4L2NA

Understanding extradiol dioxygenase mechanism in nad+ biosynthesis by viewing catalytic intermediates - ligand-free structure
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
174
structure length
174
Chain Sequence
MLTYGAPFNFPRWIDEHAHLLKPPVGNRQVWQDSDFIVTVVGGPNHRTDYHDDPLEEFFYQLRGNAYLNLWVDGRRERADLKEGDIFLLPPHVRHSPQRPEAGSACLVIERQRPAGMLDGFEWYCDACGHLVHRVEVQLKSIVTDLPPLFESFYASEDKRRCPHCGQVHPGRAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-hydroxyanthranilate 3,4-dioxygenase
publication title An Iron Reservoir to the Catalytic Metal: THE RUBREDOXIN IRON IN AN EXTRADIOL DIOXYGENASE.
pubmed doi rcsb
source organism Cupriavidus metallidurans
molecule tags Oxidoreductase
total genus 38
structure length 174
sequence length 174
ec nomenclature ec 1.13.11.6: 3-hydroxyanthranilate 3,4-dioxygenase.
pdb deposition date 2013-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06052 3-HAO 3-hydroxyanthranilic acid dioxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4l2nA01
3FX3A 2BYVE 3E5UA 5KHJA 4XFHA 3S7EA 3EJKA 1ZZ8A 1ZRCA 2ZCWA 4LA2A 1OD5A 2V09A 5I0TA 3H1MA 4I3PA 4ONUA 3RYPA 1TQ5A 4O9EA 4AQ2A 2PAKA 4ZU5A 2OYZA 1WLTA 2Q0AA 2PHLA 3MDPA 2GU9A 3PNAA 4HN0A 5C6CA 5JCTA 2PA7A 2QNKA 4EV0A 1CGPA 2QCSB 3KMHA 2IXCA 4D7SA 5I0SA 5LRSA 4R8HA 5JAXA 4DINB 3KSCA 2MNGA 4RD7A 1O5LA 1UIKA 5E16A 1JUHA 3U10A 2XKPA 4IEQA 2O1QA 1PM7A 1ZZBA 2PTMA 4KL1A 4O9GA 1CAWA 2H6BA 4YARA 4MUVA 1H1IA 1UD1A 3I59A 1O3SA 3ST7A 3I59B 3G7DA 1OFNA 3E6DA 4XETA 2N7GA 4QGLA 2GH2A 4EWAA 4FBFA 3FWEA 3WW3A 1CX4A 3S7IA 4HLTA 1Q3EA 3VHRA 4QX5A 3GYDA 2OZ6A 1YWKA 3WW2A 3H3UA 3E5XA 3WW4A 1RL3A 4IEVA 1NYWA 3U0ZA 3U11A 5I91A 2K0GA 3SCHA 4XF0A 4X6RB 4L11A 4PJYA 3ROUA 2GC3A 4I2OA 5BY5A 3MPBA 4AVAA 3SHRA 2ET1A 1UPIA 2H0VA 4HMZA 5E1RA 5BV6A 1GQGA 1ZZCA 2MPFA 2OA2A 4HVOA 4Q0PA 3PVBB 3I54A 1ZZ9A 5FLIA 4P9GA 3WW1A 5EFUA 5JSOA 4KU8A 2BNNA 4E2QA 2XLAA 5D1IA 5LRRA 4F8AA 4XFGA 4EROA 2FQPA 2B5HA 2HJIA 2ET7A 5FDBA 3LA7A 4UBHA 4J1WA 3M70A 2CGPA 5CU1A 3QACA 4A2UA 5LEJA 4XFCA 4XF9A 5BPXA 4EWEA 2GC2A 4OLLA 1PMIA 3NVCA 4QGMA 4QXKA 3H1YA 4IERA 4EWDA 3FFQA 2XGXA 3D0SA 3H7YA 1OMIA 1SEFA 4HVRA 4IESA 4XFIA 3M3IA 3KGLA 4I0BA 3H9AA 3ES1A 3MZHA 2DCTA 1QXJA 3UKTA 3BALA 1XE7A 3ETQA 2Z2SB 1UCXA 4HSLA 1DZRA 1X7NA 1DZTA 4E2SA 1ZRDA 2XL7A 3CF6E 3LOIA 2UY9A 2D5FA 1YFUA 2BGCA 2B9UA 5FLHA 3OD0A 4IEWA 2Y0OA 1IPJA 4L2NA 2Q4SA 4Z82A 1X8EA 2H6CA 4LTAA 4MZUA 3E6BA 4HZFA 5I0UA 5AVPA 3FE5A 3OGJA 3H50A 1ZVFA 2GAUA 4HN1A 4IEZA 5CADA 1WGPA 1EY2A 2GZWA 1EPZA 1FI2A 1J59A 4JV4A 4NVPA 2WC2A 2IXKA 4Q0SA 4TLFA 4PIYA 3OF1A 2QVSB 3CL1A 3HT2A 4MGZE 2K9ZA 1VP6A 1ZZ6A 2VECA 4AQ6A 4D7TA 3RPQA 4I09A 3NJZA 3RYRA 3QOPA 5FQ0A 5KBFA 3IBMA 1UW8A 4QM8A 5FQ0B 3NSTA 2EA7A 2PAMA 3TNPB 3PLQA 4OFGA 1V70A 2QJVA 1NE6A 4JTNA 4YRDA 4BH9A 1UIJA 4PIZA 1RUNA 4I01A 1QWRA 4KWLA 4LLOA 4YYOA 2EVXA 3ES4A 3HQXA 2EAAA 2WFPA 1DGWA 2IXLA 4LUKA 3SCGA 3CO2A 5KHKA 2XHKA 3NL1A 3LA2A 4ZU4A 1J1LA 4UBGA 1ZNPA 2IXHA 1RC6A 4MH0E 1FT9A 1DGRA 2P17A 3RYKA 1Y9QA 3BU7A 1J58A 3D0JA 4MV2A 3SMHA 3OTFA 3EO6A 1O7FA 4ZU7A 4META 2UY8A 1ZRFA 3ACLA 4HVQA 4QM9A 3NW4A 1XRUA 4IEYA 1Y3TA 1ZX5A 1J3RA 3SXWA 3FHIB 4MGYE 3ZDSA 1X8MA 3GBFA 1O4TA 5I93A 2Q30A 4XF3A 3DN7A 4GULA 5EZWA 3BCWA 1I6XA 3LA3A 4XF4A 2XKOA 1Q43A 4H7LA 4JVAA 1YHFA 3NKTA 1Q5OA 2MHFA 3H7JA 4XFBA 2VQAA 3IIAA 4XFAA 3RDIA 4Q0QA 5KHHA 2GC1A 5JR7B 4IEPA 2PYTA 1SQ4A 2XLGA 1G6NA 1YFYA 1CAVB 1GQHA 3KGZA 5BXXA 3RNSA 4IEOA 3CEWA 1U12A 2I45A 3LAGA 1CAXA 3CLPA 5KHIA 4QMAA 5FCCA 1CAXB 4IEUA 5J7MA 2PAEA 3EQEA 3IDBB 2XLFA 2HKXA 4K8FA 4HBNA 4KWKA 1I5ZA 2PFWA 5I8SA 3EBRA 2E9QA 1LB2A 1NXMA 3BPZA 1SFNA 2BNMA 3H3ZA 5BUVA 2KXLA 4F7ZA 4UXAA 5C8WA 4IEXA 3UKNA 4WBBA 4BYYA 4AVBA 1QY4A 2F4PA 1ZREA 4J1XA 4R52A 4XFFA 3CJXA 3LZZA 2XL9A 3TNQA 1YUDA 4E2GA 1O3QA 1RUOA 2IC1A 5J3UA 2FMYA 3B02A 5FLJA 4FAGA 2UYBA 4AXOA 2ETEA 1LKNA 5K8SA 4WVZA 4X6QB 2VPVA 3UKVA 4JTOA 4LUMA 2OPKA 4Q0VA 4QGNA 4MX3A 4BIFA 4Q0UA 1IPKA 1RTVA 1LR5A 5LEKA 3DL3A 3RZZA 4LA3A 3SCFA 5J48A 1CAWB 1NZCA 4IETA 1YFWA 1VJ2A 