEJA 2R062 1DP0A 1IG3A 3AMMA 3B9IA 2VQAA 4NOTA 5FPVA 3VN4A 3HJRA 1K12A 4MGYE 3OYWB 4GALA 4IE6A 4D6QA 4YM2A 4FTBA 4PDWA 4QPIC 1WA6X 3W5NA 2YROA 2DCJA 4AI3A 2IC1A 4P9IA 5A6XA 2QQNA 1KXGA 1WMEA 4R9BA 4AQ6A 2WJSA 2RM21 3ELNA 1NCQB 1UPIA 2ARAA 5FAXA 1EAH1 1VLNA 4QKBA 4D7SA 5A7OA 4P9GA 3RJ2X 3T09A 5FUIA 1GNHA 1V6JA 4Y5SA 5HCFA 1H6XA 3M3IA 3ZXDA 5JZGC 3B00A 3MIGA 3CJIC 4ARYA 5LA9A 2XWJB 4FOQA 2C1FA 2FZ1A 2A3XA 1UY3A 3VBHA 4BK5A 1ZA4A 3HNMA 4JX0A 3E6BA 4LXLA 4WVZA 4BOWA 1GOFA 5FY9A 1KGYA 1PM7A 3TRSB 1WW4A 1DBNA 1W04A 2CGOA 3AX4A 3IM0A 3LD8A 1E5HA 4B29A 2XPJA 2X05A 2A71A 3GBFA 4E4ZA 3TWIA 2B39A 4DY5A 4OMCA 3T2QA 3WLUA 1FOD3 4W4ZA 5H9RA 4CEWA 3WG1A 2BGOA 2OX0A 2RDNA 4D69A 4L92A 2ZGOA 2IXKA 3SISA 3TEXA 3J8F3 5I8SA 1RUC1 2XBO1 1PM4A 2HWC3 2HWD2 1WLTA 1XXNA 1JW6A 1UL9A 1CAXA 1AR82 2Y8KA 3KV4A 2Q4SA 3U11A 1FT9A 3ZSEA 3EHKA 5BNQA 2IFWA 1MZEA 2WYFA 4LITA 4TYSA 3WDTA 4DUVA 2GNBA 3I97A 4RL7A 2VTXJ 1OQDA 1O5LA 2AGSA 4WVMA 3VBFA 2EXIA 4QXKA 4L2NA 5DZGA 5F39A 1GQGA 1DQ4A 5BY5A 2ZCWA 3WF3A 1VALA 5I0TA 1DCSA 4XYXA 5A3NA 3NV1A 4KGQA 1AR63 5LATA 1D7PM 4DQAA 2NLRA 3C7GA 2WSUA 1RUG2 2W2IA 1B09A 2XMLA 5A7NA 3UESA 1F8VA 2DF7A 2J1SA 3QH6A 4P5HA 2HWF3 2R7EB 4OQ8A 4E9KA 2VZ1A 4Q1RA 4UWDA 2EAAA 2VNRA 2GZWA 3FFQA 1W2UA 3RI8A 3U4SA 1Z7S3 4IEPA 4CCLA 2BNNA 2VBBA 3GALA 3BYWA 4Y20A 4MYEA 2BTVC 3O7OA 4Q4Y2 1XPWA 4GD4A 2PHWA 4RR3C 4WBBA 1OURA 2OKXA 4NPRA 2XL9A 5D2AA 1SPPA 1RMU2 3RS6A 2ZBJA 3UETA 2FDKA 2X5IC 4KWLA 2YBSA 3VKFC 2GU9A 1DQ6A 1OFSA 1UX6A 1FAYA 2LROA 2RDQA 1F35A 3BOPA 5A33A 3ZYFA 1OVPA 4IEVA 1W9SA 2C9KA 1WBFA 2YU2A 3PJQA 5F3IA 1YXWA 2ETEA 2VOKA 1K5MA 2VZPA 5ANQA 2Z2SB 5JXHA 1I5PA 1J1LA 1CPMA 2A6XA 5FY0A 1SBEA 3FUQA 4AAPA 1VRH3 4W50A 5FBZA 3VKMA 5GLUA 5T3NA 5CFDB 5FKCA 5F3CA 2YUEA 4TLFA 