4L2NA

Understanding extradiol dioxygenase mechanism in nad+ biosynthesis by viewing catalytic intermediates - ligand-free structure
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
174
structure length
174
Chain Sequence
MLTYGAPFNFPRWIDEHAHLLKPPVGNRQVWQDSDFIVTVVGGPNHRTDYHDDPLEEFFYQLRGNAYLNLWVDGRRERADLKEGDIFLLPPHVRHSPQRPEAGSACLVIERQRPAGMLDGFEWYCDACGHLVHRVEVQLKSIVTDLPPLFESFYASEDKRRCPHCGQVHPGRAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-hydroxyanthranilate 3,4-dioxygenase
publication title An Iron Reservoir to the Catalytic Metal: THE RUBREDOXIN IRON IN AN EXTRADIOL DIOXYGENASE.
pubmed doi rcsb
source organism Cupriavidus metallidurans
molecule tags Oxidoreductase
total genus 38
structure length 174
sequence length 174
ec nomenclature ec 1.13.11.6: 3-hydroxyanthranilate 3,4-dioxygenase.
pdb deposition date 2013-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06052 3-HAO 3-hydroxyanthranilic acid dioxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4l2nA01
1Q3EA 1O4TA 3LA3A 2KXLA 3QOPA 2EAAA 5I8SA 4EWAA 5FPXA 2GC2A 4IESA 3LA2A 4OFGA 2QJVA 4D7TA 4O9GA 4AQ2A 2H0VA 2D93A 4FAHA 1OI6A 5KHIA 2PA7A 4HVRA 1V70A 1VJ2A 1NZCA 1UIJA 3BCWA 3CO2A 3EQEA 1O3SA 5C6CA 3H3ZA 4E2QA 1LKNA 4E2GA 5C8WA 5JSPA 1RUNA 4R8HA 2O8QA 3SHRA 4L11A 2Q4SA 4P9GA 2C0ZA 2XKPA 3CEWA 4LUKA 3IDCB 3WW4A 2OA2A 4AVAA 1ZVFA 2EVXA 4MGIE 2WC2A 4K8FA 4ORFA 1FXZA 1VP6A 2PFWA 2IXHA 2I45A 2BGCA 2QCSB 3H1WA 4KU8A 4YSFA 3I59A 3EO6A 4QGNA 2V09A 1SEFA 2QNKA 5D1IA 4WVZA 1NYWA 2ET1A 3RYPA 4PIXA 5BPXA 3U0ZA 2VPVA 4Q0PA 1J3QA 4LA2A 1ZZ9A 3I59B 2GC1A 3KSCA 1O5UA 2ATFA 2PYTA 4KL1A 5I93A 3FZ3A 1PMIA 5LEJA 1YLLA 4X6RB 3NW4A 4I09A 1J59A 2Z2SB 1LB2A 2CV6A 5BXXA 3JZVA 4MZUA 1YFXA 1ZREA 1J3RA 3G7DA 4I3PA 4AQ6A 1ZRFA 1NXMA 4EWEA 1Q5OA 1G6NA 1ZZ8A 5I91A 4META 1GQGA 3C3VA 3H50A 2P17A 1IPJA 4QMAA 2IC1A 1LR5A 3SCHA 5KHHA 4I0BA 4IEOA 3OTFA 5I0RA 4IEYA 4XEZA 4PIZA 2PAMA 5I0SA 3ES1A 1YHFA 4AVCA 4XF0A 2B5HA 4KWJA 2ZCWA 3TNPB 2PTMA 4OLLA 2QVSB 4BYYA 1YWKA 3FJSA 3VHRA 5JCTA 3M70A 1U12A 3SCGA 3RYRA 1H1MA 2HJIA 2WFPA 2GU9A 2OZ6A 2B8MA 2Q1ZB 4MV2A 5HI0A 4IEPA 5CVRA 4QM9A 2IXKA 1DGWA 3H7YA 2ZKLA 2GH2A 5CU1A 4N9HA 5AVPA 4MH0E 1H1IA 5K8SA 4EWDA 5JSRA 3D0JA 4MGYE 1O3RA 4UBGA 3O14A 3E6BA 3E5XA 1I6XA 4QM8A 3MZHA 1ZRCA 4YNIA 1ZZCA 2FQPA 4Q0VA 4WBBA 2D5HA 1CX4A 2Q0AA 4RD7A 1O7FA 4XFBA 3EHKA 4Q0UA 3SCFA 1UW8A 5I8YA 5FDBA 3UKNA 2MPFA 4IEQA 4QGMA 5BV6A 1XE8A 1ZRRA 1OD5A 3DN7A 4EV0A 3H3UA 4I02A 1Q43A 4XFGA 5KHJA 3E5QA 2E9QA 3NKTA 4HN1A 3IBMA 3LZZA 3D82A 4PJYA 4HLTA 4I0AA 1SQ4A 3EJKA 3MPBA 2PAKA 4O9EA 1RC6A 3LWCA 4NVPA 3H1MA 2XKOA 2XLGA 3DV8A 4MUVA 1RGSA 1XE7A 1YFYA 3ES4A 2XGXA 1WA4A 3DL3A 1DZTA 1J3PA 4EROA 1UPIA 1HW5A 3NL1A 3UKTA 4F8AA 3H9AA 4Z82A 3QACA 4KWLA 4XFFA 4IETA 1VR3A 1J58A 3IDBB 1J1LA 1RTVA 4AVBA 3S0MA 4BHPA 3S7IA 4HSJA 2OZJA 5FLJA 2D5FA 3RNSA 5FLHA 3FWEA 2H6BA 3SXWA 3RZZA 4KU7A 2GAUA 3BALA 3FFQA 3RPQA 3PVBB 2Z69A 1NE4A 1ZX5A 4Z07A 4LULA 4PIYA 2DCTA 2BNOA 1CAXA 5LRRA 3WW2A 3NSTA 4N9IA 4I01A 4Q29A 4E2SA 1TQ5A 5BY5A 3ROUA 1NE6A 5JSOA 1CAXB 5LRSA 5EFUA 4LEJA 4TLFA 3ZDSA 3U10A 1QXRA 4Q0QA 2VQAA 5FQ0A 4WZCA 2BYVE 3U11A 5J48A 3RYKA 1GQHA 3GYDA 1YFWA 3FHIB 4ZU4A 3PLQA 3D0SA 5FCCA 3KMHA 1SFNA 1YFUA 2K0GA 4IEZA 4JTOA 5FQ0B 1CGPA 4DINB 4FBFA 3NVCA 5I0TA 1YUDA 3E6DA 3HIFA 4H7LA 4HMZA 1QY4A 3ELNA 3IWZA 4XF3A 3TNQA 3KCCA 5I0UA 3S7EA 2PHLA 1CAUA 3E5UA 3DKWA 1XRUA 1QWRA 5KHGA 1I5ZA 1WGPA 1X7NA 2FMYA 2BNNA 2EA7A 4F7ZA 3H8UA 3ACLA 3KGLA 5LEKA 1CAUB 3LAGA 4XF1A 1ZZ7A 5F1RA 3OGJA 1EY2A 4ZU7A 5J7MA 1EPZA 3H1YA 4IERA 3N4MA 2IXIA 4IEXA 1ZZBA 4XFCA 4B29A 3MDPA 2VECA 1RL3A 4LA3A 2XLFA 1O3QA 5FLIA 2UYBA 3IIAA 4UXAA 4ONUA 1WLTA 2UY8A 3LOIA 4QGLA 3UKVA 1PM7A 4JTNA 5T3NA 2CAUA 4FT8A 2F4PA 2XHKA 4HN0A 1IPKA 2MNGA 1UIKA 3SMHA 2GZWA 4I2OA 3BPZA 1QXJA 5CADA 2IXJA 3BU7A 1O5LA 1EP0A 1JUHA 2MHFA 3E97A 3NJZA 4LTAA 1X8MA 4YARA 4BH9A 1UCXA 2ETEA 2O1QA 2IXLA 4JV4A 3FX3A 4CYDA 4QXKA 2BNMA 4QX5A 4J1WA 4XF9A 4GULA 2GC3A 2XLAA 1UD1A 4YRDA 1Y3TA 1Y9QA 4MX3A 4R52A 2H6CA 4XFIA 5JR7B 4IEUA 3M3IA 2OYZA 2OPKA 3I54A 5JAXA 5FPZA 2GC0A 2PHDA 4X6QB 4D7SA 3RDIA 3KGZA 4LUMA 1CAWA 1RUOA 1X8EA 3CJXA 1ZRDA 1CAVA 2UY9A 2Q30A 2HKXA 5I8TA 1X82A 2PQQA 1DGRA 1DZRA 3R6SA 1CAWB 4XFAA 2Y0OA 2CGPA 3L2HA 1OMIA 1CAVB 5KBFA 3GBFA 2IXCA 4XETA 3PNAA 4JVAA 2XL9A 3ETQA 4UBHA 5E1RA 1ZZ6A 3B02A 4XFHA 4IEVA 3FE5A 3CL1A 4HVQA 1LRHA 3USSA 2BEOA 3HT1A 4HSLA 3MYXA 2UYAA 5E16A 3WW1A 2N7GA 5BUVA 3OCPA 3BB6A 5EZWA 3LA7A 4YYOA 4BIFA 4KWKA 4ZU5A 3CLPA 3WW3A 3I7DA 3CF6E 4XF4A 2B9UA 4HZFA 1EYBA 2K9ZA 2CAVA 4L2NA 3OD0A 3ST7A 1FI2A 4IEWA 4LLOA 4Q0SA 2D40A 3EBRA 4MGZE 5KHKA 3E6CC 5J3UA 3HT2A 4AXOA 2QDRA 1L3JA 4MGKE 1ZNPA 2ET7A 3H7JA 3OF1A 4HVOA 4A2UA 2XL7A 1O3TA 4J1XA 3HQXA 1OFNA 1FT9A 2PAEA 4FAGA 4HBNA
chains in the Genus database with same CATH superfamily
