4WM8A

Crystal structure of human enterovirus d68
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
296
structure length
281
Chain Sequence
VESIIKTATDTVKSEINAELGVVPSLNAVETGATSNTEPEEAIQTRTVINQHGVSETLVENFLGRAALVSKKSFEYKNHHKNFFKWTINTKSFVQLRRKLELFTYLRFDAEITILTTVAVNGLPDLTLQAMFVPTGALTPKEQDSFHWQSGSNASVFFKISDPPARMTIPFMCINSAYSVFYDGFAGFEKNGLYGINPADTIGNLCVRIVNEHQPVGFTVTVRVYMKPKHIKAWAPRPPRTMPYMSIANANYKGRDTAPNTLNAIIGNRASVTTMPHNIVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords VP1
publication title Virus structure. Structure and inhibition of EV-D68, a virus that causes respiratory illness in children.
pubmed doi rcsb
total genus 50
structure length 281
sequence length 296
ec nomenclature
pdb deposition date 2014-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4wm8A00
1EAH2 1AYN1 2R043 1FOD3 2HWB3 1EV11 1AR73 1BBT3 1VBB1 5A32B 1QJZA 5J96B 1OOPC 1TMF2 3LOBA 4CEWA 1AL22 1K5MC 1RUE2 2HWF3 4Q4V3 4CEYC 1PVC1 1VBC2 2R061 3VBOB 1FPN2 5CFCB 2RM22 4IV3A 3VDDB 1RUG3 1EAH3 1R1A2 1R092 5CFDB 4PDWB 5AC92 5A32A 2WFF1 1TMF3 1AL23 1HQNA 1NOVA 1RUE3 1HX6A 1AL0G 2GSYA 1R081 1FPN3 3VBOA 2RM23 4CDWC 5ACA1 3FBMA 2WLPA 4CDXB 4IV1C 1AYM3 1AR82 5CFCA 4RHV1 1R1A3 1RUD1 3VBRB 3S6PA 5K0UA 1F8VA 1NCRB 1ASJ2 1VAKA 1QQP1 4PDWA 4JGZA 2HWD2 3DPRA 1AUYA 1AR62 1MEC1 4YVWB 5BNPA 1POV3 5BNOB 4FSJA 2RR12 2RS51 3ZFFB 4AEDB 2XBO2 1AYN3 1VRH2 1MQTC 1EV13 1AR92 4GH4B 5LK7B 1SMVA 3J8F2 1AR71 1BBT1 1NG0A 1NCRA 1PGW1 1PGL1 4GMP3 3VBHC 1HXS1 1PVC3 1NA1A 3NAPA 1AR63 1Z7S1 3VBSB 5ACA2 2MEV1 4N43A 4YVWA 5BNOA 1VRH3 1RUD2 4RQPB 5C8CC 4GH4A 5BNNA 3J8F3 2WFF3 5D8AC 1ND3C 4JGYB 1BMV2 4RS5B 4CDUA 1MEC2 2R072 1R083 3CJIC 5ACA3 4LLFA 4QPGB 1AL21 4RR3C 1RUE1 5C9AC 1B35C 1VBC1 1RUD3 2RM21 1VBE2 1R1A1 4FTEA 1VBA2 1QQP3 1R091 4CEYA 4Q4Y2 1HXS2 1NY72 2ZAHA 3HAGA 1Z7S2 5AC91 1MEC3 4RS5A 2R073 2X5IC 4IV3B 3JD71 1HRV2 1X33A 2WWSA 3ZFGC 4CDQB 4WM8C 4NWWA 3ZFEB 1AR81 1VBE3 4YVSC 2BFUS 5JZGC 4Q4Y3 1VB4A 1HXS3 4CDWA 1ASJ1 1Z7S3 4IV1A 3VBFB 5ABJC 1OPOA 2MEV3 4QPIC 2HWD1 4GMP1 3JBG1 1VB2A 1AR61 1HRV3 5DDJ2 2RR11 2XBO1 1VRH1 4CDQA 5K0UB 1RVF2 2RS11 1QJX2 1AR91 3ZFEA 1RHI1 2VQ0A 4JGZB 1H8TC 3J8F1 2RMU2 3DPRB 5C8CB 1MQTA 5BNPB 3VBFA 3JD72 1RUC2 2PLV2 1VBC3 5C4WC 1PO22 5DDJ3 1ND2C 1IHMA 3ZXAC 5A33A 1C8M2 1RVF3 5L7OC 3VBHA 1R093 2ZZQA 1GFF2 4WM7B 1NCQC 3VBUC 5AC93 1CD3G 4N53B 1RUJ2 1BEV1 1NA1B 3NAPB 1BMV1 3JBG2 4N43B 5C8CA 4Z92B 3JD73 1RUC3 2R071 1V9U1 2RS32 2HWC1 4Q4W2 5FMOS 1AR83 1ND3A 2RS12 4CEWC 1QJY2 1RHI2 5BNNB 1RB8G 3CJIA 1VBE1 4WM7A 1ASJ3 4RR3A 1RUI1 1VBA1 4CDUB 5C9AA 2BBVA 1C8NA 4Q4Y1 2HWD3 4N53A 1NY71 3JBG3 4EJRA 2RR13 4Q4W3 1ZBA2 4NWVA 1COV2 2XBO3 1HRV1 2RS13 1F2NA 1OOPB 1AR93 1RHI3 4Y4YA 1K5MB 4SBVA 1PO11 4CEYB 3VBOC 5CFCC 1BEV2 3VDDC 1VBD1 2HWE1 4WM8A 1V9U2 1OHFA 2HWC2 4YVSA 5CFDC 1ZBA3 2WZR1 1COV3 5DDJ1 2XPJA 5J98B 1OOPA 1K5MA 1RUI2 1RVF1 1QJX1 4CDWB 1BEV3 4IV1B 4CDXC 2FZ1A 1PIV1 2RMU1 1RUH2 1V9U3 3VBRC 2HWC3 3IDEA 1RUF2 1NCRC 1RUC1 4Q4X2 3TN92 2PLV1 1PO21 1H8TA 1PO12 2R042 1TME2 2HWB2 1POV0 1C8M1 4YVWC 1RUI3 1VBA3 5BNOC 1ZBE2 3ZFFC 2BPA2 3JB4C 4AEDC 1VBD2 2GH8A 1MQTB 2HWE2 2TBVA 4GH4C 1RUH3 1RUJ1 2WZR2 4Q4X3 3TN93 5A33B 2RS31 1HRI2 1RUG2 4GMP0 4Q4W1 1PO13 3VBHB 1X36A 1TME3 1RMU2 1QJY1 3VBSC 1ZBE3 1VBD3 1PIV2 2HWE3 4RQPC 4FTBA 4BCUA 2WZR3 2BFUL 5D8AB 1ND3B 1HRI3 1W39A 1AYM2 1ZBA1 4JGYC 4RS5C 1COV1 1WCDJ 1RMU3 1QJX3 3CJIB 4QPGC 4RR3B 5C9AB 1QJU2 1B35B 1PIV3 2RMU3 4GB32 2WS92 2DF7A 2FZ2A 2PLV3 1PO23 1A6CA 1AYN2 5D8AA 3VDDA 1EV12 1C8M3 1FMD1 2X5IB 1VBB2 4IV3C 1D4M1 1QJU3 5CFDA 3ZFGB 5FOJB 1B35A 1RUJ3 4CDQC 4WM8B 4GB33 3ZFEC 1PVC2 2R062 2WS93 4YVSB 1RUH1 2RS33 5JZGB 2IZWA 5GKAC 1E57A 4Y5Z0 1RUF1 4Q4X1 3TN91 1M06G 1QJY3 4CDXA 3VBFC 5ABJB 4QPIB 1VBB3 2R041 1FOD1 2X5IA 3VBRA 1TME1 2HWB1 2WFF2 1ZBE1 5FMOL 4RFT0 3M8LA 3ZFGA 5K0UC 2R063 1R082 2HWF1 2BUKA 4Q4V1 4PDWC 1H8TB 3JB8A 4JGZC 3ZFFA 5JZGA 4RHV2 4AEDA 1FMD2 3DPRC 1HRI1 1RUG1 2Y26A 5ABJA 5BNPC 1EAH1 1D4M2 4QPIA 1RMU1 1QQP2 5C4WB 1ND2B 1CJDA 5L7OB 1DDLA 2RS52 1TMF1 1NCQB 4WM7C 3VBUB 3VBSA 4RHV3 1FMD3 4N53C 1FPN1 1NA1C 4FTSA 3NAPC 1AYM1 1FOD2 4RQPA 4N43C 1AR72 1BBT2 1D4M3 1PGW2 1PGL2 5C4WA 1ND2A 4CEWB 1QJU1 4JGYA 2MEV2 2RS53 5BNNC 4GB31 2HWF2 2ZTNA 4Q4V2 5L7OA 2QQPA 1RUF3 2WS91 1NCQA 4QPGA 3VBUA 1POV1 4CDUC
chains in the Genus database with same CATH superfamily
3BI3A 4ASLA 1EAH2 4OZOA 2QJVA 1SG3A 1FOD3 1W8FA 3A22A 2HWB3 3KV6A 2YC0A 1AR73 2JDAA 1CR7A 5FUIA 4BK5A 1ULCA 4QU2A 2Z2SB 3IT8A 1H0BA 2JE7A 4FPKA 4X6QB 5FWJA 1DYKA 2K0GA 4MXVA 4CRQA 5FDBA 1ZZCA 1OH4A 4AHYA 2DTYA 5J96B 4KNCA 3N7LA 4BLJA 4P14A 3HJRA 1G7YA 4CEWA 5KR7A 3LOBA 4CXWA 3VHNA 2HWF3 4BPZA 2GH2A 3R4DB 4CEYC 1JZ6A 4KI5M 5EJ3A 4BXFA 5JMOA 2PHUA 3EYPA 1FPN2 5CFCB 1U5YA 4IV3A 5JR7B 3LB9A 4C1XA 3CNAA 4UF0A 2AEYA 1SZBA 4CXYA 3SHRA 2UWBA 5F7UA 4FO9A 4I0BA 4IEZA 4Q1RA 5CA6A 4PDWB 3S7EA 5AC92 4P9YA 4Y1ZA 3ACIA 3I2FA 3S5AA 5IVCA 2LM3A 2G9ZA 3WUDA 4QXHA 4WVMB 1RUE3 2ZGLA 2JIJA 2WZEA 4P00B 4AG4A 1XNAA 4GZ9A 5ACA1 4CDXB 2Z69A 4H3WA 3HBZA 3BCWA 4IV1C 4M00A 5CFCA 2J1AA 2WWJA 1R1A3 1RUD1 2XLGA 3BIWE 5FYTA 2OKXA 1FNYA 1GOHA 1KS5A 3KVBA 