3POFA

Crystal structure of masp-1 cub2 domain bound to ca2+
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
113
structure length
113
Chain Sequence
ECSGNLFTQRTGTITSPDYPNPYPKSSECSYTIDLEEGFMVTLQFEDIFDIEDHPEVPCPYDYIKIKAGSKVWGPFCGEKSPEPISTQSHSIQILFRSDNSGENRGWRLSYRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Mannan-binding lectin serine protease 1
publication title Structural Basis of Mannan-Binding Lectin Recognition by Its Associated Serine Protease MASP-1: Implications for Complement Activation.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 21
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 3.4.21.-:
pdb deposition date 2010-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00431 CUB CUB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.290 Mainly Beta Sandwich Jelly Rolls Spermadhesin, CUB domain 3pofA00
1SPPA 3POJA 5CISA 1NZIA 3POIA 1SFPA 1SPPB 3POBA 4LOTA 4LORA 5CKNA 3KQ4B 4LMFA 3DEMA 4LOSA 1NT0A 2WNOA 2QQLA 2QQKA 3POEA 2QQOA 2QQMA 4GZ9A 3POGA 3POFA 1SZBA 5CKMA 5CKQA
chains in the Genus database with same CATH superfamily
5L7OB 1W9FA 3MIEA 4QPIC 3A4UA 3HBKA 4HSLA 4EE2A 2EIGA 1BYHA 2DUPA 2WS93 4IEZA 3BB6A 1XE8A 3NV4A 4FOVA 3T1MA 3FUQA 1S0DA 3DGTA 1GP4A 2KM2A 1A8DA 1RHI1 2GH8A 1APNA 2JIGA 3LEKA 3P6BA 4WVWA 4CP0A 3QCWA 1Q8SA 2P17A 3A7QA 1PK6C 1YWKA 2VUJA 2LROA 5J1XA 3SHRA 1QKQA 3V56A 3HQUA 3ZSJA 1ENRA 1UYXA 5FY5A 1UY2A 5C4WB 4EZHA 4NO4A 2GN7A 2GC1A 2J22A 3TEYA 5IK4A 4LBOA 4Y5SA 1ZRIA 4CU6A 1XNBA 5GZEA 4UFKA 4ZONA 4XZUG 4Q4Y3 1PX4A 4DUWA 1MQTA 1VBA1 2BDRA 3BIEA 4D0QA 1VB2A 4CEYC 1IPJA 5FZ9A 1C57A 3N9QA 1PVXA 1V9U3 1VLNA 5IJRA 1TME2 5HXVA 3TRSB 3KGZA 2VZSA 3FHIB 3JBG2 4IE4A 2YPDA 1HLCA 3S7EA 2RM23 1XYNA 2YC0A 2ZHNA 4AGVA 4PF1A 3O1SA 2BPA2 4XFGA 1FV2A 3ME2A 4IGPA 1H8TC 2ZS6B 1KDKA 1XYOA 5FCCA 3PTRB 4NIGA 4AVVA 5J37A 2A6YA 2E7AA 3WDUA 3VKOA 1JZ3A 3KZ4C 4E8DA 4GB32 2VZ3A 1C8M3 2WJSA 4AL9A 3J7NA 4HBNA 3C2UA 4BQ3A 4HKLA 1N1SA 3VLBB 1KRIA 1WLCA 3C8XA 2IXKA 2X5IB 1JODA 1RUD3 4SBVA 1NUKA 4YM2A 4X8NA 3SCFA 2XVLA 4JDMA 5JXIA 2ZGRA 3O5SA 3DUIA 1GP6A 4WZFA 2QFEA 4FTEA 3ETPA 4NOTA 2DBIA 1ZNPA 2VXJA 4E8CA 4Y5TA 1OH4A 4NWWA 3BTXA 2PHUA 2UWAA 4KWUA 1YFWA 4LJHA 3RNSA 3ZMNA 1GUIA 3I3DA 1UU4A 4XC9A 5GZFA 2EICA 2VW2A 4AEDA 5CA6A 2A3XA 5JLVA 2YGLA 4HN1A 4D94A 5A6XA 1DQ1A 3WP6A 4Q0VA 5JZGA 1QGLA 4JHTA 3PHMA 2QKDA 3LDRA 1RMU3 3CJIB 4XPVA 2AZ5A 1AL23 2VOXA 2A73B 3THDA 5FTTC 1SFNA 3I2GA 2W47A 1OQEA 3A0KA 2GNMA 5FP3A 1I1EA 3MIGA 1O59A 1FAYA 4I01A 1R091 4JGYA 4I30A 5AFBA 3AVSA 1BVP1 5F2SA 1Y43B 1FT9A 4QXCA 3D4KA 2HWF2 1PNFA 1XE0A 1QJX2 3I3EA 5AC92 2XLFA 2ZZJA 4A41A 2ERFA 2MEV1 2ZPXA 5C9AB 2HLEA 4BIFA 3H7JA 3J8F1 4O7XA 2D43A 2YGMA 2WNUA 3WQ1A 2YC4A 3N7MA 3MUZ1 4OUSA 1ZZ8A 1UYZA 4Q4W1 5JOWA 1W8NA 4B7EA 4ASMB 3I8TA 1LGBA 4A6SA 3THTA 4NRPA 4BCUA 5IK8A 5A6YA 1QJY1 3NNFA 1X8MA 2EVXA 2PYTA 2ARBA 4O9EA 4O9GA 4RSUA 2Q5TA 5FZIA 5A7WB 5EZWA 4PIXA 1OVSA 2DU0A 1WLTA 3VBFB 3AYCA 4M3CE 3VZJA 1HQWA 2IXJA 1SBEA 3CIHA 1N3QA 4MH0E 3WW1A 2VQUA 2VMDA 4HK9A 4RL7A 4IE0A 4EZ4A 5I8SA 4MHRA 4ZS2A 5F39A 1MS5A 1W03A 2G4IA 1TE1B 2WT2A 3M4FA 4PDWC 3VL8A 1W8TA 3POJA 2ZKLA 4LE3A 2CGOA 2VZUA 1AYN2 3HPNA 5AFEA 3AM2A 2YYOA 5A3NA 1LOFA 2E26A 2H6BA 5A80A 1JZ7A 2SLIA 4XHXA 1D4VB 1H1AA 3RWKX 1OUSA 3ZN6B 3VZOA 3KV9A 4CPBA 2R042 2HWC3 5FMOS 4Z2AA 3ASIA 5FMOL 1QNYA 2K46A 5T5PA 1PK6A 2GC3A 4X8PA 2A75A 4OCTA 5IK5A 5APAA 5K4LA 1FX5A 1R1A2 3KGLA 4UOJA 4IEYA 1YLLA 4JTNA 1UF2C 1J1TA 1I5PA 5JDBA 1AXYA 4BHPA 1GWLA 3AX4A 3NQHA 4N7UA 5FYZA 1FNYA 1CONA 2A1XA 5JI7A 2KA3A 4TN7A 1QJZA 1UOJA 3HEIA 4AR2A 4QD2A 4DRRA 5JPNB 3SCHA 3M70A 3N9LA 2LRPA 2VZOA 5E8AA 3OGJA 4IDZA 1CX1A 3WUCA 1X33A 3KHBA 5IW0A 2DYCA 5BNOC 1UX6A 4JZRA 3PL0A 4R4XA 4K8RB 2ZXQA 1JZ4A 1XB9A 1VBD3 4H14A 2ETEA 4ONUA 2DUQA 2D3PA 4PI0A 3VBRB 4CUCA 2Y38A 1CIWA 4M0HA 1U5XA 4BQYA 2WNEA 3OBAA 4K1ZA 3TN91 3B9CA 2PHRA 4MG2A 2EIDA 3VDBA 4WM8B 1AJOA 4AEJA 4YM3A 4KQ7A 1J84A 3FL7A 1FOD2 5F8PA 2GSYA 3MEPA 1X7NA 1UO9A 1MS1A 2J1SA 3SKVA 3U11A 1I5ZA 3UYJA 1E5IA 4EYUA 1WWYA 4XDQA 1VMHA 3VZMA 4AQSA 2XL9A 3ZSMA 1POV1 4YG3A 2Y26A 5JOZA 1HN0A 1B35B 1DBNA 5J09A 3E5XA 5E16A 1UZVA 2F17A 5DZFA 3OPZA 4GH4C 4AW7A 4Q2FA 5CB7A 2EF6A 2RS12 3OSDA 4QKBA 2W5FA 2VY0A 4C8DA 4BIOA 5IFPA 1F2NA 2GZWA 1YCIA 1DGWX 4MGSA 4AHYA 4JDOA 1YYNA 1GQPA 1QQP1 2ZHMA 4ATFA 2ORXA 4H2AA 5FP8A 5GLUA 3ZXJA 2EA7A 4FCAA 2WAOA 1D2SA 3IIAA 3WR0A 4NHLA 2ZEZA 3WDTA 2Y33A 2CWMA 2HWD3 1N3OA 3NNGA 4I3GA 1SLCA 2ZX2A 4I02A 2YBSA 4D7YA 4E27A 5HCBA 3H8RA 4RFT0 4DXSA 4KG8A 3HQXA 3GBWA 1OOPB 3ACLA 4FFGA 4CDQB 2QTWB 2XONA 1RUC2 1LU1A 1HW5A 5K0UA 4AGRA 4CDUB 3LKJA 4CVUA 5HV0A 3BTYA 2JD9A 5BY5A 5D2AA 1VBE3 1VRH1 2X29A 4MSVA 3UK9A 5D8AC 3ZKYA 2WT1A 4S2GA 4Y3OA 3JQWA 3P3PA 2XJPA 4OI2A 4QHZA 2FMDA 5FYVA 3O1PA 1QJU3 2VZVA 2JIJA 2Y6LA 3HT1A 5E89A 4CTEA 4CDXC 2JDNA 3O1OA 3DPRA 4QMAA 5IVVA 2R1DA 3BTZA 4AI1A 5A6QA 3O0VA 1JU4A 4D7TA 2VTFA 4ORFA 3VZLA 1LTEA 1QNWA 2NMNA 2KXLA 3JD71 4XZPA 1GOFA 1ZZCA 1Z7S2 1CAXB 4LKSA 4A2UA 1WW5A 1X36A 2Y6FA 2E7QA 1PGW2 1EAH1 2H0VA 1T6BX 4XUPA 1WD4A 4HLTA 5FFOC 1WCDJ 4OHXA 2PLV2 2GU9A 2D40A 1W0PA 1UL9A 4CCJA 1OF4A 1GICA 1EV12 2V4AA 5T5JA 2HWB2 1W2AX 4Z92B 4RQPB 4HKOA 5LZ6A 1MEC2 2LUWA 3AXEA 4KU8A 4CDWC 2RR13 1BBT3 2DF7A 3ZIXA 3PUQA 2RS52 1O7FA 2IFRA 2D7FA 2DTWA 4IGQA 3I2JA 3VKNA 1NKGA 3BUCA 1UU6A 1HXS2 1WBLA 2RJKA 3U4SA 1DDLA 5JUVA 4I3PA 2WN2A 2GNTA 1RUE2 1POV0 1WW7A 4NROA 3OOXA 4XETA 3LFIA 1EPZA 3WZ1A 5EJ3A 2HEYF 5BNQA 4GZ9A 1NX9A 1AL0G 2A70A 2PHTA 1H8VA 3MW2A 3RMXA 5C33A 1W6QA 2R7EB 4XFHA 2CAVA 1TMF1 1S2EA 4AGGA 4GJZA 1RB8G 3VD4A 4LK7A 4TYSA 3MF6A 4LLOA 1W2UA 2PHWA 4P5YA 5F3EA 1KXGA 3VN4A 1VALA 3URFA 4RR3C 5LBBA 3M3EA 2F4PA 5SV8A 2VZ1A 1S55A 2WZPP 2WLQA 1FXZA 2AGSA 2WNVB 3JB4C 3R4SA 4N43A 4RHV3 1HRV3 1ND3B 3ZFFA 3OD0A 2FD8A 1ZZBA 3HVDA 3NAPC 1COV3 3RYPA 3M3IA 3VGIA 2BTVC 3FFQA 2WZR2 2VC9A 2X8KA 1IG3A 2CTVA 2ZKNA 4K7JA 5I91A 5LEKA 3LEMA 4XVHA 2K0GA 3WD5A 5EWSA 4ARYA 4QB1A 1YFUA 1W6PB 3B00A 3VBSA 1LOGA 3NMBA 4A45A 2VMHA 5FZOA 4ARXA 2WL1A 5J48A 2XXZA 4LBLA 1VBB3 4IL7A 1XRUA 5I93A 1ZBA3 1V0AA 5A7QA 2PLV1 5FZKA 2XLAA 4URAA 1MS0A 3T09A 3T08A 1YFYA 1CAWA 3ZYJB 1DZRA 4UF0B 3CQOA 4ATEA 4BDVB 5H9SA 2DCTA 1FPN2 2BRTA 2RDQA 4LHSA 4Y4RA 3ZKUA 5FR3A 1L7QA 5T52A 4YYOA 4COWA 1QOTA 2MNGA 2XL7A 2W08A 2RE9A 1X82A 1Q43A 1V6KA 2WA3A 3I97A 3N7LA 4IW3A 4LKEA 4K3UA 3VHOA 3CNAA 4KL1A 4UT5A 4ZS3A 1JOJA 1Q8QA 4XFFA 5C8WA 1RHI3 4FFIA 4XCBA 4NAMA 3S7IA 3SCGA 1QH6A 4L0PA 3VHNA 2P5BA 2B8MA 2CL2A 3K3NA 1RUI2 1W2NA 3P1IA 4YVSC 2YFZA 1WBFA 3WNLA 1U5YA 4MGQA 5FZ6A 4FAGA 1BCXA 3AXDA 4FFFA 2DDUA 3ROUA 5C5UA 4P02B 3VUOA 4ISRA 1XPWA 2Z69A 3ZYFA 2ZACA 2HEVF 1E5RA 2BEOA 4IV3C 3I59A 5CG9A 1W9TA 1ST8A 3WCSA 3KT4A 1LB2A 1L3JA 3BPZA 1NCRB 1W6NB 3U4XA 1VBA3 1AR92 5DQ0A 4LBQA 4KG0A 2VGDA 1O3SA 1MZ6A 5A7OA 2P3KA 1CN1A 1DYKA 1UPSA 3IDBB 3KLSA 5FZAA 4YZ5A 1IS3A 1NY71 5DAWA 1AHSA 4CUAA 1GANA 1K5MB 2VVDA 4G9SB 5KXEA 4Z07A 5FLHA 2VU9A 5LK7B 1IOAA 1AR82 1UXZA 2R0HA 2BQPA 1ULCA 1W99A 3GYDA 4DRVA 2JX9A 2W95A 1XQNA 4ZPIA 2OQ7A 4TSVA 3ITQA 1W8HA 1BEV1 3E1F1 4P5HA 4CDXA 3ZXAC 3S57A 2D6OX 3WF1A 4QDQA 2HWE1 2XWBB 2DVBA 1DYOA 4FT8A 4PCRA 4PIZA 4A7YA 2WFF2 4BQ4A 2AENA 2QQWA 4INDA 3IMNA 3TWIA 1LECA 1RUJ2 2JB8A 4BWOA 2P37A 3DYMA 3AK0A 2NYYA 1T2XA 3LWCA 3RFRA 3ZMOA 2Y6JA 2DCZA 4BH9A 1XU1A 3H8UA 5I0TA 3BU0A 1W8FA 2XJRA 4LULA 3DN7A 2WT0A 4GIQA 4LIUA 3N9MA 2D6PA 5LBCA 4J1WA 4XUTA 3R4DB 1NQDA 4YARA 1RUNA 1PM4A 1URXA 3FBMA 3ZDSA 5GZCA 1UU5A 2VBPA 2QE3A 2BNNA 2V4VA 3GHMA 1PZ9A 4J1XA 4CDWA 4FSJA 4Q4V1 4RA0A 4JC1A 1AR71 5FKBA 4ISQA 4LMFA 1JTZX 5ABJB 1IPSA 4DXZA 4DY3A 4CU7A 4LO8A 4HKWA 3SNMA 4UFMA 1L7RA 5FK7A 1RUI1 2OIIA 5C8CB 5C7GA 2CWSA 1SBDA 4WM7A 2YV8A 1QJFA 2D5HA 2QZ3A 5CZKA 2BV4A 1X9PA 1PO11 4FOYA 4G4FA 2YBPA 5C5TA 2GMPA 4UYBA 4EN6B 3RZMA 1VBC2 5IUQA 1PGL1 3O0WA 2JECA 1TNRA 1RUG2 5DG1A 3ZYHA 1Y7BA 2VAUA 2XJVA 2QVSB 2R32A 3AFGA 3WNKA 1R093 4XE9A 3ZYRA 3U75A 4AVSA 1UCXA 4MGIE 4RFRB 4Y20B 4BZ4A 5GLVA 3RDIA 2G1MA 3H3ZA 1BJQA 2XHKA 5CKNA 4QPIB 3WQ0A 4RR3A 1JYNA 2MEV3 3IIIA 4XABA 4A3ZA 5CFDC 2D6NA 3MPBA 3J8F3 4RS5A 2PHLA 3WF2A 2YC2A 2ZX3A 1O5LA 5JR2A 4FXKB 4K6BA 4BJ0A 3HN3A 1C1FA 3NAPA 2QQMA 3RSJA 1QJY3 2BZDA 3ZFEA 3I2OA 2NPIA 1NCQA 2XKPA 3HWJA 2BVBA 4QQ2A 2FMYA 2XVKA 4DFSA 1RVF2 3I2FA 2BFUS 2UYBA 2VMFA 3B5LB 2YXSA 1YJLA 1STMA 3D6EA 1MQTC 3AMQA 3LAGA 2BWAA 2BFUL 4DQAA 4PLMA 3I3MA 1RUJ1 2G9ZA 1CJPA 4Q0UA 3E97A 2WO1A 3HT2A 1W06A 5FPZA 2BGCA 4FPCA 2W1UA 3QACA 3GBGA 