1UX7A 1VBD3 4B7EA 1JOPA 1W03A 3U1XA 2PELA 1BK0A 4CCKA 2YC4A 3QOPA 4QX0A 2EAAA 4BQ3A 5L36A 3C8XA 5JMCA 2GC2A 2CDPA 1HRI3 4IESA 4DUXA 3HOBA 4FPLA 3HR9A 2XG3A 4O9GA 1W8WA 3CIHA 4BMEA 5B2GB 3ZN5A 2WO7A 4QT6A 1RUH2 2PA7A 1ULPA 2VMHA 2JDMA 1LU2A 1V70A 3KWVA 3TYJA 3S5AA 4XVHA 4KGGA 4ZXKA 4DFSA 3P6BA 4FPOB 1PZ8A 4BQ5A 3HBZA 1NY71 2ADEA 5CG9A 5F6KA 3H3ZA 4E2QA 5FZ1A 1J84A 3O1TA 2HWF3 3FLTA 4R8HA 3LE0A 4A44A 4L11A 1OLQA 5BNOC 3ZXEA 4LO4B 2R073 3CEWA 2VY0A 2ZXQA 4AVAA 4KBZA 1W2AX 5KXEA 3USUA 4MG2A 2DTYA 3KS7A 1HB1A 3IAPA 4IW3A 2WC2A 1DZQA 1BCXA 1RUF2 4Y1VA 5L9VA 1LHOA 2D6NA 5CEHA 5C4WA 1VP6A 4EZ4A 2PFWA 4EYUA 3PVEA 2I45A 2BGCA 2VZSA 4KWUA 3W20A 1I9RA 1FYUA 5AFBA 4KU8A 2BBAA 5LA0A 3C2UA 3MGUA 3USUB 2GP3A 3EO6A 1CESA 1V9U2 4HOOA 3WP5A 2JE7A 1JUIA 5HBAA 1IS4A 5J1XA 1ZYBA 1HV1A 1NYWA 5C4WB 3T0BA 2VW1A 4FO9A 2FMDA 3Q8EA 5JZGC 1VMFA 4LKFA 4H7MA 3OY8A 5LB6A 5GZCA 1XU1A 2DUQA 3H8OA 2BOIA 1CIYA 1T6GC 4LIVA 1UMIA 3KSCA 1O5UA 2WNUC 2X53S 4CZSA 4LHNA 3WNPA 5SV5A 1AL0G 1PMIA 1YLLA 4X6RB 3NW4A 4WZFA 4I09A 2WJSA 3OY8B 5A3TA 5ACA1 5BXXA 1IQDC 1H9WA 1SG3A 2EIDA 1K3IA 2WSUA 4XJAA 2VMDA 2YBSA 1YFXA 1LGBA 4N7IA 1ZREA 2FDHA 1S0FA 2SBAA 1EAH2 2AC1A 4EWEA 2W46A 2XH6A 4RHV3 2W1SA 5M0TA 2JB4A 3LPGA 3OPTA 1ZZ8A 2JE8A 5HCAA 4NPMA 3C3VA 2WRAA 1ASJ3 1IPJA 2RS52 4YW2A 2IC1A 1LR5A 4M01A 3SCHA 1KXGA 5KHHA 2E7QA 4A6SA 5JOYA 4I0BA 4IEOA 1WA6X 5D8AA 3AMQA 1CR7A 1I1EA 3PTRB 4IEYA 4DPNA 2OPWA 4PIZA 3VD4A 3KV5A 4H3WA 4UW3A 1VBB2 3ES1A 1SPPB 1TMF2 1YHFA 2BU9A 1KD7A 3U4SA 1G9DA 1GU3A 1YYNA 2GSYA 2LALA 2RDRA 4QXCA 4OZOA 4AVCA 5ANQA 2B5HA 2ZA9A 4P00B 5L7OA 4B7KA 5D8AB 2E26A 5TSWA 3P3NA 2JIJA 5GLTA 2Q8EA 1VAVA 4RS5C 3H42B 4M0HA 4DB5A 3I49A 1OQEA 2QVSB 2YZ4A 4NIAA 5J36A 1H6YA 1GICA 4Q1RA 1VBC3 3MIHA 5JCTA 2BUKA 5L7OB 4G9SB 4W4ZA 5JR2A 2HJIA 2WINB 4A7YA 1D7PM 2OX0A 2VNVA 2WFPA 1W8OA 1MS9A 2YHJA 2VXJA 5FYCA 4HANA 4LOSA 4RL7A 1S0JA 4W50A 4Q4W1 2HEYF 2YGMA 1NZIA 5GJ6A 5HI0A 4OI4A 3DGTA 2PHTA 3VBFC 3DYOA 4YW5A 2IXKA 2MEV1 4AI8A 3H7YA 4UFHA 1WLDA 1XNKA 4AVSA 3OEBA 1WW7A 5T5OA 5AVPA 3GZAA 3VBSC 2FDJA 5EIYB 1G9CA 1XYOA 2RHPA 5K8SA 1RHI1 1ULGA 1J1TA 4LLFA 1YI9A 4Q8LA 4UBGA 3ZYHA 4R4ZA 3IT8A 3E1F1 3WXPA 1FMD2 2XJVA 4QDRA 1ZRCA 1RUD1 4Q0VA 4DXSA 2V73A 1PK6C 2CGNA 3JU9A 4SLIA 4XE9A 2WWJA 3L9JT 1VBD1 1GP5A 2W3JA 3SCFA 1JZ7A 2VCBA 5FYIA 2PHWA 4JZRA 2JXAA 2MPFA 4IEQA 2JG9A 2DURA 3ZOIA 4ASLA 4IE5A 1GYKA 3AYAA 1COV2 5FZ3A 2RMU3 3POFA 4AFCA 1Q43A 2VBBA 3WDUA 1OUXA 2QUOA 4LITA 2VTXJ 4BLJA 3KQ4B 2JG9B 1X9TA 2BVBA 2WA3A 5FY5A 3HWJA 3VDBA 3LIHA 1MPXA 1X33A 4DNYA 3IBMA 1OSGA 2HWF1 5IT6A 1OF3A 3TEZA 5C71A 1PMHX 2UU8A 4PDWC 2R071 4HLTA 1AYN3 2ZGMA 4LO6B 3DPRA 1HDKA 2TEPA 3LEIA 4KBBA 4QHZA 4QQPA 4UWDA 4XIKA 4I0AA 5E88A 1NAEA 2ZX3A 2Y64A 1W3VA 1PNFA 1NY72 4YVWC 1RUI3 2WN2A 4OUEA 2GH8A 3DPRB 1ENQA 3VHOA 1D2QA 4BQ2A 1YFYA 2JKXA 3LEMA 1T6BX 3ZN6A 3ES4A 4IV3A 4YGCA 2D7FA 1W8NA 2DF7A 3UNPA 1NCRC 2ARAA 3C7GA 4AL9A 4CP1A 2BWAA 4CU7A 3OBRA 4BPZA 3L2YA 3MW2A 1AR82 2X05A 4LIUA 4DXTA 4HKOA 4KGQA 3ZN6B 4E8DA 4NIDA 4IV3B 2PLV3 2DYCA 5DAWA 2WT2A 4B4PA 1YQCA 3BODA 2RS33 1I3HA 3BOPA 4Z82A 1BQPA 2QQMA 1Z78A 4GWMA 4C0BA 1HJGA 4IETA 3AYEA 3IDBB 3R05A 3W21A 1RYYA 1J1LA 4YG6A 3POGA 4YLZA 1RXGA 2WAAA 4JQRA 4D8MA 2J42A 2XJSA 5FLJA 1G9BA 2D5FA 5LBBA 2JB8A 2R062 4GXLA 3GNEA 3SH3A 4RHV1 1S0IA 2H6BA 3O1PA 1DFQA 3P1IA 1OBNA 2QQJA 3HQRA 1ASJ1 2VZTA 1D2SA 3PJYA 5FOJB 1LOCA 5C3SA 3GBWA 5ACA2 1VRH3 1Q8OA 5FV3A 1BBT1 1XU2A 2SLIA 1O59A 5F5IA 1L7RA 2ZMKA 1W39A 2ZMLA 3BALA 3FFQA 5LBCA 2DVFA 3N9PA 3VBHA 4A6OA 3K51A 3HNBM 5BNNA 5CAZA 4LULA 4QKFA 2R7EB 2VMIA 1SCSA 2VZPA 4FTEA 5A6XA 4URTA 3WDYA 4IV1A 4P14A 3OB8A 5C3OA 2A6XA 5IK8A 3VBHB 5BNNB 3WT3A 3WNMA 1UOBA 4COWA 4N90A 1VBC1 1EUTA 1G8WA 4LPLA 3ROUA 4Y4YA 4CCLA 5JSOA 3T4VA 2D6PA 3RSJA 4LMFA 4IV1B 3KZ4C 4AHYA 1STMA 1AJKA 4TLFA 1DHKB 2R49A 4ZS2A 4K8RB 3PIGA 2D6LX 2VOWA 1QXRA 1SMVA 4RQPA 4W65A 5FQ0A 1AF9A 1LOGA 4P9JA 1QJFA 1APNA 4ISRA 4L8QA 3RYKA 3KLSA 1GQHA 4HL0A 1H2LA 1QJU3 3GYDA 5JIAA 1ODNA 1FV3A 3WG4A 4RQPB 5FQ0B 5J96B 1PZ7A 4LK6A 4KMQA 3LOBA 1WMFA 2ZGLA 1W90A 3DEMA 4Q4W2 4D0QA 1POV3 3UL2A 5HXMA 1QOOA 1ZBA2 3LD8A 2DUPA 4XF3A 5GLWA 2MEV2 5FYMA 1GNZA 4IE7A 2UWAA 3WG1A 5T5JA 4OHYA 3S7EA 3THTA 3E5UA 2BGPA 4N53A 1LENA 2E31A 2A6VA 2CNAA 5KHGA 1I5ZA 2B4KA 1RHI2 1KJRA 1OH3A 2JKBA 1WGPA 4YZ2A 4YVSC 1X7NA 5FZHA 1WW6A 3NV2A 2FMYA 5LBFA 2YY1A 2RMU1 1W0NA 2ADDA 4XZUG 1BKZA 1RUD2 3PUIA 5LEKA 1OOPA 5IK7A 1XNCA 2AH2A 4NRQA 3D4KA 1ND2A 1VBD2 4N53B 5FZ4A 1YJLA 1ZZ7A 3AYCA 2CSGA 4QDSA 1C5IA 4AVTA 3IMMA 1UOFA 5J7MA 1SZBA 3PU8A 4XBNA 3C7FA 4XBLA 4AAPA 5ISLA 1EPZA 4FXKB 1AYN1 1OOPB 1XNBA 3H1YA 1YXWA 4LBQD 4ZZ5A 3WLUA 1ND2B 3T2TA 5AFEA 5LW9A 2BFUL 3AP4A 4MVTA 4Q4X3 3FFZA 1K42A 3TN93 3ZSKA 3Q8AA 2D6MA 3CU7A 2FZ1A 4XW3A 1CN1A 3VBRC 2AUYA 1RUI1 1O3QA 2UYBA 2ZGOA 4EN7B 1GOGA 2YG0A 4RSUA 1XJAA 2HWF2 3MFAA 3NV3A 3VGIA 1CONA 1YNAA 4CPBD 4A4AA 3LOIA 1V6OA 1JOBA 2R072 1H4HA 1VBE3 2NN8A 2RG4A 1V6KA 2XXZA 4C1XA 2ZEZA 4URAA 2MNGA 1GWMA 1W2NA 2IFWA 3ZSEA 1UIKA 5FZLA 2GZWA 4C90A 4ASKA 3VD7A 1IPSA 2D3PA 2JDNA 1F5FA 1QXJA 3AMPA 2PLV1 4JRLA 2Y33A 2BWCA 4YFZA 1HXS3 2RS31 4CCDA 2ORZA 2CGOA 3RJ2X 3CZUA 1CZSA 2BP6A 5CFDC 3CDZB 3WF0A 1V0AA 3TAYA 5JUVA 5E6HA 5F7UA 3ETPA 3KT4A 1BXHA 4BK5A 2VOVA 2ZBJA 1TEIA 1D0HA 2VMEA 3M8LA 4UI9L 4HT1T 3FHAA 3M2MA 1JHJA 3RWKX 3U07A 1XC6A 1UCXA 3V64A 2BGOA 3VKNA 3LDBA 2W94A 2YFUA 5FXWA 1QIQA 4AQSA 1XNTA 1BVP1 2G9FA 2BNMA 4J1WA 3B5LB 5EQUA 1LHUA 3BI3A 