3POFA

Crystal structure of masp-1 cub2 domain bound to ca2+
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
113
structure length
113
Chain Sequence
b'ECSGNLFTQRTGTITSPDYPNPYPKSSECSYTIDLEEGFMVTLQFEDIFDIEDHPEVPCPYDYIKIKAGSKVWGPFCGEKSPEPISTQSHSIQILFRSDNSGENRGWRLSYRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Mannan-binding lectin serine protease 1
publication title Structural Basis of Mannan-Binding Lectin Recognition by Its Associated Serine Protease MASP-1: Implications for Complement Activation.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 21
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 3.4.21.-:
pdb deposition date 2010-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00431 CUB CUB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.290 Mainly Beta Sandwich Jelly Rolls Spermadhesin, CUB domain 3pofA00
1SFPA 1SPPB 2QQMA 3POJA 2QQLA 4LOSA 4GZ9A 3KQ4B 2QQOA 2QQKA 3POEA 4LMFA 3POBA 3POGA 1SZBA 2WNOA 5CKMA 1NT0A 3POFA 3DEMA 1NZIA 4LOTA 5CISA 3POIA 5CKNA 4LORA 1SPPA 5CKQA
chains in the Genus database with same CATH superfamily
5F9TA 5CVRA 4IXLA 2GMPA 1Q56A 3AK0A 4Q4W1 4EN0A 4CDXA 1RUF1 1UY2A 3NKGA 3D4KA 1Y9MA 2QCSB 2HWD1 4JQRA 3RG0A 1LGNA 4Q4Y1 1X82A 3ROUA 1ZM1A 3LIHA 4HT1T 3PNAA 2ZGRA 5KC6A 2G9FA 3RI8A 5FOJB 3LEGA 5JI7A 4WM7B 2HWB1 5BNPC 4QB1A 3M2MA 4LBKA 4IETA 2XLFA 4K1ZA 1V00A 4UYBA 3M3QA 2JJ6A 1ENRA 4A45A 4H2AA 4ASKA 1LHVA 1OH3A 4BA6A 4IQPA 4DMIA 1JTZX 2NMOA 4OHZA 1N3QA 3O1VA 1MEC1 1UIKA 1GMMA 5DPNA 5IW0A 2HLEA 2XBO3 5GALA 5DG2A 1JU3A 1UMHA 1W8NA 4FPYA 4O7XA 3V64A 2F4LA 3WNPA 4MH0E 4Q8KA 5I0RA 4ZHNA 3POWA 3RZHA 5CU1A 5FZGA 1QNYA 2W91A 3DN7A 2RS31 3ES4A 4QXBA 2CNAA 2WNUC 3LOIA 1ODNA 2BBVA 4BQYA 5FJKA 3GF6A 4FPOB 2A75A 3HNMA 4AVTA 4LMFA 2DCJA 1YQCA 1S0EA 3MPPG 3ZXDA 4E4SA 3CBNA 4NRQA 1YLLA 3KCCA 2VU9A 4IE0A 1NXMA 1WLCA 2VBBA 2GAUA 2QJVA 1NYWA 2YBKA 4LOTA 4XURA 3OUHA 5I8YA 4KWLA 1BEV3 4Y1XA 4K9SA 1FATA 4QQHA 2VC9A 4DB5A 3ZFEB 2PXJA 1UL9A 3CO2A 1PO22 5LK7B 2QQPA 2R6QA 3VBOC 2VQUA 1MS0A 2J1VA 1MQTB 1VAVA 2W46A 4JKKA 4UW6A 1BBT2 3U1XA 3M8LA 3WZ1A 4Q4X2 1UX7A 1HV1A 3ZXAC 5FFOC 3FN9A 3TAYA 1EAH3 5CNAA 2FCUA 2B9VA 3VL9A 1VRH2 2WSVA 4NIHA 1JYTA 3T4HB 1UKGA 4HL0A 1UZYA 3CJXA 1OHFA 2DCZA 2I2SA 4QD2A 4F8AA 1DLLA 4TLFA 4Q2FA 4ORFA 2ZMLA 4S2GA 3DPRC 3OBTA 1OI6A 1YQ5A 2H0VA 2EIGA 1SLAA 3OBAA 3THPA 4FAHA 1SPPB 1C3HA 3VGIA 2IFWA 2X29A 4P14A 1W3VA 4QX1A 3JD72 4AQ2A 2P37A 3FX3A 1C4RA 4NHYA 1ENQA 1WGPA 1IS4A 1EPZA 4M0HA 4IEOA 4ITCA 4N53B 4X6QB 4CU8A 2P17A 1CVNA 2ARXA 1Y4WA 1GZWB 1SLTA 2OA2A 4BQ3A 3PUSA 2YG0A 1E5HA 1W9YA 4I2OA 1YO8A 4YM3A 3V0AA 4RYDA 4QQPA 3VL8A 1QXPA 1D0GA 1PMJX 2B5HA 2JX9A 2AEYA 1U5ZA 3I54A 1HRI2 1Q43A 3ZX7A 2V4VA 5GLVA 3EJKA 1AJKA 4N9HA 4BZ4A 1UOJA 1LHNA 1E5SA 2Z4FA 3AZZA 1MS9A 2ETEA 5B2GB 2R0HA 5GZCA 2PLV2 1WCKA 4XF9A 1GSLA 1BK0A 3E5UA 3IN9A 3C7FA 3C3VA 2VL4A 5FKCA 3OJBA 3WDTA 4CUCA 4XF3A 3OY8B 2BQPA 1BYHA 1PVC3 4P9LA 4GXLA 2DFCA 1W99A 3IBMA 1REDA 1VBE2 1YJKA 2VZ1A 2J1UA 4HN1A 2F17A 1WWYA 2E31A 2VUDA 1JS9A 5FYZA 4B8EA 3NNFA 3ZYBA 4MGQA 4XW3A 1FPN3 2GC0A 3AMHA 1HRV3 4TSVA 1D2SA 5A6QA 1JU4A 3HOBA 4C8DA 4PIXA 4CEYA 5JUVA 1QU0A 4BISA 4HANA 3Q8AA 4FPLA 5L19A 2XUEA 1SLIA 3H42B 2P3JA 1KS5A 1L7QA 4UI9L 1A6CA 1PO21 3SH4A 1RMU2 2CYFA 1YFYA 1LOEA 2JD4A 2A1XA 4META 1BBT1 4CP1A 3H3ZA 5EJZB 3O0WA 4Q4X1 2VAUA 3EO6A 3AL6A 1VBD2 2EXIA 2BJSA 1EAH2 2XONA 3ZM8A 4LBNA 2GN7A 3BPSA 4BMEA 4IE6A 5CFDA 2DF7A 1WW7A 3JU9A 4F3JA 3PLQA 4GH4B 4UFIA 1RUH3 5I0UA 4NIIA 1HW5A 1US3A 3HNYM 3N35A 3USSA 3AP7A 4MX3A 4YVWC 1MS3A 3O14A 3CDZB 3P3NA 4QXHA 4AGGA 3ETQA 3LDKA 4GB33 4JAAA 3SKJE 3NNLA 2HWC2 3I2FA 1XRUA 4HETA 3N9QA 4E27A 3LOBA 1K3IA 2B42B 3H3UA 3HNBM 3JD71 5FZ6A 1D7PM 4MHRA 2QZ2A 4QU2A 1NX9A 5FZFA 4R4ZA 3D8CA 4OULA 3ILRA 4CPBA 4CTEA 5C9AB 4E2GA 4BOWA 4QHOA 5JOZA 2VZOA 3LA7A 1F5FA 1V6KA 4OI2A 4R9CA 2GNTA 1ULDA 1DGLA 4NRMA 3WF0A 5C71A 1OH4A 2I07B 1VP6A 5A3OA 2SLIA 3IIIA 1LOAA 5GLUA 2JG8B 2HWF3 4CCCA 4CDUB 5FBZA 3WQ0A 1GOFA 2WYSA 1HRI1 5GZFA 3V0BB 1AX1A 1XYNA 4PQQA 5A33A 1W3XA 1YI9A 1QXJA 1ST8A 1SFYA 1VMFA 3KVBA 4R4XA 1ZREA 3WF3A 1NY72 2PLV1 3UL2A 4FPKA 2ERFA 4DUVA 3W21A 2BFUL 2YPDA 1H2LA 3HQUA 4Q27A 3K75B 1OOPB 1LRHA 1SLLA 2W1QA 5LATA 4O61A 1VBE1 1FI2A 1XNTA 2JG9C 4Z2AA 5F5IA 1KFUL 1AYN2 1AL0G 4OVEA 3N4MA 3SC7X 1XXNA 4AAPA 5LWBA 3IIAA 1OLME 4L11A 2LM3A 1FPN2 2HH9A 5C8CB 2XGXA 2G4IA 5H9RA 5C3PA 1JMUB 1UMIA 1ULPA 2G9GA 2WT1A 3U78A 1DP0A 2N7GA 2C4XA 5T5JA 3N36A 1FV2A 5FP7A 1R64A 1RMU1 5JZGA 1UXXX 3MLLA 4JHZA 4K8RB 1J58A 4HZFA 5I0TA 1DQ5A 5I93A 3SCFA 1YRZA 3TEXA 4CXWA 1VBD1 1K5MB 3S6PA 2BEOA 1CAXA 5BNOB 1EAH1 1W2AX 4LUMA 5FUIA 2WS93 3I3DA 4XJ9A 5FY7A 1YHFA 4P08A 3Q8CA 3RGBA 2EAAA 3KQRA 3WDVA 1JI6A 4YYOA 1JYCA 4MZUA 5LBFA 3R4UA 2P1BA 2GDFA 3E97A 4XBLA 2VPVA 2AYHA 4EROA 5G05L 2Z42A 4HN0A 1W8HA 4XXAA 4B4PA 3VD4A 1S0JA 3PIGA 2HWC1 4CDXB 1Q8SA 4JVAA 1FV3A 3WDUA 1XE7A 2VMFA 5CA6A 2VZSA 4S2DA 1PHMA 4CCOA 3K51A 4ZONA 4LT5A 1UCXA 5JIUA 2WZR2 3ZSEA 5FR3A 4LO5B 3LA2A 4SLIA 4G3YC 5FWJA 2XJPA 1WW4A 3HEIA 1Q8PA 4ZPIA 3ZFFC 1OA3A 3D3AA 1JOPA 5F6LB 4FTEA 5EYYA 5KR7A 3RZMA 1W8UA 4LBQB 3ZYJB 5JOYA 1CAWA 1QMJA 1VBB2 2P2KA 2PYTA 1G9DA 3A7QA 1ASJ3 3Q8FA 2ZA9A 4BLJA 2KM2A 5J96B 1H9WA 2ZBJA 2XKPA 4P02B 1NCRC 5T5LA 4M3CB 2DVGA 2VE1A 4EV0A 4GZ9A 3ZSMA 1NY71 1OXCA 2BWCA 3LPFA 5BNPA 4N8MA 1PX3A 1DFQA 1LGCA 4D7TA 2ZMNA 1H8VA 3DXUA 4XFHA 2E51A 2GH2A 2WNOA 3AKRA 4D6RA 2YPJA 1YFXA 2OT7A 1OLMA 1W9WA 1AYN1 2WQZC 3ZSJA 5BNOC 2C24A 1UPIA 1JZ3A 2ZAAA 1FPN1 5K0UB 5C5UA 4LJHA 3UYJA 4XDPA 2J1SA 3B3QE 3NNJA 4IL7A 4IV3C 1YCIA 3S5AA 4OHVA 4Z82A 4W6YA 3WUDA 1W6MB 3BTZA 1JUHA 4XJUA 1SLBA 1VBA3 3IMNA 1GWMA 4LITA 1DU3D 2RDNA 5EP9A 2QQJA 5GJ6A 4FVVA 2JKBA 2YYOA 2RJKA 2WAAA 3B9CA 3FZ3A 5LA2A 3RZJA 1GOGA 3RPQA 3HBKA 1XNCA 3SEEA 3WF4A 3WNLA 1IG0A 2MHFA 2WS92 2BNNA 4IUGA 4DY3A 3H1YA 1R1A3 4QKDA 3NQHA 4F7ZA 1YQ8A 5F3GA 2PMWB 3HVDA 3CL1A 3O1SA 4Y26A 2P6CA 3CF6E 3S7IA 4AW7A 1H8TC 3HN3A 3CIHA 3JQXA 1BHGA 1RUI3 3B01A 3J8F3 3DL3A 1ZYBA 4QDRA 2NQYA 4B4RA 4YW4A 4CCDA 1D4M2 1QNWA 1SBEA 2WZR1 3OYWA 2A7AA 3ATGA 4MVTA 5DAVA 1W6PA 1POV3 3MI8A 3DCQA 1YWKA 2E33A 4XPVA 2ZGQA 3O1OA 2D6KA 5ANQA 4K6BA 2VMDA 1H0BA 1PK6C 3ZOIA 1W2UA 2BWAA 1VBB1 2IUWA 2UWBA 4QX7A 4Y1YA 4BCUA 3U10A 4OI0A 3THCA 1WD4A 1RUC3 2JD9A 4A42A 3KT4A 1LESA 1NLSA 1US2A 1SACA 2DCYA 3IDAA 1JODA 4K20A 4OZOA 5DDJ2 1O4TA 3AFGA 4QPGC 1H1MA 5C5TA 2YROA 2BV4A 3AZXA 2XWJB 4COWA 3NV3A 1O3RA 3CJIC 2ZEYA 2Y26A 1WMXA 4XUQA 3SITA 1N1TA 5F5QA 1WMEA 1NA1B 4DEVA 2AC1A 3POYA 4A7YA 3M3CA 4XCAA 4JGZB 3VBSC 1X36A 2RE9A 4TYSA 2JDUA 4CUGA 5F3IA 3M4FA 4WZFA 5EJ1B 3ACLA 3O0XA 4UW4A 1PO13 2V72A 5FMBA 4NPLA 2K2SA 2TBVA 1KITA 4ZS3A 5JXJA 3TBDA 3WG4A 4LR4A 4RGAA 4LKSA 4NMIA 4QB2A 2JKXA 3PVEA 2E53A 2OUHA 4UFLA 3C7GA 3MBWA 4WM8B 5C4WC 4XBQA 1XYPA 2ZOEB 2JECA 1X8EA 5FO9B 2GU9A 4CZSA 5IK5A 2VNOA 1ZZ7A 4FFGA 1GZTA 3MPBA 2PQQA 2GNDA 2Z69A 3BGAA 2GZWA 5FZLA 5L9VA 1WBLA 3VB9A 1O5UA 3LPGA 4B1MA 2VW1A 3FWEA 4JV4A 5CADA 2A3YA 2OW4A 4UBHA 2LALA 1L7RA 3DUIA 2GMEA 4Q4W3 3D0JA 4NPMA 1OLRA 3ZO0B 5IAVA 5FZ4A 3F2ZA 1WLTA 3OGGA 3VHPA 4A6SA 5J3UA 4D6SA 4A7ZA 3W9AA 2HWD3 3BTYA 3TB0A 1PM7A 4Q4Y3 1ULCA 5FPLA 5D8AC 4URTA 3SLIA 4RR3C 1UZWA 4D7SA 5FZ8A 3TWIA 2HWB3 1EPWA 2VECA 1DQ1A 1RTVA 2R30A 3PDQA 2D3RA 2UWAA 1UYPA 2D5HA 2Q5TA 3ECQA 3LDRA 3WHUA 1D4M1 3J8F2 3BU0A 3A22A 1MVQA 3IZOA 4YVWA 4NRPA 1MEC3 1IPSA 1C1LA 2C6SA 1NA1C 4JRAA 4N7UA 3HBZA 5IHRA 4ISQA 2NM1A 2UURA 5DAQA 3AP6A 5CKQA 5IVVA 4QX0A 1DG6A 4JCKA 5A7NA 3B9IA 3CU7A 4YZ1A 4DPNA 2RS33 1VBC3 3I3MA 1B35B 5IK7A 5EHDA 1C57A 1F9KA 4QPYA 5DDJ1 1QHDA 2Y6JA 5A33B 4GAZA 4QX5A 4C90A 3OY8A 4XZPA 2VMHA 4ZS2A 1REEA 3SH3A 5IFPA 2PHXA 3A0NA 1S2EA 2VVEA 1LOCA 5H9PA 1QGLA 3HQXA 2CDPA 1IS6A 4JKMA 1N3PA 1B09A 1FMD3 1HQLA 3WHTA 3I3EA 1XQNA 3VBFC 4HG6B 4IGPA 2VCBA 4BB3A 3EYPA 1E57A 2ZGPA 3ZSKA 3W5MA 3RYKA 4BWOA 2VTXA 3ACFA 5A3PA 1POV0 4HK8A 5JXHA 3DYPA 3GCXA 5FP8A 5KHGA 1JZ2A 2TEPA 3ACHA 4OI4A 3CLPA 4YW6A 4P9YA 1QOTA 1UY0A 3ZN4A 1DZTA 1TZOA 2GNBA 2I45A 2P3KA 2RM22 3AMQA 3PUIA 4I0AA 1XU2A 4YW7A 4LQRA 2W47A 2JG9A 3KV6A 1CZTA 1AR72 1HJGA 4DRVA 3W5NA 2VZVA 5E89A 5JZGB 4EWAA 1WCQA 1W04A 4QU1A 5LW9A 2NLRA 1UZVA 1ZZ9A 5TSWA 4DINB 3FHIB 2ZXQA 2RDRA 3LCPA 1LECA 1DGRN 3SCGA 1ULOA 2ORXA 4QPIC 1H4HA 3N3HA 4K3UA 4D69A 1CAXB 1UN1A 5BPXA 2FHRA 4QXCA 1NZCA 3VBUB 3ZXGA 3I59B 4IEUA 5KBFA 4QKFA 3ZVXA 2DU1A 1AXKA 2FMYA 3H8UA 3BYWA 3NNMA 4L92A 4YG0A 1KEXA 5IATA 4XEZA 3GNEA 2HWE2 1UZZA 3B00A 1XB9A 