5I8YA 1XE8A 3H1WA 3EHKA 2BEOA 5KHGA 1OI6A 4LULA 5F1RA 3S0MA 3E5QA 3L2HA 5FPZA 2ZKLA 1WA4A 4MGIE 5JSPA 3HIFA 2Z69A 2Q1ZB 5CVRA 1ZZ7A 4KU7A 4WZCA 1J3PA 2O8QA 1X82A 3N4MA 2PHDA 2D40A 1LRHA 2B8MA 3DV8A 3H8UA 4YSFA 3IDCB 3ELNA 1L3JA 1YLLA 4FT8A 2CAUA 1O3TA 3FZ3A 4ORFA 3HT1A 2C0ZA 3IWZA 5HI0A 2CAVA 4BHPA 2OZJA 1QXRA 2IXIA 2BNOA 4HSJA 1HW5A 4B29A 3BB6A 5I8TA 2QDRA 1CAVA 3D82A 1O3RA 4N9HA 1H1MA 3FJSA 3R6SA 3I7DA 4LEJA 3KCCA 4N9IA 4CYDA 3C3VA 2D5HA 1EP0A 2UYAA 2D93A 4YNIA 4AVCA 3MYXA 2ATFA 2PQQA 4KWJA 4MGKE 2GC0A 4FAHA 1VR3A 3JZVA 1EYBA 3O14A 2IXJA 4XF1A 5JSRA 1YFXA 1ZRRA 3USSA 3E6CC 3OCPA 4Q29A 4I0AA 5T3NA 1RGSA 5FPXA 5I0RA 1J3QA 1NE4A 3DKWA 4I02A 1CAUA 4XEZA 4PIXA 4Z07A 2CV6A 3LWCA 1CAUB 1FXZA 3E97A 1O5UA
chains in the Genus database with same CATH superfamily
4FPKA 2GN7A 2DU1A 1RMU2 3E5UA 1DHKB 1SPPB 3EJKA 1ZZ8A 3O5SA 4CCJA 3M3OA 3ZSJA 2FBEA 2QFEA 1OD5A 2ARBA 2V09A 1QOOA 1OF4A 3CZJA 3WDUA 1UX6A 3HQUA 5J96B 3B94A 4LO6B 5A3MA 2FDIA 3VBUB 2X10A 5FZKA 4AQ2A 1GZCA 4FTEA 3CMGA 1HV1A 1K12A 2A3WA 3K2OA 3TEWA 5FP8A 4CUGA 3VV1A 4LR4A 4FPFA 3K77A 3IB3A 3PNAA 4P9IA 3SH5A 5C6CA 4PI0A 2A6WA 5ISLA 4Q4W3 2QNKA 1HN0A 2W52A 3ACFA 1VBD2 3MUZ1 3S6PA 3T1LA 3ETPA 4D7SA 4LKFA 5I0SA 2YB7A 4R8HA 1B35B 5JAXA 4DINB 2VG9A 1O5LA 1JOPA 2FDGA 2ZHKA 1BXHA 5F3GA 2ZGQA 3J8F1 1I5PA 3VBFB 1RUF1 2RE9A 4ITCA 5DQ0A 3RSJA 4OULA 1LAJA 3AXDA 5IVYA 4IGPA 3H42B 3N9OA 5C9AB 2Q1FA 3AP9A 3AJZA 4E4SA 1SG3A 3NAPA 4GH4A 4O9GA 4QQLA 2RS32 3VBRA 4MUVA 4ASLA 1O3SA 3U78A 2Z4FA 2VCAA 4ES9A 4OQ8A 4OHYA 3E6DA 4XETA 4M4RA 2N7GA 1PZ9A 3VD9A 2NMNA 3QCWA 5CFDA 2DCKA 1X9PA 4HKOA 5JMOA 3S7IA 3R4DB 4HLTA 1SACA 2ZEXA 4QX5A 5BNOB 5FZCA 1CESA 4ZZ5A 4HK9A 3H3UA 1BLZA 1C3HA 1JYIA 3ZXKA 1FATA 2HWC1 1NYWA 4GAZA 4GB32 3U11A 4GJYA 1RJ7A 4WM7C 1SCRA 1S0GA 2K0GA 3MI8A 4XF0A 4IV1B 3VDDB 4NE9A 1KRIA 4HG6B 1XNTA 4URAA 5BY5A 5FMBA 4OZOA 2XOMA 1XNKA 2E51A 1UU4A 4RN5A 5D2AA 2ET1A 4MGQA 4XXAA 3GZTB 5E1RA 5A3WA 1E57A 1ZZCA 2CHHA 1US3A 2JG8A 3PVBB 1UZZA 3I97A 3KVBA 3WXPA 4QWNA 2DBIA 3A22A 3LPFA 2AR6A 5FZ6A 4UF0B 3T0AA 4XMAA 3U4SA 4BQ2A 4K3UA 2WS91 1W6MA 4CXXA 4F8AA 3D3AA 1H2KA 4XBNA 4FOWA 2VNRA 4Y5Z0 1W6PA 1GICA 1FNZA 4I30A 1U5XA 4FCAA 4OHVA 4QHZA 3BYWA 4BMEA 3RZKA 4LQRA 1ULPA 4WVWA 1NX9A 1QQP3 1MQTA 1SFPA 3CQOA 4J1WA 3WUDA 5A6YA 1XJAA 5CG8A 2CGPA 2A3XA 4RFT0 1HJGA 2RJKA 3N7MA 4IV3C 1S4CA 3I3BA 5CU1A 3ME2A 2PELA 3C7GA 3PUIA 5BNNB 5L19A 4XFCA 3GDBA 3EYPA 3HR9A 4XF9A 1BEV1 5FUNA 1WD3A 1AX1A 1AR61 2GC2A 2EIGA 4QDSA 1URXA 4JGYC 1T6GC 4Y1ZA 1JH5A 1VB2A 1PO21 3ILRA 5HXMA 4IL7A 1GOFA 2XQRA 3PVEA 4ISRA 5C8CA 4IERA 4EWDA 4MVTA 1NT0A 2WQZC 2SLIA 5T5LA 4CCDA 5A3LA 1ASJ2 2YU2A 4HVRA 1CD3G 1XPWA 4FPGA 4XDQA 5EJ3A 3FLRA 3M3IA 4IE0A 5CAZA 3KGLA 2ID4A 5FZDA 5AFEA 3KV4A 2RS12 4YVWB 3H9AA 5FTTC 1Q8OA 1QXJA 4YVSB 1HB2A 5ABJC 2D43A 3BALA 3HN3A 4HSLA 4G4FA 1DZRA 5SV8A 1NCRA 2AH2A 1PX4A 4BDVB 1XNDA 3T30A 4S2DA 1SPPA 2D5FA 4UW3A 3SQOA 3AMPA 1DGWX 2VCMA 5FOBB 1W6NA 2PQSA 1LOFA 1UY3A 2R32A 5LK5A 2Q4SA 3ZLIA 4Z82A 4GZ9A 1IHMA 5F39A 4AE2A 2XPJA 1IPSA 4XE9A 4D6QA 2WNUB 2H6CA 1LGCA 4Q4X2 5ACA3 3DF0A 3MW3A 3FE5A 4RGKA 4QPIC 2FZ1A 4DNYA 2WUHA 3KV5A 1YRZA 2A75A 1ZVFA 3N9LA 4GMP3 5IWFA 1DG6A 1ZYBA 2OW4A 2CSGA 2W68A 4HKWA 4LBQB 3ZXFA 4QPYA 1OLMA 1V6KA 3LPGA 2W1QA 3K4DA 4IEZA 3GCXA 4NHLA 3U4XA 1S0IA 2VGDA 3EMRA 1VRBA 1QJY1 3OEAA 5CNAA 1J59A 4NVPA 3PURA 4KMQA 4YFZA 2VULA 2W9XA 3N9MA 2WSUA 4TLFA 1AR82 2PXJA 4PIYA 4L99A 3BGAA 2WR9A 1MZFA 2K9ZA 1VP6A 3CKHA 1AL22 2GNBA 1FAYA 1AR92 1QOSA 3AJYA 4JC1A 1ENRA 4D7TA 3ORJA 3RPQA 3RYRA 5IT6A 3WVJA 5LB6A 1DLCA 1MEC3 5EHDA 5KBFA 3N35A 1OPMA 2BPA2 4QX2A 2YBSA 4N43A 3TNPB 3GCWA 3PLQA 4PDWA 3EXUA 5LWBA 3WDTA 2GN3A 4XHBA 4Y24A 4YRDA 2ZX4A 4P9JA 1KDKA 3NNMA 4P9XA 3BIWE 4PIZA 1NLQA 1PGW1 1RUNA 1RUC1 3AFKA 3P1IA 4Q4V3 4BXFA 1JZ4A 3C7FA 3CO2A 5FR3A 1KS5A 1PZ8A 2XHKA 4AI0A 1O59A 2UWBA 3DPRC 4IE7A 4QB2A 2R30A 5FBJA 2HWB1 2ORXA 1CIYA 2R16A 3PMSA 5FREA 1J1LA 5FYBA 1RUJ2 4NHKA 1COV2 1AJKA 1SLAA 5FRAA 3W9AA 1RC6A 3B5LB 1H4HA 2VJXA 3NV4A 2Y33A 4MH0E 4AEDC 2P17A 