3RZHA 3AMPA 4AVCA 1H1IA 2WWUA 4OFGA 1MZ5A 4ZS3A 4QPGB 4ATFA 2VL4A 3AVRA 1AR72 5F8PA 2Y0OA 3IT8A 1OH4A 3DYMA 4AGVA 1R1A2 4QDSA 1TME1 1SFNA 3N7KA 1I6XA 3VKOA 4YM3A 4XF3A 5A80A 3AZVA 2DCYA 3JXSA 1OLQA 4JHZA 5IVVA 1GUIA 1BLZA 3NKTA 2D97A 2DCZA 3KLSA 5CYYA 4YFWA 4FQZA 1JI6A 5CKQA 1OA2A 3VKLA 3I3QA 1JHNA 4CDWB 4E2QA 1QGLA 1W9FA 5FPUA 5JVVA 3ACFA 1OF4A 3T0BA 1AL23 1AYN2 3H0OA 5JR7B 5FZMA 5KHGA 2G1MA 1G8WA 2HWB2 2WN2A 4HBNA 4LQRA 1HJGA 2FDHA 4K3UA 1WLDA 1BYHA 1N3QA 4FPHA 3ACLA 4Q4W1 5FY5A 5SV5A 5EJ3A 3LDBA 4UFHA 3MYXA 4G4FA 1DZTA 1OLME 1ND3B 3OGJA 3KCCA 5JUVA 1W9YA 5J09A 3WV6A 3O5SA 3AP6A 2Q8EA 4LBLA 4OHVA 4ISRA 3O1VA 2OYZA 5T5PA 3CEWA 4QB6A 3KZ4C 5DAWA 4MZUA 3U10A 1JN2P 1OLMA 5I91A 5LA2A 1AJKA 1PO13 4HVRA 4WM7C 2AUYA 2VOWA 1W8FA 2WR9A 4OI4A 1MR5A 3UKVA 4D6SA 2GMEA 2B45X 3U1XA 4WM8C 2XLAA 1PGW1 1WD4A 1S4CA 1D0HA 1RVF3 2WQ8A 2WNVA 2WINB 2VW2A 3H1MA 2C4XA 3HPNA 3OUIA 1AXKA 5CVRA 5K0UC 1H8TA 3RZGA 2CGPA 4Q4V3 4EJRA 2BFUS 3VZNA 4YZ4A 1HN1A 1TZOA 3VBOA 3AMHA 3SMHA 3SEPA 4EN8B 4PHZA 1W6OA 1HXS2 3A0KA 1U5IA 3AKSA 4Q2FA 4JV4A 3TN92 5JDBA 1PVC2 2ZXQA 1W03A 2VOVA 3D3AA 1JYWA 2E32A 2JENA 1BQPA 5L19A 1XNTA 4BH9A 1BK0A 4XC9A 1X8EA 2GC2A 4LBKA 4HOOA 1S0GA 1UY4A 3KHBA 1CJDA 1DU3D 4KU8A 4NE9A 4RGAA 3J9SA 1DLCA 2A3YA 2SBAA 4A2UA 3KV5A 5FWJA 4YZ2A 4QKDA 4P02B 5FZ1A 4HG6B 1YO8A 3NJZA 1JYCA 3J8F1 5FO7B 2QQKA 2PXJA 1VIWB 2J1TA 3OPWA 3WP5A 2JE8A 1SLLA 2YMZA 1AR91 1JODA 3C7FA 4Q0PA 4R9AA 3RI9A 1EY2A 2XBO2 2PHRA 4QDRA 4CVUA 4AG4A 1Q8PA 2XJQA 4G3YC 1LB2A 4UW3A 1O8SA 3ZN6B 5J3UA 1XJAA 1HV0A 1NX9A 4XPVA 5ABJB 3VDDA 4JGYC 4P00B 3KVAA 2E26A 3GBGA 3GNEA 1NY72 1C8M2 2JDUA 3BGAA 3AK0A 1J3PA 2OZ6A 3MIHA 2P1BA 3MIFA 1NA1B 2WZR2 3MW2A 4TZDA 1AR61 4B4QA 1POV3 2BU9A 1V9U3 3PNAA 4NIIA 2MEV3 2V72A 4CU8A 