1URXA 1UWWA 3T3YA 2O1QA 4MADA 5EQUA 1PVXA 1KXGA 5KXEA 4OUEA 3I3QA 1IQAA 2Q1MA 3ZIWA 1NE6A 3PHMA 1G9FA 2LTNA 4AI3A 4XJZA 3PMEA 1NCQB 4QB6A 4QX2A 1CGPA 3J8F1 5FZKA 3UGFA 1DF0A 2D43A 2JE8A 2DTYA 3T0DA 3RDIA 2VZ3A 5JI9A 4LORA 5JWPA 3V0BA 4P9WA 1TNFA 4WVMA 1Z7S2 2EA7A 1JYWA 4XQDA 5FZOA 1CAWB 3BIWE 1G9BA 1CIYA 1PNFA 1XSQA 1DQ0A 3H3LA 1WCDJ 2BGCA 3AM2A 2BP6A 4Q8LA 2W08A 3KF3A 3K46A 3A0KA 1RGSA 4M3CE 1VBC2 4BPZA 2YUEA 5BV6A 5LA0A 4CXXA 3MZHA 4AVCA 2Z5WA 5A7WA 4K21A 4ATEA 4K40A 4YFZA 3ZFFA 2XG3A 2CGOA 1JBCA 3AKTA 3NSTA 3T08A 3A21A 4QWNA 3KV5A 2CSGA 3AX4A 5BNPB 5CG8A 1CR7A 4L99A 5JMCA 2IC1A 3ITQA 2EXKA 3OUIA 1NT0A 3POFA 4Y20B 2VVDA 4CCKA 4OZXA 1FMD2 1SFNA 3M3EA 5A1AA 1NCRA 4YW3A 5C70A 1PO23 3ZYRA 1XYOA 3GJBA 4MGZE 4NHLA 4R52A 4I01A 2QKDA 5IK4A 2VZUA 3R0RA 3U07A 3U11A 2QQMA 2VVFA 1VIWB 2R32A 1BBT3 2WNUB 4I02A 1J3PA 4IEZA 3CKHA 3VBRC 2R063 4IE4A 1HLCA 5FZBA 1REFA 1OD5A 2RM21 4Y5SA 3UNPA 3H9AA 3Q8EA 5HPOA 3EHKA 2HBUA 5M0TA 4AL9A 2QQNA 1AR71 1SZBA 2YY1A 5FYSA 5BNOA 3EMRA 5HBAA 3E1F1 3VLBB 2ADDA 2D6NA 3NV2A 2VMCA 3M3IA 3MYXA 4FTBA 3WV6A 1NCQC 2G19A 2FDFA 1RUD1 3GZAA 4UW3A 4IV3A 4CSWA 1XE0A 5FTTC 5IK8A 5F5AA 3VBOB 1TG7A 4COUA 3JD73 2EIDA 2QDNA 1Q8OA 1H2MA 2RHPA 3VDDC 1U12A 2AEZA 2VMEA 5FZCA 1Y43B 2HWE1 1VMJA 5GM0A 2DVDA 1MS4A 2OZJA 3MV11 3NJYA 1I1EA 2OVUA 4B1LA 2JDAA 1JH5A 3KD4A 5LA1A 4MSVA 4ARYA 1GNHA 2IZWA 4EWEA 2V73A 5A6XA 2FD8A 3SCHA 4E9KA 2GC2A 4I0BA 5L9RA 3GZEA 2XH6A 3OYWB 3SNMA 4LBQA 2YU1A 2Y38A 4YRDA 1HRI3 1W6PB 4HPKA 1ZBE2 3DPRB 4XF4A 4R9BA 2JB4A 1Z7S1 3WUCA 5FY4A 4EJRA 2PLV3 4M3CA 2VD7A 4PF5A 2D5FA 3D82A 1NLQA 3EB7A 5FZ9A 1W90A 4KL1A 3ABZA 1DGRA 1VBC1 2HEVF 3LA3A 5E16A 1WMFA 4FI9A 4TZDA 2C9AA 5FREA 1C5HA 4XQ4A 4AVBA 1S2KA 1VBE3 1ZRIA 3V65A 2DFBA 4AQ6A 3CEWA 2C26A 2P3YA 5CG9A 2FDIA 1ULFA 1HXS2 3AYDA 1LEDA 1LAJA 3K4ZA 2JIJA 1ZA7A 2TNFA 2Y34A 2D3SA 5F32A 5LBCA 3IMMA 1FMD1 1IGOA 4AEDC 5DZGA 5K0UA 4QPGA 1APNA 5T50A 2B7YA 2OQ7A 1UX6A 5JXGA 4QKBA 1XPWA 4Y1UA 3T0AA 1LULA 1RMU3 1UPSA 3CJIA 4Q1RA 5T52A 1W6MA 2OZ6A 4XUPA 1VALA 3URFA 2IXHA 4DS0A 4HVRA 2VZTA 5J7MA 1AX0A 4GULA 1XNKA 3JBG2 1OKOA 1VBD3 1CAVA 2R062 3RI9A 1S0FA 3S0MA 5JXIA 2ILMA 3C7HA 3VBSA 2RJLA 3ASIA 3GALA 5GZGA 4MOAA 3PU3A 2EAKA 1W39A 3LWCA 5FAXA 2CWSA 2GN3A 3POIA 1G9AA 2W68A 1J59A 4J1WA 3NVCA 1SMVA 2I74A 3OCPA 2UU8A 3ORJA 3OPZA 2HWC3 5FUPA 2WT2A 2EIBA 5C7GA 5C4WA 2JDNA 3MW4A 5LA9A 1ND2C 3WXPA 3T2QA 1ND3C 2B4KA 4XAEA 4FXKB 1A8DA 4W65A 5LASA 4D0QA 2CGNA 4URAA 4DZGA 1WA4A 4N7IA 3WNMA 1AHSA 2V5DA 3INAA 2D6MA 3RZGA 1LU2A 1HV0A 5A3UA 1I5PA 2DYCA 3OPTA 4YGEA 1HQWA 2Y64A 4Q29A 3RS6A 4YW5A 4GMP1 2RMU2 1YUDA 3EQEA 3T1MA 3HPNA 5JSPA 2C5DA 4HSLA 4YVWB 4A7KA 4KWKA 3IT8A 4DUWA 5E6HA 1ZBE1 4Q26A 5LRSA 2DUOA 3O1TA 1XNAA 1IS5A 4QKNA 3WW1A 3S57A 3E5XA 3BI3A 4RR3A 4XIOA 2DUPA 1ACCA 3NKTA 4NIAA 3ZDSA 2BU9A 1T6BX 3JB4C 2LUWA 1Y3TA 5C3RA 2NPIA 2XHKA 1AF9A 1DLCA 2A5ZA 4XHXA 5F2SA 4A6OA 5A3WA 2IXLA 5LB6A 4NWVA 1UY1A 3ON7A 4Y33A 4HLTA 4EZHA 1NA1A 2W52A 1V0AA 4IV1C 2ATFA 1RXFA 5BUVA 5E8AA 1F31A 1F35A 1AYN3 1GU3A 2G1MA 3DV8A 4OI1A 4JGZA 1HXS1 3T2TA 1JN2P 1L7LA 2DBNA 1V6OA 2Z79A 3OGVA 3ZR6A 4NIDA 3VD5A 2A6XA 2Y0OA 1JZ7A 2R042 1CWPA 2BNOA 2WN3A 5ERLA 1N1VA 2Y6FA 2XQRA 3VKFC 1AYM2 4JRLA 3WP3A 2XOMA 1I5ZA 3KM5A 1WA6X 5HCHA 2OPKA 5HXMA 5FK7A 2MPFA 2VBPA 5FZDA 4XJ8A 1F15A 4WM8A 4Z2WA 5FOBB 1W05A 2ZGUA 3GM8A 1WD3A 5J98B 1HDKA 2WA3A 1UYXA 3VBFA 5A3TA 3JBG1 4W6WA 2R061 1CD3G 1F4HA 4NHMA 4COZA 1N47A 2JG9B 3GHNA 2WZPP 4BQWA 5JLVA 4D8MA 1FXZA 1AL23 1X7NA 2WNVC 1TNRA 2XB6C 3BU7A 4YVSC 4ZU4A 3WNXA 5JSRA 5BY5A 3AVSA 1KDMA 1Z78A 2UY8A 4QHZA 2HYXA 1QJEA 2PHWA 5FZ0A 3AKSA 4FOYA 5A3MA 4LIVA 4YW2A 4MV2A 4A4AA 3FUQA 3ME2A 1SCRA 1TMF2 4FFHA 4PI2A 5A6ZA 1HX6A 1RHI3 4ZXEA 5EFUA 2QQOA 1J84A 2WZR3 5D21A 4CDQB 2ZHNA 4XHBA 5FWEA 2A3XA 4R9DA 4M4PA 4OUMA 1QJX2 5FLJA 4QPIA 4XYXA 2IWGB 1QJZA 2JWPA 3KHCA 2WBKA 5GZDA 1OUSA 2RMU1 1VBB3 3WDWA 5JDBA 2BOIA 4J6GA 4CP2A 3H1WA 1OA4A 2E32A 1RUG3 3WLUA 4I30A 1B35A 2FCVA 5J37A 4WVMB 5FO8B 5L7OC 5FZOB 3JB8A 3USUA 4BJ0A 2WDBA 4S2HA 2OX0A 4XETA 4YZ4A 5BNQA 3T09A 5FXXA 4CDWC 1GR3A 3OG2A 3B7MA 2Q8EA 3RWNA 3I49A 3KS7A 3OUJA 3X29B 5A7WB 2WO3A 2ZX0A 3DKWA 4AHXA 3H8XA 4INDA 3ZFFB 1RB8G 3ZXKA 3VUOA 3MFAA 3UK9A 3GJAA 2VXRA 4GJZA 1LTEA 2W2IA 3FE5A 5FRAA 1H1AA 4AVVA 4ONUA 4N43C 4NIGA 2XL9A 3V56A 5FXVA 2VZQA 4UFMA 2PAEA 2JDKA 1RINA 2R041 3UKVA 1NCRB 3LIGA 3NAPC 3KSCA 1AYM1 1LJ7A 4IEWA 2AUYA 4YM0A 2WWUA 3O1MA 4AQSA 3B5LB 4XFGA 4OQ9A 2C0ZA 2EALA 1OF3A 5K7PA 1TME1 3ILFA 3ZXJA 1K45A 1ZRCA 1A8MA 2QQUA 2VOKA 4UXAA 1OLQA 2WC2A 1D0HA 2JENA 2W1WA 5I0DA 2ZGNA 4YW1A 3VZMA 3WVJA 4XFFA 3WDYA 4A44A 4ATFA 4CDQC 3I2GA 2ZHMA 1IG3A 3UJQA 1VAKA 4CUBA 2XDVA 4RA0A 1LKNA 3ENRA 1YQ2A 3M7AA 1JOJA 2PA7A 1GP4A 4Z1VA 2ZCWA 1AL22 3VBUA 5FK8A 3I59A 1STMA 1MPXA 3VBRA 5DQ0A 3I2HA 4HKLA 4CU9A 4IV3B 3IAQA 2ZAHA 2OIIA 1W8WA 5FZIA 5I91A 1W03A 1GWKA 5FXZA 1WLWA 5EJ3A 4LKEA 5FXWA 1YYNA 4JKLA 4ZXKA 1TMF1 3UJOA 2VCMA 3MUY1 4FFIA 1YIPA 1D4M3 2A71A 1RHI2 1HB3A 1MR5A 1Z0HA 4LHNA 4PLNA 3VD3A 1JOBA 1NCQA 1QJX1 3LSDA 3KZ4C 3M3OA 1IOAA 1G86A 3TN92 2CHHA 5AFBA 4YM1A 2GSYA 3NJVA 4QQ2A 4UF0A 3WG1A 3VDDA 3ZYHA 3UGGA 2ZACA 4HVOA 2L9LA 4HPKB 5CFCB 2RG4A 1O91A 5DDJ3 5IYYA 4O9GA 1QQP2 3FHQA 3OGSA 4HONA 4XF1A 5DABA 1RUG2 3UETA 2BRTA 4PI0A 1LB2A 4PIYA 1H8TB 4QX3A 2OPWA 1PIV1 4NN0A 2CDOA 2V5YA 3RFRA 5LZ6A 3PL0A 2JIGA 5FYUA 2X05A 1QY4A 3HWJA 2O14A 3ALQA 4FCAA 1OQEA 4JHTA 2TUNA 1W06A 2YZ4A 3OEBA 2RDSA 4Y20A 1HIXA 1POQA 2OQ6A 3FFZA 4FOVA 5FPUA 1X9TA 2H6CA 3RZKA 1S0IA 4KU8A 4O65A 2X10A 2EVXA 3E6CC 1PK6B 1SBDA 1H6YA 4IESA 2VJXA 1VB4A 1GZ9A 1PMHX 2RV9A 2PAMA 1IHMA 1CX1A 2WNUA 4QPGB 4C0BA 4XVHA 4XJWA 3LSEA 3LQCA 3ZXEA 3OOXA 2QQLA 4B7EA 2ZS6B 4Q0VA 3CJIB 4JZRA 4DFSA 4DXZA 2WA4A 4FPCA 3R4SA 1KRIA 4GA9A 3LDBA 3ZN5A 2ARCA 4P5HA 4AHYA 3AKPA 4LBOA 4XIKA 5EPAA 5KXBA 5A80A 1CAVB 4XAAA 3U75A 1JYVA 2ZX4A 4AEDA 5IFTA 1JZ6A 3VBSB 1FNZA 1FOD3 1JYXA 2OXBA 4IEPA 1LOGA 3SEPA 5J36A 1LOFC 4YGDA 1OFSA 3VBOA 5FP3A 1AL21 4CYDA 2XPJA 1VAMA 3GGLA 4M01A 4YPJA 5T55A 4CCJA 3VBHB 3EBRA 3POJA 3T4VA 5CFCC 1WW5A 4Y4YA 1EUUA 2JICA 4BQ4A 4XJAA 2DV9A 1LCLA 3CQOA 5C4WB 2PN5A 3CZJA 4YGCA 2H0BA 3MEPA 1W9TA 3VDCA 5BYNA 2J1TA 5CAZA 3DYMA 1RHI1 1W6QA 4XDQA 1D2QA 2XKOA 4YG6A 2EF6A 1LEMA 2ZEWA 3SMHA 3N7KA 1W6NB 5K9YA 1PX4A 5CBLA 3ACIA 1X33A 3B02A 3DPRA 2R16A 4WVVA 3TN91 3LF7A 1EY2A 5FY5A 3QCWA 1ND2A 1QEXA 2ORZA 5FYIA 1JUIA 1ND3A 1W0PA 2WQ4A 1GZCA 3I8TA 4JDOA 2GP5A 4NO4A 5SV8A 2W1SA 3AJYA 4EWDA 3WQ7A 1QQP1 1ZRFA 5D8AB 3MFCA 1RUG1 1EP0A 1OVSA 4YG3A 4RR3B 4EN6B 4AZZA 3LEIA 1ALYA 1KFXL 2PHDA 3GXUA 4KGQA 2ZGOA 3TOJA 2OYZA 4AI0A 1AXYA 1ZBA1 5JPMB 4GWIA 4Q0SA 3IWZA 1GP5A 2J7MA 2VMGA 4I3GA 4AEMA 4NUBA 2NMNA 3KCXA 5BNNC 1IZ3A 4KG0A 4HVQA 1QOSA 2WABA 3WNKA 1GP6A 2DWRA 3DXTA 1F5JA 4DOUA 1JHJA 2W1UA 2CWMA 1E5IA 3AMNA 1VJ2A 5HXVA 3POSA 2GC1A 2W92A 2RM23 4C91A 3VBHC 4IV1A 3Q8BA 2J42A 2YB7A 4LOSA 4XC9A 3VN4A 3KVAA 3VZLA 1JZ5A 2VMIA 1AR73 4RN5A 3KV9A 5LCWL 4GQ7A 4EN8B 5KXDA 4AFBA 1OFNA 5HCBA 2ZX3A 1RC6A 5KHHA 4M3CF 2RVAA 2YGLA 2Q1FA 3VZNA 3VBFB 3MUZ1 4IGOA 1GICA 2X8KA 1RUD3 4NHKA 3BPZA 3O0VA 1W9SA 2E7QA 2SBAA 1AX2A 1FOD2 5CKNA 1OKQA 2VUCA 3LB9A 5A7QA 1IKPA 4LXLA 1EV12 1O3TA 2GP3A 1V9U3 1J3RA 1AR93 1KD7A 2IXIA 4PBOA 3P5BA 2HWE3 3KT7A 4CCLA 5HCAA 1WW6A 3NW4A 2E26A 3WNOA 2WO1A 4BK4A 2HEWF 4HMZA 1DCSA 3KHBA 4OHYA 2WN2A 4FP3A 3TNQA 4E4HA 5EIYB 2DU0A 3WSOA 3PUHA 1QXRA 1KJLA 1DQ6A 2WNVA 2YFZA 4YVSA 1V70A 1V6JA 4DO0A 4N9IA 2WFF3 2VTFA 5FPAA 1ZRRA 2VBDA 3U37A 1Q5OA 4E2QA 4QPIB 4C0HA 1JHNA 3JCIA 2YC0A 4XFIA 4W8JA 1LR5A 5CISA 3VDBA 4PLMA 1Z7S3 1S0GA 3DGTA 4WVWA 3FC0A 2X09A 4KBZA 4CA9A 2V09A 5C33A 1C8NA 1WCSA 4KQ7A 3PUAA 2JEMA 2OS2A 2NYYA 4X8PA 4AE2A 5JMOA 1JYIA 3O1RA 3KMHA 4COVA 4AEJA 3BOPA 2A6YA 1I6XA 3LKJA 4CE8A 3D5OA 5KHKA 5LK5A 1GQPA 2LS6A 5FPBA 3PMSA 5APAA 3PVBB 1XSRA 3UESA 3MHZA 3USUB 4RHV3 3VZKA 4BQ2A 1QOOA 4XDOA 4QM9A 5FJHA 3WDXA 5B4NA 1KDKA 4BXSV 1Q3EA 3AXEA 1UYZA 3KB5A 4Y24A 4FPFA 3PVNA 1LODA 2DBIA 2X5IC 2XJSA 3MIDA 1MS1A 4HOOA 5GLWA 3BIEA 1OURA 3IKWA 3WP5A 1BXHA 2ZGMA 5L7OA 5L73A 3ZIXA 4I3PA 4XUNA 5JIAA 1AR81 3MIEA 3JUUA 4CDWA 3AZVA 4LEJA 4BE3A 2E63A 1UOGA 1ZVFA 1IQDC 1O6UA 4AK3A 4W4ZA 4RS5B 2WFPA 3BCWA 4QGMA 4QXKA 2CY6A 2FMDA 3K2OA 1S0CA 3RMYA 4HBNA 4TTGA 2VY0A 3A23A 1QJU2 5C3QA 3PTYA 4QMAA 3POGA 1VPHA 4IERA 4CEWC 4N43A 4OHWA 1XC6A 1A78A 1O5LA 1YXWA 2WJSA 4P9JA 3WP4A 1YI7A 2YC4A 2VTXJ 2P5BA 1N3OA 3MW3A 2YGMA 3NAPA 2E9QA 3ZMOA 5FMOL 1RUD2 4B7KA 3K3OA 3P1IA 