5FPAA 3RYKA 4EJRA 1Y9QA 3BU7A 4UWDA 5DAQA 3SMHA 1WD4A 2VVDA 2P34A 1GLHA 4Q2FA 3GM8A 2G19A 2YU1A 4META 1ZRFA 5AC92 1Z7S3 4LKSA 5LASA 2E33A 2MEV3 2JENA 4FTBA 5L73A 4R9CA 4JRAA 1UKRA 3POJA 3GZAA 4X8NA 1Y3TA 2RR12 2R062 3FLTA 3U14A 5BNNA 1QH7A 4NPLA 5FK7A 3RJ2X 4BQYA 1HV0A 5JOYA 4KNCA 2Q30A 1CJPA 2R0HA 2VZTA 2RS52 4GULA 3WNXA 5DAPA 1QMJA 3ZFFC 3ZKYA 3KHBA 3KT1A 4GIQA 5JXGA 3PUAA 2B7YA 5C4WB 4B7EA 1ZBA3 5K9YA 2E7QA 2VQAA 3POGA 3JB4C 4Q0QA 1WW4A 5KHHA 2PHRA 1WZXA 5FZ0A 3QBQA 2BU9A 2KM2A 2PYTA 1YO8A 5IK4A 1OOPB 4NRQA 1N1YA 3ZPYA 2ZA9A 1SFYA 2P37A 4PQ9A 5J37A 3T0DA 1YFYA 2UU8A 4YVWA 3VKLA 1MVQA 2W94A 1EAH1 1PMHX 4NHXA 4TSVA 4YVSA 3TEXA 3VBOC 4D3WA 4DXZA 2AREA 5BXXA 4QB6A 1LHNA 1L7RA 3CEWA 3ZXJA 1QQP2 1D7PM 2VBDA 2V5DA 1W0OA 3LEGA 1LHVA 2ZAHA 4YW3A 4AVTA 4CXWA 4YZ2A 3OB8A 4LK7A 4CP9B 3MF9A 4CDQC 2D6PA 4P00B 2BWAA 1DQ0A 1PVXA 3CLPA 2KA3A 3U75A 1UZYA 4XJAA 1Q8SA 2PAEA 4COWA 5CEHA 5CG9A 2YMZA 5T5PA 1GANA 2E26A 5F5QA 5F8PA 3UL2A 5JXHA 2I07B 4HBNA 2W39A 2XJSA 1A3KA 1NA1A 4AGRA 2B39A 3USUA 1JYTA 2XWBB 2PFWA 2QQNA 5I8SA 3EBRA 2XBO3 1EV11 2CL2A 4UOJA 4COVA 2Y6FA 4MOAA 2ZOEB 4Q4Y1 4XPVA 1HRI3 4ATFA 1H8TC 4LBQA 4DMIA 1SDDB 1K3IA 1UYYA 3PU8A 1LB2A 2VQ0A 4P08A 1OFSA 2V5YA 4CRQA 4DY5A 4Y4RA 1C8M1 5JOXA 2CDPA 3WDWA 4F7ZA 1B09A 5HXVA 2XJPA 1AR91 5FIXA 5HV0A 1RVF1 4MLOA 5C8WA 3AFGA 4CDWB 1UYPA 5FZFA 3IMNA 2F4PA 3RWKX 1ZREA 1VBA2 3MW2A 4R52A 2VBPA 2PMWB 1RUG2 2D7FA 2VNVA 3K75B 4INDA 1OA3A 4QX7A 3ZFGA 2ADEA 4DQAA 2IC1A 1YQCA 1GOGA 5HCHA 5FMCA 1O8PA 2JD9A 4QD2A 3R4UA 3VKFC 3CBNA 3WF0A 1H1AA 1RUI1 1LKNA 4LKDA 3UKVA 4JTOA 4LUMA 5FP4A 3FHAA 3IDAA 3IKWA 4GXLA 2D6KA 4BIFA 1BCXA 4ZY9A 1MVEA 3LEMA 5FZLA 2HWD2 1DIWA 1DCSA 1WLDA 3D6EA 1ENXA 3MEPA 3POIA 2Q8DA 1ALYA 4HETA 1B35C 1LR5A 2EXHA 1QHDA 3J8F3 4B4QA 1UU5A 5CISA 1G9CA 3RZJA 2P3YA 5LEKA 4M3CF 3HPNA 1JYVA 2ZX0A 1UY0A 5B4XA 4QX0A 4BK4A 2RM22 4JDOA 3VBFC 3X29B 1A8MA 4GQ7A 3DL3A 4WVMA 3SCFA 3VD7A 3CJIC 2QQUA 1PK6A 2HH9A 5FYZA 1XC6A 5C9AC 4AF9A 1VB4A 1VJ2A 4LHNA 4DPNA 3EHKA 3NMBA 2RMU2 5FWEA 5T52A 1PIV2 3VDAA 1MEC2 4NIDA 4XMIA 1QF3A 2K2SA 4D69A 1CJDA 2HYXA 2BJSA 2VY0A 3L2HA 4AQSA 4M01A 4UYBA 3NNJA 3FL7A 1JN2P 3RZLA 3HIFA 3UT0A 3B01A 4NOTA 2Q1ZB 2QDNA 2O14A 5FYIA 3MFAA 5CVRA 5EV7A 5BNOC 1KEXA 3PTYA 2O8QA 5FZMA 2HWC3 1V9U2 4N53B 4YGEA 5IAXA 2D40A 1SMVA 1ULEA 4BK5A 1GWLA 2B8MA 3AKRA 4EN7B 3DV8A 2VU9A 1BBT3 1PGL1 4JZRA 5KXDA 1R091 4QPGB 4QDRA 4M0HA 5L9BA 2JEMA 4GWMA 3ZKUA 1JZ2A 4LIVA 1H4GA 1UWWA 5E6HA 3PL0A 4M3CE 2C9KA 4FT8A 1O3TA 1AYN1 4YM1A 5F3CA 2O8OA 1W06A 3JBG3 2WAAA 3WNPA 3ZIWA 2P3JA 2Y6LA 3IWZA 4J25A 5HI0A 1BYHA 3RG0A 3ZIXA 4DS0A 1QXRA 3P5BA 3WP3A 3M2MA 4FOVA 5EXOA 2ZGSA 1W8TA 5HCFA 3ZFEB 4KH9A 3HVDA 1QJU3 3HOBA 4CDXC 3PJQA 4Q8KA 2QDRA 2Y34A 1BZWA 1IKPA 1POV1 5A33B 1NXD1 2C26A 3THDA 3ZYBA 5BYNA 1JYCA 1NLRA 3FJSA 1ZBE2 1Z7S2 2W0XA 4LEJA 2QQOA 4JGZB 3AM2A 3OY8B 3KD4A 2WNVA 4NO4A 4XQWA 1GWMA 1OVPA 2QKDA 3OPTA 5ANNA 5FV3A 2HBTA 1AXZA 4ASMB 4CP9A 1BEV3 4XUOA 5DUWA 1AR63 5LZ6A 1DQ5A 4GWJA 5FYMA 3M3CA 1O4YA 4LKEA 2UYAA 1PO23 1ND2A 4YNIA 4UW5A 2WBKA 3WT3A 4KWJA 4MGKE 4FAHA 1VMFA 3JZVA 3BU0A 1EYBA 1C4RA 3OG2A 2YC0A 4XF1A 2ZS6B 1AXKA 4RS5C 2WYFA 2P4EA 5FY1A 4LBKA 4J6GA 5FPXA 1RGSA 2J7MA 2WLPA 2XVGA 4X8PA 2VMCA 5JXIA 1QOTA 2CV6A 5FZOB 1CAUB 4OMDA 1OT5A 1WWYA 3OYWA 1W04A 5FK8A 1JHNA 5FMDA 3M7AA 3FX3A 2BYVE 2Q8OA 5DMYA 4XFHA 2VD7A 4QDQA 3S7EA 1ULGA 1ENSA 1Y4WA 1DU3D 1DQ6A 2VZ3A 2ZCWA 1FMD3 1RXGA 4LA2A 5I0TA 3ZN6A 3H1MA 3NWKA 3M8LA 4I3PA 4XURA 4XQ4A 1W39A 1KJLA 4RHV1 3V56A 3KWVA 4C1XA 2J42A 4ZONA 2P3KA 4W6YA 1DBNA 4XUQA 3MPPG 1WLTA 1GQPA 5AVAA 1TMF2 2LALA 2GMPA 3MDPA 1GR3A 2HWD1 4FQ4A 1AHSA 1LNSA 2P5BA 3J26N 2W2IA 4HN0A 4AI2A 1IS4A 3EB7A 3KQRA 2A5ZA 2EIEA 2GMEA 2ZGPA 4DFSA 3GBGA 1K5JA 4BE3A 3QLQA 2VZSA 2IXCA 2G9FA 2XBO2 4A44A 1A34A 3LDBA 5IVJA 1MS5A 3MLKA 4ATEA 5AFBA 1WLWA 2BRTA 3E1F1 1UQXA 3POBA 1QIQA 4LBOA 4DUXA 4Q5OA 2WINB 5GZGA 1R1A1 3AMQA 1QJX1 2Y6KA 3AP4A 2VZ1A 5E16A 3WNMA 1PIV1 1DYOA 2JX9A 3LCPA 2WFF1 4FOQA 4IEQA 5FY8A 4CUBA 2VTXJ 1XYOA 2VMDA 3GZEA 