1H6XA 4OCTA 1EV13 1H1AA 1VRH1 2RDNA 1WW5A 1Y3TA 3NNFA 1RJ8A 2W68A 4MX3A 1E5SA 3SQOA 4D69A 4CUCA 4HKLA 1Y4WA 1MS4A 3M3IA 4IEUA 1HJFA 4NR1A 4JC1A 5FREA 3ZXJA 1LODA 2PHDA 4OUSA 4X6QB 3EMRA 4RHV2 3HQUA 2RJLA 2RR13 3ZPOA 4D7SA 3ZIWA 4QX7A 1CAWA 4F3JA 1VLNA 2HYXA 4OZXA 2Z79A 4AR2A 1AUYA 1ZBE3 4G4FA 1ASJ2 1GP6A 1O6UA 3OEAA 1QQP1 2HKXA 3ZFEC 3JD73 3WP4A 3M4FA 1LOFA 5A32A 5KXDA 2EICA 2QQUA 5FPAA 1AYM1 1CAWB 1JXNA 5CFCC 1CZVA 5KXCA 2CGPA 1JN2P 1H9PA 2C5DA 3HMYA 3O0XA 2C4XA 3DXUA 5KBFA 4BQ1A 5JOXA 4UFMA 4XETA 3W9AA 2ZABA 3JQWA 2XL9A 5A32B 1IG3A 2B46X 1ZZ6A 3POJA 1IHMA 4XFHA 4IEVA 2AR6A 2YROA 3PVNA 4LNVA 2ZGSA 1ULCA 1YC61 3AX4A 2HLEA 3WDWA 1O8PA 2GNBA 3PDQA 3HT1A 1UU4A 1VBC2 1F4AA 1ND3A 3NV1A 1QJU1 4HSLA 3J8F3 3JCIA 3MHZA 3WUCA 2D6OX 2VULA 2X5IA 2Y0IA 3BB6A 3WF1A 4AI0A 5H9PA 4BIFA 2P3IA 1O91A 3FUOA 4LXLA 3X29B 1QOTA 2WQ4A 4WVMA 3H8RA 1POV1 1ND3B 3CF6E 3ZXAC 4P9LA 4XF4A 1CZTA 4XAAA 3ZYIB 1POQA 2X5IB 3MUZ1 4MADA 3DCQA 2A6ZA 5A7WA 5T50A 2TUNA 1FI2A 3WY6A 2A6WA 5DUWA 5C8CA 3E6CC 3NNMA 3KCXA 5T52A 1ND2C 1RINA 1GUIA 3K4DA 4WVMB 4OI0A 1HV0A 1ULDA 4F83A 5FBJA 1SBFA 1VRBA 4GD4A 2ORXA 4MGKE 4TN7A 4YW1A 2W1WA 3O1RA 5IAVA 1VBA3 3OF1A 5A7WB 5C8CB 5IJRA 4FAGA 3AVSA 4HBNA 3I2IA 4D6SA 4YGDA 1Q3EA 3AVRA 2WABA 3MV11 3LSDA 5CG8A 1UQXA 3WOGA 1S0EA 2XBO3 3HNMA 3LA2A 2QJVA 4ZHNA 2D93A 2RMU2 4XURA 5EV7A 5JI9A 1OI6A 2VVDA 3J9SA 1IG0A 5KHIA 2C9AA 1FOD3 2ZX2A 4FI9A 3TN91 1BK1A 1GZ9A 1YCIA 5IVJA 5FK8A 3SEEA 1RJ7A 1J83A 3KT1A 3RI8A 5C6CA 1Y43B 3PVOA 4XBQA 1LKNA 4K20A 1CJDA 4FFHA 2DBNA 4EN0A 5JSPA 2O8QA 1RUNA 3AKSA 2Q4SA 1HIXA 1AYN2 1VBE1 3T1MA 1WMDA 2C0ZA 2XKPA 5FPUA 3IDCB 4FPJA 2UWBA 1ZVFA 3I3EA 5F3EA 1PO23 2HH9A 3WEZA 1NT0A 4QQOA 3W5NA 3SH4A 3N7KA 4ORFA 4XDPA 2DWRA 1UAIA 3NO8A 4X8NA 5BNOA 1RUI2 2R1BA 3BOWA 2QCSB 3AM2A 4BQYA 4Y4RA 2QDNA 3LB9A 4QGNA 2V09A 3R4UA 2D6KA 5JOWA 1JZ8A 4FFGA 4WVZA 4D3WA 4DXRA 3BGAA 2ET1A 5BNOB 2ZX1A 3U0ZA 4Q0PA 3GJAA 3ZFFC 3POWA 3FL7A 3TRSB 3UT0A 4C91A 3ZXFA 2YYOA 3U37A 2B9VA 2VUDA 4CXYA 2PLV2 3OBZA 4QD2A 3ZX7A 4MSVA 2W39A 2J1RA 2PYTA 2RS32 4AHXA 3ABZA 5T5PA 3FZ3A 5I93A 5ANNA 3T2PA 5JZGA 4J6GA 1NUKA 4ZPIA 1EV11 2XR4A 1J59A 1NKGA 1LB2A 1NA1C 1JI6A 2W95A 4MZUA 4PF5A 1Q8VA 1W8FA 2WNUA 1LOFC 1J3RA 3J7NA 4I3PA 2LTNA 4AQ6A 4G3YC 2RR11 3KV4A 4RGGA 4AWDA 1Q5OA 3R4DB 5JZGB 2Y6KA 1MS1A 3OYWA 5I91A 5A80A 2QKDA 1GQGA 4LO5B 4XZPA 1XE0A 3AKQA 1NLSA 3J4UH 5C7GA 1K5MC 2ZZQA 2I74A 4Z92B 5FPBA 2WNUB 1VRH2 2QZ2A 4S2HA 4UFLA 3WF3A 4ZKTB 1NOVA 5DZEA 4ISQA 2PAMA 2A7AA 3NNGA 1RUJ3 4H55A 3ACIA 3OYWB 1NQDA 3WQBA 1RIRA 3ZXGA 5GALA 1LAJA 2V5DA 2W92A 4R9DA 1X50A 2DU0A 2H0BA 1AX2A 4YG3A 2R043 1LCLA 2ZCWA 2VG9A 3ACGA 2PTMA 4OLLA 5FP3A 2O14A 3NQHA 4HKWA 5GZEA 3PIJA 3P5BA 3H0OA 4PHZA 2AGSA 2AYHA 2WQ8A 5FKCA 1GQPA 1LOAA 1UOGA 5IUQA 1AYM2 5FZMA 3WP3A 3J8F1 1F31A 3M70A 2VMFA 5CB7A 3SCGA 4BIOA 1H1MA 1WBLA 1K5JA 1JZ2A 1SLBA 4RS5A 3CJIA 2GU9A 2OZ6A 1OUSA 2B8MA 5A70A 1FMD1 2DTWA 4MV2A 2BZDA 1PX3A 5CVRA 3T08A 2WDBA 4BU2A 5EJ3A 4DRVA 3THCA 4CCMA 1WZXA 2FHRA 1QJU2 2GH2A 4RS5B 4WVWA 3RZGA 2EXJA 1XYNA 3ZXKA 1H1IA 1REDA 3FBYA 4R9AA 1P8JA 3VBUC 4EWDA 1QEXA 5JSRA 2Y26A 2Y6HA 3VBFA 4MGYE 3K48A 4AVVA 3E5XA 1VBA1 4QM8A 2LROA 4CUAA 2IVIB 2FQPA 4WBBA 1SACA 3ITQA 2AZ5A 3VBSA 3VHPA 4A3ZA 4BK4A 1XBFA 2VMCA 4XCBA 3EHKA 4XUPA 4N43C 1OKOA 4NPLA 3VBFB 2VL4A 3AZZA 4YGBA 5E89A 2ILMA 3UKNA 2JG8C 2XBO1 1W05A 4DIQA 5JOZA 2VCMA 1PK6A 1WUVA 1XE8A 3VBSB 3LCPA 5KWRA 4JGZC 4EV0A 3H3UA 4UF0A 4I02A 3LQCA 4XFGA 1FOD1 3VKMA 1KJLA 4Q4V3 2ZEWA 3VDCA 4MGQA 3E5QA 1IGOA 3HNYM 4LBQA 1PK6B 2XMLA 3AYDA 3K77A 4UF0B 3WHTA 4COVA 1JYNA 5FO8B 4NROA 1JBCA 2Z42A 2Q8OA 1PO21 1SQ4A 4LBJA 3T0DA 3TN92 3ZSLA 2O8OA 2R1DA 4LBQB 2YPDA 2PAKA 1AR81 4PI0A 5A7QA 1ULEA 2VZRA 4CPBA 1AR63 4PDWA 4UW5A 4Y3OA 2VNOA 3I3DA 1RC6A 5G04L 4B3NA 4JKMA 5CA6A 3RZMA 4ZZ8A 3DV8A 1FAYA 1RGSA 1VBE2 4CE8A 5CKQA 2WFF3 3WDXA 4ASMB 1W6MA 3DL3A 1DZTA 4PDWB 4YVWA 3U4XA 4M3CF 5FUPA 5H9RA 1HQNA 5FP8A 3J7LA 3WG3A 3OGRA 4M3CE 2R061 1W9SA 4F8AA 4E4SA 2FDKA 3S57A 5HXVA 1HXS2 1LTEA 5A3UA 1NCRA 1NQJA 1W6MB 4K40A 3K3NA 4YVWB 3SISA 4KWLA 3ZYJB 4XFFA 4FPGA 2J1SA 4LBKA 4EZHA 3GGLA 4DXZA 2AREA 5CZKA 5EWSA 3POSA 1RTVA 2VUJA 4BHPA 1ENRA 4Y5Z0 3LFIA 4W6WA 3WF4A 3KF3A 5LA1A 2WLQA 1NCRB 3GXUA 3MEPA 5LK5A 3RWNA 2VBPA 5FLHA 2D98A 2VCAA 4GKXA 3POYA 4AFMA 4RFT0 3WG2A 1EV12 2HWC3 5CIRA 2V4AA 4DUVA 3DYMA 5F8PA 5DABA 4BQ4A 1W99A 2EIEA 2AENA 1RUJ1 2F6BA 1DCSA 2RV9A 1FNYA 4KNCA 5FMOL 2W87A 4A41A 1ZX5A 4NUBA 2RR12 4NHYA 1MEC3 1MR5A 1ZBE2 2R041 2ZS6B 4LHLA 1KRIA 1ONAA 3A21A 1DGLA 1N1VA 3CJIC 4UAPA 5LRRA 3JD72 3WW2A 4EQVA 1Y9GA 4AF9A 3Q8BA 5IVFA 2PHUA 4K1YA 2KM2A 4XDQA 3T0AA 3HJRA 5BY5A 3RZJA 2DCKA 4E4DX 3MIBA 1JYVA 1NE6A 1N47A 4W6YA 5FYZA 2VZQA 4IE0A 1JZ3A 5LRSA 5F3CA 5FMCA 3A0KA 4GALA 1XPWA 4QQLA 4LO8A 1R1A3 5HV4A 3AKTA 3DYPA 3O0WA 5IYYA 1ZBA1 2JDAA 4DOUA 1AX0A 5FYHA 3U11A 5C70A 2QQVA 2ZGUA 3ORJA 3J8F2 3A0NA 5FO7B 4QPIC 3W58A 5ABJC 3FHIB 3OGVA 5IK4A 4QDQA 3PL0A 2A6YA 4P9YA 3D0SA 3K75B 4INDA 4LKSA 4PF1A 3KMHA 1SFNA 4IGQA 2Q1FA 1HB4A 4NIGA 5A7PA 2BQPA 4DINB 3OGGA 4NIHA 2EXHA 2GMEA 2OQ6A 3J7HA 3CBNA 5I0TA 1W6QA 4FBFA 5A1AA 3HIFA 4H7LA 1O4ZA 3AJYA 3TWIA 1QJX3 