4ZU5A 1FOD1 3PIJA 5FBJA 4AHWA 3QBQA 5CFDC 5F1RA 4LULA 5FYVA 1EV11 1SFPA 4QDQA 4JQTA 1W0NA 3VBRB 2B8MA 1V9U2 3NJXA 2F6BA 1AR92 4ISRA 3RNSA 5J48A 2GC3A 3VDAA 3M1HA 5F6KA 4CDQA 2WZEA 2DCKA 1DZQA 4GMP3 1IS3A 1V6IA 1GYKA 1IPJA 1NQDA 2FCTA 5C8WA 3W58A 1OD3A 3QACA 1H2NA 1PM4A 2R0FA 2ID4A 3MGUA 3FBMA 1J1LA 2WFF2 1CX4A 1ZBE3 1R092 2VW2A 4NHXA 1CPNA 1UOFA 3RRDA 5FYMA 1YIFA 1LOBA 1HKDA 1TEIA 4RGKA 3RWKX 3KLSA 2FQPA 4LKFA 2WR9A 3TNPB 4UF0B 1OQ1A 4P9GA 3VDDB 2P6HA 3WW2A 1NE4A 3RZLA 1SCSA 3JZVA 1ZZBA 4K8FA 2LRPA 3RMXA 2J1RA 4DXTA 2AR6A 4AI1A 1GNYA 5DUXA 3BOWA 4S2FA 4YM2A 3KV4A 4RS5C 3L9JT 4Y1VA 4ZZ5A 4RHV2 1HXS3 3AMMA 5FZ1A 3AMPA 5A3LA 2Y33A 2CU5A 5IVEA 1U0AA 2CAVA 1AUYA 2O8OA 2Y6GA 3N9NA 4Y4RA 4Y5TA 5C3SA 5JCTA 3N9PA 2B46X 1YNAA 4IW3A 3WEZA 1V6NA 4O9EA 5FY8A 4F83A 1UY4A 2WLQA 3U0ZA 1VLNA 2ZPXA 5C6CA 4PBPA 3T0BA 3JBG3 2D98A 1CJPA 4MGIE 3MW2A 1K12A 1X8MA 3FJSA 3FHAA 4PIZA 5FY1A 4LTAA 1VB2A 4BQXA 2XVGA 3NJZA 2QFEA 4AF9A 1QJU1 2Q1ZB 4IEXA 4Y3OA 1NLRA 3ETPA 2ZHKA 4X8NA 4CCEA 4DNYA 4AQTA 5AFEA 2D44A 2O8QA 2KA3A 4Q0UA 1HN0A 4AEDB 3J7LA 5F5CA 4OLLA 3GHMA 3I3BA 3RJRA 4C1WA 2D6LX 4OHXA 3ZFGC 5IAXA 3KF5A 1YC61 3MDPA 1C8M3 5LRRA 5LY1A 1GWLA 3FLRA 1GKBA 1QDOA 2IXKA 4HXCA 3ZYFA 1UAIA 1V9U1 4LBLA 1AR91 4HKOA 4XE9A 5AC92 1HJFA 1TQ5A 2R1DA 4UFKA 1UYYA 2PHUA 5DMYA 3NWKA 2RR12 2RMU3 2ZGLA 4CVUA 1WZXA 3MF9A 1LOFA 3AJZA 3QH6A 1U5YA 1ENSA 2FZ1A 1RUJ2 3F95A 1W6QB 1W8FA 4XMIA 3UT0A 2CTVA 2B45X 4BLIA 3VZJA 2QDRA 2WFF1 1IPKA 1R091 2W3JA 4ARXA 5CFCA 4V2WA 4D7YA 1H30A 2G9ZA 1XBFA 4LHLA 4Z8BA 1H8TA 1ND2B 2Q8DA 1UMZA 2UWCA 2AGSA 1ND3B 1NUKA 4Q0PA 4GD4A 1LU1A 4U36A 1KQRA 2DTWA 3MF6A 3MIBA 4OMCA 4RQPC 5GKAC 1O4YA 1XOYA 2RJ2A 3GZUC 4FT8A 4CU6A 4RHV1 3ZXLA 2E7TA 1O3SA 3N9OA 4Q4V3 3MIGA 1PK6A 4EN9B 1ULGA 5SV5A 5J09A 2BZDA 3HD8B 2R043 4GMP0 5EYXA 3H8OA 4GKXA 3GBGA 4NR1A 1V6MA 4UT5A 1AYM3 4YSFA 3NMBA 1I9RA 4D3WA 1BMV2 1JW6A 1S55A 1W2OA 3RZZA 4EQVA 2VZPA 3IDCB 2XR4A 1TME3 5FKBA 2W87A 5JSOA 3P3PA 4L8QA 5FMCA 5ABJC 4PCRA 4LHSA 4XUTA 1XNBA 3U4XA 4LO6B 2YHJA 1CZVA 1H9PA 1U5IA 5FZHA 3TEWA 4G9SB 4IV1B 1GQHA 2X53S 4AWDA 4D6QA 4JC1A 4BU2A 1JZ4A 5L9BA 1N1SA 5BNNA 1DYKA 1R1ZA 1PGW2 2K9ZA 2IVIB 5FYTA 3R05A 2YMZA 4QPWA 1VRBA 3WX5A 1BZWA 1RVF3 3IDEA 5A7PA 1QJY2 3KT1A 4HSJA 3HT1A 4A2UA 3VBHA 2VCAA 5FMDA 3S30A 1VMHA 4AAXA 4AYUA 1TMF3 1EUTA 1M4WA 1G6NA 3PVOA 1G8WA 2D40A 4XOGA 1C8M2 4RSUA 2E6VA 3HT2A 4ES9A 5HI0A 1MS5A 1RUE2 4C1XA 2Y8KA 2RS13 3WD5A 3RVHA 5CYYA 4Z92B 1DGWA 5AC91 1QJX3 1YQ6A 3G7DA 1QH7A 1Y9GA 2IVJA 1BK1A 2VNGA 3APBA 4LUKA 4R8HA 1AR63 4NPRA 3VZOA 3SXWA 2ES3A 3IPVB 2RR11 1W6NA 2WNVB 4YVSB 2VO5A 3OBZA 5A7OA 5CKMA 4WM7C 1DGWX 3J4UH 5ACA3 1ZRDA 1RUJ1 1KJRA 1OSGA 1ZZ8A 2Q30A 1SQ4A 4AHZA 4AXOA 2ZJCA 4DXRA 1W28A 3AB0A 5LEKA 2ZZQA 2J1AA 4Y5Z0 2AREA 1R082 4CUAA 3AP5A 3W59A 2W0XA 3AYCA 5EWSA 3H7JA 2YBPA 4UW5A 1PIV3 5D8AA 1FT9A 3VD7A 5H9QA 1M06G 2DVFA 2F4PA 4JX0A 4XTMA 3ZPOA 4IEYA 4P9XA 3ZR5A 4M0NA 3MICA 3ST7A 4KWJA 3OSDA 2WRAA 3FLTA 2QUOA 4DIQA 3AFKA 4XXPA 2QE3A 5KWRA 4P9IA 5DN2A 4CU7A 2XLAA 1DQ4A 2HJIA 4H55A 2ZKNA 4UFJA 1U5XA 3ZDVA 3WY6A 4Q4V2 3E6BA 2YFUA 2JDPA 3BKZA 3I2OA 1LENA 3LEKA 3R4DB 3I97A 5L7OB 1W2TA 1GFF2 1YJLA 3OF1A 2R073 1BMV1 1DQ2A 2VUAA 2XBO2 3C2UA 2BFUS 3EXUA 4PF1A 2LW8A 3OD0A 5FYHA 3WOGA 2V4AA 3ZFEC 4CDWB 5A32A 3DECA 3MIHA 3OD4A 1TME2 1S0DA 1MQTC 1S2BA 3E5QA 4FO9A 4SBVA 3H1MA 2X5IA 3SKVA 5FYCA 4PLOA 3JXSA 4FQZA 4OUSA 4YLZA 4Y22A 4FPJA 2ZX1A 4JTNA 2A6ZA 3T1LA 1OC1A 3LFMA 3MLKA 4N43B 1PGW1 1AXZA 5T5OA 3NV4A 4FFFA 3O1PA 4PT6A 2PAKA 1LGBA 5F3EA 1DZRA 5DXDA 3NAPB 1QJY1 1BEV2 3B93A 4MO3M 1RVF2 1AZDA 4XFBA 3LAGA 1J3QA 2ARBA 4MLOA 1PGSA 3I7DA 1UOBA 5DUVA 4E4DX 5JAXA 5FYBA 3OGRA 4K7JA 1C8M1 2MEV3 3ZN6A 4AFDA 2O0OA 3KWVA 2W95A 2WO2A 4XQWA 4AEKA 1RUE1 4PDWB 4CEWA 2AH2A 3ELNA 2RS53 1MZ6A 1E5RA 2RS12 4NAOA 1ODMA 3SH5A 3HN1A 1O8PA 2J1EA 2BTVC 4N53C 2WO7A 4B3NA 1CAUA 1UF2C 3BALA 1VRH1 5D2AA 3TN93 1AR62 1DIWA 2BPA2 4IDZA 1Q8VA 4AI8A 4BDVB 2KD7A 2K46A 5KHIA 5ACA2 3UV9A 1RXGA 1LHOA 2AZ5A 5IT6A 1QQP3 4XUOA 4LK6A 1R081 1WBFA 2VOWA 3J26N 3PJQA 5E88A 5F8PA 1PGL2 2PTMA 5DAXA 4LIUA 2XUMA 1H6XA 3N7JA 1BVVA 4B29A 4E8CA 3PTRB 3VKLA 1PIV2 5DAPA 1ZX5A 5E1RA 2WL1A 2Y60A 5DAWA 1O3QA 5ISLA 2QNKA 3I2KA 3FBYA 1H4GA 2WSUA 1ZBA3 2ARAA 2ZABA 2ET1A 5AVPA 5FLIA 2XQXA 2D6OX 3WCSA 1SBFA 1K5JA 3D0SA 1W6OB 3H8RA 4YZ3A 3PUQA 1ONAA 3DEMA 1LNSA 4E2SA 4MXWA 4BIOA 2GNMA 1MVEA 1HB1A 2VCCA 4Q4V1 4NJ4A 1YFWA 4MYEA 2XL7A 4CXYA 3QOPA 3FUOA 5AVAA 2XJRA 5LBBA 3G6JB 1OT5A 3AL5A 3KCYA 4RS5A 3RYPA 5B4XA 3SHRA 2XBO1 4AGRA 2FDKA 4LE4A 2R072 1GANA 2XLGA 2WNEA 4OCTA 5DUUA 4MXVA 4FOQA 4QQLA 2XVLA 5KC5A 2QQKA 1OMIA 2CV6A 2BGPA 3LEMA 3CZUA 3RQ0A 3KGZA 4PDWC 1PVC2 1ZA4A 5FZEA 1XU1A 3QD6A 2WWSA 1V6LA 1SDWA 3K4AA 4K1YA 5HV4A 2WINB 1BCXA 2QBXA 4QT6A 4AVAA 2PHRA 1VR3A 5JVVA 2XJTA 1VE0A 4YZ2A 5GZEA 1HRV2 1ZNPA 1QJFA 3ZKUA 2BVBA 2ZTNA 1GV9A 1MZFA 2P4EA 4GH4C 4KG8A 4XCBA 4B4QA 1CN1A 1I3HA 1WKYA 1BEV1 1RVF1 5CB7A 3TRSB 4CCNA 2VGDA 3L2HA 5FV3A 5IWFA 1KS4A 1BJQA 2Q0AA 1MACA 1SHWB 1GOHA 2HEYF 3SISA 2DDUA 1W8OA 4JGYB 2DURA 5FZ3A 3THTA 3W20A 2MEV2 3IB3A 4L0PA 2XHNA 5C9AC 1QDCA 2EXJA 2XXZA 4U2AA 2RS11 2Q8OA 4MG2A 2RS52 4YGBA 2BW8A 4CP9A 3BTXA 2UYBA 3AKQA 4LBQD 1LHUA 1O4ZA 4V2VA 3ZFGA 3BODA 4Q1PA 1JZ8A 1AR61 2PELA 2YV8A 4HFSA 4L9BA 3AP9A 4TWTA 3UKTA 2VM9A 3LFIA 2ENRA 2CL2A 2JG8C 1OUXA 5ACA1 1RUH2 4EYUA 4CDUC 2VW0A 1PGL1 3IAPA 2IXCA 2H6BA 5IVFA 1EYBA 4GB32 5D1IA 5I8TA 1WMDA 1XJAA 5FPXA 4TXWA 2GH8A 2AACA 4FPEA 1OA2A 3E6DA 4BH9A 5IUQA 3HIFA 1KGYA 4H7MA 4KI5M 1PZ8A 3POEA 1QF3A 3LD8A 5LY2A 5A6YA 3OEAA 2HYKA 1OOPC 3OGJA 3FLPA 3ZYPA 3HQRA 1ZBA2 3NV1A 2BBAA 3WCRA 4E4ZA 3MLJA 5FY0A 5FQ0A 1WCUA 4GALA 1NOVA 2BYVE 1AR83 4NWWA 3S7EA 2ZGKA 4LO8A 1X9PA 4BM8A 3O5SA 3WR0A 4JDMA 2HWF2 4I0WB 1PMIA 1CJDA 3VV1A 1AJOA 5C8CC 4ZU7A 5HCFA 4P5YA 3NRUA 4ZKTB 2Y0IA 4KMQA 5GLTA 5L36A 1GBGA 3N9LA 2XJUA 4RQPA 2WLPA 4XFCA 3RYRA 2AENA 3GYDA 3K3NA 2C9KA 2R071 2W39A 3KGLA 3MO4A 4M4RA 4XF0A 4PQ9A 3WNNA 1DYPA 3P6BA 2Y6KA 5FO7B 4ES8A 4IGQA 4H7LA 4JGYC 1OPMA 5CEHA 3OTFA 1P8JA 4NVPA 1JYNA 1PNGA 1PVC1 1FAYA 4JDNA 2NN8A 2JE7A 1K5MC 1UD1A 3DYOA 1CQ9A 4JTOA 1TVGA 1SG3A 5BNNB 1A34A 1EV13 1QKQA 2VOXA 4FTSA 5ABJA 1L3JA 3IM0A 5F7UA 5F2WA 2WKKA 4QDSA 4BQ5A 4KNCA 1HRV1 2VQ0A 4XABA 4KBBA 3O7OA 1HN1A 5T54A 2ZEXA 2PHTA 4TLGA 3AYAA 3J7MA 4BQ1A 2A6VA 1CESA 3ACGA 2EXHA 2ZGSA 4XBNA 5FCCA 4V1PA 3NNGA 3WF1A 1ZZCA 4CDXC 5K8SA 3I2DA 2A73B 4UAPA 2DUQA 2OUJA 1GLHA 3ZPYA 3VHRA 4EZ4A 2FBEA 2MEV1 2PHLA 3WQ1A 3SQOA 5J1XA 3ZXFA 4QGNA 1F2NA 2RS51 4H14A 1PZ7A 2D3PA 1G7YA 2KXLA 4KU7A 4R9AA 5FP9A 1GUIA 5FUNA 2QQVA 3GDBA 4J25A 5DUWA 2BNMA 3O12A 2PHFA 3K4DA 3ZYIB 1WLDA 1DHKB 4AG4A 3NO8A 4WBBA 5ANNA 3TYJA 5JR7B 5T3NA 4EN7B 1RUH1 5A7SA 1H2KA 1RIRA 4FSJA 2XVKA 2W94A 2ZHLA 1C28A 3FMGA 3HMYA 4GB31 4IE7A 4ASMB 4BIFA 4N90A 3KQ4B 5JPNB 4DXSA 3AP4A 1W8ZA 1DYOA 3ZKYA 1YEWA 4WM7A 4A3ZA 4NROA 1FNYA 4QAWA 4J1XA 5FLHA 3GBFA 4QHBA 3U14A 5H9SA 3THDA 3B69A 1UU4A 4Z07A 1UIJA 5FDBA 1OVPA 2A70A 2A6WA 1TE1B 3ZSLA 3V0AB 3AZWA 5HV0A 2QVSB 4AI9A 3OPWA 2R7EB 3C7EA 3IDBB 3U4SA 3I4IA 4GWMA 1PZ9A 1LHWA 2YBSA 2PQSA 3H0OA 1AR82 2YDEA 4Q0QA 2ZMKA 4UFHA 3VKOA 1HB2A 2HWF1 3J7HA 1ASJ2 1O59A 1UY3A 2EICA 2W5FA 3WW3A 2FDGA 3OB8A 5K0UC 5FIXA 2HKXA 1RJ7A 2IFRA 4OFGA 1NG0A 3ZMNA 4YFWA 1CONA 1D4VB 1S4CA 2CAUA 1T6GC 2CGPA 1NAEA 1QJU3 5A32B 4DQAA 1RUOA 1C1FA 5T5PA 1NKGA 3PJYA 2ZX2A 4L97A 4ASLA 1IKQA 3B94A 2VG9A 5IVCA 2XWBB 3AVRA 2E7AA 4RFRB 2MNGA 2X5IB 5EZWA 3R6SA 1COV3 4Y22B 2VQTA 2HBTA 3VKMA 4Y1ZA 4GKYA 2ZEZA 5G04L 3T30A 5A3NA 1K42A 2OKXA 3ZFEA 4H3WA 4UBGA 4CCMA 1BVP1 4DUXA 3GZTB 4LA3A 4CEYB 2ADEA 3QLQA 1MQTA 4FPHA 1XNDA 1F8VA 2BUKA 5DZFA 5DG1A 4PJYA 4LK7A 2ET7A 3J7NA 4ET7A 3TEZA 4CPBD 2W9XA 1UXZA 2BERA 4NAMA 3ZYGA 2BGOA 5KXCA 3ZN6B 3IPVA 4LBJA 3T2PA 4CEWB 2GALA 1N1YA 2BDRA 2UYAA 2P34A 4X6RB 1W9FA 3H7YA 1VBA2 4KH9A 4WV8A 5FMOS 1R093 5EV7A 4BYYA 1NQJA 1UU6A 1J1TA 2UY9A 5I8SA 1CAUB 2J22A 3JQWA 2NZ9A 1W0OA 2JDMA 3RJ2X 3WP6A 1RUF3 5CFDB 2VNVA 2DVAA 4W50A 4KWUA 1SPPA 3MV01 2WS91 4LPLA 1MZ5A 3BVCA 1CPMA 1UU5A 5FYYA 1ZZ6A 1UW8A 3N7MA 1R1A2 3WF2A 3T2OA 4G4FA 2Q8CA 4BHPA 1CZSA 4A41A 1ENXA 4N53A 4RGGA 5GLZA 3WG3A 2JE9A 1GZWA 2D6PA 3RSJA 2BVVA 1SEFA 2DVBA 5F39A 4L2NA 4NE9A 3ES1A 1DDLA 1RUI2 1OQDA 4IE5A 2QZ3A 2Y6LA 3CMGA 1Y7BA 1NZIA 3C7OA 3H50A 1UO9A 4MUVA 3VHNA 5C3OA 1UNBA 4LO7A 4RD7A 5A1LA 4JGZC 4MXWB 3O1UA 3BTAA 4CRQA 4DY5A 5IVJA 2IXJA 2VULA 1O7FA 4W6XA 4I09A 3GCWA 2JDHA 3WG2A 1BLZA 4LO4B 4LE3A 1ASJ1 