2XOMA

Atomic resolution structure of tmcbm61 in complex with beta-1,4- galactotriose
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
145
structure length
145
Chain Sequence
SRNYLKNPGFETGEFSPWRVSGDKKAVKVVKANPSSNAHQGEYAVNFWLDESFSFELSQEVELPAGVYRVGFWTHGEKGVKIALKVSDYGGNERSVEVETTGWLEWKNPEIRNIKVETGRIKITVSVEGRAGDWGFIDDFYLFRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ARABINOGALACTAN ENDO-1,4-BETA-GALACTOSIDASE
publication title Recognition of the Helical Structure of Beta-1,4-Galactan by a New Family of Carbohydrate-Binding Modules.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 36
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2010-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2xomA00
4ARXA 1UMIA 2X10A 3CDZB 1F4AA 3I2HA 5J1XA 2Z4FA 1I5PA 4CU6A 1EUTA 4A3ZA 5IYYA 3ZM8A 3MV01 3T08A 2JKXA 4QB2A 2VO5A 4UAPA 4XZUG 3FHAA 3GM8A 3LPGA 5C71A 2WAAA 3LE0A 4QX2A 2X05A 4RYDA 4E8CA 1JZ3A 2VCCA 4DEQA 5HXMA 2VOTA 2DDUA 1OH4A 1J83A 1NUKA 2J22A 4CUBA 5JMOA 2VL4A 2R7EB 5G04L 3OBAA 3DYMA 4QAWA 3T09A 5JXJA 5DPNA 3I97A 1GUIA 4LQRA 5C7GA 1OT5A 1O59A 3NJVA 2EIBA 3CKHA 4P02B 3WQBA 1UMHA 3CZJA 2JD9A 4BXSV 4LKSA 2Y8KA 3THDA 1BHGA 1JZ4A 2J1VA 4AG4A 2VQUA 1W99A 3FL7A 4JKLA 4XUPA 2VZQA 4JKMA 4MGQA 2C9KA 1UZ0A 4LPLA 4DUWA 5JXIA 4P08A 2WBKA 2WO1A 3I2KA 3C7FA 5IHRA 1W8OA 2ORXA 5JUVA 2BERA 2L9LA 4HG6B 3SEPA 2WZEA 2BGOA 2VZUA 3C8XA 3CZUA 5LA2A 3P6BA 5EIYB 5IFPA 1OF3A 3ECQA 3NQHA 2J1UA 1TG7A 4CUAA 1L7RA 2ZEZA 1XNAA 4PQQA 4Z2AA 4KI5M 4LHSA 3ACIA 1JYWA 4DUXA 2WAOA 2VQTA 4E8DA 5JXHA 2ORZA 2J1EA 4OZOA 3UETA 4D8MA 4CVUA 2QQLA 4BJ0A 2DCKA 2JE8A 3OGRA 2B9VA 3W5NA 3K77A 1K12A 2W91A 1W9WA 3U37A 4QX3A 4OUEA 2WQ8A 4A6OA 3T0DA 2VZVA 1CIYA 4XUTA 4FI9A 1UY4A 3HPNA 1SHWB 3I2IA 1UYXA 3K4ZA 3NNGA 4YPJA 1JHJA 3BN6A 4ARYA 2W1WA 3PUIA 4MOAA 3WEZA 3FN9A 3I2FA 4MGSA 4ET7A 1CZVA 4JHZA 1NAEA 1NX9A 2YC2A 5G05L 2WYSA 2ID4A 1JYNA 1UXXX 5LA0A 3J7HA 1T2XA 3T0AA 2WO3A 1SDDB 1UY1A 2W1QA 2XOMA 4QDQA 3MUZ1 4MADA 3CIHA 3WNOA 5JXGA 1GU3A 3A7QA 1UY0A 5HPOA 2WN3A 3VDAA 1UXZA 3OGVA 5IJRA 3I3DA 2YC4A 3I3EA 3JXSA 4XVHA 2LW8A 2CDPA 1XPWA 3WF1A 2RJ2A 4IUGA 2VMDA 5B4XA 1KGYA 3T2OA 1JU3A 3SKJE 5DMYA 5B4NA 1GOGA 2ZEXA 5I0DA 4D0QA 1J84A 1R64A 3CQOA 2W5FA 3WNNA 2J1TA 1JZ5A 2VTFA 2E32A 4L0PA 3OB8A 1EUUA 3I2JA 4XUNA 2B4KA 3MBWA 3LPFA 2W9XA 3DYOA 2VC9A 2VZRA 2RVAA 2VZTA 2ZEWA 3SEEA 4PF1A 4QX0A 4GWIA 2RV9A 3I3BA 4QDSA 4CU8A 4A42A 1W9TA 3F2ZA 3A22A 2QQOA 2XHNA 2J1SA 1XNTA 3HEIA 2VZ3A 4TTGA 3NJXA 1RYYA 3HOBA 3BGAA 3A21A 4BK5A 3D3AA 3SKVA 1H6XA 2WUHA 2KD7A 2VMCA 2W3JA 4XUQA 3VD5A 1GNYA 3IIIA 1L7QA 2WO2A 2QQKA 2VZSA 2C26A 1W0NA 3MO4A 2J1RA 3VD7A 2E31A 4CU9A 3HN3A 5LCWL 3WNMA 1KEXA 3EB7A 2E33A 1JZ6A 3EYPA 3K46A 5DN2A 4A45A 1O8SA 2Y6LA 3MV11 1NKGA 2VZOA 1LNSA 4AAXA 2YFZA 1ULPA 3NRUA 3VD9A 5C70A 2VZPA 3I2GA 3IAQA 2Y64A 2CDOA 3HNYM 3ACHA 4MO3M 4PT6A 4XURA 2QBXA 4KMQA 2WABA 4DXRA 2V72A 2HYXA 2Y6GA 4JX0A 3A23A 2ZEYA 4P00B 3OGSA 3PUHA 2YG0A 3FHQA 4A41A 2WN2A 3GDBA 4CU7A 2V5DA 3C7HA 2VJXA 4DXTA 2W87A 2YB7A 2BGPA 3ACGA 3ETPA 1US3A 3GXUA 3VDCA 1P8JA 3HNMA 4QX1A 2YFUA 3UESA 4ZZ5A 2W94A 1GQPA 1JYXA 2ZXQA 3OEAA 4RN5A 4GWJA 3WNLA 5LA1A 3WF2A 1IQDC 4W8JA 2Y6KA 3DECA 3OG2A 4W50A 5FUIA 1TVGA 3AC0A 2EIEA 1OD3A 4OMDA 3C7EA 1DYOA 1UWWA 1CZSA 1US2A 4XUOA 5EJ1B 1JZ7A 3CMGA 4KWUA 4DEVA 2EICA 3K75B 3HNBM 4DUVA 1CX1A 4QB1A 1PMHX 3T0BA 1UYZA 2OKXA 3W5MA 1UY2A 2C4XA 3IB3A 4QPWA 2W92A 1JYVA 3K4DA 3WF0A 3LEKA 1GMMA 3IDAA 4ZXEA 4OYUA 2VMEA 3P1IA 3WNPA 3VD3A 2VMFA 3GGLA 1F4HA 2VCAA 1GOHA 3OEBA 4P5YA 1HN1A 1W8NA 4QDRA 2Y6JA 2HLEA 1JI6A 1K3IA 3WNKA 1CZTA 4BDVB 2W1UA 2J7MA 2LS6A 2J1AA 4M4RA 1PX4A 5CZKA 5CYYA 3LEIA 1PMJX 3DYPA 4DXSA 2VZ1A 2XONA 4W4ZA 1WCQA 2W1SA 2DCJA 3IAPA 4A44A 1GOFA 4BK4A 1YQ2A 3LQCA 3VDBA 4M4PA 2E26A 2JDAA 3ACFA 5F7UA 2V4VA 5DQ0A 4QB6A 1MPXA 4ZZ8A 3T2QA 4JKKA 1D7PM 2WDBA 2X09A 1OF4A 3K4AA 2BBAA 1JZ2A 4CUCA 1UX7A 4OMCA 1W9SA 5A1AA 2BZDA 2EIDA 5JR2A 2QQJA 2VCBA 1XC6A 3C7OA 1JU4A 3WF3A 3VD4A 2QQNA 4TXWA 2PQSA 2QQMA 3THCA 3E1F1 3C7GA 5IFTA 1JZ8A 1DP0A 1WKYA 4UOJA 5EJZB 4A4AA 1DLCA 2VR4A 4GZ9A 3WSOA 1PX3A 1SG3A 1H6YA 2Y6HA 3WF4A 3LEGA 2QQIA 1O8PA 2WZ8A 3T2PA 2VM9A 3ABZA 2W46A 3HJRA 3UNPA 1K45A 1UY3A 2W47A 2W95A 2XQXA 3MUY1 4ZY9A 1ULOA 1UYYA 1K42A 4UI9L
chains in the Genus database with same CATH superfamily
2WJSA 2XUEA 1JW6A 2X10A 5ANQA 3CDZB 1F4AA 2FDFA 4KL1A 4F7ZA 1A8DA 1UU6A 1CONA 5BNPC 5J1XA 1AR61 2P2KA 4F83A 2GMEA 2CU5A 5AVPA 5L19A 4B7KA 1I5PA 2CAUA 2E7AA 4CU6A 2UYAA 5K4LA 5I8SA 1TME3 2EAAA 2CWMA 1CX4A 3JCIA 1O3SA 3R6SA 3NV3A 2QCSB 3BU7A 4YW4A 1NXMA 3QACA 3M3CA 4UAPA 3FHAA 3GM8A 2DUOA 5FYSA 1J3RA 1NY72 1VB2A 4JTNA 2PHLA 4EJRA 5A3PA 5C8WA 2BPA2 1UOFA 5D21A 3ZYBA 5DZGA 2NP0A 4QX2A 2X05A 4RYDA 4E8CA 4I3PA 4V2WA 3KLSA 2XWJB 2R6QA 1WLDA 1OH4A 5DAWA 2A6XA 4META 4XOGA 1J83A 3RI8A 2MEV3 4UFKA 1X33A 4HK9A 4PCRA 4QAWA 3T09A 5DUVA 1R1A3 3I97A 3MIFA 4XFAA 1BBT2 4CA9A 4GALA 3USSA 3LF7A 5GLUA 4LLFA 3JU9A 3N35A 3NJVA 5DG1A 1K5MC 2EIBA 3CKHA 3BU0A 3WQ0A 2XWBB 2BV4A 2XBO2 1ZZBA 3QLQA 4E4SA 3VHRA 4NVPA 4AI9A 2FD8A 1CR7A 4A7ZA 3THDA 4FSJA 1QJFA 1PO11 2BFUS 1JZ4A 1NQJA 4LNVA 4AG4A 3O1RA 1NQDA 1W99A 1QJZA 1DHKB 3CF6E 4TN7A 2VZQA 3SITA 4LPLA 3VBRC 1AR92 5JXIA 1CD3G 3ELNA 5FZOB 4XILA 4AEMA 5FYCA 3NSTA 1MR5A 3I2KA 3ZSMA 5DXDA 5JOZA 4UBGA 1W8OA 2GC3A 1BLZA 3FC0A 1R082 4TWTA 5JUVA 3E6DA 1NCRC 5I0UA 4P14A 4HG6B 2SLIA 1HKDA 1BKZA 4QPIC 2VZUA 5A1FA 1DGRA 1TEIA 1KDMA 3ME2A 1V6MA 3ZFGA 3VGIA 2A5ZA 3P6BA 3M3EA 2PTMA 5A3TA 4E4HA 3VN4A 1OF3A 2WSUA 3U14A 1YC61 2MPFA 3USUA 2XB6C 3I54A 3Q8CA 4MZUA 2GN3A 4BQ2A 4YGDA 1RUH3 3UL2A 3U0ZA 4AE2A 4JGYA 3IPVB 2V4AA 3LWCA 2A71A 4RFT0 4CDWC 3E97A 3FBYA 1S0EA 4KG0A 4NRQA 4NR1A 1HJGA 3ZXDA 2I2SA 1KD7A 1RUF2 3UKNA 3ZN5A 4AVAA 5FXZA 4I0WB 4LHSA 4KWJA 1N47A 3U78A 2DVGA 5F3GA 3VL8A 4A7YA 1URXA 1HJFA 2HWC1 3ACIA 4R9DA 4RR3A 5FUNA 4IERA 4M01A 1FMD1 2WAOA 2E6VA 5KXDA 2JG8B 1PGW2 1WCSA 1JYCA 1L7LA 3R4UA 2XPJA 3POYA 1X9TA 4NWVA 3ZR6A 4CEYC 1H8TA 1DGLA 4JAAA 2BP6A 4OQ9A 2D97A 3VUOA 2QNKA 1FNYA 2DCZA 4HXCA 4AI1A 4UF0B 1OFNA 1XRUA 4BJ0A 1AR62 2XJPA 5AC93 3CHXA 3W5NA 1JS9A 2EA7A 3LOBA 4U2AA 1F15A 4KG8A 1QH7A 1JUIA 1ODNA 1S2KA 1V9U1 1ZBA1 2ZX3A 4QX3A 4I01A 4MHUA 3BOPA 3LSEA 3L2YA 1W9FA 3NV2A 2DTYA 2WA4A 1OVSA 1W8TA 4XF4A 5DAQA 4GD4A 3I4IA 5A7SA 5GM0A 1QJX1 4YSFA 3UKTA 2WT1A 3Q8EA 4QPGC 1Q5OA 2NYYA 4EN8B 1MS8A 1YFYA 3NAPA 2XUMA 1DQ5A 1SACA 1T6BX 1N1VA 1UYXA 4AFMA 5C8CA 1MEC3 1ENXA 1GZCA 4LJHA 4NRPA 1ND3A 2CYFA 1CVNA 4YPJA 1JHJA 3H0OA 1RVF1 2B46X 5FZ3A 3GNEA 4ISRA 4COYA 1LOCA 2DCYA 1ACCA 2YPDA 4ONUA 3K51A 1ULCA 5A7WA 3RRDA 5FZDA 4IQPA 1FPN3 2F4PA 2IXHA 1LHUA 1VE0A 1ZZ8A 1EAH3 4N9IA 5IW0A 3LFMA 3WEZA 4G3YC 2ET1A 1BEV3 3H1YA 5FMDA 3WXPA 5LRSA 1CZVA 1CAVA 1ZM1A 2GALA 2K46A 5F5CA 1ENQA 3O0VA 1UD1A 2JE9A 4QX5A 5G05L 3FHIB 4CE8A 1MQTB 3BIEA 4OI4A 1UXXX 3J7HA 4N53A 1H9PA 3OPTA 4AVVA 3BKZA 4XCAA 1NCQB 3O1SA 1PO12 3B69A 1RMU3 4LXLA 1RGSA 3WNOA 5FZAA 5T5OA 4YFZA 1H1MA 4FFFA 5JXGA 2VBPA 4CCLA 1UY0A 1XSRA 3LAGA 3R05A 1LOBA 2WN3A 1TE1B 4AI0A 1B35A 1XNKA 4O9EA 1VBD1 4P9WA 3VDAA 4G9SB 1L3JA 2ZJCA 4PLNA 5KXCA 4YG0A 2E53A 3TYJA 3UV9A 1HV0A 2YC4A 1HB3A 3I3EA 4HN1A 3JXSA 3WHUA 2ZX2A 4IV3C 3ALQA 1DGWA 2CDPA 3KB5A 3TNQA 3BPSA 1XPWA 1OPOA 2QQWA 3AKSA 3S0MA 1R091 1Y9QA 2P6HA 3WF1A 2WWUA 2RJ2A 1H9WA 1PHMA 3KV6A 3MFCA 2GH2A 4B4RA 4ATFA 4DMIA 5B4XA 2OA2A 2W08A 3NMBA 4XJ9A 3OCPA 4A6SA 3U10A 5B4NA 2GZWA 3K3OA 2Q1MA 4KH9A 1MZFA 3VBFC 4LUKA 3EXUA 3KHCA 1B09A 2ZEXA 4AI3A 4E9KA 1ZRDA 1ZREA 1QQP1 2WNVB 2P4EA 2RS53 2WRAA 3MIHA 2JDMA 3NWKA 4IE0A 4L9BA 4Y1UA 1W2TA 2CTVA 2VH9A 4L0PA 2YGLA 3LFIA 1PM7A 3OB8A 2WQ4A 2VY0A 3OTFA 4OHVA 4K21A 2RS11 5HBAA 4CDQC 1WLCA 2HWC2 3ZXJA 1AYM1 1FMD2 4CDUC 1H8VA 2IWGB 4KU8A 1IG0A 3SNMA 1DU3D 4RQPB 1VBA1 2VZRA 5FCCA 5FQ0B 2JIGA 4DQAA 5K0UB 1JYIA 1W8WA 4LBMA 4HK8A 4PF1A 1RUNA 1AJOA 2RV9A 2C9AA 3I3BA 4CU8A 4A42A 4XMIA 2PHUA 5FYBA 2OPWA 1LGBA 4ZHNA 2CGPA 1NLQA 4HVQA 2IUWA 1Y43B 3EBRA 4CYDA 3SCHA 1V9U2 2RR13 1ZBA2 2J1SA 1XNTA 1YFXA 2XL9A 4HLTA 4JVAA 4ZXKA 5T50A 4COWA 5C4WB 3NJXA 1PZ9A 3HOBA 4YNIA 2VTXJ 1CGPA 2XHKA 2OPKA 1CWPA 1QJX2 3D3AA 5LBBA 1LODA 5A3UA 3AMMA 1SQ4A 4AEJA 4XFBA 2VQAA 1IS3A 4BIFA 5D1IA 2WZR1 4K20A 1Q8QA 5FAXA 5KHGA 2YBPA 2QQKA 5FDBA 1PK6B 4HKLA 4GH4B 4LKFA 4DPNA 4XJWA 1OHFA 3KT1A 1RVF2 2E31A 1S0IA 2XJUA 5HCFA 1LRHA 4AVBA 3O1VA 5CKNA 1V6JA 1DGWX 5FXVA 1C8M1 1WW6A 4JGZC 3EYPA 3F95A 3MFAA 1IPKA 5DN2A 5FZOA 4YG6A 3E5XA 4JDNA 1O8SA 3VBHC 4I3GA 3L9JT 4F8AA 5FKBA 3HD8B 1IHMA 3KCCA 5APAA 1DQ4A 4YZ1A 3CJIC 4XJUA 1J59A 1QEXA 1AJKA 3RMXA 1LNSA 4IETA 3LIGA 1AF9A 1ULPA 3R4DB 3VDDC 2B42B 1IZ3A 2CSGA 1CAUB 2YDEA 5D8AC 3A0NA 5AVAA 4QU1A 2HWF3 5FXWA 1O91A 2ZGOA 3ACHA 2PFWA 2FDKA 1FNZA 3AK0A 1C5IA 1GQHA 1GZTA 4JX0A 4CDXC 4AXOA 3FX3A 2ZTNA 5FYTA 3FLRA 1UU5A 3NV4A 1ENRA 2LROA 1VBD2 2R32A 3IPVA 4JC1A 4ZS2A 1J58A 2FDGA 2YG0A 4XW3A 3OGJA 4B8EA 2WT0A 4COUA 2WN2A 3GDBA 4ES9A 1JYTA 1AX1A 4XJAA 2V5DA 1MS5A 4C91A 4QQLA 3B9CA 1R092 2E63A 2JG8A 4ZU5A 3JB4C 1RUOA 1RUJ3 3MICA 3PU8A 3HNMA 2YGMA 4QX1A 5BNQA 2XKOA 1JN2P 1WCUA 1H1IA 1Q3EA 5M0TA 2QE3A 4FFHA 1RL3A 4UF0A 4FPOB 1IS4A 5C3SA 4FAHA 2HEVF 3TAYA 1QQP2 3VKMA 5JZGC 2NZ9A 1GP5A 4GWJA 4N43C 3WNLA 5I91A 4E4DX 1IQDC 1RHI3 4UXAA 5E1RA 3DECA 3OG2A 4Q27A 4BQ3A 2RS12 2PMWB 5FUIA 3WDWA 1TVGA 1LB2A 4H3WA 2WR9A 1LOEA 2PXJA 5FPAA 1AYM2 2Q4SA 3SH3A 3ZFEC 1VBA2 1VBE1 1DBNA 1APNA 4LHNA 4XE9A 1UWWA 1CZSA 1DF0A 5L9RA 5A1LA 4XUOA 2QZ3A 2W68A 1OC1A 1OBNA 4LT5A 4DEVA 1WLWA 2R1BA 1CX1A 4OHYA 1SMVA 1PMHX 3HAGA 3T0BA 3QCWA 1UY2A 5J37A 4FAGA 2W92A 3NL1A 3ZXLA 3ZFFC 1JYVA 1O3RA 3ZYIB 3MPBA 4LBLA 1CJPA 4CCOA 5FRAA 1GMMA 3Q9OA 4IGPA 2Q8DA 2ZOEB 4HOOA 3LD8A 2H0BA 4LBQB 3RZZA 2VG9A 5CBLA 3MYXA 3HMYA 3VL9A 3ZOIA 1HXS1 4D6SA 4QGMA 3MW3A 1MQTA 3KMHA 3L2HA 4N7IA 3GGLA 4A2UA 1QXPA 4HKWA 4P5YA 1F5JA 1H4GA 1NCQA 1W8NA 2WZPP 1XXNA 2WYFA 1RIRA 3GHNA 3N7JA 4XCBA 2D6MA 1QNWA 3NNLA 4ISQA 2ZZQA 4XACA 4LO8A 3M4FA 1G86A 4OUMA 4SBVA 1C8M2 2QVSB 5F5QA 4CCKA 1YQ8A 1SDWA 2R063 1WA6X 2J1AA 3AX4A 1OLME 5FY5A 1LCLA 2ERFA 5CYYA 4XJZA 2HWB3 4Y5Z0 4FP2A 5LB6A 1D2QA 1QU0A 2BVVA 3KF5A 4P9XA 5FZ4A 1C57A 4DOUA 1TME1 2AREA 4ES8A 5BPXA 2QKDA 4CZSA 3RZLA 4QT6A 2PYTA 3S6PA 4ASKA 4RHV3 3VDBA 3LB9A 4M4PA 3N9MA 2W39A 4GMP1 2WIIB 1JODA 2JDAA 2V4VA 2VECA 2ZGQA 3KQRA 1MPXA 2JDHA 1XJAA 4Q0QA 3T2QA 2OS2A 4DS0A 3GBFA 1FYUA 3RZKA 2WNVA 4B29A 1W0PA 3WQ1A 2EXJA 5JDBA 1RUC3 5JMCA 1RTVA 4EYUA 3SQOA 3W20A 4BA6A 1QOOA 1E57A 1UZZA 5FJHA 4LK6A 5IVCA 5JSPA 4LBQD 1K5MB 1W3XA 1XC6A 1RJ8A 3WF3A 5TSWA 4RQPA 2VVFA 4B1LA 