4RQPA 5E6HA 2QZ2A 4Q0VA 3MO4A 3BOWA 1QJX2 4QGMA 3WDWA 1ASJ1 3AZXA 4Q29A 5DUVA 2NN8A 5I0DA 2BBAA 5DZFA 3LZZA 5FXZA 1QHDA 1LKNA 3ZFGC 4D8MA 2HWF1 4X6RB 3AMNA 4A42A 4AE2A 1X50A 2Y6LA 5BV6A 4IV3C 2D98A 3S57A 1Z78A 5ANNA 4IUGA 2X53S 1F5FA 3MLKA 1QDOA 4RD7A 3AL6A 3AYEA 2O1QA 1AVBA 2DUQA 2Q0AA 3WSOA 3AJZA 2ZHKA 3AP5A 3R05A 4H2AA 2XDVA 2ORXA 5JCTA 1R64A 4V1PA 2CHHA 1JU4A 1PZ8A 2R16A 2W1WA 4IEUA 3QH7A 3ES4A 1W05A 2VMDA 5FYCA 5GLTA 1RC6A 2ILMA 4LHNA 3MW4A 4RGKA 2MHFA 4AVSA
chains in the Genus database with same CATH topology
4LBQD 3W58A 5ACA3 1X36A 1TMF3 3V0BA 3WG4A 1RUJ2 1H2LA 1ND2C 1KFXL 4AI2A 1EP0A 1QJZA 3M3CA 1O3QA 1GZWA 2SLIA 3T2TA 2TEPA 2DU1A 3H8UA 1YUDA 4QPIA 4ES9A 1OOPB 3WNXA 3ZN4A 1NLSA 1XU1A 2RR11 4RS5C 2ZHNA 4QM9A 4IXLA 4XOGA 3VBRB 1PK6B 3VBSC 4XW3A 2C0ZA 2FMDA 4XE9A 4DOUA 3M3OA 2JEMA 2JICA 3WP3A 5HXVA 4ZU7A 5JZGA 3VHPA 3CJIA 4GULA 4DY3A 4QMAA 2UURA 2UWAA 4C0BA 1ONAA 3OD4A 4BPZA 1VR3A 2JD4A 4OI0A 2D43A 3B5LB 2P3KA 3VZOA 3SCFA 3ROUA 5I93A 4LO4B 2ZAAA 1AL21 1ZBE2 3KB5A 4Y5Z0 2R042 1Y9QA 5KXBA 4PLMA 1HX6A 3ZXJA 2WNUC 3O0XA 3SCHA 1XU2A 2UWBA 1NOVA 1GYKA 1GV9A 3O0VA 4XFIA 1DDLA 1VBE3 2A6ZA 1RUF1 2P2KA 5DDJ1 3POSA 2VG9A 3OF1A 1VBA2 1U12A 3A4UA 5GZCA 4N53C 4LEJA 4KBBA 1MZ6A 4N43C 2GAUA 1FYUA 2E53A 2I07B 4GMP3 4HETA 2QNKA 4B8EA 2I2SA 4RHV1 2DVBA 2D6NA 1N1YA 1SBDA 5CG9A 1RVF1 3W9AA 4I0WB 4IEZA 1XNCA 5CU1A 3AYAA 4EN0A 1PGW2 1NZCA 3B7MA 3CJXA 1O4ZA 5I0UA 4TWTA 1CD3G 1RUD3 4JRLA 4HKWA 3ZDSA 2R0HA 5GJ6A 4YGEA 3HD8B 1AHSA 5BNPB 4Z1VA 2HJIA 3IMNA 1D2QA 3QOPA 3CO2A 4O9EA 5FQ0A 1RB8G 3FBYA 1MQTC 3TOJA 5BPXA 3G7DA 3UJQA 4NO4A 1UW8A 2QJVA 3PJYA 2ZACA 2PHLA 5JOWA 4JTOA 2QFEA 1KQRA 2PAEA 1A3KA 5IK7A 5CBLA 1GKBA 5BNOB 1FOD2 3SH4A 2ZX3A 4RR3A 1RUI3 4QX5A 4UW4A 2ZABA 4COVA 2H6CA 2XL7A 