4CEYC 1RUC2 3HR9A 5FZMA 1OPOA 4MGKE 3CHXA 2R49A 3K48A 5FY9A 3MIFA 2VXJA 5F3CA 4OMDA 5JOWA 1DBNA 1MZEA 4XACA 4WM8C 5DZEA 1HB4A 5JOXA 2WUHA 4PHZA 2VH9A 4FP2A 5FP4A 1SLCA 4BMBA 4Q5OA 4TN7A 3HJRA 2C1FA 4XMAA 4DEQA 2A3WA 2JDYA 2RDQA 3TEYA 4MGYE 4UWDA 4FBFA 1COV2 2Y6HA 3BB6A 2YXSA 2JB8A 2QTWB 4AGVA 4WZCA 2EIEA 4LA2A 4P00B 1QWRA 5IVBA 1PO12 5F37A 4OQ8A 3FL7A 5AC93 4OYUA 4PDWA 3L2YA 2D7FA 2JXAA 2WZ8A 3AXDA 3K77A 4FQ4A 5EXOA 5FPZA 3UKNA 3VKNA 4AFMA 2RR13 4YARA 5LEJA 2D93A 2B39A 3A4UA 4HK9A 2DCTA 1W8TA 5I0SA 3I2JA 1RUJ3 1ULEA 3D6EA 1GQGA 2JDZA 1VBA1 4FOWA 2KR2A 2ZZJA 4GH4A 4LLOA 4CP9B 4CP0A 4WVZA 4NOTA 3WINE 3ZFGB 4MGTA 2K0GA 4ZZ8A 5A70A 4FAGA 4QX8A 4LKDA 4KGGA 4Q4W2 1SDDB 1S0BA 1RUF2 3DKQA 5IJRA 3WT3A 3AC0A 4COYA 2QQIA 3C8XA 4RFT0 3BUCA 4HKWA 2HWD2 3N9MA 1R1A1 1A3KA 1B35C 4Q4Y2 5K4LA 4YZ5A 5C9AA 4XILA 3Q9OA 3GBWA 3LE0A 4MGSA 4BK5A 3S5QA 4MHUA 2XJQA 4M00A 3VHOA 2XMLA 2YC2A 4GJYA 1UQXA 2Z2SB 2HWB2 4AVSA 1W6OA 1H1IA 4LLFA 1RITA 5JR2A 1RUI1 2R1BA 4AFAA 2JG8A 4YWAA 2VOVA 1NXD1 5CIRA 4CDUA 1QH6A 1S1AA 5FQ0B 1MEC2 1POV1 1MS8A 4LBMA 2P3IA 4E8DA 1J83A 2VUJA 4FXGB 3DF0A 5BXXA 4DRRA 5CZKA 3AYEA 2RS32 4LNVA 3M70A 4XTPA 4AR2A 1AVBA 1RUC1 2D97A 1YFUA 2XJVA 1OOPA 4EE2A 1RL3A 4RQPB 5KHJA 4IEQA 3BN6A 1BKZA 1C5IA 1QIQA 3QH7A 3HAGA 1RJ8A 3PURA 2PFWA 2WQ8A 4A3XA 1W2NA 2FDJA 4QQOA 1G9CA 1UKRA 1F4AA 2BOJA 5JZGC 2WWJA 3CNAA 1Q8QA 4GWJA 2LROA 2B9UA 4LHKA 5FZ7A 5IVYA 2WAOA 4AI2A 5LBEA 1GNZA 1HQNA 1QJY3 2VZRA 3LZZA 5C8CA 3OBRA 4XZUG 3WW4A 1WUVA 4GIQA 3N7LA 1UZ0A 1COV1 5A1FA 1FX5A 4BXFA 4IEVA 4D94A 3VD9A 3FFQA 1BQPA 5ABJB 3AZYA 2VR4A 1O8SA 3LGRA 3VBUC 3WQBA 4QGLA 2Q4SA 4YNIA 2GMMA 1RUE3 1PO11 2FZ2A 4Q4X3 1T2XA 1JXNA 2WIIB 3PU8A 3ILNA 4JGYA 2QQWA 1XE8A 4XFAA 3ZLIA 3J9SA 4UOJA 5FPVA 3I2IA 4AFCA 2VQAA 4FPGA 1VRH3 1OF4A 4RL7A 3POBA 1K5MA 4QM8A 2YU2A 2ZKLA 1CIWA 1RUNA 2NP0A 1FYUA 2VNRA 2WT0A 5FZAA 1X50A 1OBNA 4ZY9A 3UGHA 1R083 2VOTA 2WYFA 2ZGTA 1RYYA 4AOCA 1Y9QA 3NL1A 4GWNA 2FDHA
chains in the Genus database with same CATH topology
1SFPA 1SPPB 2QQMA 3POJA 2QQLA 4LOSA 4GZ9A 3KQ4B 2QQOA 2QQKA 3POEA 4LMFA 3POBA 3POGA 1SZBA 2WNOA 5CKMA 1NT0A 3POFA 3DEMA 1NZIA 4LOTA 5CISA 3POIA 5CKNA 4LORA 1SPPA 5CKQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SFP A;  1SPP B;  2QQM A;  3POJ A;  2QQL A;  4LOS A;  4GZ9 A;  3KQ4 B;  2QQO A;  2QQK A;  3POE A;  4LMF A;  3POB A;  3POG A;  1SZB A;  2WNO A;  5CKM A;  1NT0 A;  3POF A;  3DEM A;  1NZI A;  4LOT A;  5CIS A;  3POI A;  5CKN A;  4LOR A;  1SPP A;  5CKQ A; 
#chains in the Genus database with same CATH topology
 5F9T A;  5CVR A;  4IXL A;  2GMP A;  1Q56 A;  3AK0 A;  4Q4W 1;  4EN0 A;  4CDX A;  1RUF 1;  1UY2 A;  3NKG A;  3D4K A;  1Y9M A;  2QCS B;  2HWD 1;  4JQR A;  3RG0 A;  1LGN A;  4Q4Y 1;  1X82 A;  3ROU A;  1ZM1 A;  3LIH A;  4HT1 T;  3PNA A;  2ZGR A;  5KC6 A;  2G9F A;  3RI8 A;  5FOJ B;  3LEG A;  5JI7 A;  4WM7 B;  2HWB 1;  5BNP C;  4QB1 A;  3M2M A;  4LBK A;  4IET A;  2XLF A;  4K1Z A;  1V00 A;  4UYB A;  3M3Q A;  2JJ6 A;  1ENR A;  4A45 A;  4H2A A;  4ASK A;  1LHV A;  1OH3 A;  4BA6 A;  4IQP A;  4DMI A;  1JTZ X;  2NMO A;  4OHZ A;  1N3Q A;  3O1V A;  1MEC 1;  1UIK A;  1GMM A;  5DPN A;  5IW0 A;  2HLE A;  2XBO 3;  5GAL A;  5DG2 A;  1JU3 A;  1UMH A;  1W8N A;  4FPY A;  4O7X A;  3V64 A;  2F4L A;  3WNP A;  4MH0 E;  4Q8K A;  5I0R A;  4ZHN A;  3POW A;  3RZH A;  5CU1 A;  5FZG A;  1QNY A;  2W91 A;  3DN7 A;  2RS3 1;  3ES4 A;  4QXB A;  2CNA A;  2WNU C;  3LOI A;  1ODN A;  2BBV A;  4BQY A;  5FJK A;  3GF6 A;  4FPO B;  2A75 A;  3HNM A;  4AVT A;  4LMF A;  2DCJ A;  1YQC A;  1S0E A;  3MPP G;  3ZXD A;  4E4S A;  3CBN A;  4NRQ A;  1YLL A;  3KCC A;  2VU9 A;  4IE0 A;  1NXM A;  1WLC A;  2VBB A;  2GAU A;  2QJV A;  1NYW A;  2YBK A;  4LOT A;  4XUR A;  3OUH A;  5I8Y A;  4KWL A;  1BEV 3;  4Y1X A;  4K9S A;  1FAT A;  4QQH A;  2VC9 A;  4DB5 A;  3ZFE B;  2PXJ A;  1UL9 A;  3CO2 A;  1PO2 2;  5LK7 B;  2QQP A;  2R6Q A;  3VBO C;  2VQU A;  1MS0 A;  2J1V A;  1MQT B;  1VAV A;  2W46 A;  4JKK A;  4UW6 A;  1BBT 2;  3U1X A;  3M8L A;  3WZ1 A;  4Q4X 2;  1UX7 A;  1HV1 A;  3ZXA C;  5FFO C;  3FN9 A;  3TAY A;  1EAH 3;  5CNA A;  2FCU A;  2B9V A;  3VL9 A;  1VRH 2;  2WSV A;  4NIH A;  1JYT A;  3T4H B;  1UKG A;  4HL0 A;  1UZY A;  3CJX A;  1OHF A;  2DCZ A;  2I2S A;  4QD2 A;  4F8A A;  1DLL A;  4TLF A;  4Q2F A;  4ORF A;  2ZML A;  4S2G A;  3DPR C;  3OBT A;  1OI6 A;  1YQ5 A;  2H0V A;  2EIG A;  1SLA A;  3OBA A;  3THP A;  4FAH A;  1SPP B;  1C3H A;  3VGI A;  2IFW A;  2X29 A;  4P14 A;  1W3V A;  4QX1 A;  3JD7 2;  4AQ2 A;  2P37 A;  3FX3 A;  1C4R A;  4NHY A;  1ENQ A;  1WGP A;  1IS4 A;  1EPZ A;  4M0H A;  4IEO A;  4ITC A;  4N53 B;  4X6Q B;  4CU8 A;  2P17 A;  1CVN A;  2ARX A;  1Y4W A;  1GZW B;  1SLT A;  2OA2 A;  4BQ3 A;  3PUS A;  2YG0 A;  1E5H A;  1W9Y A;  4I2O A;  1YO8 A;  4YM3 A;  3V0A A;  4RYD A;  4QQP A;  3VL8 A;  1QXP A;  1D0G A;  1PMJ X;  2B5H A;  2JX9 A;  2AEY A;  1U5Z A;  3I54 A;  1HRI 2;  1Q43 A;  3ZX7 A;  2V4V A;  5GLV A;  3EJK A;  1AJK A;  4N9H A;  4BZ4 A;  1UOJ A;  1LHN A;  1E5S A;  2Z4F A;  3AZZ A;  1MS9 A;  2ETE A;  5B2G B;  2R0H A;  5GZC A;  2PLV 2;  1WCK A;  4XF9 A;  1GSL A;  1BK0 A;  3E5U A;  3IN9 A;  3C7F A;  3C3V A;  2VL4 A;  5FKC A;  3OJB A;  3WDT A;  4CUC A;  4XF3 A;  3OY8 B;  2BQP A;  1BYH A;  1PVC 3;  4P9L A;  4GXL A;  2DFC A;  1W99 A;  3IBM A;  1RED A;  1VBE 2;  1YJK A;  2VZ1 A;  2J1U A;  4HN1 A;  2F17 A;  1WWY A;  2E31 A;  2VUD A;  1JS9 A;  5FYZ A;  4B8E A;  3NNF A;  3ZYB A;  4MGQ A;  4XW3 A;  1FPN 3;  2GC0 A;  3AMH A;  1HRV 3;  4TSV A;  1D2S A;  5A6Q A;  1JU4 A;  3HOB A;  4C8D A;  4PIX A;  4CEY A;  5JUV A;  1QU0 A;  4BIS A;  4HAN A;  3Q8A A;  4FPL A;  5L19 A;  2XUE A;  1SLI A;  3H42 B;  2P3J A;  1KS5 A;  1L7Q A;  4UI9 L;  1A6C A;  1PO2 1;  3SH4 A;  1RMU 2;  2CYF A;  1YFY A;  1LOE A;  2JD4 A;  2A1X A;  4MET A;  1BBT 1;  4CP1 A;  3H3Z A;  5EJZ B;  3O0W A;  4Q4X 1;  2VAU A;  3EO6 A;  3AL6 A;  1VBD 2;  2EXI A;  2BJS A;  1EAH 2;  2XON A;  3ZM8 A;  4LBN A;  2GN7 A;  3BPS A;  4BME A;  4IE6 A;  5CFD A;  2DF7 A;  1WW7 A;  3JU9 A;  4F3J A;  3PLQ A;  4GH4 B;  4UFI A;  1RUH 3;  5I0U A;  4NII A;  1HW5 A;  1US3 A;  3HNY M;  3N35 A;  3USS A;  3AP7 A;  4MX3 A;  4YVW C;  1MS3 A;  3O14 A;  3CDZ B;  3P3N A;  4QXH A;  4AGG A;  3ETQ A;  3LDK A;  4GB3 3;  4JAA A;  3SKJ E;  3NNL A;  2HWC 2;  3I2F A;  1XRU A;  4HET A;  3N9Q A;  4E27 A;  3LOB A;  1K3I A;  2B42 B;  3H3U A;  3HNB M;  3JD7 1;  5FZ6 A;  1D7P M;  4MHR A;  2QZ2 A;  4QU2 A;  1NX9 A;  5FZF A;  4R4Z A;  3D8C A;  4OUL A;  3ILR A;  4CPB A;  4CTE A;  5C9A B;  4E2G A;  4BOW A;  4QHO A;  5JOZ A;  2VZO A;  3LA7 A;  1F5F A;  1V6K A;  4OI2 A;  4R9C A;  2GNT A;  1ULD A;  1DGL A;  4NRM A;  3WF0 A;  5C71 A;  1OH4 A;  2I07 B;  1VP6 A;  5A3O A;  2SLI A;  3III A;  1LOA A;  5GLU A;  2JG8 B;  2HWF 3;  4CCC A;  4CDU B;  5FBZ A;  3WQ0 A;  1GOF A;  2WYS A;  1HRI 1;  5GZF A;  3V0B B;  1AX1 A;  1XYN A;  4PQQ A;  5A33 A;  1W3X A;  1YI9 A;  1QXJ A;  1ST8 A;  1SFY A;  1VMF A;  3KVB A;  4R4X A;  1ZRE A;  3WF3 A;  1NY7 2;  2PLV 1;  3UL2 A;  4FPK A;  2ERF A;  4DUV A;  3W21 A;  2BFU L;  2YPD A;  1H2L A;  3HQU A;  4Q27 A;  3K75 B;  1OOP B;  1LRH A;  1SLL A;  2W1Q A;  5LAT A;  4O61 A;  1VBE 1;  1FI2 A;  1XNT A;  2JG9 C;  4Z2A A;  5F5I A;  1KFU L;  1AYN 2;  1AL0 G;  4OVE A;  3N4M A;  3SC7 X;  1XXN A;  4AAP A;  5LWB A;  3IIA A;  1OLM E;  4L11 A;  2LM3 A;  1FPN 2;  2HH9 A;  5C8C B;  2XGX A;  2G4I A;  5H9R A;  5C3P A;  1JMU B;  1UMI A;  1ULP A;  2G9G A;  2WT1 A;  3U78 A;  1DP0 A;  2N7G A;  2C4X A;  5T5J A;  3N36 A;  1FV2 A;  5FP7 A;  1R64 A;  1RMU 1;  5JZG A;  1UXX X;  3MLL A;  4JHZ A;  4K8R B;  1J58 A;  4HZF A;  5I0T A;  1DQ5 A;  5I93 A;  3SCF A;  1YRZ A;  3TEX A;  4CXW A;  1VBD 1;  1K5M B;  3S6P A;  2BEO A;  1CAX A;  5BNO B;  1EAH 1;  1W2A X;  4LUM A;  5FUI A;  2WS9 3;  3I3D A;  4XJ9 A;  5FY7 A;  1YHF A;  4P08 A;  3Q8C A;  3RGB A;  2EAA A;  3KQR A;  3WDV A;  1JI6 A;  4YYO A;  1JYC A;  4MZU A;  5LBF A;  3R4U A;  2P1B A;  2GDF A;  3E97 A;  4XBL A;  2VPV A;  2AYH A;  4ERO A;  5G05 L;  2Z42 A;  4HN0 A;  1W8H A;  4XXA A;  4B4P A;  3VD4 A;  1S0J A;  3PIG A;  2HWC 1;  4CDX B;  1Q8S A;  4JVA A;  1FV3 A;  3WDU A;  1XE7 A;  2VMF A;  5CA6 A;  2VZS A;  4S2D A;  1PHM A;  4CCO A;  3K51 A;  4ZON A;  4LT5 A;  1UCX A;  5JIU A;  2WZR 2;  3ZSE A;  5FR3 A;  4LO5 B;  3LA2 A;  4SLI A;  4G3Y C;  5FWJ A;  2XJP A;  1WW4 A;  3HEI A;  