2BVBA 2RG4A 4Q5OA 2PQSA 5FQ0A 2QQMA 1R1A1 5K0UA 3ZKYA 1G9AA 4IV1C 2QFEA 5C6CA 3RYRA 2ADEA 4AGRA 3O12A 3VBSC 3C7GA 1QXJA 5ACA1 1X7NA 2P3IA 1IPJA 1REFA 4PIZA 5KHHA 5EJZB 3INAA 3OBZA 3WZ1A 4BYYA 4GZ9A 2J42A 3RZMA 3WSOA 1PX3A 5FWEA 4AVSA 4XQDA 1V6NA 4WZCA 4KU7A 4WVWA 4Q26A 4D69A 2WZ8A 5LBCA 2D7FA 2RHPA 5DG2A 4XFGA 2W46A 1H1AA 2C0ZA 2PAKA 3M2MA 3WDXA 1NCRB 4D7SA 1K45A 2W95A 2XQXA 1VBE2 3EQEA 4IEYA 2DFBA 5FP7A 5KR7A 1VBB3 4QPIB 4QU2A 4XBQA 3I7DA 4UI9L 1NA1C 4XJ8A 1PK6A 5GKAC 4GH4A 4QQPA 3WV6A 4NIGA 2W52A 2Z4FA 1YI7A 1Z7S1 3AFKA 4K7JA 4W6YA 2OZ6A 3WDUA 3NJYA 3N9NA 4CDWB 4XFFA 4FOWA 1N3OA 3MV01 4NHKA 1MS1A 4P9LA 2JG9B 5FZ0A 1AL23 4RS5B 2ZHLA 2UWBA 3LPGA 4EWDA 1HXS2 1REDA 1UU4A 4HFSA 3JD71 4CP1A 4CCCA 5B2GB 1HIXA 3B94A 4HBNA 1BMV1 1UOGA 2WAAA 3B02A 4R52A 3TN91 4AQSA 1OA4A 1ZBE3 1CAUA 4LKDA 4YGEA 4KWLA 1ZRCA 5HXMA 1A3KA 2YY1A 2ZX0A 2VOTA 2DVDA 2Q30A 5L9VA 4IDZA 1PGSA 2LTNA 2R071 1NUKA 1DIWA 4A44A 1UIJA 4QKDA 5JMOA 2YZ4A 1SBFA 3JBG3 2R7EB 4NROA 5BV6A 1COV1 2NMOA 1TZOA 2C5DA 2FDIA 3WD5A 1SLTA 2VNOA 5DPNA 1OOPC 5IAVA 4XF9A 4NAMA 4Q4W3 4Z82A 5CFDB 1O59A 2W2IA 3ETQA 3GCWA 5JSRA 4P9YA 1QIQA 3IDCB 2OYZA 3RMYA 1V6KA 3H8XA 3FJSA 3WQBA 4P02B 4GMP0 4HVRA 4QPGB 2Q8CA 3CZJA 1TME2 4LKSA 2YBKA 4KQ7A 2Y8KA 1BHGA 1I5ZA 5DUXA 4CCDA 4XYXA 1CIWA 2VVEA 3FL7A 1JOJA 1LHWA 2VNVA 4XUPA 2Z79A 4MSVA 3VD9A 4JKMA 4R4ZA 2C9KA 1UZ0A 3KV5A 4NO4A 5FO9B 3P3PA 4YZ2A 1DLLA 3ZMNA 1XBFA 5IWFA 5FOJB 1H2MA 4Q4X1 3POFA 4AGGA 5KWRA 3EHKA 2WC2A 3C2UA 4AHXA 4QD2A 3CO2A 1ZA4A 3AJZA 5J09A 3THTA 4PLMA 5F1RA 3I59B 2BGOA 1X36A 4IEOA 3CZUA 1R1A2 3KQ4B 3R4SA 4YVSC 2SBAA 3O1UA 5A80A 4YGCA 1UZYA 2WFF1 4JHTA 1F5FA 2Q0AA 2VXRA 3KWVA 4PI0A 3KCYA 5FO7B 5IK4A 2G19A 1TG7A 5GALA 5ACA2 1LENA 2B39A 4AFBA 2VTXA 2VVDA 1PVXA 2OUHA 3ILFA 1V6IA 1VBC3 1W6PB 1CN1A 3OPWA 4YVWA 4Z2AA 4KI5M 5GJ6A 5F3EA 1PVC3 3H8UA 4BOWA 2VW2A 2Y60A 5CU1A 1IG3A 4LBQA 5FZ7A 4D7YA 2YPJA 2G1MA 5FZFA 4TZDA 5A3LA 2VQTA 4E8DA 1W6QB 2VQ0A 1XE7A 1CAWB 1UO9A 1LEDA 1OQEA 4IEXA 4ORFA 4D8MA 5JI7A 3UETA 2HEYF 4LOTA 4Q4Y1 4GAZA 1W8ZA 3PL0A 3I49A 3DGTA 3IN9A 2A3YA 3U11A 5F37A 4IEZA 4FOYA 3T1LA 1X8EA 2VW0A 3EMRA 4LBNA 1Z7S2 3AKTA 3POSA 4EN7B 1H2KA 2JKBA 3PU3A 3PLQA 3GZEA 3JQWA 1GZWA 1RXGA 3ZLIA 3J7LA 1OI6A 2FMDA 4MUVA 2CNAA 4H55A 1RC6A 1W8FA 1OUXA 2IXLA 3WUDA 3WUCA 4CDQB 3JD72 1CIYA 4D6QA 4CDUB 1BMV2 1E5IA 3TN92 3WVJA 2DUQA 4Y1YA 2A6YA 3CJXA 2HEWF 1UY4A 3AXDA 4I30A 2ADDA 5FOBB 1VRH1 3NNGA 2PELA 2A6ZA 5CISA 1LEMA 4BK4A 3FWEA 3MIBA 3T4HB 2UWAA 3IMMA 4Q1RA 2R072 2E51A 4PF5A 3MW2A 5FLHA 4ARYA 5CA6A 1COV2 2W1WA 4MG2A 3AM2A 3LZZA 2CHHA 2VOVA 3FN9A 2OQ7A 3ZXEA 4JHZA 4BZ4A 2ZGLA 3I8TA 1Z78A 3ZX7A 4AOCA 1NX9A 3CEWA 2R16A 1K5MA 4V1PA 3ZVXA 2ID4A 4R9BA 3NKTA 4BE3A 5KHKA 1TMF3 5LA0A 3TEZA 2XJSA 3T0AA 4EZHA 1SDDB 4LO5B 1C5HA 3O7OA 4HSJA 4MADA 3J8F3 4LLOA 5SV5A 3A7QA 3R0RA 1A34A 3KD4A 5DDJ3 3TBDA 1QKQA 2ZMKA 5E88A 4B4QA 1PMIA 2EVXA 1CQ9A 2QJVA 4Q4X2 3OGVA 2D43A 3BODA 3JUUA 4EROA 1XE0A 4KGQA 1MS0A 4XVHA 4BQXA 5CG9A 4EN9B 4ASMB 4AZZA 2ZMLA 1JTZX 3LCPA 2DUPA 1NCRA 5LW9A 4YM2A 2HWD1 4QPIA 5I93A 2A3XA 2IVIB 4IUGA 2WFF2 5BNOC 1GWLA 4PLOA 3PMSA 4CUGA 2Z5WA 4XBLA 2HWE1 4I02A 4Y24A 4N8MA 1O4TA 3DV8A 5DMYA 2LRPA 4YZ5A 3PDQA 4UT5A 1PNFA 3V64A 4C8DA 4DNYA 4KGGA 2W5FA 3FUOA 3WNNA 3IMNA 1AR73 2ZX1A 3NNMA 1YXWA 2AH2A 2VTFA 4CDWA 2ZKLA 1W2OA 4XUNA 2JG9A 4AR2A 2B4KA 3N7MA 4RS5A 3ST7A 3B93A 4JRLA 1QJU1 4GB33 2B9UA 4K8FA 4CEWC 3LKJA 2VW1A 3WW4A 2VC9A 4XAAA 1D4M3 4E2SA 3AYEA 3HQXA 2ZEWA 2VOKA 1HLCA 4IEVA 2VMHA 1Y9GA 3RYPA 1AL0G 5GLVA 4Q4Y2 4HSLA 5FY8A 4C90A 4Z8BA 2XL7A 3BPZA 3MZHA 3A22A 4XFIA 4CP9B 1EV11 5F5IA 1RUJ1 5IVFA 2AZ5A 4KWKA 4X8NA 4NMIA 5C3RA 3HEIA 1RUE1 2RMU3 3BGAA 5CFDA 1UOJA 4B4PA 3MF6A 2R041 5DAVA 2JDNA 1H6XA 2W3JA 5GLTA 3J9SA 2JDPA 4QPGA 1UNBA 4XFHA 1SBDA 1VRH2 2WO2A 4WZFA 1M4WA 2C26A 1O4YA 5LRRA 3V0BB 2KXLA 1W0NA 3H1WA 4BH9A 2JD4A 1YWKA 3HN3A 5LK5A 4S2HA 1MACA 3KGLA 3N9LA 2Q1FA 3EB7A 3N36A 4O7XA 4AW7A 5CFCB 1WMFA 4AEDB 3D5OA 3B3QE 2MNGA 4A45A 2XLGA 2FDHA 1OKQA 4LO7A 3H50A 2Y6LA 2VOXA 1WZXA 2VPVA 3MV11 5J7MA 1NKGA 2YC0A 1KS4A 2YFZA 2YV8A 3OUHA 5T55A 4Z07A 3ZFGC 2X5IB 4LA2A 2WNUB 3I2GA 3I59A 5JVVA 4Q1PA 1BXHA 5C70A 2OUJA 1RUD1 2CDOA 4V2VA 3HNYM 1AYN3 4MO3M 3MIEA 4PT6A 4XURA 1ULGA 2RE9A 3ES4A 1LOFC 3PNAA 4KMQA 5CEHA 2WABA 2WS91 4DXRA 2HYXA 4JGYC 4L99A 4NIHA 3ZPOA 2ZEYA 1UZWA 1UW8A 2A73B 4W6WA 5FP8A 1LULA 2RDRA 1W6PA 2BQPA 2DU0A 2GNMA 2VE1A 3H3ZA 4RR3C 4J1WA 5A32B 4QQHA 4QXBA 3AP9A 5LY2A 4N7UA 3ZYGA 3OD0A 3WW3A 4DINB 1YYNA 5JSOA 1GZ9A 1O6UA 2PA7A 3VKOA 3KV4A 4IEWA 4AF9A 1HB1A 4BB3A 3D82A 4DXTA 1W6QA 2YB7A 2HWD2 1ODMA 2A1XA 2ZGPA 1CAWA 2YU2A 2TEPA 2IXCA 1BBT3 4PIYA 3UESA 3UKVA 3DXTA 5JIUA 1GANA 2W94A 1FXZA 2HWE2 2DBIA 3JZVA 4COZA 5KXBA 1POV1 3PTRB 2ZXQA 3OEAA 4RN5A 2WQZC 4LO4B 1EP0A 3IDBB 2LALA 4YM3A 4K8RB 4FVVA 3ZSJA 2Y38A 3WF2A 3V65A 1UF2C 3RQ0A 2Y6KA 3PJQA 2G9ZA 2ZBJA 5FY9A 4W50A 2O0OA 2VUDA 2E7TA 5LZ6A 4UW3A 2FZ1A 1QJU2 4CDQA 2OX0A 2EALA 3AC0A 2EIEA 5CADA 1H30A 3UK9A 1AR93 2YHJA 4CDUA 4Q0UA 1FATA 3RDIA 2BFUL 4KBZA 5C8CC 4AL9A 1AXYA 1US2A 3ZXGA 1SFYA 1LHVA 1ND3C 5CG8A 2BGCA 5EJ1B 5HCAA 4IV1B 3D0JA 3CMGA 3HQUA 2EICA 1UYPA 3ZN6B 2RS31 1H2LA 3ILNA 4WM7B 2IVJA 1R083 2I07B 3W5MA 1EV12 3IB3A 3H1MA 4QPWA 3AP5A 5EJ3A 1RUJ2 3RGBA 1YUDA 2XJQA 1DZQA 3O0WA 3IWZA 5HV0A 4W6XA 3VBUC 2DFCA 1RUE2 3GBWA 3T3YA 5ISLA 4WM8B 2GH8A 3AVSA 4B3NA 3O1MA 2DWRA 4XHBA 1SBEA 2R042 5DAPA 4NPLA 2ZGRA 3AZZA 1EPZA 1WUVA 3KS7A 4OYUA 3P1IA 4PDWB 2VXJA 1W3VA 3DL3A 2V5YA 2ES3A 1HRI1 3OEBA 1J1LA 5L7OB 1SCRA 3N7LA 3RI9A 1RUF3 5JR7B 2VBDA 3D8CA 2CGNA 3A0KA 3K48A 3VKNA 4DFSA 3WP4A 5FYIA 5IUQA 3ZYJB 2WSVA 4CSWA 3WNXA 4R8HA 5BY5A 1K3IA 3VKFC 3WNKA 1Q56A 2BNOA 2FQPA 1W2UA 2W1UA 2J7MA 4XQ4A 1XYOA 3WG2A 4AK3A 2QUOA 1GYKA 1O5LA 1OSGA 4N9HA 2Z2SB 4LTAA 2IXJA 3LEIA 4FPGA 1YIFA 1AR63 1EYBA 2BU9A 1U12A 4LOSA 4XFCA 5C3PA 5L73A 1HB2A 5GZFA 2Y0IA 3GBGA 4OULA 5FPZA 2DBNA 4YW2A 1RUD2 1ZVFA 1AX2A 3LDBA 4L97A 5DZFA 2HBTA 1KITA 1YQ2A 2B45X 5F2WA 5FV3A 1W6MB 3W58A 3LOIA 2WS92 4JTOA 5A70A 2BWAA 2R1DA 1XE8A 1T6GC 2I45A 4FPEA 4YW1A 4Y4RA 4J1XA 3WX5A 1FI2A 4Q0SA 1Q8PA 3DN7A 4AHZA 2PHFA 1LU2A 4JKKA 5KHJA 1FOD1 5JAXA 2X09A 3DPRB 5A3OA 1GFF2 2XDVA 4Y3OA 3K4AA 4OHZA 2BBAA 5BYNA 3SH4A 1OOPB 2PQQA 4PHZA 2G4IA 1UX7A 3BTAA 5F6LB 5JLVA 4GKXA 1VAMA 5FFOC 1AR83 3DEMA 1JU4A 1XQNA 3NW4A 1POV0 3VD4A 4E4ZA 1YRZA 2WINB 1DDLA 2RM21 5FY0A 3NNJA 2VMGA 4TXWA 4RSUA 2P34A 2D93A 5F2SA 1QWRA 2GN7A 4LR4A 3E1F1 3WDTA 4BHPA 5EPAA 3WP3A 1C3HA 1PO21 2A75A 4UFIA 1JZ8A 4ZPIA 4AFDA 4Z1VA 2EXHA 1DP0A 1WKYA 4CP9A 2JEMA 4OLLA 4UOJA 4LULA 1DLCA 1RXFA 2VR4A 4Q0PA 5DUWA 1LHNA 1PIV1 1PO13 1H2NA 4CCJA 3T2PA 3AB0A 4EN0A 5AFBA 1HQNA 1V70A 3ES1A 4EWEA 3GJAA 3HJRA 2YU1A 5FKCA 5LA9A 3SCFA 3BTZA 2W47A 5A7QA 2JB4A 3MUY1 3VBOB 5J36A 3OGGA 4JCKA 4ZY9A 3AZXA 5IHRA 1WW7A 2D5HA 2PAMA 3QBQA 1K42A 4ARXA 3MIGA 5JOXA 3QH6A 2RS32 3V0BA 3B5LB 1UOBA 3ZYPA 4MXWB 5FK8A 3LGRA 1X9PA 5CFCA 1U5YA 5HV4A 1Y9MA 2ZGUA 4A3ZA 1RUG1 5FLIA 4DXZA 2VGDA 4AEDA 3CU7A 3ZM8A 2PHRA 5J98B 3T08A 1ND2C 2JKXA 4FPHA 4PI2A 4QB2A 2VO5A 5F8PA 1UAIA 4XZUG 2EIGA 3H42B 3LA7A 2D3SA 3PVNA 3LE0A 1W06A 1I6XA 1I9RA 2X5IA 1HRI2 2WNUA 2PHDA 3S5QA 4DEQA 4NHXA 1PVC1 4GQ7A 4UBHA 4AAPA 4RGAA 3ORJA 5A7OA 1YQCA 1ZRIA 2DDUA 3TWIA 4QKBA 2HWC3 5E6HA 4H2AA 2ZCWA 4Y20B 2J22A 1FMD3 5K9YA 1TNRA 2XLFA 5G04L 1UL9A 3TEYA 5LK7B 3DYMA 5JXJA 5FZCA 4LQRA 4MVTA 1MZEA 5C7GA 1G9BA 4PIXA 5L9BA 1LGNA 3PUQA 5C9AB 5A32A 1ZRRA 3KV9A 1WMEA 3IDEA 1JXNA 1V9U3 1SZBA 2VUJA 1ZBA3 1QHDA 2WZR2 1GICA 4JDOA 2F17A 5ABJC 3NV1A 1HRV1 3U75A 2GNDA 3GJBA 3OBTA 2J1VA 4X8PA 4O9GA 2Y33A 3VV1A 1QJX3 4QX7A 1PGL1 3KCXA 4XXPA 5GZGA 1SFNA 3OBRA 5BNPB 1DQ6A 2HYKA 4P9IA 3U4SA 4RFRB 2VUCA 3CLPA 4NUBA 4BU2A 2WBKA 4IGOA 1FOD2 3U1XA 3UT0A 1Y7BA 2HKXA 4AQ6A 2O8OA 1J1TA 4J25A 3C7FA 2GP3A 2PLV3 4IESA 2EXKA 3AL5A 3RS6A 1RVF3 4XTMA 3AKQA 5F32A 2WNOA 3GCXA 3ON7A 5F3IA 5FUPA 3POBA 5H9PA 5C3QA 2RM22 1QJY3 1V0AA 3C8XA 2LM3A 5EYYA 4XXAA 4AI2A 1V00A 5J3UA 2Q1ZB 3VHNA 4DB5A 3O1PA 3ZN6A 5GZCA 5IFPA 1DZRA 1PO22 1S0GA 4M3CF 3ZXAC 3ECQA 3NQHA 3AP4A 3FZ3A 4WM7A 2J1UA 4FTBA 1GLHA 1ALYA 3ITQA 4H7MA 1WGPA 4TLFA 4CUAA 3HBZA 1MVQA 3UJOA 2ZEZA 1SLAA 1UZVA 3PJYA 3H3LA 4J6GA 4PQQA 3UGFA 1PIV2 4WM8A 1LR5A 3AXEA 4QGLA 1MQTC 3WW1A 5EWSA 4L2NA 1JYWA 1JOPA 2MEV1 1KDKA 2VCMA 3H9AA 3I2OA 1J3PA 4PDWA 3M70A 4UFLA 3O0XA 3ZSEA 1VBD3 4ATEA 2J1EA 2VU9A 5L7OA 4OZOA 4OI0A 1SFPA 4QKNA 2GMMA 3J4UH 3HWJA 4FPCA 4KNCA 2QQLA 4S2DA 3T2TA 5BNOB 3B01A 1KXGA 1ULFA 5EYXA 5C5UA 2DCKA 5A7NA 4HKOA 2NM1A 2Z69A 2WFPA 3OGRA 4E27A 2B9VA 2YROA 4MX3A 1K12A 4HPKB 1Q8OA 1R093 4FPFA 4IEPA 1W9WA 2EF6A 1RUG2 1BZWA 3DF0A 2XH6A 3U37A 3VBRB 5LBEA 2ETEA 3POIA 3AP7A 3J26N 4OUEA 5T5LA 2WQ8A 5C4WA 3PURA 3BTYA 2P37A 2IFWA 3LSDA 3GZTB 2JJ6A 4OCTA 1Q43A 4CEWB 1QQP3 1AR71 4FI9A 4FPKA 4D3WA 2G9GA 3ZIWA 3ZXKA 1IGOA 2JDZA 5H9RA 3I2IA 2BNNA 2BTVC 2V09A 1PVC2 2RS13 1W6MA 5KXEA 3OUIA 2ENRA 4CXYA 3BN6A 1AYM3 2RJKA 2WNVC 3FLTA 3O1TA 3T30A 4CPBD 1VBA3 2HBUA 2KM2A 2TBVA 4S2FA 4LBKA 5FBZA 1ZRFA 5FZ8A 3DPRA 4L11A 5GLZA 2FZ2A 3I2FA 1ASJ3 2ZHNA 3PTYA 4NIIA 1OOPA 4ET7A 1I1EA 2UYBA 4RGKA 3WP5A 2YC2A 4GWNA 4E2QA 1JYNA 1GQGA 1RUH1 2VNGA 2XR4A 3HN1A 4GA9A 3WLUA 3RZJA 1YQ6A 5JPNB 1Z0HA 2R0FA 1IS5A 1UY1A 1FAYA 2W1QA 2XOMA 1DZTA 3IZOA 3ZXFA 1HRV2 2ZGNA 3H7JA 4CEYB 1GNZA 5FYMA 4BM8A 2V73A 1PGL2 4IL7A 1GU3A 1WMDA 2IZWA 1YFUA 5EXOA 4NJ4A 5CB7A 2ZA9A 4XAEA 2CV6A 2Y0OA 3I2DA 5IATA 2XMLA 4EN6B 1ENSA 3HVDA 5IJRA 4AFAA 3I3DA 2CAVA 3D4KA 5IAXA 4UW4A 5JI9A 2XVGA 2BRTA 1HB4A 1TQ5A 3WDVA 3LA3A 5AC91 4Y1VA 4R9AA 1KJRA 2C24A 4AVCA 1C8M3 2BEOA 2CL2A 3VBOA 3AKRA 3DKWA 5FZ6A 2AC1A 4GH4C 3N9OA 1S1AA 2VMDA 3N9PA 4FQ4A 5FYZA 3T2OA 3LIHA 1GOGA 1SLLA 4QXKA 4AWDA 4MXWA 5I0DA 4D0QA 1R64A 1IKPA 3CQOA 4X6RB 1MS4A 4EWAA 1YIPA 4U36A 5IVBA 3KGZA 1POQA 1AYN1 1TNFA 2E32A 2KA3A 2WT2A 1EUUA 1MEC1 1RUI3 2P1BA 5J96B 1ONAA 4I09A 5JWPA 2KR2A 4TSVA 2Q5TA 4MHRA 2MEV2 2ZGSA 1BVVA 5JOWA 2FBEA 2DCTA 4XTPA 1S0CA 3DYOA 3WCRA 2VZTA 1FPN1 2RVAA 3K2OA 1ULEA 2WNEA 1VMHA 4PJYA 2NPIA 1EAH1 3HR9A 3POWA 2FHRA 1BEV1 4GWIA 3URFA 3B9IA 3QD6A 4QDSA 2HH9A 2A6WA 1X82A 4JDMA 2JDYA 2C6SA 2PAEA 1JMUB 4Y20A 3DUIA 3O5SA 4XPVA 4GWMA 2Q8EA 3ZDSA 1X50A 4RD7A 2BYVE 2C1FA 3E5QA 3PMEA 2D44A 3A4UA 4Y22B 1SCSA 4TTGA 1JOBA 3IKWA 1RYYA 4BQ5A 1U5XA 4XC9A 3UJQA 1RMU1 2XQRA 1Q8SA 5GZDA 5C9AA 5LY1A 1OUSA 2K9ZA 5JCTA 3H8OA 2WUHA 3RWNA 2KD7A 5FMOS 2VMCA 4IV3B 4XUQA 3X29B 1GNYA 2DU1A 2QQVA 1DYKA 1JBCA 4ZONA 5E16A 4DZGA 2ZGMA 3VHPA 4DY3A 4MGTA 4OHXA 2VZSA 4DY5A 2D6KA 3MO4A 4FPJA 2J1RA 4IXLA 4Z2WA 