2ZGMA 2GNMA 3NJYA 1YQ2A 4YARA 2H6BA 5FY4A 5IVEA 4CTEA 3NAPB 4GH4B 4XDPA 1UD1A 1JTZX 3PHMA 4K20A 4OI4A 2ZX2A 3ST7A 2LROA 2JECA 5DUXA 3G7DA 2E63A 1W8OA 4QGLA 2GH2A 3O0XA 1RHI2 3FWEA 4S2GA 3AK0A 3WW3A 4EWAA 1CX4A 4WM7A 2ORZA 4R4XA 1VBB1 3VHRA 3GYDA 2HWE1 1A8DA 2I74A 1S0EA 3SEPA 1OKOA 1R64A 1XNBA 2OZ6A 3BTAA 1YWKA 1M4WA 3P6BA 1MZEA 3PVOA 3E5XA 2RHPA 1RL3A 4IEVA 4W4ZA 3WV6A 3KT4A 4HKLA 1RUC3 4N53A 1I9RA 3SCHA 1RUD2 2GC3A 3AYDA 4AAXA 1D4VB 1AL0G 2ZXQA 4QPGA 5F3IA 3SHRA 3VKMA 1OLRA 4HMZA 2P6HA 2MPFA 1KJRA 2RDRA 2YYOA 2ZX1A 3CU7A 3LKJA 2A7AA 3I54A 4Q0PA 4E4DX 2JG8B 1ZZ9A 2Z5WA 4LE3A 5FLIA 2WL1A 5F3EA 4KU8A 4QX3A 2FZ2A 2BNNA 3VDCA 4YGCA 2WAOA 4PLNA 5D1IA 3SLIA 4XCAA 4CU8A 2NM1A 1W6MB 2QQIA 4C90A 2PHFA 5T50A 2GMMA 5BNQA 3JD73 1W3VA 2HWF3 1W6PB 2HJIA 1GU3A 4K7JA 2ET7A 4TXWA 4IGQA 4P02B 4BMBA 2VXJA 2Y26A 4UBHA 3AC0A 5LY2A 4CU7A 3ITQA 4JDMA 1MQTB 3NV1A 4JGYA 4AHWA 1OH3A 3BVCA 1MS9A 5JVVA 4FPHA 1LOEA 3OY8A 1BBT2 4NPMA 5LEJA 1AYM3 3PIJA 5BPXA 5T5OA 1SCSA 4XTPA 3LSEA 1VLNA 1WLCA 2R072 3VZLA 1BMV2 3NVCA 1W8FA 4QGMA 4QXKA 2B45X 4WV8A 4CE8A 3BTXA 3FFQA 3N9NA 1W0PA 3D0SA 3PVNA 5C8CB 3H7YA 1HIXA 1OMIA 4LO8A 3UV9A 1OLME 4AK3A 5ABJA 5C4WC 1YI9A 1D4M1 1ND3C 4ES8A 3BOPA 3A4UA 4CPBA 1S0JA 1PO12 4LBJA 2XUEA 1UOFA 4Y1UA 3ES1A 3T2TA 2DCTA 3O12A 1QJU2 1EAH3 1W8NA 1XE7A 2VCBA 1HRV2 2OT7A 3JUUA 1X7NA 1FOD1 4CDUC 1NY71 4E2SA 3ACGA 2XL7A 1NCRB 4FSJA 2JXAA 2BUKA 3T0BA 2NP0A 2B9UA 1KXGA 4QB1A 2W1UA 2YXSA 4IEWA 1RYYA 1W6NB 1SLBA 2Y0OA 1E5SA 3SNMA 5C7GA 3FBYA 1K5MA 1YNAA 1SBDA 5A32A 1X8EA 1UZVA 4YZ1A 1UO9A 1ZA4A 4MZUA 1H2MA 3E6BA 5FPLA 5I0UA 1DFQA 3LSDA 4PT6A 2C4XA 2O0OA 3OGJA 2R1DA 4M0NA 3IN9A 1TME3 1FV2A 4AFCA 3KV6A 3LIHA 1EV13 5JOWA 1QEXA 2DV9A 3VKNA 5L7OC 4Q4Y3 4OMCA 4A42A 4WM8C 3IAQA 4FFFA 2GAUA 4OCTA 5JMCA 4JQTA 4K40A 1DGLA 3QD6A 5G05L 4FOYA 5D21A 2GNDA 3ENRA 1S0CA 1NCQA 1WGPA 2XJTA 3B00A 1EY2A 1VMHA 3ECQA 1C8M3 3FFZA 4RQPC 5FP7A 4LT5A 3F2ZA 2VNOA 3DCQA 5C3SA 1J1TA 1RVF3 4AW7A 4W6WA 4XACA 1H6YA 1XXNA 1R1ZA 5DAXA 3N36A 3B93A 5CKMA 3GF6A 1XYPA 3NRUA 3WP5A 4CDWC 4BQXA 3WNNA 1FMD2 2A71A 4OI1A 3I2KA 2BQPA 4AQ6A 1PHMA 3T2QA 2RDQA 2J1AA 5DDJ1 5EYXA 5FQ0A 1TNRA 2XUMA 4QM8A 3ZN4A 3AMNA 5CIRA 5I0DA 3ZSEA 1RUI3 2PAMA 2VOWA 1QH6A 4N43B 4A7KA 4PDWB 1HXS2 1NE6A 4CEWA 3TN92 3WCSA 3FUQA 3PMEA 3HNYM 3J9SA 3AYEA 4BJ0A 1G9BA 2Q1MA 5EWSA 1OLQA 2RDNA 5IATA 2VO5A 4QXCA 1VBC1 4AEMA 2YPDA 3HQXA 1DDLA 5KXCA 2IXLA 3WNKA 4XUPA 4BQ4A 3ZYHA 5KHKA 1VBE2 4LLFA 5EJZB 4QKFA 3OUJA 4ZU4A 4HONA 3LIGA 4AFAA 1J83A 2G1MA 1JZ7A 2WZR2 3J7LA 1XOYA 4OUMA 3AZWA 4B4PA 1ZNPA 1VRH3 4H2AA 2IXHA 4DB5A 2W3JA 4XJ8A 4A41A 2BP6A 3C7OA 1FT9A 3HNBM 1PVC1 2VVFA 1HN1A 4MV2A 4H7MA 5FZHA 2D44A 3OTFA 3KCYA 4QQHA 1UPSA 3S5AA 1UY4A 2FMDA 4HVQA 4Y22A 2KR2A 2A1XA 5HPOA 1XRUA 4UFMA 3THPA 4TYSA 2D97A 1MACA 4A6OA 4LOTA 1ZX5A 3SXWA 1WCSA 3W5NA 2BOIA 1R093 1OKQA 2VTXA 5HCAA 2OVUA 4YGBA 5KXEA 1MZ6A 3T08A 3WDVA 5D8AC 3VL8A 2JD4A 1R083 4DZGA 3UNPA 2BERA 3C2UA 2HLEA 1AR71 3RMXA 1JZ5A 1UU6A 1JYNA 1UXXX 2Q8EA 4AGGA 1UZWA 4I3GA 5LY1A 1YIFA 2JKBA 2MHFA 5SV5A 3HWJA 4FVVA 5FZEA 1OBNA 3RDIA 5GLTA 4V2VA 3VBOA 4ZHNA 2GC1A 4IEPA 2XB6C 4P9YA 5FZ1A 5GLWA 1SQ4A 3ZSLA 2XLGA 4E4HA 1RUJ1 2X5IB 5LA9A 3O1RA 1G6NA 3LOBA 1RMU1 2ZGUA 3JD72 2HWF2 4AHYA 1CPNA 3VBSB 1CAVB 1RUH3 3LD8A 4K6BA 1OQ1A 1H9WA 1GQHA 4BIOA 1POV3 4CDQA 3KGZA 4IEOA 3ZXEA 4I0WB 4AI8A 5F5IA 3WEZA 4LITA 3FBMA 1ST8A 1RUE2 2WT2A 3DGTA 3WQ7A 4JGZC 1N1TA 3DYPA 4XOGA 4MXVA 2JG9A 1AYM2 1CAXA 2NYYA 4FPCA 1FX5A 1L7QA 2PLV2 4QMAA 5BNPC 1DQ1A 5J7MA 1XSQA 5A3UA 1VBD1 2XLFA 5FFOC 4FQZA 1H8TA 4KWKA 1TE1B 2BGPA 1YJKA 4CEYB 4DY3A 1NA1B 3VBHA 3S5QA 3USUB 3TRSB 2E7TA 3ZOIA 3SITA 3P3NA 1G8WA 3U37A 1NXMA 3BPZA 1AXYA 1W8WA 5H9PA 3H3ZA 5BUVA 2ZTNA 3MIDA 3BODA 4UXAA 2WJSA 1PNFA 4CUCA 3SKVA 2B42B 2RS31 3T4HB 2FDKA 3WQ0A 2DUOA 3OJBA 1HX6A 3LZZA 1C28A 4CCNA 3ASIA 4MXWB 2XL9A 4RHV3 1MS8A 3J7NA 3VN4A 2RJLA 3ZMOA 1YUDA 1RUOA 5LBEA 3WQ1A 3ZFGB 5J3UA 2FMYA 3QH7A 1CWPA 4CXYA 2JB8A 1LTEA 5FLJA 3B9CA 2D3SA 2XQXA 1UZ0A 3MIBA 4WVZA 4X6QB 4XQDA 5K8SA 