1Q8P A;  4ZPI A;  3ZFF C;  1OA3 A;  3D3A A;  1JOP A;  5F6L B;  4FTE A;  5EYY A;  5KR7 A;  3RZM A;  1W8U A;  4LBQ B;  3ZYJ B;  5JOY A;  1CAW A;  1QMJ A;  1VBB 2;  2P2K A;  2PYT A;  1G9D A;  3A7Q A;  1ASJ 3;  3Q8F A;  2ZA9 A;  4BLJ A;  2KM2 A;  5J96 B;  1H9W A;  2ZBJ A;  2XKP A;  4P02 B;  1NCR C;  5T5L A;  4M3C B;  2DVG A;  2VE1 A;  4EV0 A;  4GZ9 A;  3ZSM A;  1NY7 1;  1OXC A;  2BWC A;  3LPF A;  5BNP A;  4N8M A;  1PX3 A;  1DFQ A;  1LGC A;  4D7T A;  2ZMN A;  1H8V A;  3DXU A;  4XFH A;  2E51 A;  2GH2 A;  2WNO A;  3AKR A;  4D6R A;  2YPJ A;  1YFX A;  2OT7 A;  1OLM A;  1W9W A;  1AYN 1;  2WQZ C;  3ZSJ A;  5BNO C;  2C24 A;  1UPI A;  1JZ3 A;  2ZAA A;  1FPN 1;  5K0U B;  5C5U A;  4LJH A;  3UYJ A;  4XDP A;  2J1S A;  3B3Q E;  3NNJ A;  4IL7 A;  4IV3 C;  1YCI A;  3S5A A;  4OHV A;  4Z82 A;  4W6Y A;  3WUD A;  1W6M B;  3BTZ A;  1JUH A;  4XJU A;  1SLB A;  1VBA 3;  3IMN A;  1GWM A;  4LIT A;  1DU3 D;  2RDN A;  5EP9 A;  2QQJ A;  5GJ6 A;  4FVV A;  2JKB A;  2YYO A;  2RJK A;  2WAA A;  3B9C A;  3FZ3 A;  5LA2 A;  3RZJ A;  1GOG A;  3RPQ A;  3HBK A;  1XNC A;  3SEE A;  3WF4 A;  3WNL A;  1IG0 A;  2MHF A;  2WS9 2;  2BNN A;  4IUG A;  4DY3 A;  3H1Y A;  1R1A 3;  4QKD A;  3NQH A;  4F7Z A;  1YQ8 A;  5F3G A;  2PMW B;  3HVD A;  3CL1 A;  3O1S A;  4Y26 A;  2P6C A;  3CF6 E;  3S7I A;  4AW7 A;  1H8T C;  3HN3 A;  3CIH A;  3JQX A;  1BHG A;  1RUI 3;  3B01 A;  3J8F 3;  3DL3 A;  1ZYB A;  4QDR A;  2NQY A;  4B4R A;  4YW4 A;  4CCD A;  1D4M 2;  1QNW A;  1SBE A;  2WZR 1;  3OYW A;  2A7A A;  3ATG A;  4MVT A;  5DAV A;  1W6P A;  1POV 3;  3MI8 A;  3DCQ A;  1YWK A;  2E33 A;  4XPV A;  2ZGQ A;  3O1O A;  2D6K A;  5ANQ A;  4K6B A;  2VMD A;  1H0B A;  1PK6 C;  3ZOI A;  1W2U A;  2BWA A;  1VBB 1;  2IUW A;  2UWB A;  4QX7 A;  4Y1Y A;  4BCU A;  3U10 A;  4OI0 A;  3THC A;  1WD4 A;  1RUC 3;  2JD9 A;  4A42 A;  3KT4 A;  1LES A;  1NLS A;  1US2 A;  1SAC A;  2DCY A;  3IDA A;  1JOD A;  4K20 A;  4OZO A;  5DDJ 2;  1O4T A;  3AFG A;  4QPG C;  1H1M A;  5C5T A;  2YRO A;  2BV4 A;  3AZX A;  2XWJ B;  4COW A;  3NV3 A;  1O3R A;  3CJI C;  2ZEY A;  2Y26 A;  1WMX A;  4XUQ A;  3SIT A;  1N1T A;  5F5Q A;  1WME A;  1NA1 B;  4DEV A;  2AC1 A;  3POY A;  4A7Y A;  3M3C A;  4XCA A;  4JGZ B;  3VBS C;  1X36 A;  2RE9 A;  4TYS A;  2JDU A;  4CUG A;  5F3I A;  3M4F A;  4WZF A;  5EJ1 B;  3ACL A;  3O0X A;  4UW4 A;  1PO1 3;  2V72 A;  5FMB A;  4NPL A;  2K2S A;  2TBV A;  1KIT A;  4ZS3 A;  5JXJ A;  3TBD A;  3WG4 A;  4LR4 A;  4RGA A;  4LKS A;  4NMI A;  4QB2 A;  2JKX A;  3PVE A;  2E53 A;  2OUH A;  4UFL A;  3C7G A;  3MBW A;  4WM8 B;  5C4W C;  4XBQ A;  1XYP A;  2ZOE B;  2JEC A;  1X8E A;  5FO9 B;  2GU9 A;  4CZS A;  5IK5 A;  2VNO A;  1ZZ7 A;  4FFG A;  1GZT A;  3MPB A;  2PQQ A;  2GND A;  2Z69 A;  3BGA A;  2GZW A;  5FZL A;  5L9V A;  1WBL A;  3VB9 A;  1O5U A;  3LPG A;  4B1M A;  2VW1 A;  3FWE A;  4JV4 A;  5CAD A;  2A3Y A;  2OW4 A;  4UBH A;  2LAL A;  1L7R A;  3DUI A;  2GME A;  4Q4W 3;  3D0J A;  4NPM A;  1OLR A;  3ZO0 B;  5IAV A;  5FZ4 A;  3F2Z A;  1WLT A;  3OGG A;  3VHP A;  4A6S A;  5J3U A;  4D6S A;  4A7Z A;  3W9A A;  2HWD 3;  3BTY A;  3TB0 A;  1PM7 A;  4Q4Y 3;  1ULC A;  5FPL A;  5D8A C;  4URT A;  3SLI A;  4RR3 C;  1UZW A;  4D7S A;  5FZ8 A;  3TWI A;  2HWB 3;  1EPW A;  2VEC A;  1DQ1 A;  1RTV A;  2R30 A;  3PDQ A;  2D3R A;  2UWA A;  1UYP A;  2D5H A;  2Q5T A;  3ECQ A;  3LDR A;  3WHU A;  1D4M 1;  3J8F 2;  3BU0 A;  3A22 A;  1MVQ A;  3IZO A;  4YVW A;  4NRP A;  1MEC 3;  1IPS A;  1C1L A;  2C6S A;  1NA1 C;  4JRA A;  4N7U A;  3HBZ A;  5IHR A;  4ISQ A;  2NM1 A;  2UUR A;  5DAQ A;  3AP6 A;  5CKQ A;  5IVV A;  4QX0 A;  1DG6 A;  4JCK A;  5A7N A;  3B9I A;  3CU7 A;  4YZ1 A;  4DPN A;  2RS3 3;  1VBC 3;  3I3M A;  1B35 B;  5IK7 A;  5EHD A;  1C57 A;  1F9K A;  4QPY A;  5DDJ 1;  1QHD A;  2Y6J A;  5A33 B;  4GAZ A;  4QX5 A;  4C90 A;  3OY8 A;  4XZP A;  2VMH A;  4ZS2 A;  1REE A;  3SH3 A;  5IFP A;  2PHX A;  3A0N A;  1S2E A;  2VVE A;  1LOC A;  5H9P A;  1QGL A;  3HQX A;  2CDP A;  1IS6 A;  4JKM A;  1N3P A;  1B09 A;  1FMD 3;  1HQL A;  3WHT A;  3I3E A;  1XQN A;  3VBF C;  4HG6 B;  4IGP A;  2VCB A;  4BB3 A;  3EYP A;  1E57 A;  2ZGP A;  3ZSK A;  3W5M A;  3RYK A;  4BWO A;  2VTX A;  3ACF A;  5A3P A;  1POV 0;  4HK8 A;  5JXH A;  3DYP A;  3GCX A;  5FP8 A;  5KHG A;  1JZ2 A;  2TEP A;  3ACH A;  4OI4 A;  3CLP A;  4YW6 A;  4P9Y A;  1QOT A;  1UY0 A;  3ZN4 A;  1DZT A;  1TZO A;  2GNB A;  2I45 A;  2P3K A;  2RM2 2;  3AMQ A;  3PUI A;  4I0A A;  1XU2 A;  4YW7 A;  4LQR A;  2W47 A;  2JG9 A;  3KV6 A;  1CZT A;  1AR7 2;  1HJG A;  4DRV A;  3W5N A;  2VZV A;  5E89 A;  5JZG B;  4EWA A;  1WCQ A;  1W04 A;  4QU1 A;  5LW9 A;  2NLR A;  1UZV A;  1ZZ9 A;  5TSW A;  4DIN B;  3FHI B;  2ZXQ A;  2RDR A;  3LCP A;  1LEC A;  1DGR N;  3SCG A;  1ULO A;  2ORX A;  4QPI C;  1H4H A;  3N3H A;  4K3U A;  4D69 A;  1CAX B;  1UN1 A;  5BPX A;  2FHR A;  4QXC A;  1NZC A;  3VBU B;  3ZXG A;  3I59 B;  4IEU A;  5KBF A;  4QKF A;  3ZVX A;  2DU1 A;  1AXK A;  2FMY A;  3H8U A;  3BYW A;  3NNM A;  4L92 A;  4YG0 A;  1KEX A;  5IAT A;  4XEZ A;  3GNE A;  2HWE 2;  1UZZ A;  3B00 A;  1XB9 A;  1URX A;  1UWW A;  3T3Y A;  2O1Q A;  4MAD A;  5EQU A;  1PVX A;  1KXG A;  5KXE A;  4OUE A;  3I3Q A;  1IQA A;  2Q1M A;  3ZIW A;  1NE6 A;  3PHM A;  1G9F A;  2LTN A;  4AI3 A;  4XJZ A;  3PME A;  1NCQ B;  4QB6 A;  4QX2 A;  1CGP A;  3J8F 1;  5FZK A;  3UGF A;  1DF0 A;  2D43 A;  2JE8 A;  2DTY A;  3T0D A;  3RDI A;  2VZ3 A;  5JI9 A;  4LOR A;  5JWP A;  3V0B A;  4P9W A;  1TNF A;  4WVM A;  1Z7S 2;  2EA7 A;  1JYW A;  4XQD A;  5FZO A;  1CAW B;  3BIW E;  1G9B A;  1CIY A;  1PNF A;  1XSQ A;  1DQ0 A;  3H3L A;  1WCD J;  2BGC A;  3AM2 A;  2BP6 A;  4Q8L A;  2W08 A;  3KF3 A;  3K46 A;  3A0K A;  1RGS A;  4M3C E;  1VBC 2;  4BPZ A;  2YUE A;  5BV6 A;  5LA0 A;  4CXX A;  3MZH A;  4AVC A;  2Z5W A;  5A7W A;  4K21 A;  4ATE A;  4K40 A;  4YFZ A;  3ZFF A;  2XG3 A;  2CGO A;  1JBC A;  3AKT A;  3NST A;  3T08 A;  3A21 A;  4QWN A;  3KV5 A;  2CSG A;  3AX4 A;  5BNP B;  5CG8 A;  1CR7 A;  4L99 A;  5JMC A;  2IC1 A;  3ITQ A;  2EXK A;  3OUI A;  1NT0 A;  3POF A;  4Y20 B;  2VVD A;  4CCK A;  4OZX A;  1FMD 2;  1SFN A;  3M3E A;  5A1A A;  1NCR A;  4YW3 A;  5C70 A;  1PO2 3;  3ZYR A;  1XYO A;  3GJB A;  4MGZ E;  4NHL A;  4R52 A;  4I01 A;  2QKD A;  5IK4 A;  2VZU A;  3R0R A;  3U07 A;  3U11 A;  2QQM A;  2VVF A;  1VIW B;  2R32 A;  1BBT 3;  2WNU B;  4I02 A;  1J3P A;  4IEZ A;  3CKH A;  3VBR C;  2R06 3;  4IE4 A;  1HLC A;  5FZB A;  1REF A;  1OD5 A;  2RM2 1;  4Y5S A;  3UNP A;  3H9A A;  3Q8E A;  5HPO A;  3EHK A;  2HBU A;  5M0T A;  4AL9 A;  2QQN A;  1AR7 1;  1SZB A;  2YY1 A;  5FYS A;  5BNO A;  3EMR A;  5HBA A;  3E1F 1;  3VLB B;  2ADD A;  2D6N A;  3NV2 A;  2VMC A;  3M3I A;  3MYX A;  4FTB A;  3WV6 A;  1NCQ C;  2G19 A;  2FDF A;  1RUD 1;  3GZA A;  4UW3 A;  4IV3 A;  4CSW A;  1XE0 A;  5FTT C;  5IK8 A;  5F5A A;  3VBO B;  1TG7 A;  4COU A;  3JD7 3;  2EID A;  2QDN A;  1Q8O A;  1H2M A;  2RHP A;  3VDD C;  1U12 A;  2AEZ A;  2VME A;  5FZC A;  1Y43 B;  2HWE 1;  1VMJ A;  5GM0 A;  2DVD A;  1MS4 A;  2OZJ A;  3MV1 1;  3NJY A;  1I1E A;  2OVU A;  4B1L A;  2JDA A;  1JH5 A;  3KD4 A;  5LA1 A;  4MSV A;  4ARY A;  1GNH A;  2IZW A;  4EWE A;  2V73 A;  5A6X A;  2FD8 A;  3SCH A;  4E9K A;  2GC2 A;  4I0B A;  5L9R A;  3GZE A;  2XH6 A;  3OYW B;  3SNM A;  4LBQ A;  2YU1 A;  2Y38 A;  4YRD A;  1HRI 3;  1W6P B;  4HPK A;  1ZBE 2;  3DPR B;  4XF4 A;  4R9B A;  2JB4 A;  1Z7S 1;  3WUC A;  5FY4 A;  4EJR A;  2PLV 3;  4M3C A;  2VD7 A;  4PF5 A;  2D5F A;  3D82 A;  1NLQ A;  3EB7 A;  5FZ9 A;  1W90 A;  4KL1 A;  3ABZ A;  1DGR A;  1VBC 1;  2HEV F;  3LA3 A;  5E16 A;  1WMF A;  4FI9 A;  4TZD A;  2C9A A;  5FRE A;  1C5H A;  4XQ4 A;  4AVB A;  1S2K A;  1VBE 3;  1ZRI A;  3V65 A;  2DFB A;  4AQ6 A;  3CEW A;  2C26 A;  2P3Y A;  5CG9 A;  2FDI A;  1ULF A;  1HXS 2;  3AYD A;  1LED A;  1LAJ A;  3K4Z A;  2JIJ A;  1ZA7 A;  2TNF A;  2Y34 A;  2D3S A;  5F32 A;  5LBC A;  3IMM A;  1FMD 1;  1IGO A;  4AED C;  5DZG A;  5K0U A;  4QPG A;  1APN A;  5T50 A;  2B7Y A;  2OQ7 A;  1UX6 A;  5JXG A;  4QKB A;  1XPW A;  4Y1U A;  3T0A A;  1LUL A;  1RMU 3;  1UPS A;  3CJI A;  4Q1R A;  5T52 A;  1W6M A;  2OZ6 A;  4XUP A;  1VAL A;  3URF A;  2IXH A;  4DS0 A;  4HVR A;  2VZT A;  5J7M A;  1AX0 A;  4GUL A;  1XNK A;  3JBG 2;  1OKO A;  1VBD 3;  1CAV A;  2R06 2;  3RI9 A;  1S0F A;  3S0M A;  5JXI A;  2ILM A;  3C7H A;  3VBS A;  2RJL A;  3ASI A;  3GAL A;  5GZG A;  4MOA A;  3PU3 A;  2EAK