1ZZBA 2OIIA 4HG6B 5K0UA 3ZIXA 4AFAA 5B2GB 2Y60A 5KHIA 1MVEA 4JRAA 5I0DA 5T3NA 3J9SA 4PDWA 1CAXB 2HWD2 4COVA 3DECA 5K4LA 1OF4A 2VD7A 2C0ZA 2NPIA 1VIWB 3KV4A 4YVWB 3SKVA 2WKKA 5BNOB 4WVMA 5FWEA 1NYWA 5BUVA 2VY0A 1QJEA 3L2HA 4IEQA 3V0BB 4U2AA 3ZPOA 1SFNA 3BUCA 1VRH2 5A3TA 1EV13 1YLLA 3NV1A 1YNAA 4ISRA 3ZYHA 4Q0VA 3KB5A 1SMVA 1W28A 4R9BA 5C8WA 3TRSB 4FPEA 1DYPA 4OYUA 1HN0A 3J8F2 1BBT1 2DCTA 1ENQA 1OD5A 4LO6B 4AEKA 4OCTA 1OLQA 1V0AA 2XQXA 4D3WA 1TVGA 3CDZB 3B93A 3KQRA 1NT0A 4OHXA 3AMHA 3T0BA 5CAZA 5FPAA 5FZ0A 3B3QE 3UKNA 1FNZA 2MEV1 4N43A 2K46A 4LKDA 4YVWA 4XACA 5BNOA 4AK3A 1MS9A 3J7LA 4PLNA 4UAPA 3V0BA 1GWMA 3VD9A 2ATFA 4YYOA 4MV2A 1O5LA 3IB3A 1F4HA 2JEMA 2JG8B 4XBLA 4NAOA 3N9QA 5JXJA 4TYSA 1AR62 1J3RA 5D8AC 1OUXA 1GNZA 2XH6A 2EIEA 2E7QA 4J1XA 1PVXA 3LFMA 3K75B 3WUCA 4QX5A 3ACHA 4NPMA 2BP6A 4DNYA 3GALA 1MEC2 1PX4A 3NNMA 5GZCA 4YRDA 3POBA 3ZXEA 1US2A 3AP4A 1VMFA 5GZFA 4MSVA 2CU5A 4PQ9A 1CZSA 3S0MA 5FLIA 1VBC1 3CL1A 3PLQA 2PYTA 4UFMA 1ULPA 4HSLA 4ONUA 1A8MA 2LW8A 2YUEA 2VVFA 4K8FA 4XABA 4LT5A 1QH7A 2JG8A 2DFBA 4CEYA 5GZGA 4A42A 1BZWA 4BDVB 1PK6B 1D2QA 3ZMNA 2H0BA 1HXS2 2ZAHA 4BIFA 1LESA 3PTRB 3D82A 1S4CA 4HXCA 1LHWA 2VGDA 2X5IC 5LEKA 2WQZC 4ZU5A 5F9TA 3INAA 3KVAA 1W6QB 2PFWA 4NOTA 2ZAAA 4XFBA 4MH0E 4W6YA 3ENRA 5DZFA 1SCSA 4QGLA 4NMIA 4AVCA 1XE8A 4NWWA 4ZPIA 1VBE3 5BNQA 2B42B 2KXLA 2YGLA 5LATA 1VB4A 2ARCA 3O1UA 1CAUA 1ASJ1 1WWYA 2ZX1A 4QKDA 5EYYA 4IV1A 1GR3A 5GLWA 5IK8A 2FCVA 5F3IA 2VCCA 3GGLA 3EHKA 3O1SA 1IGOA 5IK7A 1BXHA 1GP6A 1VB2A 1PZ7A 1HRV3 3Q8BA 1EUUA 2VZUA 4AVBA 1W6QA 1LCLA 4CCCA 1JI6A 1ENSA 2D6PA 3MGUA 1W0NA 2XBO1 4COYA 1YQ6A 1RVF2 2RS11 4AQ2A 2VQ0A 3SLIA 2E9QA 1JS9A 4XFGA 1CIYA 5CG8A 2XVKA 2HKXA 4JGZB 4XYXA 2RMU2 4D6SA 3AYEA 3IDBB 4E8DA 2OVUA 2R1BA 4QX0A 3WF0A 5KXCA 1YO8A 3QH7A 2QNKA 2BERA 4BK4A 1J59A 3ACFA 5M0TA 5C4WC 3O1OA 1ND2C 5B4XA 2E53A 4INDA 3VD4A 4ET7A 1IHMA 1G9DA 3OOXA 4W50A 3JXSA 4K40A 5GZEA 5KHGA 1IG3A 3NVCA 1GFF2 3HVDA 1NCQC 5LCWL 5J09A 3LE0A 5AC93 3WW1A 3FJSA 3M3OA 4BWOA 2JDUA 3UESA 1BEV1 1NA1B 3URFA 3FHQA 3JD73 2BJSA 3H1WA 4JDOA 2R071 1YI9A 3HQXA 3GNEA 4IE4A 5HCHA 2ET7A 4Q4W2 5FMOS 4AI2A 1GOFA 1ZRDA 3GZAA 1JU4A 2XL9A 1G6NA 1IZ3A 2P3KA 3NWKA 4FPGA 5FV3A 1D4VB 1O91A 2LS6A 4N90A 3V65A 5BNNB 2EIBA 5JLVA 1RB8G 1Q8SA 4ISQA 2EF6A 4XF1A 1YFXA 3RPQA 3KZ4C 1GKBA 2JB4A 1AXKA 2WNUC 2WNOA 5IVBA 1RUI1 2A75A 1O4YA 1ULDA 3PUQA 4B7KA 4Q4Y1 2HWD3 3W9AA 5F37A 1NY71 5A3MA 3JBG3 4LBQD 1YQ8A 3IAPA 3UGGA 3CMGA 4LK6A 1C5HA 3A7QA 3B7MA 4CCLA 2ZXQA 5LWBA 2Q30A 5CBLA 2Y6LA 2JKXA 1FT9A 3HOBA 2GAUA 3OPZA 1ULGA 3WVJA 4YG0A 4DQAA 1OT5A 1OOPB 1W05A 1K5MB 3POYA 4FVVA 1QF3A 3TBDA 4YM2A 4D69A 5C33A 3RI9A 3PDQA 2W1UA 2ZX0A 3LCPA 3Q8FA 3Q8AA 2WO1A 3NL1A 1PZ8A 4QHBA 3IDAA 3I4IA 4B7EA 1UU4A 2Q0AA 2O1QA 4D7YA 2NM1A 2A6WA 5J37A 3O5SA 2UWCA 1QOSA 4XFIA 1X82A 4UFIA 1JHNA 3AP6A 4FPFA 4P9XA 5CFDC 1CJPA 2O8OA 3PUAA 4XUNA 5FXXA 1COV3 5FK8A 2CDOA 4XQDA 5DMYA 4JDMA 1ULEA 4EE2A 2JB8A 5CEHA 5F32A 4FOQA 1OOPA 5F2SA 4HL0A 1K5MA 4DINB 2XXZA 5FY8A 5C3QA 3T0DA 2RDRA 4FFHA 3LWCA 2GALA 3PUSA 3PL0A 3AKPA 3GBGA 3JUUA 4JC1A 1V9U3 4AI8A 4LK7A 2QQWA 1EP0A 1YJLA 5IVYA 3U37A 4Q4X2 4QQOA 3AZYA 4JKMA 4XVHA 2W2IA 5K7PA 5FLJA 3T3YA 3KS7A 1PO12 2H0VA 1H1AA 2R042 3TNPB 5FO8B 1GZWB 2QQLA 2ZGMA 3PIJA 1VE0A 3HNMA 4P5YA 1C8M1 4LUKA 5APAA 2C24A 3ZFFC 5F3EA 1GZTA 1DZQA 5FYCA 5FY5A 2CHHA 2G9FA 3A23A 4GH4C 1ZREA 3HBKA 4WVWA 3RZZA 2ZKNA 4XEZA 4ZXEA 2JDNA 4QHOA 2Q5TA 1H9WA 3K77A 2ET1A 3WT3A 4K9SA 1DGWA 5FZHA 3TN93 3USUB 3ILFA 2P6CA 1RUG2 4GMP0 1AVBA 2VJXA 1EUTA 5FPUA 3B01A 3FFZA 1RMU2 4XUPA 4MG2A 1NE4A 4NHXA 1GZWA 5ANNA 4FTBA 2C9KA 3VZOA 1VBD3 2B9UA 2DUQA 2UU8A 3N35A 2CWSA 4XAEA 2HWE3 3LF7A 5FCCA 4QU1A 3JCIA 2X10A 5DAWA 5A3WA 3TB0A 4DUVA 4XILA 3OYWB 2NQYA 2N7GA 5IK4A 2VVDA 1JW6A 2VXJA 2QBXA 4QDRA 4ITCA 1ND3B 4NHKA 5FQ0B 4JGYC 3USUA 1OLME 5L9BA 2BBAA 3ZN5A 4MVTA 4DXRA 2P34A 1WBFA 3CJIB 4QQHA 3F2ZA 5JSPA 2VZVA 1SBFA 1JODA 1PM4A 1WCKA 1PIV3 2RMU3 4QX8A 2PXJA 2XWBB 2ZGRA 3ACLA 3NV4A 3HN3A 2JX9A 2LALA 5FBZA 5LK5A 4PIXA 1OKOA 2WS92 3LEKA 2DF7A 2ZKLA 4I2OA 3OYWA 2GC1A 3HIFA 1NLSA 1MZFA 2J1RA 3OBZA 3U4XA 1WMFA 5FY0A 1LOCA 4CP1A 1RL3A 2JDPA 2YFUA 3LQCA 2ZGSA 4JQRA 3USSA 1NLQA 1OA3A 4JKLA 5LBCA 1GBGA 1I5ZA 1VBB2 1XNKA 3RRDA 4IESA 4O9EA 3OTFA 3ROUA 5FXWA 5AFBA 1NE6A 2A6YA 2QQUA 2ZPXA 2XLFA 4FPLA 5CFDA 3VKFC 2Y38A 4YG3A 4CU8A 4FBFA 3NJVA 5A6XA 3UGFA 4CCDA 3LFIA 2E51A 2P17A 4AW7A 2ETEA 3ZDSA 1RUH1 4I30A 3ST7A 1UZZA 4N7UA 4AEMA 1J1TA 1GNYA 1Y9GA 2QZ3A 2A70A 1LOBA 1RUF1 4L8QA 4KWJA 5K8SA 2ADEA 2QTWB 4K20A 1XQNA 2ZX4A 1GQGA 1OVSA 3IIIA 3VBFC 1XNBA 3N3HA 4QPIB 4XIKA 3R4SA 3U78A 1LOFC 2GMEA 4W6WA 5A7WB 1TME1 1JU3A 1XU1A 5CKQA 2VECA 5A6ZA 5FZ8A 3GXUA 5FMOL 3WCSA 2FDHA 2D6NA 4QX2A 2Q8DA 4FXKB 4LIUA 3AB0A 1UYZA 1R082 2GNDA 3LZZA 5FRAA 1DLCA 1UWWA 4CCOA 1JYXA 2IFRA 1YFUA 3NRUA 2RDSA 5IW0A 5KXDA 1H8TB 4KWKA 4ZS3A 3WW2A 4P9IA 2HEWF 3ZFFA 1Q8QA 1RYYA 1GUIA 2WAAA 1FX5A 1HRI1 3POEA 4MLOA 1FV3A 1JYVA 5BXXA 1EAH1 1XJAA 2J1SA 2EAKA 4FP3A 4HFSA 4NHMA 4I3GA 4QPIA 4DIQA 3GM8A 4GWMA 1QQP2 2XQRA 3LEGA 4LBKA 2ZX3A 5A7WA 4I0AA 5JAXA 1W9FA 2DVGA 1EPZA 3I2IA 4YM3A 