3VD7A 1WBLA 4CU9A 4NRMA 3IBMA 5LCWL 3WNMA 5CKQA 5BNPA 3VBFB 5FWJA 5AFEA 4I0AA 4OZXA 3BTXA 3VBUB 4FXGB 4D6RA 5KBFA 1KRIA 1S2EA 4Q4V3 1DQ1A 1RUH2 1HDKA 3FUQA 2ZMNA 2RS51 4YW6A 4QQOA 1WW4A 2ZHKA 3GZUC 4XDQA 5IT6A 4K9SA 2XLAA 4Y1ZA 3B00A 4YLZA 1R1ZA 2BOJA 3FLPA 4B7EA 4E2GA 2V72A 2Y6GA 2GC1A 2QDRA 4GIQA 3A23A 5EP9A 1HXS3 2G9FA 3TRSB 2ET7A 1YFWA 4M3CE 3ZPYA 2JWPA 4CPBA 4M0HA 1W39A 5BNNC 2BOIA 4BISA 1LOGA 4D7TA 4YVWC 2JDUA 1NE4A 3HT1A 1IKQA 2YUEA 1DGRN 2JXAA 4NPRA 3OGSA 3PUHA 4FOQA 2O8QA 3ZN4A 3BYWA 3KHBA 2ARCA 4JRAA 4MGKE 3MEPA 5AC92 5IK7A 3KM5A 4MGYE 1YJLA 2GU9A 4BPZA 2AACA 3AMQA 2VJXA 1NZCA 2BGPA 3ETPA 4FPYA 1US3A 3AYCA 3GXUA 3W21A 2RR11 1P8JA 1QJEA 3W9AA 3PVEA 4BXFA 4XETA 3BALA 2VNRA 3APBA 3AVRA 5I8TA 3OF1A 4ZZ5A 3S57A 5BNOA 1GQPA 3P3NA 5FP9A 5FIXA 3SMHA 5F3CA 4XDPA 2ATFA 4K3UA 5FYVA 5FR3A 4HPKA 5LA1A 4CRQA 1WMXA 3VBRA 4Q8LA 2X29A 1AYN2 2ZACA 1OA2A 1N1YA 4JGZB 5A6YA 1MEC2 1UPSA 1QOTA 4DRVA 4XZPA 3VBHB 2ARXA 5J48A 1OFSA 2FCVA 2NLRA 4GMP3 3CJIB 4CCEA 5FYUA 2UY9A 4OMDA 4YFWA 1FPN2 3OPZA 4HVOA 3VDDB 4CEWA 1EAH2 1F31A 3Q8BA 5FZ9A 5D8AB 1JZ7A 3KSCA 1NOVA 1BEV2 4KWUA 4CCNA 2UU8A 3IM0A 3HNBM 4MLOA 4DUVA 3GHMA 4QB1A 2VULA 1AR81 2A70A 1GKBA 1OLMA 1JH5A 4UW6A 4CDXB 1D4VB 2C4XA 3MPPG 3RJRA 5FPXA 4L92A 2MHFA 1OURA 3K4DA 1NLRA 3N7KA 3WF0A 4WVVA 3SHRA 1HN0A 2B8MA 2HWF1 5A6XA 1F2NA 3IDAA 4NPMA 5FXXA 1RMU2 4XMAA 5CIRA 5HCBA 1BCXA 3ATGA 4ZXEA 4A3XA 2P3JA 5ACA3 3WNPA 4M3CB 4P9GA 3HQRA 2OXBA 2PHWA 3BOWA 2VMFA 3QH7A 2OQ6A 1F4HA 1YEWA 2VCAA 1C1FA 2A7AA 1ZZ6A 2IFRA 1HN1A 1OLQA 4QDRA 4LA3A 4CEYA 5JIAA 4B1MA 3J7MA 3VZOA 2AGSA 2N7GA 1UIKA 4KBBA 5HXVA 2HLEA 2ZHMA 3RZGA 4LE3A 3Q8FA 3WOGA 1CZTA 1ZNPA 1QXRA 2QTWB 5FZKA 4IEUA 4BDVB 3M3QA 3VZJA 5JZGB 4N43B 3KT7A 5FMOL 5F6KA 2YXSA 5A6ZA 3MDPA 3WCSA 1LGCA 1E5HA 1ND2B 1BVP1 3H7YA 4AYUA 4BQ1A 4IE6A 3WG1A 1PMJX 4IE5A 3DYPA 3M8LA 5L36A 1Z7S3 4GULA 5IVYA 4AVTA 1OKOA 2AYHA 1WCQA 1LHOA 2P3YA 3BVCA 4QM9A 5FP4A 2RS52 5FPUA 2OT7A 2D40A 3ZFEB 4BQ4A 5KC5A 3V0AB 1SEFA 3IAPA 1W04A 2DVAA 1UQXA 3CNAA 3J7NA 1RHI1 4FO9A 5FZGA 5A7PA 2ZABA 4AI8A 1GP4A 4MYEA 5H9QA 2AEYA 4O65A 2E26A 1LOFA 3M7AA 2VUAA 1NT0A 2K0GA 3ACFA 3MGUA 4LITA 3JD73 5DQ0A 5FZHA 5F7UA 5FTTC 5T5PA 3ZYRA 4O61A 3TN93 4Y5TA 3S7IA 1H0BA 1D7PM 4LO6B 5C5TA 5I8YA 2WDBA 3ZFFB 2XJTA 5ANNA 2JG9C 1YJKA 3H8RA 2AUYA 2UY8A 4RS5C 1AXZA 1STMA 1JZ2A 2P6CA 2ILMA 3AJYA 5T52A 5LBFA 1H4HA 1GSLA 1W9SA 2BZDA 1VAKA 2QQJA 2R073 2VCBA 1SPPB 3BB6A 2GC0A 3C7OA 5HCHA 1COV3 4OUSA 2RR12 3DXUA 4PBOA 4Z92B 4Q0VA 2GNTA 4NAOA 3ILRA 3B7MA 4LUMA 4XHXA 4NE9A 5ABJB 4QXCA 2I74A 2BWCA 5DUUA 5IFTA 3N4MA 4K1YA 3BCWA 3PIGA 4YRDA 2D6LX 2P5BA 2OVUA 4C0BA 5EHDA 3TEWA 4P5HA 4LIVA 4XF3A 1SG3A 1LESA 3MIDA 4UYBA 5CFDC 2GDFA 1YQ5A 2Y6HA 4NIAA 4Y22A 1CESA 4DIQA 4RA0A 5FZMA 2QQIA 1O8PA 1OMIA 1RINA 2B5HA 2WO7A 4IE7A 1O5UA 3ABZA 4YZ4A 1VRBA 4CTEA 4AQTA 2XVLA 4IV3A 1UY3A 3IIAA 4WVMB 2WWJA 3MLKA 4ASLA 4Q4X3 4GJZA 1H8TC 3FFQA 5E8AA 1UMIA 2R061 2PLV1 3FMGA 3I2HA 3OJBA 1MVEA 2HWB1 4H7LA 1AR82 3PUSA 4HN0A 1UKRA 3PHMA 1BQPA 4FP3A 3AZYA 1U0AA 1QJY1 2XBO3 3DKQA 3VBFA 1EUTA 1VALA 2BNMA 3SXWA 5IYYA 3NKGA 2CWSA 4MGZE 2HWF2 5CKMA 1LJ7A 4C1XA 2QQPA 1D0HA 3VBUA 1CPNA 2WFF3 1YI9A 4IEQA 1W2NA 1S0JA 2AR6A 4RHV1 2DF7A 3UGGA 1QH6A 1EPWA 2LUWA 2GP5A 3OSDA 5C71A 3NAPC 3MHZA 2JENA 3S7EA 4FTEA 4BLIA 4FXKB 4GKYA 3DCQA 2ZKNA 2ZS6B 1JZ3A 1CJDA 2D3RA 2VCCA 3OYWB 1N1TA 1RUC1 5FPBA 1W8UA 4HANA 2BUKA 1G7YA 5LATA 4YW5A 3RJ2X 3VBSB 2X53S 2JDKA 1O3QA 4CUBA 2IC1A 2VL4A 5FY4A 3OBAA 3SC7X 1BJQA 1D0GA 1VJ2A 4RL7A 1NZIA 4ITCA 5IK8A 3FFZA 1GUIA 4Q4Y3 4FFGA 1OT5A 1S4CA 2D6PA 4XABA 4WV8A 1A8MA 2JECA 1DYPA 3FE5A 4NHMA 2DTWA 4UFMA 4N53C 1C1LA 1U5IA 1UMHA 2JE7A 2ZAAA 3GYDA 1UKGA 1G6NA 2JD9A 4BXSV 3Q8AA 4L8QA 5IVEA 1AXKA 4NWWA 2D3PA 3LDRA 1AZDA 1RHI2 1VIWB 4MH0E 4FBFA 1UX6A 3ZR5A 3AFGA 3RPQA 1W28A 3WW2A 1NA1B 2WKKA 3TNPB 4C1WA 2VQUA 3ZSKA 4JKLA 2WWSA 4MGQA 1B35C 1S2BA 1S0DA 3RVHA 4DUWA 4QHBA 1YCIA 4P08A 3UYJA 5FYHA 1VBB1 1VR3A 4M0NA 5ERLA 4UFJA 2WO1A 2EXIA 1VRH3 4JGZA 2DV9A 5FZBA 3VBHA 1OQ1A 2ORXA 4YYOA 2AENA 1GP6A 4Y33A 5H9SA 2BERA 2R0HA 2L9LA 3CJIA 3SEPA 3M3OA 2RDSA 2WZEA 4QHZA 4YW3A 4BQYA 4EZ4A 4WBBA 4Y26A 5LA2A 3VDDA 3SISA 1ASJ1 2XG3A 3KT4A 5D8AA 5EIYB 1AL21 1SLBA 4N90A 1F9KA 3PUAA 3U07A 3E5UA 5K7PA 3ZKUA 1OQDA 5FY7A 1GWMA 3N3HA 1GWKA 3ENRA 3FBMA 4LHKA 4CDXA 2P3KA 1KFUL 3WY6A 1L7RA 2Y34A 1U5ZA 1ZBE1 1XNAA 4HONA 4LKEA 3TEXA 2Q8OA 1HQWA 5LWBA 1FT9A 1UPIA 1ZZ9A 3POEA 4CXXA 1UMZA 4DUXA 4YM0A 2WLQA 3JBG1 4M3CA 4X6QB 4UFHA 5FBJA 3HBKA 2RDQA 5JXHA 2ORZA 1N3PA 5EZWA 3VZKA 2EAKA 4CVUA 2R062 2PLV2 4Q4W1 1WD4A 2YBSA 3AMPA 4FCAA 4LIUA 5HI0A 2HWB2 5EQUA 1YO8A 2JE8A 2Y26A 2VAUA 4TLGA 3ZIXA 3K77A 4FQZA 1QJY2 3GF6A 4Q2FA 2W91A 2HWD3 1S55A 4XQWA 3AL6A 3CBNA 2A6VA 3HIFA 4CP2A 5JZGA 1E5RA 4N43A 3D0SA 1F35A 1VAVA 3NNFA 4XIOA 4RHV2 4A6OA 1G9CA 3T0DA 2HWE3 2GAUA 1ND2A 2VZVA 2X8KA 5I0TA 2IXIA 2O14A 4P9JA 5F39A 3ROUA 3BUCA 4UWDA 4XUTA 2D6OX 4F3JA 3WT3A 3ZFEA 4YGBA 3V0AA 3HPNA 1SHWB 1RUI1 1RUC2 1W6NB 2DVBA 1WD3A 3K4ZA 4YVSB 4CCMA 3HT2A 4HZFA 1W6OB 3I3QA 5IK5A 4UW5A 4NN0A 1FV2A 4XEZA 3OY8B 3LDKA 1XNCA 1QJU3 2O1QA 4XBNA 4HT1T 5DABA 1OVPA 2XJVA 2UURA 3RYKA 1XYPA 3WR0A 1G9FA 2TNFA 3PUIA 3SLIA 1CAXB 3VKLA 2ZGKA 3ZFFA 4MOAA 4EV0A 5FYYA 2OZJA 5A33B 4G4FA 4MGSA 1DG6A 4MGIE 4BMEA 1OD5A 1NAEA 2CGOA 2WYSA 3LEMA 1N1SA 1SPPA 1EV13 4LORA 4K1ZA 1T2XA 4D94A 1XU2A 2WO3A 1VBC1 2H0VA 3AMHA 1LKNA 1RUE3 5I0RA 1LECA 2F4LA 2XJRA 3MUZ1 3POGA 3CIHA 4QDQA 5ABJA 2BJSA 3ZO0B 2R043 2JX9A 3VZMA 1XU1A 4AQ2A 5HPOA 1MS3A 1A6CA 1N3QA 1VMJA 1VBB2 5F5AA 4OI2A 5A6QA 1UXZA 5SV8A 2RJLA 1XYNA 1DQ2A 4QGNA 2PHTA 2E7QA 2QZ2A 5A3MA 1J3QA 2H6CA 2XKPA 2QDNA 2LW8A 4BWOA 1D2SA 4JQRA 1KQRA 4FT8A 2JG8C 4EE2A 1G9DA 4WVMA 1LAJA 4YWAA 4XIKA 2WLPA 1WCKA 4LMFA 1ASJ2 1YHFA 4Y1XA 1HW5A 2BBVA 2OIIA 1KGYA 1AL22 1JU3A 1X8MA 4Q4V1 5LASA 3SKJE 5FK7A 2VD7A 5FJKA 1WA4A 4AFCA 5CFCC 3M1HA 2ZGTA 1J84A 3PIJA 4RGGA 4BIOA 5CVRA 4OFGA 4AEDC 5BNNB 5LEJA 2J1TA 1ZBE2 3T4VA 4FOVA 4YVWB 1RUD3 1JZ5A 4MXVA 1SLIA 4R9CA 2DVFA 4HL0A 4QXHA 2ZX4A 1XOYA 1ZX5A 1O4ZA 3I2JA 2CY6A 2WS93 3MBWA 3LPFA 3MI8A 1IOAA 4PQ9A 3P5BA 2X5IC 2WNUC 3JBG2 2W9XA 1PNGA 3VB9A 3D6EA 3G7DA 3ZSLA 3OUJA 3POJA 1NXD1 4JZRA 3SEEA 3OYWA 4QX0A 4Q4W2 3W59A 3AP6A 4IV1A 2ARAA 3ASIA 1C28A 3EJKA 1W9TA 1EY2A 3F2ZA 4S2GA 3VBSA 2JB8A 3GZAA 5KHIA 2QQOA 1TMF1 1GZWB 2TUNA 4R4XA 3ZDVA 2A3WA 2XHNA 1QNYA 2VZ3A 4GXLA 4ZU7A 5FPVA 2ARBA 3VZNA 1AHSA 1ZZCA 2DURA 3J8F1 3A21A 5FMBA 5GZEA 1POV3 4BK5A 5CNAA 3SKVA 3VD5A 3CL1A 2RDNA 5DDJ1 1W2AX 3S5AA 1IQAA 3IIIA 4WVZA 2E9QA 2P17A 3KZ4C 1NCQC 5FLJA 1L7QA 4I2OA 4OQ8A 2AEZA 1FV3A 1KJLA 1RUI2 1JHNA 1NA1A 1AVBA 4AHWA 4BCUA 1LTEA 2GNBA 2B7YA 3S30A 4BQWA 1SLCA 1Y3TA 2Z42A 4OHWA 4HETA 1KEXA 3U4XA 4CP0A 3AZVA 2E33A 1JZ6A 2BDRA 4IGQA 3K46A 1ZYBA 3SCGA 1I3HA 3ZYHA 2RS33 1AX0A 1OH3A 2D6NA 2VZOA 5IVVA 4AAXA 3NRUA 3OD4A 4YW7A 2VZPA 3IAQA 1VBC2 2Y64A 1WW5A 3EO6A 5T3NA 3N9QA 5A3NA 2QBXA 4NIDA 1WBFA 4LK7A 2ZZJA 4WM7C 3WP6A 1OPMA 3PVOA 3VLBB 1QY4A 4YARA 3PVBB 1NE6A 1RJ7A 4GB31 2VBBA 4QPYA 3VZLA 3KVAA 1D4M1 2W0XA 1HRI3 4W65A 4P00B 4WM8C 5FZIA 3VHOA 5T5JA 3BIWE 4YM1A 3WDYA 1QGLA 1VPHA 1GR3A 3FHQA 4AHYA 4DO0A 3KF3A 1AUYA 3UGHA 4PDWC 1NG0A 4A41A 1LU1A 1PZ8A 4CU7A 2GSYA 1NLSA 4RQPC 3C7HA 1QF3A 1YLLA 5L7OC 2W87A 3VDCA 3ACGA 5C3OA 2UWCA 2YYOA 1Q8VA 4URTA 5K0UC 5LEKA 2R30A 5I0SA 3C3VA 4INDA 3RWKX 2YFUA 1VP6A 2RMU1 3KVBA 4Q4V2 1MZ6A 5C33A 5FY1A 3SH5A 4IW3A 4DRRA 1JYXA 1BYHA 3JQXA 1PZ7A 1XSQA 4AEKA 1DQ0A 1M06G 2OW4A 4Q29A 4NHYA 3NJZA 4XF1A 2D98A 5C4WC 2DYCA 2WZR3 1VMFA 5CAZA 1W05A 3NVCA 4W8JA 2QQUA 3O1OA 1IPSA 3AKPA 3M3IA 3NO8A 3LA2A 4FPLA 5E89A 4CXWA 5FMCA 1OD3A 1W90A 3C7EA 2GC2A 1XB9A 1VLNA 2GMPA 5FREA 1DYOA 2FDJA 5JPMB 1FOD3 1G8WA 1V6LA 2XXZA 3ZFGB 4LHLA 1WWYA 4QWNA 4OVEA 2D5FA 4ZU4A 1S0FA 3IT8A 1PK6C 1W6NA 4YVSA 3K75B 3V56A 1W6OA 3AZWA 4GJYA 3TB0A 3USUB 1GNHA 1LOAA 1ULDA 2ZAHA 1UYZA 3OY8A 3E6BA 4K40A 2OKXA 3WQ7A 4XF0A 1TMF2 2NMNA 4JGYB 1REEA 2RM23 3DPRC 5BXXA 3AYDA 3AMNA 3LEKA 1IS6A 3I3MA 1QOSA 1CAXA 1WLTA 2WL1A 5FZLA 5A33A 3J8F2 4LBJA 3OOXA 1PO23 4FFIA 4RR3B 1O3TA 3BI3A 4IE4A 1NY71 4JV4A 5JOYA 5T54A 2VMEA 5DDJ2 1HX6A 3T1MA 3RZHA 2PN5A 3H3UA 3VD3A 3JB8A 4Y4YA 3RFRA 4A7KA 1DCSA 2XVKA 1GV9A 1K5JA 4QKFA 2F6BA 1GOHA 5EFUA 3THPA 4BLJA 1H8TB 1ZA7A 3ACLA 5GLWA 4ZS3A 1PIV3 4Y5SA 2IXKA 4I0BA 4EQVA 2NN8A 2Y6FA 2Y6JA 3AYAA 4LEJA 5FO8B 1OA3A 3RSJA 1JI6A 4TYSA 1MS9A 4SLIA 1Y4WA 2H6BA 2PHXA 1W03A 4OI1A 3MF9A 4M00A 2LS6A 3E6CC 1BBT1 2K2SA 4M4RA 1PX4A 5CZKA 1W0OA 4ZKTB 1VB4A 1RITA 2FCTA 4DXSA 2VZ1A 3VBOC 2XONA 1NYWA 2XBO1 3NAPB 2R49A 4QQ2A 4W4ZA 5KC6A 3RG0A 1KS5A 1QDCA 1V6OA 1AR72 1WCDJ 1RUG3 2W1SA 1KFXL 3WINE 2DCJA 4FTSA 4LE4A 5C8CB 1GOFA 4COVA 1O7FA 2FMYA 1E5SA 1ND3B 5EV7A 1C8NA 1W9YA 2YMZA 3LQCA 1HV1A 1OLRA 1XNBA 4LBOA 1RB8G 3G6JB 5DZEA 4GB32 5A7WB 1QMJA 1ZZ7A 4QB6A 4ZZ8A 1A78A 1AR91 1OXCA 3ZYFA 1XNDA 5BNNA 1D4M2 1VBE3 3QOPA 1CPMA 1OF4A 4QX8A 3RNSA 3WG3A 4C0HA 4AGVA 4CUCA 1ST8A 1UCXA 1YNAA 1CAVB 4QHOA 4BMBA 1S0BA 4OMCA 4K6BA 5A1AA 2EIDA 5JR2A 1BK1A 1R081 5FP3A 2NQYA 1W8HA 4XDOA 4N53B 1BK0A 5FZ1A 4HMZA 1FX5A 3MLJA 1DFQA 2QQNA 5K8SA 2FCUA 3MW4A 3MLLA 3THCA 2RMU2 1HQLA 4H14A 2JIJA 5A3WA 3WHTA 4JQTA 3TOJA 2VOWA 1PM4A 1UN1A 1B35B 2JICA 2HJIA 2WA3A 5D2AA 4A4AA 3K3NA 2XGXA 1QDOA 5F9TA 1H6YA 1JUHA 5IVJA 4NHLA 4QM8A 3WF4A 3LEGA 5C9AC 1HRV3 1RUF1 4NOTA 2VMIA 2BW8A 4PBPA 5BUVA 3WG4A 3GALA 1MZ5A 2VM9A 1F8VA 4YG3A 3O14A 3ZMOA 5FPLA 3UNPA 1GBGA 2ZPXA 1PGW1 4QMAA 4YZ3A 4URAA 1ULOA 4Q8KA 1UYYA 4MV2A 1C4RA 5DAXA 5FZEA
chains in the Genus database with same CATH topology