4HT1T 5F6LB 3MIEA 1D4M3 2HWC2 2VULA 2X5IA 2JG8B 3POYA 4FPGA 4IETA 1CAVB 1SMVA 4XEZA 3M3EA 1QDCA 1ZZ8A 4B4PA 2ZZJA 1X8MA 3E6CC 3KSCA 1DGRA 1LODA 3QCWA 4GB33 4LA2A 1MEC1 1QXJA 1U5YA 4CDXB 4AFAA 1Q56A 2EAKA 2PAMA 2MEV1 1F31A 2BNOA 1GANA 3ZXGA 1N1TA 1VBD1 1S0EA 2XJPA 2EXHA 4GA9A 4P14A 2Q1ZB 3U0ZA 2G4IA 2NM1A 4XZPA 1J3RA 2WA4A 3IPVB 2RM23 3L2YA 2D6PA 4Q4X1 2HWF2 1EAH3 3TNQA 3SXWA 2CGNA 1Z7S2 3RG0A 1Q43A 4CDUA 4A7ZA 4YFZA 3GZUC 2CL2A 2XJSA 1UF2C 5C8CC 2E6VA 3GZTB 5C9AC 5GLWA 3D8CA 4DB5A 3WDYA 1NXMA 3PVOA 4Y1ZA 3ILNA 2P3JA 4YVSB 3TBDA 1SLCA 5AC91 1OHFA 2YGLA 4TSVA 2VW0A 3ZSKA 1LECA 3USUA 1FI2A 1WW7A 1VBB1 4BHPA 1QJY1 2YDEA 4WV8A 5KXDA 3PLQA 4XFHA 2O8OA 1TE1B 1VRH2 1G9FA 4WM7A 1VBC1 3V0AB 5EV7A 3H50A 4GH4C 4LO5B 3VBUC 2O8QA 1RUC3 4H55A 3S7EA 1GBGA 4WM8A 3N3HA 3OY8B 4UW6A 1SCRA 1Z0HA 5K0UA 3ZSJA 1ULFA 3KT1A 1V6OA 2MPFA 1U5XA 5AVAA 3KM5A 4MVTA 2ARXA 4LBQA 1EYBA 2F4PA 3TAYA 2FMYA 2VQ0A 4EN9B 4QT6A 3ENRA 5FRAA 1XYPA 3G6JB 1RJ8A 4L97A 1W6PB 4ONUA 1LOBA 1LTEA 4QD2A 4AF9A 1AL22 5LEKA 1D4VB 2LTNA 4BIFA 5KHIA 2B5HA 1VBE1 1M4WA 5CFCB 1UZYA 3WDVA 3DN7A 3ETQA 3PVNA 4ZU5A 4H7MA 3M70A 3CF6E 4YM0A 2WQZC 1R081 2JG9C 3N7LA 1YIFA 3D82A 4K21A 1DGLA 2R0FA 4CP2A 1LHWA 3AZWA 4Z92B 1HDKA 1C57A 4AEDB 1WCKA 2ET7A 3ZFEB 1CONA 2VH9A 2ZZQA 3H1YA 1PO12 5IK8A 1WBLA 4KWKA 4JGYA 1NG0A 4PLOA 2UY8A 2YXSA 1S0IA 2LM3A 1RVF2 4MH0E 4EWAA 2QE3A 4LLOA 4RA0A 3ZX7A 4R8HA 5JIAA 4COUA 4PDWB 1WCDJ 4Q4V2 4HN1A 4IV1A 1Q8SA 4U2AA 3FJSA 4K40A 5K7PA 3ZFGA 1POV0 3KGZA 1DF0A 1CAUA 1J1TA 4MXVA 5C33A 4IV3A 5LRSA 4MLOA 5T54A 3JUUA 4IL7A 4AFDA 4P9JA 3L2HA 1CQ9A 3WR0A 4CDQC 3VBHB 4AHXA 1ZRDA 2QCSB 4UBGA 1TME3 2HKXA 5E16A 2R49A 2PHUA 5AVPA 4XJ8A 2R073 3UJOA 1UD1A 4DINB 2W52A 2Y38A 2P37A 4GQ7A 4OVEA 1LOFA 2YV8A 5CA6A 1QQP1 