3VD4A 1F4AA 5FO9B 1UN1A 4GB31 2ERFA 2OPKA 4Q0VA 2P6CA 1TME2 2R6QA 3OBAA 5FZBA 5IK8A 5A7NA 1W9SA 2Y0IA 3THTA 3NO8A 5C5TA 1FPN3 3UETA 2ZBJA 4Q4W2 1RB8G 1GNYA 4CCOA 3V65A 1ENQA 1G9FA 1YQ6A 4FXGB 1VAVA 5FXVA 1QJX3 2ARAA 1JOBA 3IT8A 2YY1A 4XVHA 3WF4A 3I3DA 2WFF3 3RZZA 3K46A 5J48A 4WVMB 3WNOA 4FP2A 1PK6B 2HEYF 2X29A 3K3NA 4NR1A 4BWOA 5LA2A 1GOHA 4GH4C 2BEOA 2BGOA 1BK0A 4QXBA 4KG0A 3VBRC 1W2UA 5C33A 4M4PA 2GSYA 5F7UA 3MW4A 1V6JA 2VW1A 2ARCA 4Q27A 1VBB3 1V6OA 5FY7A 2HWE3 1WA4A 2J1EA 4Q8LA 3VZMA 2JJ6A 3ZYPA 5CFDC 5IFTA 4XTMA 3KLSA 3S30A 4MADA 3MLLA 1X82A 1OUXA 2PHDA 4Z2WA 2VR4A 1RJ8A 1E5IA 2YPJA 4AVSA 1OA2A 5FY0A 3AYCA 3O0VA 2KD7A 3H8UA 1CZVA 5F5CA 4N7IA 3WF1A 2VOKA 3APBA 3IDCB 5TSWA 1MS4A 1LESA 5JI9A 2X05A 4R9AA 2VQTA 1DLLA 1ASJ1 1L3JA 5JIUA 2CAUA 4PF5A 5K0UC 3FZ3A 4ORFA 4BQ3A 3HT1A 5CB7A 2FD8A 2JG8C 2VMIA 3AL5A 2RVAA 3N9QA 3AL6A 1VRH2 2UWAA 3ZO0B 4CDXA 2CAVA 2VVEA 3POSA 1JU4A 4U2AA 2RS11 1ZRIA 2D98A 2WNEA 1VMJA 3KM5A 4KWUA 3WP4A 4W65A 2IXIA 4HSJA 1LOBA 2AENA 3ATGA 3HEIA 4B29A 3NQHA 2X5IA 5A7PA 3VD3A 5I8TA 3WHUA 3C7HA 1G9AA 3PUHA 1JS9A 1CAVA 4P9WA 3VBSA 3FN9A 4FFIA 4CA9A 2LTNA 2D6MA 3SEEA 3V0BA 2WIIB 4EQVA 3WHTA 3R6SA 4FO9A 3KCCA 4NWWA 3UGHA 3PDQA 1DGRN 2A73B 1V0AA 3JB8A 3VHPA 3C3VA 2R043 5JZGC 2X53S 2WNVB 5IVCA 4Q4X1 2G9ZA 2IZWA 2D5HA 5ERLA 4LO5B 1W3XA 1EP0A 5IYYA 4OVEA 4E8DA 2E53A 1IOAA 4AQTA 1R082 5A6QA 2CNAA 4RSUA 1ND2B 1T6BX 2PQQA 1S2EA 3Q9OA 4AEJA 4XW3A 4Y20B 1VR3A 3HBZA 4BLJA 4EZHA 1QJFA 2JIJA 4OI2A 5C8CC 2IXJA 1D4M3 4CEYA 1O91A 3USSA 4QKNA 3OCPA 4QXHA 2ZHLA 3LFIA 5I0RA 4HFSA 1W99A 1NE4A 3DKWA 4XEZA 1DZQA 4CU9A 3G6JB 2DCYA 3GJBA 3MICA 4OUSA 4ZXKA 4NHMA 1FXZA 1AR81 3E97A 1RUH2 1FOD3 3OYWB 3WG2A 1APNA 1AL21 1ZRCA 2WWSA 3H8RA 3HBKA 4RR3C 2WABA 1V00A 4ONUA 3RYPA 3ZN6B 4IE5A 4MXWA 5L9VA 3ZVXA 3PJYA 1AX0A 1HQWA 1SHWB 1X36A 5FZ8A 1LOFC 4KG8A 4JHTA 4NHYA 4ZU5A 3AVRA 3CIHA 3RMYA 3JXSA 2YHJA 5DAVA 2Q0AA 3VBUC 2GU9A 4XYXA 5JCTA 4TTGA 4AL9A 2CTVA 2YBKA 5GKAC 4EV0A 5ACA2 1H2NA 2XG3A 2JE8A 1CGPA 2QCSB 1GSLA 1UL9A 1W9YA 2PHWA 5A7OA 1W2TA 1V6NA 4DXSA 5LRSA 5LBFA 2A6YA 1O6UA 3BN6A 1UIKA 4Z1VA 3ZYFA 2ZMKA 5EIYB 2JWPA 4JX0A 4L92A 1WCKA 4AHZA 4KQ7A 1UMZA 1S0BA 3C8XA 3W59A 4XAEA 1LCLA 3U10A 4UFKA 1H2LA 1RUF3 2IVIB 4YM0A 1COV1 1MS1A 1OSGA 2O1QA 2PTMA 5E89A 1H1IA 2OUHA 3I59A 1U0AA 2ILMA 4LOSA 1YIPA 5DDJ3 3LGRA 4YPJA 4FBFA 3K51A 1WBLA 5GALA 5GLVA 2V4VA 5AC91 3KB5A 1UMHA 4WM7B 1AZDA 4Y33A 1OVSA 3DUIA 2PHXA 4ARXA 2B4KA 4DUVA 2AUYA 2RR11 4AFBA 2ADDA 2R061 4QU2A 3U0ZA 1FPN2 1X50A 1VIWB 3K3OA 4A4AA 3B7MA 2WNOA 4L11A 4PJYA 3ROUA 2GNTA 4TLGA 4I2OA 2RS51 5GJ6A 2JDUA 3MPBA 4LK6A 4DUWA 2Y6GA 3I8TA 4Q4V2 5EJ1B 4UW6A 1GUIA 5FJHA 4HXCA 3AX4A 3WZ1A 4IV1C 3VDDC 4AVAA 2OQ7A 5BV6A 4YG0A 1GQGA 2OA2A 3Q8FA 4FFHA 4HVOA 5JPNB 3O1UA 2VUAA 3MO4A 1CONA 2JDHA 2H0BA 4B1MA 3I2GA 1P8JA 4P9GA 5FKCA 2XONA 5JSOA 4FPYA 3ZXAC 4E2QA 2LW8A 3B69A 2XLAA 4YZ3A 2DBNA 1PVC3 4R9BA 4K9SA 2WS93 4RGGA 5FYCA 5A3NA 4EROA 1Y9GA 4AFDA 5J98B 1CX1A 1QXPA 3OGSA 1OD3A 2FQPA 2B5HA 1QQP1 4BB3A 1X9TA 1HQNA 4Y3OA 2W46A 2WO3A 3TEYA 1ULOA 1GNHA 2EIBA 2VW2A 1IS5A 2D3RA 2ENRA 3LA7A 1F5FA 1ULDA 1MS0A 3M70A 4UFLA 1JU3A 4ASKA 5DUVA 3NNFA 5LW9A 3GJAA 2EXJA 2Q8CA 3KQ4B 4JGYB 2AGSA 3WP6A 1OURA 1YEWA 1SLCA 1UF2C 2MEV2 5FZIA 1W28A 1V6MA 2VZVA 5KC5A 3KZ4C 4LHKA 1ND3A 1PMIA 4N90A 5BNNC 2E31A 2YDEA 4LBQD 5JIAA 1AR73 2DF7A 3OGRA 3I2FA 4DOUA 2WYSA 4KI5M 2XGXA 3WR0A 1C5IA 3UESA 2ZKNA 1LENA 4Y20A 3R0RA 3M1HA 3UYJA 3UJQA 2DFBA 2BBAA 4FXKB 5ABJB 5KC6A 4CDUA 3PIGA 1ZBA2 4XFIA 4D8MA 4LO4B 4W8JA 1SZBA 1PGSA 1STMA 3AYAA 2CWMA 3HNMA 5A7SA 1RMU3 5K7PA 3MZHA 1PNGA 3KHCA 1CN1A 3F95A 3UKTA 3DXTA 3L9JT 3IAPA 4Y1YA 4B3NA 5CFCA 1VBA1 1ZRDA 4YVWC 2JDMA 3LOIA 1RUG1 2UY9A 3O1TA 1K45A 4YVSC 1YFUA 4YFWA 5K4LA 1JZ3A 5FLHA 4B8EA 4BU2A 4IDZA 2ZX3A 3OD0A 1OC1A 2JDKA 2WO1A 3A23A 2GP5A 2Y6HA 4XUNA 2R042 1IPJA 3AKPA 2Y38A 4LBNA 3BIEA 2J1SA 4MHUA 1K5MB 5A32B 2JDNA 4B4RA 4D6SA 5L7OA 3OEBA 3CZUA 2W1SA 2ZEYA 4ZS3A 3T09A 3WSOA 3TEZA 1POV0 1Y43B 2W1WA 4OZXA 4QKDA 3JU9A 4ET7A 1J84A 2EXKA 2WNUC 