4ARXA 1UMIA 2X10A 3CDZB 1F4AA 3I2HA 5J1XA 2Z4FA 1I5PA 4CU6A 1EUTA 4A3ZA 5IYYA 3ZM8A 3MV01 3T08A 2JKXA 4QB2A 2VO5A 4UAPA 4XZUG 3FHAA 3GM8A 3LPGA 5C71A 2WAAA 3LE0A 4QX2A 2X05A 4RYDA 4E8CA 1JZ3A 2VCCA 4DEQA 5HXMA 2VOTA 2DDUA 1OH4A 1J83A 1NUKA 2J22A 4CUBA 5JMOA 2VL4A 2R7EB 5G04L 3OBAA 3DYMA 4QAWA 3T09A 5JXJA 5DPNA 3I97A 1GUIA 4LQRA 5C7GA 1OT5A 1O59A 3NJVA 2EIBA 3CKHA 4P02B 3WQBA 1UMHA 3CZJA 2JD9A 4BXSV 4LKSA 2Y8KA 3THDA 1BHGA 1JZ4A 2J1VA 4AG4A 2VQUA 1W99A 3FL7A 4JKLA 4XUPA 2VZQA 4JKMA 4MGQA 2C9KA 1UZ0A 4LPLA 4DUWA 5JXIA 4P08A 2WBKA 2WO1A 3I2KA 3C7FA 5IHRA 1W8OA 2ORXA 5JUVA 2BERA 2L9LA 4HG6B 3SEPA 2WZEA 2BGOA 2VZUA 3C8XA 3CZUA 5LA2A 3P6BA 5EIYB 5IFPA 1OF3A 3ECQA 3NQHA 2J1UA 1TG7A 4CUAA 1L7RA 2ZEZA 1XNAA 4PQQA 4Z2AA 4KI5M 4LHSA 3ACIA 1JYWA 4DUXA 2WAOA 2VQTA 4E8DA 5JXHA 2ORZA 2J1EA 4OZOA 3UETA 4D8MA 4CVUA 2QQLA 4BJ0A 2DCKA 2JE8A 3OGRA 2B9VA 3W5NA 3K77A 1K12A 2W91A 1W9WA 3U37A 4QX3A 4OUEA 2WQ8A 4A6OA 3T0DA 2VZVA 1CIYA 4XUTA 4FI9A 1UY4A 3HPNA 1SHWB 3I2IA 1UYXA 3K4ZA 3NNGA 4YPJA 1JHJA 3BN6A 4ARYA 2W1WA 3PUIA 4MOAA 3WEZA 3FN9A 3I2FA 4MGSA 4ET7A 1CZVA 4JHZA 1NAEA 1NX9A 2YC2A 5G05L 2WYSA 2ID4A 1JYNA 1UXXX 5LA0A 3J7HA 1T2XA 3T0AA 2WO3A 1SDDB 1UY1A 2W1QA 2XOMA 4QDQA 3MUZ1 4MADA 3CIHA 3WNOA 5JXGA 1GU3A 3A7QA 1UY0A 5HPOA 2WN3A 3VDAA 1UXZA 3OGVA 5IJRA 3I3DA 2YC4A 3I3EA 3JXSA 4XVHA 2LW8A 2CDPA 1XPWA 3WF1A 2RJ2A 4IUGA 2VMDA 5B4XA 1KGYA 3T2OA 1JU3A 3SKJE 5DMYA 5B4NA 1GOGA 2ZEXA 5I0DA 4D0QA 1J84A 1R64A 3CQOA 2W5FA 3WNNA 2J1TA 1JZ5A 2VTFA 2E32A 4L0PA 3OB8A 1EUUA 3I2JA 4XUNA 2B4KA 3MBWA 3LPFA 2W9XA 3DYOA 2VC9A 2VZRA 2RVAA 2VZTA 2ZEWA 3SEEA 4PF1A 4QX0A 4GWIA 2RV9A 3I3BA 4QDSA 4CU8A 4A42A 1W9TA 3F2ZA 3A22A 2QQOA 2XHNA 2J1SA 1XNTA 3HEIA 2VZ3A 4TTGA 3NJXA 1RYYA 3HOBA 3BGAA 3A21A 4BK5A 3D3AA 3SKVA 1H6XA 2WUHA 2KD7A 2VMCA 2W3JA 4XUQA 3VD5A 1GNYA 3IIIA 1L7QA 2WO2A 2QQKA 2VZSA 2C26A 1W0NA 3MO4A 2J1RA 3VD7A 2E31A 4CU9A 3HN3A 5LCWL 3WNMA 1KEXA 3EB7A 2E33A 1JZ6A 3EYPA 3K46A 5DN2A 4A45A 1O8SA 2Y6LA 3MV11 1NKGA 2VZOA 1LNSA 4AAXA 2YFZA 1ULPA 3NRUA 3VD9A 5C70A 2VZPA 3I2GA 3IAQA 2Y64A 2CDOA 3HNYM 3ACHA 4MO3M 4PT6A 4XURA 2QBXA 4KMQA 2WABA 4DXRA 2V72A 2HYXA 2Y6GA 4JX0A 3A23A 2ZEYA 4P00B 3OGSA 3PUHA 2YG0A 3FHQA 4A41A 2WN2A 3GDBA 4CU7A 2V5DA 3C7HA 2VJXA 4DXTA 2W87A 2YB7A 2BGPA 3ACGA 3ETPA 1US3A 3GXUA 3VDCA 1P8JA 3HNMA 4QX1A 2YFUA 3UESA 4ZZ5A 2W94A 1GQPA 1JYXA 2ZXQA 3OEAA 4RN5A 4GWJA 3WNLA 5LA1A 3WF2A 1IQDC 4W8JA 2Y6KA 3DECA 3OG2A 4W50A 5FUIA 1TVGA 3AC0A 2EIEA 1OD3A 4OMDA 3C7EA 1DYOA 1UWWA 1CZSA 1US2A 4XUOA 5EJ1B 1JZ7A 3CMGA 4KWUA 4DEVA 2EICA 3K75B 3HNBM 4DUVA 1CX1A 4QB1A 1PMHX 3T0BA 1UYZA 2OKXA 3W5MA 1UY2A 2C4XA 3IB3A 4QPWA 2W92A 1JYVA 3K4DA 3WF0A 3LEKA 1GMMA 3IDAA 4ZXEA 4OYUA 2VMEA 3P1IA 3WNPA 3VD3A 2VMFA 3GGLA 1F4HA 2VCAA 1GOHA 3OEBA 4P5YA 1HN1A 1W8NA 4QDRA 2Y6JA 2HLEA 1JI6A 1K3IA 3WNKA 1CZTA 4BDVB 2W1UA 2J7MA 2LS6A 2J1AA 4M4RA 1PX4A 5CZKA 5CYYA 3LEIA 1PMJX 3DYPA 4DXSA 2VZ1A 2XONA 4W4ZA 1WCQA 2W1SA 2DCJA 3IAPA 4A44A 1GOFA 4BK4A 1YQ2A 3LQCA 3VDBA 4M4PA 2E26A 2JDAA 3ACFA 5F7UA 2V4VA 5DQ0A 4QB6A 1MPXA 4ZZ8A 3T2QA 4JKKA 1D7PM 2WDBA 2X09A 1OF4A 3K4AA 2BBAA 1JZ2A 4CUCA 1UX7A 4OMCA 1W9SA 5A1AA 2BZDA 2EIDA 5JR2A 2QQJA 2VCBA 1XC6A 3C7OA 1JU4A 3WF3A 3VD4A 2QQNA 4TXWA 2PQSA 2QQMA 3THCA 3E1F1 3C7GA 5IFTA 1JZ8A 1DP0A 1WKYA 4UOJA 5EJZB 4A4AA 1DLCA 2VR4A 4GZ9A 3WSOA 1PX3A 1SG3A 1H6YA 2Y6HA 3WF4A 3LEGA 2QQIA 1O8PA 2WZ8A 3T2PA 2VM9A 3ABZA 2W46A 3HJRA 3UNPA 1K45A 1UY3A 2W47A 2W95A 2XQXA 3MUY1 4ZY9A 1ULOA 1UYYA 1K42A 4UI9L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ARX A;  1UMI A;  2X10 A;  3CDZ B;  1F4A A;  3I2H A;  5J1X A;  2Z4F A;  1I5P A;  4CU6 A;  1EUT A;  4A3Z A;  5IYY A;  3ZM8 A;  3MV0 1;  3T08 A;  2JKX A;  4QB2 A;  2VO5 A;  4UAP A;  4XZU G;  3FHA A;  3GM8 A;  3LPG A;  5C71 A;  2WAA A;  3LE0 A;  4QX2 A;  2X05 A;  4RYD A;  4E8C A;  1JZ3 A;  2VCC A;  4DEQ A;  5HXM A;  2VOT A;  2DDU A;  1OH4 A;  1J83 A;  1NUK A;  2J22 A;  4CUB A;  5JMO A;  2VL4 A;  2R7E B;  5G04 L;  3OBA A;  3DYM A;  4QAW A;  3T09 A;  5JXJ A;  5DPN A;  3I97 A;  1GUI A;  4LQR A;  5C7G A;  1OT5 A;  1O59 A;  3NJV A;  2EIB A;  3CKH A;  4P02 B;  3WQB A;  1UMH A;  3CZJ A;  2JD9 A;  4BXS V;  4LKS A;  2Y8K A;  3THD A;  1BHG A;  1JZ4 A;  2J1V A;  4AG4 A;  2VQU A;  1W99 A;  3FL7 A;  4JKL A;  4XUP A;  2VZQ A;  4JKM A;  4MGQ A;  2C9K A;  1UZ0 A;  4LPL A;  4DUW A;  5JXI A;  4P08 A;  2WBK A;  2WO1 A;  3I2K A;  3C7F A;  5IHR A;  1W8O A;  2ORX A;  5JUV A;  2BER A;  2L9L A;  4HG6 B;  3SEP A;  2WZE A;  2BGO A;  2VZU A;  3C8X A;  3CZU A;  5LA2 A;  3P6B A;  5EIY B;  5IFP A;  1OF3 A;  3ECQ A;  3NQH A;  2J1U A;  1TG7 A;  4CUA A;  1L7R A;  2ZEZ A;  1XNA A;  4PQQ A;  4Z2A A;  4KI5 M;  4LHS A;  3ACI A;  1JYW A;  4DUX A;  2WAO A;  2VQT A;  4E8D A;  5JXH A;  2ORZ A;  2J1E A;  4OZO A;  3UET A;  4D8M A;  4CVU A;  2QQL A;  4BJ0 A;  2DCK A;  2JE8 A;  3OGR A;  2B9V A;  3W5N A;  3K77 A;  1K12 A;  2W91 A;  1W9W A;  3U37 A;  4QX3 A;  4OUE A;  2WQ8 A;  4A6O A;  3T0D A;  2VZV A;  1CIY A;  4XUT A;  4FI9 A;  1UY4 A;  3HPN A;  1SHW B;  3I2I A;  1UYX A;  3K4Z A;  3NNG A;  4YPJ A;  1JHJ A;  3BN6 A;  4ARY A;  2W1W A;  3PUI A;  4MOA A;  3WEZ A;  3FN9 A;  3I2F A;  4MGS A;  4ET7 A;  1CZV A;  4JHZ A;  1NAE A;  1NX9 A;  2YC2 A;  5G05 L;  2WYS A;  2ID4 A;  1JYN A;  1UXX X;  5LA0 A;  3J7H A;  1T2X A;  3T0A A;  2WO3 A;  1SDD B;  1UY1 A;  2W1Q A;  2XOM A;  4QDQ A;  3MUZ 1;  4MAD A;  3CIH A;  3WNO A;  5JXG A;  1GU3 A;  3A7Q A;  1UY0 A;  5HPO A;  2WN3 A;  3VDA A;  1UXZ A;  3OGV A;  5IJR A;  3I3D A;  2YC4 A;  3I3E A;  3JXS A;  4XVH A;  2LW8 A;  2CDP A;  1XPW A;  3WF1 A;  2RJ2 A;  4IUG A;  2VMD A;  5B4X A;  1KGY A;  3T2O A;  1JU3 A;  3SKJ E;  5DMY A;  5B4N A;  1GOG A;  2ZEX A;  5I0D A;  4D0Q A;  1J84 A;  1R64 A;  3CQO A;  2W5F A;  3WNN A;  2J1T A;  1JZ5 A;  2VTF A;  2E32 A;  4L0P A;  3OB8 A;  1EUU A;  3I2J A;  4XUN A;  2B4K A;  3MBW A;  3LPF A;  2W9X A;  3DYO A;  2VC9 A;  2VZR A;  2RVA A;  2VZT A;  2ZEW A;  3SEE A;  4PF1 A;  4QX0 A;  4GWI A;  2RV9 A;  3I3B A;  4QDS A;  4CU8 A;  4A42 A;  1W9T A;  3F2Z A;  3A22 A;  2QQO A;  2XHN A;  2J1S A;  1XNT A;  3HEI A;  2VZ3 A;  4TTG A;  3NJX A;  1RYY A;  3HOB A;  3BGA A;  3A21 A;  4BK5 A;  3D3A A;  3SKV A;  1H6X A;  2WUH A;  2KD7 A;  2VMC A;  2W3J A;  4XUQ A;  3VD5 A;  1GNY A;  3III A;  1L7Q A;  2WO2 A;  2QQK A;  2VZS A;  2C26 A;  1W0N A;  3MO4 A;  2J1R A;  3VD7 A;  2E31 A;  4CU9 A;  3HN3 A;  5LCW L;  3WNM A;  1KEX A;  3EB7 A;  2E33 A;  1JZ6 A;  3EYP A;  3K46 A;  5DN2 A;  4A45 A;  1O8S A;  2Y6L A;  3MV1 1;  1NKG A;  2VZO A;  1LNS A;  4AAX A;  2YFZ A;  1ULP A;  3NRU A;  3VD9 A;  5C70 A;  2VZP A;  3I2G A;  3IAQ A;  2Y64 A;  2CDO A;  3HNY M;  3ACH A;  4MO3 M;  4PT6 A;  4XUR A;  2QBX A;  4KMQ A;  2WAB A;  4DXR A;  2V72 A;  2HYX A;  2Y6G A;  4JX0 A;  3A23 A;  2ZEY A;  4P00 B;  3OGS A;  3PUH A;  2YG0 A;  3FHQ A;  4A41 A;  2WN2 A;  3GDB A;  4CU7 A;  2V5D A;  3C7H A;  2VJX A;  4DXT A;  2W87 A;  2YB7 A;  2BGP A;  3ACG A;  3ETP A;  1US3 A;  3GXU A;  3VDC A;  1P8J A;  3HNM A;  4QX1 A;  2YFU A;  3UES A;  4ZZ5 A;  2W94 A;  1GQP A;  1JYX A;  2ZXQ A;  3OEA A;  4RN5 A;  4GWJ A;  3WNL A;  5LA1 A;  3WF2 A;  1IQD C;  4W8J A;  2Y6K A;  3DEC A;  3OG2 A;  4W50 A;  5FUI A;  1TVG A;  3AC0 A;  2EIE A;  1OD3 A;  4OMD A;  3C7E A;  1DYO A;  1UWW A;  1CZS A;  1US2 A;  4XUO A;  5EJ1 B;  1JZ7 A;  3CMG A;  4KWU A;  4DEV A;  2EIC A;  3K75 B;  3HNB M;  4DUV A;  1CX1 A;  4QB1 A;  1PMH X;  3T0B A;  1UYZ A;  2OKX A;  3W5M A;  1UY2 A;  2C4X A;  3IB3 A;  4QPW A;  2W92 A;  1JYV A;  3K4D A;  3WF0 A;  3LEK A;  1GMM A;  3IDA A;  4ZXE A;  4OYU A;  2VME A;  3P1I A;  3WNP A;  3VD3 A;  2VMF A;  3GGL A;  1F4H A;  2VCA A;  1GOH A;  3OEB A;  4P5Y A;  1HN1 A;  1W8N A;  4QDR A;  2Y6J A;  2HLE A;  1JI6 A;  1K3I A;  3WNK A;  1CZT A;  4BDV B;  2W1U A;  2J7M A;  2LS6 A;  2J1A A;  4M4R A;  1PX4 A;  5CZK A;  5CYY A;  3LEI A;  1PMJ X;  3DYP A;  4DXS A;  2VZ1 A;  2XON A;  4W4Z A;  1WCQ A;  2W1S A;  2DCJ A;  3IAP A;  4A44 A;  1GOF A;  4BK4 A;  1YQ2 A;  3LQC A;  3VDB A;  4M4P A;  2E26 A;  2JDA A;  3ACF A;  5F7U A;  2V4V A;  5DQ0 A;  4QB6 A;  1MPX A;  4ZZ8 A;  3T2Q A;  4JKK A;  1D7P M;  2WDB A;  2X09 A;  1OF4 A;  3K4A A;  2BBA A;  1JZ2 A;  4CUC A;  1UX7 A;  4OMC A;  1W9S A;  5A1A A;  2BZD A;  2EID A;  5JR2 A;  2QQJ A;  2VCB A;  1XC6 A;  3C7O A;  1JU4 A;  3WF3 A;  3VD4 A;  2QQN A;  4TXW A;  2PQS A;  2QQM A;  3THC A;  3E1F 1;  3C7G A;  5IFT A;  1JZ8 A;  1DP0 A;  1WKY A;  4UOJ A;  5EJZ B;  4A4A A;  1DLC A;  2VR4 A;  4GZ9 A;  3WSO A;  1PX3 A;  1SG3 A;  1H6Y A;  2Y6H A;  3WF4 A;  3LEG A;  2QQI A;  1O8P A;  2WZ8 A;  3T2P A;  2VM9 A;  3ABZ A;  2W46 A;  3HJR A;  3UNP A;  1K45 A;  1UY3 A;  2W47 A;  2W95 A;  2XQX A;  3MUY 1;  4ZY9 A;  1ULO A;  1UYY A;  1K42 A;  4UI9 L; 
#chains in the Genus database with same CATH topology
 2WJS A;  2XUE A;  1JW6 A;  2X10 A;  5ANQ A;  3CDZ B;  1F4A A;  2FDF A;  4KL1 A;  4F7Z A;  1A8D A;  1UU6 A;  1CON A;  5BNP C;  5J1X A;  1AR6 1;  2P2K A;  4F83 A;  2GME A;  2CU5 A;  5AVP A;  5L19 A;  4B7K A;  1I5P A;  2CAU A;  2E7A A;  4CU6 A;  2UYA A;  5K4L A;  5I8S A;  1TME 3;  2EAA A;  2CWM A;  1CX4 A;  3JCI A;  1O3S A;  3R6S A;  3NV3 A;  2QCS B;  3BU7 A;  4YW4 A;  1NXM A;  3QAC A;  3M3C A;  4UAP A;  3FHA A;  3GM8 A;  2DUO A;  5FYS A;  1J3R A;  1NY7 2;  1VB2 A;  4JTN A;  2PHL A;  4EJR A;  5A3P A;  5C8W A;  2BPA 2;  1UOF A;  5D21 A;  3ZYB A;  5DZG A;  2NP0 A;  4QX2 A;  2X05 A;  4RYD A;  4E8C A;  4I3P A;  4V2W A;  3KLS A;  2XWJ B;  2R6Q A;  1WLD A;  1OH4 A;  5DAW A;  2A6X A;  4MET A;  4XOG A;  1J83 A;  3RI8 A;  2MEV 3;  4UFK A;  1X33 A;  4HK9 A;  4PCR A;  4QAW A;  3T09 A;  5DUV A;  1R1A 3;  3I97 A;  3MIF A;  4XFA A;  1BBT 2;  4CA9 A;  4GAL A;  3USS A;  3LF7 A;  5GLU A;  4LLF A;  3JU9 A;  3N35 A;  3NJV A;  5DG1 A;  1K5M C;  2EIB A;  3CKH A;  3BU0 A;  3WQ0 A;  2XWB B;  2BV4 A;  2XBO 2;  1ZZB A;  3QLQ A;  4E4S A;  3VHR A;  4NVP A;  4AI9 A;  2FD8 A;  1CR7 A;  4A7Z A;  3THD A;  4FSJ A;  1QJF A;  1PO1 1;  2BFU S;  1JZ4 A;  1NQJ A;  4LNV A;  4AG4 A;  3O1R A;  1NQD A;  1W99 A;  1QJZ A;  1DHK B;  3CF6 E;  4TN7 A;  2VZQ A;  3SIT A;  4LPL A;  3VBR C;  1AR9 2;  5JXI A;  1CD3 G;  3ELN A;  5FZO B;  4XIL A;  4AEM A;  5FYC A;  3NST A;  1MR5 A;  3I2K A;  3ZSM A;  5DXD A;  5JOZ A;  4UBG A;  1W8O A;  2GC3 A;  1BLZ A;  3FC0 A;  1R08 2;  4TWT A;  5JUV A;  3E6D A;  1NCR C;  5I0U A;  4P14 A;  4HG6 B;  2SLI A;  1HKD A;  1BKZ A;  4QPI C;  2VZU A;  5A1F A;  1DGR A;  1TEI A;  1KDM A;  3ME2 A;  1V6M A;  3ZFG A;  3VGI A;  2A5Z A;  3P6B A;  3M3E A;  2PTM A;  5A3T A;  4E4H A;  3VN4 A;  1OF3 A;  2WSU A;  3U14 A;  1YC6 1;  2MPF A;  3USU A;  2XB6 C;  3I54 A;  3Q8C A;  4MZU A;  2GN3 A;  4BQ2 A;  4YGD A;  1RUH 3;  3UL2 A;  3U0Z A;  4AE2 A;  4JGY A;  3IPV B;  2V4A A;  3LWC A;  2A71 A;  4RFT 0;  4CDW C;  3E97 A;  3FBY A;  1S0E A;  4KG0 A;  4NRQ A;  4NR1 A;  1HJG A;  3ZXD A;  2I2S A;  1KD7 A;  1RUF 2;  3UKN A;  3ZN5 A;  4AVA A;  5FXZ A;  4I0W B;  4LHS A;  4KWJ A;  1N47 A;  3U78 A;  2DVG A;  5F3G A;  3VL8 A;  4A7Y A;  1URX A;  1HJF A;  2HWC 1;  3ACI A;  4R9D A;  4RR3 A;  5FUN A;  4IER A;  4M01 A;  1FMD 1;  2WAO A;  2E6V A;  5KXD A;  2JG8 B;  1PGW 2;  1WCS A;  1JYC A;  1L7L A;  3R4U A;  2XPJ A;  3POY A;  1X9T A;  4NWV A;  3ZR6 A;  4CEY C;  1H8T A;  1DGL A;  4JAA A;  2BP6 A;  4OQ9 A;  2D97 A;  3VUO A;  2QNK A;  1FNY A;  2DCZ A;  4HXC A;  4AI1 A;  4UF0 B;  1OFN