3O1VA 5A6QA 3LDKA 5I0TA 3AVRA 2W39A 1Q56A 2Y0OA 4XFAA 4WM7C 1QU0A 1KJLA 2FDFA 2FBEA 2GZWA 2QUOA 2D6KA 4IE5A 4EN8B 4WZFA 4XXAA 1L3JA 3FX3A 1FPN1 3I49A 4ARXA 1AYM1 1FOD2 2VBPA 2NMOA 1AR72 1ODMA 5FZEA 4IGOA 1A8DA 1JOBA 3AJZA 5T5PA 1UY0A 1CZVA 2CYFA 4E4HA 2NMNA 1JZ8A 4M0HA 5F6LB 5BPXA 2A5ZA 3OY8B 1QJU1 3OG2A 4Y24A 5KHJA 1OPMA 2WA4A 1E5RA 1YRZA 4JGYA 2ES3A 1W8HA 1Y3TA 1UZ0A 3B5LB 4NO4A 1RJ7A 2HWF2 4MGKE 3WX5A 1JZ3A 2XJUA 4B4RA 1C1LA 2WO3A 2D7FA 5CG9A 4CDUC 2VOTA 2VZTA 2YPJA 1AYN1 3BIEA 2R043 4XUTA 4BHPA 4AHXA 3KF3A 1BBT3 1HQLA 3MLJA 4IQPA 2J42A 1CPMA 4CU7A 3OPTA 1BKZA 2Q8CA 3PTYA 5JOYA 5A32B 1M4WA 4K1YA 4K8RB 1S2BA 2GN7A 5D2AA 1GOGA 2WO7A 1F9KA 2W68A 3NNFA 1GP5A 4B29A 1RUE2 1AXYA 4Q4V3 1PVC1 3VBOB 5FZIA 2ILMA 1OLMA 1H2MA 3WDXA 2QE3A 4IETA 1RUG3 4V2VA 3THDA 3N9MA 4CU6A 2XJPA 4Q8KA 3VDCA 4XUQA 2Q1FA 1R1A2 3LGRA 4YFZA 3NQHA 5FKBA 5GALA 3HWJA 4Q8LA 1SBDA 2PN5A 1VAVA 1C4RA 2BZDA 5IATA 1GQHA 4DUXA 5JSOA 3LA7A 1O3QA 1F5FA 3I3BA 1EPWA 3OEBA 4URAA 2VQTA 1GICA 5A32A 2WFF1 2DVBA 3FLPA 4QD2A 4QX7A 5DABA 2CNAA 5FZ3A 3SISA 5FY4A 1HQNA 1NOVA 3K46A 1HX6A 2GSYA 2QDNA 5E8AA 2FDKA 4S2DA 5J7MA 3AKTA 2Y8KA 4CDWC 3NKGA 3VBOA 5FR3A 3KSCA 2XVGA 4XOGA 3DL3A 3WNKA 4A3XA 1AR82 1W04A 3H1YA 4RHV1 4Z8BA 5F6KA 3VN4A 4F3JA 1F8VA 3CU7A 4LEJA 4YPJA 3LIHA 1NCRB 2WFPA 4Z1VA 4HZFA 1VAKA 1UOFA 5IVJA 4JAAA 3IM0A 4CSWA 4OI2A 1KQRA 3EBRA 5E6HA 5KXEA 1MEC1 1RITA 2W1SA 1JXNA 1POV3 1B09A 1CONA 1KJRA 2XMLA 2RS51 1FYUA 3UGHA 1VMJA 2A7AA 2JWPA 1MQTC 2NLRA 4YW1A 1MS4A 1AR92 1G9BA 2VMGA 3O0XA 3TEXA 1BK1A 1A34A 4MADA 2NYYA 1F31A 1W8UA 1US3A 1CQ9A 1E5IA 5FY7A 3MPBA 4OVEA 1NCRA 2BW8A 5I91A 1PGW1 1KS4A 1UOGA 5FXVA 5KHHA 3WP6A 1O3RA 3FL7A 1PGL1 4ZZ8A 4L2NA 3WSOA 5DUUA 3DKQA 1HXS1 1V00A 1QEXA 2ZA9A 3E6BA 4P9WA 5JXHA 3OUJA 3VZLA 4UXAA 3E5QA 4PQQA 4LHNA 2VU9A 3POFA 2K9ZA 1OA4A 2WNVB 3I2JA 5IYYA 2VVEA 3WG1A 2BOJA 4JHZA 1DQ0A 3BKZA 2VNGA 5SV8A 3GDBA 1VRBA 4AWDA 2ARAA 3RZKA 3JU9A 4XDQA 5HBAA 4JKKA 3U14A 1X9TA 3MW2A 2EIDA 4OI0A 5KXBA 4OMDA 1LB2A 5A7OA 4CDUA 2V4VA 2VZ1A 2Y6GA 4XUOA 2YC2A 3WOGA 4FT8A 3VZKA 4R8HA 1R083 2DUOA 5FXZA 4GAZA 4S2FA 3K4DA 3K4ZA 3PU3A 4LLFA 1XE0A 1AL21 4QPGB 4XJWA 4BQ2A 4RR3C 1MACA 1VAMA 4YZ5A 5C9AC 1YHFA 2VMFA 1B35C 5CADA 2FHRA 4XJUA 4B3NA 4NRMA 2RM21 1W6NA 3QOPA 2WNVA 1JZ4A 4H7MA 3WINE 2JDZA 4MYEA 1VBE2 1RC6A 3HT1A 4LORA 4BISA 1GP4A 5FUNA 3DYPA 4FTEA 1LHVA 1YC61 1QQP3 1R091 2P3JA 5FREA 4FI9A 2W47A 2Z42A 3OGGA 1WA6X 3H9AA 4R9CA 1JH5A 2EAAA 1ZZ6A 1ZA7A 4XHXA 2R073 4KGQA 2Q1ZB 3N7KA 5DUWA 4YM0A 2BQPA 5ANQA 4IV3B 4QM8A 1HRV2 5FAXA 1LECA 5A3NA 3PVEA 5LASA 4CDQB 2YBKA 1SFYA 4WM8C 2WAOA 3M3EA 4YARA 3IN9A 4NHLA 4TWTA 1KGYA 2W9XA 2PAEA 3UT0A 4YVSC 3ZXJA 1V6OA 2XJSA 5HCAA 4UFKA 4LLOA 4Q4Y3 1H1MA 2X05A 4CDWA 2DDUA 5C3OA 2GU9A 3J4UH 3FE5A 2WT0A 1QH6A 1Z7S3 1QDCA 1V6KA 2R7EB 5A1LA 4GMP1 1G8WA 1REDA 4ASKA 3QCWA 1LODA 3BTYA 1OFSA 1W2NA 2VH9A 5DG2A 3ZKUA 2DTWA 1VJ2A 2RR11 3QACA 3WHTA 2ZBJA 4PF1A 2RHPA 1YJKA 4CDQA 5K0UB 1WMDA 1WW6A 1W8TA 1QJX2 4QXBA 4J25A 1DQ6A 1JYCA 5K9YA 1HDKA 2IXKA 5JOXA 1MS8A 1IS3A 2VZ3A 2MPFA 2JJ6A 3AKSA 2PHWA 4BQYA 4Y1YA 1MQTA 1X9PA 3AYDA 4XZUG 1AJOA 1R1ZA 1XYOA 2CTVA 3BOWA 2DBNA 3JD72 4ZXKA 3NO8A 4UFJA 4GJYA 2PLV2 4XF4A 1RGSA 2MHFA 3VD7A 3ZXAC 5FO9B 1AZDA 1PMHX 3ALQA 2PHFA 4MOAA 4QX3A 4XDOA 4DY5A 5AFEA 3ZXDA 3V0AA 1TEIA 2ZZQA 4IEOA 5EYXA 5HCBA 5LBBA 1W9TA 3I8TA 4PLMA 4K3UA 3M70A 5H9PA 4W8JA 4YNIA 3KT7A 1SLAA 2J7MA 1CD3G 1GZCA 2ZMNA 3I54A 1RUJ2 5FYVA 1W0OA 5FPVA 1OD3A 4EZ4A 1BMV1 3JBG2 2BNMA 4N43B 4Q29A 4AZZA 3VL9A 1W3XA 4N9IA 4G9SB 2BNOA 2O14A 4AR2A 1AR83 3I97A 4UOJA 3ON7A 1QJY2 2AZ5A 4UW6A 2VOVA 5LBEA 4BMEA 1S0GA 4D8MA 3H7JA 2XONA 3H3UA 1W8NA 2BVBA 2LRPA 2V4AA 3A4UA 2EXIA 5LA9A 4RR3A 1VBA1 5C9AA 4NPLA 3JQXA 3POJA 3SCFA 5EIYB 4GWJA 4F83A 3J7MA 2EALA 5CU1A 4EJRA 4F8AA 2D3RA 2YC4A 3ES1A 3E6CC 3FBYA 4HVQA 4C0HA 4NWVA 4CE8A 1OBNA 1COV2 2OA2A 1ZRCA 2ZS6B 1CWPA 1OF3A 3AXDA 3KF5A 1AR93 1RHI3 4Y4YA 5A3OA 1PO11 3M3QA 4G4FA 5IT6A 2IXIA 4DUWA 4CEYB 3AKQA 4PT6A 3NMBA 4CZSA 1F5JA 2VQAA 3VDDC 3EO6A 2XJQA 4TTGA 1WCSA 1UCXA 4MXWB 3RZMA 4Y1VA 4WM8A 1V9U2 3ASIA 1ACCA 4YVSA 3KV5A 5HV4A 3RYKA 2VW2A 4IDZA 1TZOA 1DG6A 1MZ6A 3MLLA 4Y4RA 1SLCA 5DDJ1 2XPJA 3UETA 1T6BX 2FMDA 5AVAA 2IXLA 2GNMA 1W0PA 2WZ8A 2Y34A 3SH4A 3WG3A 2J1TA 1IS4A 4HLTA 4ASMB 5I0RA 3IBMA 3ZR6A 3LD8A 3RWKX 4F7ZA 5A1FA 3HQRA 1PMJX 1K5JA 2PHTA 1UO9A 1GQPA 3C7EA 1CAUB 4LOSA 1AF9A 4XQ4A 4IV1B 4RFRB 5FJHA 4MGZE 5FZCA 4IEYA 4LPLA 2JG9C 4R9DA 4AFCA 4B8EA 4D6QA 4MXWA 4YFWA 1PMIA 3VBRC 2HWC3 1IKPA 4N7IA 4XMIA 2CDPA 3E97A 1RUC1 3TN92 4DXTA 2ZABA 1PO21 2PAMA 3I2HA 2L9LA 5JMCA 1G9AA 3AYAA 2VQUA 1DU3D 3CKHA 4GJZA 1QIQA 3JZVA 2JECA 2A1XA 3BU0A 3WP4A 3AFGA 4L92A 5F1RA 4AFDA 1JYIA 1NLRA 1O3TA 4AEDC 1VBD2 4JV4A 2HWE2 3SEPA 1FV2A 2E7TA 1XYNA 3WG4A 2F4PA 1RUH3 2DCKA 4UYBA 2KM2A 3D5OA 4COZA 2D5FA 2I07B 5JXIA 1NX9A 2KA3A 2RS31 3WQ1A 3HNBM 3DXUA 1X36A 2HBUA 2XL7A 3C2UA 1TME3 1LU2A 1UMZA 2ZEYA 3G6JB 3VBSC 1UOBA 3A0KA 3S57A 5IJRA 1W8WA 1WD4A 1I6XA 2RDQA 2JD9A 1PIV2 1MZEA 2B4KA 2VOXA 2Y0IA 4UW4A 4CP0A 4RQPC 1WLWA 5B4NA 2P4EA 2YXSA 2OPKA 4E2GA 4GXLA 3MZHA 1IG0A 2XKOA 2WZR3 2QVSB 3T4HB 