3IWZA 4YGEA 3TNQA 5J37A 4WM7C 4Q26A 4XABA 3WV6A 3K4ZA 3MUY1 1G9AA 3MLKA 2Y6LA 1XRUA 1PGSA 2EIGA 2P2KA 1HRI1 1W6QB 2P5BA 2WNVA 2ZGQA 4NRMA 1S0CA 1XNAA 4FTSA 1UYYA 1W2TA 3HD8B 3MIGA 1VBA2 2YC0A 3OUIA 3DF0A 2A70A 4FPKA 1C1LA 3H8UA 2FBEA 3ACLA 2JE9A 3KGLA 1UZWA 2V4VA 2YPJA 3UJQA 1G7YA 3AZXA 4Y1ZA 1KDMA 2XJTA 4BQWA 2WNVB 1OA4A 3OGJA 4YVSA 4WM8C 2JWPA 4FP2A 5FYTA 5AC93 2FDIA 1CD3G 2XBO2 4Y1UA 2XJPA 1MACA 1WCSA 2ERFA 4XJ9A 4XJWA 5FP7A 3V56A 1GLHA 4DS0A 5K7PA 4AHZA 3M3OA 2QBXA 4XXPA 4IEXA 1FOD2 1ZZBA 3UGHA 4YVSB 1R093 1UMZA 1LJ7A 2DBIA 4I3GA 4UW4A 1F5JA 3AL6A 4U2AA 5FRAA 2VECA 3MI8A 1RL3A 1AR61 2X09A 2XLFA 3WDTA 2I2SA 1UMHA 3I2GA 2JJ6A 5FIXA 4P9XA 3OD4A 5H9QA 4UXAA 5IATA 4ONUA 1W6OA 2HEVF 3NJXA 4A3XA 4BMBA 1WLTA 3AXDA 2UY8A 2CWMA 2CL2A 2VM9A 5F37A 4RGKA 3UKVA 4CCCA 1DBNA 5FAXA 1IOAA 2HWB3 2CAUA 4FT8A 1PO22 2F4PA 2VOXA 3V65A 1MQTC 2ZAHA 3VBRA 3VLBB 2P6HA 1REFA 3ZMNA 4CU8A 2OIIA 1ZRIA 4CUGA 2FCUA 1W6OB 2GMPA 4NIIA 1CQ9A 1Q8QA 2D43A 4DRRA 1WMXA 3QH7A 5DMYA 5IFPA 4I2OA 5H9SA 3MIDA 2VUCA 4YM3A 1KS5A 1RUE3 3BPZA 3LSEA 2PHXA 1WLWA 5FWJA 2IXJA 4YZ3A 2CDOA 2YU1A 3BU7A 2P37A 1Q8SA 4MXVA 3VBRB 1W6PA 4CXWA 3E97A 3N9NA 3M3CA 3NV4A 4QAWA 1LHNA 1QDOA 2PQSA 5CKNA 3I8TA 3UESA 5CFDA 1DGRN 4OULA 4BH9A 4KG0A 5DUXA 4AGRA 3QLQA 1R1ZA 1CPNA 1W6PB 1AVBA 1JTZX 2IXLA 3Q8FA 1WD3A 4JV4A 4UT5A 2JDUA 4XQ4A 5LA9A 3NNLA 4ARYA 4ATEA 4GULA 4NMIA 1YIFA 3LPFA 3WSOA 1AL23 2HWC1 4S2GA 3RG0A 4NWVA 1BLZA 1UD1A 1PMJX 3R0RA 4CDXC 4DY3A 4GMP3 5CFDB 1AXKA 3VZKA 1O4YA 3RVHA 1GOFA 4MGTA 1DG6A 1DIWA 5FPZA 3GALA 3O1VA 1MEC1 2R0FA 4LUMA 1OA2A 3ZO0B 1QJZA 3B69A 3CJXA 1ZRDA 3VD9A 2ZGKA 2DCYA 1FX5A 1OT5A 1X82A 1HB3A 5DQ0A 4D94A 5JXJA 3RS6A 2YXSA 3OGSA 4IGPA 4JDOA 3BTAA 1S0DA 2W9XA 4R9CA 3ZN4A 1RUJ2 5FZCA 4Y22A 1GWKA 1E57A 1OMIA 1XXNA 1L7QA 5LASA 3T2QA 5JXHA 3I97A 4MXWA 3ZFEA 2R042 3GBFA 3DKQA 2IXCA 2VNRA 4FPEA 3VN4A 1R1A1 3B02A 3LDRA 4GWIA 1W9FA 3OBAA 4R9BA 5CFCA 4HVQA 3VKFC 4Y22B 1LRHA 2EXKA 2JX9A 4QB6A 4QKDA 4AOCA 1W9YA 2BEOA 5A1LA 1LU1A 3ZXLA 4MXWB 3ZFEB 3N36A 1LECA 1SHWB 4NWWA 3ZYRA 4FVVA 4NAMA 5EZWA 3LA7A 4XCAA 4YYOA 1AR93 2UURA 3WZ1A 3NAPC 5CFCB 2ZACA 4KWKA 4TXWA 4ZU5A 2VTXA 2ZHLA 2HBTA 5JDBA 1UYZA 2WNVC 3W59A 4DMIA 3ACHA 3I7DA 5JPMB 4NHMA 1QJX1 1VALA 1EYBA 2K9ZA 3CHXA 5EJZB 2CAVA 3T3YA 5HCHA 3V0BA 3BU0A 3FLRA 1PHMA 3OD0A 3I2FA 3ST7A 1GBGA 2DU1A 2JIGA 3SC7X 2GNTA 1H8VA 1DYKA 3WQ1A 4QPGC 3KHCA 4AXOA 4GH4C 3LF7A 5GKAC 1WCDJ 2WYFA 4P02B 3ZSMA 3V0BB 2UWCA 3WX5A 1IZ3A 1OF4A 1ZNPA 2ET7A 4HVOA 4XTPA 3WINE 4A2UA 2NM1A 4B1LA 4J1XA 5FWEA 1OFNA 4ET7A 1OPMA 1OURA 2A75A 1PM4A 1O4TA 1X36A 2G1MA 1RITA 4RN5A 5T5LA 3O12A 3U78A 4AW7A 1XOYA 1HRI2 5AC91 5FYYA 5I8SA 4EWAA 3MBWA 1SBEA 2DVGA 5LZ6A 2E51A 3BTYA 4AQ2A 2H0VA 1QXPA 5DG1A 1PO13 4K6BA 2WZR3 5C5TA 2JDKA 3ENRA 1W2UA 2L9LA 1R091 1LHVA 4OHZA 1WCQA 3CZJA 1NZCA 3KVBA 4QX1A 4CCNA 4LOTA 1UIJA 3N9MA 1DQ6A 4XXAA 2VH9A 4BISA 4LE4A 3PUHA 4W6XA 3ZMOA 1YO8A 4E2GA 2WZPP 3EB7A 4Y1YA 2P34A 3SHRA 2BV4A 1CWPA 2W08A 4P9GA 1YRZA 3EXUA 1Z7S3 2OA2A 3WCRA 2AEYA 1TE1B 2EVXA 2HWB1 2QQLA 2NYYA 2VZ1A 4XJ8A 2VO5A 4ZS3A 4AI1A 1NG0A 1VMHA 4B4RA 1FXZA 4E27A 1AR62 3ZPYA 3I2KA 3MF9A 1SLLA 4P9WA 5IVEA 4HK8A 2IWGB 4YSFA 5IW0A 4PLNA 3POEA 1UKRA 3AP5A 4BQXA 5D1IA 5L9RA 2WFF2 5F32A 1PVXA 3NKGA 2E32A 5C3PA 5C3RA 1BMV1 5FKBA 1BHGA 1WW4A 4RR3C 2Y8KA 3RYPA 1GNYA 2VE1A 5BPXA 2VPVA 3B9CA 5FOBB 1MS0A 1W8HA 4HG6B 1ZZ9A 2P3YA 5FXXA 3I2HA 5DAVA 2GC1A 2WA4A 5IVYA 2VBDA 2ATFA 1UYXA 1AR73 1Q8PA 3KT7A 3MO4A 1ENSA 4LT5A 4PLMA 3N7JA 1AL21 5LEJA 4NHLA 5A3OA 5FUNA 5FY8A 2WO2A 3ZFFA 5IHRA 2Z2SB 3NWKA 4GMP1 4KG8A 2C26A 3EYPA 1C28A 5HV0A 3JZVA 3IDEA 4LJHA 5JMOA 5F6LB 4LE3A 2NZ9A 2EALA 5JXIA 1UXXX 4C0HA 1HX6A 1ZRFA 3T1LA 1NXMA 2FZ2A 3ILRA 4PBPA 4Y26A 3GBGA 3ZFFB 4YW3A 1WMEA 3HN3A 1NA1A 4O7XA 3ZKYA 4BA6A 3IN9A 4JKKA 2P17A 5A7OA 1QH7A 1ODMA 4QMAA 1M06G 2HWC2 1VB2A 4QB1A 5C3QA 1IQAA 2DUOA 3OTFA 4CDQC 3J26N 5I0RA 1S4CA 2VZ3A 4XEZA 5I0SA 5FP4A 1MVEA 1NA1B 3HEIA 3HVDA 3N7LA 1UZVA 2GNDA 4X8PA 1QJEA 1K5MA 3VDDC 1MEC2 3D6EA 3P3PA 5CKMA 3BPSA 4IDZA 2QTWB 1OLME 3O1SA 3RFRA 1JU3A 5FZOA 2RVAA 4BYYA 1SBDA 1YIPA 1YWKA 3FJSA 1K5MB 1WCKA 4QX3A 5FP9A 3ZYGA 1U12A 3OPWA 3RYRA 4NJ4A 2D44A 1AR91 1M4WA 3ON7A 5FZOB 4GJZA 5FJKA 4GB33 2WR9A 1R1A2 5F5AA 2W52A 4IEPA 4XJUA 3VBOC 3AZYA 5A7SA 4JDNA 2BDRA 5GZGA 5IFTA 5IK5A 1DDLA 1NXD1 3PURA 2G4IA 4L0PA 4QM9A 2E33A 4FPFA 3AZVA 2OVUA 2BVVA 4HETA 5CU1A 3B7MA 4N9HA 2GN7A 4UFIA 3WF2A 4V1PA 4MH0E 5C9AC 4QHBA 4HFSA 1LESA 3OOXA 5DUUA 3D0JA 3BIWE 2XONA 1O3RA 3AFGA 2ZHMA 5BNPC 1F15A 2RS13 2DCZA 3PUSA 1QJX2 1TG7A 1U5YA 3PJQA 5FMDA 1ZZCA 4YM0A 5A33A 4NOTA 3TEWA 1US2A 1QHDA 2GP5A 2Q0AA 4U36A 3VBUA 1O7FA 4Q0UA 2JECA 1OH4A 1UY1A 4L9BA 1C1FA 4GIQA 4CU6A 1NLRA 4FTBA 5GZFA 5A33B 1TME3 1ZRRA 2PHFA 1PO11 2PMWB 1OD5A 2WZR1 1DP0A 3DN7A 4NHKA 4Q4X1 5FXZA 3VBUB 3ZKUA 2ZX4A 4XHXA 4XACA 4N43A 1JZ5A 1ACCA 2F4LA 4GWNA 4JQTA 2YBPA 2JG8A 1UF2C 4AEDC 4GA9A 3MF6A 4LBOA 1JYTA 5AC92 4JGZA 1BZWA 3LZZA 4DEVA 1HB2A 3MW3A 4PJYA 4IXLA 2IUWA 4N43B 1S2EA 1E5HA 1Z7S1 1ENXA 3WD5A 2JG8B 3B3QE 3ECQA 1PVC3 1LGCA 4QHOA 1R092 1GZTA 4GZ9A 1HRV3 1PGL1 3MPBA 4JGZB 4M00A 5FY7A 2JENA 3ILFA 2W1QA 