A;  1XRU A;  4BJ0 A;  1AR6 2;  2XJP A;  5AC9 3;  3CHX A;  3W5N A;  1JS9 A;  2EA7 A;  3LOB A;  4U2A A;  1F15 A;  4KG8 A;  1QH7 A;  1JUI A;  1ODN A;  1S2K A;  1V9U 1;  1ZBA 1;  2ZX3 A;  4QX3 A;  4I01 A;  4MHU A;  3BOP A;  3LSE A;  3L2Y A;  1W9F A;  3NV2 A;  2DTY A;  2WA4 A;  1OVS A;  1W8T A;  4XF4 A;  5DAQ A;  4GD4 A;  3I4I A;  5A7S A;  5GM0 A;  1QJX 1;  4YSF A;  3UKT A;  2WT1 A;  3Q8E A;  4QPG C;  1Q5O A;  2NYY A;  4EN8 B;  1MS8 A;  1YFY A;  3NAP A;  2XUM A;  1DQ5 A;  1SAC A;  1T6B X;  1N1V A;  1UYX A;  4AFM A;  5C8C A;  1MEC 3;  1ENX A;  1GZC A;  4LJH A;  4NRP A;  1ND3 A;  2CYF A;  1CVN A;  4YPJ A;  1JHJ A;  3H0O A;  1RVF 1;  2B46 X;  5FZ3 A;  3GNE A;  4ISR A;  4COY A;  1LOC A;  2DCY A;  1ACC A;  2YPD A;  4ONU A;  3K51 A;  1ULC A;  5A7W A;  3RRD A;  5FZD A;  4IQP A;  1FPN 3;  2F4P A;  2IXH A;  1LHU A;  1VE0 A;  1ZZ8 A;  1EAH 3;  4N9I A;  5IW0 A;  3LFM A;  3WEZ A;  4G3Y C;  2ET1 A;  1BEV 3;  3H1Y A;  5FMD A;  3WXP A;  5LRS A;  1CZV A;  1CAV A;  1ZM1 A;  2GAL A;  2K46 A;  5F5C A;  1ENQ A;  3O0V A;  1UD1 A;  2JE9 A;  4QX5 A;  5G05 L;  3FHI B;  4CE8 A;  1MQT B;  3BIE A;  4OI4 A;  1UXX X;  3J7H A;  4N53 A;  1H9P A;  3OPT A;  4AVV A;  3BKZ A;  4XCA A;  1NCQ B;  3O1S A;  1PO1 2;  3B69 A;  1RMU 3;  4LXL A;  1RGS A;  3WNO A;  5FZA A;  5T5O A;  4YFZ A;  1H1M A;  4FFF A;  5JXG A;  2VBP A;  4CCL A;  1UY0 A;  1XSR A;  3LAG A;  3R05 A;  1LOB A;  2WN3 A;  1TE1 B;  4AI0 A;  1B35 A;  1XNK A;  4O9E A;  1VBD 1;  4P9W A;  3VDA A;  4G9S B;  1L3J A;  2ZJC A;  4PLN A;  5KXC A;  4YG0 A;  2E53 A;  3TYJ A;  3UV9 A;  1HV0 A;  2YC4 A;  1HB3 A;  3I3E A;  4HN1 A;  3JXS A;  3WHU A;  2ZX2 A;  4IV3 C;  3ALQ A;  1DGW A;  2CDP A;  3KB5 A;  3TNQ A;  3BPS A;  1XPW A;  1OPO A;  2QQW A;  3AKS A;  3S0M A;  1R09 1;  1Y9Q A;  2P6H A;  3WF1 A;  2WWU A;  2RJ2 A;  1H9W A;  1PHM A;  3KV6 A;  3MFC A;  2GH2 A;  4B4R A;  4ATF A;  4DMI A;  5B4X A;  2OA2 A;  2W08 A;  3NMB A;  4XJ9 A;  3OCP A;  4A6S A;  3U10 A;  5B4N A;  2GZW A;  3K3O A;  2Q1M A;  4KH9 A;  1MZF A;  3VBF C;  4LUK A;  3EXU A;  3KHC A;  1B09 A;  2ZEX A;  4AI3 A;  4E9K A;  1ZRD A;  1ZRE A;  1QQP 1;  2WNV B;  2P4E A;  2RS5 3;  2WRA A;  3MIH A;  2JDM A;  3NWK A;  4IE0 A;  4L9B A;  4Y1U A;  1W2T A;  2CTV A;  2VH9 A;  4L0P A;  2YGL A;  3LFI A;  1PM7 A;  3OB8 A;  2WQ4 A;  2VY0 A;  3OTF A;  4OHV A;  4K21 A;  2RS1 1;  5HBA A;  4CDQ C;  1WLC A;  2HWC 2;  3ZXJ A;  1AYM 1;  1FMD 2;  4CDU C;  1H8V A;  2IWG B;  4KU8 A;  1IG0 A;  3SNM A;  1DU3 D;  4RQP B;  1VBA 1;  2VZR A;  5FCC A;  5FQ0 B;  2JIG A;  4DQA A;  5K0U B;  1JYI A;  1W8W A;  4LBM A;  4HK8 A;  4PF1 A;  1RUN A;  1AJO A;  2RV9 A;  2C9A A;  3I3B A;  4CU8 A;  4A42 A;  4XMI A;  2PHU A;  5FYB A;  2OPW A;  1LGB A;  4ZHN A;  2CGP A;  1NLQ A;  4HVQ A;  2IUW A;  1Y43 B;  3EBR A;  4CYD A;  3SCH A;  1V9U 2;  2RR1 3;  1ZBA 2;  2J1S A;  1XNT A;  1YFX A;  2XL9 A;  4HLT A;  4JVA A;  4ZXK A;  5T50 A;  4COW A;  5C4W B;  3NJX A;  1PZ9 A;  3HOB A;  4YNI A;  2VTX J;  1CGP A;  2XHK A;  2OPK A;  1CWP A;  1QJX 2;  3D3A A;  5LBB A;  1LOD A;  5A3U A;  3AMM A;  1SQ4 A;  4AEJ A;  4XFB A;  2VQA A;  1IS3 A;  4BIF A;  5D1I A;  2WZR 1;  4K20 A;  1Q8Q A;  5FAX A;  5KHG A;  2YBP A;  2QQK A;  5FDB A;  1PK6 B;  4HKL A;  4GH4 B;  4LKF A;  4DPN A;  4XJW A;  1OHF A;  3KT1 A;  1RVF 2;  2E31 A;  1S0I A;  2XJU A;  5HCF A;  1LRH A;  4AVB A;  3O1V A;  5CKN A;  1V6J A;  1DGW X;  5FXV A;  1C8M 1;  1WW6 A;  4JGZ C;  3EYP A;  3F95 A;  3MFA A;  1IPK A;  5DN2 A;  5FZO A;  4YG6 A;  3E5X A;  4JDN A;  1O8S A;  3VBH C;  4I3G A;  3L9J T;  4F8A A;  5FKB A;  3HD8 B;  1IHM A;  3KCC A;  5APA A;  1DQ4 A;  4YZ1 A;  3CJI C;  4XJU A;  1J59 A;  1QEX A;  1AJK A;  3RMX A;  1LNS A;  4IET A;  3LIG A;  1AF9 A;  1ULP A;  3R4D B;  3VDD C;  2B42 B;  1IZ3 A;  2CSG A;  1CAU B;  2YDE A;  5D8A C;  3A0N A;  5AVA A;  4QU1 A;  2HWF 3;  5FXW A;  1O91 A;  2ZGO A;  3ACH A;  2PFW A;  2FDK A;  1FNZ A;  3AK0 A;  1C5I A;  1GQH A;  1GZT A;  4JX0 A;  4CDX C;  4AXO A;  3FX3 A;  2ZTN A;  5FYT A;  3FLR A;  1UU5 A;  3NV4 A;  1ENR A;  2LRO A;  1VBD 2;  2R32 A;  3IPV A;  4JC1 A;  4ZS2 A;  1J58 A;  2FDG A;  2YG0 A;  4XW3 A;  3OGJ A;  4B8E A;  2WT0 A;  4COU A;  2WN2 A;  3GDB A;  4ES9 A;  1JYT A;  1AX1 A;  4XJA A;  2V5D A;  1MS5 A;  4C91 A;  4QQL A;  3B9C A;  1R09 2;  2E63 A;  2JG8 A;  4ZU5 A;  3JB4 C;  1RUO A;  1RUJ 3;  3MIC A;  3PU8 A;  3HNM A;  2YGM A;  4QX1 A;  5BNQ A;  2XKO A;  1JN2 P;  1WCU A;  1H1I A;  1Q3E A;  5M0T A;  2QE3 A;  4FFH A;  1RL3 A;  4UF0 A;  4FPO B;  1IS4 A;  5C3S A;  4FAH A;  2HEV F;  3TAY A;  1QQP 2;  3VKM A;  5JZG C;  2NZ9 A;  1GP5 A;  4GWJ A;  4N43 C;  3WNL A;  5I91 A;  4E4D X;  1IQD C;  1RHI 3;  4UXA A;  5E1R A;  3DEC A;  3OG2 A;  4Q27 A;  4BQ3 A;  2RS1 2;  2PMW B;  5FUI A;  3WDW A;  1TVG A;  1LB2 A;  4H3W A;  2WR9 A;  1LOE A;  2PXJ A;  5FPA A;  1AYM 2;  2Q4S A;  3SH3 A;  3ZFE C;  1VBA 2;  1VBE 1;  1DBN A;  1APN A;  4LHN A;  4XE9 A;  1UWW A;  1CZS A;  1DF0 A;  5L9R A;  5A1L A;  4XUO A;  2QZ3 A;  2W68 A;  1OC1 A;  1OBN A;  4LT5 A;  4DEV A;  1WLW A;  2R1B A;  1CX1 A;  4OHY A;  1SMV A;  1PMH X;  3HAG A;  3T0B A;  3QCW A;  1UY2 A;  5J37 A;  4FAG A;  2W92 A;  3NL1 A;  3ZXL A;  3ZFF C;  1JYV A;  1O3R A;  3ZYI B;  3MPB A;  4LBL A;  1CJP A;  4CCO A;  5FRA A;  1GMM A;  3Q9O A;  4IGP A;  2Q8D A;  2ZOE B;  4HOO A;  3LD8 A;  2H0B A;  4LBQ B;  3RZZ A;  2VG9 A;  5CBL A;  3MYX A;  3HMY A;  3VL9 A;  3ZOI A;  1HXS 1;  4D6S A;  4QGM A;  3MW3 A;  1MQT A;  3KMH A;  3L2H A;  4N7I A;  3GGL A;  4A2U A;  1QXP A;  4HKW A;  4P5Y A;  1F5J A;  1H4G A;  1NCQ A;  1W8N A;  2WZP P;  1XXN A;  2WYF A;  1RIR A;  3GHN A;  3N7J A;  4XCB A;  2D6M A;  1QNW A;  3NNL A;  4ISQ A;  2ZZQ A;  4XAC A;  4LO8 A;  3M4F A;  1G86 A;  4OUM A;  4SBV A;  1C8M 2;  2QVS B;  5F5Q A;  4CCK A;  1YQ8 A;  1SDW A;  2R06 3;  1WA6 X;  2J1A A;  3AX4 A;  1OLM E;  5FY5 A;  1LCL A;  2ERF A;  5CYY A;  4XJZ A;  2HWB 3;  4Y5Z 0;  4FP2 A;  5LB6 A;  1D2Q A;  1QU0 A;  2BVV A;  3KF5 A;  4P9X A;  5FZ4 A;  1C57 A;  4DOU A;  1TME 1;  2ARE A;  4ES8 A;  5BPX A;  2QKD A;  4CZS A;  3RZL A;  4QT6 A;  2PYT A;  3S6P A;  4ASK A;  4RHV 3;  3VDB A;  3LB9 A;  4M4P A;  3N9M A;  2W39 A;  4GMP 1;  2WII B;  1JOD A;  2JDA A;  2V4V A;  2VEC A;  2ZGQ A;  3KQR A;  1MPX A;  2JDH A;  1XJA A;  4Q0Q A;  3T2Q A;  2OS2 A;  4DS0 A;  3GBF A;  1FYU A;  3RZK A;  2WNV A;  4B29 A;  1W0P A;  3WQ1 A;  2EXJ A;  5JDB A;  1RUC 3;  5JMC A;  1RTV A;  4EYU A;  3SQO A;  3W20 A;  4BA6 A;  1QOO A;  1E57 A;  1UZZ A;  5FJH A;  4LK6 A;  5IVC A;  5JSP A;  4LBQ D;  1K5M B;  1W3X A;  1XC6 A;  1RJ8 A;  3WF3 A;  5TSW A;  4RQP A;  2VVF A;  4B1L A;  2BVB A;  2RG4 A;  4Q5O A;  2PQS A;  5FQ0 A;  2QQM A;  1R1A 1;  5K0U A;  3ZKY A;  1G9A A;  4IV1 C;  2QFE A;  5C6C A;  3RYR A;  2ADE A;  4AGR A;  3O12 A;  3VBS C;  3C7G A;  1QXJ A;  5ACA 1;  1X7N A;  2P3I A;  1IPJ A;  1REF A;  4PIZ A;  5KHH A;  5EJZ B;  3INA A;  3OBZ A;  3WZ1 A;  4BYY A;  4GZ9 A;  2J42 A;  3RZM A;  3WSO A;  1PX3 A;  5FWE A;  4AVS A;  4XQD A;  1V6N A;  4WZC A;  4KU7 A;  4WVW A;  4Q26 A;  4D69 A;  2WZ8 A;  5LBC A;  2D7F A;  2RHP A;  5DG2 A;  4XFG A;  2W46 A;  1H1A A;  2C0Z A;  2PAK A;  3M2M A;  3WDX A;  1NCR B;  4D7S A;  1K45 A;  2W95 A;  2XQX A;  1VBE 2;  3EQE A;  4IEY A;  2DFB A;  5FP7 A;  5KR7 A;  1VBB 3;  4QPI B;  4QU2 A;  4XBQ A;  3I7D A;  4UI9 L;  1NA1 C;  4XJ8 A;  1PK6 A;  5GKA C;  4GH4 A;  4QQP A;  3WV6 A;  4NIG A;  2W52 A;  2Z4F A;  1YI7 A;  1Z7S 1;  3AFK A;  4K7J A;  4W6Y A;  2OZ6 A;  3WDU A;  3NJY A;  3N9N A;  4CDW B;  4XFF A;  4FOW A;  1N3O A;  3MV0 1;  4NHK A;  1MS1 A;  4P9L A;  2JG9 B;  5FZ0 A;  1AL2 3;  4RS5 B;  2ZHL A;  2UWB A;  3LPG A;  4EWD A;  1HXS 2;  1RED A;  1UU4 A;  4HFS A;  3JD7 1;  4CP1 A;  4CCC A;  5B2G B;  1HIX A;  3B94 A;  4HBN A;  1BMV 1;  1UOG A;  2WAA A;  3B02 A;  4R52 A;  3TN9 1;  4AQS A;  1OA4 A;  1ZBE 3;  1CAU A;  4LKD A;  4YGE A;  4KWL A;  1ZRC A;  5HXM A;  1A3K A;  2YY1 A;  2ZX0 A;  2VOT A;  2DVD A;  2Q30 A;  5L9V A;  4IDZ A;  1PGS A;  2LTN A;  2R07 1;  1NUK A;  1DIW A;  4A44 A;  1UIJ A;  4QKD A;  5JMO A;  2YZ4 A;  1SBF A;  3JBG 3;  2R7E B;  4NRO A;  5BV6 A;  1COV 1;  2NMO A;  1TZO A;  2C5D A;  2FDI A;  3WD5 A;  1SLT A;  2VNO A;  5DPN A;  1OOP C;  5IAV A;  4XF9 A;  4NAM A;  4Q4W 3;  4Z82 A;  5CFD B;  1O59 A;  2W2I A;  3ETQ A;  3GCW A;  5JSR A;  4P9Y A;  1QIQ A;  3IDC B;  2OYZ A;  3RMY A;  1V6K A;  3H8X A;  3FJS A;  3WQB A;  4P02 B;  4GMP 0;  4HVR A;  4QPG B;  2Q8C A;  3CZJ A;  1TME 2;  4LKS A;  2YBK A;  4KQ7 A;  2Y8K A;  1BHG A;  1I5Z A;  5DUX A;  4CCD A;  4XYX A;  1CIW A;  2VVE A;  3FL7 A;  1JOJ A;  1LHW A;  2VNV A;  4XUP A;  2Z79 A;  4MSV A;  3VD9 A;  4JKM A;  4R4Z A;  2C9K A;  1UZ0 A;  3KV5 A;  4NO4 A;  5FO9 B;  3P3P A;  4YZ2 A;  1DLL A;  3ZMN A;  1XBF A;  5IWF A;  5FOJ B;  1H2M A;  4Q4X 1;  3POF A;  4AGG A;  5KWR A;  3EHK A;  2WC2 A;  3C2U A;  4AHX A;  4QD2 A;  3CO2 A;  1ZA4 A;  3AJZ A;  5J09 A;  3THT A;  4PLM A;  5F1R A;  3I59 B;  2BGO A;  1X36 A;  4IEO A;  3CZU A;  1R1A 2;  3KQ4 B;  3R4S A;  4YVS C;  2SBA A;  3O1U A;  5A80 A;  4YGC A;  1UZY A;  2WFF 1;  4JHT A;  1F5F A;  2Q0A A;  2VXR A;  3KWV A;  4PI0 A;  3KCY A;  5FO7 B;  5IK4 A;  2G19 A;  1TG7 A;  5GAL A;  5ACA 2;  1LEN A;  2B39 A;  4AFB A;  2VTX A;  2VVD A;  1PVX A;  2OUH A;  3ILF A;  1V6I A;  1VBC 3;  1W6P B;  1CN1 A;  3OPW A;  4YVW A;  4Z2A A;  4KI5 M;  5GJ6 A;  5F3E A;  1PVC 3;  3H8U A;  4BOW A;  2VW2 A;  2Y60 A;  5CU1 A;  1IG3 A;  4LBQ A;  5FZ7 A;  4D7Y A;  2YPJ A;  2G1M A;  5FZF A;  4TZD A;  5A3L A;  2VQT A;  4E8D A;  1W6Q B;  2VQ0 A;  1XE7 A;  1CAW B;  1UO9 A;  1LED A;  1OQE A;  4IEX A;  4ORF A;  4D8M A;  5JI7 A;  3UET A;  2HEY F;  4LOT A;  4Q4Y 1;  4GAZ A;  1W8Z A;  3PL0 A;  3I49 A;  3DGT A;  3IN9 A;  2A3Y A;  3U11 A;  5F37 A;  4IEZ A;  4FOY A;  3T1L A;  1X8E A;  2VW0 A;  3EMR A;  4LBN A;  1Z7S 2;  3AKT A;  3POS A;  4EN7 B;  1H2K A;  2JKB A;  3PU3 A;  3PLQ A;  3GZE A;  3JQW A;  1GZW A;  1RXG A;  3ZLI A;  3J7L A;  1OI6 A;  2FMD A;  4MUV A;  2CNA A;  4H55 A;  1RC6 A;  1W8F A;  1OUX A;  2IXL A;  3WUD A;  3WUC A;  4CDQ B;  3JD7 2;  1CIY A;  4D6Q A;  4CDU B;  1BMV 2;  1E5I A;  3TN9 2;  3WVJ A;  2DUQ A;  4Y1Y A;  2A6Y A;  3CJX A;  2HEW F;  1UY4 A;  3AXD A;  4I30 A;  2ADD A;  5FOB B;  1VRH 1;  3NNG A;  2PEL A;  2A6Z A;  5CIS A;  1LEM A;  4BK4 A;  3FWE A;  3MIB A;  3T4H B;  2UWA A;  3IMM A;  4Q1R A;  2R07 2;  2E51 A;  4PF5 A;  3MW2 A;  5FLH A;  4ARY A;  5CA6 