1PGL1 2AR6A 1ND2A 4GB31 5FO8B 4LBOA 1RHI1 4CEWB 4PCRA 1NCRC 2GMMA 5JAXA 2OPKA 1OLRA 4LBJA 4RS5A 4Q4W3 1NQDA 5H9PA 2DURA 2PELA 3VBSA 3BTAA 2EF6A 1CAXB 3RRDA 1V9U2 1ZREA 4JGZC 1ENQA 3HIFA 5D8AC 3SCGA 4AFCA 1S0BA 5BNNA 3KD4A 4WVMB 3VBFB 2NQYA 5BUVA 2HWE3 4P9YA 4QQHA 4JAAA 1LULA 1QOSA 3H7JA 3QLQA 4FQ4A 5I0SA 3VHNA 4CEYC 4S2DA 5FOJB 3JQWA 4RSUA 1LOGA 3KMHA 4XHXA 3D6EA 3V56A 4RGGA 2WNUA 4DRVA 4Y1UA 2BYVE 3OTFA 5DXDA 2AZ5A 3WP6A 2CY6A 3K51A 4ASMB 1YHFA 1SACA 1IGOA 2D5HA 1V6KA 5ACA2 1GFF2 1TMF2 1SFYA 1FPN2 2GDFA 5KXEA 4BMBA 3K48A 2ZHMA 5AFEA 1IPJA 2D40A 4N53A 2PHFA 3ME2A 4Y20B 2ZX0A 2XVGA 3UK9A 4JDMA 4XMIA 4N43A 1F2NA 1ZZ9A 4W6XA 1DQ2A 3DPRC 1V70A 5E88A 2DVFA 3I8TA 2WNEA 2VNGA 4XIOA 4XILA 3MIDA 4K1YA 1AR93 2Q8OA 5A33B 5B2GB 3S6PA 1NQJA 4NWWA 1LGCA 1GNZA 4GMP0 4H7LA 1QH7A 1E57A 1BBT1 2BWAA 1R1ZA 3WVJA 1PZ7A 1RINA 3ZYRA 2ZGUA 1K5MB 1XNBA 3JD71 1RL3A 2JXAA 1AJOA 2Z42A 2DCTA 4EN7B 1ZBA1 4FBFA 1DQ1A 2RHPA 5FDBA 4NHLA 2JX9A 1MQTA 1N3PA 4XFFA 4WVWA 1YRZA 4YW5A 3GZAA 3PMSA 4NHMA 3RQ0A 1ASJ3 5DG1A 1LGNA 4I09A 1BZWA 2Z5WA 3C3VA 5FLHA 4P9XA 3WZ1A 1ZRRA 5FFOC 1BXHA 3D5OA 2Z69A 3LA7A 3B69A 4NWVA 5CB7A 5IK4A 1U0AA 1SLBA 5GM0A 2EIGA 1LENA 1HRV2 1VAKA 4DXZA 5DUWA 3NW4A 2A5ZA 1YYNA 4QQ2A 4AHYA 3DF0A 1APNA 2WFF3 3IWZA 1A8DA 1Q8QA 4YGDA 1I3HA 2D44A 4BIOA 5L36A 1UU6A 4ORFA 2RJLA 4HKLA 1LGBA 4IEYA 1KITA 4OHYA 4DPNA 4I3GA 1WGPA 2PHDA 4S2FA 2R1BA 1ZNPA 1RUD2 3M3QA 1HV1A 2D6MA 3OD0A 3VV1A 3THTA 5LEJA 4HVQA 2RR13 1FMD1 3JZVA 1G86A 4OI2A 4R4XA 4PBPA 3U4XA 2GH8A 1ZZ7A 2WNVB 4JVAA 1H8TB 4MGKE 1SLIA 4CTEA 5CIRA 3VBOB 4AHWA 2RS51 3AKPA 1W6OB 4AVAA 1LHNA 4XQWA 2R071 5C8CA 1RUI2 2B9UA 5C9AA 4LUMA 1MVQA 4I0AA 3BB6A 4YM1A 2XG3A 1D4M2 4FPCA 1REFA 5J36A 3AYCA 5JLVA 3SH5A 1H2MA 2PLV1 3WQ1A 2OUJA 2B46X 