5FLJA 1C4RA 1YQ2A 4BMBA 4CEYB 4KGQA 3R4UA 5LRSA 4Q4X2 3T4VA 1GKBA 1OI6A 3HBZA 2RDNA 4M4PA 2OS2A 4QQHA 3ST7A 2ZAHA 2J42A 1ZBE1 1H8TB 2WYSA 1G7YA 2Q8EA 1M4WA 4DO0A 3GJBA 3AZWA 2GC2A 5F9TA 4BISA 5LY2A 1KFXL 3APBA 1TG7A 4NHMA 2GNBA 5FIXA 1JMUB 4N53C 4YVSA 2RV9A 2ZZQA 5JPMB 1YIPA 4QHBA 5A3TA 3WF3A 4Q0QA 3ZN4A 3RZLA 2DUOA 5J7MA 1DHKB 4NRQA 1X50A 4AAXA 1NE6A 1W6MB 2WNOA 2JE7A 4P00B 4DS0A 2VZRA 5LY1A 5FY8A 2FZ2A 3SISA 4FP2A 4BK4A 2GC0A 1CPMA 4QAWA 2BGOA 3W59A 3QD6A 5FYBA 2WABA 3MIFA 4AEDC 5JXJA 3UV9A 1LOCA 3FUOA 2GN3A 2ZHKA 5JZGC 3ZXLA 1PMJX 3O7OA 3KV4A 5FO8B 5JCTA 3MV11 4BU2A 2ZMLA 4EWAA 2EXIA 2D97A 4UXAA 1C3HA 2JENA 2P6CA 3T2OA 4DPNA 1A78A 3AKSA 1QHDA 1J3QA 2BOJA 4JGYC 3TN93 1UYYA 1HIXA 1AZDA 4QPYA 2VW1A 2VG9A 3I3QA 4JX0A 3RJRA 1FMD1 1W0OA 1J1LA 3T3YA 1JZ8A 4L8QA 1GQGA 1ZZ9A 1CAVB 1BQPA 3EB7A 3AKRA 2WNUC 1POV3 4Y22B 4IERA 5FMDA 3FHAA 4KBZA 5F6KA 4YVWA 1O4YA 3AZXA 4RD7A 1AXKA 3RMYA 4QPWA 2P3IA 5A33A 1RUOA 3ZSKA 5CFCC 2Y64A 4UFJA 4QKFA 1GZCA 2WYFA 1TEIA 2R072 2Y60A 1MVQA 2W87A 1XNCA 5T54A 2W91A 5C3RA 1ZRCA 4A7KA 3PURA 1MVEA 4HANA 4S2HA 3V65A 2CGPA 1SLLA 1IGOA 2R0FA 1O6UA 3MICA 2VBDA 3VZKA 2C4XA 2JDHA 1UYPA 1DQ0A 2OVUA 1SMVA 2DU1A 1F8VA 5IVFA 1Q3EA 1SZBA 4YGCA 1AR62 2WBKA 2OX0A 3M3QA 3TEWA 2VNRA 2DCJA 3F2ZA 1BLZA 1T6GC 4V2WA 5FZCA 5CADA 1VRH3 1LOFC 1H1MA 2Y6KA 3HIFA 1CESA 3KV6A 4PDWB 5K7PA 1QDOA 3B94A 4UW5A 1EUUA 3UESA 2W94A 4COYA 3HD8B 3DECA 2ZGKA 2AEZA 5CFDA 1KD7A 3LEIA 4CU8A 5A1FA 1A3KA 1QU0A 4UBGA 4IEXA 4NPMA 2VBBA 1EPWA 2WWSA 3JD73 2ORZA 1WZXA 5L9VA 4ZU7A 4QQPA 2A6VA 5ISLA 3A23A 1EAH3 4MXWA 2SBAA 2VM9A 4Y4YA 2C6SA 1TNFA 2JDYA 2RHPA 4FPEA 1PVC2 5KHKA 1ZRFA 4M0NA 1F4AA 2VZPA 1LEDA 1LOEA 3C7HA 3VL9A 1YEWA 3E6DA 1H2MA 4QXBA 1NLSA 2Q1FA 4QKNA 4XF4A 2Y6HA 3EBRA 4LPLA 2V09A 3IKWA 4LO7A 2VVEA 4XDOA 5DAXA 2ZEWA 4MYEA 1UWWA 5F32A 2CSGA 3ALQA 4HK8A 3FZ3A 4JTOA 4YZ2A 1QIQA 5FLIA 5F3GA 1LODA 2J1VA 4NIAA 5EYXA 4YM0A 5BNOB 3QBQA 1R082 1GWMA 5C3SA 3T2QA 4MUVA 4XQDA 2WZEA 4MGYE 4LIVA 2DTYA 4QX0A 4CUGA 5BYNA 3O1RA 2ES3A 1PO21 5LK5A 4ZXEA 1JS9A 4AK3A 4YW3A 5I0RA 2E9QA 4P9YA 1C8NA 1CAUA 1NLQA 2QJVA 3KM5A 3RWNA 3OYWA 3ZXFA 3EHKA 1D0GA 4A7ZA 4A4AA 4BXSV 1LULA 1TMF3 4HETA 3ZDVA 4N53A 1KS4A 2F4LA 2XQRA 5JMOA 2OUJA 4QX7A 4XILA 4GA9A 2CU5A 5GJ6A 1OLQA 2ZJCA 3PUSA 3MZHA 2X09A 3VKLA 2AEYA 4PJYA 3MW3A 1RYYA 3J7HA 4XURA 1AYM2 2D6MA 4GH4B 5F2WA 2XLGA 3LD8A 5CKMA 1V6JA 2B4KA 3OY8A 3C7GA 4HG6B 1ZZ7A 5LRRA 3TEXA 2R49A 3A0NA 1NZIA 3WG4A 1OA2A 4Z8BA 1UN1A 4LXLA 3VD5A 5IATA 2WR9A 4Q8KA 2D6KA 3C3VA 3BCWA 5BXXA 1VJ2A 1UW8A 5FPUA 1QMJA 2WA4A 1D4M2 5K0UC 1MZEA 4LHKA 4HXCA 1ALYA 2PLV3 4GWMA 2XQXA 3OB8A 3ZXKA 1N3PA 4XJWA 1NA1A 3AP4A 4HPKB 3BOWA 5A32A 1B09A 1UMZA 1ZRRA 2XUMA 3POSA 5T5OA 4EN9B 5DZEA 3S0MA 1TME1 3PDQA 5IHRA 2MHFA 3BODA 5D8AB 3DPRC 3JBG1 4XJ8A 1Z0HA 4XW3A 3RPQA 4XOGA 1AX1A 3VD7A 3N7JA 1O5UA 3WCRA 3IM0A 3Q8CA 3EQEA 4IEQA 3FHQA 1SG3A 4XMAA 1VAMA 1I6XA 5CFCA 1DGWA 2ATFA 3C7FA 4JGZA 4L9BA 4UWDA 4AVAA 4GB31 3B69A 4NHYA 3AP5A 4NUBA 1JBCA 1NOVA 1OVPA 1NYWA 1VIWB 4C90A 2MPFA 3DYOA 3PU8A 3POYA 3UGGA 4AVCA 1G8WA 4RGKA 2C9AA 5I8YA 5IFTA 5KHIA 3V0AB 5LEJA 2FDIA 2VZQA 2YG0A 1ZA7A 3J7LA 4BYYA 3VD9A 4FQZA 4K20A 4HN0A 4KWKA 4N8MA 2TEPA 2A7AA 1S0GA 3NRUA 4AI3A 4AI2A 4D8MA 1U12A 3AC0A 1UD1A 4L99A 1W8WA 1SPPB 3KCCA 1LJ7A 2RS32 4CDWB 4JV4A 4MXVA 2R6QA 2W1SA 5ACA2 1JOBA 4OFGA 5GLTA 3T30A 1KFUL 3DKQA 3BIWE 1NG0A 2XPJA 1UKRA 5F5CA 5K8SA 3WHUA 5A3LA 4CZSA 4XIOA 1BEV3 1S1AA 4XXAA 5L7OC 1H0BA 3WY6A 3JQXA 2HWE3 1RUF2 2H6CA 3GZEA 3UT0A 4CUBA 2VECA 4Z1VA 3RQ0A 1DFQA 1S0CA 1EP0A 5IAVA 1O8PA 4B3NA 3VDAA 3R6SA 5B4NA 3USSA 4CP9B 3B3QE 4L92A 3IAPA 5T5LA 1DQ6A 5A7SA 2Z4FA 4N43C 3ZFFC 2EIEA 1REEA 1F5JA 2HWF1 5AC91 1QJX1 4L97A 2E31A 4RR3B 4B4QA 1AX0A 2VXRA 3PLQA 5SV5A 5C4WC 1UOBA 2Q8OA 1WD3A 4AOCA 2RMU2 2FDKA 1HRI2 3WP3A 3VBSC 3POEA 3NAPB 4LITA 1BZWA 1GMMA 4XF9A 4Q4V3 3THPA 1AR73 1FYUA 1H6YA 1BHGA 3ZFGB 3LSDA 4LBKA 4AHXA 1I3HA 4FOWA 3AMHA 4XYXA 3O1MA 1W6OB 2L9LA 1RUI3 2FQPA 1S0JA 3DF0A 4S2DA 3VHRA 4DEQA 5C3QA 2E33A 3P3NA 4EJRA 4ES9A 2B7YA 5KHGA 4N7IA 4L11A 3AYDA 1PO13 3VBUA 2RJLA 4CEWA 3UJQA 1VMFA 4PHZA 3ZXGA 1YNAA 1WCKA 3ON7A 5FP9A 2I74A 1JOPA 1W8UA 4OQ9A 1LR5A 5FQ0A 4B7KA 3E6CC 2WRAA 3KCXA 4D3WA 4D69A 4UFLA 5FUPA 3GBFA 2W9XA 2VMGA 4RN5A 5E6HA 2JE9A 3VDDC 1AVBA 3MUY1 3USUA 1W0NA 3NVCA 3WDWA 1AYN1 2X10A 1W2OA 3I54A 3CJXA 4N9IA 1XNDA 2HBUA 3N7KA 4C0HA 1LRHA 2DVFA 5FBZA 2IVJA 1NE4A 3HQRA 1VMJA 1IPKA 2X5IC 3MLJA 1OLMA 4Q26A 1K12A 1ENXA 4Q4Y2 2R041 2ZOEB 4NE9A 4UI9L 5I8TA 1NAEA 2OQ6A 3T0AA 1OA4A 5FV3A 3CL1A 3PUAA 4LT5A 2XB6C 3FLPA 4BQ2A 5CG8A 4MOAA 4QPGB 3WEZA 1FNZA 3LDBA 4QGLA 5ANQA 1R1A1 4QWNA 4YG0A 1WMDA 4B1LA 3LPGA 4K40A 1WMXA 3SC7X 1YQ5A 1RUJ3 2RM22 3NWKA 2JG8B 1GZWB 1ZYBA 2GAUA 1GLHA 1OPMA 4IV3B 2AYHA 5FPBA 2QQKA 1SQ4A 2K2SA 3KS7A 2QQIA 2OT7A 3RI8A 1ULOA 1ULPA 2XDVA 3N36A 4NWVA 5FZGA 5GZDA 5B4XA 1JYVA 2NM1A 2NMOA 5FRAA 2IUWA 2VE1A 3N9NA 4QXKA 5FXXA 5LASA 3SXWA 3TYJA 5FZHA 3GZTB 4QB6A 3WNMA 1C8M2 2XR4A 3CJIC 3MDPA 5FBJA 3ES4A 3WSOA 5FK8A 4M3CB 2ZCWA 3SEPA 1E5SA 3KT1A 3NO8A 5FKCA 1ZRDA 1Q8VA 3CMGA 4ZU5A 1RINA 4WVMB 2VTXJ 5H9RA 3H8XA 1WLDA 3OGRA 3ZXEA 3CHXA 1F5FA 1RUD2 4YW5A 1ZBE3 1GOGA 5I0UA 3WF4A 3KMHA 5GM0A 5C70A 4YG6A 1U0AA 4UW4A 4GWIA 4GKXA 2ZBJA 2R30A 4CPBD 2VJXA 1WMEA 2JG9A 5CEHA 2W1QA 1FOD1 4AFMA 3VBOB 3IDAA 2OPKA 3BU7A 4R52A 3LSEA 5FUIA 3ABZA 1V00A 3HJRA 3B9IA 1MACA 4IV1A 5FPAA 1US3A 5AVPA 5HCHA 3WF0A 1H4GA 1D7PM 4BK5A 4K1YA 1RMU2 2RS11 2WO7A 1UPIA 4YW2A 5FZLA 1AL22 2JKXA 4R9CA 1YI7A 2TNFA 5LA0A 4KGGA 3OPWA 2HBTA 4LE4A 3ZOIA 4WM7C 4QM8A 4XBNA 2K9ZA 4YM1A 2E7TA 2RG4A 3M3OA 3VBHB 4B8EA 4RGGA 4FPJA 2BERA 4JDNA 1ND2A 2QZ2A 1O4TA 3KWVA 2AR6A 3AL6A 4IQPA 4TLGA 5FY1A 3MYXA 1CD3G 5L7OA 3FX3A 2KD7A 3M1HA 1BKZA 3J4UH 1IQAA 3OUHA 3WOGA 3V0BB 3ZO0B 2O1QA 5IWFA 1RUC1 1FMD3 2YUEA 1QF3A 4QU1A 2NP0A 1US2A 1RXFA 3VKMA 2FCTA 2XWJB 2JD4A 1SDWA 3ZLIA 5FZFA 4RS5C 4AYUA 4F83A 4XXPA 2JICA 3MFCA 1CPNA 4TWTA 3AVRA 2IXHA 4D7SA 5JWPA 3H50A 4OQ8A 1XC6A 2W39A 1YQ6A 4V1PA 4Q4X3 3ZFEC 5C4WA 5FAXA 1NCQC 4M00A 5FYYA 4AQ2A 1DZQA 1GZTA 3ACIA 3S5QA 2JB4A 1Z7S1 3ES1A 1UNBA 1LESA 2DFCA 1ULFA 1HB3A 1HN1A 1GNZA 3FLTA 1PGW1 4SLIA 4BQWA 1IS6A 4DB5A 1HKDA 1LHWA 1H1IA 5F1RA 2EXKA 4M4RA 3DV8A 5F5QA 1MQTB 1OMIA 3D3AA 1UIKA 2XKOA 3K48A 3WLUA 1EV11 2HWB1 5LA9A 2WQZC 1JI6A 2Y6GA 1MEC1 1ULGA 3QH6A 3UKNA 4MGTA 4DY5A 1JUIA 1ZM1A 4M3CF 2A6WA 1RJ8A 3Q9OA 4CRQA 2IXIA 1WCSA 2JE8A 2RS51 2WLPA 3ZYPA 2ZEYA 3VDDA 4OI0A 3AJYA 4Y5Z0 4WM8C 1RUH2 4K8FA 3T2PA 4ZKTB 1CIYA 1GV9A 4YW4A 2BGPA 5JSRA 5KR7A 5IVEA 1UY4A 2C0ZA 3VV1A 1HXS1 3M3CA 2YY1A 2CY6A 3K77A 3M2MA 2E51A 3GF6A 4ZXKA 2A3WA 1RUE1 2J7MA 4IUGA 4UW3A 4OHZA 1W04A 2X5IA 3RJ2X 3VHPA 4GKYA 2JXAA 2WO2A 2O0OA 2PQQA 3K75B 2GNDA 4LR4A 3LIHA 4P14A 1KDMA 2DURA 3AKQA 3M7AA 3PUHA 1W9SA 5D1IA 2WC2A 3LB9A 4OHWA 3RGBA 3SKJE 3WW3A 4B4PA 4E2GA 4IE6A 5KBFA 5KXCA 4AFBA 5F3CA 3N9PA 3OF1A 5FUNA 2V5DA 1N1YA 1VBD2 2DCYA 4Y1XA 1UMHA 2ZGNA 4XFIA 2UWBA 3MPPG 5A70A 4HOOA 3ZXDA 3PMEA 2VVFA 2KR2A 3GALA 3NV3A 4DUXA 2YMZA 3RZHA 4QB2A 5F7UA 4KBBA 1SLAA 1BMV2 5FJKA 2HYKA 2WZR1 4JQTA 4X6RB 4BOWA 1WA6X 3NJXA 3CJIA 4XQWA 5DN2A 1RJ7A 4AEDB 5FWEA 3WNNA 4CDUC 1GR3A 4YWAA 5IT6A 5JZGB 3WV6A 2DBNA 3B7MA 2VOWA 4NIHA 3EYPA 2P1BA 1A6CA 1PO23 4MVTA 1MPXA 4PF5A 3E5QA 3ZR6A 1V6MA 4XTPA 3CF6E 3K4AA 1OQ1A 1S0BA 2V73A 1LKNA 1OLME 2QQOA 5FOBB 4JGYB 2E32A 2VNOA 3GZAA 4LA2A 1GBGA 5C9AA 1VP6A 1W3VA 3AZYA 1RGSA 4YVWC 1G86A 4O61A 1PMIA 1FPN1 1DYPA 3FMGA 4QDRA 3SMHA 1DQ4A 4HMZA 3C7OA 1UOGA 4XJ9A 4OHYA 4AEKA 2WN3A 4LHLA 4UBHA 1LHVA 2WNUB 1V70A 3KB5A 5A7WA 4W4ZA 4CA9A 5IVJA 5FY0A 2HWD2 1RUH1 4Y26A 4YW1A 1KEXA 1W9WA 3W21A 2UU8A 3P5BA 4E2SA 4KWLA 3VBFA 1NXMA 4EQVA 2WSUA 1UQXA 1ONAA 3Q8FA 4RQPC 1W2TA 3WP5A 3VDCA 4CCDA 1RXGA 1VBE2 5IVBA 4NN0A 4HVRA 1KGYA 3IB3A 3W58A 3H1YA 4OZOA 5CAZA 2C1FA 1FV3A 1UOFA 4HZFA 4EROA 1H6XA 3I2DA 3L2YA 4HVOA 5J96B 1QJU2 2CGNA 3AMNA 1VB4A 5KHHA 1SLBA 3O0XA 1D0HA 3FLRA 1J3RA 1AR91 2E53A 1JU3A 2NQYA 3ZN6A 4NIIA 1PGSA 3CO2A 5FY9A 2VNGA 4CXYA 3LPFA 4LO4B 4AFAA 3EJKA 1TME3 2WKKA 4URTA 3ZN5A 2B39A 1CWPA 3JBG3 5FDBA 4LK6A 3GCWA 2D3RA 1AR81 1H30A 4XUOA 4UFIA 1HQLA 3IPVA 2UY9A 3R0RA 3PU3A 1EYBA 5LCWL 4F8AA 1PK6B 5T3NA 2VPVA 4XJAA 5FJHA 2ZGQA 2QQJA 1Q56A 3GGLA 4GB33 4OMDA 4YFWA 2WFF1 5L9BA 1O4ZA 4LUMA 5BNNC 1V6IA 2RR12 1ND3C 1BBT2 3O14A 4FPYA 5A3UA 1WCUA 2Q8DA 4IEVA 2R16A 3H1WA 4CU9A 3WX5A 1C5IA 5EFUA 2V5YA 4DEVA 4MV2A 5ANNA 5FY7A 1CX4A 4Y1UA 2Y0IA 2W92A 4H7LA 1NT0A 