4NVPA 2ZX0A 1HXS1 1PGW1 3H1MA 3LWCA 2XUMA 2XKOA 2XLGA 1AJOA 4Y24A 1DQ1A 3SLIA 5K0UC 1XE7A 5F9TA 4QB2A 5FY4A 2HWB2 2XGXA 1H2KA 4P9IA 1YEWA 1JZ4A 1WA4A 3K4AA 5F3IA 4COUA 1J3PA 3ALQA 4EROA 1UU6A 5F39A 3O1UA 3KQRA 1UPIA 1HW5A 2WYSA 1IS6A 1HN0A 4RFRB 5FBZA 3AFKA 1RUE2 2NLRA 1W8UA 1AR71 3AMHA 4ATFA 3QACA 4Q5OA 1BMV2 3B94A 5FXVA 3FHQA 2WZ8A 3QD6A 5FMBA 4KI5M 1IS5A 4FXGB 4AVBA 3S0MA 3T4HB 3S7IA 1QH6A 3PTYA 1SLIA 2OZJA 2ZZJA 1F9KA 4QQ2A 1V6MA 2J1EA 4NPRA 5L9BA 3RNSA 5A6QA 1QF3A 3FWEA 3QBQA 1ZBE1 4CRQA 3SXWA 4PQQA 1H2NA 4UFJA 2Y38A 1AL22 3JD71 4PCRA 3JQXA 3KHBA 3VB9A 1UZ0A 4I30A 5A3WA 2D97A 4JRAA 4JKLA 4XAEA 4AFAA 1O8SA 1NLQA 1OFSA 1A8DA 2ZGPA 4KU7A 4FOQA 3PVBB 4IE4A 1TNRA 1KDKA 3NMBA 4Z07A 3A22A 3N9LA 2XPJA 2G9ZA 4FOYA 2D3SA 4CEWC 2DCTA 2IVJA 4CCOA 3M7AA 1CIWA 4AFDA 2BNOA 1CAXA 4LBNA 5KC6A 4CCEA 2DDUA 1POV0 3DUIA 3NSTA 2YV8A 4N9IA 4I01A 1JMUB 1V6NA 3AC0A 3AMMA 4HPKA 4Q29A 4E2SA 1TQ5A 5FPLA 2A73B 5I0DA 3B9IA 1AHSA 2IFRA 3QCWA 3ASIA 4OI2A 5FZAA 3S5QA 3N7MA 3TOJA 3VZOA 1CAXB 2A71A 4M3CA 1V6LA 5EFUA 4LEJA 1U5IA 4CEYC 3ZDSA 2WKKA 4GB31 1WCUA 4HPKB 3U10A 4Q0QA 3WUDA 1TZOA 2O0OA 2QQIA 2QFEA 2R30A 1RUG3 2BYVE 2CTVA 2E7AA 4LHKA 5J48A 2DVBA 1PNGA 3CJIB 4YWAA 2Q8CA 4M3CB 3UYJA 3GJBA 3B93A 4KQ7A 5FYUA 4CP2A 1OQ1A 3RJRA 1AR92 3HPNA 3N3HA 4M4PA 1EPWA 1YJKA 5FCCA 5FTTC 1JHNA 2K0GA 4XTMA 3BTZA 1B35C 2CU5A 2WO1A 1GR3A 4JDMA 2RS11 3NVCA 5J09A 4HMZA 4CDUC 1REEA 1UY3A 4QPIA 3ZLIA 5ABJA 5FZ7A 3IIIA 2BFUS 3RGBA 2RM23 4Y20A 1GZWA 5FYVA 4QKBA 4XMIA 5I0UA 1SLAA 1W3XA 1FPN3 2WQZC 4QPIB 5ABJB 5FZGA 4UW6A 3R4SA 5IVVA 1TME1 2Y34A 2X10A 3IZOA 3POIA 4L92A 4NHXA 4WM7A 2BNNA 3WDVA 5FZFA 4Y20B 2YMZA 1C8M3 2J1VA 4ZXEA 1CJPA 5IVCA 1S1AA 5T55A 4XJZA 1SCRA 2W0XA 4P08A 2ZGRA 1QMJA 4WM7B 5CBLA 5DAQA 2BW8A 2W5FA 3D3AA 4AI2A 5FY1A 2FDFA 4BOWA 3B01A 3KV6A 1PO12 4C8DA 2WZR2 4QX8A 4Q4X2 1BVVA 2XB6C 1PX4A 1PVC1 1DQ0A 2A5ZA 2Y6JA 4N7UA 1Y7BA 1ZM1A 2IXIA 2R32A 4WM8A 3VV1A 4FPHA 4XFCA 1HRV1 3HN1A 3MDPA 3QH6A 4Q27A 2DFCA 3MICA 2VW0A 3ACFA 4LA3A 4JGYC 5FLIA 1T2XA 1DGWX 2V72A 2YFZA 3DXTA 2QQPA 1SLTA 1LEMA 2DFBA 3CQOA 5JI7A 3O5SA 4WM8B 1Z7S2 2XDVA 2VZOA 3BN6A 1CX1A 2P3JA 3FMGA 4HN0A 2W91A 2Y6FA 4A42A 1IPKA 4IL7A 4GKYA 3RQ0A 3BUCA 2JICA 2VOKA 2BJSA 1PGL2 1QOSA 1DLCA 2B42B 1A3KA 3SMHA 1XQNA 4LKEA 3GCWA 2FCVA 1PGW2 1PIV3 2ARXA 4EE2A 5CADA 5FZ8A 4EN6B 5EXOA 2HWD3 1X9PA 3ZFGA 4DEQA 4S2FA 4O65A 2BOJA 1MQTA 1O5LA 5FZ9A 1EP0A 2A3XA 1ZA7A 5T54A 3W5MA 5FZDA 1HQLA 3OUJA 1X8MA 2WNOA 5EPAA 4MOAA 3VKOA 2GN3A 3ZFGB 1UY2A 2E7TA 2ENRA 1FATA 1DYOA 3Q8CA 4Z8BA 1MQTB 2ETEA 1BYHA 1Y9MA 3FX3A 5FZBA 1NCQC 2WWSA 3ZYBA 1AR72 4OHWA 4QXKA 4XF9A 1BEV3 3MPPG 2GC3A 2XLAA 1A8MA 5A6ZA 2AACA 2JEMA 3O7OA 4GAZA 3BVCA 4YRDA 1Y9QA 1RVF3 3KCYA 4R52A 4XDOA 5JR7B 1XB9A 3FUQA 5DDJ3 2PN5A 5FJHA 4RYDA 1WBFA 3ZR6A 1S0BA 4YZ4A 5JAXA 1F8VA 4ZONA 1S0GA 3RDIA 3DECA 1TVGA 1RUOA 3VDAA 2XJQA 4CDXA 1SPPA 3MLJA 1H2MA 1CAVA 1R64A 4P5HA 2QQKA 2UY9A 2Q30A 5I8TA 2PQQA 5GZDA 3JXSA 1LEDA 1DGRA 4QXHA 1H8TC 1OD3A 4QQHA 1BBT3 3TEYA 4AGGA 5FZ6A 3R6SA 4DUWA 4LR4A 3U14A 2Y0OA 3VZNA 1VMJA 2YB7A 3L2HA 3K46A 2HEWF 4CDXB 1CAVB 2XHNA 4YFWA 4S2DA 2VD7A 2OXBA 3PNAA 4JVAA 4XOGA 3ETQA 3LEGA 1D4VB 4MHRA 4UBHA 5E1RA 4PLOA 3FC0A 1GANA 3C7EA 3I3QA 3SNMA 3FE5A 1RUG1 3AMNA 3CL1A 1OHFA 1N3QA 4AI3A 3MYXA 5GLVA 2UYAA 4CDWA 1OKQA 1TNFA 3VL8A 3OCPA 1F2NA 1NX9A 5A6YA 3MLLA 4QPWA 2OT7A 2FDGA 3ZYFA 2DVDA 2F17A 4GB32 1IS3A 3CLPA 2EAKA 2ZMNA 4CDWB 2B9UA 4HZFA 1W04A 2HWE3 4TLGA 3KVAA 2XJUA 4EJRA 5E8AA 1UWWA 2RM21 4TTGA 4K21A 4Q0SA 3NAPA 5KHKA 2D40A 3EBRA 4MLOA 3NRUA 5J3UA 3HT2A 4YZ5A 1D4M3 4Z1VA 2QZ3A 4OHVA 1FPN1 1L3JA 1SDDB 4KH9A 5FFOC 1OC1A 2Z5WA 5D2AA 3S6PA 2RS12 1UU5A 3JBG3 2XJRA 3ZSJA 3H7JA 5FZKA 4IE6A 3VZLA 1C8M1 3NAPB 3LIGA 1FT9A 3I2OA 3O0VA 4HONA 5EJ1B 4QPGA 3KM5A 4Q4V1 1UO9A 4GH4A 4CP9A 1HKDA 2ZEXA 3GDBA 4QU2A 4B1MA 3LA3A 3T09A 1KFUL 4Y33A 3TEXA 4XYXA 2KXLA 1N3PA 4H14A 1UKGA 3AL5A 5FPXA 2GALA 4OFGA 2WT0A 4E9KA 2LUWA 4GJYA 1TME2 1LOEA 2ID4A 4D7TA 1SFPA 3LKJA 1C4RA 4QPGB 3IPVA 4GH4B 2W1UA 4CP9B 1HLCA 4FAHA 3LDKA 1OXCA 2W47A 1MS8A 4HVRA 2A1XA 5DPNA 1VJ2A 5HCBA 4B8EA 5EHDA 4BB3A 3BCWA 3CO2A 3EQEA 1O3SA 2R16A 3K3OA 1VPHA 3AJZA 3IPVB 5C8WA 5C4WC 2E63A 2WUHA 2VCCA 1OQDA 2WFF1 4XQWA 4LUKA 3WW4A 3ZFGC 3JUUA 1PVC2 2ZJCA 4Y1XA 1C3HA 4MGIE 1S2BA 4K8FA 4Q4Y3 2VR4A 4RGAA 1HRV2 5HCFA 1K12A 4Y5SA 3UGGA 2ZKNA 3GF6A 1H4GA 1UPSA 5FZIA 2IXHA 3JB8A 1PIV1 5BYNA 3O1MA 2VOTA 4OYUA 1VE0A 5FPVA 2RJKA 2P1BA 2HWD1 3H1WA 2Y60A 4H2AA 2C6SA 4C1WA 4Z2AA 1JW6A 4BZ4A 3I59A 4L99A 5KXBA 1SDWA 1A78A 5FZEA 1SEFA 2QNKA 1DQ5A 3FBMA 4A45A 1UN1A 3OPZA 5A3LA 3LFMA 1QNWA 3AXEA 1RUC3 4PIXA 4YM2A 1J3QA 5IVBA 1G86A 1LOBA 3IDAA 1V6IA 4LA2A 1LHWA 3I59B 5C5UA 1A34A 3Q9OA 4MO3M 2JDHA 3UGFA 1QJY3 1BEV1 4KL1A 4NN0A 4RR3A 4UFKA 5FR3A 4LQRA 2LW8A 3ME2A 1IKPA 2ES3A 1RVF1 2CV6A 4FSJA 5DDJ1 3WQ7A 4FCAA 1DF0A 1W28A 4CU9A 2VZVA 5GLUA 5D8AC 3VZJA 3G7DA 4RR3B 1AZDA 2ZEYA 3AB0A 4AZZA 5JPNB 1G6NA 3MV01 3M3EA 2NP0A 4NAOA 3VZMA 4META 3H50A 3VKLA 1KFXL 3V0AA 1XSRA 4DO0A 4YW4A 2LS6A 2QQWA 5L7OC 4COZA 3N9OA 1N1YA 4AI9A 2YGLA 1UYPA 3K2OA 5EYYA 4D6RA 4FQZA 5F3GA 3TB0A 1H0BA 1W8TA 1W0PA 4LBLA 4CDWC 