2XVLA 5F5AA 3M2MA 5D8AB 4CCMA 1XRUA 1PNGA 1HRI3 4EQVA 1ZBA1 4RS5C 1WCDJ 2D40A 5TSWA 2AENA 4ES8A 4COWA 4DXSA 1QJX3 5C3SA 4HN1A 1KITA 2BWAA 4Q0PA 3N7MA 4LHSA 5F5CA 5GLVA 3K3OA 4LTAA 1LOGA 3RJRA 5FYSA 4E2SA 4BM8A 1HJGA 3DV8A 3P6BA 2D5HA 1DCSA 3WNLA 2C9AA 1AHSA 3PU8A 2WYSA 5F39A 5F5QA 2ZGTA 4AHWA 4EN9B 2PLV3 2FZ2A 1XSQA 3AC0A 1Q43A 2VBDA 4V2WA 2YGMA 3TAYA 3ABZA 2Y6FA 1IOAA 1GNHA 1I5PA 3WF1A 3MO4A 5D8AA 1U5ZA 2VPVA 2JIGA 3NSTA 2PA7A 3VDDA 5FPLA 2QQJA 1Z0HA 1YFYA 4R4ZA 2X5IB 3ZLIA 1I9RA 1T6GC 4LE4A 2Y6KA 5FMDA 1QJU3 3BVCA 4LBNA 1SCRA 2VNVA 2WWUA 5D21A 1OQEA 1RUJ3 1KDMA 3ZFEC 2XDVA 4HVOA 2EA7A 1SLTA 5HXMA 4CCEA 1ODNA 1YI7A 1WKYA 5FKCA 2SLIA 2ZEZA 4GULA 1W2AX 1FATA 2IZWA 4IEXA 4EN0A 3UKVA 1K12A 2V09A 1OA2A 2JICA 4Q0SA 3FUQA 1SBEA 3N36A 4TN7A 3UJOA 1QJY3 4KG0A 3ZDVA 3UKTA 5LA0A 3H8RA 2WQ4A 2DV9A 4QHZA 4LBMA 4Q2FA 4BQWA 5LZ6A 1FOD1 1KD7A 2X5IA 3PVOA 3VBRA 2HWB1 3UNPA 2RE9A 1ZBE1 2YB7A 4M4RA 4LUMA 1H2LA 3M8LA 4NIHA 3UYJA 4KBBA 5T5JA 3ATGA 4YZ3A 2Q8EA 4UW5A 5A3UA 2HWF1 1CN1A 2BUKA 1IKQA 2OPWA 2BGPA 1U0AA 3KCYA 4GWIA 3LEIA 4LIVA 3DPRC 4FFIA 3T08A 4AEDA 3LA2A 4LITA 1MS0A 4JVAA 2IXJA 2X09A 2D6OX 2JXAA 3U4SA 4FOYA 5BNPC 3GBFA 2EIGA 1WW4A 3IPVA 3NJYA 4JTNA 3U07A 5FZLA 4BQ5A 2AACA 4LBQB 4AFBA 5C4WB 2ORZA 1HB4A 4IUGA 1ND2B 4JDNA 3I3MA 5A7NA 2ZCWA 2R0HA 3CBNA 3K4AA 3THTA 2A73B 2GNBA 1J3PA 1ZZ9A 3T2TA 4MGTA 1NCQB 1KEXA 4CXXA 3VBSA 3ZYGA 1GWKA 2Y64A 4NN0A 2W95A 1YQ2A 1TG7A 4GD4A 4RHV3 1FMD3 3DYOA 4N53C 4FOVA 3NAPC 1L7RA 4GA9A 4DFSA 5F3GA 4RQPA 3ECQA 3L9JT 3QD6A 4ZZ5A 1BBT2 1D4M3 2VTXA 4DEVA 5IHRA 4LJHA 4LBQA 2LUWA 5C4WA 3S5QA 1ND2A 1W8ZA 1QXJA 4AGVA 4LHKA 2MEV2 1H4HA 1SPPA 2RS53 4GB31 2VCBA 3DEMA 4Q4V2 4LA3A 3K48A 5DAXA 2PHXA 1NCQA 2WNUB 3OBRA 5T55A 3OCPA 4C1WA 2QQKA 1LKNA 2HYKA 5L9VA 3T1LA 5T5OA 1GLHA 2WSVA 3MF6A 2OUJA 1EV11 2VZRA 4AFMA 1OC1A 4BQ4A 2XG3A 4JZRA 4OHZA 4XXPA 1LENA 1JN2P 4Q27A 3BTXA 1V6IA 1BLZA 3VLBB 4OUSA 2WT2A 1MS5A 3ZM8A 1ZRFA 2TNFA 5CIRA 4OHVA 2VXRA 1VBC2 2R061 4WZCA 1VALA 1GANA 3AXEA 4LBOA 5A7SA 2WNUA 3H50A 5EWSA 1KFUL 2OZ6A 3C7GA 3GZUC 3OEAA 5H9QA 4HKWA 4CUGA 2VNRA 5A3LA 1BK0A 3BTZA 1O4TA 4DRRA 5ISLA 3VKOA 5CFDB 3N7JA 4YM1A 4QMAA 2C4XA 3ZOIA 5FMBA 3SNMA 1TMF3 1ALYA 1AL23 4GKYA 4XFHA 3NJZA 4EN6B 1E5SA 2Y6HA 3ETQA 3IDCB 1R64A 4TXWA 4K1ZA 1YFWA 2P37A 4AAXA 2RM23 5FYHA 2ENRA 3FBMA 3MYXA 1CGPA 5C6CA 3BPSA 3PURA 4UWDA 3W21A 4Y3OA 3S6PA 5C7GA 3OPWA 2FCUA 5FY9A 4XE9A 2LROA 3B94A 4E27A 1ASJ2 1HN1A 2IUWA 3ZYPA 1X8MA 1DBNA 4QXCA 5FPXA 4NIAA 1H4GA 4CPBD 1YEWA 5A1AA 1N47A 2FMYA 2OT7A 3DPRA 3FLTA 3L2YA 5GM0A 3SH3A 3V56A 2V5YA 5FOBB 3O1RA 4XF3A 5IWFA 5BNPA 1JUHA 3MFAA 4YGBA 4FSJA 3ZFFB 3BPZA 3ELNA 3POIA 1O6UA 2XBO2 3SKJE 3FHIB 1DLLA 4TSVA 3MW4A 3I2OA 3NNJA 4GH4B 1D2SA 4SLIA 4UBGA 1UIJA 3DYMA 1RXFA 4IE0A 4XBNA 4QDQA 4NIGA 3W5NA 1O7FA 3KM5A 5CISA 2RJLA 3WF3A 4IGPA 1DHKB 4DB5A 5FP7A 1JBCA 3NV3A 1LJ7A 2R32A 4GMP3 2DU1A 3J7NA 2YZ4A 4X8NA 3VBHC 5J36A 1HB1A 2VZQA 1N1TA 1W06A 3NAPA 4BZ4A 1OI6A 1UZWA 3RMXA 5FO7B 2C5DA 5GJ6A 2C26A 1UX7A 4U36A 3IIAA 2XOMA 3SEEA 3FN9A 3VBSB 2ZGNA 5GZDA 1QNYA 2WNEA 4KBZA 5CZKA 2EXHA 3HMYA 2FDGA 1GV9A 4URTA 4GH4A 4PIYA 3MIEA 3HN1A 5JOZA 4JCKA 1QHDA 4NRQA 5LB6A 3RWNA 4EYUA 2JDMA 2XB6C 1H9PA 2GDFA 3MIBA 2NP0A 1CAVA 2IXCA 3FC0A 3LEMA 1N3PA 4UI9L 3PUHA 4JGYB 3C7OA 1L7QA 4YG6A 5FZDA 2WC2A 2OXBA 4N9HA 2R072 1YCIA 5FK7A 1UY2A 4Q26A 2FDIA 3TNQA 5ACA3 1FAYA 3AP5A 1KDKA 1QOTA 2VZPA 4A7ZA 1RUD3 3RJ2X 2WR9A 1NZCA 3WQ0A 1SACA 4ATEA 1BQPA 4DRVA 5F3CA 3MUY1 2WN3A 4TLFA 4OHYA 2V73A 3N9PA 2WO2A 4X6RB 4Q4Y2 5A3PA 2JE9A 2D44A 3MIFA 3HD8B 3HAGA 1NY72 2WABA 3QLQA 3W20A 2R49A 2EICA 3ZSJA 4YZ2A 1Z7S2 2FDJA 2A3XA 5AC91 1SLIA 4AI0A 2WL1A 4UFHA 3EMRA 2VW1A 4IEPA 3UJQA 2SBAA 4Q5OA 4COUA 3JD71 1TQ5A 2YBSA 4QPWA 5T5LA 5LY2A 4CTEA 1CZTA 5A70A 1X33A 2WWSA 2BWCA 4H7LA 3ZFGC 5FJKA 1XOYA 5FIXA 4RYDA 4ZU4A 2KD7A 4B1MA 1J84A 2PQSA 3ZO0B 5FLHA 5FZOA 3X29B 4FAGA 4LA2A 3Q9OA 3HNYM 5JZGC 4I02A 4O9GA 2ZMLA 1AX0A 3ACGA 3EQEA 3KT1A 3RS6A 2DFCA 2ZGUA 4LKSA 4Z07A 1U5IA 3VBFB 3VZNA 1W3VA 2ZHNA 5ABJC 1OPOA 2MEV3 2E7AA 4PF5A 4W4ZA 4Q0UA 2HWD1 2DCYA 2E63A 4B4QA 1W9SA 4XPVA 2ZGQA 3JBG1 1AR61 1STMA 5FZ6A 3ZR5A 1L7LA 5JIAA 1VRH1 1X7NA 3U11A 2B8MA 3OUIA 1JZ5A 4PI0A 3RZLA 1IS6A 3KQ4B 4DO0A 2VCMA 4O61A 2CSGA 2I74A 3J8F1 1N1YA 1VMHA 2A3YA 1UF2C 4XZPA 1GYKA 4RGAA 1LRHA 1LNSA 1O8PA 5BY5A 4OQ9A 5H9RA 1AX2A 1OH3A 4GKXA 3VBFA 1DQ4A 3BALA 3MI8A 3H8UA 4XBQA 3GF6A 4LO8A 5LRRA 1OKQA 2UY8A 2WZPP 1VBC3 4LXLA 1LOFA 3M3CA 5JOWA 5DDJ3 3LAGA 3KMHA 3PIGA 3I3QA 4YW3A 2DURA 2Q1MA 2ZEXA 4XETA 1WGPA 3PUIA 2ZACA 3RVHA 5A33A 4ATFA 2TEPA 1C8M2 5T52A 1XNCA 5FFOC 5L7OC 3VBHA 4C0BA 5J1XA 4NIDA 5FBJA 4WM7B 4N8MA 1CX4A 3VBUC 3ZXLA 4BU2A 5DAPA 5KWRA 4A44A 3ZYJB 3RNSA 1X8EA 3MEPA 1BCXA 5FZGA 2FQPA 3FUOA 4GALA 5EJZB 1RUC3 2PMWB 3LA3A 3U75A 1S0BA 2VC9A 1V9U1 3RFRA 2VR4A 2VM9A 1XC6A 1YIPA 3LSEA 3AMMA 4CEWC 1UXXX 1RHI2 2WRAA 3VHPA 5BV6A 2W1WA 4RGKA 4M3CF 3LPFA 4IE6A 2BTVC 4YW4A 2D3PA 3POGA 1XXNA 4WM7A 1WUVA 3E6DA 1ASJ3 3I2GA 1KFXL 3QBQA 4YGEA 4CDUB 3B69A 5FUPA 4DPNA 4FQ4A 1FI2A 5FP8A 1A78A 3BODA 4YGDA 5GLUA 3AM2A 4CU9A 4DXZA 5LRSA 2I2SA 2G9GA 1TE1B 