4C1WA 2P3YA 2BNMA 4LEJA 2GMMA 4XJZA 4Q8LA 5KHJA 1JZ2A 3VBRA 1PZ7A 1GP5A 1NLRA 4KI5M 4R9AA 3B93A 2JDPA 3Q8BA 1S0IA 3LA3A 4LBQD 1RL3A 3NL1A 2A5ZA 3MHZA 3U37A 4XUNA 2BWCA 4IEUA 4WM8A 3LA7A 4H55A 3WW4A 1LHUA 4LO6B 3ZPYA 1G9DA 2AH2A 1PNGA 2LW8A 4RHV2 1HRV2 1VBC1 2BYVE 1B35A 1COV2 1HJFA 1L7LA 3AZVA 4BQXA 4FBFA 1RUG1 3F95A 2B46X 1IG0A 3V64A 3BN6A 1CGPA 1OURA 1OQDA 4IETA 3A21A 3DL3A 5FY4A 3UKTA 1LNSA 3MV01 2HWF3 3PMSA 3MF9A 3AKTA 5DDJ2 5AC93 1QJX3 4CCCA 1TZOA 3OGSA 4COVA 1AJKA 5EQUA 5EIYB 4FTSA 3ILNA 4G3YC 3D0JA 1VBB2 2A6XA 1ZBA2 3ECQA 5DUWA 5ERLA 2Z2SB 3OEAA 4MZUA 1U5ZA 3OTFA 3WNXA 4NPLA 4LORA 2HEWF 5FYTA 4L2NA 3WDVA 4DINB 3THCA 5FZ8A 4C1XA 1OOPA 4CDQA 5KC6A 2VCAA 3DEMA 3JB8A 2PFWA 1RVF1 4HT1T 4CDUA 2PHFA 1KJRA 3H3UA 4QQOA 1QXPA 5BPXA 3FWEA 3MBWA 1NA1C 4E4HA 5LATA 5T50A 1O3TA 3TAYA 2OXBA 5H9QA 4LUKA 5K0UB 2WFPA 3RZJA 4DNYA 2VW0A 2J1EA 1RHI2 2ARAA 1W9YA 1C5HA 4UW6A 4P9JA 3MIDA 4IESA 2OPWA 1WKYA 5EHDA 1H9WA 1MS8A 4P9GA 4Z82A 5AVAA 3UGHA 4AWDA 2JJ6A 4CXWA 4Q4X1 2BP6A 1AYN3 2F6BA 4H3WA 3W5NA 1RITA 4LOTA 3RZKA 1CAXA 1Q8OA 1VAKA 1XSRA 3DPRB 1QOSA 2XJSA 3NNJA 4BLIA 4JGZC 4JRAA 4F3JA 5IYYA 2CAUA 4MADA 3FC0A 1LGNA 3FJSA 1SCSA 1GOHA 3ATGA 2R043 4ES8A 1QDCA 4AZZA 1YQ8A 1JYCA 3E5UA 3AL5A 1VBA2 2VQTA 4CCEA 1NQJA 4D6QA 1N47A 4RQPA 1QXJA 2ADDA 1S2KA 3AB0A 1JN2P 1R1A3 1RTVA 4GD4A 3BOPA 2DVGA 1KJLA 4PBOA 1DP0A 2JDZA 3LA2A 3N4MA 1DGRA 2N7GA 2P34A 5EJ1B 1JYXA 4N90A 2CDOA 2LALA 4DXRA 4RYDA 3TB0A 1CZSA 2OZ6A 5CBLA 4DMIA 4EWEA 5C8CC 4R9DA 5DDJ1 1WGPA 1XBFA 1PIV2 5FYIA 1ULEA 2OYZA 1CJDA 1HB1A 1VR3A 3GHNA 4FXGB 1YHFA 5D21A 3WXPA 1DU3D 3SQOA 4YZ1A 2Y0OA 5B2GB 1DZTA 1JUHA 5JSOA 1OD3A 4V2VA 4DIQA 5J98B 2NZ9A 1F9KA 1W6QB 1JYWA 5KWRA 1F4HA 4QX8A 1UMIA 4Y1VA 1UY0A 4YPJA 3DKWA 1H9PA 1HX6A 2B45X 1RC6A 2DVDA 1JHJA 4IXLA 3I4IA 5BNNA 2WNVA 1FOD3 5DG2A 1ND3A 5HPOA 4XAAA 2O8QA 3OBZA 3WW2A 1DCSA 4ASKA 3Q8EA 4DXTA 4YZ3A 2YBKA 2PA7A 2VH9A 1HDKA 4N43B 3ZFFB 4C91A 3BALA 4XF3A 1Y4WA 1DG6A 1W6PA 4BQ1A 3MLLA 2ZABA 3NJYA 2QBXA 2VUDA 2RDRA 5HCFA 2RS13 1LAJA 1U5IA 2W46A 3MI8A 2R071 3VBSB 5DAQA 3JUUA 1PM7A 3TOJA 3ACGA 2BUKA 4IE5A 3K51A 2ZGPA 1R092 5FZOB 2IFWA 4KMQA 3VBUC 4CEWC 2VUAA 3Q8AA 5FMBA 4LKDA 5EV7A 1F31A 1YI9A 1RIRA 4UF0A 1W3XA 3U1XA 2BVVA 4GQ7A 1SHWB 1AUYA 2MEV2 3DYPA 5CVRA 4MHUA 3WNOA 4BM8A 1CAWB 1HV0A 2Q0AA 3J8F2 1XE7A 4LOSA 4ZZ5A 1AR61 2FDHA 2ZGSA 1ZA4A 2VOKA 4MGZE 1OPOA 5FZDA 2IXCA 4LBMA 5F37A 2CHHA 4CE8A 1RUC3 1O3QA 1ZREA 4Q4W2 2AREA 3AZZA 4LLFA 1SBFA 4QX1A 4EN0A 2PHDA 1LOBA 5C6CA 1LGCA 1QJY2 4P9WA 4PBPA 1UY3A 3HNMA 1ODMA 1WA4A 3E6BA 1PIV1 3VDDB 4JKKA 4K9SA 1MS3A 3X29B 2EAAA 2Q1ZB 1Q5OA 2FCVA 2YB7A 4PLOA 5JR7B 1OKQA 4J6GA 4XIKA 3RS6A 3LF7A 4YW7A 1OFSA 1S4CA 2HYXA 1MZ5A 4OI1A 3PUIA 4PLNA 2CYFA 4XFAA 5BV6A 2JDUA 1MZFA 2JEMA 5GZGA 3BTAA 1Z7S3 5A1AA 1VE0A 4Y24A 1XNTA 1W05A 1IS5A 1NCRA 1W6NA 4B4RA 3OBTA 3I59B 5F6LB 4P9IA 2ADEA 1LCLA 2G9GA 3D5OA 4W65A 1PVC1 3AMPA 2A71A 2FHRA 1IS4A 1EV13 1K5MA 3POFA 4LBQB 3ZX7A 2HWB3 4JQRA 5A7NA 3VB9A 1MEC3 2VR4A 3TBDA 4YNIA 2XBO2 3OUIA 3O12A 1X9TA 2GDFA 2WZ8A 4EV0A 2G9FA 1AF9A 2RS53 1R1ZA 4OLLA 4LA3A 1OH3A 5FYUA 5L19A 4JAAA 1R081 2FDJA 4FO9A 2FBEA 4JVAA 4C0BA 4CDXB 5KXBA 3N35A 1HXS3 4QX5A 1XSQA 2XG3A 1RUE3 4ZU4A 5A1LA 4HONA 5HI0A 4XMIA 2P3JA 1OUXA 2JG9C 1GNYA 3JXSA 5FYSA 1WCQA 4KH9A 1SDDB 1BK1A 3FE5A 3NKGA 3NV1A 4Q5OA 2Q8CA 3ZSLA 5GLWA 4PQQA 2IWGB 5E1RA 1XXNA 4IV1C 3LFMA 4XJUA 4BXFA 4NHXA 3CKHA 1E57A 4FPHA 1SACA 4XACA 4EN7B 4BQ5A 4FAHA 5A3MA 5BNPC 5EP9A 3HR9A 3RG0A 3EO6A 5GLZA 1LU2A 3BKZA 1ASJ2 2WINB 1LHNA 2WAAA 2WWUA 2HKXA 3K4DA 5JIAA 5ABJA 2ZMKA 5FZMA 2Z5WA 2PTMA 3IZOA 3KV5A 2ZGUA 4AAPA 1AYM1 5C8CA 3TN92 3N3HA 2P6HA 3RRDA 5KXDA 2WZR3 5FOJB 3GJAA 2QUOA 1MS9A 2XVGA 1ND2C 2ET1A 4Q0PA 1D2QA 4WM7B 3IDEA 3VD3A 3T0DA 5A7PA 1Y3TA 3O1VA 1Y9QA 2B5HA 2R062 2YDEA 1GU3A 2ZAAA 4Y1YA 5JOYA 3KVBA 1IQDC 1ENSA 1D4M1 3AP6A 4A44A 1R64A 5J36A 4Y20A 4OULA 3I2HA 4GALA 4QPIA 5FZ0A 2BNOA 1LENA 2FCUA 1PX3A 2W0XA 3K4ZA 4I09A 4XFCA 4TTGA 2JDKA 3GM8A 4PI2A 1ULDA 1XNKA 1QWRA 1FPN3 2DFBA 1QQP2 1BXHA 1OT5A 2XBO1 3HAGA 3IWZA 3QLQA 1UAIA 4COZA 3ZPOA 4RS5B 4QKDA 1W8ZA 4FQ4A 1ACCA 2ZEXA 3BYWA 4DOUA 5FP7A 3T1LA 1DF0A 2TUNA 1RUH3 3IPVB 3KSCA 4UAPA 2BBVA 1AXZA 4AVBA 1HV1A 5IVYA 4PT6A 3ZFEB 2ZX1A 4YW6A 4GJYA 1NCQB 1OF3A 2R1BA 4YGBA 3WT3A 2D93A 4E2QA 1ZX5A 4AQ6A 5FZEA 3OD4A 4CYDA 2XHNA 1UZZA 1VRH2 1SEFA 1YQCA 4FP3A 4FPLA 1VAVA 1K45A 2LM3A 4AQTA 2CNAA 4GMP1 4HFSA 2WS92 4TLFA 4XF0A 4I0BA 4CEYA 2W1WA 3H8OA 1KS5A 3ACHA 3LDKA 1H2NA 4M01A 3VKFC 1UIJA 1JXNA 1PMHX 5A3PA 4CCNA 4JKLA 5A6ZA 4NIDA 5CU1A 3ORJA 1HB2A 5FZ1A 1AR93 1ASJ1 2B42B 1H8TA 2RS31 3JD72 5FP4A 4AVTA 2AACA 1UZWA 4EWDA 4LNVA 4A3XA 5ACA1 3W20A 3TEZA 1EAH2 3KVAA 4OHVA 3WDXA 1AR83 2XJQA 4IEPA 3L9JT 3FN9A 3C7EA 5FXWA 5H9PA 1OXCA 2YPJA 4W6YA 3RI9A 3G6JB 2PAMA 4Q1RA 5DZGA 5HXMA 3CLPA 2RDSA 1RUF1 4YVSB 2R061 1V9U2 4NAOA 1W6MA 2WFF3 3MIBA 1Y9MA 2IXLA 5DUXA 1GWKA 1P8JA 3NJZA 1UX7A 1G9FA 3GXUA 1VRBA 3K46A 4R8HA 2VULA 4JKMA 4W50A 1F35A 3OUJA 1HQNA 3ILFA 2PAKA 4OUMA 2WQ8A 3H1MA 4OI4A 4FPKA 3B01A 1G9BA 4LHNA 3I7DA 2QNKA 1A34A 2EALA 2RMU1 2QDRA 4F7ZA 3ETQA 4Y33A 1REDA 1HRI1 2BU9A 3POIA 4XFBA 4AI0A 4YRDA 1TMF2 3SLIA 2IVIB 3J9SA 3O1TA 2G19A 4D6RA 4MGKE 1WW6A 1PHMA 3OG2A 2ARCA 4AI9A 4JRLA 4GULA 2H0BA 4BLJA 2WDBA 2YU2A 1POQA 4QM9A 5CYYA 3LQCA 1O8SA 1CAVA 2FDFA 5C9AC 3DXUA 2X05A 4Y22A 2WS91 4FPOB 4WZCA 3A22A 5HV4A 1VBC3 2VOVA 3J7MA 4ZY9A 4AFCA 1W28A 2XUEA 1RUG3 1JYTA 1WMFA 1LHOA 4LTAA 5FXVA 2VQAA 1C1LA 2B9UA 2ZTNA 5FZBA 5DUUA 5LWBA 4CCMA 5JAXA 5A3OA 1SLTA 3OBRA 4YVWB 2I45A 5DAVA 2RJ2A 5BNPA 4BE3A 3NNLA 5I0DA 4XBLA 3CZUA 1WW4A 2OZJA 5A33B 1XYPA 4GMP0 3VBFC 5JI9A 1IKPA 3IMMA 4OYUA 3TNPB 4LBJA 2ARXA 5L36A 5DMYA 1EY2A 4Q4Y1 2ZX0A 4XEZA 3UKVA 3EMRA 2I07B 2QQLA 5EXOA 3ZIWA 2JDAA 4WVVA 1IKQA 2AUYA 1O91A 2ID4A 3WQ7A 1RVF3 1V9U1 1HB4A 3O1UA 3KHCA 5C71A 1QEXA 2GH2A 1KQRA 2RM21 1YIFA 3PVNA 4PDWA 1YUDA 1QOOA 2UY8A 4MO3M 3U07A 4R9BA 4W8JA 3FFZA 1OC1A 5DPNA 1GSLA 5GALA 5IK7A 1N1VA 1FATA 3SH4A 3KF5A 1UKGA 3MGUA 4IEOA 3TNQA 4Q1PA 4CP2A 4AHZA 4AFDA 1J83A 3MLKA 3ACFA 1C8M1 1ENQA 5L73A 1MS4A 3H9AA 5JIUA 5FPLA 4WVZA 5CFDB 4CXXA 2QQVA 1Y9GA 4QX3A 1BK0A 3DCQA 1RUD1 1S0FA 4HL0A 2A6ZA 1DGRN 5L9RA 3RYKA 4RGAA 4A42A 3PJYA 3ZR5A 2BOIA 1LOAA 3LCPA 5C3PA 2Q4SA 2YU1A 4MXWB 3NSTA 3QH7A 4WV8A 2VCMA 3WG3A 4IE7A 2QDNA 4OVEA 3PTYA 1OBNA 2EAKA 1GZ9A 2DCKA 4YGDA 5FWJA 2B9VA 2PQSA 5BNNB 1E5HA 1NY72 1YFXA 2UYAA 3PIJA 4GXLA 4N9HA 2NLRA 2CV6A 3D82A 3HNBM 4HSJA 2VQ0A 2GMEA 2Z79A 2ZGTA 2OA2A 1JZ6A 3J26N 3ZFGC 2HWC2 3ZYBA 3VBRC 5BNOA 3S6PA 1BEV2 5FO7B 3VZNA 1NZCA 4LO5B 2PMWB 4FI9A 3S30A 3KT7A 5DDJ3 2YROA 4CCOA 3BI3A 2HWE2 2D5FA 1RMU1 3H42B 3NW4A 3PVOA 3EXUA 3GNEA 2ZGOA 3ZSEA 1AL21 4YFZA 3ILRA 3SH5A 3ELNA 5TSWA 4TZDA 2D98A 3T0BA 2VMIA 4LKFA 4QT6A 3POWA 1SFPA 4XTMA 2A3YA 2YFUA 2GALA 3LGRA 5EYYA 2ET7A 3ZM8A 1CAUB 4CCLA 3GCXA 4E4SA 1B35C 4GAZA 1AX2A 1SLIA 3WUDA 2EIBA 3OYWB 2W2IA 5FYMA 5G05L 3AKPA 3AP9A 3S5AA 3WDYA 4NRMA 2ENRA 5EJZB 4BB3A 4XAEA 5K9YA 1ODNA 4N53B 1OA3A 2HH9A 4XCAA 4P08A 4Q4V2 1AR72 1UZYA 1S0EA 4GH4A 5LBEA 1G9CA 3G7DA 1VPHA 1C28A 2QCSB 3MFAA 4Y1ZA 4YZ4A 3IAQA 4KWJA 2VL4A 5C3OA 4QPGC 3SEEA 2ZMNA 3K3OA 3OGVA 3WNPA 4Z2WA 1V6OA 2TBVA 3OY8B 1UXXX 4XBQA 3WINE 1OOPC 1PO12 4CDQC 5FZ3A 4BA6A 2JG8C 3W5MA 3OPTA 3KQ4B 2JDMA 3PVEA 1PGL2 1I9RA 5F5AA 2R073 1GQHA 3KF3A 2DVAA 3ZVXA 1WUVA 3NKTA 3AMMA 4OUEA 5DAPA 3OCPA 4OMCA 4HPKA 3L2HA 4LQRA 1GYKA 1KITA 5E88A 4B29A 3LE0A 1PZ8A 4XF1A 3D0SA 1N1TA 1YO8A 2BW8A 4TXWA 4FOQA 3RZGA 1NA1B 3LZZA 4QGMA 4PIYA 5A32B 4QHOA 5D8AA 3MW4A 1AR63 4X6QB 2C24A 5FZ4A 4CSWA 4D6SA 3INAA 1DGLA 1XU2A 1YXWA 2WIIB 3KD4A 2HWC1 3NJVA 2W68A 5FPXA 1V6LA 1M06G 4QQLA 4GWNA 5KC5A 3ENRA 3HMYA 3CZJA 3M8LA 4O65A 3JCIA 3H7YA 1X8EA 3SH3A 1PIV3 2PHXA 2QQUA 2VTXA 3AFKA 3IN9A 4Q0SA 1OHFA 4I2OA 5CNAA 5GKAC 3CEWA 2WWJA 4AF9A 2VO5A 3VBOC 1CR7A 1F15A 2WSVA 3PIGA 5EPAA 4JGZB 5CFCB 4LBNA 4CP1A 3WG1A 2PXJA 4P9XA 4P9LA 3V0AA 3WQBA 2YZ4A 3OJBA 2J1RA 5FZ7A 3JZVA 1W90A 3RVHA 1JZ5A 1QH7A 3OGGA 2J1UA 3I3BA 5J3UA 3MIHA 4I0AA 4FPGA 1SPPA 2NN8A 1PVC3 3BVCA 5LA2A 4E9KA 3PVBB 3WG2A 3QOPA 3POBA 1VBD1 1YJKA 4YSFA 2CDPA 5A3WA 1LEMA 1G9AA 1ZBE2 1G6NA 2OW4A 2XH6A 3VBHC 1ZZ6A 2EXHA 3MO4A 2VMEA 2ZX4A 3UL2A 3IT8A 1O3RA 1BMV1 4K21A 1J59A 2YHJA 1DQ2A 1OLRA 1XJAA 5LW9A 1JH5A 5JXGA 5FXZA 5JSPA 1HJGA 1R083 3UJOA 1OD5A 4Q27A 1W39A 3N9OA 2D44A 3LEGA 1SCRA 4J25A 1TVGA 4I0WB 1CQ9A 3RYRA 4ASLA 4CP9A 5G04L 2LTNA 3LIGA 3UGFA 4UFHA 2VNVA 5IVCA 2WNVC 