3H50A 2QUOA 4OYUA 4NAOA 3O1PA 3KV9A 3H8XA 1HDKA 1IKQA 2BTVC 1GV9A 4HANA 5IJRA 2P1BA 3WF2A 2C5DA 4U36A 4HN1A 4E9KA 4DEQA 2WA3A 5CADA 1FV3A 2GZWA 1RXFA 1EPZA 1N3PA 2RM21 2ZMLA 1NCQB 1FI2A 1HRI2 4JV4A 2X09A 2WC2A 3N3HA 3OPWA 1QJY3 4DXTA 1RINA 3JCIA 2RS33 1REFA 4Q0SA 3WCRA 2GDFA 3O0WA 4E8CA 3W58A 1U5YA 4JKLA 1S2KA 2QVSB 3HT2A 4MGZE 3WY6A 2RMU1 1BVVA 3ZYIB 2CY6A 4CCEA 1MEC1 1IG3A 4GMP0 4I09A 3NJZA 2TBVA 3WF3A 2ZEWA 2QZ3A 3I3QA 1AF9A 3IBMA 4D0QA 5FQ0B 4HL0A 2DUQA 2EA7A 4OFGA 4MHRA 4E4ZA 4BM8A 5IK5A 2DFCA 2QJVA 1V9U1 2W08A 3AVSA 3LDRA 4GKXA 4NAMA 1BJQA 4BH9A 4CEWB 2GALA 2YROA 3OBZA 3OBRA 4NUBA 2J1UA 3GHNA 1XU2A 2OQ6A 1W2OA 4JQRA 3IMMA 1QWRA 4LLOA 4YYOA 4HOOA 4WZFA 3I3EA 4NWVA 4IUGA 2EAAA 4LUKA 1DGWA 4AHXA 1LECA 3NL1A 3GZUC 3H8OA 4AI9A 1H30A 3J8F2 4UFJA 2FCVA 2BVVA 2E32A 1W2AX 3TB0A 1W9WA 4AEDB 1Q8PA 1KDMA 4H55A 4UBGA 2HWB3 3ZDVA 5A1AA 2ZHMA 3NJVA 4PHZA 4Y5SA 1H6XA 3AP6A 2C1FA 5C5UA 3H3LA 3WOGA 4V1PA 1E5RA 3FHQA 3FLPA 1ZBE1 1Z7S1 1O7FA 1XBFA 2ARXA 2VMHA 2Y8KA 2UY8A 4ZU7A 2IFRA 3ACLA 2W91A 3NW4A 4IV3A 2DVAA 5D8AA 4Y22B 1WCQA 2ZAAA 2HWC2 3SH3A 1AX2A 1Z78A 4Y1VA 3ZFFB 5M0TA 3FHIB 4Y5TA 3POYA 1X8MA 3FC0A 4LO7A 3I2HA 2XDVA 5B4NA 5IHRA 4BZ4A 3TWIA 4QX8A 4BXSV 1W90A 3NNGA 2UURA 1F2NA 5GZFA 4JRLA 5EZWA 4KBZA 3R4SA 1I6XA 1WW6A 1ASJ3 2VQUA 5FP3A 4BQ1A 1G9DA 3LA3A 4KGQA 3VHNA 3AP5A 4H7LA 4JVAA 1A6CA 2ZGLA 2C24A 1Q5OA 3RI9A 1IZ3A 4QHBA 1TEIA 2RS13 2W87A 4XFAA 2QQMA 3JBG2 3OD4A 4D94A 2ZGNA 3VBOB 2WS92 2OXBA 5FZ3A 5IW0A 5GZEA 5LATA 5JLVA 1NQJA 4AI1A 4AOCA 5EPAA 1OOPC 3RNSA 1W9FA 2JIGA 2AC1A 2L9LA 3OGVA 4CDQB 2QBXA 5A3PA 5BNPA 1LOAA 2I45A 3MLJA 1HB4A 4QKBA 4YLZA 5IVBA 2ZGOA 4YW5A 3IPVA 5KHIA 3V0AA 2BWCA 4XUTA 1TMF1 2A6VA 2JG9B 1CAXB 2WNVC 3J7HA 4Q26A 2C6SA 4IEUA 4QPIA 5FCCA 4URTA 3POWA 1LU2A 5FPBA 3S57A 4IXLA 4YW2A 1BEV2 4G3YC 1AR62 2Q5TA 3ZXDA 1GYKA 1PM4A 2VW0A 1H8TB 1ND2C 1PO22 2W47A 2EF6A 2LRPA 2XBO1 3UGFA 4ZKTB 1W6OA 2VZUA 4K8RB 3KVAA 4XIOA 4LPLA 1CIWA 3VBHB 3RRDA 2XXZA 4DXRA 2E9QA 3DECA 1LHUA 1WMXA 3ABZA 4V2WA 3CDZB 1ULCA 3AKQA 1LGNA 3PUQA 1SFNA 2BNMA 4P5HA 1REDA 1AR83 4NRMA 2KXLA 3K4AA 3PTRB 2LS6A 4CCCA 4HPKA 1OQDA 5A7WA 4RL7A 1AL23 3IDEA 3I2DA 5FMOL 4IEXA 4LORA 1AR93 3UKNA 4XBQA 2E7AA 3HQRA 4ISQA 4NIIA 4WBBA 5A1FA 1OQEA 4TZDA 1QY4A 4S2HA 1JBCA 4J1XA 3CJXA 4JDNA 3BOWA 1XNCA 4PLMA 4YG6A 4Y26A 3SKJE 4FPLA 3TNQA 5C3OA 1RHI1 1UOGA 2NQYA 3ACHA 1O3QA 2DWRA 2VL4A 5DZEA 4EN9B 3B02A 4AI3A 4D6RA 2F4LA 4DEVA 4FAGA 2UYBA 2LUWA 2XMLA 4NROA 1JYWA 2GP3A 4OHXA 2IFWA 4FPOB 2AZ5A 3VL9A 4MGSA 2DU0A 4AVVA 3O1OA 2VZRA 3BTYA 3O1VA 3SISA 1RUD1 2WQ4A 2CGNA 5C3RA 4CCMA 1QKQA 1LULA 3ZX7A 1QNWA 3H0OA 3CJIB 1JMUB 1N1SA 1WMEA 3DPRA 3JQWA 1TNFA 3OSDA 3GXUA 3AB0A 1QJY2 2VOVA 4LA3A 1COV3 1CAWB 1ZM1A 4XILA 4LHLA 5APAA 1YFWA 2VUJA 4LXLA 4AEDA 5H9SA 1XE8A 3H1WA 1DP0A 1XU1A 3T2OA 1OI6A 2WN3A 2ZZQA 5A1LA 4GA9A 5FKBA 3HJRA 4BOWA 5F1RA 5DZFA 5EP9A 5FPZA 1LHWA 2JICA 5AC93 4MGIE 4A45A 1W8UA 1AUYA 2Z69A 5CFCC 1NKGA 1JUIA 1ZZ7A 2WT1A 4KU7A 2BV4A 5CKNA 1BVP1 2RR13 1JZ8A 2R063 3N4MA 3OPZA 1BBT1 1REEA 1W9TA 1LRHA 5DN2A 2YV8A 4QX1A 5DABA 4KGGA 5K0UA 1PGW2 2RS53 2R071 4L8QA 4XAAA 4N53C 1RUC2 4GWIA 4LBLA 3ZFFA 4EZ4A 5KR7A 1BMV1 3ZYGA 2Y6JA 4RFRB 2VMGA 3VD5A 1ODNA 4YSFA 3L2YA 3ELNA 4GALA 4CPBD 1GP6A 4RA0A 3JBG1 2W92A 4QPGC 1YLLA 4KBBA 5FYYA 4QQOA 2WKKA 1AYN3 1LOCA 1PO11 2HWB2 3FUOA 3PU3A 1W6QA 4IQPA 3RI8A 3W21A 4BHPA 4CDXB 2OZJA 4FPJA 2TNFA 1DF0A 1DYPA 1QJU1 2BNOA 4A3XA 1HRV1 3DXUA 1HW5A 1UYXA 3QH6A 1QJEA 4EE2A 3U1XA 5FAXA 5IUQA 1W8ZA 5JZGA 2OKXA 3GGLA 1O3RA 3D82A 2WSVA 4JKKA 3ZFEC 2RJ2A 1H1MA 1UKGA 2J22A 3DKQA 4OI0A 2OX0A 5FWJA 2TEPA 3V0BB 5FZ7A 4N9IA 4CYDA 4BA6A 4K21A 4MGTA 2V73A 1UNBA 1IQDC 4QHOA 1SLTA 1S0DA 1RIRA 4XBLA 1JHJA 1TG7A 2X8KA 3WINE 1GZWA 4PLOA 2ZJCA 3POFA 4YM2A 2Y64A 1S55A 3Q8AA 5DPNA 4XJZA 2D93A 4AVCA 4D7YA 1H9PA 2VTFA 3MYXA 4RS5B 5F2WA 4P14A 2ATFA 4AEKA 3RZHA 3HD8B 2SBAA 3ZPOA 2GC0A 1D2QA 2WT0A 5FZ4A 3M3QA 2YGLA 4XJWA 5FPUA 4NIHA 3URFA 1US2A 4W6XA 1KS4A 2VUCA 3ZR5A 3E6CC 1CPMA 3K4ZA 3ZYRA 5T3NA 2B46X 1BK1A 