4KG8A 3ZMOA 5KHKA 4OZXA 3VZJA 2XUEA 4XFFA 2XBO3 3IMMA 3TEZA 4DMIA 1SLBA 1W6NB 1DIWA 2GN3A 5DUXA 1OQDA 2RS13 1BJQA 4FPHA 3PHMA 4HSJA 4OI1A 2V5DA 3ZXKA 2X8KA 4OLLA 3ZYRA 4MGSA 4BA6A 4HVRA 4C8DA 2E26A 3CZJA 1NAEA 4K21A 4QB6A 3HPNA 3KD4A 4BYYA 4MUVA 1LTEA 4MGQA 4QQPA 4EZHA 2HYXA 3ETPA 4AVTA 5CFCC 3T2OA 1YWKA 2ARXA 2E33A 2QFEA 1VBD1 3MV01 3OD0A 4IEUA 2D3SA 2HWE1 3GHNA 5FYUA 1PNFA 2HWC2 4MO3M 1W6OB 4G3YC 3F95A 5F2WA 3TOJA 3K51A 1XSRA 1ZBA3 1ZX5A 3HT2A 1X50A 1WLTA 2GMPA 4NJ4A 3T4VA 1GU3A 3MICA 3T0AA 1UPIA 5J98B 1GMMA 3WDTA 4C91A 1HQWA 3B02A 2F17A 5FYMA 1D7PM 5F5IA 1UY4A 5JXGA 1RVF1 3BGAA 4LNVA 1LAJA 1I3HA 2CAUA 3FFQA 4IW3A 3MW3A 4CDWB 4CUAA 1BEV3 3U0ZA 4L97A 4XJAA 3VD3A 1DGWX 1VP6A 2ZMKA 4AXOA 2X53S 4CDXC 2FZ1A 4OHWA 1IPSA 2OQ7A 1PIV1 2RMU1 1UN1A 2AYHA 1RUH2 4O65A 2PHLA 1JZ2A 1LGNA 3ME2A 1SLLA 3IDEA 3O12A 4LE3A 1RUF2 1TNFA 2YBPA 5JPNB 3TEYA 1W6OA 2YPDA 3CF6E 3AZWA 3NKTA 4KQ7A 5CB7A 2CGPA 3AKRA 3VV1A 1YQ5A 2QQNA 1DZRA 4OFGA 4MHUA 4XTPA 3GYDA 1TME2 4A2UA 1DYOA 1Q8OA 3OF1A 1NQDA 3SXWA 1QWRA 4YVWC 3ZN6B 1KXGA 3IKWA 1RUI3 2GMMA 4XF0A 4YW6A 1LEDA 3AMNA 5BNOC 3PJYA 4MGYE 2R16A 2BPA2 3RZGA 4FQZA 2GH8A 1W6PB 1MQTB 1ST8A 5HPOA 5L36A 1ZVFA 5CKNA 4Y5TA 3OD4A 3MFCA 1HW5A 2WZR2 4Y26A 4EN7B 2O8QA 1U12A 4YWAA 3PVBB 1S0EA 1S0DA 3CIHA 1HRI2 4HPKB 4Q4W1 3V0AB 3BOPA 5T54A 3H1MA 3WNPA 3LSDA 3VL8A 2UWAA 4L99A 3SMHA 1ZBE3 4I01A 2DVDA 3ZN6A 4XCAA 3WQBA 3O14A 4Q1PA 1CX1A 3WZ1A 3MDPA 3H8XA 3H7YA 3I2KA 4AVAA 4E4ZA 1W6PA 3SH5A 5A6YA 2QQIA 2BGOA 3H3ZA 4QDSA 2PHRA 2XHNA 5DQ0A 2JG8C 3ZYBA 5IK5A 1T2XA 5IVVA 1PZ9A 5FZ1A 4JTOA 5I8YA 1QXPA 3WV6A 2BDRA 1UYPA 4JQTA 3WHUA 3C7FA 1CIWA 1AYM2 3ZXGA 4HPKA 3D6EA 4A41A 1IQAA 5FZBA 4BOWA 4AI9A 5JI7A 5F8PA 4FCAA 1UQXA 2XUMA 3N4MA 4RR3B 4XF9A 3VKLA 5C9AB 4EWAA 1QJU2 1B35B 3AL5A 4XIOA 4EV0A 1DGLA 1XB9A 2DYCA 2H6CA 2YYOA 3S30A 2CL2A 4WV8A 2CGOA 2HEVF 1ZZ8A 3BU7A 3LOIA 3GZTB 3WDUA 5FZAA 2WBKA 3C3VA 4BXSV 4IL7A 3KHCA 3P3NA 2WIIB 4E8CA 1YUDA 2BU9A 4LR4A 1LEMA 1AYN2 1PK6C 3GZEA 4M0NA 4W6XA 1VPHA 2G4IA 3T1MA 4GWNA 3R6SA 1Y9QA 4HETA 1C8M3 2R1DA 4P02B 2BNNA 4HMZA 1P8JA 4XDPA 3AFKA 3HR9A 4Y22B 3RG0A 2H6BA 4QB1A 1V6NA 3OBAA 3LPGA 2VUAA 2ZX2A 4R4XA 1VLNA 1B35A 4HANA 4GB33 4NVPA 4WM8B 5SV5A 3AMPA 2AREA 3THPA 1PVC2 2ORXA 2ZOEB 4UT5A 5E16A 4YVSB 4YSFA 5JCTA 5FYYA 2P5BA 3FWEA 2ID4A 2PHDA 2JE8A 1G9FA 1C3HA 1W2TA 2D43A 1C28A 1E57A 1O5UA 2W08A 2XGXA 1AXZA 2Q4SA 4Y5Z0 1HLCA 2YMZA 2OW4A 1ZM1A 2KR2A 4OUMA 1UMHA 4J6GA 4Q4X1 4CDXA 1WMEA 4YW7A 1NQJA 2IWGB 2VMHA 2R041 3DCQA 2YFZA 3I7DA 2OUHA 4Y22A 2WFF2 3H0OA 4PJYA 5H9SA 3W59A 5FZ7A 2ZJCA 4Z82A 4DEQA 1CPNA 4QXKA 4JHTA 2B5HA 4RD7A 2R063 1CAXA 5GLTA 4TZDA 1IPKA 1UPSA 4X8PA 4Y1UA 2ZHLA 3D3AA 4NAMA 1J3QA 4LQRA 4Q4V1 4Y20B 4JGZC 3JB8A 4P5HA 5HCFA 3QH6A 4BLIA 4RHV2 1C57A 5HXVA 1LOAA 1FMD2 2AH2A 3EJKA 1XPWA 1AJKA 4CCJA 1RUG1 2GC3A 2F6BA 3JQWA 2Y26A 1HIXA 2A6VA 4J1WA 5FTTC 4AI1A 1D4M2 3IMNA 1RXGA 2RG4A 5FPZA 4E4SA 1RMU1 4ZONA 1V70A 3T2PA 1TNRA 1CJDA 4BIOA 5ERLA 4AVVA 3HQUA 5IVEA 3I59B 3R4UA 2RS52 4XHBA 4XJZA 3WCRA 3WP5A 2YU2A 1ENRA 1NKGA 4GQ7A 5LBFA 1UYXA 2QQOA 4Y20A 1NA1C 4FTSA 5KBFA 4PBOA 5DUVA 4MZUA 1MS1A 1S1AA 1AX1A 5DZEA 4RGGA 3SCHA 5E88A 1SDDB 2GC0A 3THCA 3AYCA 1PGW2 2RVAA 3SITA 5JPMB 1PGL2 1S55A 2CGNA 4NHYA 1UX6A 3MF9A 3S7IA 1BVP1 3CQOA 4K7JA 4HK8A 4QX1A 4UFLA 5JR2A 1MVQA 2E31A 5BNNC 5KC5A 3KT4A 3OGVA 2WDBA 1PHMA 3VB9A 3I59A 2QQPA 1DP0A 1RUF3 1BHGA 2WS91 4HONA 4A6SA 1POV1 3I2DA 3ES4A 5IAVA 3VKMA 2D6LX 5EPAA 1ZRRA 4W65A 5DG1A 4XTMA 2VBBA 5HV0A 3OGRA 4S2HA 3R0RA 1ZRIA 4XMAA 2VO5A 4FP2A 5GLZA 1VBB1 5EQUA 4FAHA 1QJZA 5E89A 4QGNA 1PK6A 4AGRA 1XNDA 1OOPC 1TMF2 3NNLA 2WN2A 3NW4A 2NN8A 2YG0A 4KWLA 1AL22 1K5MC 2WSUA 4CA9A 4XQWA 3D4KA 2EXKA 1SQ4A 1UZVA 3WQ7A 2W52A 3VZMA 2RM22 2JDYA 3VDDB 4ZU7A 5L19A 3MUZ1 4NIIA 1D0GA 3MIDA 3WF2A 1EAH3 4FOWA 4OI4A 1LU1A 1R092 2Y33A 1UU6A 1UYYA 3T2QA 2D98A 3OSDA 3RYRA 2VG9A 2VMCA 3B9IA 3B9CA 4HOOA 3WNMA 5JIUA 3V64A 3WD5A 4ZHNA 1WLCA 2W94A 4PCRA 4KH9A 4PHZA 1F35A 2PAKA 2IC1A 2VZSA 2K2SA 4FXGB 2QZ2A 2Y6JA 4P9JA 4YZ1A 3ZN4A 1AL0G 1R081 1FPN3 4LKEA 2XLAA 1VR3A 1N3QA 2CAVA 2D97A 2WLPA 4K6BA 1AYM3 3ZVXA 2JG9B 1J1LA 3VBRB 4ZS2A 3W5MA 3N9OA 5A80A 2VW0A 4A7YA 3KLSA 1MPXA 3Q8EA 4YLZA 5DAQA 2VAUA 4ZKTB 1QQP1 3PMSA 4JGZA 2HBTA 4AOCA 1D0HA 2P2KA 1BYHA 2CY6A 4WBBA 3RQ0A 1H2NA 4OQ8A 1AUYA 4S2GA 4YW2A 2IXHA 1DF0A 1F15A 2GP3A 4V1PA 5CNAA 5FZMA 3RGBA 4BE3A 2RR12 2W46A 2HJIA 2VL4A 1QMJA 3R05A 1LHUA 4AEDB 1WW7A 1AYN3 5LA2A 1W9WA 2FD8A 3J7HA 1UD1A 3EXUA 4NE9A 4D6RA 2RDNA 4ARYA 2GNTA 3EB7A 2PELA 1S2EA 2J1VA 3IPVB 5EP9A 2JG9A 5I0UA 5LK7B 4QGMA 1Q5OA 2JD4A 2BRTA 3AZZA 2EXJA 4XURA 1AR71 3OGSA 1NG0A 1WLDA 4Y33A 2FCTA 2XJVA 4NR1A 5IAXA 5I0SA 1CVNA 3H3LA 1UNBA 1PVC3 1NA1A 3WEZA 4LKFA 1AR63 1Z7S1 3MHZA 1UOJA 2YY1A 3AP7A 1GWLA 4IE7A 4IEVA 3TWIA 5ACA2 4KMQA 2W92A 2E32A 4CCKA 1YXWA 3GCXA 5DZGA 1VRH3 2XKPA 1RUD2 1DZTA 4RQPB 2ZZJA 2XWJB 1ZNPA 3MIHA 1APNA 5C8CC 3CO2A 3OB8A 5FYIA 5BNNA 3J8F3 4META 2J22A 4I09A 2WFF3 4H14A 4CP9B 4XJ8A 1ND3C 1UY1A 5CVRA 4MX3A 1BMV2 2VMIA 1OURA 3MBWA 4RS5B 1SPPB 2WQ8A 3VDAA 3IWZA 5JWPA 1JZ7A 3I3EA 1WZXA 5EXOA 3CJIC 4XJ9A 1O59A 5C5UA 