3NV2A 4YLZA 5JXHA 1YRZA 4QDSA 1DIWA 1K42A 4OZXA 1A8MA 3H3LA 2O14A 1QJEA 4JHZA 1OKOA 2WUHA 3KCYA 1UZ0A 4R4ZA 4KU7A 1WLWA 2Y8KA 4AEMA 2E6VA 2Q30A 4MLOA 3UNPA 4Q4W3 5F5IA 1Q8PA 3AYEA 2WQ4A 1K3IA 1BVVA 2D6LX 5M0TA 3ZFGA 1CVNA 2HWD1 4JCKA 1W6OA 1DLLA 1FI2A 1AYM3 4IEWA 4NVPA 5F3IA 3T4HB 1QXRA 4AI8A 4Q29A 4QX2A 3ZYIB 1YC61 4QGNA 4E4DX 3IBMA 1XOYA 1ZVFA 1FMD2 1GNHA 2PAEA 3GZUC 3BPSA 2UWCA 2W3JA 3AYAA 3U14A 1VBE1 1SFYA 2AC1A 4GWJA 2O8OA 2XGXA 4W6XA 1OSGA 2PN5A 2ZGMA 5FPVA 3VBUB 3FBYA 4CEWB 4XQ4A 5FMCA 4FPFA 2VD7A 1D4M3 3AP7A 2LS6A 1QJU1 2P2KA 5FQ0B 2DV9A 3PNAA 5JVVA 2XOMA 3I2KA 1CZTA 5I0SA 4XDPA 2VOTA 2VCCA 3LOIA 5FYCA 4FVVA 2XJUA 4META 3USUB 4DZGA 5DABA 1H4HA 2ZA9A 3WP4A 2BBAA 2I2SA 3UETA 1DQ5A 2XBO3 1DLCA 4S2FA 1TQ5A 5LA1A 1MR5A 5CKQA 2J1AA 3U0ZA 2QQNA 3HOBA 3GDBA 1CZVA 2JWPA 4QPGA 4KNCA 5IAXA 3D8CA 4ITCA 5FO9B 1NCRC 4QXHA 4DUVA 4A6OA 2JG8A 1GZWA 1JYIA 2C9KA 2ILMA 4IV3A 3OEBA 1OFNA 5BUVA 3H0OA 4NPRA 1K5JA 3PJQA 2ZGLA 1UY1A 2RR11 2OUHA 3BGAA 1BBT1 2D3SA 1K5MC 4NMIA 3RZZA 4ZHNA 3SITA 3CBNA 2EXJA 4GMP3 2C5DA 4AE2A 4BPZA 2XMLA 2P4EA 3I2IA 4NJ4A 2GP5A 2ZHLA 4M3CA 4XUQA 3T2TA 2FDGA 4WVMA 5FREA 3WHTA 4BMEA 5CISA 2OKXA 1REFA 1ASJ3 2V72A 3I49A 1XNAA 3JU9A 1IHMA 4U36A 5FYHA 2RS33 1S2BA 3HNYM 3HN1A 5ACA3 1EUTA 1NXD1 2RVAA 3W9AA 4AHWA 3U10A 5DUVA 5HCAA 2J1TA 4W6WA 1W8OA 1IZ3A 5HBAA 1GFF2 5DXDA 5LBFA 2HJIA 4YGEA 3VBOA 5LB6A 4ET7A 4ZZ8A 2JKBA 2IZWA 2VZTA 4FTBA 4H7MA 3AJZA 1RUF3 2XJTA 2UURA 2JG9B 2C26A 2R063 3CU7A 4HVQA 4RHV1 1HRV1 4XHBA 4NR1A 4COUA 4U2AA 1COV1 1QY4A 2QQPA 3B02A 3KQRA 1H2LA 5ABJC 5JMCA 1V6NA 4IV1B 3LOBA 2E63A 3IDCB 1H2KA 2IC1A 4E4ZA 5BNPB 2W52A 2Q1MA 2PELA 3U78A 4QU2A 1QQP3 4CCKA 1JHNA 1PO22 4IGOA 2VCBA 4FFHA 4AG4A 2DWRA 2RMU3 1VBB1 2BJSA 3VBHA 4EN8B 1ZBA1 1HRI3 4AXOA 2FZ1A 5T55A 3WVJA 4PQ9A 5CIRA 1JW6A 3ZYGA 2WO3A 3K2OA 2X53S 3POGA 3CDZB 4WBBA 3R05A 1J58A 3DXTA 5JOXA 2VUCA 1Z78A 2GP3A 4MX3A 4NHKA 2Z42A 3V0BA 3NNMA 4B1MA 1ND2B 1J3PA 2VMCA 2Y34A
chains in the Genus database with same CATH topology
1SPPA 3POJA 5CISA 1NZIA 3POIA 1SFPA 1SPPB 3POBA 4LOTA 4LORA 5CKNA 3KQ4B 4LMFA 3DEMA 4LOSA 1NT0A 2WNOA 2QQLA 2QQKA 3POEA 2QQOA 2QQMA 4GZ9A 3POGA 3POFA 1SZBA 5CKMA 5CKQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SPP A;  3POJ A;  5CIS A;  1NZI A;  3POI A;  1SFP A;  1SPP B;  3POB A;  4LOT A;  4LOR A;  5CKN A;  3KQ4 B;  4LMF A;  3DEM A;  4LOS A;  1NT0 A;  2WNO A;  2QQL A;  2QQK A;  3POE A;  2QQO A;  2QQM A;  4GZ9 A;  3POG A;  3POF A;  1SZB A;  5CKM A;  5CKQ A; 
#chains in the Genus database with same CATH topology
 5L7O B;  1W9F A;  3MIE A;  4QPI C;  3A4U A;  3HBK A;  4HSL A;  4EE2 A;  2EIG A;  1BYH A;  2DUP A;  2WS9 3;  4IEZ A;  3BB6 A;  1XE8 A;  3NV4 A;  4FOV A;  3T1M A;  3FUQ A;  1S0D A;  3DGT A;  1GP4 A;  2KM2 A;  1A8D A;  1RHI 1;  2GH8 A;  1APN A;  2JIG A;  3LEK A;  3P6B A;  4WVW A;  4CP0 A;  3QCW A;  1Q8S A;  2P17 A;  3A7Q A;  1PK6 C;  1YWK A;  2VUJ A;  2LRO A;  5J1X A;  3SHR A;  1QKQ A;  3V56 A;  3HQU A;  3ZSJ A;  1ENR A;  1UYX A;  5FY5 A;  1UY2 A;  5C4W B;  4EZH A;  4NO4 A;  2GN7 A;  2GC1 A;  2J22 A;  3TEY A;  5IK4 A;  4LBO A;  4Y5S A;  1ZRI A;  4CU6 A;  1XNB A;  5GZE A;  4UFK A;  4ZON A;  4XZU G;  4Q4Y 3;  1PX4 A;  4DUW A;  1MQT A;  1VBA 1;  2BDR A;  3BIE A;  4D0Q A;  1VB2 A;  4CEY C;  1IPJ A;  5FZ9 A;  1C57 A;  3N9Q A;  1PVX A;  1V9U 3;  1VLN A;  5IJR A;  1TME 2;  5HXV A;  3TRS B;  3KGZ A;  2VZS A;  3FHI B;  3JBG 2;  4IE4 A;  2YPD A;  1HLC A;  3S7E A;  2RM2 3;  1XYN A;  2YC0 A;  2ZHN A;  4AGV A;  4PF1 A;  3O1S A;  2BPA 2;  4XFG A;  1FV2 A;  3ME2 A;  4IGP A;  1H8T C;  2ZS6 B;  1KDK A;  1XYO A;  5FCC A;  3PTR B;  4NIG A;  4AVV A;  5J37 A;  2A6Y A;  2E7A A;  3WDU A;  3VKO A;  1JZ3 A;  3KZ4 C;  4E8D A;  4GB3 2;  2VZ3 A;  1C8M 3;  2WJS A;  4AL9 A;  3J7N A;  4HBN A;  3C2U A;  4BQ3 A;  4HKL A;  1N1S A;  3VLB B;  1KRI A;  1WLC A;  3C8X A;  2IXK A;  2X5I B;  1JOD A;  1RUD 3;  4SBV A;  1NUK A;  4YM2 A;  4X8N A;  3SCF A;  2XVL A;  4JDM A;  5JXI A;  2ZGR A;  3O5S A;  3DUI A;  1GP6 A;  4WZF A;  2QFE A;  4FTE A;  3ETP A;  4NOT A;  2DBI A;  1ZNP A;  2VXJ A;  4E8C A;  4Y5T A;  1OH4 A;  4NWW A;  3BTX A;  2PHU A;  2UWA A;  4KWU A;  1YFW A;  4LJH A;  3RNS A;  3ZMN A;  1GUI A;  3I3D A;  1UU4 A;  4XC9 A;  5GZF A;  2EIC A;  2VW2 A;  4AED A;  5CA6 A;  2A3X A;  5JLV A;  2YGL A;  4HN1 A;  4D94 A;  5A6X A;  1DQ1 A;  3WP6 A;  4Q0V A;  5JZG A;  1QGL A;  4JHT A;  3PHM A;  2QKD A;  3LDR A;  1RMU 3;  3CJI B;  4XPV A;  2AZ5 A;  1AL2 3;  2VOX A;  2A73 B;  3THD A;  5FTT C;  1SFN A;  3I2G A;  2W47 A;  1OQE A;  3A0K A;  2GNM A;  5FP3 A;  1I1E A;  3MIG A;  1O59 A;  1FAY A;  4I01 A;  1R09 1;  4JGY A;  4I30 A;  5AFB A;  3AVS A;  1BVP 1;  5F2S A;  1Y43 B;  1FT9 A;  4QXC A;  3D4K A;  2HWF 2;  1PNF A;  1XE0 A;  1QJX 2;  3I3E A;  5AC9 2;  2XLF A;  2ZZJ A;  4A41 A;  2ERF A;  2MEV 1;  2ZPX A;  5C9A B;  2HLE A;  4BIF A;  3H7J A;  3J8F 1;  4O7X A;  2D43 A;  2YGM A;  2WNU A;  3WQ1 A;  2YC4 A;  3N7M A;  3MUZ 1;  4OUS A;  1ZZ8 A;  1UYZ A;  4Q4W 1;  5JOW A;  1W8N A;  4B7E A;  4ASM B;  3I8T A;  1LGB A;  4A6S A;  3THT A;  4NRP A;  4BCU A;  5IK8 A;  5A6Y A;  1QJY 1;  3NNF A;  1X8M A;  2EVX A;  2PYT A;  2ARB A;  4O9E A;  4O9G A;  4RSU A;  2Q5T A;  5FZI A;  5A7W B;  5EZW A;  4PIX A;  1OVS A;  2DU0 A;  1WLT A;  3VBF B;  3AYC A;  4M3C E;  3VZJ A;  1HQW A;  2IXJ A;  1SBE A;  3CIH A;  1N3Q A;  4MH0 E;  3WW1 A;  2VQU A;  2VMD A;  4HK9 A;  4RL7 A;  4IE0 A;  4EZ4 A;  5I8S A;  4MHR A;  4ZS2 A;  5F39 A;  1MS5 A;  1W03 A;  2G4I A;  1TE1 B;  2WT2 A;  3M4F A;  4PDW C;  3VL8 A;  1W8T A;  3POJ A;  2ZKL A;  4LE3 A;  2CGO A;  2VZU A;  1AYN 2;  3HPN A;  5AFE A;  3AM2 A;  2YYO A;  5A3N A;  1LOF A;  2E26 A;  2H6B A;  5A80 A;  1JZ7 A;  2SLI A;  4XHX A;  1D4V B;  1H1A A;  3RWK X;  1OUS A;  3ZN6 B;  3VZO A;  3KV9 A;  4CPB A;  2R04 2;  2HWC 3;  5FMO S;  4Z2A A;  3ASI A;  5FMO L;  1QNY A;  2K46 A;  5T5P A;  1PK6 A;  2GC3 A;  4X8P A;  2A75 A;  4OCT A;  5IK5 A;  5APA A;  5K4L A;  1FX5 A;  1R1A 2;  3KGL A;  4UOJ A;  4IEY A;  1YLL A;  4JTN A;  1UF2 C;  1J1T A;  1I5P A;  5JDB A;  1AXY A;  4BHP A;  1GWL A;  3AX4 A;  3NQH A;  4N7U A;  5FYZ A;  1FNY A;  1CON A;  2A1X A;  5JI7 A;  2KA3 A;  4TN7 A;  1QJZ A;  1UOJ A;  3HEI A;  4AR2 A;  4QD2 A;  4DRR A;  5JPN B;  3SCH A;  3M70 A;  3N9L A;  2LRP A;  2VZO A;  5E8A A;  3OGJ A;  4IDZ A;  1CX1 A;  3WUC A;  1X33 A;  3KHB A;  5IW0 A;  2DYC A;  5BNO C;  1UX6 A;  4JZR A;  3PL0 A;  4R4X A;  4K8R B;  2ZXQ A;  1JZ4 A;  1XB9 A;  1VBD 3;  4H14 A;  2ETE A;  4ONU A;  2DUQ A;  2D3P A;  4PI0 A;  3VBR B;  4CUC A;  2Y38 A;  1CIW A;  4M0H A;  1U5X A;  4BQY A;  2WNE A;  3OBA A;  4K1Z A;  3TN9 1;  3B9C A;  2PHR A;  4MG2 A;  2EID A;  3VDB A;  4WM8 B;  1AJO A;  4AEJ A;  4YM3 A;  4KQ7 A;  1J84 A;  3FL7 A;  1FOD 2;  5F8P A;  2GSY A;  3MEP A;  1X7N A;  1UO9 A;  1MS1 A;  2J1S A;  3SKV A;  3U11 A;  1I5Z A;  3UYJ A;  1E5I A;  4EYU A;  1WWY A;  4XDQ A;  1VMH A;  3VZM A;  4AQS A;  2XL9 A;  3ZSM A;  1POV 1;  4YG3 A;  2Y26 A;  5JOZ A;  1HN0 A;  1B35 B;  1DBN A;  5J09 A;  3E5X A;  5E16 A;  1UZV A;  2F17 A;  5DZF A;  3OPZ A;  4GH4 C;  4AW7 A;  4Q2F A;  5CB7 A;  2EF6 A;  2RS1 2;  3OSD A;  4QKB A;  2W5F A;  2VY0 A;  4C8D A;  4BIO A;  5IFP A;  1F2N A;  2GZW A;  1YCI A;  1DGW X;  4MGS A;  4AHY A;  4JDO A;  1YYN A;  1GQP A;  1QQP 1;  2ZHM A;  4ATF A;  2ORX A;  4H2A A;  5FP8 A;  5GLU A;  3ZXJ A;  2EA7 A;  4FCA A;  2WAO A;  1D2S A;  3IIA A;  3WR0 A;  4NHL A;  2ZEZ A;  3WDT A;  2Y33 A;  2CWM A;  2HWD 3;  1N3O A;  3NNG A;  4I3G A;  1SLC A;  2ZX2 A;  4I02 A;  2YBS A;  4D7Y A;  4E27 A;  5HCB A;  3H8R A;  4RFT 0;  4DXS A;  4KG8 A;  3HQX A;  3GBW A;  1OOP B;  3ACL A;  4FFG A;  4CDQ B;  2QTW B;  2XON A;  1RUC 2;  1LU1 A;  1HW5 A;  5K0U A;  4AGR A;  4CDU B;  3LKJ A;  4CVU A;  5HV0 A;  3BTY A;  2JD9 A;  5BY5 A;  5D2A A;  1VBE 3;  1VRH 1;  2X29 A;  4MSV A;  3UK9 A;  5D8A C;  3ZKY A;  2WT1 A;  4S2G A;  4Y3O A;  3JQW A;  3P3P A;  2XJP A;  4OI2 A;  4QHZ A;  2FMD A;  5FYV A;  3O1P A;  1QJU 3;  2VZV A;  2JIJ A;  2Y6L A;  3HT1 A;  5E89 A;  4CTE A;  4CDX C;  2JDN A;  3O1O A;  3DPR A;  4QMA A;  5IVV A;  2R1D A;  3BTZ A;  4AI1 A;  5A6Q A;  3O0V A;  1JU4 A;  4D7T A;  2VTF A;  4ORF A;  3VZL A;  1LTE A;  1QNW A;  2NMN A;  2KXL A;  3JD7 1;  4XZP A;  1GOF A;  1ZZC A;  1Z7S 2;  1CAX B;  4LKS A;  4A2U A;  1WW5 A;  1X36 A;  2Y6F A;  2E7Q A;  1PGW 2;  1EAH 1;  2H0V