2BDRA 4FTSA 4NJ4A 1J3QA 2BVBA 4RR3A 3OOXA 2V4AA 4EN8B 4A6SA 2FCTA 1JI6A 3GBWA 1F4HA 3R05A 3UJOA 4F3JA 1VBA3 4PQQA 4YGDA 5KHJA 1FMD1 1RUG3 2ZHNA 3N9PA 1EUTA 1EAH2 4PF1A 4ARYA 2WRAA 5FO8B 3VBUA 3T1MA 4WVVA 4BCUA 5LBCA 3WG4A 1IS6A 1TQ5A 1GP4A 3I2IA 2PAKA 4O9EA 1WW5A 1UYZA 2OYZA 1KITA 2JDYA 3VZNA 3RZMA 1HXS1 1LODA 2QQKA 5EYYA 4Q1RA 3TN91 1K5MC 3VKOA 2PHLA 3A21A 4CSWA 2PA7A 4SBVA 5JUVA 3B3QE 3POEA 3MV01 2HWD3 3RJRA 4UFHA 3KMHA 5CZKA 4NIGA 1GZ9A 1HLCA 5JR2A 1B35A 4XHXA 4YW1A 2EAKA 3M4FA 4G9SB 4ZS2A 1UAIA 3D5OA 4Y4YA 1EV12 1OA4A 4CP1A 1VBE1 3KSCA 2DCZA 2MNGA 2RM23 4M00A 4Q4Y2 4RD7A 4OHZA 3V64A 3VBFA 5F37A 5CKQA 3KCXA 4A7YA 1WBFA 1NCQC 1CR7A 2VNGA 1S1AA 3CJIA 3M3EA 2WZR1 1JUHA 5FO7B 1C8M2 5FYTA 2XVKA 5C9AA 1R1A3 5DG2A 2XKPA 4XDOA 5FXWA 5F2SA 2RMU3 1LU1A 1PIV3 1PM7A 1GZTA 1RVF2 1ZZBA 4KL1A 1CAWA 2CDOA 4PI2A 5FUIA 3NV3A 3WDYA 4BPZA 2XJQA 1TVGA 3Q8CA 4NMIA 2AEYA 3I59B 5FY5A 1GKBA 1BHGA 1LOGA 2K46A 1OFNA 3ACIA 1OUSA 3LE0A 2QQPA 1LEMA 5H9QA 3NAPC 5F5AA 4P9LA 5BNOA 1Q3EA 2A70A 1V9U3 1CVNA 1LEDA 4NPRA 4TN7A 1H8VA 4BISA 5FPVA 1RUI2 3MGUA 2DTWA 1WCDJ 3WW2A 2WO2A 3Q8EA 1PMJX 3WW4A 2LM3A 4H3WA 4CEWC 5GZDA 5I91A 4IV1A 2R0FA 3VDDA 5CA6A 2JDAA 4X6RB 4CP0A 1FNYA 5FZ9A 4YW4A 3ZSKA 4L0PA 4PBOA 1V6LA 5IVVA 1ONAA 3T2PA 2BFUS 1ZA7A 1Q56A 3HAGA 2H0VA 1C1FA 1UPIA 2Y60A 4L9BA 3VZKA 5KWRA 2G4IA 3LF7A 1W03A 1QDOA 4W50A 2HEWF 1XE0A 5FZGA 4Z2AA 4UF0A 3WW1A 5G04L 5EFUA 1IQAA 4MO3M 3WDXA 5C71A 3B9IA 2VZPA 2J1RA 5LRRA 3Q8BA 1W0NA 4LHSA 4BQ5A 4EN0A 3JD71 2P2KA 2HWF1 5LK7B 2DUPA 2NZ9A 4XFGA 2YUEA 4GWNA 5FXXA 5FY9A 4UAPA 2VC9A 4MG2A 3I2JA 1WKYA 4GKYA 3BI3A 3TOJA 3J7MA 1ZBE3 5JXJA 1DQ2A 4CCLA 4XC9A 4XABA 4K1ZA 5CBLA 5JI7A 5FDBA 1RUE1 5J1XA 4NRPA 1XQNA 5C70A 1U5IA 3MIGA 5FYHA 2WZPP 1N1VA 2BFUL 4L97A 3NV2A 2DCJA 1AYM1 2PLV1 3WD5A 3ZN5A 3QACA 4A2UA 2DURA 2R7EB 5DAWA 4EWEA 1MQTC 1AVBA 1IG0A 3KT7A 3LB9A 5DG1A 1O4ZA 4A7ZA 1HB3A 4C1WA 4F83A 1VE0A 3VUOA 3T4VA 5A80A 4OLLA 1R092 1PGL2 5IAVA 4XXPA 1SDWA 3H1YA 2NLRA 4FI9A 1ND3B 3AZYA 4PCRA 4RYDA 4RS5A 2D6LX 4ZZ8A 2JB4A 3AKTA 1MR5A 1S0FA 1SEFA 1AYN2 4IESA 2OPWA 4XJ9A 5GZCA 1GBGA 1VAMA 3AMMA 1UOBA 2PHTA 1F9KA 3AXEA 4CDUB 5FYSA 1N47A 1CZSA 1NOVA 1Y7BA 2B9VA 1LJ7A 2C9AA 4I0BA 5FUPA 2CYFA 2QQJA 2XHNA 1DQ4A 1MPXA 3ETQA 2Z2SB 1UCXA 4UT5A 1DZTA 2VZOA 1D2SA 2AEZA 3AP7A 3CF6E 5CFCB 3OUHA 3NKGA 1SLIA 4QQPA 4AZZA 1Q8VA 1OXCA 2BGCA 1XSRA 3I4IA 4DRVA 5IFPA 5FP9A 4XCBA 2YBPA 1C57A 2FDHA 3OBTA 1NCRC 1YCIA 4L2NA 4NIAA 1TMF3 2WNUA 2UWCA 3IM0A 2FCUA 1W2NA 2VE1A 2QTWB 2JG9C 3ALQA 4LTAA 2YFUA 3N7LA 4HZFA 5LBBA 4P5YA 1YJLA 3FMGA 1TME1 1U5ZA 3MIEA 5AVPA 5L7OB 4WM8B 3MV11 1QGLA 2D6NA 3ILNA 3BTZA 4Q4W1 2JDPA 1GNZA 1N3QA 2FDJA 4TWTA 1DYKA 2ZEZA 2YC2A 4RQPB 1WMDA 5F6KA 1ULFA 2VZQA 3GALA 5ANQA 3VBHC 2VXRA 2NPIA 2NMOA 1WMFA 5GM0A 2Z79A 1F31A 4CCKA 2WQ8A 4COZA 1G7YA 2AYHA 2WWJA 2RG4A 2IXKA 4QPWA 3KS7A 3O1SA 1RITA 2VMFA 3BPSA 3OF1A 5H9RA 3CL1A 5IK7A 4NN0A 1XYNA 1ZZ6A 4DO0A 2DVFA 2VECA 1RHI3 3LEKA 3QOPA 4XIKA 1W8HA 1UW8A 3GHMA 2PN5A 4IGOA 4RHV2 1LGBA 3OUIA 4O7XA 3MIHA 3NSTA 4COUA 3I3MA 1VPHA 4AWDA 1VAKA 4AAPA 3VGIA 1V70A 4YWAA 4JTNA 2FDFA 2WLQA 1V6IA 4YG3A 3U07A 3NJXA 3WLUA 5HV4A 1PZ7A 1UIJA 1UMIA 1UX7A 4N43C 1RUD3 1F35A 4PDWC 4I01A 4Z8BA 1OF3A 1E5HA 4KWLA 4MSVA 2EVXA 3CNAA 3ES4A 5A3OA 1HJFA 4RGAA 1JODA 3W5MA 2WO7A 1FYUA 2WFPA 1VBC3 2ZABA 4R4ZA 3SCGA 2QQLA 3N7JA 2BBVA 3LA2A 1OPOA 2YZ4A 4R9DA 1POQA 2YG0A 3LEIA 3C7EA 1R1A2 1QJX2 2HBUA 2IUWA 2V72A 4QU1A 4COYA 2BOJA 1QDCA 1VRH1 5KXBA 1OH4A 3DEMA 4SLIA 4XJUA 2WFF2 5FJKA 2VOTA 1JZ6A 5JOZA 1K42A 4UFIA 5L36A 1DGRA 5L9RA 3WG1A 1EPWA 5A6XA 3D0JA 1J58A 4C8DA 5J36A 3UK9A 1QJZA 3VZJA 4FP3A 2WN2A 1YQ5A 1JOJA 1F5JA 2OUJA 3EO6A 2DVDA 3PUSA 3O7OA 3RWNA 1KGYA 3TAYA 1VBB2 2HWE2 4QM9A 2WDBA 1CQ9A 4GJZA 2DTYA 4B1LA 1UY1A 4JHZA 4IV3B 3LFMA 5EQUA 4IEYA 5CYYA 1PX3A 5D8AB 2QE3A 2F17A 2BW8A 1TZOA 2XR4A 5GLUA 1J3RA 2R073 3MUY1 4MGYE 5FXZA 3ZDSA 3GBFA 1IGOA 1R081 1UY2A 4CU6A 1O4TA 2VMEA 5I93A 4JCKA 4XZPA 4XF3A 3DN7A 2ZPXA 4EYUA 1HQLA 1KFUL 2JE9A 3BCWA 3SH4A 1GFF2 2VM9A 