2DVAA 5FY1A 1RUE1 1LGBA 4HT1T 3ZYIB 2RV9A 4E2QA 3RI8A 5KC6A 1QXRA 2W91A 2OZJA 1RIRA 1H8VA 2VCAA 5FYBA 4FFFA 1LHNA 1ZA4A 4L11A 3KCXA 4I3PA 4QQLA 1R1A1 1VBA2 5FZFA 2R30A 2P6HA 1JOPA 1MZ5A 2A6XA 2XJTA 4CP9A 4Z2AA 2CV6A 1Q8VA 3O0WA 1MEC3 3GJAA 3KV9A 4RS5A 3PJQA 5J3UA 3WDYA 3PNAA 3WY6A 4TLGA 1WD3A 5JDBA 1U5XA 1E5HA 3FLRA 4LULA 3WW4A 3Q8CA 1HKDA 4E4DX 2R0FA 3ZFEB 1AR81 2BYVE 3CLPA 3UK9A 2BFUS 4LBJA 3VHRA 1W90A 5EJ1B 2UYBA 1WMXA 4LO5B 1EY2A 4ZY9A 3ZX7A 2XHKA 1HXS3 3ILNA 3WR0A 2HEYF 3IAQA 4QKBA 2OYZA 2YHJA 5C3PA 1Y9MA 2PTMA 3W58A 1RUNA 1DGRA 4QPIC 2JDKA 5DPNA 3NNGA 4RSUA 4EROA 1DGRN 1OXCA 5JUVA 3RZHA 1H6YA 3FZ3A 5DDJ2 3T09A 1URXA 1NUKA 3MV11 1C1FA 4NPRA 1QOOA 1PX3A 1G9CA 1OLRA 3B00A 1BVVA 1LOEA 1N1VA 1DFQA 3KGLA 1AR91 4MHRA 1RHI1 4L9BA 3ZFEA 1I1EA 3TEWA 3ZSKA 2YROA 2UYAA 1H8TC 1HV0A 2B46X 5EHDA 3SQOA 5BYNA 3WXPA 2CWMA 3DPRB 2OQ6A 1UY3A 3FHAA 3RSJA 3WF4A 5C8CB 2BV4A 1S0CA 3ZKYA 3HEIA 1HV1A 4M01A 4D94A 1QNWA 3AX4A 5BNPB 1RUC2 2YU1A 2G19A 5JI9A 4IEWA 1H1IA 1PO22 4M4PA 1OQ1A 1O8SA 1KRIA 4QPYA 3VHOA 1RVF3 1DQ2A 1R093 2Z79A 3WDWA 4A7KA 3ZSLA 4DY3A 1H2KA 4YGCA 1UXZA 3T30A 4IERA 4N53B 3DN7A 2J1EA 3M7AA 3NAPB 4WVVA 5C8CA 2GC2A 4Z92B 4L0PA 4BQ1A 3ZPYA 4Y5SA 2RS32 2HWC1 2LTNA 3APBA 4NRPA 4AAPA 2ZEWA 1K42A 4LBLA 1IQDC 3P1IA 1V6LA 4HKLA 1ND3A 2R6QA 2RS12 4LO4B 5FQ0A 5J48A 2QQMA 1ENXA 1UAIA 2VUCA 3DUIA 4YW5A 2WJSA 2VZOA 3ORJA 1MS3A 4OUEA 1QDOA 2IVJA 1CAVB 3CJIA 1LGCA 1DQ1A 1VBE1 3GCWA 1FXZA 2VUJA 4BJ0A 5JSRA 5FYZA 1Y4WA 2BBVA 1C8NA 4AI3A 1XE7A 3O0VA 4CYDA 2YDEA 4XC9A 3LKJA 3O1TA 4N53A 2W87A 1J58A 1JTZX 2VOWA 1V6MA 5FZKA 3POSA 2B7YA 1XYPA 1NXD1 3KGZA 2RR13 4Q4W3 1ZBA2 3PVNA 2DWRA 1K45A 1JYTA 4KU8A 4LOTA 1HRV1 4BQ3A 1F2NA 5EFUA 1HJFA 3LDBA 4RA0A 2JENA 5AVPA 2OS2A 4SBVA 4CUCA 2WYFA 3WNOA 4A45A 4AVSA 1MR5A 1SFPA 3VBOC 4AF9A 2XR4A 2IFWA 1BEV2 4XCBA 1WBLA 2VE1A 3AZVA 2AR6A 1ULFA 2TUNA 3OJBA 5I8SA 4QQ2A 1REEA 4PBPA 1OHFA 3UV9A 3K2OA 4D7SA 3BTAA 2VMDA 4HBNA 1OMIA 2A6ZA 3KHBA 2WZR1 2ZGOA 2QKDA 5D1IA 4LO7A 4R52A 3AZXA 1Z78A 4PIZA 5FP9A 5FZOB 4DZGA 1UL9A 4CPBA 4AQTA 1RUI2 1WA4A 1QJX1 3C8XA 2AUYA 3BYWA 5IVFA 3D0SA 3UL2A 4KWUA 1G86A 1LULA 2G1MA 3CEWA 3GJBA 3O1MA 3CJXA 1UKRA 2X29A 3ZSMA 2AEZA 5C70A 1N3OA 4CVUA 1NCRC 2NZ9A 1HB2A 4PLOA 1JYNA 2PLV1 1QY4A 3SCGA 3WDVA 1NZIA 2VUDA 1H8TA 4HK9A 5EV7A 2RJ2A 1WCQA 1WW5A 3NV2A 4H55A 3U10A 2RJKA 1JHJA 2HWB2 1POV0 3KCCA 4FPYA 1ZYBA 2VULA 4M3CE 1UMIA 2QDRA 1VBA3 1GSLA 1ZBE2 4XAAA 1XBFA 3JB4C 2HLEA 1H6XA 5FMCA 3RDIA 2V72A 3ITQA 2WUHA 1NXMA 1SDWA 2TBVA 2UURA 2DCZA 2A71A 2C6SA 4NUBA 4RL7A 4AE2A 4BQXA 3VUOA 1V6JA 3DF0A 1RUJ1 1S0FA 1Q3EA 1F4AA 1UW8A 1JMUB 3AP9A 2Z5WA 3K3NA 3N9LA 3E5UA 4AEJA 3O7OA 3TYJA 4Q4X3 3WNNA 2OX0A 3I3DA 3C7HA 3VGIA 5A33B 1OUSA 3AK0A 1PO13 3G7DA 2UY9A 5FZ4A 3VBHB 2B9VA 3O1PA 2B45X 4P08A 3CHXA 1OVPA 3RZJA 1QJY1 1OFNA 5EZWA 2P3IA 1UKGA 2P3YA 5A7PA 2VOKA 3ZXFA 4AHZA 4A4AA 1PGSA 2ZGPA 3M3IA 1EYBA 3BN6A 3VD5A 1J83A 2WNVC 2Q8OA 5DXDA 1A3KA 3ILRA 3D0JA 2VTFA 3MPPG 3OY8A 3P3PA 4HN0A 2ERFA 2DBIA 4XFCA 3ZYFA 4QB2A 3MLKA 4BCUA 5L73A 5T50A 2QQVA 4XW3A 3MIGA 2BFUL 4AGGA 1ULOA 2F4LA 1W39A 3A0NA 3M1HA 4FPJA 4KU7A 4QKFA 1COV1 2W5FA 3P5BA 3CZUA 1RMU3 2ARBA 1UIKA 1W2UA 4QPGC 5FPBA 5C71A 1RINA 1S0JA 1XNTA 2MNGA 4GIQA 1JUIA 1IPJA 1Q8PA 1QJFA 4HKOA 2YV8A 4PI2A 3IZOA 2ZHMA 5G05L 5FZ9A 4O7XA 4LMFA 2D6MA 3LDRA 4GB32 2ZGKA 1UZYA 3POWA 2PQQA 5IUQA 2DU0A 4YZ4A 4FFGA 2WLQA 1H30A 1RTVA 5IFPA 3AL6A 5LY1A 1JOJA 1PO23 1HB3A 4AL9A 2C1FA 4OULA 1A6CA 4UBHA 3AMQA 2HH9A 2W3JA 5FP4A 1SEFA 5CKMA 1O4ZA 1JYWA 1EV12 4CP2A 4QKNA 2VNOA 4JRLA 1OSGA 1FMD1 2B39A 3GBWA 3U1XA 4WVZA 5I93A 4IV3C 3H8OA 1D4M1 1WCUA 2ADDA 1YQCA 1POQA 5HI0A 4E9KA 5A7QA 4AQ6A 3ZFGB 5FOJB 1QGLA 2AGSA 4QM9A 4CDQC 4A6OA 1REFA 3AJYA 1UU5A 5FP3A 2R062 4CCNA 2WS93 2EVXA 4LHLA 4A3ZA 2XJRA 4ORFA 3VKNA 2BGCA 4Z2WA 1GZ9A 3ZSEA 2Z4FA 3GHMA 2RS33 1CAWB 5JZGB 3WG2A 2DUPA 1K3IA 5GKAC 4DOUA 5IFTA 3OGJA 3DXTA 3TN91 1M06G 5ABJB 3RYPA 1W03A 2DVFA 2E6VA 1VBB3 1LR5A 1YIFA 2WA3A 3OUHA 4MGIE 3WW3A 2J1UA 5DN2A 1LHOA 3WLUA 3H42B 5E1RA 1W6MB 4BB3A 4H2AA 4B4PA 4AYUA 5LEJA 3PMEA 2AC1A 4RFT0 3FMGA 3N9NA 3ZFGA 1Y43B 3LIGA 2GP5A 5K0UC 2W1QA 3RMYA 4DS0A 1N1SA 2O0OA 4PDWC 4M3CB 2I45A 1CAWA 2IVIB 2BOIA 2W0XA 1IS5A 4NROA 5CYYA 5JZGA 4BMBA 4IXLA 3BB6A 5JVVA 1O3SA 3E1F1 5C5TA 3D8CA 5ABJA 1S2KA 1RJ8A 1W2OA 1C5IA 1CESA 1SHWB 1XU2A 4QT6A 2BEOA 4UW3A 4EWEA 2WT1A 5DAVA 4AQSA 2JKBA 5I8TA 3J26N 4KGGA 5C3RA 4P9LA 3KWVA 1W6MA 4JX0A 1RUOA 1S0IA 3OBTA 4I0WB 4Q0QA 5L7OB 1DDLA 2VTXJ 1Y7BA 2DCJA 3VDBA 1DQ5A 1TMF1 2WINB 4IGQA 3SC7X 3VBUB 2QCSB 4D0QA 2JDHA 4RN5A 1YYNA 4BH9A 1W9YA 4B1LA 3DGTA 4P9GA 4KL1A 2A3WA 4Y1XA 4M3CA 3AVSA 3WP3A 1QKQA 4D7TA 5G04L 3A21A 1ONAA 4N43C 4QWNA 3WNXA 1ZZ7A 4FPOB 2BVVA 3M4FA 4FPCA 1W99A 4EWDA 5LA1A 4ES9A 4CEWB 1W8OA 4OMCA 4C90A 2P1BA 3VBUA 3DKWA 2VMEA 2D93A 2ZHKA 2ZTNA 3NJXA 4QAWA 5L7OA 4CUBA 3ZIWA 4QPGA 3E5XA 4R9AA 1PM7A 4UF0B 5L9RA 5LW9A
chains in the Genus database with same CATH topology