4D7TA 2W68A 4XFGA 1QJU1 3GHMA 1PGL2 3N7MA 2GALA 3AZYA 4R9CA 2HYKA 1B35C 1GICA 5GZEA 1LU2A 3B93A 1H2NA 1RUF3 4GH4A 5DDJ3 3VBUA 2BNMA 1O3SA 1PIV1 3QACA 1NYWA 2KM2A 3LOBA 1AF9A 3A0NA 5DUUA 2HWE1 5JWPA 2BGCA 2VMGA 3VDDB 4K9SA 2BWCA 2IXHA 2XWBB 4RHV3 3FLTA 4HKOA 3J4UH 4EWDA 2RM22 1PO21 1F9KA 2GNTA 4XXAA 1UU4A 4K7JA 3APBA 4KQ7A 1EAH2 3JBG1 4JC1A 2Z79A 3AJYA 1UIKA 1WD3A 1RITA 4LA3A 3ZFFC 4XFBA 4RQPB 3Q9OA 5H9QA 1REDA 4A7KA 4I02A 2P3IA 2CV6A 4U36A 1QWRA 1SEFA 1XQNA 2RS31 4XFCA 3MZHA 2JG9A 2QDNA 1L3JA 1SDWA 2BVBA 3HT1A 3V65A 1PGSA 2RS11 2R32A 1MVEA 2UYBA 5IUQA 1Y3TA 4AGGA 4I01A 1D2SA 2C9AA 1UPSA 1HRI3 3I59A 4LULA 1AYM1 2VW1A 1RUE1 1RUC2 3V0BB 1C5HA 1V00A 2XUMA 4AQ2A 1UMZA 2NYYA 3B9CA 1X82A 3ZIXA 4LLFA 1GZWB 4QPIB 2XKPA 2VVFA 3WT3A 2PQQA 4F83A 1JH5A 4YVSC 1MEC3 1TEIA 4M01A 3PMEA 5L7OC 3NV4A 3FC0A 4A3XA 1Q5OA 1RUH1 1VBD3 4XQDA 5JZGB 2YHJA 3M1HA 3CJIB 2IXJA 1W6NA 2RJKA 5A3MA 4CDQA 4FPYA 4K1ZA 2AREA 2TNFA 3JB4C 3VZLA 1CN1A 2AYHA 3ZSLA 4UBHA 4BLJA 3ZSMA 2R063 2C5DA 4Q4X3 1KJRA 2P17A 4IESA 5A32A 1C8NA 2RMU1 2E7TA 4LR4A 2Q1MA 4ATEA 2A7AA 2K0GA 1DGWA 4YW1A 1U5ZA 3NV3A 3AFKA 3IIAA 1NCRA 2WFF1 2BW8A 3ZMNA 2ES3A 5C4WC 1DGWX 5AC93 4INDA 4Y1VA 3DUIA 3ZXLA 1C1FA 4JGZA 2VUAA 4XTPA 1VBB3 2DFBA 4KWJA 2XVLA 4C91A 1ENRA 4FPOB 1QJY3 3MI8A 5D8AA 5DG2A 4F8AA 4FTSA 1VBC3 3FFZA 3M4FA 3EXUA 3NKGA 2XH6A 4Y1YA 4FPEA 1F5JA 1RJ7A 2D6LX 4YNIA 3HT2A 1FX5A 4YGBA 3NAPB 4CEYA 4IEXA 3MF9A 5FREA 4HVOA 4W6YA 2D3SA 1TME2 3NO8A 4HMZA 3I54A 5JOXA 5FQ0B 2R072 2DV9A 2R30A 1H1AA 3SH3A 3ZO0B 3OCPA 4YW3A 5FPXA 3MPPG 4IERA 4C90A 1I9RA 2FQPA 4UXAA 4ASLA 1N3OA 4COWA 1RUNA 2XHKA 4YG6A 3D4KA 4RR3B 5JI7A 3DPRA 4EV0A 3R4UA 3ZXKA 3IKWA 4M3CF 4FPLA 4Q4W2 2ATFA 1R083 2X5IB 1HQLA 1QNWA 5FMOS 4HL0A 4EWEA 3BODA 1DQ5A 2CAVA 