A;  1T6B X;  4XUP A;  1WD4 A;  4HLT A;  5FFO C;  1WCD J;  4OHX A;  2PLV 2;  2GU9 A;  2D40 A;  1W0P A;  1UL9 A;  4CCJ A;  1OF4 A;  1GIC A;  1EV1 2;  2V4A A;  5T5J A;  2HWB 2;  1W2A X;  4Z92 B;  4RQP B;  4HKO A;  5LZ6 A;  1MEC 2;  2LUW A;  3AXE A;  4KU8 A;  4CDW C;  2RR1 3;  1BBT 3;  2DF7 A;  3ZIX A;  3PUQ A;  2RS5 2;  1O7F A;  2IFR A;  2D7F A;  2DTW A;  4IGQ A;  3I2J A;  3VKN A;  1NKG A;  3BUC A;  1UU6 A;  1HXS 2;  1WBL A;  2RJK A;  3U4S A;  1DDL A;  5JUV A;  4I3P A;  2WN2 A;  2GNT A;  1RUE 2;  1POV 0;  1WW7 A;  4NRO A;  3OOX A;  4XET A;  3LFI A;  1EPZ A;  3WZ1 A;  5EJ3 A;  2HEY F;  5BNQ A;  4GZ9 A;  1NX9 A;  1AL0 G;  2A70 A;  2PHT A;  1H8V A;  3MW2 A;  3RMX A;  5C33 A;  1W6Q A;  2R7E B;  4XFH A;  2CAV A;  1TMF 1;  1S2E A;  4AGG A;  4GJZ A;  1RB8 G;  3VD4 A;  4LK7 A;  4TYS A;  3MF6 A;  4LLO A;  1W2U A;  2PHW A;  4P5Y A;  5F3E A;  1KXG A;  3VN4 A;  1VAL A;  3URF A;  4RR3 C;  5LBB A;  3M3E A;  2F4P A;  5SV8 A;  2VZ1 A;  1S55 A;  2WZP P;  2WLQ A;  1FXZ A;  2AGS A;  2WNV B;  3JB4 C;  3R4S A;  4N43 A;  4RHV 3;  1HRV 3;  1ND3 B;  3ZFF A;  3OD0 A;  2FD8 A;  1ZZB A;  3HVD A;  3NAP C;  1COV 3;  3RYP A;  3M3I A;  3VGI A;  2BTV C;  3FFQ A;  2WZR 2;  2VC9 A;  2X8K A;  1IG3 A;  2CTV A;  2ZKN A;  4K7J A;  5I91 A;  5LEK A;  3LEM A;  4XVH A;  2K0G A;  3WD5 A;  5EWS A;  4ARY A;  4QB1 A;  1YFU A;  1W6P B;  3B00 A;  3VBS A;  1LOG A;  3NMB A;  4A45 A;  2VMH A;  5FZO A;  4ARX A;  2WL1 A;  5J48 A;  2XXZ A;  4LBL A;  1VBB 3;  4IL7 A;  1XRU A;  5I93 A;  1ZBA 3;  1V0A A;  5A7Q A;  2PLV 1;  5FZK A;  2XLA A;  4URA A;  1MS0 A;  3T09 A;  3T08 A;  1YFY A;  1CAW A;  3ZYJ B;  1DZR A;  4UF0 B;  3CQO A;  4ATE A;  4BDV B;  5H9S A;  2DCT A;  1FPN 2;  2BRT A;  2RDQ A;  4LHS A;  4Y4R A;  3ZKU A;  5FR3 A;  1L7Q A;  5T52 A;  4YYO A;  4COW A;  1QOT A;  2MNG A;  2XL7 A;  2W08 A;  2RE9 A;  1X82 A;  1Q43 A;  1V6K A;  2WA3 A;  3I97 A;  3N7L A;  4IW3 A;  4LKE A;  4K3U A;  3VHO A;  3CNA A;  4KL1 A;  4UT5 A;  4ZS3 A;  1JOJ A;  1Q8Q A;  4XFF A;  5C8W A;  1RHI 3;  4FFI A;  4XCB A;  4NAM A;  3S7I A;  3SCG A;  1QH6 A;  4L0P A;  3VHN A;  2P5B A;  2B8M A;  2CL2 A;  3K3N A;  1RUI 2;  1W2N A;  3P1I A;  4YVS C;  2YFZ A;  1WBF A;  3WNL A;  1U5Y A;  4MGQ A;  5FZ6 A;  4FAG A;  1BCX A;  3AXD A;  4FFF A;  2DDU A;  3ROU A;  5C5U A;  4P02 B;  3VUO A;  4ISR A;  1XPW A;  2Z69 A;  3ZYF A;  2ZAC A;  2HEV F;  1E5R A;  2BEO A;  4IV3 C;  3I59 A;  5CG9 A;  1W9T A;  1ST8 A;  3WCS A;  3KT4 A;  1LB2 A;  1L3J A;  3BPZ A;  1NCR B;  1W6N B;  3U4X A;  1VBA 3;  1AR9 2;  5DQ0 A;  4LBQ A;  4KG0 A;  2VGD A;  1O3S A;  1MZ6 A;  5A7O A;  2P3K A;  1CN1 A;  1DYK A;  1UPS A;  3IDB B;  3KLS A;  5FZA A;  4YZ5 A;  1IS3 A;  1NY7 1;  5DAW A;  1AHS A;  4CUA A;  1GAN A;  1K5M B;  2VVD A;  4G9S B;  5KXE A;  4Z07 A;  5FLH A;  2VU9 A;  5LK7 B;  1IOA A;  1AR8 2;  1UXZ A;  2R0H A;  2BQP A;  1ULC A;  1W99 A;  3GYD A;  4DRV A;  2JX9 A;  2W95 A;  1XQN A;  4ZPI A;  2OQ7 A;  4TSV A;  3ITQ A;  1W8H A;  1BEV 1;  3E1F 1;  4P5H A;  4CDX A;  3ZXA C;  3S57 A;  2D6O X;  3WF1 A;  4QDQ A;  2HWE 1;  2XWB B;  2DVB A;  1DYO A;  4FT8 A;  4PCR A;  4PIZ A;  4A7Y A;  2WFF 2;  4BQ4 A;  2AEN A;  2QQW A;  4IND A;  3IMN A;  3TWI A;  1LEC A;  1RUJ 2;  2JB8 A;  4BWO A;  2P37 A;  3DYM A;  3AK0 A;  2NYY A;  1T2X A;  3LWC A;  3RFR A;  3ZMO A;  2Y6J A;  2DCZ A;  4BH9 A;  1XU1 A;  3H8U A;  5I0T A;  3BU0 A;  1W8F A;  2XJR A;  4LUL A;  3DN7 A;  2WT0 A;  4GIQ A;  4LIU A;  3N9M A;  2D6P A;  5LBC A;  4J1W A;  4XUT A;  3R4D B;  1NQD A;  4YAR A;  1RUN A;  1PM4 A;  1URX A;  3FBM A;  3ZDS A;  5GZC A;  1UU5 A;  2VBP A;  2QE3 A;  2BNN A;  2V4V A;  3GHM A;  1PZ9 A;  4J1X A;  4CDW A;  4FSJ A;  4Q4V 1;  4RA0 A;  4JC1 A;  1AR7 1;  5FKB A;  4ISQ A;  4LMF A;  1JTZ X;  5ABJ B;  1IPS A;  4DXZ A;  4DY3 A;  4CU7 A;  4LO8 A;  4HKW A;  3SNM A;  4UFM A;  1L7R A;  5FK7 A;  1RUI 1;  2OII A;  5C8C B;  5C7G A;  2CWS A;  1SBD A;  4WM7 A;  2YV8 A;  1QJF A;  2D5H A;  2QZ3 A;  5CZK A;  2BV4 A;  1X9P A;  1PO1 1;  4FOY A;  4G4F A;  2YBP A;  5C5T A;  2GMP A;  4UYB A;  4EN6 B;  3RZM A;  1VBC 2;  5IUQ A;  1PGL 1;  3O0W A;  2JEC A;  1TNR A;  1RUG 2;  5DG1 A;  3ZYH A;  1Y7B A;  2VAU A;  2XJV A;  2QVS B;  2R32 A;  3AFG A;  3WNK A;  1R09 3;  4XE9 A;  3ZYR A;  3U75 A;  4AVS A;  1UCX A;  4MGI E;  4RFR B;  4Y20 B;  4BZ4 A;  5GLV A;  3RDI A;  2G1M A;  3H3Z A;  1BJQ A;  2XHK A;  5CKN A;  4QPI B;  3WQ0 A;  4RR3 A;  1JYN A;  2MEV 3;  3III A;  4XAB A;  4A3Z A;  5CFD C;  2D6N A;  3MPB A;  3J8F 3;  4RS5 A;  2PHL A;  3WF2 A;  2YC2 A;  2ZX3 A;  1O5L A;  5JR2 A;  4FXK B;  4K6B A;  4BJ0 A;  3HN3 A;  1C1F A;  3NAP A;  2QQM A;  3RSJ A;  1QJY 3;  2BZD A;  3ZFE A;  3I2O A;  2NPI A;  1NCQ A;  2XKP A;  3HWJ A;  2BVB A;  4QQ2 A;  2FMY A;  2XVK A;  4DFS A;  1RVF 2;  3I2F A;  2BFU S;  2UYB A;  2VMF A;  3B5L B;  2YXS A;  1YJL A;  1STM A;  3D6E A;  1MQT C;  3AMQ A;  3LAG A;  2BWA A;  2BFU L;  4DQA A;  4PLM A;  3I3M A;  1RUJ 1;  2G9Z A;  1CJP A;  4Q0U A;  3E97 A;  2WO1 A;  3HT2 A;  1W06 A;  5FPZ A;  2BGC A;  4FPC A;  2W1U A;  3QAC A;  3GBG A;  5FLJ A;  1C4R A;  1YQ2 A;  4BMB A;  4CEY B;  4KGQ A;  3R4U A;  5LRS A;  4Q4X 2;  3T4V A;  1GKB A;  1OI6 A;  3HBZ A;  2RDN A;  4M4P A;  2OS2 A;  4QQH A;  3ST7 A;  2ZAH A;  2J42 A;  1ZBE 1;  1H8T B;  2WYS A;  1G7Y A;  2Q8E A;  1M4W A;  4DO0 A;  3GJB A;  3AZW A;  2GC2 A;  5F9T A;  4BIS A;  5LY2 A;  1KFX L;  3APB A;  1TG7 A;  4NHM A;  2GNB A;  5FIX A;  1JMU B;  4N53 C;  4YVS A;  2RV9 A;  2ZZQ A;  5JPM B;  1YIP A;  4QHB A;  5A3T A;  3WF3 A;  4Q0Q A;  3ZN4 A;  3RZL A;  2DUO A;  5J7M A;  1DHK B;  4NRQ A;  1X50 A;  4AAX A;  1NE6 A;  1W6M B;  2WNO A;  2JE7 A;  4P00 B;  4DS0 A;  2VZR A;  5LY1 A;  5FY8 A;  2FZ2 A;  3SIS A;  4FP2 A;  4BK4 A;  2GC0 A;  1CPM A;  4QAW A;  2BGO A;  3W59 A;  3QD6 A;  5FYB A;  2WAB A;  3MIF A;  4AED C;  5JXJ A;  3UV9 A;  1LOC A;  3FUO A;  2GN3 A;  2ZHK A;  5JZG C;  3ZXL A;  1PMJ X;  3O7O A;  3KV4 A;  5FO8 B;  5JCT A;  3MV1 1;  4BU2 A;  2ZML A;  4EWA A;  2EXI A;  2D97 A;  4UXA A;  1C3H A;  2JEN A;  2P6C A;  3T2O A;  4DPN A;  1A78 A;  3AKS A;  1QHD A;  1J3Q A;  2BOJ A;  4JGY C;  3TN9 3;  1UYY A;  1HIX A;  1AZD A;  4QPY A;  2VW1 A;  2VG9 A;  3I3Q A;  4JX0 A;  3RJR A;  1FMD 1;  1W0O A;  1J1L A;  3T3Y A;  1JZ8 A;  4L8Q A;  1GQG A;  1ZZ9 A;  1CAV B;  1BQP A;  3EB7 A;  3AKR A;  2WNU C;  1POV 3;  4Y22 B;  4IER A;  5FMD A;  3FHA A;  4KBZ A;  5F6K A;  4YVW A;  1O4Y A;  3AZX A;  4RD7 A;  1AXK A;  3RMY A;  4QPW A;  2P3I A;  5A33 A;  1RUO A;  3ZSK A;  5CFC C;  2Y64 A;  4UFJ A;  4QKF A;  1GZC A;  2WYF A;  1TEI A;  2R07 2;  2Y60 A;  1MVQ A;  2W87 A;  1XNC A;  5T54 A;  2W91 A;  5C3R A;  1ZRC A;  4A7K A;  3PUR A;  1MVE A;  4HAN A;  4S2H A;  3V65 A;  2CGP A;  1SLL A;  1IGO A;  2R0F A;  1O6U A;  3MIC A;  2VBD A;  3VZK A;  2C4X A;  2JDH A;  1UYP A;  1DQ0 A;  2OVU A;  1SMV A;  2DU1 A;  1F8V A;  5IVF A;  1Q3E A;  1SZB A;  4YGC A;  1AR6 2;  2WBK A;  2OX0 A;  3M3Q A;  3TEW A;  2VNR A;  2DCJ A;  3F2Z A;  1BLZ A;  1T6G C;  4V2W A;  5FZC A;  5CAD A;  1VRH 3;  1LOF C;  1H1M A;  2Y6K A;  3HIF A;  1CES A;  3KV6 A;  4PDW B;  5K7P A;  1QDO A;  3B94 A;  4UW5 A;  1EUU A;  3UES A;  2W94 A;  4COY A;  3HD8 B;  3DEC A;  2ZGK A;  2AEZ A;  5CFD A;  1KD7 A;  3LEI A;  4CU8 A;  5A1F A;  1A3K A;  1QU0 A;  4UBG A;  4IEX A;  4NPM A;  2VBB A;  1EPW A;  2WWS A;  3JD7 3;  2ORZ A;  1WZX A;  5L9V A;  4ZU7 A;  4QQP A;  2A6V A;  5ISL A;  3A23 A;  1EAH 3;  4MXW A;  2SBA A;  2VM9 A;  4Y4Y A;  2C6S A;  1TNF A;  2JDY A;  2RHP A;  4FPE A;  1PVC 2;  5KHK A;  1ZRF A;  4M0N A;  1F4A A;  2VZP A;  1LED A;  1LOE A;  3C7H A;  3VL9 A;  1YEW A;  3E6D A;  1H2M A;  4QXB A;  1NLS A;  2Q1F A;  4QKN A;  4XF4 A;  2Y6H A;  3EBR A;  4LPL A;  2V09 A;  3IKW A;  4LO7 A;  2VVE A;  4XDO A;  5DAX A;  2ZEW A;  4MYE A;  1UWW A;  5F32 A;  2CSG A;  3ALQ A;  4HK8 A;  3FZ3 A;  4JTO A;  4YZ2 A;  1QIQ A;  5FLI A;  5F3G A;  1LOD A;  2J1V A;  4NIA A;  5EYX A;  4YM0 A;  5BNO B;  3QBQ A;  1R08 2;  1GWM A;  5C3S A;  3T2Q A;  4MUV A;  4XQD A;  2WZE A;  4MGY E;  4LIV A;  2DTY A;  4QX0 A;  4CUG A;  5BYN A;  3O1R A;  2ES3 A;  1PO2 1;  5LK5 A;  4ZXE A;  1JS9 A;  4AK3 A;  4YW3 A;  5I0R A;  2E9Q A;  4P9Y A;  1C8N A;  1CAU A;  1NLQ A;  2QJV A;  3KM5 A;  3RWN A;  3OYW A;  3ZXF A;  3EHK A;  1D0G A;  4A7Z A;  4A4A A;  4BXS V;  1LUL A;  1TMF 3;  4HET A;  3ZDV A;  4N53 A;  1KS4 A;  2F4L A;  2XQR