A;  1COV 2;  2W1W A;  4MG2 A;  3AM2 A;  3LZZ A;  2CHH A;  2VOV A;  3FN9 A;  2OQ7 A;  3ZXE A;  4JHZ A;  4BZ4 A;  2ZGL A;  3I8T A;  1Z78 A;  3ZX7 A;  4AOC A;  1NX9 A;  3CEW A;  2R16 A;  1K5M A;  4V1P A;  3ZVX A;  2ID4 A;  4R9B A;  3NKT A;  4BE3 A;  5KHK A;  1TMF 3;  5LA0 A;  3TEZ A;  2XJS A;  3T0A A;  4EZH A;  1SDD B;  4LO5 B;  1C5H A;  3O7O A;  4HSJ A;  4MAD A;  3J8F 3;  4LLO A;  5SV5 A;  3A7Q A;  3R0R A;  1A34 A;  3KD4 A;  5DDJ 3;  3TBD A;  1QKQ A;  2ZMK A;  5E88 A;  4B4Q A;  1PMI A;  2EVX A;  1CQ9 A;  2QJV A;  4Q4X 2;  3OGV A;  2D43 A;  3BOD A;  3JUU A;  4ERO A;  1XE0 A;  4KGQ A;  1MS0 A;  4XVH A;  4BQX A;  5CG9 A;  4EN9 B;  4ASM B;  4AZZ A;  2ZML A;  1JTZ X;  3LCP A;  2DUP A;  1NCR A;  5LW9 A;  4YM2 A;  2HWD 1;  4QPI A;  5I93 A;  2A3X A;  2IVI B;  4IUG A;  2WFF 2;  5BNO C;  1GWL A;  4PLO A;  3PMS A;  4CUG A;  2Z5W A;  4XBL A;  2HWE 1;  4I02 A;  4Y24 A;  4N8M A;  1O4T A;  3DV8 A;  5DMY A;  2LRP A;  4YZ5 A;  3PDQ A;  4UT5 A;  1PNF A;  3V64 A;  4C8D A;  4DNY A;  4KGG A;  2W5F A;  3FUO A;  3WNN A;  3IMN A;  1AR7 3;  2ZX1 A;  3NNM A;  1YXW A;  2AH2 A;  2VTF A;  4CDW A;  2ZKL A;  1W2O A;  4XUN A;  2JG9 A;  4AR2 A;  2B4K A;  3N7M A;  4RS5 A;  3ST7 A;  3B93 A;  4JRL A;  1QJU 1;  4GB3 3;  2B9U A;  4K8F A;  4CEW C;  3LKJ A;  2VW1 A;  3WW4 A;  2VC9 A;  4XAA A;  1D4M 3;  4E2S A;  3AYE A;  3HQX A;  2ZEW A;  2VOK A;  1HLC A;  4IEV A;  2VMH A;  1Y9G A;  3RYP A;  1AL0 G;  5GLV A;  4Q4Y 2;  4HSL A;  5FY8 A;  4C90 A;  4Z8B A;  2XL7 A;  3BPZ A;  3MZH A;  3A22 A;  4XFI A;  4CP9 B;  1EV1 1;  5F5I A;  1RUJ 1;  5IVF A;  2AZ5 A;  4KWK A;  4X8N A;  4NMI A;  5C3R A;  3HEI A;  1RUE 1;  2RMU 3;  3BGA A;  5CFD A;  1UOJ A;  4B4P A;  3MF6 A;  2R04 1;  5DAV A;  2JDN A;  1H6X A;  2W3J A;  5GLT A;  3J9S A;  2JDP A;  4QPG A;  1UNB A;  4XFH A;  1SBD A;  1VRH 2;  2WO2 A;  4WZF A;  1M4W A;  2C26 A;  1O4Y A;  5LRR A;  3V0B B;  2KXL A;  1W0N A;  3H1W A;  4BH9 A;  2JD4 A;  1YWK A;  3HN3 A;  5LK5 A;  4S2H A;  1MAC A;  3KGL A;  3N9L A;  2Q1F A;  3EB7 A;  3N36 A;  4O7X A;  4AW7 A;  5CFC B;  1WMF A;  4AED B;  3D5O A;  3B3Q E;  2MNG A;  4A45 A;  2XLG A;  2FDH A;  1OKQ A;  4LO7 A;  3H50 A;  2Y6L A;  2VOX A;  1WZX A;  2VPV A;  3MV1 1;  5J7M A;  1NKG A;  2YC0 A;  1KS4 A;  2YFZ A;  2YV8 A;  3OUH A;  5T55 A;  4Z07 A;  3ZFG C;  2X5I B;  4LA2 A;  2WNU B;  3I2G A;  3I59 A;  5JVV A;  4Q1P A;  1BXH A;  5C70 A;  2OUJ A;  1RUD 1;  2CDO A;  4V2V A;  3HNY M;  1AYN 3;  4MO3 M;  3MIE A;  4PT6 A;  4XUR A;  1ULG A;  2RE9 A;  3ES4 A;  1LOF C;  3PNA A;  4KMQ A;  5CEH A;  2WAB A;  2WS9 1;  4DXR A;  2HYX A;  4JGY C;  4L99 A;  4NIH A;  3ZPO A;  2ZEY A;  1UZW A;  1UW8 A;  2A73 B;  4W6W A;  5FP8 A;  1LUL A;  2RDR A;  1W6P A;  2BQP A;  2DU0 A;  2GNM A;  2VE1 A;  3H3Z A;  4RR3 C;  4J1W A;  5A32 B;  4QQH A;  4QXB A;  3AP9 A;  5LY2 A;  4N7U A;  3ZYG A;  3OD0 A;  3WW3 A;  4DIN B;  1YYN A;  5JSO A;  1GZ9 A;  1O6U A;  2PA7 A;  3VKO A;  3KV4 A;  4IEW A;  4AF9 A;  1HB1 A;  4BB3 A;  3D82 A;  4DXT A;  1W6Q A;  2YB7 A;  2HWD 2;  1ODM A;  2A1X A;  2ZGP A;  1CAW A;  2YU2 A;  2TEP A;  2IXC A;  1BBT 3;  4PIY A;  3UES A;  3UKV A;  3DXT A;  5JIU A;  1GAN A;  2W94 A;  1FXZ A;  2HWE 2;  2DBI A;  3JZV A;  4COZ A;  5KXB A;  1POV 1;  3PTR B;  2ZXQ A;  3OEA A;  4RN5 A;  2WQZ C;  4LO4 B;  1EP0 A;  3IDB B;  2LAL A;  4YM3 A;  4K8R B;  4FVV A;  3ZSJ A;  2Y38 A;  3WF2 A;  3V65 A;  1UF2 C;  3RQ0 A;  2Y6K A;  3PJQ A;  2G9Z A;  2ZBJ A;  5FY9 A;  4W50 A;  2O0O A;  2VUD A;  2E7T A;  5LZ6 A;  4UW3 A;  2FZ1 A;  1QJU 2;  4CDQ A;  2OX0 A;  2EAL A;  3AC0 A;  2EIE A;  5CAD A;  1H30 A;  3UK9 A;  1AR9 3;  2YHJ A;  4CDU A;  4Q0U A;  1FAT A;  3RDI A;  2BFU L;  4KBZ A;  5C8C C;  4AL9 A;  1AXY A;  1US2 A;  3ZXG A;  1SFY A;  1LHV A;  1ND3 C;  5CG8 A;  2BGC A;  5EJ1 B;  5HCA A;  4IV1 B;  3D0J A;  3CMG A;  3HQU A;  2EIC A;  1UYP A;  3ZN6 B;  2RS3 1;  1H2L A;  3ILN A;  4WM7 B;  2IVJ A;  1R08 3;  2I07 B;  3W5M A;  1EV1 2;  3IB3 A;  3H1M A;  4QPW A;  3AP5 A;  5EJ3 A;  1RUJ 2;  3RGB A;  1YUD A;  2XJQ A;  1DZQ A;  3O0W A;  3IWZ A;  5HV0 A;  4W6X A;  3VBU C;  2DFC A;  1RUE 2;  3GBW A;  3T3Y A;  5ISL A;  4WM8 B;  2GH8 A;  3AVS A;  4B3N A;  3O1M A;  2DWR A;  4XHB A;  1SBE A;  2R04 2;  5DAP A;  4NPL A;  2ZGR A;  3AZZ A;  1EPZ A;  1WUV A;  3KS7 A;  4OYU A;  3P1I A;  4PDW B;  2VXJ A;  1W3V A;  3DL3 A;  2V5Y A;  2ES3 A;  1HRI 1;  3OEB A;  1J1L A;  5L7O B;  1SCR A;  3N7L A;  3RI9 A;  1RUF 3;  5JR7 B;  2VBD A;  3D8C A;  2CGN A;  3A0K A;  3K48 A;  3VKN A;  4DFS A;  3WP4 A;  5FYI A;  5IUQ A;  3ZYJ B;  2WSV A;  4CSW A;  3WNX A;  4R8H A;  5BY5 A;  1K3I A;  3VKF C;  3WNK A;  1Q56 A;  2BNO A;  2FQP A;  1W2U A;  2W1U A;  2J7M A;  4XQ4 A;  1XYO A;  3WG2 A;  4AK3 A;  2QUO A;  1GYK A;  1O5L A;  1OSG A;  4N9H A;  2Z2S B;  4LTA A;  2IXJ A;  3LEI A;  4FPG A;  1YIF A;  1AR6 3;  1EYB A;  2BU9 A;  1U12 A;  4LOS A;  4XFC A;  5C3P A;  5L73 A;  1HB2 A;  5GZF A;  2Y0I A;  3GBG A;  4OUL A;  5FPZ A;  2DBN A;  4YW2 A;  1RUD 2;  1ZVF A;  1AX2 A;  3LDB A;  4L97 A;  5DZF A;  2HBT A;  1KIT A;  1YQ2 A;  2B45 X;  5F2W A;  5FV3 A;  1W6M B;  3W58 A;  3LOI A;  2WS9 2;  4JTO A;  5A70 A;  2BWA A;  2R1D A;  1XE8 A;  1T6G C;  2I45 A;  4FPE A;  4YW1 A;  4Y4R A;  4J1X A;  3WX5 A;  1FI2 A;  4Q0S A;  1Q8P A;  3DN7 A;  4AHZ A;  2PHF A;  1LU2 A;  4JKK A;  5KHJ A;  1FOD 1;  5JAX A;  2X09 A;  3DPR B;  5A3O A;  1GFF 2;  2XDV A;  4Y3O A;  3K4A A;  4OHZ A;  2BBA A;  5BYN A;  3SH4 A;  1OOP B;  2PQQ A;  4PHZ A;  2G4I A;  1UX7 A;  3BTA A;  5F6L B;  5JLV A;  4GKX A;  1VAM A;  5FFO C;  1AR8 3;  3DEM A;  1JU4 A;  1XQN A;  3NW4 A;  1POV 0;  3VD4 A;  4E4Z A;  1YRZ A;  2WIN B;  1DDL A;  2RM2 1;  5FY0 A;  3NNJ A;  2VMG A;  4TXW A;  4RSU A;  2P34 A;  2D93 A;  5F2S A;  1QWR A;  2GN7 A;  4LR4 A;  3E1F 1;  3WDT A;  4BHP A;  5EPA A;  3WP3 A;  1C3H A;  1PO2 1;  2A75 A;  4UFI A;  1JZ8 A;  4ZPI A;  4AFD A;  4Z1V A;  2EXH A;  1DP0 A;  1WKY A;  4CP9 A;  2JEM A;  4OLL A;  4UOJ A;  4LUL A;  1DLC A;  1RXF A;  2VR4 A;  4Q0P A;  5DUW A;  1LHN A;  1PIV 1;  1PO1 3;  1H2N A;  4CCJ A;  3T2P A;  3AB0 A;  4EN0 A;  5AFB A;  1HQN A;  1V70 A;  3ES1 A;  4EWE A;  3GJA A;  3HJR A;  2YU1 A;  5FKC A;  5LA9 A;  3SCF A;  3BTZ A;  2W47 A;  5A7Q A;  2JB4 A;  3MUY 1;  3VBO B;  5J36 A;  3OGG A;  4JCK A;  4ZY9 A;  3AZX A;  5IHR A;  1WW7 A;  2D5H A;  2PAM A;  3QBQ A;  1K42 A;  4ARX A;  3MIG A;  5JOX A;  3QH6 A;  2RS3 2;  3V0B A;  3B5L B;  1UOB A;  3ZYP A;  4MXW B;  5FK8 A;  3LGR A;  1X9P A;  5CFC A;  1U5Y A;  5HV4 A;  1Y9M A;  2ZGU A;  4A3Z A;  1RUG 1;  5FLI A;  4DXZ A;  2VGD A;  4AED A;  3CU7 A;  3ZM8 A;  2PHR A;  5J98 B;  3T08 A;  1ND2 C;  2JKX A;  4FPH A;  4PI2 A;  4QB2 A;  2VO5 A;  5F8P A;  1UAI A;  4XZU G;  2EIG A;  3H42 B;  3LA7 A;  2D3S A;  3PVN A;  3LE0 A;  1W06 A;  1I6X A;  1I9R A;  2X5I A;  1HRI 2;  2WNU A;  2PHD A;  3S5Q A;  4DEQ A;  4NHX A;  1PVC 1;  4GQ7 A;  4UBH A;  4AAP A;  4RGA A;  3ORJ A;  5A7O A;  1YQC A;  1ZRI A;  2DDU A;  3TWI A;  4QKB A;  2HWC 3;  5E6H A;  4H2A A;  2ZCW A;  4Y20 B;  2J22 A;  1FMD 3;  5K9Y A;  1TNR A;  2XLF A;  5G04 L;  1UL9 A;  3TEY A;  5LK7 B;  3DYM A;  5JXJ A;  5FZC A;  4LQR A;  4MVT A;  1MZE A;  5C7G A;  1G9B A;  4PIX A;  5L9B A;  1LGN A;  3PUQ A;  5C9A B;  5A32 A;  1ZRR A;  3KV9 A;  1WME A;  3IDE A;  1JXN A;  1V9U 3;  1SZB A;  2VUJ A;  1ZBA 3;  1QHD A;  2WZR 2;  1GIC A;  4JDO A;  2F17 A;  5ABJ C;  3NV1 A;  1HRV 1;  3U75 A;  2GND A;  3GJB A;  3OBT A;  2J1V A;  4X8P A;  4O9G A;  2Y33 A;  3VV1 A;  1QJX 3;  4QX7 A;  1PGL 1;  3KCX A;  4XXP A;  5GZG A;  1SFN A;  3OBR A;  5BNP B;  1DQ6 A;  2HYK A;  4P9I A;  3U4S A;  4RFR B;  2VUC A;  3CLP A;  4NUB A;  4BU2 A;  2WBK A;  4IGO A;  1FOD 2;  3U1X A;  3UT0 A;  1Y7B A;  2HKX A;  4AQ6 A;  2O8O A;  1J1T A;  4J25 A;  3C7F A;  2GP3 A;  2PLV 3;  4IES A;  2EXK A;  3AL5 A;  3RS6 A;  1RVF 3;  4XTM A;  3AKQ A;  5F32 A;  2WNO A;  3GCX A;  3ON7 A;  5F3I A;  5FUP A;  3POB A;  5H9P A;  5C3Q A;  2RM2 2;  1QJY 3;  1V0A A;  3C8X A;  2LM3 A;  5EYY A;  4XXA A;  4AI2 A;  1V00 A;  5J3U A;  2Q1Z B;  3VHN A;  4DB5 A;  3O1P A;  3ZN6 A;  5GZC A;  5IFP A;  1DZR A;  1PO2 2;  1S0G A;  4M3C F;  3ZXA C;  3ECQ A;  3NQH A;  3AP4 A;  3FZ3 A;  4WM7 A;  2J1U A;  4FTB A;  1GLH A;  1ALY A;  3ITQ A;  4H7M A;  1WGP A;  4TLF A;  4CUA A;  3HBZ A;  1MVQ A;  3UJO A;  2ZEZ A;  1SLA A;  1UZV A;  3PJY A;  3H3L A;  4J6G A;  4PQQ A;  3UGF A;  1PIV 2;  4WM8 A;  1LR5 A;  3AXE A;  4QGL A;  1MQT C;  3WW1 A;  5EWS A;  4L2N A;  1JYW A;  1JOP A;  2MEV 1;  1KDK A;  2VCM A;  3H9A A;  3I2O A;  1J3P A;  4PDW A;  3M70 A;  4UFL A;  3O0X A;  3ZSE A;  1VBD 3;  4ATE A;  2J1E A;  2VU9 A;  5L7O A;  4OZO A;  4OI0 A;  1SFP A;  4QKN A;  2GMM A;  3J4U H;  3HWJ A;  4FPC A;  4KNC A;  2QQL A;  4S2D A;  3T2T A;  5BNO B;  3B01 A;  1KXG A;  1ULF A;  5EYX A;  5C5U A;  2DCK A;  5A7N A;  4HKO A;  2NM1 A;  2Z69 A;  2WFP A;  3OGR A;  4E27 A;  2B9V A;  2YRO A;  4MX3 A;  1K12 A;  4HPK B;  1Q8O A;  1R09 3;  4FPF A;  4IEP A;  1W9W A;  2EF6 A;  1RUG 2;  1BZW A;  3DF0 A;  2XH6 A;  3U37 A;  3VBR B;  5LBE A;  2ETE A;  3POI A;  3AP7 A;  3J26 N;  4OUE A;  5T5L A;  2WQ8 A;  5C4W A;  3PUR A;  3BTY A;  2P37 A;  2IFW A;  3LSD A;  3GZT B;  2JJ6 A;  4OCT A;  1Q43 A;  4CEW B;  1QQP 3;  1AR7 1;  4FI9 A;  4FPK A;  4D3W A;  2G9G A;  3ZIW A;  3ZXK A;  1IGO A;  2JDZ A;  5H9R A;  3I2I A;  2BNN A;  2BTV C;  2V09 A;  1PVC 2;  2RS1 3;  1W6M A;  5KXE A;  3OUI A;  2ENR A;  4CXY A;  3BN6 A;  1AYM 3;  2RJK A;  2WNV C;  3FLT A;  3O1T A;  3T30 A;  4CPB D;  1VBA 3;  2HBU A;  2KM2 A;  2TBV A;  4S2F A;  4LBK A;  5FBZ A;  1ZRF A;  5FZ8 A;  3DPR A;  4L11 A;  5GLZ A;  2FZ2 A;  3I2F A;  1ASJ 3;  2ZHN A;  3PTY A;  4NII A;  1OOP A;  4ET7 A;  1I1E A;  2UYB A;  4RGK A;  3WP5 A;  2YC2 A;  4GWN A;  4E2Q A;  1JYN A;  1GQG A;  1RUH 1;  2VNG A;  2XR4 A;  3HN1 A;  4GA9 A;  3WLU A;  3RZJ A;  1YQ6 A;  5JPN B;  1Z0H A;  2R0F A;  1IS5 A;  1UY1 A;  1FAY A;  2W1Q A;  2XOM A;  1DZT A;  3IZO A;  3ZXF A;  1HRV 2;  2ZGN A;  3H7J A;  4CEY B;  1GNZ A;  5FYM A;  4BM8 A;  2V73 A;  1PGL 2;  4IL7 A;  1GU3 A;  1WMD A;  2IZW A;  1YFU A;  5EXO A;  4NJ4 A;  5CB7 A;  2ZA9 A;  4XAE A;  2CV6 A;  2Y0O A;  3I2D A;  5IAT A;  2XML A;  4EN6 B;  1ENS A;  3HVD A;  5IJR A;  4AFA A;  3I3D A;  2CAV A;  3D4K A;  5IAX A;  4UW4 A;  5JI9 A;  2XVG A;  2BRT A;  1HB4 A;  1TQ5 A;  3WDV A;  3LA3 A;  5AC9 1;  4Y1V A;  4R9A A;  1KJR A;  2C24 A;  4AVC A;  1C8M 3;  2BEO A;  2CL2 A;  3VBO