4YSFA 4N7IA 3ES1A 3WHTA 4AK3A 2WWSA 2CTVA 1IPKA 4K20A 4GWNA 1IKQA 3KGLA 4YVWC 1PHMA 1DYPA 4AGRA 4CP1A 1ULGA 4XF0A 4FTEA 3PVBB 1R091 1VP6A 1WCSA 2H0BA 3WDXA 2A6VA 2UY9A 3HMYA 4PLNA 4COZA 1DFQA 1HQNA 4CEWC 3GYDA 3U07A 4Q4Y3 1BVP1 1S2BA 5HBAA 2W0XA 4HN0A 4WZFA 1S0DA 1GSLA 3S0MA 1NE6A 3V64A 1AL0G 3LAGA 3O14A 1J59A 3L9JT 1YFWA 1PZ9A 3IDBB 1DHKB 2WT1A 2BBVA 1G9DA 3ATGA 4HLTA 1CESA 4CDUB 1AX0A 4LHLA 1MS0A 3E97A 5GZDA 3R0RA 4YG0A 4MXWA 5E89A 1NCQC 4EN6B 1HRI1 5T55A 2IXIA 1I5ZA 1UCXA 3J8F2 4I0BA 1LHOA 1OPMA 4H3WA 3NL1A 1AR92 4MGZE 1ZYBA 3WP4A 1AR73 3USUB 2WSVA 1R1A3 1DG6A 1QQP3 1QH6A 4XJAA 2D93A 3ECQA 1LOEA 1RHI3 4F3JA 4WM7B 1YFXA 3IDEA 4KG0A 4SLIA 4B7EA 5JOYA 3AXDA 5KHKA 3UKTA 2YZ4A 3OGGA 4WM8B 4Q8KA 2XJTA 1COV1 1AR62 3LCPA 5TSWA 5K0UB 4M00A 4AI8A 3SLIA 4LO6B 4D7YA 5BYNA 1V6IA 1ASJ2 2WIIB 3RPQA 1G7YA 2R061 4LBQB 2VU9A 2NMNA 1VJ2A 4MGIE 4E27A 4P9LA 2ZGMA 4HK8A 1UN1A 2GC1A 4QM8A 4LBNA 1KS5A 4ZKTB 4QQOA 1MS3A 5T5OA 2A6YA 4AQSA 3D0JA 1FXZA 1PNFA 2GNDA 4Q27A 4Z2WA 1DZQA 4HPKA 3URFA 2JDZA 1MS9A 1XYNA 1B35A 4DRRA 3OPZA 3MICA 4M0HA 4B4RA 1TNFA 2FBEA 4JDOA 2UWCA 4GXLA 3ZXEA 5JSPA 3BIWE 2ZAHA 1HXS3 3TN93 1C4RA 1VAMA 2ZMKA 3NV2A 2X29A 3T1LA 4JGYB 2RR12 4Z82A 3AFGA 1OQ1A 4QU2A 1LU1A 4P9WA 3EJKA 1H1MA 3WW4A 1UAIA 3FX3A 4NHKA 1C3HA 3SNMA 1BMV1 4Z8BA 1BBT3 3ZFFA 1Y43B 1G9CA 2CNAA 4IV1B 3JD73 1URXA 3INAA 4AI0A 3ZFGB 2DU0A 1CAUB 2HWD1 2EVXA 4XJWA 1AR81 1ZBA3 1UU5A 1CJPA 4IV3B 1SLTA 3BU7A 4MSVA 2A73B 2DCKA 3WX5A 3AP4A 2JKBA 4MX3A 1QOTA 4B3NA 3LKJA 1CVNA 3AKTA 3M8LA 3MW3A 5CFDC 3AKQA 3E5XA 5GLZA 3PTYA 3MFCA 2JJ6A 1RTVA 3S30A 4QPGC 1H8TC 5I8YA 1RUF2 1A8MA 1IQAA 4PIZA 1RUG1 4KL1A 5DDJ2 5F1RA 1CAWA 2BPA2 1BEV3 5KHHA 4AEMA 2PYTA 3MFAA 4CZSA 2E51A 1EPZA 1OSGA 3R6SA 1N47A 4NVPA 3HWJA 5JPMB 