A;  5JMO A;  2OUJ A;  4QX7 A;  4XIL A;  4GA9 A;  2CU5 A;  5GJ6 A;  1OLQ A;  2ZJC A;  3PUS A;  3MZH A;  2X09 A;  3VKL A;  2AEY A;  4PJY A;  3MW3 A;  1RYY A;  3J7H A;  4XUR A;  1AYM 2;  2D6M A;  4GH4 B;  5F2W A;  2XLG A;  3LD8 A;  5CKM A;  1V6J A;  2B4K A;  3OY8 A;  3C7G A;  4HG6 B;  1ZZ7 A;  5LRR A;  3TEX A;  2R49 A;  3A0N A;  1NZI A;  3WG4 A;  1OA2 A;  4Z8B A;  1UN1 A;  4LXL A;  3VD5 A;  5IAT A;  2WR9 A;  4Q8K A;  2D6K A;  3C3V A;  3BCW A;  5BXX A;  1VJ2 A;  1UW8 A;  5FPU A;  1QMJ A;  2WA4 A;  1D4M 2;  5K0U C;  1MZE A;  4LHK A;  4HXC A;  1ALY A;  2PLV 3;  4GWM A;  2XQX A;  3OB8 A;  3ZXK A;  1N3P A;  4XJW A;  1NA1 A;  3AP4 A;  4HPK B;  3BOW A;  5A32 A;  1B09 A;  1UMZ A;  1ZRR A;  2XUM A;  3POS A;  5T5O A;  4EN9 B;  5DZE A;  3S0M A;  1TME 1;  3PDQ A;  5IHR A;  2MHF A;  3BOD A;  5D8A B;  3DPR C;  3JBG 1;  4XJ8 A;  1Z0H A;  4XW3 A;  3RPQ A;  4XOG A;  1AX1 A;  3VD7 A;  3N7J A;  1O5U A;  3WCR A;  3IM0 A;  3Q8C A;  3EQE A;  4IEQ A;  3FHQ A;  1SG3 A;  4XMA A;  1VAM A;  1I6X A;  5CFC A;  1DGW A;  2ATF A;  3C7F A;  4JGZ A;  4L9B A;  4UWD A;  4AVA A;  4GB3 1;  3B69 A;  4NHY A;  3AP5 A;  4NUB A;  1JBC A;  1NOV A;  1OVP A;  1NYW A;  1VIW B;  4C90 A;  2MPF A;  3DYO A;  3PU8 A;  3POY A;  3UGG A;  4AVC A;  1G8W A;  4RGK A;  2C9A A;  5I8Y A;  5IFT A;  5KHI A;  3V0A B;  5LEJ A;  2FDI A;  2VZQ A;  2YG0 A;  1ZA7 A;  3J7L A;  4BYY A;  3VD9 A;  4FQZ A;  4K20 A;  4HN0 A;  4KWK A;  4N8M A;  2TEP A;  2A7A A;  1S0G A;  3NRU A;  4AI3 A;  4AI2 A;  4D8M A;  1U12 A;  3AC0 A;  1UD1 A;  4L99 A;  1W8W A;  1SPP B;  3KCC A;  1LJ7 A;  2RS3 2;  4CDW B;  4JV4 A;  4MXV A;  2R6Q A;  2W1S A;  5ACA 2;  1JOB A;  4OFG A;  5GLT A;  3T30 A;  1KFU L;  3DKQ A;  3BIW E;  1NG0 A;  2XPJ A;  1UKR A;  5F5C A;  5K8S A;  3WHU A;  5A3L A;  4CZS A;  4XIO A;  1BEV 3;  1S1A A;  4XXA A;  5L7O C;  1H0B A;  3WY6 A;  3JQX A;  2HWE 3;  1RUF 2;  2H6C A;  3GZE A;  3UT0 A;  4CUB A;  2VEC A;  4Z1V A;  3RQ0 A;  1DFQ A;  1S0C A;  1EP0 A;  5IAV A;  1O8P A;  4B3N A;  3VDA A;  3R6S A;  5B4N A;  3USS A;  4CP9 B;  3B3Q E;  4L92 A;  3IAP A;  5T5L A;  1DQ6 A;  5A7S A;  2Z4F A;  4N43 C;  3ZFF C;  2EIE A;  1REE A;  1F5J A;  2HWF 1;  5AC9 1;  1QJX 1;  4L97 A;  2E31 A;  4RR3 B;  4B4Q A;  1AX0 A;  2VXR A;  3PLQ A;  5SV5 A;  5C4W C;  1UOB A;  2Q8O A;  1WD3 A;  4AOC A;  2RMU 2;  2FDK A;  1HRI 2;  3WP3 A;  3VBS C;  3POE A;  3NAP B;  4LIT A;  1BZW A;  1GMM A;  4XF9 A;  4Q4V 3;  3THP A;  1AR7 3;  1FYU A;  1H6Y A;  1BHG A;  3ZFG B;  3LSD A;  4LBK A;  4AHX A;  1I3H A;  4FOW A;  3AMH A;  4XYX A;  3O1M A;  1W6O B;  2L9L A;  1RUI 3;  2FQP A;  1S0J A;  3DF0 A;  4S2D A;  3VHR A;  4DEQ A;  5C3Q A;  2E33 A;  3P3N A;  4EJR A;  4ES9 A;  2B7Y A;  5KHG A;  4N7I A;  4L11 A;  3AYD A;  1PO1 3;  3VBU A;  2RJL A;  4CEW A;  3UJQ A;  1VMF A;  4PHZ A;  3ZXG A;  1YNA A;  1WCK A;  3ON7 A;  5FP9 A;  2I74 A;  1JOP A;  1W8U A;  4OQ9 A;  1LR5 A;  5FQ0 A;  4B7K A;  3E6C C;  2WRA A;  3KCX A;  4D3W A;  4D69 A;  4UFL A;  5FUP A;  3GBF A;  2W9X A;  2VMG A;  4RN5 A;  5E6H A;  2JE9 A;  3VDD C;  1AVB A;  3MUY 1;  3USU A;  1W0N A;  3NVC A;  3WDW A;  1AYN 1;  2X10 A;  1W2O A;  3I54 A;  3CJX A;  4N9I A;  1XND A;  2HBU A;  3N7K A;  4C0H A;  1LRH A;  2DVF A;  5FBZ A;  2IVJ A;  1NE4 A;  3HQR A;  1VMJ A;  1IPK A;  2X5I C;  3MLJ A;  1OLM A;  4Q26 A;  1K12 A;  1ENX A;  4Q4Y 2;  2R04 1;  2ZOE B;  4NE9 A;  4UI9 L;  5I8T A;  1NAE A;  2OQ6 A;  3T0A A;  1OA4 A;  5FV3 A;  3CL1 A;  3PUA A;  4LT5 A;  2XB6 C;  3FLP A;  4BQ2 A;  5CG8 A;  4MOA A;  4QPG B;  3WEZ A;  1FNZ A;  3LDB A;  4QGL A;  5ANQ A;  1R1A 1;  4QWN A;  4YG0 A;  1WMD A;  4B1L A;  3LPG A;  4K40 A;  1WMX A;  3SC7 X;  1YQ5 A;  1RUJ 3;  2RM2 2;  3NWK A;  2JG8 B;  1GZW B;  1ZYB A;  2GAU A;  1GLH A;  1OPM A;  4IV3 B;  2AYH A;  5FPB A;  2QQK A;  1SQ4 A;  2K2S A;  3KS7 A;  2QQI A;  2OT7 A;  3RI8 A;  1ULO A;  1ULP A;  2XDV A;  3N36 A;  4NWV A;  5FZG A;  5GZD A;  5B4X A;  1JYV A;  2NM1 A;  2NMO A;  5FRA A;  2IUW A;  2VE1 A;  3N9N A;  4QXK A;  5FXX A;  5LAS A;  3SXW A;  3TYJ A;  5FZH A;  3GZT B;  4QB6 A;  3WNM A;  1C8M 2;  2XR4 A;  3CJI C;  3MDP A;  5FBJ A;  3ES4 A;  3WSO A;  5FK8 A;  4M3C B;  2ZCW A;  3SEP A;  1E5S A;  3KT1 A;  3NO8 A;  5FKC A;  1ZRD A;  1Q8V A;  3CMG A;  4ZU5 A;  1RIN A;  4WVM B;  2VTX J;  5H9R A;  3H8X A;  1WLD A;  3OGR A;  3ZXE A;  3CHX A;  1F5F A;  1RUD 2;  4YW5 A;  1ZBE 3;  1GOG A;  5I0U A;  3WF4 A;  3KMH A;  5GM0 A;  5C70 A;  4YG6 A;  1U0A A;  4UW4 A;  4GWI A;  4GKX A;  2ZBJ A;  2R30 A;  4CPB D;  2VJX A;  1WME A;  2JG9 A;  5CEH A;  2W1Q A;  1FOD 1;  4AFM A;  3VBO B;  3IDA A;  2OPK A;  3BU7 A;  4R52 A;  3LSE A;  5FUI A;  3ABZ A;  1V00 A;  3HJR A;  3B9I A;  1MAC A;  4IV1 A;  5FPA A;  1US3 A;  5AVP A;  5HCH A;  3WF0 A;  1H4G A;  1D7P M;  4BK5 A;  4K1Y A;  1RMU 2;  2RS1 1;  2WO7 A;  1UPI A;  4YW2 A;  5FZL A;  1AL2 2;  2JKX A;  4R9C A;  1YI7 A;  2TNF A;  5LA0 A;  4KGG A;  3OPW A;  2HBT A;  4LE4 A;  3ZOI A;  4WM7 C;  4QM8 A;  4XBN A;  2K9Z A;  4YM1 A;  2E7T A;  2RG4 A;  3M3O A;  3VBH B;  4B8E A;  4RGG A;  4FPJ A;  2BER A;  4JDN A;  1ND2 A;  2QZ2 A;  1O4T A;  3KWV A;  2AR6 A;  3AL6 A;  4IQP A;  4TLG A;  5FY1 A;  3MYX A;  1CD3 G;  5L7O A;  3FX3 A;  2KD7 A;  3M1H A;  1BKZ A;  3J4U H;  1IQA A;  3OUH A;  3WOG A;  3V0B B;  3ZO0 B;  2O1Q A;  5IWF A;  1RUC 1;  1FMD 3;  2YUE A;  1QF3 A;  4QU1 A;  2NP0 A;  1US2 A;  1RXF A;  3VKM A;  2FCT A;  2XWJ B;  2JD4 A;  1SDW A;  3ZLI A;  5FZF A;  4RS5 C;  4AYU A;  4F83 A;  4XXP A;  2JIC A;  3MFC A;  1CPN A;  4TWT A;  3AVR A;  2IXH A;  4D7S A;  5JWP A;  3H50 A;  4OQ8 A;  1XC6 A;  2W39 A;  1YQ6 A;  4V1P A;  4Q4X 3;  3ZFE C;  5C4W A;  5FAX A;  1NCQ C;  4M00 A;  5FYY A;  4AQ2 A;  1DZQ A;  1GZT A;  3ACI A;  3S5Q A;  2JB4 A;  1Z7S 1;  3ES1 A;  1UNB A;  1LES A;  2DFC A;  1ULF A;  1HB3 A;  1HN1 A;  1GNZ A;  3FLT A;  1PGW 1;  4SLI A;  4BQW A;  1IS6 A;  4DB5 A;  1HKD A;  1LHW A;  1H1I A;  5F1R A;  2EXK A;  4M4R A;  3DV8 A;  5F5Q A;  1MQT B;  1OMI A;  3D3A A;  1UIK A;  2XKO A;  3K48 A;  3WLU A;  1EV1 1;  2HWB 1;  5LA9 A;  2WQZ C;  1JI6 A;  2Y6G A;  1MEC 1;  1ULG A;  3QH6 A;  3UKN A;  4MGT A;  4DY5 A;  1JUI A;  1ZM1 A;  4M3C F;  2A6W A;  1RJ8 A;  3Q9O A;  4CRQ A;  2IXI A;  1WCS A;  2JE8 A;  2RS5 1;  2WLP A;  3ZYP A;  2ZEY A;  3VDD A;  4OI0 A;  3AJY A;  4Y5Z 0;  4WM8 C;  1RUH 2;  4K8F A;  3T2P A;  4ZKT B;  1CIY A;  1GV9 A;  4YW4 A;  2BGP A;  5JSR A;  5KR7 A;  5IVE A;  1UY4 A;  2C0Z A;  3VV1 A;  1HXS 1;  3M3C A;  2YY1 A;  2CY6 A;  3K77 A;  3M2M A;  2E51 A;  3GF6 A;  4ZXK A;  2A3W A;  1RUE 1;  2J7M A;  4IUG A;  4UW3 A;  4OHZ A;  1W04 A;  2X5I A;  3RJ2 X;  3VHP A;  4GKY A;  2JXA A;  2WO2 A;  2O0O A;  2PQQ A;  3K75 B;  2GND A;  4LR4 A;  3LIH A;  4P14 A;  1KDM A;  2DUR A;  3AKQ A;  3M7A A;  3PUH A;  1W9S A;  5D1I A;  2WC2 A;  3LB9 A;  4OHW A;  3RGB A;  3SKJ E;  3WW3 A;  4B4P A;  4E2G A;  4IE6 A;  5KBF A;  5KXC A;  4AFB A;  5F3C A;  3N9P A;  3OF1 A;  5FUN A;  2V5D A;  1N1Y A;  1VBD 2;  2DCY A;  4Y1X A;  1UMH A;  2ZGN A;  4XFI A;  2UWB A;  3MPP G;  5A70 A;  4HOO A;  3ZXD A;  3PME A;  2VVF A;  2KR2 A;  3GAL A;  3NV3 A;  4DUX A;  2YMZ A;  3RZH A;  4QB2 A;  5F7U A;  4KBB A;  1SLA A;  1BMV 2;  5FJK A;  2HYK A;  2WZR 1;  4JQT A;  4X6R B;  4BOW A;  1WA6 X;  3NJX A;  3CJI A;  4XQW A;  5DN2 A;  1RJ7 A;  4AED B;  5FWE A;  3WNN A;  4CDU C;  1GR3 A;  4YWA A;  5IT6 A;  5JZG B;  3WV6 A;  2DBN A;  3B7M A;  2VOW A;  4NIH A;  3EYP A;  2P1B A;  1A6C A;  1PO2 3;  4MVT A;  1MPX A;  4PF5 A;  3E5Q A;  3ZR6 A;  1V6M A;  4XTP A;  3CF6 E;  3K4A A;  1OQ1 A;  1S0B A;  2V73 A;  1LKN A;  1OLM E;  2QQO A;  5FOB B;  4JGY B;  2E32 A;  2VNO A;  3GZA A;  4LA2 A;  1GBG A;  5C9A A;  1VP6 A;  1W3V A;  3AZY A;  1RGS A;  4YVW C;  1G86 A;  4O61 A;  1PMI A;  1FPN 1;  1DYP A;  3FMG A;  4QDR A;  3SMH A;  1DQ4 A;  4HMZ A;  3C7O A;  1UOG A;  4XJ9 A;  4OHY A;  4AEK A;  2WN3 A;  4LHL A;  4UBH A;  1LHV A;  2WNU B;  1V70 A;  3KB5 A;  5A7W A;  4W4Z A;  4CA9 A;  5IVJ A;  5FY0 A;  2HWD 2;  1RUH 1;  4Y26 A;  4YW1 A;  1KEX A;  1W9W A;  3W21 A;  2UU8 A;  3P5B A;  4E2S A;  4KWL A;  3VBF A;  1NXM A;  4EQV A;  2WSU A;  1UQX A;  1ONA A;  3Q8F A;  4RQP C;  1W2T A;  3WP5 A;  3VDC A;  4CCD A;  1RXG A;  1VBE 2;  5IVB A;  4NN0 A;  4HVR A;  1KGY A;  3IB3 A;  3W58 A;  3H1Y A;  4OZO A;  5CAZ A;  2C1F A;  1FV3 A;  1UOF A;  4HZF A;  4ERO A;  1H6X A;  3I2D A;  3L2Y A;  4HVO A;  