A;  3AKR A;  3DKW A;  5FZ6 A;  2AC1 A;  4GH4 C;  3N9O A;  1S1A A;  2VMD A;  3N9P A;  4FQ4 A;  5FYZ A;  3T2O A;  3LIH A;  1GOG A;  1SLL A;  4QXK A;  4AWD A;  4MXW A;  5I0D A;  4D0Q A;  1R64 A;  1IKP A;  3CQO A;  4X6R B;  1MS4 A;  4EWA A;  1YIP A;  4U36 A;  5IVB A;  3KGZ A;  1POQ A;  1AYN 1;  1TNF A;  2E32 A;  2KA3 A;  2WT2 A;  1EUU A;  1MEC 1;  1RUI 3;  2P1B A;  5J96 B;  1ONA A;  4I09 A;  5JWP A;  2KR2 A;  4TSV A;  2Q5T A;  4MHR A;  2MEV 2;  2ZGS A;  1BVV A;  5JOW A;  2FBE A;  2DCT A;  4XTP A;  1S0C A;  3DYO A;  3WCR A;  2VZT A;  1FPN 1;  2RVA A;  3K2O A;  1ULE A;  2WNE A;  1VMH A;  4PJY A;  2NPI A;  1EAH 1;  3HR9 A;  3POW A;  2FHR A;  1BEV 1;  4GWI A;  3URF A;  3B9I A;  3QD6 A;  4QDS A;  2HH9 A;  2A6W A;  1X82 A;  4JDM A;  2JDY A;  2C6S A;  2PAE A;  1JMU B;  4Y20 A;  3DUI A;  3O5S A;  4XPV A;  4GWM A;  2Q8E A;  3ZDS A;  1X50 A;  4RD7 A;  2BYV E;  2C1F A;  3E5Q A;  3PME A;  2D44 A;  3A4U A;  4Y22 B;  1SCS A;  4TTG A;  1JOB A;  3IKW A;  1RYY A;  4BQ5 A;  1U5X A;  4XC9 A;  3UJQ A;  1RMU 1;  2XQR A;  1Q8S A;  5GZD A;  5C9A A;  5LY1 A;  1OUS A;  2K9Z A;  5JCT A;  3H8O A;  2WUH A;  3RWN A;  2KD7 A;  5FMO S;  2VMC A;  4IV3 B;  4XUQ A;  3X29 B;  1GNY A;  2DU1 A;  2QQV A;  1DYK A;  1JBC A;  4ZON A;  5E16 A;  4DZG A;  2ZGM A;  3VHP A;  4DY3 A;  4MGT A;  4OHX A;  2VZS A;  4DY5 A;  2D6K A;  3MO4 A;  4FPJ A;  2J1R A;  4IXL A;  4Z2W A;  3VD7 A;  1WBL A;  4CU9 A;  4NRM A;  3IBM A;  5LCW L;  3WNM A;  5CKQ A;  5BNP A;  3VBF B;  5FWJ A;  5AFE A;  4I0A A;  4OZX A;  3BTX A;  3VBU B;  4FXG B;  4D6R A;  5KBF A;  1KRI A;  1S2E A;  4Q4V 3;  1DQ1 A;  1RUH 2;  1HDK A;  3FUQ A;  2ZMN A;  2RS5 1;  4YW6 A;  4QQO A;  1WW4 A;  2ZHK A;  3GZU C;  4XDQ A;  5IT6 A;  4K9S A;  2XLA A;  4Y1Z A;  3B00 A;  4YLZ A;  1R1Z A;  2BOJ A;  3FLP A;  4B7E A;  4E2G A;  2V72 A;  2Y6G A;  2GC1 A;  2QDR A;  4GIQ A;  3A23 A;  5EP9 A;  1HXS 3;  2G9F A;  3TRS B;  2ET7 A;  1YFW A;  4M3C E;  3ZPY A;  2JWP A;  4CPB A;  4M0H A;  1W39 A;  5BNN C;  2BOI A;  4BIS A;  1LOG A;  4D7T A;  4YVW C;  2JDU A;  1NE4 A;  3HT1 A;  1IKQ A;  2YUE A;  1DGR N;  2JXA A;  4NPR A;  3OGS A;  3PUH A;  4FOQ A;  2O8Q A;  3ZN4 A;  3BYW A;  3KHB A;  2ARC A;  4JRA A;  4MGK E;  3MEP A;  5AC9 2;  5IK7 A;  3KM5 A;  4MGY E;  1YJL A;  2GU9 A;  4BPZ A;  2AAC A;  3AMQ A;  2VJX A;  1NZC A;  2BGP A;  3ETP A;  4FPY A;  1US3 A;  3AYC A;  3GXU A;  3W21 A;  2RR1 1;  1P8J A;  1QJE A;  3W9A A;  3PVE A;  4BXF A;  4XET A;  3BAL A;  2VNR A;  3APB A;  3AVR A;  5I8T A;  3OF1 A;  4ZZ5 A;  3S57 A;  5BNO A;  1GQP A;  3P3N A;  5FP9 A;  5FIX A;  3SMH A;  5F3C A;  4XDP A;  2ATF A;  4K3U A;  5FYV A;  5FR3 A;  4HPK A;  5LA1 A;  4CRQ A;  1WMX A;  3VBR A;  4Q8L A;  2X29 A;  1AYN 2;  2ZAC A;  1OA2 A;  1N1Y A;  4JGZ B;  5A6Y A;  1MEC 2;  1UPS A;  1QOT A;  4DRV A;  4XZP A;  3VBH B;  2ARX A;  5J48 A;  1OFS A;  2FCV A;  2NLR A;  4GMP 3;  3CJI B;  4CCE A;  5FYU A;  2UY9 A;  4OMD A;  4YFW A;  1FPN 2;  3OPZ A;  4HVO A;  3VDD B;  4CEW A;  1EAH 2;  1F31 A;  3Q8B A;  5FZ9 A;  5D8A B;  1JZ7 A;  3KSC A;  1NOV A;  1BEV 2;  4KWU A;  4CCN A;  2UU8 A;  3IM0 A;  3HNB M;  4MLO A;  4DUV A;  3GHM A;  4QB1 A;  2VUL A;  1AR8 1;  2A70 A;  1GKB A;  1OLM A;  1JH5 A;  4UW6 A;  4CDX B;  1D4V B;  2C4X A;  3MPP G;  3RJR A;  5FPX A;  4L92 A;  2MHF A;  1OUR A;  3K4D A;  1NLR A;  3N7K A;  3WF0 A;  4WVV A;  3SHR A;  1HN0 A;  2B8M A;  2HWF 1;  5A6X A;  1F2N A;  3IDA A;  4NPM A;  5FXX A;  1RMU 2;  4XMA A;  5CIR A;  5HCB A;  1BCX A;  3ATG A;  4ZXE A;  4A3X A;  2P3J A;  5ACA 3;  3WNP A;  4M3C B;  4P9G A;  3HQR A;  2OXB A;  2PHW A;  3BOW A;  2VMF A;  3QH7 A;  2OQ6 A;  1F4H A;  1YEW A;  2VCA A;  1C1F A;  2A7A A;  1ZZ6 A;  2IFR A;  1HN1 A;  1OLQ A;  4QDR A;  4LA3 A;  4CEY A;  5JIA A;  4B1M A;  3J7M A;  3VZO A;  2AGS A;  2N7G A;  1UIK A;  4KBB A;  5HXV A;  2HLE A;  2ZHM A;  3RZG A;  4LE3 A;  3Q8F A;  3WOG A;  1CZT A;  1ZNP A;  1QXR A;  2QTW B;  5FZK A;  4IEU A;  4BDV B;  3M3Q A;  3VZJ A;  5JZG B;  4N43 B;  3KT7 A;  5FMO L;  5F6K A;  2YXS A;  5A6Z A;  3MDP A;  3WCS A;  1LGC A;  1E5H A;  1ND2 B;  1BVP 1;  3H7Y A;  4AYU A;  4BQ1 A;  4IE6 A;  3WG1 A;  1PMJ X;  4IE5 A;  3DYP A;  3M8L A;  5L36 A;  1Z7S 3;  4GUL A;  5IVY A;  4AVT A;  1OKO A;  2AYH A;  1WCQ A;  1LHO A;  2P3Y A;  3BVC A;  4QM9 A;  5FP4 A;  2RS5 2;  5FPU A;  2OT7 A;  2D40 A;  3ZFE B;  4BQ4 A;  5KC5 A;  3V0A B;  1SEF A;  3IAP A;  1W04 A;  2DVA A;  1UQX A;  3CNA A;  3J7N A;  1RHI 1;  4FO9 A;  5FZG A;  5A7P A;  2ZAB A;  4AI8 A;  1GP4 A;  4MYE A;  5H9Q A;  2AEY A;  4O65 A;  2E26 A;  1LOF A;  3M7A A;  2VUA A;  1NT0 A;  2K0G A;  3ACF A;  3MGU A;  4LIT A;  3JD7 3;  5DQ0 A;  5FZH A;  5F7U A;  5FTT C;  5T5P A;  3ZYR A;  4O61 A;  3TN9 3;  4Y5T A;  3S7I A;  1H0B A;  1D7P M;  4LO6 B;  5C5T A;  5I8Y A;  2WDB A;  3ZFF B;  2XJT A;  5ANN A;  2JG9 C;  1YJK A;  3H8R A;  2AUY A;  2UY8 A;  4RS5 C;  1AXZ A;  1STM A;  1JZ2 A;  2P6C A;  2ILM A;  3AJY A;  5T52 A;  5LBF A;  1H4H A;  1GSL A;  1W9S A;  2BZD A;  1VAK A;  2QQJ A;  2R07 3;  2VCB A;  1SPP B;  3BB6 A;  2GC0 A;  3C7O A;  5HCH A;  1COV 3;  4OUS A;  2RR1 2;  3DXU A;  4PBO A;  4Z92 B;  4Q0V A;  2GNT A;  4NAO A;  3ILR A;  3B7M A;  4LUM A;  4XHX A;  4NE9 A;  5ABJ B;  4QXC A;  2I74 A;  2BWC A;  5DUU A;  5IFT A;  3N4M A;  4K1Y A;  3BCW A;  3PIG A;  4YRD A;  2D6L X;  2P5B A;  2OVU A;  4C0B A;  5EHD A;  3TEW A;  4P5H A;  4LIV A;  4XF3 A;  1SG3 A;  1LES A;  3MID A;  4UYB A;  5CFD C;  2GDF A;  1YQ5 A;  2Y6H A;  4NIA A;  4Y22 A;  1CES A;  4DIQ A;  4RA0 A;  5FZM A;  2QQI A;  1O8P A;  1OMI A;  1RIN A;  2B5H A;  2WO7 A;  4IE7 A;  1O5U A;  3ABZ A;  4YZ4 A;  1VRB A;  4CTE A;  4AQT A;  2XVL A;  4IV3 A;  1UY3 A;  3IIA A;  4WVM B;  2WWJ A;  3MLK A;  4ASL A;  4Q4X 3;  4GJZ A;  1H8T C;  3FFQ A;  5E8A A;  1UMI A;  2R06 1;  2PLV 1;  3FMG A;  3I2H A;  3OJB A;  1MVE A;  2HWB 1;  4H7L A;  1AR8 2;  3PUS A;  4HN0 A;  1UKR A;  3PHM A;  1BQP A;  4FP3 A;  3AZY A;  1U0A A;  1QJY 1;  2XBO 3;  3DKQ A;  3VBF A;  1EUT A;  1VAL A;  2BNM A;  3SXW A;  5IYY A;  3NKG A;  2CWS A;  4MGZ E;  2HWF 2;  5CKM A;  1LJ7 A;  4C1X A;  2QQP A;  1D0H A;  3VBU A;  1CPN A;  2WFF 3;  1YI9 A;  4IEQ A;  1W2N A;  1S0J A;  2AR6 A;  4RHV 1;  2DF7 A;  3UGG A;  1QH6 A;  1EPW A;  2LUW A;  2GP5 A;  3OSD A;  5C71 A;  3NAP C;  3MHZ A;  2JEN A;  3S7E A;  4FTE A;  4BLI A;  4FXK B;  4GKY A;  3DCQ A;  2ZKN A;  2ZS6 B;  1JZ3 A;  1CJD A;  2D3R A;  2VCC A;  3OYW B;  1N1T A;  1RUC 1;  5FPB A;  1W8U A;  4HAN A;  2BUK A;  1G7Y A;  5LAT A;  4YW5 A;  3RJ2 X;  3VBS B;  2X53 S;  2JDK A;  1O3Q A;  4CUB A;  2IC1 A;  2VL4 A;  5FY4 A;  3OBA A;  3SC7 X;  1BJQ A;  1D0G A;  1VJ2 A;  4RL7 A;  1NZI A;  4ITC A;  5IK8 A;  3FFZ A;  1GUI A;  4Q4Y 3;  4FFG A;  1OT5 A;  1S4C A;  2D6P A;  4XAB A;  4WV8 A;  1A8M A;  2JEC A;  1DYP A;  3FE5 A;  4NHM A;  2DTW A;  4UFM A;  4N53 C;  1C1L A;  1U5I A;  1UMH A;  2JE7 A;  2ZAA A;  3GYD A;  1UKG A;  1G6N A;  2JD9 A;  4BXS V;  3Q8A A;  4L8Q A;  5IVE A;  1AXK A;  4NWW A;  2D3P A;  3LDR A;  1AZD A;  1RHI 2;  1VIW B;  4MH0 E;  4FBF A;  1UX6 A;  3ZR5 A;  3AFG A;  3RPQ A;  1W28 A;  3WW2 A;  1NA1 B;  2WKK A;  3TNP B;  4C1W A;  2VQU A;  3ZSK A;  4JKL A;  2WWS A;  4MGQ A;  1B35 C;  1S2B A;  1S0D A;  3RVH A;  4DUW A;  4QHB A;  1YCI A;  4P08 A;  3UYJ A;  5FYH A;  1VBB 1;  1VR3 A;  4M0N A;  5ERL A;  4UFJ A;  2WO1 A;  2EXI A;  1VRH 3;  4JGZ A;  2DV9 A;  5FZB A;  3VBH A;  1OQ1 A;  2ORX A;  4YYO A;  2AEN A;  1GP6 A;  4Y33 A;  5H9S A;  2BER A;  2R0H A;  2L9L A;  3CJI A;  3SEP A;  3M3O A;  2RDS A;  2WZE A;  4QHZ A;  4YW3 A;  4BQY A;  4EZ4 A;  4WBB A;  4Y26 A;  5LA2 A;  3VDD A;  3SIS A;  1ASJ 1;  2XG3 A;  3KT4 A;  5D8A A;  5EIY B;  1AL2 1;  1SLB A;  4N90 A;  1F9K A;  3PUA A;  3U07 A;  3E5U A;  5K7P A;  3ZKU A;  1OQD A;  5FY7 A;  1GWM A;  3N3H A;  1GWK A;  3ENR A;  3FBM A;  4LHK A;  4CDX A;  2P3K A;  1KFU L;  3WY6 A;  1L7R A;  2Y34 A;  1U5Z A;  1ZBE 1;  1XNA A;  4HON A;  4LKE A;  3TEX A;  2Q8O A;  1HQW A;  5LWB A;  1FT9 A;  1UPI A;  1ZZ9 A;  3POE A;  4CXX A;  1UMZ A;  4DUX A;  4YM0 A;  2WLQ A;  3JBG 1;  4M3C A;  4X6Q B;  4UFH A;  5FBJ A;  3HBK A;  2RDQ A;  5JXH A;  2ORZ A;  1N3P A;  5EZW A;  3VZK A;  2EAK A;  4CVU A;  2R06 2;  2PLV 2;  4Q4W 1;  1WD4 A;  2YBS A;  3AMP A;  4FCA A;  4LIU A;  5HI0 A;  2HWB 2;  5EQU A;  1YO8 A;  2JE8 A;  2Y26 A;  2VAU A;  4TLG A;  3ZIX A;  3K77 A;  4FQZ A;  1QJY 2;  3GF6 A;  4Q2F A;  2W91 A;  2HWD 3;  1S55 A;  4XQW A;  3AL6 A;  3CBN A;  2A6V A;  3HIF A;  4CP2 A;  5JZG A;  1E5R A;  4N43 A;  3D0S A;  1F35 A;  1VAV A;  3NNF A;  4XIO A;  4RHV 2;  4A6O A;  1G9C A;  3T0D A;  2HWE 3;  2GAU A;  1ND2 A;  2VZV A;  2X8K A;  5I0T A;  2IXI A;  2O14 A;  4P9J A;  5F39 A;  3ROU A;  3BUC A;  4UWD A;  4XUT A;  2D6O X;  4F3J A;  3WT3 A;  3ZFE A;  4YGB A;  3V0A A;  3HPN A;  1SHW B;  1RUI 1;  1RUC 2;  1W6N B;  2DVB A;  1WD3 A;  3K4Z A;  4YVS B;  4CCM A;  3HT2 A;  4HZF A;  1W6O B;  3I3Q A;  5IK5 A;  4UW5 A;  4NN0 A;  1FV2 A;  4XEZ A;  3OY8 B;  3LDK A;  1XNC A;  1QJU 3;  2O1Q A;  4XBN A;  4HT1 T;  5DAB A;  1OVP A;  2XJV A;  2UUR A;  3RYK A;  1XYP A;  3WR0 A;  1G9F A;  2TNF A;  3PUI A;  3SLI A;  1CAX B;  3VKL A;  2ZGK A;  3ZFF A;  4MOA A;  4EV0 A;  5FYY A;  2OZJ A;  5A33 B;  4G4F A;  4MGS A;  1DG6 A;  4MGI E;  4BME A;  1OD5 A;  1NAE A;  2CGO A;  2WYS A;  3LEM A;  1N1S A;  1SPP A;  1EV1 3;  4LOR A;  4K1Z A;  1T2X A;  4D94 A;  1XU2 A;  2WO3 A;  1VBC 1;  2H0V A;  3AMH A;  1LKN A;  1RUE 3;  5I0R A;  1LEC A;  2F4L A;  2XJR A;  3MUZ 1;  3POG A;  3CIH A;  4QDQ A;  5ABJ A;  2BJS A;  3ZO0 B;  2R04 3;  2JX9 A;  3VZM A;  1XU1 A;  4AQ2 A;  5HPO A;  1MS3 A;  1A6C A;  1N3Q A;  1VMJ A;  1VBB 2;  5F5A A;  4OI2 A;  5A6Q A;  1UXZ A;  5SV8 A;  2RJL A;  1XYN A;  1DQ2 A;  4QGN A;  2PHT A;  2E7Q A;  2QZ2 A;  5A3M A;  1J3Q A;  2H6C A;  2XKP A;  2QDN A;  2LW8 A;  4BWO A;  1D2S A;  4JQR A;  1KQR A;  4FT8 A;  2JG8 C;  4EE2 A;  1G9D A;  4WVM A;  1LAJ A;  4YWA A;  4XIK A;  2WLP A;  1WCK A;  4LMF A;  1ASJ 2;  1YHF A;  4Y1X A;  1HW5 A;  2BBV A;  2OII A;  1KGY A;  1AL2 2;  1JU3 A;  1X8M A;  4Q4V 1;  5LAS A;  3SKJ E;  5FK7 A;  2VD7 A;  5FJK A;  1WA4 A;  4AFC A;  5CFC C;  3M1H A;  2ZGT A;  1J84 A;  3PIJ A;  4RGG A;  4BIO A;  5CVR A;  4OFG A;  4AED C;  5BNN B;  5LEJ A;  2J1T A;  1ZBE 2;  3T4V A;  4FOV A;  4YVW B;  1RUD 3;  1JZ5 A;  4MXV A;  1SLI A;  4R9C A;  2DVF A;  4HL0 A;  4QXH A;  2ZX4 A;  1XOY A;  1ZX5 A;  1O4Z A;  3I2J A;  2CY6 A;  