A;  1W39 A;  3LWC A;  5FAX A;  2CWS A;  2GN3 A;  3POI A;  1G9A A;  2W68 A;  1J59 A;  4J1W A;  3NVC A;  1SMV A;  2I74 A;  3OCP A;  2UU8 A;  3ORJ A;  3OPZ A;  2HWC 3;  5FUP A;  2WT2 A;  2EIB A;  5C7G A;  5C4W A;  2JDN A;  3MW4 A;  5LA9 A;  1ND2 C;  3WXP A;  3T2Q A;  1ND3 C;  2B4K A;  4XAE A;  4FXK B;  1A8D A;  4W65 A;  5LAS A;  4D0Q A;  2CGN A;  4URA A;  4DZG A;  1WA4 A;  4N7I A;  3WNM A;  1AHS A;  2V5D A;  3INA A;  2D6M A;  3RZG A;  1LU2 A;  1HV0 A;  5A3U A;  1I5P A;  2DYC A;  3OPT A;  4YGE A;  1HQW A;  2Y64 A;  4Q29 A;  3RS6 A;  4YW5 A;  4GMP 1;  2RMU 2;  1YUD A;  3EQE A;  3T1M A;  3HPN A;  5JSP A;  2C5D A;  4HSL A;  4YVW B;  4A7K A;  4KWK A;  3IT8 A;  4DUW A;  5E6H A;  1ZBE 1;  4Q26 A;  5LRS A;  2DUO A;  3O1T A;  1XNA A;  1IS5 A;  4QKN A;  3WW1 A;  3S57 A;  3E5X A;  3BI3 A;  4RR3 A;  4XIO A;  2DUP A;  1ACC A;  3NKT A;  4NIA A;  3ZDS A;  2BU9 A;  1T6B X;  3JB4 C;  2LUW A;  1Y3T A;  5C3R A;  2NPI A;  2XHK A;  1AF9 A;  1DLC A;  2A5Z A;  4XHX A;  5F2S A;  4A6O A;  5A3W A;  2IXL A;  5LB6 A;  4NWV A;  1UY1 A;  3ON7 A;  4Y33 A;  4HLT A;  4EZH A;  1NA1 A;  2W52 A;  1V0A A;  4IV1 C;  2ATF A;  1RXF A;  5BUV A;  5E8A A;  1F31 A;  1F35 A;  1AYN 3;  1GU3 A;  2G1M A;  3DV8 A;  4OI1 A;  4JGZ A;  1HXS 1;  3T2T A;  1JN2 P;  1L7L A;  2DBN A;  1V6O A;  2Z79 A;  3OGV A;  3ZR6 A;  4NID A;  3VD5 A;  2A6X A;  2Y0O A;  1JZ7 A;  2R04 2;  1CWP A;  2BNO A;  2WN3 A;  5ERL A;  1N1V A;  2Y6F A;  2XQR A;  3VKF C;  1AYM 2;  4JRL A;  3WP3 A;  2XOM A;  1I5Z A;  3KM5 A;  1WA6 X;  5HCH A;  2OPK A;  5HXM A;  5FK7 A;  2MPF A;  2VBP A;  5FZD A;  4XJ8 A;  1F15 A;  4WM8 A;  4Z2W A;  5FOB B;  1W05 A;  2ZGU A;  3GM8 A;  1WD3 A;  5J98 B;  1HDK A;  2WA3 A;  1UYX A;  3VBF A;  5A3T A;  3JBG 1;  4W6W A;  2R06 1;  1CD3 G;  1F4H A;  4NHM A;  4COZ A;  1N47 A;  2JG9 B;  3GHN A;  2WZP P;  4BQW A;  5JLV A;  4D8M A;  1FXZ A;  1AL2 3;  1X7N A;  2WNV C;  1TNR A;  2XB6 C;  3BU7 A;  4YVS C;  4ZU4 A;  3WNX A;  5JSR A;  5BY5 A;  3AVS A;  1KDM A;  1Z78 A;  2UY8 A;  4QHZ A;  2HYX A;  1QJE A;  2PHW A;  5FZ0 A;  3AKS A;  4FOY A;  5A3M A;  4LIV A;  4YW2 A;  4MV2 A;  4A4A A;  3FUQ A;  3ME2 A;  1SCR A;  1TMF 2;  4FFH A;  4PI2 A;  5A6Z A;  1HX6 A;  1RHI 3;  4ZXE A;  5EFU A;  2QQO A;  1J84 A;  2WZR 3;  5D21 A;  4CDQ B;  2ZHN A;  4XHB A;  5FWE A;  2A3X A;  4R9D A;  4M4P A;  4OUM A;  1QJX 2;  5FLJ A;  4QPI A;  4XYX A;  2IWG B;  1QJZ A;  2JWP A;  3KHC A;  2WBK A;  5GZD A;  1OUS A;  2RMU 1;  1VBB 3;  3WDW A;  5JDB A;  2BOI A;  4J6G A;  4CP2 A;  3H1W A;  1OA4 A;  2E32 A;  1RUG 3;  3WLU A;  4I30 A;  1B35 A;  2FCV A;  5J37 A;  4WVM B;  5FO8 B;  5L7O C;  5FZO B;  3JB8 A;  3USU A;  4BJ0 A;  2WDB A;  4S2H A;  2OX0 A;  4XET A;  4YZ4 A;  5BNQ A;  3T09 A;  5FXX A;  4CDW C;  1GR3 A;  3OG2 A;  3B7M A;  2Q8E A;  3RWN A;  3I49 A;  3KS7 A;  3OUJ A;  3X29 B;  5A7W B;  2WO3 A;  2ZX0 A;  3DKW A;  4AHX A;  3H8X A;  4IND A;  3ZFF B;  1RB8 G;  3ZXK A;  3VUO A;  3MFA A;  3UK9 A;  3GJA A;  2VXR A;  4GJZ A;  1LTE A;  2W2I A;  3FE5 A;  5FRA A;  1H1A A;  4AVV A;  4ONU A;  4N43 C;  4NIG A;  2XL9 A;  3V56 A;  5FXV A;  2VZQ A;  4UFM A;  2PAE A;  2JDK A;  1RIN A;  2R04 1;  3UKV A;  1NCR B;  3LIG A;  3NAP C;  3KSC A;  1AYM 1;  1LJ7 A;  4IEW A;  2AUY A;  4YM0 A;  2WWU A;  3O1M A;  4AQS A;  3B5L B;  4XFG A;  4OQ9 A;  2C0Z A;  2EAL A;  1OF3 A;  5K7P A;  1TME 1;  3ILF A;  3ZXJ A;  1K45 A;  1ZRC A;  1A8M A;  2QQU A;  2VOK A;  4UXA A;  1OLQ A;  2WC2 A;  1D0H A;  2JEN A;  2W1W A;  5I0D A;  2ZGN A;  4YW1 A;  3VZM A;  3WVJ A;  4XFF A;  3WDY A;  4A44 A;  4ATF A;  4CDQ C;  3I2G A;  2ZHM A;  1IG3 A;  3UJQ A;  1VAK A;  4CUB A;  2XDV A;  4RA0 A;  1LKN A;  3ENR A;  1YQ2 A;  3M7A A;  1JOJ A;  2PA7 A;  1GP4 A;  4Z1V A;  2ZCW A;  1AL2 2;  3VBU A;  5FK8 A;  3I59 A;  1STM A;  1MPX A;  3VBR A;  5DQ0 A;  3I2H A;  4HKL A;  4CU9 A;  4IV3 B;  3IAQ A;  2ZAH A;  2OII A;  1W8W A;  5FZI A;  5I91 A;  1W03 A;  1GWK A;  5FXZ A;  1WLW A;  5EJ3 A;  4LKE A;  5FXW A;  1YYN A;  4JKL A;  4ZXK A;  1TMF 1;  3UJO A;  2VCM A;  3MUY 1;  4FFI A;  1YIP A;  1D4M 3;  2A71 A;  1RHI 2;  1HB3 A;  1MR5 A;  1Z0H A;  4LHN A;  4PLN A;  3VD3 A;  1JOB A;  1NCQ A;  1QJX 1;  3LSD A;  3KZ4 C;  3M3O A;  1IOA A;  1G86 A;  3TN9 2;  2CHH A;  5AFB A;  4YM1 A;  2GSY A;  3NJV A;  4QQ2 A;  4UF0 A;  3WG1 A;  3VDD A;  3ZYH A;  3UGG A;  2ZAC A;  4HVO A;  2L9L A;  4HPK B;  5CFC B;  2RG4 A;  1O91 A;  5DDJ 3;  5IYY A;  4O9G A;  1QQP 2;  3FHQ A;  3OGS A;  4HON A;  4XF1 A;  5DAB A;  1RUG 2;  3UET A;  2BRT A;  4PI0 A;  1LB2 A;  4PIY A;  1H8T B;  4QX3 A;  2OPW A;  1PIV 1;  4NN0 A;  2CDO A;  2V5Y A;  3RFR A;  5LZ6 A;  3PL0 A;  2JIG A;  5FYU A;  2X05 A;  1QY4 A;  3HWJ A;  2O14 A;  3ALQ A;  4FCA A;  1OQE A;  4JHT A;  2TUN A;  1W06 A;  2YZ4 A;  3OEB A;  2RDS A;  4Y20 A;  1HIX A;  1POQ A;  2OQ6 A;  3FFZ A;  4FOV A;  5FPU A;  1X9T A;  2H6C A;  3RZK A;  1S0I A;  4KU8 A;  4O65 A;  2X10 A;  2EVX A;  3E6C C;  1PK6 B;  1SBD A;  1H6Y A;  4IES A;  2VJX A;  1VB4 A;  1GZ9 A;  1PMH X;  2RV9 A;  2PAM A;  1IHM A;  1CX1 A;  2WNU A;  4QPG B;  4C0B A;  4XVH A;  4XJW A;  3LSE A;  3LQC A;  3ZXE A;  3OOX A;  2QQL A;  4B7E A;  2ZS6 B;  4Q0V A;  3CJI B;  4JZR A;  4DFS A;  4DXZ A;  2WA4 A;  4FPC A;  3R4S A;  1KRI A;  4GA9 A;  3LDB A;  3ZN5 A;  2ARC A;  4P5H A;  4AHY A;  3AKP A;  4LBO A;  4XIK A;  5EPA A;  5KXB A;  5A80 A;  1CAV B;  4XAA A;  3U75 A;  1JYV A;  2ZX4 A;  4AED A;  5IFT A;  1JZ6 A;  3VBS B;  1FNZ A;  1FOD 3;  1JYX A;  2OXB A;  4IEP A;  1LOG A;  3SEP A;  5J36 A;  1LOF C;  4YGD A;  1OFS A;  3VBO A;  5FP3 A;  1AL2 1;  4CYD A;  2XPJ A;  1VAM A;  3GGL A;  4M01 A;  4YPJ A;  5T55 A;  4CCJ A;  3VBH B;  3EBR A;  3POJ A;  3T4V A;  5CFC C;  1WW5 A;  4Y4Y A;  1EUU A;  2JIC A;  4BQ4 A;  4XJA A;  2DV9 A;  1LCL A;  3CQO A;  5C4W B;  2PN5 A;  3CZJ A;  4YGC A;  2H0B A;  3MEP A;  1W9T A;  3VDC A;  5BYN A;  2J1T A;  5CAZ A;  3DYM A;  1RHI 1;  1W6Q A;  4XDQ A;  1D2Q A;  2XKO A;  4YG6 A;  2EF6 A;  1LEM A;  2ZEW A;  3SMH A;  3N7K A;  1W6N B;  5K9Y A;  1PX4 A;  5CBL A;  3ACI A;  1X33 A;  3B02 A;  3DPR A;  2R16 A;  4WVV A;  3TN9 1;  3LF7 A;  1EY2 A;  5FY5 A;  3QCW A;  1ND2 A;  1QEX A;  2ORZ A;  5FYI A;  1JUI A;  1ND3 A;  1W0P A;  2WQ4 A;  1GZC A;  3I8T A;  4JDO A;  2GP5 A;  4NO4 A;  5SV8 A;  2W1S A;  3AJY A;  4EWD A;  3WQ7 A;  1QQP 1;  1ZRF A;  5D8A B;  3MFC A;  1RUG 1;  1EP0 A;  1OVS A;  4YG3 A;  4RR3 B;  4EN6 B;  4AZZ A;  3LEI A;  1ALY A;  1KFX L;  2PHD A;  3GXU A;  4KGQ A;  2ZGO A;  3TOJ A;  2OYZ A;  4AI0 A;  1AXY A;  1ZBA 1;  5JPM B;  4GWI A;  4Q0S A;  3IWZ A;  1GP5 A;  2J7M A;  2VMG A;  4I3G A;  4AEM A;  4NUB A;  2NMN A;  3KCX A;  5BNN C;  1IZ3 A;  4KG0 A;  4HVQ A;  1QOS A;  2WAB A;  3WNK A;  1GP6 A;  2DWR A;  3DXT A;  1F5J A;  4DOU A;  1JHJ A;  2W1U A;  2CWM A;  1E5I A;  3AMN A;  1VJ2 A;  5HXV A;  3POS A;  2GC1 A;  2W92 A;  2RM2 3;  4C91 A;  3VBH C;  4IV1 A;  3Q8B A;  2J42 A;  2YB7 A;  4LOS A;  4XC9 A;  3VN4 A;  3KVA A;  3VZL A;  1JZ5 A;  2VMI A;  1AR7 3;  4RN5 A;  3KV9 A;  5LCW L;  4GQ7 A;  4EN8 B;  5KXD A;  4AFB A;  1OFN A;  5HCB A;  2ZX3 A;  1RC6 A;  5KHH A;  4M3C F;  2RVA A;  2YGL A;  2Q1F A;  3VZN A;  3VBF B;  3MUZ 1;  4IGO A;  1GIC A;  2X8K A;  1RUD 3;  4NHK A;  3BPZ A;  3O0V A;  1W9S A;  2E7Q A;  2SBA A;  1AX2 A;  1FOD 2;  5CKN A;  1OKQ A;  2VUC A;  3LB9 A;  5A7Q A;  1IKP A;  4LXL A;  1EV1 2;  1O3T A;  2GP3 A;  1V9U 3;  1J3R A;  1AR9 3;  1KD7 A;  2IXI A;  4PBO A;  3P5B A;  2HWE 3;  3KT7 A;  4CCL A;  5HCA A;  1WW6 A;  3NW4 A;  2E26 A;  3WNO A;  2WO1 A;  4BK4 A;  2HEW F;  4HMZ A;  1DCS A;  3KHB A;  4OHY A;  2WN2 A;  4FP3 A;  3TNQ A;  4E4H A;  5EIY B;  2DU0 A;  3WSO A;  3PUH A;  1QXR A;  1KJL A;  1DQ6 A;  2WNV A;  2YFZ A;  4YVS A;  1V70 A;  1V6J A;  4DO0 A;  4N9I A;  2WFF 3;  2VTF A;  5FPA A;  1ZRR A;  2VBD A;  3U37 A;  1Q5O A;  4E2Q A;  4QPI B;  4C0H A;  1JHN A;  3JCI A;  2YC0 A;  4XFI A;  4W8J A;  1LR5 A;  5CIS A;  3VDB A;  4PLM A;  1Z7S 3;  1S0G A;  3DGT A;  4WVW A;  3FC0 A;  2X09 A;  4KBZ A;  4CA9 A;  2V09 A;  5C33 A;  1C8N A;  1WCS A;  4KQ7 A;  3PUA A;  2JEM A;  2OS2 A;  2NYY A;  4X8P A;  4AE2 A;  5JMO A;  1JYI A;  3O1R A;  3KMH A;  4COV A;  4AEJ A;  3BOP A;  2A6Y A;  1I6X A;  3LKJ A;  4CE8 A;  3D5O A;  5KHK A;  5LK5 A;  1GQP A;  2LS6 A;  5FPB A;  3PMS A;  5APA A;  3PVB B;  1XSR A;  3UES A;  3MHZ A;  3USU B;  4RHV 3;  3VZK A;  4BQ2 A;  1QOO A;  4XDO A;  