5J96 B;  1QJU 2;  2CGN A;  3AMN A;  1VB4 A;  5KHH A;  1SLB A;  3O0X A;  1D0H A;  3FLR A;  1J3R A;  1AR9 1;  2E53 A;  1JU3 A;  2NQY A;  3ZN6 A;  4NII A;  1PGS A;  3CO2 A;  5FY9 A;  2VNG A;  4CXY A;  3LPF A;  4LO4 B;  4AFA A;  3EJK A;  1TME 3;  2WKK A;  4URT A;  3ZN5 A;  2B39 A;  1CWP A;  3JBG 3;  5FDB A;  4LK6 A;  3GCW A;  2D3R A;  1AR8 1;  1H30 A;  4XUO A;  4UFI A;  1HQL A;  3IPV A;  2UY9 A;  3R0R A;  3PU3 A;  1EYB A;  5LCW L;  4F8A A;  1PK6 B;  5T3N A;  2VPV A;  4XJA A;  5FJH A;  2ZGQ A;  2QQJ A;  1Q56 A;  3GGL A;  4GB3 3;  4OMD A;  4YFW A;  2WFF 1;  5L9B A;  1O4Z A;  4LUM A;  5BNN C;  1V6I A;  2RR1 2;  1ND3 C;  1BBT 2;  3O14 A;  4FPY A;  5A3U A;  1WCU A;  2Q8D A;  4IEV A;  2R16 A;  3H1W A;  4CU9 A;  3WX5 A;  1C5I A;  5EFU A;  2V5Y A;  4DEV A;  4MV2 A;  5ANN A;  5FY7 A;  1CX4 A;  4Y1U A;  2Y0I A;  2W92 A;  4H7L A;  1NT0 A;  4C1W A;  2P3Y A;  2BNM A;  4LEJ A;  2GMM A;  4XJZ A;  4Q8L A;  5KHJ A;  1JZ2 A;  3VBR A;  1PZ7 A;  1GP5 A;  1NLR A;  4KI5 M;  4R9A A;  3B93 A;  2JDP A;  3Q8B A;  1S0I A;  3LA3 A;  4LBQ D;  1RL3 A;  3NL1 A;  2A5Z A;  3MHZ A;  3U37 A;  4XUN A;  2BWC A;  4IEU A;  4WM8 A;  3LA7 A;  4H55 A;  3WW4 A;  1LHU A;  4LO6 B;  3ZPY A;  1G9D A;  2AH2 A;  1PNG A;  2LW8 A;  4RHV 2;  1HRV 2;  1VBC 1;  2BYV E;  1B35 A;  1COV 2;  1HJF A;  1L7L A;  3AZV A;  4BQX A;  4FBF A;  1RUG 1;  3F95 A;  2B46 X;  1IG0 A;  3V64 A;  3BN6 A;  1CGP A;  1OUR A;  1OQD A;  4IET A;  3A21 A;  3DL3 A;  5FY4 A;  3UKT A;  1LNS A;  3MV0 1;  2HWF 3;  3PMS A;  3MF9 A;  3AKT A;  5DDJ 2;  5AC9 3;  1QJX 3;  4CCC A;  1TZO A;  3OGS A;  4COV A;  1AJK A;  5EQU A;  5EIY B;  4FTS A;  3ILN A;  4G3Y C;  3D0J A;  1VBB 2;  2A6X A;  1ZBA 2;  3ECQ A;  5DUW A;  5ERL A;  2Z2S B;  3OEA A;  4MZU A;  1U5Z A;  3OTF A;  3WNX A;  4NPL A;  4LOR A;  2HEW F;  5FYT A;  4L2N A;  3WDV A;  4DIN B;  3THC A;  5FZ8 A;  4C1X A;  1OOP A;  4CDQ A;  5KC6 A;  2VCA A;  3DEM A;  3JB8 A;  2PFW A;  1RVF 1;  4HT1 T;  4CDU A;  2PHF A;  1KJR A;  3H3U A;  4QQO A;  1QXP A;  5BPX A;  3FWE A;  3MBW A;  1NA1 C;  4E4H A;  5LAT A;  5T50 A;  1O3T A;  3TAY A;  2OXB A;  5H9Q A;  4LUK A;  5K0U B;  2WFP A;  3RZJ A;  4DNY A;  2VW0 A;  2J1E A;  1RHI 2;  2ARA A;  1W9Y A;  1C5H A;  4UW6 A;  4P9J A;  3MID A;  4IES A;  2OPW A;  1WKY A;  5EHD A;  1H9W A;  1MS8 A;  4P9G A;  4Z82 A;  5AVA A;  3UGH A;  4AWD A;  2JJ6 A;  4CXW A;  4Q4X 1;  2BP6 A;  1AYN 3;  2F6B A;  4H3W A;  3W5N A;  1RIT A;  4LOT A;  3RZK A;  1CAX A;  1Q8O A;  1VAK A;  1XSR A;  3DPR B;  1QOS A;  2XJS A;  3NNJ A;  4BLI A;  4JGZ C;  4JRA A;  4F3J A;  5IYY A;  2CAU A;  4MAD A;  3FC0 A;  1LGN A;  3FJS A;  1SCS A;  1GOH A;  3ATG A;  2R04 3;  4ES8 A;  1QDC A;  4AZZ A;  1YQ8 A;  1JYC A;  3E5U A;  3AL5 A;  1VBA 2;  2VQT A;  4CCE A;  1NQJ A;  4D6Q A;  1N47 A;  4RQP A;  1QXJ A;  2ADD A;  1S2K A;  3AB0 A;  1JN2 P;  1R1A 3;  1RTV A;  4GD4 A;  3BOP A;  2DVG A;  1KJL A;  4PBO A;  1DP0 A;  2JDZ A;  3LA2 A;  3N4M A;  1DGR A;  2N7G A;  2P34 A;  5EJ1 B;  1JYX A;  4N90 A;  2CDO A;  2LAL A;  4DXR A;  4RYD A;  3TB0 A;  1CZS A;  2OZ6 A;  5CBL A;  4DMI A;  4EWE A;  5C8C C;  4R9D A;  5DDJ 1;  1WGP A;  1XBF A;  1PIV 2;  5FYI A;  1ULE A;  2OYZ A;  1CJD A;  1HB1 A;  1VR3 A;  3GHN A;  4FXG B;  1YHF A;  5D21 A;  3WXP A;  1DU3 D;  3SQO A;  4YZ1 A;  2Y0O A;  5B2G B;  1DZT A;  1JUH A;  5JSO A;  1OD3 A;  4V2V A;  4DIQ A;  5J98 B;  2NZ9 A;  1F9K A;  1W6Q B;  1JYW A;  5KWR A;  1F4H A;  4QX8 A;  1UMI A;  4Y1V A;  1UY0 A;  4YPJ A;  3DKW A;  1H9P A;  1HX6 A;  2B45 X;  1RC6 A;  2DVD A;  1JHJ A;  4IXL A;  3I4I A;  5BNN A;  2WNV A;  1FOD 3;  5DG2 A;  1ND3 A;  5HPO A;  4XAA A;  2O8Q A;  3OBZ A;  3WW2 A;  1DCS A;  4ASK A;  3Q8E A;  4DXT A;  4YZ3 A;  2YBK A;  2PA7 A;  2VH9 A;  1HDK A;  4N43 B;  3ZFF B;  4C91 A;  3BAL A;  4XF3 A;  1Y4W A;  1DG6 A;  1W6P A;  4BQ1 A;  3MLL A;  2ZAB A;  3NJY A;  2QBX A;  2VUD A;  2RDR A;  5HCF A;  2RS1 3;  1LAJ A;  1U5I A;  2W46 A;  3MI8 A;  2R07 1;  3VBS B;  5DAQ A;  3JUU A;  1PM7 A;  3TOJ A;  3ACG A;  2BUK A;  4IE5 A;  3K51 A;  2ZGP A;  1R09 2;  5FZO B;  2IFW A;  4KMQ A;  3VBU C;  4CEW C;  2VUA A;  3Q8A A;  5FMB A;  4LKD A;  5EV7 A;  1F31 A;  1YI9 A;  1RIR A;  4UF0 A;  1W3X A;  3U1X A;  2BVV A;  4GQ7 A;  1SHW B;  1AUY A;  2MEV 2;  3DYP A;  5CVR A;  4MHU A;  3WNO A;  4BM8 A;  1CAW B;  1HV0 A;  2Q0A A;  3J8F 2;  1XE7 A;  4LOS A;  4ZZ5 A;  1AR6 1;  2FDH A;  2ZGS A;  1ZA4 A;  2VOK A;  4MGZ E;  1OPO A;  5FZD A;  2IXC A;  4LBM A;  5F37 A;  2CHH A;  4CE8 A;  1RUC 3;  1O3Q A;  1ZRE A;  4Q4W 2;  2ARE A;  3AZZ A;  4LLF A;  1SBF A;  4QX1 A;  4EN0 A;  2PHD A;  1LOB A;  5C6C A;  1LGC A;  1QJY 2;  4P9W A;  4PBP A;  1UY3 A;  3HNM A;  1ODM A;  1WA4 A;  3E6B A;  1PIV 1;  3VDD B;  4JKK A;  4K9S A;  1MS3 A;  3X29 B;  2EAA A;  2Q1Z B;  1Q5O A;  2FCV A;  2YB7 A;  4PLO A;  5JR7 B;  1OKQ A;  4J6G A;  4XIK A;  3RS6 A;  3LF7 A;  4YW7 A;  1OFS A;  1S4C A;  2HYX A;  1MZ5 A;  4OI1 A;  3PUI A;  4PLN A;  2CYF A;  4XFA A;  5BV6 A;  2JDU A;  1MZF A;  2JEM A;  5GZG A;  3BTA A;  1Z7S 3;  5A1A A;  1VE0 A;  4Y24 A;  1XNT A;  1W05 A;  1IS5 A;  1NCR A;  1W6N A;  4B4R A;  3OBT A;  3I59 B;  5F6L B;  4P9I A;  2ADE A;  1LCL A;  2G9G A;  3D5O A;  4W65 A;  1PVC 1;  3AMP A;  2A71 A;  2FHR A;  1IS4 A;  1EV1 3;  1K5M A;  3POF A;  4LBQ B;  3ZX7 A;  2HWB 3;  4JQR A;  5A7N A;  3VB9 A;  1MEC 3;  2VR4 A;  3TBD A;  4YNI A;  2XBO 2;  3OUI A;  3O12 A;  1X9T A;  2GDF A;  2WZ8 A;  4EV0 A;  2G9F A;  1AF9 A;  2RS5 3;  1R1Z A;  4OLL A;  4LA3 A;  1OH3 A;  5FYU A;  5L19 A;  4JAA A;  1R08 1;  2FDJ A;  4FO9 A;  2FBE A;  4JVA A;  4C0B A;  4CDX B;  5KXB A;  3N35 A;  1HXS 3;  4QX5 A;  1XSQ A;  2XG3 A;  1RUE 3;  4ZU4 A;  5A1L A;  4HON A;  5HI0 A;  4XMI A;  2P3J A;  1OUX A;  2JG9 C;  1GNY A;  3JXS A;  5FYS A;  1WCQ A;  4KH9 A;  1SDD B;  1BK1 A;  3FE5 A;  3NKG A;  3NV1 A;  4Q5O A;  2Q8C A;  3ZSL A;  5GLW A;  4PQQ A;  2IWG B;  5E1R A;  1XXN A;  4IV1 C;  3LFM A;  4XJU A;  4BXF A;  4NHX A;  3CKH A;  1E57 A;  4FPH A;  1SAC A;  4XAC A;  4EN7 B;  4BQ5 A;  4FAH A;  5A3M A;  5BNP C;  5EP9 A;  3HR9 A;  3RG0 A;  3EO6 A;  5GLZ A;  1LU2 A;  3BKZ A;  1ASJ 2;  2WIN B;  1LHN A;  2WAA A;  2WWU A;  2HKX A;  3K4D A;  5JIA A;  5ABJ A;  2ZMK A;  5FZM A;  2Z5W A;  2PTM A;  3IZO A;  3KV5 A;  2ZGU A;  4AAP A;  1AYM 1;  5C8C A;  3TN9 2;  3N3H A;  2P6H A;  3RRD A;  5KXD A;  2WZR 3;  5FOJ B;  3GJA A;  2QUO A;  1MS9 A;  2XVG A;  1ND2 C;  2ET1 A;  4Q0P A;  1D2Q A;  4WM7 B;  3IDE A;  3VD3 A;  3T0D A;  5A7P A;  1Y3T A;  3O1V A;  1Y9Q A;  2B5H A;  2R06 2;  2YDE A;  1GU3 A;  2ZAA A;  4Y1Y A;  5JOY A;  3KVB A;  1IQD C;  1ENS A;  1D4M 1;  3AP6 A;  4A44 A;  1R64 A;  5J36 A;  4Y20 A;  4OUL A;  3I2H A;  4GAL A;  4QPI A;  5FZ0 A;  2BNO A;  1LEN A;  2FCU A;  1PX3 A;  2W0X A;  3K4Z A;  4I09 A;  4XFC A;  4TTG A;  2JDK A;  3GM8 A;  4PI2 A;  1ULD A;  1XNK A;  1QWR A;  1FPN 3;  2DFB A;  1QQP 2;  1BXH A;  1OT5 A;  2XBO 1;  3HAG A;  3IWZ A;  3QLQ A;  1UAI A;  4COZ A;  3ZPO A;  4RS5 B;  4QKD A;  1W8Z A;  4FQ4 A;  1ACC A;  2ZEX A;  3BYW A;  4DOU A;  5FP7 A;  3T1L A;  1DF0 A;  2TUN A;  1RUH 3;  3IPV B;  3KSC A;  4UAP A;  2BBV A;  1AXZ A;  4AVB A;  1HV1 A;  5IVY A;  4PT6 A;  3ZFE B;  2ZX1 A;  4YW6 A;  4GJY A;  1NCQ B;  1OF3 A;  2R1B A;  4YGB A;  3WT3 A;  2D93 A;  4E2Q A;  1ZX5 A;  4AQ6 A;  5FZE A;  3OD4 A;  4CYD A;  2XHN A;  1UZZ A;  1VRH 2;  1SEF A;  1YQC A;  4FP3 A;  4FPL A;  1VAV A;  1K45 A;  2LM3 A;  4AQT A;  2CNA A;  4GMP 1;  4HFS A;  2WS9 2;  4TLF A;  4XF0 A;  4I0B A;  4CEY A;  2W1W A;  3H8O A;  1KS5 A;  3ACH A;  3LDK A;  1H2N A;  4M01 A;  3VKF C;  1UIJ A;  1JXN A;  1PMH X;  5A3P A;  4CCN A;  4JKL A;  5A6Z A;  4NID A;  5CU1 A;  3ORJ A;  1HB2 A;  5FZ1 A;  1AR9 3;  1ASJ 1;  2B42 B;  1H8T A;  2RS3 1;  3JD7 2;  5FP4 A;  4AVT A;  2AAC A;  1UZW A;  4EWD A;  4LNV A;  4A3X A;  5ACA 1;  3W20 A;  3TEZ A;  1EAH 2;  3KVA A;  4OHV A;  3WDX A;  1AR8 3;  2XJQ A;  4IEP A;  3L9J T;  3FN9 A;  3C7E A;  5FXW A;  5H9P A;  1OXC A;  2YPJ A;  4W6Y A;  3RI9 A;  3G6J B;  2PAM A;  4Q1R A;  5DZG A;  5HXM A;  3CLP A;  2RDS A;  1RUF 1;  4YVS B;  2R06 1;  1V9U 2;  4NAO A;  1W6M A;  2WFF 3;  3MIB A;  1Y9M A;  2IXL A;  5DUX A;  1GWK A;  1P8J A;  3NJZ A;  1UX7 A;  1G9F A;  3GXU A;  1VRB A;  3K46 A;  4R8H A;  2VUL A;  4JKM A;  4W50 A;  1F35 A;  3OUJ A;  1HQN A;  3ILF A;  2PAK A;  4OUM A;  2WQ8 A;  3H1M A;  4OI4 A;  4FPK A;  3B01 A;  1G9B