2WS9 3;  3MBW A;  3LPF A;  3MI8 A;  1IOA A;  4PQ9 A;  3P5B A;  2X5I C;  2WNU C;  3JBG 2;  2W9X A;  1PNG A;  3VB9 A;  3D6E A;  3G7D A;  3ZSL A;  3OUJ A;  3POJ A;  1NXD 1;  4JZR A;  3SEE A;  3OYW A;  4QX0 A;  4Q4W 2;  3W59 A;  3AP6 A;  4IV1 A;  2ARA A;  3ASI A;  1C28 A;  3EJK A;  1W9T A;  1EY2 A;  3F2Z A;  4S2G A;  3VBS A;  2JB8 A;  3GZA A;  5KHI A;  2QQO A;  1TMF 1;  1GZW B;  2TUN A;  4R4X A;  3ZDV A;  2A3W A;  2XHN A;  1QNY A;  2VZ3 A;  4GXL A;  4ZU7 A;  5FPV A;  2ARB A;  3VZN A;  1AHS A;  1ZZC A;  2DUR A;  3J8F 1;  3A21 A;  5FMB A;  5GZE A;  1POV 3;  4BK5 A;  5CNA A;  3SKV A;  3VD5 A;  3CL1 A;  2RDN A;  5DDJ 1;  1W2A X;  3S5A A;  1IQA A;  3III A;  4WVZ A;  2E9Q A;  2P17 A;  3KZ4 C;  1NCQ C;  5FLJ A;  1L7Q A;  4I2O A;  4OQ8 A;  2AEZ A;  1FV3 A;  1KJL A;  1RUI 2;  1JHN A;  1NA1 A;  1AVB A;  4AHW A;  4BCU A;  1LTE A;  2GNB A;  2B7Y A;  3S30 A;  4BQW A;  1SLC A;  1Y3T A;  2Z42 A;  4OHW A;  4HET A;  1KEX A;  3U4X A;  4CP0 A;  3AZV A;  2E33 A;  1JZ6 A;  2BDR A;  4IGQ A;  3K46 A;  1ZYB A;  3SCG A;  1I3H A;  3ZYH A;  2RS3 3;  1AX0 A;  1OH3 A;  2D6N A;  2VZO A;  5IVV A;  4AAX A;  3NRU A;  3OD4 A;  4YW7 A;  2VZP A;  3IAQ A;  1VBC 2;  2Y64 A;  1WW5 A;  3EO6 A;  5T3N A;  3N9Q A;  5A3N A;  2QBX A;  4NID A;  1WBF A;  4LK7 A;  2ZZJ A;  4WM7 C;  3WP6 A;  1OPM A;  3PVO A;  3VLB B;  1QY4 A;  4YAR A;  3PVB B;  1NE6 A;  1RJ7 A;  4GB3 1;  2VBB A;  4QPY A;  3VZL A;  3KVA A;  1D4M 1;  2W0X A;  1HRI 3;  4W65 A;  4P00 B;  4WM8 C;  5FZI A;  3VHO A;  5T5J A;  3BIW E;  4YM1 A;  3WDY A;  1QGL A;  1VPH A;  1GR3 A;  3FHQ A;  4AHY A;  4DO0 A;  3KF3 A;  1AUY A;  3UGH A;  4PDW C;  1NG0 A;  4A41 A;  1LU1 A;  1PZ8 A;  4CU7 A;  2GSY A;  1NLS A;  4RQP C;  3C7H A;  1QF3 A;  1YLL A;  5L7O C;  2W87 A;  3VDC A;  3ACG A;  5C3O A;  2UWC A;  2YYO A;  1Q8V A;  4URT A;  5K0U C;  5LEK A;  2R30 A;  5I0S A;  3C3V A;  4IND A;  3RWK X;  2YFU A;  1VP6 A;  2RMU 1;  3KVB A;  4Q4V 2;  1MZ6 A;  5C33 A;  5FY1 A;  3SH5 A;  4IW3 A;  4DRR A;  1JYX A;  1BYH A;  3JQX A;  1PZ7 A;  1XSQ A;  4AEK A;  1DQ0 A;  1M06 G;  2OW4 A;  4Q29 A;  4NHY A;  3NJZ A;  4XF1 A;  2D98 A;  5C4W C;  2DYC A;  2WZR 3;  1VMF A;  5CAZ A;  1W05 A;  3NVC A;  4W8J A;  2QQU A;  3O1O A;  1IPS A;  3AKP A;  3M3I A;  3NO8 A;  3LA2 A;  4FPL A;  5E89 A;  4CXW A;  5FMC A;  1OD3 A;  1W90 A;  3C7E A;  2GC2 A;  1XB9 A;  1VLN A;  2GMP A;  5FRE A;  1DYO A;  2FDJ A;  5JPM B;  1FOD 3;  1G8W A;  1V6L A;  2XXZ A;  3ZFG B;  4LHL A;  1WWY A;  4QWN A;  4OVE A;  2D5F A;  4ZU4 A;  1S0F A;  3IT8 A;  1PK6 C;  1W6N A;  4YVS A;  3K75 B;  3V56 A;  1W6O A;  3AZW A;  4GJY A;  3TB0 A;  3USU B;  1GNH A;  1LOA A;  1ULD A;  2ZAH A;  1UYZ A;  3OY8 A;  3E6B A;  4K40 A;  2OKX A;  3WQ7 A;  4XF0 A;  1TMF 2;  2NMN A;  4JGY B;  1REE A;  2RM2 3;  3DPR C;  5BXX A;  3AYD A;  3AMN A;  3LEK A;  1IS6 A;  3I3M A;  1QOS A;  1CAX A;  1WLT A;  2WL1 A;  5FZL A;  5A33 A;  3J8F 2;  4LBJ A;  3OOX A;  1PO2 3;  4FFI A;  4RR3 B;  1O3T A;  3BI3 A;  4IE4 A;  1NY7 1;  4JV4 A;  5JOY A;  5T54 A;  2VME A;  5DDJ 2;  1HX6 A;  3T1M A;  3RZH A;  2PN5 A;  3H3U A;  3VD3 A;  3JB8 A;  4Y4Y A;  3RFR A;  4A7K A;  1DCS A;  2XVK A;  1GV9 A;  1K5J A;  4QKF A;  2F6B A;  1GOH A;  5EFU A;  3THP A;  4BLJ A;  1H8T B;  1ZA7 A;  3ACL A;  5GLW A;  4ZS3 A;  1PIV 3;  4Y5S A;  2IXK A;  4I0B A;  4EQV A;  2NN8 A;  2Y6F A;  2Y6J A;  3AYA A;  4LEJ A;  5FO8 B;  1OA3 A;  3RSJ A;  1JI6 A;  4TYS A;  1MS9 A;  4SLI A;  1Y4W A;  2H6B A;  2PHX A;  1W03 A;  4OI1 A;  3MF9 A;  4M00 A;  2LS6 A;  3E6C C;  1BBT 1;  2K2S A;  4M4R A;  1PX4 A;  5CZK A;  1W0O A;  4ZKT B;  1VB4 A;  1RIT A;  2FCT A;  4DXS A;  2VZ1 A;  3VBO C;  2XON A;  1NYW A;  2XBO 1;  3NAP B;  2R49 A;  4QQ2 A;  4W4Z A;  5KC6 A;  3RG0 A;  1KS5 A;  1QDC A;  1V6O A;  1AR7 2;  1WCD J;  1RUG 3;  2W1S A;  1KFX L;  3WIN E;  2DCJ A;  4FTS A;  4LE4 A;  5C8C B;  1GOF A;  4COV A;  1O7F A;  2FMY A;  1E5S A;  1ND3 B;  5EV7 A;  1C8N A;  1W9Y A;  2YMZ A;  3LQC A;  1HV1 A;  1OLR A;  1XNB A;  4LBO A;  1RB8 G;  3G6J B;  5DZE A;  4GB3 2;  5A7W B;  1QMJ A;  1ZZ7 A;  4QB6 A;  4ZZ8 A;  1A78 A;  1AR9 1;  1OXC A;  3ZYF A;  1XND A;  5BNN A;  1D4M 2;  1VBE 3;  3QOP A;  1CPM A;  1OF4 A;  4QX8 A;  3RNS A;  3WG3 A;  4C0H A;  4AGV A;  4CUC A;  1ST8 A;  1UCX A;  1YNA A;  1CAV B;  4QHO A;  4BMB A;  1S0B A;  4OMC A;  4K6B A;  5A1A A;  2EID A;  5JR2 A;  1BK1 A;  1R08 1;  5FP3 A;  2NQY A;  1W8H A;  4XDO A;  4N53 B;  1BK0 A;  5FZ1 A;  4HMZ A;  1FX5 A;  3MLJ A;  1DFQ A;  2QQN A;  5K8S A;  2FCU A;  3MW4 A;  3MLL A;  3THC A;  2RMU 2;  1HQL A;  4H14 A;  2JIJ A;  5A3W A;  3WHT A;  4JQT A;  3TOJ A;  2VOW A;  1PM4 A;  1UN1 A;  1B35 B;  2JIC A;  2HJI A;  2WA3 A;  5D2A A;  4A4A A;  3K3N A;  2XGX A;  1QDO A;  5F9T A;  1H6Y A;  1JUH A;  5IVJ A;  4NHL A;  4QM8 A;  3WF4 A;  3LEG A;  5C9A C;  1HRV 3;  1RUF 1;  4NOT A;  2VMI A;  2BW8 A;  4PBP A;  5BUV A;  3WG4 A;  3GAL A;  1MZ5 A;  2VM9 A;  1F8V A;  4YG3 A;  3O14 A;  3ZMO A;  5FPL A;  3UNP A;  1GBG A;  2ZPX A;  1PGW 1;  4QMA A;  4YZ3 A;  4URA A;  1ULO A;  4Q8K A;  1UYY A;  4MV2 A;  1C4R A;  5DAX A;  5FZE A; 
#chains in the Genus database with same CATH homology
 4ARX A;  1UMI A;  2X10 A;  3CDZ B;  1F4A A;  3I2H A;  5J1X A;  2Z4F A;  1I5P A;  4CU6 A;  1EUT A;  4A3Z A;  5IYY A;  3ZM8 A;  3MV0 1;  3T08 A;  2JKX A;  4QB2 A;  2VO5 A;  4UAP A;  4XZU G;  3FHA A;  3GM8 A;  3LPG A;  5C71 A;  2WAA A;  3LE0 A;  4QX2 A;  2X05 A;  4RYD A;  4E8C A;  1JZ3 A;  2VCC A;  4DEQ A;  5HXM A;  2VOT A;  2DDU A;  1OH4 A;  1J83 A;  1NUK A;  2J22 A;  4CUB A;  5JMO A;  2VL4 A;  2R7E B;  5G04 L;  3OBA A;  3DYM A;  4QAW A;  3T09 A;  5JXJ A;  5DPN A;  3I97 A;  1GUI A;  4LQR A;  5C7G A;  1OT5 A;  1O59 A;  3NJV A;  2EIB A;  3CKH A;  4P02 B;  3WQB A;  1UMH A;  3CZJ A;  2JD9 A;  4BXS V;  4LKS A;  2Y8K A;  3THD A;  1BHG A;  1JZ4 A;  2J1V A;  4AG4 A;  2VQU A;  1W99 A;  3FL7 A;  4JKL A;  4XUP A;  2VZQ A;  4JKM A;  4MGQ A;  2C9K A;  1UZ0 A;  4LPL A;  4DUW A;  5JXI A;  4P08 A;  2WBK A;  2WO1 A;  3I2K A;  3C7F A;  5IHR A;  1W8O A;  2ORX A;  5JUV A;  2BER A;  2L9L A;  4HG6 B;  3SEP A;  2WZE A;  2BGO A;  2VZU A;  3C8X A;  3CZU A;  5LA2 A;  3P6B A;  5EIY B;  5IFP A;  1OF3 A;  3ECQ A;  3NQH A;  2J1U A;  1TG7 A;  4CUA A;  1L7R A;  2ZEZ A;  1XNA A;  4PQQ A;  4Z2A A;  4KI5 M;  4LHS A;  3ACI A;  1JYW A;  4DUX A;  2WAO A;  2VQT A;  4E8D A;  5JXH A;  2ORZ A;  2J1E A;  4OZO A;  3UET A;  4D8M A;  4CVU A;  2QQL A;  4BJ0 A;  2DCK A;  2JE8 A;  3OGR A;  2B9V A;  3W5N A;  3K77 A;  1K12 A;  2W91 A;  1W9W A;  3U37 A;  4QX3 A;  4OUE A;  2WQ8 A;  4A6O A;  3T0D A;  2VZV A;  1CIY A;  4XUT A;  4FI9 A;  1UY4 A;  3HPN A;  1SHW B;  3I2I A;  1UYX A;  3K4Z A;  3NNG A;  4YPJ A;  1JHJ A;  3BN6 A;  4ARY A;  2W1W A;  3PUI A;  4MOA A;  3WEZ A;  3FN9 A;  3I2F A;  4MGS A;  4ET7 A;  1CZV A;  4JHZ A;  1NAE A;  1NX9 A;  2YC2 A;  5G05 L;  2WYS A;  2ID4 A;  1JYN A;  1UXX X;  5LA0 A;  3J7H A;  1T2X A;  3T0A A;  2WO3 A;  1SDD B;  1UY1 A;  2W1Q A;  2XOM A;  4QDQ A;  3MUZ 1;  4MAD A;  3CIH A;  3WNO A;  5JXG A;  1GU3 A;  3A7Q A;  1UY0 A;  5HPO A;  2WN3 A;  3VDA A;  1UXZ A;  3OGV A;  5IJR A;  3I3D A;  2YC4 A;  3I3E A;  3JXS A;  4XVH A;  2LW8 A;  2CDP A;  1XPW A;  3WF1 A;  2RJ2 A;  4IUG A;  2VMD A;  5B4X A;  1KGY A;  3T2O A;  1JU3 A;  3SKJ E;  5DMY A;  5B4N A;  1GOG A;  2ZEX A;  5I0D A;  4D0Q A;  1J84 A;  1R64 A;  3CQO A;  2W5F A;  3WNN A;  2J1T A;  1JZ5 A;  2VTF A;  2E32 A;  4L0P A;  3OB8 A;  1EUU A;  3I2J A;  4XUN A;  2B4K A;  3MBW A;  3LPF A;  2W9X A;  3DYO A;  2VC9 A;  2VZR A;  2RVA A;  2VZT A;  2ZEW A;  3SEE A;  4PF1 A;  4QX0 A;  4GWI A;  2RV9 A;  3I3B A;  4QDS A;  4CU8 A;  4A42 A;  1W9T A;  3F2Z A;  3A22 A;  2QQO A;  2XHN A;  2J1S A;  1XNT A;  3HEI A;  2VZ3 A;  4TTG A;  3NJX A;  1RYY A;  3HOB A;  3BGA A;  3A21 A;  4BK5 A;  3D3A A;  3SKV A;  1H6X A;  2WUH A;  2KD7 A;  2VMC A;  2W3J A;  4XUQ A;  3VD5 A;  1GNY A;  3III A;  1L7Q A;  2WO2 A;  2QQK A;  2VZS A;  2C26 A;  1W0N A;  3MO4 A;  2J1R A;  3VD7 A;  2E31 A;  4CU9 A;  3HN3 A;  5LCW L;  3WNM A;  1KEX A;  3EB7 A;  2E33 A;  1JZ6 A;  3EYP A;  3K46 A;  5DN2 A;  4A45 A;  1O8S A;  2Y6L A;  3MV1 1;  1NKG A;  2VZO A;  1LNS A;  4AAX A;  2YFZ A;  1ULP A;  3NRU A;  3VD9 A;  5C70 A;  2VZP A;  3I2G A;  3IAQ A;  2Y64 A;  2CDO A;  3HNY M;  3ACH A;  4MO3 M;  4PT6 A;  4XUR A;  2QBX A;  4KMQ A;  2WAB A;  4DXR A;  2V72 A;  2HYX A;  2Y6G A;  4JX0 A;  3A23 A;  2ZEY A;  4P00 B;  3OGS A;  3PUH A;  2YG0 A;  3FHQ A;  4A41 A;  2WN2 A;  3GDB A;  4CU7 A;  2V5D A;  3C7H A;  2VJX A;  4DXT A;  2W87 A;  2YB7 A;  2BGP A;  3ACG A;  3ETP A;  1US3 A;  3GXU A;  3VDC A;  1P8J A;  3HNM A;  4QX1 A;  2YFU A;  3UES A;  4ZZ5 A;  2W94 A;  1GQP A;  1JYX A;  2ZXQ A;  3OEA A;  4RN5 A;  4GWJ A;  3WNL A;  5LA1 A;  3WF2 A;  1IQD C;  4W8J A;  2Y6K A;  3DEC A;  3OG2 A;  4W50 A;  5FUI A;  1TVG A;  3AC0 A;  2EIE A;  1OD3 A;  4OMD A;  3C7E A;  1DYO A;  1UWW A;  1CZS A;  1US2 A;  4XUO A;  5EJ1 B;  1JZ7 A;  3CMG A;  4KWU A;  4DEV A;  2EIC A;  3K75 B;  3HNB M;  4DUV A;  1CX1 A;  4QB1 A;  1PMH X;  3T0B A;  1UYZ A;  2OKX A;  3W5M A;  1UY2 A;  2C4X A;  3IB3 A;  4QPW A;  2W92 A;  1JYV A;  3K4D A;  3WF0 A;  3LEK A;  1GMM A;  3IDA A;  4ZXE A;  4OYU A;  2VME A;  3P1I A;  3WNP A;  3VD3 A;  2VMF A;  3GGL A;  1F4H A;  2VCA A;  1GOH A;  3OEB A;  4P5Y A;  1HN1 A;  1W8N A;  4QDR A;  2Y6J A;  2HLE A;  1JI6 A;  1K3I A;  3WNK A;  1CZT A;  4BDV B;  2W1U A;  2J7M A;  2LS6 A;  2J1A A;  4M4R A;  1PX4 A;  5CZK A;  5CYY A;  3LEI A;  1PMJ X;  3DYP A;  4DXS A;  2VZ1 A;  2XON A;  4W4Z A;  1WCQ A;  2W1S A;  2DCJ A;  3IAP A;  4A44 A;  1GOF A;  4BK4 A;  1YQ2 A;  3LQC A;  3VDB A;  4M4P A;  2E26 A;  2JDA A;  3ACF A;  5F7U A;  2V4V A;  5DQ0 A;  4QB6 A;  1MPX A;  4ZZ8 A;  3T2Q A;  4JKK A;  1D7P M;  2WDB A;  2X09 A;  1OF4 A;  3K4A A;  2BBA A;  1JZ2 A;  4CUC A;  1UX7 A;  4OMC A;  1W9S A;  5A1A A;  2BZD A;  2EID A;  5JR2 A;  2QQJ A;  2VCB A;  1XC6 A;  3C7O A;  1JU4 A;  3WF3 A;  3VD4 A;  2QQN A;  4TXW A;  2PQS A;  2QQM A;  3THC A;  3E1F 1;  3C7G A;  5IFT A;  1JZ8 A;  1DP0 A;  1WKY A;  4UOJ A;  5EJZ B;  4A4A A;  1DLC A;  2VR4 A;  4GZ9 A;  3WSO A;  1PX3 A;  1SG3 A;  1H6Y A;  2Y6H A;  3WF4 A;  3LEG A;  2QQI A;  1O8P A;  2WZ8 A;  3T2P A;  2VM9 A;  3ABZ A;  2W46 A;  3HJR A;  3UNP A;  1K45 A;  1UY3 A;  2W47 A;  2W95 A;  2XQX A;  3MUY 1;  4ZY9 A;  1ULO A;  1UYY A;  1K42 A;  4UI9 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...