1JZ6A 3V0AB 1RMU3 4OQ8A 4XF0A 2X8KA 5FK7A 4K9SA 5FO9B 4CDQA 2LM3A 4KWJA 3TNPB 2ARCA 4XPVA 5K4LA 2RE9A 4W8JA 2OS2A 3M1HA 4ZY9A 1QQP3 2WS93 4IQPA 3VHNA 1YQ5A 2OKXA 3SKJE 2JDYA 3T30A 3VDDA 3U75A 4AEKA 1IKQA 3VHRA 2QQNA 4AQTA 4CXXA 1V6JA 2VQUA 3OSDA 1QDCA 1AYM3 2VW2A 3IMNA 5LY2A 4CDQB 5JLVA 1GNHA 4O61A 2JDZA 1D0GA 1UZZA 3LEKA 1QNYA 2XUEA 2ZOEB 3TBDA 5KR7A 2HYKA 1OA3A 3I2DA 2Q1ZB 2GNMA 1UX6A 3WNOA 5A7NA 3VDDB 2HWE1 4OMDA 2CYFA 1RUG2 1KITA 1GP4A 2AEZA 1OVPA 3VUOA 4IUGA 4AK3A 4JHTA 1DGWA 1U0AA 2ZKLA 4AGVA 1DQ4A 4CUBA 3INAA 1R083 2VXRA 5ERLA 3WHUA 2VVEA 1D4M1 5LK7B 2BRTA 2C1FA 2OQ7A 4WV8A 3VBOA 3GZUC 4L97A 1RXFA 2PXJA 4NE9A 2E6VA 4NRPA 4HXCA 2G9GA 1UZYA 1XYPA 4DY5A 3OBTA 3O14A 3E6BA 1LULA 3JBG1 4K3UA 5JWPA 3O1OA 1I6XA 3MZHA 4YNIA 1VAMA 2JG9C 2CHHA 5B4NA 2A3WA 3WNNA 5C9AA 2D5HA 1CX4A 2RM22 4RD7A 3VBOB 2KD7A 2WZEA 4NO4A 4XFBA 4CA9A 2PHRA 1UW8A 3CKHA 5I8YA 5BNPA 5FDBA 5LCWL 4J25A 4FPYA 5CNAA 5BV6A 1S2KA 1FPN2 4QGMA 4CVUA 4OMCA 2GMMA 2VVFA 2A3YA 2VAUA 2Z4FA 1JODA 1DLLA 1VIWB 2P4EA 5C9AB 2XWBB 5KC5A 1Z0HA 3MW4A 1C8M2 4Y5TA 4ITCA 3VD3A 2Q5TA 4AE2A 1OLMA 4OQ9A 3POBA 5LY1A 1RUH3 4Q4V2 5KHJA 3H8XA 4E4ZA 3DPRC 5BNPB 4YPJA 3UK9A 2R0HA 2NPIA 2VTFA 2YUEA 1B09A 2E9QA 3NJVA 1JYXA 3NKTA 3D5OA 4HN1A 4XILA 3D82A 4DZGA 4LBMA 4GWJA 3RI9A 5BNQA 1GWLA 4JHZA 2DV9A 2IZWA 2Y6GA 4A7KA 4AEDA 4UOJA 1UXZA 5DN2A 2D3RA 4Q4Y1 4SBVA 1JYIA 2KA3A 3EJKA 1XNDA 4IV3C 1RUF3 2E53A 1W9WA 1C8NA 1RUE1 4TWTA 1LNSA 4O9EA 4PQ9A 3KB5A 2WLPA 1KEXA 4ARXA 2J1TA 4MUVA 1F35A 1A6CA 3BYWA 5F2SA 2J7MA 5G05L 5JVVA 4AEDB 5EP9A 1V9U3 3PUQA 2K2SA 4YW7A 5LA2A 4AYUA 2DCJA 4D7YA 2B39A 1DQ2A 1RUC1 4BLIA 4UYBA 4QPYA 3WNXA 1N3OA 3NL1A 3UKTA 5FZ0A 5K0UA 1PIV2 3APBA 4PBOA 1E5RA 1WLCA 5FMOS 3GHNA 2HWD2 3GHMA 3H9AA 1QJY1 2VQTA 4FFFA 5DUVA 4Z2WA 2Q1MA 3I2JA 2B45X 2WO3A 4FPCA 4MHUA 1VR3A 1J58A 4OVEA 1YQ8A 4CP0A 4E8CA 1KQRA 4LHSA 4QXBA 5K0UB 2ZGTA 2QE3A 4ES8A 3ZXDA 1H30A 4BXFA 2VC9A 1GFF2 3ZIXA 3JB4C 1ST8A 1JOJA 4HSJA 4PT6A 1N1TA 2JD9A 1ALYA 5GLZA 1EAH3 4TYSA 1U5XA 3CMGA 1JH5A 2CWSA 3LGRA 2HBUA 3UJOA 2YBKA 2VJXA 2XQRA 3RZZA 4ES9A 1BEV2 2XVKA 3VBHC 4MGSA 1UY0A 4FOVA 3THDA 5BNNC 5CISA 3IAQA 2RS53 1N1SA 3F2ZA 2RDQA 5FYSA 1RVF2 5DZFA 1MZ6A 2I07B 4MYEA 5DDJ2 4IV1C 4V2WA 2GAUA 3RPQA 2ZGNA 1VBB3 4LORA 5B4XA 1TMF3 3RMYA 5F2WA 1Q56A 2Z69A 1NE4A 3GZEA 2NMNA 5DAXA 3ZYPA 4BDVB 2OUJA 5A3MA 1RMU1 4XUQA 1CPMA 4PIYA 3AP7A 3SITA 4AHWA 4BWOA 2Q8DA 2BTVC 1UY4A 2EF6A 1W0OA 3RZHA 3RZKA 4PI2A 4YM1A 2WS91 1MVQA 4Q1PA 3F95A 3HAGA 3NJYA 1BBT2 2ZTNA 4COYA 4OHXA 1YQ6A 4RQPC 4CEWA 1OPOA 3KD4A 1QGLA 3UETA 4JAAA 2KR2A 5FY9A 4EN9B 1I5PA 5D21A 4K7JA 3IKWA 4AEMA 4AG4A 5J98B 1DYPA 2VQAA 1UL9A 4CEWB 4WZCA 2W2IA 3OJBA 4AAXA 4RA0A 5HPOA 1W2OA 4FFIA 4I0WB 1RB8G 1R081 1LGNA 5A3PA 4QWNA 1YFWA 5LATA 4ZU4A 3PLQA 4CEYA 1US3A 3ZM8A 1C57A 4LO7A 4E4HA 1YFUA 4IEZA 4JTOA 2C24A 1EUUA 1CGPA 1W06A 1YUDA 2NMOA 1U5ZA 3E6DA 3MIEA 1FMD3 3NNJA 1QY4A 2HWE2 4N53C 3RMXA 5K9YA 2J1UA 3ELNA 1W9TA 4CEYB 3WCSA 4CCJA 2WNEA 1HN1A 1GOHA 4IGOA 2VQ0A 3KCCA 1B35A 2YU2A 2WIIB 3J7MA 1OOPC 2PHLA 1CAUA 2XQXA 3DKWA 1D4M2 1QWRA 3PHMA 5DG2A 3G6JB 4XMAA 4CDUA 2VMGA 1WWYA 5C33A 2P3KA 1JS9A 4XUOA 3IM0A 4BM8A 3JBG2 3PUAA 1MS3A 4BCUA 3WNLA 3RZLA 1COV3 2WWUA 2EA7A 1GMMA 3HBKA 4HK9A 4F7ZA 1B35B 2FD8A 1RUH1 1MZFA 1AX1A 1CAUB 1CVNA 1UOJA 3LAGA 4FOWA 4XF1A 2WL1A 5F5QA 4CDUB 1GZCA 5F1RA 3AZWA 1KGYA 4AEJA 1EY2A 2P6CA 4Q8KA 4ZU7A 2BERA 4QKNA 3T2OA 2DVAA 3N35A 3WP6A 2B7YA 1QU0A 4IERA 3AP9A 4V2VA 5A1FA 3N4MA 5SV8A 3WNKA 4JX0A 3THPA 1OLRA 4XC9A 4B29A 2CY6A 1RUF1 2JD4A 1HQWA 3D8CA 1PZ9A 3IIAA 5L73A 1V00A 2VZUA 4FP3A 4Q2FA 3A4UA 4LK7A 1KS4A 2XVGA 4LKDA 4QX2A 5FYBA 3WVJA 4QGLA 3ZR5A 1V9U1 4BE3A 3VL9A 1PM7A 4JTNA 1MZ5A 1AXYA 1JYCA 5T3NA 4JGYA 4GMP0 2NQYA 2XHKA 4Q4Y2 2BBVA 1GV9A 1G9FA 4DQAA 2C9KA 2G19A 3MFCA 3RRDA 1S55A 1URXA 4AFBA 1YI7A 1AR83 2WSVA 2VU9A 3SH5A 2WAOA 1ZA4A 2EIBA 4JCKA 4WVVA 3A23A 3N9QA 4JGYB 4QU1A 1AXZA 1JUHA 2GDFA 2MHFA 2ZAAA 2YDEA 2EXIA 2OUHA 2VGDA 3B00A 3GCXA 3NJZA 4P5YA 1YQ2A 2J22A 4LTAA 4OI1A 1RUC2 3H3LA 1SFYA 3FLPA 4YARA 5CYYA 3ZVXA 1EAH1 4CTEA 4D6QA 2O1QA 2R063 2ZHKA 1W6NA 3ILNA 1MZEA 4XUNA 4CYDA 2VNGA 1ULOA 4A7ZA 1QJY2 4QX5A 2J1AA 3BKZA 2RS51 5DXDA 1FV2A 4BXSV 1C5HA 1K45A 3SEPA 5ACA3 1WKYA 4YG0A 1GKBA 2H6CA 2TNFA 1W6NB 4XFIA 4YW6A 1NCQA 2OPKA 2WT1A 1VBB1 2OYZA 3I54A 1TMF1 3URFA 5A3NA 2FCTA 2BPA2 2GC0A 3KGZA 2YC2A 1X8EA 3MIFA 1BJQA 2LRPA 3I4IA 3AK0A 1NCQB 3WR0A 5GM0A 3GZTB 1DZRA 1VB4A 4XUTA 3CNAA 3VD5A 3ZDVA 2K46A 3FN9A 4TZDA 5JXGA 3AKPA 4XFAA 1JYWA 1E5IA 2RDSA 1UNBA 5JIUA 1RMU2 3A7QA 2OW4A 5IWFA 3WQ0A 1ND3C 3I3MA 2V5YA 2ARBA 4M0NA 3ATGA 1H8TA 2X5IC 4XQDA 3C7OA 1OVSA 3KV9A 5EYXA 5FUIA 5LBEA 1DU3D 1QQP2 2WS92 3KF5A 1XSQA 2WN3A 3GM8A 5LWBA 3USSA 2XOMA 2JDPA 3C7HA 5DZGA 3SKVA 1SLCA 4N8MA 2TBVA 3BTXA 5E16A 3WW1A 2N7GA 5BUVA 5DAPA 1H8TB 5F5CA 3IB3A 1VAKA 3PMEA 2XWJB 5C8CC 1L7LA 3AKRA 1QKQA 2XVLA 3M3QA 1WD4A 2X29A 3BIEA 4GQ7A 3WW3A 4XHBA 5IAXA 4Q4W3 4XIOA 1JU4A 2ZHNA 3OG2A 4R4XA 4BJ0A 1ZBA3 4TSVA 4CSWA 4L2NA 1F4HA 4YZ1A 2MEV3 1W8ZA 5AVAA 3AP6A 3OUHA 1R082 4IEWA 4LLOA 5APAA 4MGZE 4M4RA 3PMSA 4OUMA 3S30A 3I3BA 5FY0A 2QQOA 2QDRA 1ULFA 4FQ4A 2R6QA 3PU3A 1GSLA 4EN8B 1MS5A 2ZPXA 1RHI3 3UV9A 2VUAA 1FNZA 2RJ2A 1GZWB 4K1ZA 1COV1 5L19A 4B4QA 2XL7A 1O3TA 3HQXA 1RUD3 2PAEA 2WBKA