2D6OX 3M7AA 4RHV2 1S0FA 3KT7A 5T52A 4RS5B 4CDWC 1JUIA 5HI0A 4OLLA 1C5IA 3I4IA 2O0OA 3VBSB 3UKNA 1H4GA 5L7OA 2IXLA 3IBMA 4X8NA 1H4HA 2ZGLA 2H0VA 2AH2A 4Q4Y1 1SQ4A 1LR5A 3FLPA 1AUYA 5IK5A 1W6QA 2G9FA 4E4DX 5I8TA 1LHVA 4GWMA 4KG8A 1QKQA 1RMU1 4DMIA 3O12A 1YJLA 3TNPB 2XLFA 5BNNB 5D1IA 4FAGA 1GZ9A 1ND3C 2I45A 2PFWA 2ZKNA 2KXLA 1FMD3 1O3RA 4HSLA 1EPWA 1S2KA 2XKOA 1MS5A 2EA7A 3JQXA 4QGLA 4ISQA 5JMCA 2X8KA 2ZX4A 4YRDA 2VOXA 2WNUB 4OHXA 4YARA 2RS53 2DTWA 4PF5A 4LE4A 2HEVF 5DUXA 1W6MA 1UKRA 2WZPP 4Y22A 3VUOA 3DKWA 1AR71 1ZRCA 3HN1A 1R1A1 3POWA 3R4DB 4N7UA 4RQPC 4X6QB 2DTYA 5C4WA 4AWDA 4N53B 1VAVA 1OKQA 2PLV3 2ZMLA 2VMIA 4N43B 1ULDA 2H6BA 2NMOA 3VL9A 1QJU3 1KJLA 4J1WA 1KRIA 3VZMA 3FBMA 3KCXA 4BYYA 1CR7A 4D94A 2CAUA 2IWGB 3FWEA 1MEC2 1V6NA 1AYN1 2R043 2YGMA 2MEV2 4XJ9A 2V5YA 3TB0A 2HWB1 1OA3A 1H0BA 1VBD2 1PIV3 1DZRA 1MACA 4XTMA 1FV2A 4XF9A 3PVEA 2ET1A 1Q8VA 3HBZA 1V6MA 5F5QA 4N9IA 4IEQA 5F6KA 3WUCA 1PO23 1VBA3 1ZZBA 4Q4X2 1MQTB 3JBG3 2DFCA 1OFNA 3P3NA 5ABJC 3AMQA 3R4SA 4D3WA 1X33A 1OMIA 4LHKA 4CP0A 3RMXA 1NA1C 1UKGA 3AKRA 4F7ZA 4XETA 1DYKA 4FPJA 4FOVA 4JDNA 3FUOA 2AENA 2WS93 2RS33 2VMHA 4M3CE 5AC92 3WD5A 3AB0A 2B8MA 4PQ9A 1C28A 1HXS1 1XNDA 3TN91 1PVC1 3JU9A 1JXNA 3WDUA 5KBFA 2DUOA 2RS13 1VBB2 4KGGA 2CWMA 4M3CA 5JPNB 3WHUA 3WCSA 1QJY2 1V6LA 4N9HA 3VL8A 1VBC2 4YVWA 1AYM3 5J7MA 1ZRFA 2BEOA 3ASIA 5A3LA 3KS7A 1LHUA 1RUE3 5HCBA 5C6CA 1G6NA 5CADA 3RWNA 3KQRA 1H9PA 1J58A 1YJKA 4BE3A 1BMV2 2XLGA 1BKZA 1QMJA 3GHNA 4XIKA 3TYJA 1S55A 1WA4A 3H7YA 4XJUA 4QQLA 5K8SA 3OYWA 4AXOA 1AXZA 5FPZA 1H30A 1KS4A 3JCIA 3ILFA 1OOPC 1RUH3 4META 1NY71 3VBRC 1C8M1 1PK6C 2MNGA 2ZGKA 1NCQA 2WZR1 4MUVA 4S2HA 4C0HA 5C8CB 5C9AB 1VBE2 3N4MA 2QUOA 4XHBA 3ZYIB 1BEV1 1R082 1QJX1 4OUMA 1DIWA 3NAPC 1KDMA 5CNAA