4ASLA 1EAH2 2QJVA 1FOD3 2HWB3 2YC0A 1AR73 1CR7A 1ULCA 4QU2A 2Z2SB 3IT8A 1H0BA 2JE7A 4FPKA 4X6QB 1DYKA 2K0GA 4MXVA 4CRQA 5FDBA 1ZZCA 4AHYA 2DTYA 5J96B 4KNCA 3N7LA 4BLJA 4P14A 3LOBA 1G7YA 4CEWA 3VHNA 2HWF3 4BPZA 2GH2A 3R4DB 4CEYC 5EJ3A 2PHUA 1FPN2 5CFCB 1U5YA 4IV3A 5JR7B 3LB9A 4C1XA 3CNAA 3SHRA 2UWBA 4FO9A 4I0BA 4IEZA 4Q1RA 5CA6A 4PDWB 3S7EA 5AC92 4P9YA 4Y1ZA 2LM3A 3WUDA 4WVMB 1RUE3 2ZGLA 4AG4A 5ACA1 4CDXB 2Z69A 4H3WA 3HBZA 3BCWA 4IV1C 4M00A 5CFCA 3BIWE 1R1A3 1RUD1 2XLGA 1FNYA 3ZIXA 1KS5A 1ZZBA 2OIIA 5K0UA 4AFAA 5B2GB 1MVEA 4JRAA 5T3NA 3J9SA 4PDWA 1CAXB 2HWD2 4COVA 2C0ZA 2NPIA 1VIWB 4YVWB 1AR62 5BUVA 2WKKA 5BNOB 4WVMA 3V0BB 1NYWA 2VY0A 3L2HA 4IEQA 4U2AA 1SFNA 1VRH2 1EV13 1YLLA 3NV1A 1YNAA 4ISRA 4Q0VA 3KB5A 1SMVA 4R9BA 5C8WA 3TRSB 4FPEA 1DYPA 3J8F2 1BBT1 2DCTA 1ENQA 1OD5A 4LO6B 4AEKA 1OLQA 4D3WA 3KQRA 3B93A 4OHXA 3AMHA 5CAZA 3UKNA 3B3QE 1FNZA 2MEV1 4N43A 4YVWA 5BNOA 3V0BA 1MS9A 4PLNA 2ATFA 4YYOA 4MV2A 1O5LA 2JEMA 2JG8B 4XBLA 4TYSA 1J3RA 5D8AC 2XH6A 1GNZA 2E7QA 4J1XA 1PVXA 3WUCA 4QX5A 4DNYA 3GALA 1MEC2 5GZCA 4YRDA 3ZXEA 3AP4A 5GZFA 4MSVA 4PQ9A 3S0MA 5FLIA 1VBC1 3CL1A 3PLQA 2PYTA 4HSLA 4ONUA 1A8MA 2YUEA 4LT5A 2VVFA 4K8FA 1QH7A 2JG8A 2DFBA 4CEYA 5GZGA 1BZWA 1PK6B 1D2QA 3ZMNA 2H0BA 1HXS2 2ZAHA 4BIFA 1LESA 3D82A 1LHWA 2VGDA 2X5IC 5LEKA 2WQZC 4ZU5A 5F9TA 3INAA 1W6QB 2PFWA 4NOTA 2ZAAA 4XFBA 4MH0E 4W6YA 3ENRA 5DZFA 1SCSA 4QGLA 4AVCA 1XE8A 4NWWA 1VBE3 5BNQA 2B42B 2KXLA 2YGLA 1VB4A 1CAUA 1ASJ1 2ZX1A 5EYYA 5IK8A 4IV1A 1GR3A 5GLWA 3EHKA 1IGOA 5IK7A 1BXHA 1VB2A 1PZ7A 1HRV3 4AVBA 1W6QA 1LCLA 1ENSA 2D6PA 3MGUA 2XBO1 4COYA 1RVF2 2RS11 4AQ2A 2VQ0A 3SLIA 2E9QA 4XFGA 5CG8A 2XVKA 2HKXA 4JGZB 4XYXA 2RMU2 3AYEA 3IDBB 2OVUA 2R1BA 5KXCA 1YO8A 3QH7A 2QNKA 1J59A 5C4WC 1ND2C 2E53A 4INDA 1IHMA 1G9DA 4K40A 5GZEA 5KHGA 3NVCA 1GFF2 1NCQC 5J09A 5AC93 3WW1A 3FJSA 3M3OA 4BWOA 1BEV1 1NA1B 3URFA 3JD73 3H1WA 4JDOA 2R071 1YI9A 3HQXA 3GNEA 2ET7A 4Q4W2 5FMOS 4AI2A 1ZRDA 3GZAA 2XL9A 1G6NA 1IZ3A 2P3KA 3NWKA 4FPGA 1D4VB 1O91A 4N90A 3V65A 5BNNB 5JLVA 1RB8G 1Q8SA 4ISQA 2EF6A 4XF1A 1YFXA 3RPQA 3KZ4C 1GKBA 2WNUC 1AXKA 1RUI1 2A75A 1O4YA 1ULDA 4B7KA 4Q4Y1 2HWD3 3W9AA 1NY71 5A3MA 3JBG3 4LBQD 1C5HA 3B7MA 2Q30A 5CBLA 1FT9A 3OPZA 2GAUA 1ULGA 3WVJA 4YG0A 4DQAA 1OOPB 1K5MB 3POYA 4FVVA 1QF3A 3TBDA 4YM2A 4D69A 5C33A 3RI9A 2ZX0A 3LCPA 3NL1A 1PZ8A 4QHBA 4B7EA 3I4IA 4D7YA 1UU4A 2Q0AA 2O1QA 2NM1A 2A6WA 3O5SA 2UWCA 1QOSA 4XFIA 1X82A 1JHNA 3AP6A 4FPFA 4P9XA 5CFDC 1CJPA 2O8OA 1COV3 4XQDA 4JDMA 1ULEA 4FOQA 1OOPA 4HL0A 1K5MA 4DINB 3LWCA 2GALA 3AKPA 3GBGA 3JUUA 4JC1A 1V9U3 4AI8A 1EP0A 1YJLA 4Q4X2 4QQOA 3AZYA 5K7PA 5FLJA 3KS7A 1PO12 2H0VA 1H1AA 2R042 3TNPB 5FO8B 1GZWB 2ZGMA 1C8M1 4LUKA 3ZFFC 1DZQA 2G9FA 4GH4C 1ZREA 4WVWA 3RZZA 2ZKNA 4XEZA 2Q5TA 1H9WA 2ET1A 3WT3A 4K9SA 1DGWA 3TN93 3USUB 3ILFA 1RUG2 4GMP0 1AVBA 3B01A 3FFZA 1RMU2 1NE4A 1GZWA 3VZOA 1VBD3 2B9UA 2DUQA 2UU8A 3N35A 2CWSA 5FCCA 2HWE3 4AK3A 1O3QA 3JCIA 3TB0A 4XILA 3OYWB 2NQYA 2N7GA 5IK4A 2VVDA 1JW6A 4ITCA 1ND3B 4NHKA 5FQ0B 4JGYC 3USUA 3ZN5A 4MVTA 2P34A 1WBFA 3CJIB 4QQHA 5JSPA 1SBFA 1WCKA 1PIV3 2RMU3 2XWBB 3NV4A 2ZGRA 3ACLA 2JX9A 2LALA 5FBZA 5LK5A 4PIXA 2WS92 2DF7A 2ZKLA 4I2OA 3OYWA 2GC1A 3HIFA 1NLSA 1MZFA 3U4XA 1WMFA 1LOCA 4CP1A 1RL3A 2ZGSA 4JQRA 3USSA 1OA3A 1GBGA 1I5ZA 1VBB2 1XNKA 3RRDA 4IESA 4O9EA 3OTFA 3ROUA 5AFBA 1NE6A 2A6YA 2ZPXA 2XLFA 4FPLA 5CFDA 3VKFC 2Y38A 4YG3A 4FBFA 2E51A 2P17A 4AW7A 2ETEA 3ZDSA 1RUH1 4I30A 3ST7A 1UZZA 4N7UA 4AEMA 1J1TA 2QZ3A 2A70A 1LOBA 1RUF1 4L8QA 4KWJA 5K8SA 3VBFC 4K20A 1XQNA 2ZX4A 1GQGA 1XNBA 3N3HA 4QPIB 4XIKA 3R4SA 1LOFC 2GMEA 4W6WA 1TME1 1XU1A 2VECA 3WCSA 5FMOL 2D6NA 4FXKB 3AB0A 1R082 2GNDA 3LZZA 5FRAA 2IFRA 1YFUA 5KXDA 1H8TB 4KWKA 3WW2A 3ZFFA 4P9IA 2HEWF 1Q8QA 1FX5A 1HRI1 4MLOA 1FV3A 5BXXA 1EAH1 4HFSA 4FP3A 2EAKA 4NHMA 4I3GA 4QPIA 4GWMA 1QQP2 4LBKA 2ZX3A 4I0AA 5JAXA 2DVGA 1EPZA 4YM3A 5I0TA 2W39A 1Q56A 2Y0OA 4XFAA 4WM7C 1QU0A 1KJLA 2FBEA 2GZWA 2QUOA 2D6KA 4EN8B 4WZFA 4XXAA 1L3JA 3FX3A 1FPN1 1AYM1 1FOD2 2NMOA 1AR72 1A8DA 3AJZA 5T5PA 2CYFA 2NMNA 4M0HA 5F6LB 5BPXA 2A5ZA 3OY8B 1QJU1 4Y24A 5KHJA 1OPMA 2WA4A 1YRZA 4JGYA 2ES3A 3B5LB 1Y3TA 4NO4A 3WX5A 1RJ7A 2HWF2 4MGKE 2XJUA 4B4RA 1C1LA 2D7FA 5CG9A 4CDUC 2YPJA 1AYN1 2R043 4BHPA 4AHXA 3MLJA 1BBT3 1HQLA 4IQPA 1CPMA 1BKZA 3PTYA 5JOYA 5A32B 1M4WA 4K1YA 1S2BA 2GN7A 1F9KA 2W68A 4B29A 1RUE2 1AXYA 4Q4V3 1PVC1 3VBOB 2ILMA 1H2MA 3WDXA 2QE3A 4IETA 1RUG3 4Q8KA 2XJPA 1R1A2 3LGRA 4YFZA 5GALA 3HWJA 4Q8LA 1SBDA 2PN5A 1VAVA 1C4RA 5JSOA 1GQHA 3LA7A 1F5FA 1EPWA 1GICA 5A32A 2WFF1 2DVBA 3FLPA 4QD2A 3SISA 2CNAA 1HQNA 1NOVA 1HX6A 2GSYA 2QDNA 5E8AA 4S2DA 5J7MA 3AKTA 4CDWC 3NKGA 3VBOA 3KSCA 2XVGA 4XOGA 3DL3A 4A3XA 1AR82 3H1YA 4RHV1 4Z8BA 5F6KA 3VN4A 4F3JA 1F8VA 3CU7A 4LEJA 1NCRB 2WFPA 4Z1VA 4HZFA 1VAKA 4JAAA 3IM0A 4OI2A 1KQRA 3EBRA 5KXEA 1MEC1 1RITA 1JXNA 1POV3 1B09A 1CONA 1KJRA 2RS51 1FYUA 2A7AA 1MQTC 2NLRA 4YW1A 1MS4A 1AR92 2VMGA 3O0XA 1BK1A 2NYYA 1F31A 1CQ9A 5I91A 3MPBA 4OVEA 1NCRA 2BW8A 1PGW1 1KS4A 5KHHA 3WP6A 1PGL1 1O3RA 4L2NA 5DUUA 1HXS1 1V00A 2ZA9A 3E6BA 4P9WA 3VZLA 4UXAA 3E5QA 4LHNA 2VU9A 2K9ZA 1OA4A 2WNVB 2VVEA 3WG1A 1DQ0A 2VNGA 5SV8A 4AWDA 3JU9A 4XDQA 5HBAA 3MW2A 4OI0A 5KXBA 1LB2A 4CDUA 3WOGA 4FT8A 3VZKA 4R8HA 1R083 2DUOA 4S2FA 4LLFA 4QPGB 1AL21 4XJWA 4RR3C 1MACA 1VAMA 