chains in the Genus database with same CATH topology
1VBD3 4B7EA 2PELA 3QOPA 2EAAA 5L36A 5JMCA 2GC2A 1HRI3 4IESA 4FPLA 3HR9A 2XG3A 4O9GA 4BMEA 5B2GB 3ZN5A 4QT6A 1RUH2 2VMHA 2PA7A 1LU2A 1V70A 3TYJA 4ZXKA 4KGGA 4DFSA 4FPOB 1PZ8A 3HBZA 1NY71 5CG9A 5F6KA 3H3ZA 4E2QA 2HWF3 3FLTA 4R8HA 4L11A 1OLQA 5BNOC 3ZXEA 4LO4B 2R073 3CEWA 2VY0A 4AVAA 5KXEA 3USUA 2DTYA 3KS7A 2WC2A 1DZQA 1BCXA 1RUF2 4Y1VA 1LHOA 2D6NA 5C4WA 1VP6A 2PFWA 3PVEA 2I45A 2BGCA 1I9RA 1FYUA 5AFBA 4KU8A 3C2UA 3MGUA 3USUB 3EO6A 1CESA 1V9U2 3WP5A 2JE7A 1JUIA 5HBAA 1IS4A 1ZYBA 1HV1A 1NYWA 5C4WB 2VW1A 4FO9A 2FMDA 5JZGC 4H7MA 3OY8A 5GZCA 1XU1A 2DUQA 1T6GC 3KSCA 1O5UA 2WNUC 2X53S 4CZSA 4LHNA 5SV5A 1AL0G 1PMIA 1YLLA 4X6RB 3NW4A 4WZFA 4I09A 2WJSA 3OY8B 5ACA1 5BXXA 1H9WA 2WSUA 4XJAA 1YFXA 1LGBA 4N7IA 1ZREA 1S0FA 2SBAA 1EAH2 4EWEA 2XH6A 4RHV3 1ZZ8A 5HCAA 3C3VA 1ASJ3 1IPJA 2RS52 4YW2A 2IC1A 1LR5A 4M01A 3SCHA 1KXGA 5KHHA 2E7QA 5JOYA 4I0BA 4IEOA 5D8AA 3AMQA 1CR7A 1I1EA 4IEYA 4DPNA 4PIZA 4H3WA 4UW3A 1VBB2 3ES1A 1TMF2 1YHFA 1KD7A 1G9DA 1YYNA 2GSYA 2LALA 4AVCA 2B5HA 2ZA9A 5L7OA 4B7KA 5D8AB 5TSWA 3P3NA 5GLTA 4DB5A 1VAVA 4RS5C 4M0HA 1OQEA 2QVSB 2YZ4A 5J36A 1GICA 4Q1RA 1VBC3 3MIHA 5JCTA 2BUKA 5L7OB 4G9SB 2HJIA 2WINB 4A7YA 2WFPA 1MS9A 2YHJA 4HANA 4RL7A 1S0JA 5HI0A 4Q4W1 2HEYF 2YGMA 5GJ6A 4OI4A 3DGTA 2PHTA 3VBFC 4YW5A 2IXKA 2MEV1 4AI8A 3H7YA 1WLDA 1XNKA 4AVSA 1WW7A 5T5OA 5AVPA 3GZAA 3VBSC 1G9CA 1XYOA 2RHPA 5K8SA 1RHI1 1ULGA 1J1TA 4LLFA 1YI9A 4Q8LA 4UBGA 4R4ZA 3IT8A 3WXPA 1FMD2 2XJVA 1ZRCA 1RUD1 4Q0VA 2V73A 1PK6C 2CGNA 3JU9A 4SLIA 4XE9A 3L9JT 1VBD1 3SCFA 2PHWA 2JXAA 2MPFA 4IEQA 2JG9A 2DURA 4ASLA 1GYKA 3AYAA 1COV2 2RMU3 4AFCA 1Q43A 3WDUA 2QUOA 4BLJA 2JG9B 2BVBA 2WA3A 3HWJA 1X33A 4DNYA 3IBMA 1OSGA 2HWF1 5IT6A 2UU8A 4PDWC 2R071 4HLTA 1AYN3 2ZGMA 4LO6B 3DPRA 1HDKA 2TEPA 4QQPA 4KBBA 4XIKA 4I0AA 5E88A 2ZX3A 1PNFA 1NY72 4YVWC 1RUI3 2GH8A 3DPRB 1ENQA 3VHOA 1D2QA 1YFYA 3ZN6A 3ES4A 4IV3A 4YGCA 2D7FA 2DF7A 1NCRC 4CP1A 2BWAA 3OBRA 4BPZA 3L2YA 3MW2A 1AR82 4HKOA 4KGQA 3ZN6B 4IV3B 2PLV3 2DYCA 4B4PA 2WT2A 3BODA 2RS33 1I3HA 3BOPA 4Z82A 1BQPA 4GWMA 1Z78A 4C0BA 4IETA 3AYEA 3IDBB 3R05A 1J1LA 4YG6A 4YLZA 4JQRA 2XJSA 5FLJA 1G9BA 2D5FA 2R062 4GXLA 3SH3A 3GNEA 4RHV1 1S0IA 2H6BA 1DFQA 1ASJ1 1D2SA 3PJYA 5FOJB 1LOCA 3GBWA 5ACA2 1VRH3 1Q8OA 1BBT1 1XU2A 2SLIA 2ZMKA 1W39A 2ZMLA 3BALA 3FFQA 2DVFA 3VBHA 5BNNA 3K51A 5CAZA 4LULA 2VMIA 1SCSA 4FTEA 4URTA 3WDYA 4IV1A 4P14A 2A6XA 5IK8A 3VBHB 5BNNB 3WT3A 4COWA 4N90A 1VBC1 1G8WA 3ROUA 4Y4YA 5JSOA 2D6PA 3RSJA 4IV1B 3KZ4C 4AHYA 1AJKA 4TLFA 1DHKB 2R49A 2D6LX 2VOWA 1QXRA 1SMVA 4RQPA 4W65A 5FQ0A 1AF9A 1LOGA 4P9JA 4L8QA 1APNA 4ISRA 3RYKA 3KLSA 1GQHA 4HL0A 1H2LA 1QJU3 3GYDA 5JIAA 1FV3A 3WG4A 4RQPB 5FQ0B 5J96B 1PZ7A 3LOBA 1WMFA 2ZGLA 4Q4W2 1POV3 3UL2A 1QOOA 1ZBA2 4XF3A 2DUPA 5GLWA 2MEV2 1GNZA 2UWAA 3WG1A 5T5JA 4OHYA 3S7EA 3THTA 3E5UA 4N53A 1LENA 2CNAA 2A6VA 5KHGA 1I5ZA 1RHI2 1KJRA 2JKBA 1WGPA 4YZ2A 4YVSC 1X7NA 1WW6A 3NV2A 2FMYA 2YY1A 2RMU1 1BKZA 1RUD2 5LEKA 1OOPA 5IK7A 1XNCA 2AH2A 3D4KA 1ND2A 1VBD2 4N53B 1YJLA 1ZZ7A 3AYCA 1C5IA 4AVTA 5J7MA 4XBNA 4XBLA 1EPZA 4FXKB 1AYN1 1OOPB 1XNBA 3H1YA 1YXWA 4LBQD 3WLUA 1ND2B 3T2TA 5AFEA 2BFUL 3AP4A 4MVTA 4Q4X3 3FFZA 3TN93 3ZSKA 2D6MA 3CU7A 2FZ1A 4XW3A 1CN1A 3VBRC 2AUYA 1RUI1 1O3QA 2UYBA 2ZGOA 4EN7B 4RSUA 2HWF2 3MFAA 3NV3A 3VGIA 1CONA 1YNAA 3LOIA 1V6OA 2R072 1H4HA 1VBE3 2NN8A 1V6KA 4C1XA 2MNGA 2IFWA 3ZSEA 1UIKA 2GZWA 4C90A 2D3PA 4JRLA 1F5FA 1QXJA 3AMPA 2PLV1 4YFZA 2BWCA 1HXS3 2RS31 5CFDC 2CGOA 3RJ2X 3TAYA 3KT4A 1BXHA 2VOVA 2ZBJA 1TEIA 1D0HA 3M8LA 4HT1T 3M2MA 3U07A 3V64A 1UCXA 3VKNA 4AQSA 1BVP1 2G9FA 2BNMA 4J1WA 3B5LB 1LHUA 1EV13 1H1AA 1VRH1 1WW5A 1Y3TA 1RJ8A 2W68A 4MX3A 4D69A 4HKLA 1MS4A 3M3IA 4IEUA 4NR1A 4JC1A 5FREA 1LODA 2PHDA 4OUSA 4X6QB 4D7SA 4RHV2 2RJLA 2RR13 4F3JA 3ZIWA 1CAWA 1VLNA 4OZXA 2Z79A 1AUYA 1ZBE3 4G4FA 1ASJ2 1QQP1 2HKXA 3ZFEC 3JD73 3WP4A 3M4FA 1LOFA 5A32A 5KXDA 1AYM1 1CAWB 1JXNA 5CFCC 5KXCA 2CGPA 1JN2P 1H9PA 2C5DA 3HMYA 3O0XA 5KBFA 4BQ1A 5JOXA 4XETA 3W9AA 2ZABA 3JQWA 2XL9A 5A32B 2B46X 1ZZ6A 1IHMA 4XFHA 4IEVA 2AR6A 2YROA 3PVNA 4LNVA 2ZGSA 1ULCA 3AX4A 3WDWA 2GNBA 3HT1A 1UU4A 1VBC2 1ND3A 3NV1A 4HSLA 1QJU1 3J8F3 3JCIA 3WUCA 2D6OX 2VULA 2X5IA 2Y0IA 3BB6A 4AI0A 5H9PA 4BIFA 2P3IA 1O91A 3FUOA 3X29B 1QOTA 2WQ4A 4WVMA 1POV1 1ND3B 3CF6E 3ZXAC 4P9LA 4XF4A 3ZYIB 2X5IB 2A6ZA 5T50A 5C8CA 2TUNA 1FI2A 3WY6A 2A6WA 5DUWA 3E6CC 3KCXA 5T52A 1ND2C 1RINA 4WVMB 4OI0A 1HV0A 1ULDA 4F83A 1SBFA 4MGKE 4YW1A 1VBA3 3OF1A 5C8CB 4FAGA 4HBNA 4YGDA 1Q3EA 3LSDA 5CG8A 3WOGA 1S0EA 2XBO3 3LA2A 2QJVA 2D93A 2RMU2 5EV7A 5JI9A 1OI6A 2VVDA 3J9SA 5KHIA 2C9AA 1FOD3 2ZX2A 3TN91 1BK1A 1GZ9A 1YCIA 1RJ7A 3KT1A 3RI8A 5C6CA 1Y43B 3PVOA 4XBQA 1LKNA 4K20A 1CJDA 5JSPA 4EN0A 1RUNA 2O8QA 3AKSA 2Q4SA 1HIXA 1AYN2 1VBE1 3T1MA 1WMDA 2C0ZA 2XKPA 3IDCB 4FPJA 2UWBA 1ZVFA 1PO23 4QQOA 3SH4A 3N7KA 4ORFA 2DWRA 1UAIA 3NO8A 4X8NA 5BNOA 1RUI2 2R1BA 3BOWA 2QCSB 3AM2A 2QDNA 3LB9A 4QGNA 2V09A 3R4UA 2D6KA 5JOWA 4WVZA 4D3WA 2ET1A 5BNOB 2ZX1A 3U0ZA 4Q0PA 3ZFFC 