A;  4LHN A;  3I7D A;  2QNK A;  1A34 A;  2EAL A;  2RMU 1;  2QDR A;  4F7Z A;  3ETQ A;  4Y33 A;  1RED A;  1HRI 1;  2BU9 A;  3POI A;  4XFB A;  4AI0 A;  4YRD A;  1TMF 2;  3SLI A;  2IVI B;  3J9S A;  3O1T A;  2G19 A;  4D6R A;  4MGK E;  1WW6 A;  1PHM A;  3OG2 A;  2ARC A;  4AI9 A;  4JRL A;  4GUL A;  2H0B A;  4BLJ A;  2WDB A;  2YU2 A;  1POQ A;  4QM9 A;  5CYY A;  3LQC A;  1O8S A;  1CAV A;  2FDF A;  5C9A C;  3DXU A;  2X05 A;  4Y22 A;  2WS9 1;  4FPO B;  4WZC A;  3A22 A;  5HV4 A;  1VBC 3;  2VOV A;  3J7M A;  4ZY9 A;  4AFC A;  1W28 A;  2XUE A;  1RUG 3;  1JYT A;  1WMF A;  1LHO A;  4LTA A;  5FXV A;  2VQA A;  1C1L A;  2B9U A;  2ZTN A;  5FZB A;  5DUU A;  5LWB A;  4CCM A;  5JAX A;  5A3O A;  1SLT A;  3OBR A;  4YVW B;  2I45 A;  5DAV A;  2RJ2 A;  5BNP A;  4BE3 A;  3NNL A;  5I0D A;  4XBL A;  3CZU A;  1WW4 A;  2OZJ A;  5A33 B;  1XYP A;  4GMP 0;  3VBF C;  5JI9 A;  1IKP A;  3IMM A;  4OYU A;  3TNP B;  4LBJ A;  2ARX A;  5L36 A;  5DMY A;  1EY2 A;  4Q4Y 1;  2ZX0 A;  4XEZ A;  3UKV A;  3EMR A;  2I07 B;  2QQL A;  5EXO A;  3ZIW A;  2JDA A;  4WVV A;  1IKQ A;  2AUY A;  1O91 A;  2ID4 A;  3WQ7 A;  1RVF 3;  1V9U 1;  1HB4 A;  3O1U A;  3KHC A;  5C71 A;  1QEX A;  2GH2 A;  1KQR A;  2RM2 1;  1YIF A;  3PVN A;  4PDW A;  1YUD A;  1QOO A;  2UY8 A;  4MO3 M;  3U07 A;  4R9B A;  4W8J A;  3FFZ A;  1OC1 A;  5DPN A;  1GSL A;  5GAL A;  5IK7 A;  1N1V A;  1FAT A;  3SH4 A;  3KF5 A;  1UKG A;  3MGU A;  4IEO A;  3TNQ A;  4Q1P A;  4CP2 A;  4AHZ A;  4AFD A;  1J83 A;  3MLK A;  3ACF A;  1C8M 1;  1ENQ A;  5L73 A;  1MS4 A;  3H9A A;  5JIU A;  5FPL A;  4WVZ A;  5CFD B;  4CXX A;  2QQV A;  1Y9G A;  4QX3 A;  1BK0 A;  3DCQ A;  1RUD 1;  1S0F A;  4HL0 A;  2A6Z A;  1DGR N;  5L9R A;  3RYK A;  4RGA A;  4A42 A;  3PJY A;  3ZR5 A;  2BOI A;  1LOA A;  3LCP A;  5C3P A;  2Q4S A;  2YU1 A;  4MXW B;  3NST A;  3QH7 A;  4WV8 A;  2VCM A;  3WG3 A;  4IE7 A;  2QDN A;  4OVE A;  3PTY A;  1OBN A;  2EAK A;  1GZ9 A;  2DCK A;  4YGD A;  5FWJ A;  2B9V A;  2PQS A;  5BNN B;  1E5H A;  1NY7 2;  1YFX A;  2UYA A;  3PIJ A;  4GXL A;  4N9H A;  2NLR A;  2CV6 A;  3D82 A;  3HNB M;  4HSJ A;  2VQ0 A;  2GME A;  2Z79 A;  2ZGT A;  2OA2 A;  1JZ6 A;  3J26 N;  3ZFG C;  2HWC 2;  3ZYB A;  3VBR C;  5BNO A;  3S6P A;  1BEV 2;  5FO7 B;  3VZN A;  1NZC A;  4LO5 B;  2PMW B;  4FI9 A;  3S30 A;  3KT7 A;  5DDJ 3;  2YRO A;  4CCO A;  3BI3 A;  2HWE 2;  2D5F A;  1RMU 1;  3H42 B;  3NW4 A;  3PVO A;  3EXU A;  3GNE A;  2ZGO A;  3ZSE A;  1AL2 1;  4YFZ A;  3ILR A;  3SH5 A;  3ELN A;  5TSW A;  4TZD A;  2D98 A;  3T0B A;  2VMI A;  4LKF A;  4QT6 A;  3POW A;  1SFP A;  4XTM A;  2A3Y A;  2YFU A;  2GAL A;  3LGR A;  5EYY A;  2ET7 A;  3ZM8 A;  1CAU B;  4CCL A;  3GCX A;  4E4S A;  1B35 C;  4GAZ A;  1AX2 A;  1SLI A;  3WUD A;  2EIB A;  3OYW B;  2W2I A;  5FYM A;  5G05 L;  3AKP A;  3AP9 A;  3S5A A;  3WDY A;  4NRM A;  2ENR A;  5EJZ B;  4BB3 A;  4XAE A;  5K9Y A;  1ODN A;  4N53 B;  1OA3 A;  2HH9 A;  4XCA A;  4P08 A;  4Q4V 2;  1AR7 2;  1UZY A;  1S0E A;  4GH4 A;  5LBE A;  1G9C A;  3G7D A;  1VPH A;  1C28 A;  2QCS B;  3MFA A;  4Y1Z A;  4YZ4 A;  3IAQ A;  4KWJ A;  2VL4 A;  5C3O A;  4QPG C;  3SEE A;  2ZMN A;  3K3O A;  3OGV A;  3WNP A;  4Z2W A;  1V6O A;  2TBV A;  3OY8 B;  1UXX X;  4XBQ A;  3WIN E;  1OOP C;  1PO1 2;  4CDQ C;  5FZ3 A;  4BA6 A;  2JG8 C;  3W5M A;  3OPT A;  3KQ4 B;  2JDM A;  3PVE A;  1PGL 2;  1I9R A;  5F5A A;  2R07 3;  1GQH A;  3KF3 A;  2DVA A;  3ZVX A;  1WUV A;  3NKT A;  3AMM A;  4OUE A;  5DAP A;  3OCP A;  4OMC A;  4HPK A;  3L2H A;  4LQR A;  1GYK A;  1KIT A;  5E88 A;  4B29 A;  3LE0 A;  1PZ8 A;  4XF1 A;  3D0S A;  1N1T A;  1YO8 A;  2BW8 A;  4TXW A;  4FOQ A;  3RZG A;  1NA1 B;  3LZZ A;  4QGM A;  4PIY A;  5A32 B;  4QHO A;  5D8A A;  3MW4 A;  1AR6 3;  4X6Q B;  2C24 A;  5FZ4 A;  4CSW A;  4D6S A;  3INA A;  1DGL A;  1XU2 A;  1YXW A;  2WII B;  3KD4 A;  2HWC 1;  3NJV A;  2W68 A;  5FPX A;  1V6L A;  1M06 G;  4QQL A;  4GWN A;  5KC5 A;  3ENR A;  3HMY A;  3CZJ A;  3M8L A;  4O65 A;  3JCI A;  3H7Y A;  1X8E A;  3SH3 A;  1PIV 3;  2PHX A;  2QQU A;  2VTX A;  3AFK A;  3IN9 A;  4Q0S A;  1OHF A;  4I2O A;  5CNA A;  5GKA C;  3CEW A;  2WWJ A;  4AF9 A;  2VO5 A;  3VBO C;  1CR7 A;  1F15 A;  2WSV A;  3PIG A;  5EPA A;  4JGZ B;  5CFC B;  4LBN A;  4CP1 A;  3WG1 A;  2PXJ A;  4P9X A;  4P9L A;  3V0A A;  3WQB A;  2YZ4 A;  3OJB A;  2J1R A;  5FZ7 A;  3JZV A;  1W90 A;  3RVH A;  1JZ5 A;  1QH7 A;  3OGG A;  2J1U A;  3I3B A;  5J3U A;  3MIH A;  4I0A A;  4FPG A;  1SPP A;  2NN8 A;  1PVC 3;  3BVC A;  5LA2 A;  4E9K A;  3PVB B;  3WG2 A;  3QOP A;  3POB A;  1VBD 1;  1YJK A;  4YSF A;  2CDP A;  5A3W A;  1LEM A;  1G9A A;  1ZBE 2;  1G6N A;  2OW4 A;  2XH6 A;  3VBH C;  1ZZ6 A;  2EXH A;  3MO4 A;  2VME A;  2ZX4 A;  3UL2 A;  3IT8 A;  1O3R A;  1BMV 1;  4K21 A;  1J59 A;  2YHJ A;  1DQ2 A;  1OLR A;  1XJA A;  5LW9 A;  1JH5 A;  5JXG A;  5FXZ A;  5JSP A;  1HJG A;  1R08 3;  3UJO A;  1OD5 A;  4Q27 A;  1W39 A;  3N9O A;  2D44 A;  3LEG A;  1SCR A;  4J25 A;  1TVG A;  4I0W B;  1CQ9 A;  3RYR A;  4ASL A;  4CP9 A;  5G04 L;  2LTN A;  3LIG A;  3UGF A;  4UFH A;  2VNV A;  5IVC A;  2WNV C;  3NV2 A;  4YLZ A;  5JXH A;  1YRZ A;  4QDS A;  1DIW A;  1K42 A;  4OZX A;  1A8M A;  3H3L A;  2O14 A;  1QJE A;  4JHZ A;  1OKO A;  2WUH A;  3KCY A;  1UZ0 A;  4R4Z A;  4KU7 A;  1WLW A;  2Y8K A;  4AEM A;  2E6V A;  2Q30 A;  4MLO A;  3UNP A;  4Q4W 3;  5F5I A;  1Q8P A;  3AYE A;  2WQ4 A;  1K3I A;  1BVV A;  2D6L X;  5M0T A;  3ZFG A;  1CVN A;  2HWD 1;  4JCK A;  1W6O A;  1DLL A;  1FI2 A;  1AYM 3;  4IEW A;  4NVP A;  5F3I A;  3T4H B;  1QXR A;  4AI8 A;  4Q29 A;  4QX2 A;  3ZYI B;  1YC6 1;  4QGN A;  4E4D X;  3IBM A;  1XOY A;  1ZVF A;  1FMD 2;  1GNH A;  2PAE A;  3GZU C;  3BPS A;  2UWC A;  2W3J A;  3AYA A;  3U14 A;  1VBE 1;  1SFY A;  2AC1 A;  4GWJ A;  2O8O A;  2XGX A;  4W6X A;  1OSG A;  2PN5 A;  2ZGM A;  5FPV A;  3VBU B;  3FBY A;  4CEW B;  4XQ4 A;  5FMC A;  4FPF A;  2VD7 A;  1D4M 3;  3AP7 A;  2LS6 A;  1QJU 1;  2P2K A;  5FQ0 B;  2DV9 A;  3PNA A;  5JVV A;  2XOM A;  3I2K A;  1CZT A;  5I0S A;  4XDP A;  2VOT A;  2VCC A;  3LOI A;  5FYC A;  4FVV A;  2XJU A;  4MET A;  3USU B;  4DZG A;  5DAB A;  1H4H A;  2ZA9 A;  3WP4 A;  2BBA A;  2I2S A;  3UET A;  1DQ5 A;  2XBO 3;  1DLC A;  4S2F A;  1TQ5 A;  5LA1 A;  1MR5 A;  5CKQ A;  2J1A A;  3U0Z A;  2QQN A;  3HOB A;  3GDB A;  1CZV A;  2JWP A;  4QPG A;  4KNC A;  5IAX A;  3D8C A;  4ITC A;  5FO9 B;  1NCR C;  4QXH A;  4DUV A;  4A6O A;  2JG8 A;  1GZW A;  1JYI A;  2C9K A;  2ILM A;  4IV3 A;  3OEB A;  1OFN A;  5BUV A;  3H0O A;  4NPR A;  1K5J A;  3PJQ A;  2ZGL A;  1UY1 A;  2RR1 1;  2OUH A;  3BGA A;  1BBT 1;  2D3S A;  1K5M C;  4NMI A;  3RZZ A;  4ZHN A;  3SIT A;  3CBN A;  2EXJ A;  4GMP 3;  2C5D A;  4AE2 A;  4BPZ A;  2XML A;  2P4E A;  3I2I A;  4NJ4 A;  2GP5 A;  2ZHL A;  4M3C A;  4XUQ A;  3T2T A;  2FDG A;  4WVM A;  5FRE A;  3WHT A;  4BME A;  5CIS A;  2OKX A;  1REF A;  1ASJ 3;  2V72 A;  3I49 A;  1XNA A;  3JU9 A;  1IHM A;  4U36 A;  5FYH A;  2RS3 3;  1S2B A;  3HNY M;  3HN1 A;  5ACA 3;  1EUT A;  1NXD 1;  2RVA A;  3W9A A;  4AHW A;  3U10 A;  5DUV A;  5HCA A;  2J1T A;  4W6W A;  1W8O A;  1IZ3 A;  5HBA A;  1GFF 2;  5DXD A;  5LBF A;  2HJI A;  4YGE A;  3VBO A;  5LB6 A;  4ET7 A;  4ZZ8 A;  2JKB A;  2IZW A;  2VZT A;  4FTB A;  4H7M A;  3AJZ A;  1RUF 3;  2XJT A;  2UUR A;  2JG9 B;  2C26 A;  2R06 3;  3CU7 A;  4HVQ A;  4RHV 1;  1HRV 1;  4XHB A;  4NR1 A;  4COU A;  4U2A A;  1COV 1;  1QY4 A;  2QQP A;  3B02 A;  3KQR A;  1H2L A;  5ABJ C;  5JMC A;  1V6N A;  4IV1 B;  3LOB A;  2E63 A;  3IDC B;  1H2K A;  2IC1 A;  4E4Z A;  5BNP B;  2W52 A;  2Q1M A;  2PEL A;  3U78 A;  4QU2 A;  1QQP 3;  4CCK A;  1JHN A;  1PO2 2;  4IGO A;  2VCB A;  4FFH A;  4AG4 A;  2DWR A;  2RMU 3;  1VBB 1;  2BJS A;  3VBH A;  4EN8 B;  1ZBA 1;  1HRI 3;  4AXO A;  2FZ1 A;  5T55 A;  3WVJ A;  4PQ9 A;  5CIR A;  1JW6 A;  3ZYG A;  2WO3 A;  3K2O A;  2X53 S;  3POG A;  3CDZ B;  4WBB A;  3R05 A;  1J58 A;  3DXT A;  5JOX A;  2VUC A;  1Z78 A;  2GP3 A;  4MX3 A;  4NHK A;  2Z42 A;  3V0B A;  3NNM A;  4B1M A;  1ND2 B;  1J3P A;  2VMC A;  2Y34 A; 
#chains in the Genus database with same CATH homology
 1SPP A;  3POJ A;  5CIS A;  1NZI A;  3POI A;  1SFP A;  1SPP B;  3POB A;  4LOT A;  4LOR A;  5CKN A;  3KQ4 B;  4LMF A;  3DEM A;  4LOS A;  1NT0 A;  2WNO A;  2QQL A;  2QQK A;  3POE A;  2QQO A;  2QQM A;  4GZ9 A;  3POG A;  3POF A;  1SZB A;  5CKM A;  5CKQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...