4QM9 A;  5FJH A;  3WDX A;  5B4N A;  1KDK A;  4BXS V;  1Q3E A;  3AXE A;  1UYZ A;  3KB5 A;  4Y24 A;  4FPF A;  3PVN A;  1LOD A;  2DBI A;  2X5I C;  2XJS A;  3MID A;  1MS1 A;  4HOO A;  5GLW A;  3BIE A;  1OUR A;  3IKW A;  3WP5 A;  1BXH A;  2ZGM A;  5L7O A;  5L73 A;  3ZIX A;  4I3P A;  4XUN A;  5JIA A;  1AR8 1;  3MIE A;  3JUU A;  4CDW A;  3AZV A;  4LEJ A;  4BE3 A;  2E63 A;  1UOG A;  1ZVF A;  1IQD C;  1O6U A;  4AK3 A;  4W4Z A;  4RS5 B;  2WFP A;  3BCW A;  4QGM A;  4QXK A;  2CY6 A;  2FMD A;  3K2O A;  1S0C A;  3RMY A;  4HBN A;  4TTG A;  2VY0 A;  3A23 A;  1QJU 2;  5C3Q A;  3PTY A;  4QMA A;  3POG A;  1VPH A;  4IER A;  4CEW C;  4N43 A;  4OHW A;  1XC6 A;  1A78 A;  1O5L A;  1YXW A;  2WJS A;  4P9J A;  3WP4 A;  1YI7 A;  2YC4 A;  2VTX J;  2P5B A;  1N3O A;  3MW3 A;  2YGM A;  3NAP A;  2E9Q A;  3ZMO A;  5FMO L;  1RUD 2;  4B7K A;  3K3O A;  3P1I A;  4ZU5 A;  1FOD 1;  3PIJ A;  5FBJ A;  4AHW A;  3QBQ A;  5CFD C;  5F1R A;  4LUL A;  5FYV A;  1EV1 1;  1SFP A;  4QDQ A;  4JQT A;  1W0N A;  3VBR B;  2B8M A;  1V9U 2;  3NJX A;  2F6B A;  1AR9 2;  4ISR A;  3RNS A;  5J48 A;  2GC3 A;  3VDA A;  3M1H A;  5F6K A;  4CDQ A;  2WZE A;  2DCK A;  1DZQ A;  4GMP 3;  1IS3 A;  1V6I A;  1GYK A;  1IPJ A;  1NQD A;  2FCT A;  5C8W A;  3W58 A;  1OD3 A;  3QAC A;  1H2N A;  1PM4 A;  2R0F A;  2ID4 A;  3MGU A;  3FBM A;  1J1L A;  2WFF 2;  1CX4 A;  1ZBE 3;  1R09 2;  2VW2 A;  4NHX A;  1CPN A;  1UOF A;  3RRD A;  5FYM A;  1YIF A;  1LOB A;  1HKD A;  1TEI A;  4RGK A;  3RWK X;  3KLS A;  2FQP A;  4LKF A;  2WR9 A;  3TNP B;  4UF0 B;  1OQ1 A;  4P9G A;  3VDD B;  2P6H A;  3WW2 A;  1NE4 A;  3RZL A;  1SCS A;  3JZV A;  1ZZB A;  4K8F A;  2LRP A;  3RMX A;  2J1R A;  4DXT A;  2AR6 A;  4AI1 A;  1GNY A;  5DUX A;  3BOW A;  4S2F A;  4YM2 A;  3KV4 A;  4RS5 C;  3L9J T;  4Y1V A;  4ZZ5 A;  4RHV 2;  1HXS 3;  3AMM A;  5FZ1 A;  3AMP A;  5A3L A;  2Y33 A;  2CU5 A;  5IVE A;  1U0A A;  2CAV A;  1AUY A;  2O8O A;  2Y6G A;  3N9N A;  4Y4R A;  4Y5T A;  5C3S A;  5JCT A;  3N9P A;  2B46 X;  1YNA A;  4IW3 A;  3WEZ A;  1V6N A;  4O9E A;  5FY8 A;  4F83 A;  1UY4 A;  2WLQ A;  3U0Z A;  1VLN A;  2ZPX A;  5C6C A;  4PBP A;  3T0B A;  3JBG 3;  2D98 A;  1CJP A;  4MGI E;  3MW2 A;  1K12 A;  1X8M A;  3FJS A;  3FHA A;  4PIZ A;  5FY1 A;  4LTA A;  1VB2 A;  4BQX A;  2XVG A;  3NJZ A;  2QFE A;  4AF9 A;  1QJU 1;  2Q1Z B;  4IEX A;  4Y3O A;  1NLR A;  3ETP A;  2ZHK A;  4X8N A;  4CCE A;  4DNY A;  4AQT A;  5AFE A;  2D44 A;  2O8Q A;  2KA3 A;  4Q0U A;  1HN0 A;  4AED B;  3J7L A;  5F5C A;  4OLL A;  3GHM A;  3I3B A;  3RJR A;  4C1W A;  2D6L X;  4OHX A;  3ZFG C;  5IAX A;  3KF5 A;  1YC6 1;  3MDP A;  1C8M 3;  5LRR A;  5LY1 A;  1GWL A;  3FLR A;  1GKB A;  1QDO A;  2IXK A;  4HXC A;  3ZYF A;  1UAI A;  1V9U 1;  4LBL A;  1AR9 1;  4HKO A;  4XE9 A;  5AC9 2;  1HJF A;  1TQ5 A;  2R1D A;  4UFK A;  1UYY A;  2PHU A;  5DMY A;  3NWK A;  2RR1 2;  2RMU 3;  2ZGL A;  4CVU A;  1WZX A;  3MF9 A;  1LOF A;  3AJZ A;  3QH6 A;  1U5Y A;  1ENS A;  2FZ1 A;  1RUJ 2;  3F95 A;  1W6Q B;  1W8F A;  4XMI A;  3UT0 A;  2CTV A;  2B45 X;  4BLI A;  3VZJ A;  2QDR A;  2WFF 1;  1IPK A;  1R09 1;  2W3J A;  4ARX A;  5CFC A;  4V2W A;  4D7Y A;  1H30 A;  2G9Z A;  1XBF A;  4LHL A;  4Z8B A;  1H8T A;  1ND2 B;  2Q8D A;  1UMZ A;  2UWC A;  2AGS A;  1ND3 B;  1NUK A;  4Q0P A;  4GD4 A;  1LU1 A;  4U36 A;  1KQR A;  2DTW A;  3MF6 A;  3MIB A;  4OMC A;  4RQP C;  5GKA C;  1O4Y A;  1XOY A;  2RJ2 A;  3GZU C;  4FT8 A;  4CU6 A;  4RHV 1;  3ZXL A;  2E7T A;  1O3S A;  3N9O A;  4Q4V 3;  3MIG A;  1PK6 A;  4EN9 B;  1ULG A;  5SV5 A;  5J09 A;  2BZD A;  3HD8 B;  2R04 3;  4GMP 0;  5EYX A;  3H8O A;  4GKX A;  3GBG A;  4NR1 A;  1V6M A;  4UT5 A;  1AYM 3;  4YSF A;  3NMB A;  1I9R A;  4D3W A;  1BMV 2;  1JW6 A;  1S55 A;  1W2O A;  3RZZ A;  4EQV A;  2VZP A;  3IDC B;  2XR4 A;  1TME 3;  5FKB A;  2W87 A;  5JSO A;  3P3P A;  4L8Q A;  5FMC A;  5ABJ C;  4PCR A;  4LHS A;  4XUT A;  1XNB A;  3U4X A;  4LO6 B;  2YHJ A;  1CZV A;  1H9P A;  1U5I A;  5FZH A;  3TEW A;  4G9S B;  4IV1 B;  1GQH A;  2X53 S;  4AWD A;  4D6Q A;  4JC1 A;  4BU2 A;  1JZ4 A;  5L9B A;  1N1S A;  5BNN A;  1DYK A;  1R1Z A;  1PGW 2;  2K9Z A;  2IVI B;  5FYT A;  3R05 A;  2YMZ A;  4QPW A;  1VRB A;  3WX5 A;  1BZW A;  1RVF 3;  3IDE A;  5A7P A;  1QJY 2;  3KT1 A;  4HSJ A;  3HT1 A;  4A2U A;  3VBH A;  2VCA A;  5FMD A;  3S30 A;  1VMH A;  4AAX A;  4AYU A;  1TMF 3;  1EUT A;  1M4W A;  1G6N A;  3PVO A;  1G8W A;  2D40 A;  4XOG A;  1C8M 2;  4RSU A;  2E6V A;  3HT2 A;  4ES9 A;  5HI0 A;  1MS5 A;  1RUE 2;  4C1X A;  2Y8K A;  2RS1 3;  3WD5 A;  3RVH A;  5CYY A;  4Z92 B;  1DGW A;  5AC9 1;  1QJX 3;  1YQ6 A;  3G7D A;  1QH7 A;  1Y9G A;  2IVJ A;  1BK1 A;  2VNG A;  3APB A;  4LUK A;  4R8H A;  1AR6 3;  4NPR A;  3VZO A;  3SXW A;  2ES3 A;  3IPV B;  2RR1 1;  1W6N A;  2WNV B;  4YVS B;  2VO5 A;  3OBZ A;  5A7O A;  5CKM A;  4WM7 C;  1DGW X;  3J4U H;  5ACA 3;  1ZRD A;  1RUJ 1;  1KJR A;  1OSG A;  1ZZ8 A;  2Q30 A;  1SQ4 A;  4AHZ A;  4AXO A;  2ZJC A;  4DXR A;  1W28 A;  3AB0 A;  5LEK A;  2ZZQ A;  2J1A A;  4Y5Z 0;  2ARE A;  1R08 2;  4CUA A;  3AP5 A;  3W59 A;  2W0X A;  3AYC A;  5EWS A;  3H7J A;  2YBP A;  4UW5 A;  1PIV 3;  5D8A A;  1FT9 A;  3VD7 A;  5H9Q A;  1M06 G;  2DVF A;  2F4P A;  4JX0 A;  4XTM A;  3ZPO A;  4IEY A;  4P9X A;  3ZR5 A;  4M0N A;  3MIC A;  3ST7 A;  4KWJ A;  3OSD A;  2WRA A;  3FLT A;  2QUO A;  4DIQ A;  3AFK A;  4XXP A;  2QE3 A;  5KWR A;  4P9I A;  5DN2 A;  4CU7 A;  2XLA A;  1DQ4 A;  2HJI A;  4H55 A;  2ZKN A;  4UFJ A;  1U5X A;  3ZDV A;  3WY6 A;  4Q4V 2;  3E6B A;  2YFU A;  2JDP A;  3BKZ A;  3I2O A;  1LEN A;  3LEK A;  3R4D B;  3I97 A;  5L7O B;  1W2T A;  1GFF 2;  1YJL A;  3OF1 A;  2R07 3;  1BMV 1;  1DQ2 A;  2VUA A;  2XBO 2;  3C2U A;  2BFU S;  3EXU A;  4PF1 A;  2LW8 A;  3OD0 A;  5FYH A;  3WOG A;  2V4A A;  3ZFE C;  4CDW B;  5A32 A;  3DEC A;  3MIH A;  3OD4 A;  1TME 2;  1S0D A;  1MQT C;  1S2B A;  3E5Q A;  4FO9 A;  4SBV A;  3H1M A;  2X5I A;  3SKV A;  5FYC A;  4PLO A;  3JXS A;  4FQZ A;  4OUS A;  4YLZ A;  4Y22 A;  4FPJ A;  2ZX1 A;  4JTN A;  2A6Z A;  3T1L A;  1OC1 A;  3LFM A;  3MLK A;  4N43 B;  1PGW 1;  1AXZ A;  5T5O A;  3NV4 A;  4FFF A;  3O1P A;  4PT6 A;  2PAK A;  1LGB A;  5F3E A;  1DZR A;  5DXD A;  3NAP B;  1QJY 1;  1BEV 2;  3B93 A;  4MO3 M;  1RVF 2;  1AZD A;  4XFB A;  3LAG A;  1J3Q A;  2ARB A;  4MLO A;  1PGS A;  3I7D A;  1UOB A;  5DUV A;  4E4D X;  5JAX A;  5FYB A;  3OGR A;  4K7J A;  1C8M 1;  2MEV 3;  3ZN6 A;  4AFD A;  2O0O A;  3KWV A;  2W95 A;  2WO2 A;  4XQW A;  4AEK A;  1RUE 1;  4PDW B;  4CEW A;  2AH2 A;  3ELN A;  2RS5 3;  1MZ6 A;  1E5R A;  2RS1 2;  4NAO A;  1ODM A;  3SH5 A;  3HN1 A;  1O8P A;  2J1E A;  2BTV C;  4N53 C;  2WO7 A;  4B3N A;  1CAU A;  1UF2 C;  3BAL A;  1VRH 1;  5D2A A;  3TN9 3;  1AR6 2;  1DIW A;  2BPA 2;  4IDZ A;  1Q8V A;  4AI8 A;  4BDV B;  2KD7 A;  2K46 A;  5KHI A;  5ACA 2;  3UV9 A;  1RXG A;  1LHO A;  2AZ5 A;  5IT6 A;  1QQP 3;  4XUO A;  4LK6 A;  1R08 1;  1WBF A;  2VOW A;  3J26 N;  3PJQ A;  5E88 A;  5F8P A;  1PGL 2;  2PTM A;  5DAX A;  4LIU A;  2XUM A;  1H6X A;  3N7J A;  1BVV A;  4B29 A;  4E8C A;  3PTR B;  3VKL A;  1PIV 2;  5DAP A;  1ZX5 A;  5E1R A;  2WL1 A;  2Y60 A;  5DAW A;  1O3Q A;  5ISL A;  2QNK A;  3I2K A;  3FBY A;  1H4G A;  2WSU A;  1ZBA 3;  2ARA A;  2ZAB A;  2ET1 A;  5AVP A;  5FLI A;  2XQX A;  2D6O X;  3WCS A;  1SBF A;  1K5J A;  3D0S A;  1W6O B;  3H8R A;  4YZ3 A;  3PUQ A;  1ONA A;  3DEM A;  1LNS A;  4E2S A;  4MXW A;  4BIO A;  2GNM A;  1MVE A;  1HB1 A;  2VCC A;  4Q4V 1;  4NJ4 A;  1YFW A;  4MYE A;  2XL7 A;  4CXY A;  3QOP A;  3FUO A;  5AVA A;  2XJR A;  5LBB A;  3G6J B;  1OT5 A;  3AL5 A;  3KCY A;  4RS5 A;  3RYP A;  5B4X A;  3SHR A;  2XBO 1;  4AGR A;  2FDK A;  4LE4 A;  2R07 2;  1GAN A;  2XLG A;  2WNE A;  4OCT A;  5DUU A;  4MXV A;  4FOQ A;  4QQL A;  2XVL A;  5KC5 A;  2QQK A;  1OMI A;  2CV6 A;  2BGP A;  3LEM A;  3CZU A;  3RQ0 A;  3KGZ A;  4PDW C;  1PVC 2;  1ZA4 A;  5FZE A;  1XU1 A;  3QD6 A;  2WWS A;  1V6L A;  1SDW A;  3K4A A;  4K1Y A;  5HV4 A;  2WIN B;  1BCX A;  2QBX A;  4QT6 A;  4AVA A;  2PHR A;  1VR3 A;  5JVV A;  2XJT A;  1VE0 A;  4YZ2 A;  5GZE A;  1HRV 2;  1ZNP A;  1QJF A;  3ZKU A;  2BVB A;  2ZTN A;  1GV9 A;  1MZF A;  2P4E A;  4GH4 C;  4KG8 A;  4XCB A;  4B4Q A;  1CN1 A;  1I3H A;  1WKY A;  1BEV 1;  1RVF 1;  5CB7 A;  3TRS B;  4CCN A;  2VGD A;  3L2H A;  5FV3 A;  5IWF A;  1KS4 A;  1BJQ A;  2Q0A A;  1MAC A;  1SHW B;  1GOH A;  2HEY F;  3SIS A;  2DDU A;  1W8O A;  4JGY