3POWA 3TRSB 4C91A 3ZXFA 2YYOA 2PLV2 4QD2A 3ZX7A 4MSVA 2W39A 2RS32 2PYTA 4AHXA 5T5PA 3FZ3A 5I93A 5JZGA 4J6GA 1EV11 1J59A 1LB2A 1NA1C 4MZUA 4PF5A 1Q8VA 2WNUA 1LOFC 1J3RA 4I3PA 2LTNA 4AQ6A 4G3YC 2RR11 4RGGA 4AWDA 5JZGB 1Q5OA 3R4DB 1MS1A 3OYWA 5I91A 2QKDA 1GQGA 4LO5B 4XZPA 3AKQA 1NLSA 3J4UH 1K5MC 2ZZQA 2I74A 4Z92B 2WNUB 1VRH2 2QZ2A 4S2HA 4ZKTB 1NOVA 5DZEA 4ISQA 2PAMA 2A7AA 1RUJ3 4H55A 3OYWB 1NQDA 3ZXGA 1RIRA 5GALA 4R9DA 1X50A 2DU0A 2H0BA 1AX2A 4YG3A 2R043 1LCLA 2ZCWA 2VG9A 2PTMA 4OLLA 4HKWA 5GZEA 3H0OA 4DOUA 2AGSA 2AYHA 5IUQA 3WP3A 1LOAA 3ZXJA 1AYM2 3J8F1 1F31A 3M70A 5CB7A 3SCGA 4BIOA 1H1MA 1WBLA 1SLBA 4RS5A 3CJIA 2GU9A 2OZ6A 2B8MA 1FMD1 2DTWA 4MV2A 5CVRA 5EJ3A 4DRVA 2FHRA 1QJU2 2GH2A 4RS5B 4WVWA 2EXJA 1XYNA 3ZXKA 1H1IA 1REDA 3FBYA 4R9AA 3VBUC 4EWDA 5JSRA 2Y26A 3VBFA 4MGYE 3K48A 4AVVA 3E5XA 1VBA1 4QM8A 2FQPA 4WBBA 1SACA 3VBSA 2AZ5A 3VHPA 3EHKA 4N43C 3VBFB 3AZZA 4YGBA 5E89A 2ILMA 3UKNA 2JG8C 2XBO1 5JOZA 1PK6A 1WUVA 1XE8A 3VBSB 3LCPA 5KWRA 4JGZC 4EV0A 3H3UA 4I02A 4XFGA 1FOD1 3VKMA 1KJLA 4Q4V3 3E5QA 1IGOA 4LBQA 1PK6B 3AYDA 3WHTA 4COVA 5FO8B 1JBCA 2Z42A 1PO21 1SQ4A 4LBJA 3TN92 3ZSLA 2O8OA 2R1DA 4LBQB 2PAKA 1AR81 1ULEA 1AR63 4PDWA 4UW5A 2VNOA 1RC6A 4B3NA 5CA6A 3DV8A 1FAYA 1RGSA 1VBE2 2WFF3 3WDXA 4ASMB 1W6MA 3DL3A 1DZTA 4PDWB 4YVWA 4M3CF 5H9RA 1HQNA 3WG3A 4M3CE 2R061 4F8AA 4E4SA 5HXVA 1HXS2 1LTEA 1NCRA 1NQJA 1W6MB 4K40A 4YVWB 3SISA 4KWLA 3ZYJB 4XFFA 4FPGA 4LBKA 4DXZA 2AREA 5EWSA 3POSA 1RTVA 2VUJA 4BHPA 1ENRA 4Y5Z0 4W6WA 2WLQA 1NCRB 3MEPA 5LK5A 3RWNA 5FLHA 2D98A 4GKXA 3POYA 4AFMA 4RFT0 3WG2A 1EV12 2HWC3 5CIRA 2F6BA 2AENA 1RUJ1 1FNYA 4KNCA 5FMOL 1ZX5A 2RR12 1MEC3 1MR5A 1ZBE2 2R041 2ZS6B 4LHLA 1KRIA 1ONAA 3CJIC 1DGLA 1N1VA 5LRRA 3WW2A 3JD72 4AF9A 2PHUA 4K1YA 2KM2A 4XDQA 5BY5A 2DCKA 4E4DX 3MIBA 1NE6A 1N47A 4W6YA 5LRSA 3A0KA 4GALA 4QQLA 4LO8A 1R1A3 3AKTA 3O0WA 1ZBA1 1AX0A 3U11A 2ZGUA 3J8F2 3A0NA 5FO7B 4QPIC 3W58A 5ABJC 3FHIB 5IK4A 2A6YA 4P9YA 3D0SA 4INDA 3KMHA 1SFNA 2BQPA 4DINB 3OGGA 2EXHA 2GMEA 4FBFA 5I0TA 1W6QA 3HIFA 4H7LA 1O4ZA 3AJYA 3TWIA 1QJX3 3IWZA 4YGEA 3TNQA 5J37A 4WM7C 4Q26A 3WV6A 1G9AA 3MLKA 1XRUA 1PGSA 2EIGA 2P2KA 1HRI1 1W6QB 2WNVA 2ZGQA 1S0CA 4FTSA 3HD8B 3MIGA 1VBA2 2YC0A 3DF0A 2A70A 4FPKA 1C1LA 3H8UA 2FBEA 3ACLA 2JE9A 3KGLA 3UJQA 2YPJA 1G7YA 3AZXA 4Y1ZA 1KDMA 2XJTA 2WNVB 1OA4A 3OGJA 4YVSA 4WM8C 4FP2A 5AC93 1CD3G 2XBO2 4Y1UA 2XJPA 1MACA 1WCSA 2ERFA 4XJ9A 4XJWA 3V56A 1GLHA 4DS0A 5K7PA 4AHZA 3M3OA 4XXPA 4IEXA 1FOD2 1ZZBA 4YVSB 1R093 1UMZA 1LJ7A 4UW4A 4I3GA 2Q8OA 1F5JA 5FRAA 4U2AA 2VECA 3MI8A 1RL3A 1AR61 2XLFA 3WDTA 2I2SA 2JJ6A 4P9XA 3OD4A 5H9QA 4UXAA 4ONUA 1W6OA 2HEVF 4A3XA 4BMBA 1WLTA 3AXDA 2UY8A 2CWMA 2CL2A 3UKVA 1DBNA 5FAXA 1IOAA 2HWB3 2CAUA 4FT8A 1PO22 2F4PA 2VOXA 3V65A 1MQTC 2ZAHA 3VBRA 3VLBB 3ZMNA 1REFA 2OIIA 1W6OB 2GMPA 4DRRA 1CQ9A 1Q8QA 2D43A 3QH7A 4I2OA 5H9SA 3MIDA 4YM3A 1KS5A 1RUE3 3BPZA 3LSEA 2PHXA 1WLWA 2IXJA 4YZ3A 3BU7A 4MXVA 2P37A 1Q8SA 3VBRB 1W6PA 3E97A 3M3CA 3NV4A 1LHNA 1QDOA 3I8TA 5CFDA 1DGRN 4OULA 4BH9A 4KG0A 5DUXA 4AGRA 3QLQA 1R1ZA 1CPNA 1W6PB 1AVBA 1JTZX 2IXLA 4JV4A 1WD3A 4XQ4A 4ATEA 4GULA 1YIFA 1AL23 2HWC1 4S2GA 3RG0A 4NWVA 1UD1A 3R0RA 4CDXC 4DY3A 4GMP3 5CFDB 1AXKA 3VZKA 1O4YA 1DG6A 1DIWA 5FPZA 3GALA 1MEC1 2R0FA 4LUMA 1OA2A 3ZO0B 1QJZA 3B69A 3CJXA 1ZRDA 2ZGKA 2DCYA 1FX5A 1X82A 4D94A 3RS6A 2YXSA 4JDOA 3BTAA 1S0DA 4R9CA 3ZN4A 1RUJ2 4Y22A 1E57A 1OMIA 1XXNA 4MXWA 3ZFEA 2R042 3GBFA 2IXCA 2VNRA 4FPEA 3VN4A 1R1A1 3B02A 4R9BA 5CFCA 4HVQA 3VKFC 4Y22B 1LRHA 2EXKA 2JX9A 2BEOA 1LU1A 3ZXLA 4MXWB 3ZFEB 3N36A 1LECA 4NWWA 3ZYRA 4FVVA 5EZWA 3LA7A 4YYOA 1AR93 2UURA 3WZ1A 3NAPC 5CFCB 2ZACA 4KWKA 4ZU5A 2ZHLA 5JDBA 2WNVC 4DMIA 3W59A 5JPMB 3I7DA 4NHMA 1QJX1 1VALA 1EYBA 2K9ZA 2CAVA 3V0BA 3FLRA 1PHMA 3OD0A 3ST7A 1GBGA 2DU1A 2GNTA 1H8VA 1DYKA 3WQ1A 4QPGC 4AXOA 4GH4C 5GKAC 1WCDJ 3ZSMA 3V0BB 2UWCA 3WX5A 1IZ3A 1ZNPA 2ET7A 4HVOA 4XTPA 3WINE 4A2UA 2NM1A 4J1XA 1OFNA 1OPMA 2A75A 1O4TA 1X36A 1RITA 5T5LA 3O12A 4AW7A 1HRI2 5AC91 5I8SA 4EWAA 1SBEA 2DVGA 2E51A 4AQ2A 2H0VA 1QXPA 5DG1A 1PO13 4K6BA 2WZR3 3ENRA 1W2UA 4OHZA 1R091 1LHVA 1NZCA 1UIJA 4XXAA 1DQ6A 2VH9A 4LE4A 4W6XA 3ZMOA 1YO8A 4E2GA 2WZPP 4Y1YA 2P34A 3SHRA 2W08A 4P9GA 1YRZA 3EXUA 1Z7S3 2OA2A 3WCRA 2EVXA 1TE1B 2HWB1 2NYYA 4XJ8A 4AI1A 1NG0A 4B4RA 1FXZA 4E27A 1AR62 3ZPYA 3MF9A 1SLLA 4P9WA 4HK8A 2IWGB 4YSFA 4PLNA 1UKRA 3AP5A 5D1IA 1BMV1 2WFF2 1PVXA 3NKGA 1WW4A 4RR3C 3RYPA 5BPXA 2VPVA 3B9CA 5FOBB 1MS0A 1ZZ9A 2GC1A 2WA4A 2ATFA 1AR73 1Q8PA 3KT7A 4LT5A 1ENSA 4PLMA 3N7JA 1AL21 5LEJA 4NHLA 3ZFFA 3U4XA 2Z2SB 3NWKA 4GMP1 4KG8A 1C28A 3JZVA 3IDEA 5F6LB 4LE3A 2NZ9A 2EALA 4C0HA 1HX6A 1ZRFA 3T1LA 1NXMA 2FZ2A 3ILRA 4PBPA 4Y26A 3GBGA 3ZFFB 4YW3A 1WMEA 4BA6A 1NA1A 3IN9A 2P17A 1QH7A 4QMAA 1M06G 2HWC2 1VB2A 1IQAA 2DUOA 3OTFA 4CDQC 3J26N 5I0RA 4XEZA 5I0SA 1MVEA 1NA1B 3N7LA 2GNDA 4X8PA 1K5MA 3VDDC 1MEC2 3D6EA 3P3PA 4BYYA 1SBDA 1YIPA 1YWKA 3FJSA 1K5MB 1WCKA 3ZYGA 1U12A 3RYRA 2D44A 1AR91 1M4WA 4GB33 1R1A2 2W52A 4IEPA 4XJUA 3VBOC 3AZYA 5GZGA 4JDNA 5IK5A 1DDLA 1NXD1 2G4IA 4QM9A 4FPFA 3AZVA 2OVUA 2BVVA 4HETA 5CU1A 3B7MA 4N9HA 2GN7A 4V1PA 4MH0E 5C9AC 4QHBA 4HFSA 1LESA 5DUUA 3D0JA 3BIW