4YZ5A 5C9AC 1YHFA 1B35C 5CADA 2FHRA 4XJUA 4B3NA 2RM21 1W6NA 3QOPA 2WNVA 4H7MA 3WINE 2JDZA 4MYEA 1VBE2 1RC6A 3HT1A 4FTEA 1LHVA 1QQP3 1R091 2P3JA 5FREA 2Z42A 3OGGA 3H9AA 4R9CA 1JH5A 2EAAA 1ZZ6A 4XHXA 2R073 4KGQA 2Q1ZB 3N7KA 5DUWA 4YM0A 2BQPA 4IV3B 4QM8A 1HRV2 5FAXA 1LECA 3PVEA 4CDQB 1SFYA 4WM8C 3M3EA 4YARA 3IN9A 4NHLA 4TWTA 2PAEA 3ZXJA 4YVSC 1V6OA 2XJSA 5HCAA 4LLOA 4Q4Y3 1H1MA 4CDWA 2GU9A 3J4UH 3FE5A 2WT0A 1QH6A 1Z7S3 1QDCA 1V6KA 4GMP1 1G8WA 1REDA 3QCWA 1LODA 1OFSA 2VH9A 5DG2A 2DTWA 1VJ2A 2RR11 3QACA 3WHTA 2ZBJA 2RHPA 1YJKA 4CDQA 5K0UB 1WMDA 1WW6A 1QJX2 1DQ6A 1JYCA 5K9YA 1HDKA 2IXKA 5JOXA 1MS8A 1IS3A 2MPFA 2JJ6A 3AKSA 2PHWA 4Y1YA 1MQTA 3AYDA 1AJOA 1R1ZA 1XYOA 2CTVA 3BOWA 3JD72 4ZXKA 3NO8A 2PLV2 4XF4A 1RGSA 2MHFA 3ZXAC 5FO9B 1AZDA 3ALQA 4DY5A 2PHFA 5J37A 3V0AA 5AFEA 3ZXDA 1TEIA 2ZZQA 4IEOA 5EYXA 5HCBA 3I8TA 4PLMA 4K3UA 3M70A 5H9PA 4YNIA 3KT7A 1SLAA 1CD3G 1GZCA 2ZMNA 3I54A 1RUJ2 1W0OA 1BMV1 3JBG2 2BNMA 4N43B 4Q29A 3VL9A 4N9IA 4G9SB 2BNOA 1AR83 1QJY2 2AZ5A 4UW6A 2VOVA 4BMEA 1S0GA 3H7JA 3H3UA 2BVBA 3A4UA 2EXIA 4RR3A 1VBA1 5C9AA 3JQXA 3SCFA 4F83A 2EALA 5CU1A 4EJRA 4F8AA 2D3RA 3ES1A 3E6CC 3FBYA 4HVQA 4C0HA 4NWVA 1COV2 2OA2A 1ZRCA 2ZS6B 3AXDA 1AR93 1RHI3 4Y4YA 1PO11 3M3QA 4G4FA 5IT6A 2IXIA 4CEYB 3AKQA 4CZSA 1F5JA 2VQAA 3VDDC 3EO6A 2XJQA 1WCSA 1UCXA 4MXWB 4Y1VA 4WM8A 1V9U2 3ASIA 4YVSA 3RYKA 2VW2A 1DG6A 1MZ6A 3MLLA 1SLCA 5DDJ1 2XPJA 2FMDA 5AVAA 2IXLA 2GNMA 1W0PA 3SH4A 3WG3A 4ASMB 5KHIA 4HLTA 1IS4A 5I0RA 3IBMA 4F7ZA 2PHTA 1CAUB 1AF9A 4XQ4A 4IV1B 4MGZE 4IEYA 2JG9C 4R9DA 4AFCA 4B8EA 4MXWA 4YFWA 1PMIA 3VBRC 2HWC3 1IKPA 4N7IA 4XMIA 3E97A 1RUC1 3TN92 2ZABA 1PO21 2PAMA 5JMCA 1G9AA 3AYAA 1DU3D 3JZVA 2JECA 3WP4A 3AFGA 4L92A 5F1RA 4AFDA 1JYIA 1NLRA 1O3TA 4AEDC 1VBD2 4JV4A 2HWE2 1FV2A 2E7TA 1XYNA 3WG4A 2F4PA 1RUH3 2DCKA 2KM2A 3D5OA 4COZA 2D5FA 2I07B 2KA3A 2RS31 3WQ1A 1X36A 2XL7A 3C2UA 1TME3 1LU2A 1UMZA 3G6JB 3VBSC 3A0KA 1WD4A 1I6XA 1PIV2 1MZEA 2VOXA 2Y0IA 4UW4A 4CP0A 4RQPC 1WLWA 2YXSA 4E2GA 2OPKA 3MZHA 4GXLA 2XKOA 2WZR3 2QVSB 2XVLA 3M2MA 5D8AB 1XRUA 1PNGA 1HRI3 1ZBA1 4RS5C 1WCDJ 2D40A 5TSWA 2AENA 4ES8A 4COWA 1QJX3 4HN1A 1KITA 2BWAA 4Q0PA 3N7MA 5GLVA 4LTAA 1LOGA 3RJRA 4E2SA 4BM8A 3DV8A 2D5HA 2C9AA 1AHSA 5F5QA 2ZGTA 4AHWA 4EN9B 2PLV3 2FZ2A 1Q43A 2YGMA 3TAYA 1IOAA 1GNHA 5D8AA 2VPVA 1U5ZA 3NSTA 3VDDA 2PA7A 1Z0HA 1YFYA 4R4ZA 2X5IB 1I9RA 1T6GC 4LE4A 1QJU3 4LBNA 1SCRA 1OQEA 1RUJ3 1KDMA 3ZFEC 4HVOA 2EA7A 1SLTA 1YI7A 2SLIA 4GULA 4IEXA 2IZWA 1FATA 4EN0A 3UKVA 2V09A 1OA2A 2JICA 4Q0SA 3FUQA 1SBEA 3N36A 3UJOA 1QJY3 4KG0A 3UKTA 2WQ4A 2DV9A 4LBMA 4Q2FA 1FOD1 1KD7A 2X5IA 3PVOA 3VBRA 2HWB1 2RE9A 1ZBE1 4LUMA 1H2LA 3M8LA 4KBBA 5T5JA 3ATGA 4YZ3A 4UW5A 2HWF1 1CN1A 2BUKA 1IKQA 1U0AA 3KCYA 1G9BA 4AEDA 3DPRC 3LA2A 1MS0A 4JVAA 2IXJA 2D6OX 2JXAA 4FOYA 5BNPC 3GBFA 2EIGA 1WW4A 3IPVA 4JTNA 3U07A 4LBQB 4AFBA 5C4WB 1ND2B 4JDNA 2ZCWA 2R0HA 3THTA 2A73B 2GNBA 1J3PA 1ZZ9A 3T2TA 1NCQB 3VBSA 3ZYGA 4NN0A 4RHV3 1FMD3 4N53C 4FOVA 3NAPC 4GA9A 4DFSA 4RQPA 3ECQA 3L9JT 3QD6A 1BBT2 1D4M3 4LBQA 2LUWA 5C4WA 1ND2A 1QXJA 4AGVA 4LHKA 2MEV2 1H4HA 2RS53 4GB31 4Q4V2 4LA3A 3K48A 2PHXA 1NCQA 2WNUB 3OBRA 5T55A 3OCPA 4C1WA 1LKNA 2HYKA 3T1LA 5T5OA 1GLHA 2WSVA 3MF6A 2OUJA 1EV11 2XG3A 4OHZA 4XXPA 1LENA 1JN2P 4Q27A 1V6IA 3VLBB 4OUSA 2WT2A 1MS5A 1ZRFA 2TNFA 5CIRA 4OHVA 2VXRA 1VBC2 2R061 4WZCA 1VALA 1GANA 3AXEA 4LBOA 2WNUA 3H50A 5EWSA 1KFUL 2OZ6A 3GZUC 5H9QA 4HKWA 2VNRA 5A3LA 1O4TA 4DRRA 3VKOA 5CFDB 3N7JA 4YM1A 4QMAA 3SNMA 1TMF3 1ALYA 1AL23 4GKYA 4XFHA 3NJZA 4EN6B 3IDCB 3ETQA 4K1ZA 1YFWA 2P37A 2RM23 2ENRA 3FBMA 3MYXA 1CGPA 5C6CA 3S6PA 4XE9A 3B94A 4E27A 1ASJ2 3ZYPA 1X8MA 1DBNA 5FPXA 1H4GA 1N47A 2FMYA 3DPRA 3FLTA 3L2YA 5GM0A 3SH3A 3V56A 2V5YA 5FOBB 4XF3A 5BNPA 1JUHA 3MFAA 4YGBA 4FSJA 3ZFFB 3BPZA 3ELNA 2XBO2 3FHIB 1DLLA 4TSVA 3MW4A 4GH4B 1D2SA 4SLIA 4UBGA 1UIJA 4XBNA 1O7FA 3KM5A 2RJLA 1DHKB 4DB5A 1JBCA 3NV3A 1LJ7A 2R32A 4GMP3 2DU1A 3VBHC 2YZ4A 4X8NA 5J36A 3NAPA 1N1TA 4BZ4A 1OI6A 3RMXA 5FO7B 2C5DA 5GJ6A 4U36A 3IIAA 2ZGNA 5GZDA 1QNYA 2WNEA 2EXHA 3HMYA 1GV9A 4URTA 4GH4A 4PIYA 3MIEA 3HN1A 5JOZA 4JCKA 1QHDA 3RWNA 2XB6C 1H9PA 2GDFA 3MIBA 2NP0A 1CAVA 2IXCA 3FC0A 1N3PA 4JGYB 4YG6A 2WC2A 4N9HA 2R072 1YCIA 4Q26A 3TNQA 5ACA3 1FAYA 3AP5A 1KDKA 1QOTA 4A7ZA 1RUD3 3RJ2X 1NZCA 3WQ0A 1SACA 4ATEA 1BQPA 4DRVA 4TLFA 4OHYA 2V73A 4X6RB 4Q4Y2 2JE9A 2D44A 3MIFA 3HD8B 3HAGA 1NY72 3ZSJA 3QLQA 4AFMA 2R49A 4YZ2A 1Z7S2 5AC91 2A3XA 1SLIA 4AI0A 2WL1A 2VW1A 4IEPA 3UJQA 2SBAA 4COUA 3JD71 1TQ5A 5T5LA 4CTEA 1X33A 2WWSA 2BWCA 4H7LA 3ZFGC 4ZU4A 3ZO0B 5FLHA 3X29B 4FAGA 4LA2A 3Q9OA 5JZGC 4I02A 4O9GA 2ZMLA 1AX0A 3EQEA 3KT1A 3RS6A 2DFCA 2ZGUA 4Z07A 1U5IA 3VBFB 3VZNA 2ZHNA 5ABJC 1OPOA 2MEV3 2E7AA 4PF5A 4Q0UA 2HWD1 2DCYA 2E63A 4B4QA 4XPVA 2ZGQA 3JBG1 1AR61 5JIAA 1VRH1 1X7NA 3U11A 2B8MA 1IS6A 2I74A 3J8F1 1N1YA 4XZPA 2A3YA 1UF2C 1GYKA 4RGAA 1LRHA 5BY5A 5H9RA 1AX2A 4GKXA 3VBFA 1DQ4A 3BALA 3MI8A 3H8UA 4XBQA 3GF6A 4LO8A 5LRRA 1OKQA 2UY8A 2WZPP 1VBC3 1LOFA 3M3CA 5JOWA 5DDJ3 3LAGA 3KMHA 4YW3A 2DURA 2Q1MA 4XETA 1WGPA 2ZACA 5A33A 4ATFA 2TEPA 1C8M2 5T52A 1XNCA 5FFOC 5L7OC 3VBHA 4C0BA 4WM7B 1CX4A 3VBUC 3ZXLA