B;  2DUR A;  5FZ3 A;  3THT A;  3W20 A;  2MEV 2;  3IB3 A;  4L0P A;  2XHN A;  5C9A C;  1QDC A;  2EXJ A;  2XXZ A;  4U2A A;  2RS1 1;  2Q8O A;  4MG2 A;  2RS5 2;  4YGB A;  2BW8 A;  4CP9 A;  3BTX A;  2UYB A;  3AKQ A;  4LBQ D;  1LHU A;  1O4Z A;  4V2V A;  3ZFG A;  3BOD A;  4Q1P A;  1JZ8 A;  1AR6 1;  2PEL A;  2YV8 A;  4HFS A;  4L9B A;  3AP9 A;  4TWT A;  3UKT A;  2VM9 A;  3LFI A;  2ENR A;  2CL2 A;  2JG8 C;  1OUX A;  5ACA 1;  1RUH 2;  4EYU A;  4CDU C;  2VW0 A;  1PGL 1;  3IAP A;  2IXC A;  2H6B A;  5IVF A;  1EYB A;  4GB3 2;  5D1I A;  5I8T A;  1WMD A;  1XJA A;  5FPX A;  4TXW A;  2GH8 A;  2AAC A;  4FPE A;  1OA2 A;  3E6D A;  4BH9 A;  5IUQ A;  3HIF A;  1KGY A;  4H7M A;  4KI5 M;  1PZ8 A;  3POE A;  1QF3 A;  3LD8 A;  5LY2 A;  5A6Y A;  3OEA A;  2HYK A;  1OOP C;  3OGJ A;  3FLP A;  3ZYP A;  3HQR A;  1ZBA 2;  3NV1 A;  2BBA A;  3WCR A;  4E4Z A;  3MLJ A;  5FY0 A;  5FQ0 A;  1WCU A;  4GAL A;  1NOV A;  2BYV E;  1AR8 3;  4NWW A;  3S7E A;  2ZGK A;  4LO8 A;  1X9P A;  4BM8 A;  3O5S A;  3WR0 A;  4JDM A;  2HWF 2;  4I0W B;  1PMI A;  1CJD A;  3VV1 A;  1AJO A;  5C8C C;  4ZU7 A;  5HCF A;  4P5Y A;  3NRU A;  4ZKT B;  2Y0I A;  4KMQ A;  5GLT A;  5L36 A;  1GBG A;  3N9L A;  2XJU A;  4RQP A;  2WLP A;  4XFC A;  3RYR A;  2AEN A;  3GYD A;  3K3N A;  2C9K A;  2R07 1;  2W39 A;  3KGL A;  3MO4 A;  4M4R A;  4XF0 A;  4PQ9 A;  3WNN A;  1DYP A;  3P6B A;  2Y6K A;  5FO7 B;  4ES8 A;  4IGQ A;  4H7L A;  4JGY C;  1OPM A;  5CEH A;  3OTF A;  1P8J A;  4NVP A;  1JYN A;  1PNG A;  1PVC 1;  1FAY A;  4JDN A;  2NN8 A;  2JE7 A;  1K5M C;  1UD1 A;  3DYO A;  1CQ9 A;  4JTO A;  1TVG A;  1SG3 A;  5BNN B;  1A34 A;  1EV1 3;  1QKQ A;  2VOX A;  4FTS A;  5ABJ A;  1L3J A;  3IM0 A;  5F7U A;  5F2W A;  2WKK A;  4QDS A;  4BQ5 A;  4KNC A;  1HRV 1;  2VQ0 A;  4XAB A;  4KBB A;  3O7O A;  1HN1 A;  5T54 A;  2ZEX A;  2PHT A;  4TLG A;  3AYA A;  3J7M A;  4BQ1 A;  2A6V A;  1CES A;  3ACG A;  2EXH A;  2ZGS A;  4XBN A;  5FCC A;  4V1P A;  3NNG A;  3WF1 A;  1ZZC A;  4CDX C;  5K8S A;  3I2D A;  2A73 B;  4UAP A;  2DUQ A;  2OUJ A;  1GLH A;  3ZPY A;  3VHR A;  4EZ4 A;  2FBE A;  2MEV 1;  2PHL A;  3WQ1 A;  3SQO A;  5J1X A;  3ZXF A;  4QGN A;  1F2N A;  2RS5 1;  4H14 A;  1PZ7 A;  2D3P A;  1G7Y A;  2KXL A;  4KU7 A;  4R9A A;  5FP9 A;  1GUI A;  5FUN A;  2QQV A;  3GDB A;  4J25 A;  5DUW A;  2BNM A;  3O12 A;  2PHF A;  3K4D A;  3ZYI B;  1WLD A;  1DHK B;  4AG4 A;  3NO8 A;  4WBB A;  5ANN A;  3TYJ A;  5JR7 B;  5T3N A;  4EN7 B;  1RUH 1;  5A7S A;  1H2K A;  1RIR A;  4FSJ A;  2XVK A;  2W94 A;  2ZHL A;  1C28 A;  3FMG A;  3HMY A;  4GB3 1;  4IE7 A;  4ASM B;  4BIF A;  4N90 A;  3KQ4 B;  5JPN B;  4DXS A;  3AP4 A;  1W8Z A;  1DYO A;  3ZKY A;  1YEW A;  4WM7 A;  4A3Z A;  4NRO A;  1FNY A;  4QAW A;  4J1X A;  5FLH A;  3GBF A;  4QHB A;  3U14 A;  5H9S A;  3THD A;  3B69 A;  1UU4 A;  4Z07 A;  1UIJ A;  5FDB A;  1OVP A;  2A70 A;  2A6W A;  1TE1 B;  3ZSL A;  3V0A B;  3AZW A;  5HV0 A;  2QVS B;  4AI9 A;  3OPW A;  2R7E B;  3C7E A;  3IDB B;  3U4S A;  3I4I A;  4GWM A;  1PZ9 A;  1LHW A;  2YBS A;  2PQS A;  3H0O A;  1AR8 2;  2YDE A;  4Q0Q A;  2ZMK A;  4UFH A;  3VKO A;  1HB2 A;  2HWF 1;  3J7H A;  1ASJ 2;  1O59 A;  1UY3 A;  2EIC A;  2W5F A;  3WW3 A;  2FDG A;  3OB8 A;  5K0U C;  5FIX A;  2HKX A;  1RJ7 A;  2IFR A;  4OFG A;  1NG0 A;  3ZMN A;  4YFW A;  1CON A;  1D4V B;  1S4C A;  2CAU A;  1T6G C;  2CGP A;  1NAE A;  1QJU 3;  5A32 B;  4DQA A;  1RUO A;  1C1F A;  5T5P A;  1NKG A;  3PJY A;  2ZX2 A;  4L97 A;  4ASL A;  1IKQ A;  3B94 A;  2VG9 A;  5IVC A;  2XWB B;  3AVR A;  2E7A A;  4RFR B;  2MNG A;  2X5I B;  5EZW A;  3R6S A;  1COV 3;  4Y22 B;  2VQT A;  2HBT A;  3VKM A;  4Y1Z A;  4GKY A;  2ZEZ A;  5G04 L;  3T30 A;  5A3N A;  1K42 A;  2OKX A;  3ZFE A;  4H3W A;  4UBG A;  4CCM A;  1BVP 1;  4DUX A;  3GZT B;  4LA3 A;  4CEY B;  2ADE A;  3QLQ A;  1MQT A;  4FPH A;  1XND A;  1F8V A;  2BUK A;  5DZF A;  5DG1 A;  4PJY A;  4LK7 A;  2ET7 A;  3J7N A;  4ET7 A;  3TEZ A;  4CPB D;  2W9X A;  1UXZ A;  2BER A;  4NAM A;  3ZYG A;  2BGO A;  5KXC A;  3ZN6 B;  3IPV A;  4LBJ A;  3T2P A;  4CEW B;  2GAL A;  1N1Y A;  2BDR A;  2UYA A;  2P34 A;  4X6R B;  1W9F A;  3H7Y A;  1VBA 2;  4KH9 A;  4WV8 A;  5FMO S;  1R09 3;  5EV7 A;  4BYY A;  1NQJ A;  1UU6 A;  1J1T A;  2UY9 A;  5I8S A;  1CAU B;  2J22 A;  3JQW A;  2NZ9 A;  1W0O A;  2JDM A;  3RJ2 X;  3WP6 A;  1RUF 3;  5CFD B;  2VNV A;  2DVA A;  4W50 A;  4KWU A;  1SPP A;  3MV0 1;  2WS9 1;  4LPL A;  1MZ5 A;  3BVC A;  1CPM A;  1UU5 A;  5FYY A;  1ZZ6 A;  1UW8 A;  3N7M A;  1R1A 2;  3WF2 A;  3T2O A;  4G4F A;  2Q8C A;  4BHP A;  1CZS A;  4A41 A;  1ENX A;  4N53 A;  4RGG A;  5GLZ A;  3WG3 A;  2JE9 A;  1GZW A;  2D6P A;  3RSJ A;  2BVV A;  1SEF A;  2DVB A;  5F39 A;  4L2N A;  4NE9 A;  3ES1 A;  1DDL A;  1RUI 2;  1OQD A;  4IE5 A;  2QZ3 A;  2Y6L A;  3CMG A;  1Y7B A;  1NZI A;  3C7O A;  3H50 A;  1UO9 A;  4MUV A;  3VHN A;  5C3O A;  1UNB A;  4LO7 A;  4RD7 A;  5A1L A;  4JGZ C;  4MXW B;  3O1U A;  3BTA A;  4CRQ A;  4DY5 A;  5IVJ A;  2IXJ A;  2VUL A;  1O7F A;  4W6X A;  4I09 A;  3GCW A;  2JDH A;  3WG2 A;  1BLZ A;  4LO4 B;  4LE3 A;  1ASJ 1;  4CEY C;  1RUC 2;  3HR9 A;  5FZM A;  1OPO A;  4MGK E;  3CHX A;  2R49 A;  3K48 A;  5FY9 A;  3MIF A;  2VXJ A;  5F3C A;  4OMD A;  5JOW A;  1DBN A;  1MZE A;  4XAC A;  4WM8 C;  5DZE A;  1HB4 A;  5JOX A;  2WUH A;  4PHZ A;  2VH9 A;  4FP2 A;  5FP4 A;  1SLC A;  4BMB A;  4Q5O A;  4TN7 A;  3HJR A;  2C1F A;  4XMA A;  4DEQ A;  2A3W A;  2JDY A;  2RDQ A;  3TEY A;  4MGY E;  4UWD A;  4FBF A;  1COV 2;  2Y6H A;  3BB6 A;  2YXS A;  2JB8 A;  2QTW B;  4AGV A;  4WZC A;  2EIE A;  4LA2 A;  4P00 B;  1QWR A;  5IVB A;  1PO1 2;  5F37 A;  4OQ8 A;  3FL7 A;  5AC9 3;  4OYU A;  4PDW A;  3L2Y A;  2D7F A;  2JXA A;  2WZ8 A;  3AXD A;  3K77 A;  4FQ4 A;  5EXO A;  5FPZ A;  3UKN A;  3VKN A;  4AFM A;  2RR1 3;  4YAR A;  5LEJ A;  2D93 A;  2B39 A;  3A4U A;  4HK9 A;  2DCT A;  1W8T A;  5I0S A;  3I2J A;  1RUJ 3;  1ULE A;  3D6E A;  1GQG A;  2JDZ A;  1VBA 1;  4FOW A;  2KR2 A;  2ZZJ A;  4GH4 A;  4LLO A;  4CP9 B;  4CP0 A;  4WVZ A;  4NOT A;  3WIN E;  3ZFG B;  4MGT A;  2K0G A;  4ZZ8 A;  5A70 A;  4FAG A;  4QX8 A;  4LKD A;  4KGG A;  4Q4W 2;  1SDD B;  1S0B A;  1RUF 2;  3DKQ A;  5IJR A;  3WT3 A;  3AC0 A;  4COY A;  2QQI A;  3C8X A;  4RFT 0;  3BUC A;  4HKW A;  2HWD 2;  3N9M A;  1R1A 1;  1A3K A;  1B35 C;  4Q4Y 2;  5K4L A;  4YZ5 A;  5C9A A;  4XIL A;  3Q9O A;  3GBW A;  3LE0 A;  4MGS A;  4BK5 A;  3S5Q A;  4MHU A;  2XJQ A;  4M00 A;  3VHO A;  2XML A;  2YC2 A;  4GJY A;  1UQX A;  2Z2S B;  2HWB 2;  4AVS A;  1W6O A;  1H1I A;  4LLF A;  1RIT A;  5JR2 A;  1RUI 1;  2R1B A;  4AFA A;  2JG8 A;  4YWA A;  2VOV A;  1NXD 1;  5CIR A;  4CDU A;  1QH6 A;  1S1A A;  5FQ0 B;  1MEC 2;  1POV 1;  1MS8 A;  4LBM A;  2P3I A;  4E8D A;  1J83 A;  2VUJ A;  4FXG B;  3DF0 A;  5BXX A;  4DRR A;  5CZK A;  3AYE A;  2RS3 2;  4LNV A;  3M70 A;  4XTP A;  4AR2 A;  1AVB A;  1RUC 1;  2D97 A;  1YFU A;  2XJV A;  1OOP A;  4EE2 A;  1RL3 A;  4RQP B;  5KHJ A;  4IEQ A;  3BN6 A;  1BKZ A;  1C5I A;  1QIQ A;  3QH7 A;  3HAG A;  1RJ8 A;  3PUR A;  2PFW A;  2WQ8 A;  4A3X A;  1W2N A;  2FDJ A;  4QQO A;  1G9C A;  1UKR A;  1F4A A;  2BOJ A;  5JZG C;  2WWJ A;  3CNA A;  1Q8Q A;  4GWJ A;  2LRO A;  2B9U A;  4LHK A;  5FZ7 A;  5IVY A;  2WAO A;  4AI2 A;  5LBE A;  1GNZ A;  1HQN A;  1QJY 3;  2VZR A;  3LZZ A;  5C8C A;  3OBR A;  4XZU G;  3WW4 A;  1WUV A;  4GIQ A;  3N7L A;  1UZ0 A;  1COV 1;  5A1F A;  1FX5 A;  4BXF A;  4IEV A;  4D94 A;  3VD9 A;  3FFQ A;  1BQP A;  5ABJ B;  3AZY A;  2VR4 A;  1O8S A;  3LGR A;  3VBU C;  3WQB A;  4QGL A;  2Q4S A;  4YNI A;  2GMM A;  1RUE 3;  1PO1 1;  2FZ2 A;  4Q4X 3;  1T2X A;  1JXN A;  2WII B;  3PU8 A;  3ILN A;  4JGY A;  2QQW A;  1XE8 A;  4XFA A;  3ZLI A;  3J9S A;  4UOJ A;  5FPV A;  3I2I A;  4AFC A;  2VQA A;  4FPG A;  1VRH 3;  1OF4 A;  4RL7 A;  3POB A;  1K5M A;  4QM8 A;  2YU2 A;  2ZKL A;  1CIW A;  1RUN A;  2NP0 A;  1FYU A;  2VNR A;  2WT0 A;  5FZA A;  1X50 A;  1OBN A;  4ZY9 A;  3UGH A;  1R08 3;  2VOT A;  2WYF A;  2ZGT A;  1RYY A;  4AOC A;  1Y9Q A;  3NL1 A;  4GWN A;  2FDH A; 
#chains in the Genus database with same CATH homology
 1SFP A;  1SPP B;  2QQM A;  3POJ A;  2QQL A;  4LOS A;  4GZ9 A;  3KQ4 B;  2QQO A;  2QQK A;  3POE A;  4LMF A;  3POB A;  3POG A;  1SZB A;  2WNO A;  5CKM A;  1NT0 A;  3POF A;  3DEM A;  1NZI A;  4LOT A;  5CIS A;  3POI A;  5CKN A;  4LOR A;  1SPP A;  5CKQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...