1KQRA 2ZGTA 4FFGA 5C4WA 4A3ZA 4XF4A 4CVUA 4LIUA 4N7UA 2XKOA 1Q43A 4YZ5A 1D0GA 5FYUA 1M06G 3ZMNA 1YHFA 2W5FA 1ODMA 3NKTA 3H7JA 1NZIA 1PO13 3MFCA 1W05A 4XFBA 3IIAA 5DUUA 3ZXLA 2J1TA 5LA1A 3BUCA 3RZGA 1UXZA 5JR7B 1OOPA 4H14A 4JAAA 1HRV3 1RUH1 2WZEA 3UGGA 2VOXA 4LBMA 1JXNA 1RUJ3 5F9TA 5FBZA 1Y9MA 5LCWL 1KFXL 3IIIA 4GD4A 1NG0A 2FHRA 2PHUA 2W95A 2X5IC 4IE6A 5E8AA 5A7QA 2R49A 4YZ4A 3VBSC 1U12A 2D6OX 3LAGA 5BNPB 1D0HA 1SBEA 2EALA 2CGOA 3ZXGA 2WA4A 2VAUA 3J4UH 4QAWA 1Z0HA 4B7KA 2YGMA 5FYVA 3I49A 4C0BA 5F6LB 1NQDA 2DVGA 3IPVB 1GP5A 4PBPA 3V0AB 1MZ5A 4K1YA 5LA0A 5JDBA 2IWGB 3EQEA 1OHFA 2XVLA 3IDBB 4QPIB 3VHOA 3WX5A 5ACA1 4M3CB 2HKXA 4K8FA 2WWUA 1JYXA 4ZXEA 1VBD3 3KF3A 2QZ2A 4WM8A 3ZYJB 1I5ZA 1YQ8A 5J09A 4GMP1 1WCUA 1YC61 2RV9A 1W6OB 2TUNA 5A70A 3AZVA 4RQPA 2VUDA 4LNVA 4CEYC 1D4M2 1NA1C 4HK8A 1WUVA 1NAEA 3ILFA 1NUKA 3RS6A 4OHWA 1KD7A 4CDWA 1N3OA 4HPKB 1YYNA 2NN8A 5A7WB 1HKDA 2GH8A 3HMYA 4AGVA 4CP2A 2ES3A 4AVBA 1FOD2 4BYYA 1NY72 5FZAA 3BKZA 1BQPA 2VH9A 4XFFA 1WA6X 4IE4A 4MYEA 4OQ9A 4E2GA 3ON7A 4C91A 5B2GB 4CUAA 1HXS3 3INAA 3MF6A 3TN93 4C0HA 1H0BA 1A78A 1VALA 4AXOA 2ETEA 4Z92B 5GLZA 5JWPA 3DYOA 1I3HA 3ZFGC 2VPVA 1S2BA 5T5JA 1F8VA 2ZZJA 1G86A 1HB1A 1FPN1 4QQ2A 4AG4A 3A0KA 2P3IA 3N7KA 4QGNA 5A6ZA 4GB33 1C1LA 2AACA 4MX3A 4YW6A 3A7QA 4JKMA 4Q0UA 1EUUA 1VBE3 4Q4V1 1IPKA 1RTVA 2OS2A 4YW7A 1GMMA 2XWJB 4N8MA 3KF5A 4HT1T 2XH6A 3WNLA 4IW3A 2BZDA 1XNAA 2WZR3 4OUEA 2DVBA 1WW7A 3DPRB 3SC7X 4AR2A 4FPEA 3D8CA 2XJRA 2WZ8A 3HN1A 3WQBA 3RVHA 3VBRB 1SBFA 3TYJA 1NZCA 1F15A 2A3YA 2E6VA 4IETA 3JQXA 3D4KA 5IVFA 1RUF2 3VLBB 5I8YA 2XJVA 3WG3A 2EIDA 1L7LA 2XJUA 2VCCA 1LHOA 4ZPIA 5KHGA 5CFDB 1T2XA 3I2OA 2G9GA 1PK6C 2EXIA 4LULA 2HYKA 1O8SA 4Q1PA 2YFZA 5DDJ2 3E5QA 3VB9A 3S0MA 2QQWA 2ZKLA 2CU5A 4O65A 5JSPA 5T54A 5HBAA 2JE7A 1JW6A 1YXWA 3K48A 1AJOA 4WZCA 1J3PA 2DYCA 3AZXA 5HCBA 2ZGRA 1C8NA 3P3PA 4E27A 1GWKA 2MEV1 1X33A 3ZSMA 3LQCA 3MHZA 1Q8QA 2HEVF 4DIQA 2ZACA 5K0UB 1VBC2 3WUCA 1BKZA 2DDUA 2J1VA 2OIIA 3RGBA 1IS3A 4QT6A 5A3TA 3T3YA 5FOJB 3O1MA 2D3PA 3VZOA 2A6XA 5C3QA 2C0ZA 5F32A 1ZBA1 2Z42A 5JPMB 1I1EA 3MBWA 3DYMA 3RFRA 5DZGA 2ZMNA 1NLSA 4XZUG 1W6QB 2YC4A 3ZFEA 2JKXA 2EICA 3AZZA 4BQWA 1PVC2 3BB6A 3GNEA 5A33A 5C3PA 3MIFA 4S2FA 1RUE3 4AFMA 4N9HA 5JZGB 2ZGKA 3AKSA 4LMFA 4JGZA 3LDKA 3IZOA 1CZTA 3I7DA 2R041 3CHXA 2PLV3 3RQ0A 4DRRA 4CZSA 1XB9A 2JDZA 3AMHA 1MS3A 3ZR6A 4UW4A 4AYUA 1ACCA 1QU0A 1GZWB 3A0NA 5T55A 5FMOS 4Q4X3 4LE4A 3W20A 2A6ZA 1SLLA 5DXDA 1QNYA 2VBBA 4M3CA 2RDSA 1C5HA 2I2SA 1AR72 1UOJA 3O14A 1YI7A 3OGGA 5E88A 5JSRA 1YFXA 1ZRRA 2F6BA 4O61A 2QQVA 4Q29A 3ZM8A 4YM3A 4I0AA 3NNLA 4UI9L 4Y1XA 2R1BA 1HRI1 5FZOA 3TBDA 4I02A 1CAUA 4Z07A 4PIXA 4LJHA 3VDBA 2CWSA 2IVJA 3LWCA 4RR3B 4EN6B 3THCA 4BLIA 1O5UA
chains in the Genus database with same CATH topology
4FPKA 2GN7A 2DU1A 1RMU2 3E5UA 1DHKB 3EJKA 1ZZ8A 3O5SA 3M3OA 3ZSJA 2FBEA 2QFEA 1OD5A 2ARBA 2V09A 1QOOA 3ZYPA 5CFCC 3WDUA 1UX6A 5J96B 3B94A 4LO6B 5A3MA 3VBUB 4AQ2A 1GZCA 4FTEA 1HV1A 2A3WA 3VV1A 4LR4A 4FPFA 3PNAA 4P9IA 3SH5A 5C6CA 2A6WA 4Q4W3 2QNKA 2W52A 1VBD2 3S6PA 3T1LA 4D7SA 5I0SA 4R8HA 1B35B 5JAXA 4DINB 2VG9A 1O5LA 2ZHKA 1BXHA 2ZGQA 3J8F1 3VBFB 1RUF1 2RE9A 4ITCA 3RSJA 4OULA 3AXDA 5C9AB 3AP9A 3AJZA 4E4SA 3NAPA 4GH4A 4O9GA 4QQLA 2RS32 3VBRA 4MUVA 4ASLA 1O3SA 4ES9A 4OHYA 3E6DA 4XETA 2N7GA 1PZ9A 2NMNA 3QCWA 5CFDA 2DCKA 4HKOA 3S7IA 3R4DB 4HLTA 1SACA 4QX5A 5BNOB 1CESA 4HK9A 3H3UA 1C3HA 1JYIA 3ZXKA 1FATA 2HWC1 1NYWA 4GB32 3U11A 1RJ7A 4WM7C 1SCRA 1S0GA 2K0GA 3MI8A 4XF0A 4IV1B 3VDDB 1KRIA 5BY5A 1XNKA 2E51A 1UU4A 2ET1A 4XXAA 3GZTB 5E1RA 1E57A 1ZZCA 2JG8A 3PVBB 1UZZA 3WXPA 2AR6A 4XMAA 4K3UA 2WS91 1W6MA 4F8AA 1H2KA 4XBNA 4FOWA 2VNRA 4Y5Z0 1W6PA 1GICA 1FNZA 4I30A 1U5XA 4FCAA 4OHVA 4BMEA 4WVWA 1QQP3 3WUDA 1MQTA 4J1WA 5CG8A 2CGPA 2A3XA 4RFT0 2RJKA 3N7MA 4IV3C 5CU1A 5BNNB 3ME2A 2PELA 5L19A 4XFCA 4XF9A 3HR9A 1BEV1 1WD3A 1AX1A 1AR61 2GC2A 2EIGA 1URXA 4JGYC 1T6GC 4Y1ZA 1JH5A 1VB2A 1PO21 3ILRA 4IL7A 3PVEA 4ISRA 5C8CA 4IERA 4EWDA 4MVTA 2WQZC 2SLIA 5T5LA 5A3LA 1ASJ2 4HVRA 1CD3G 4XDQA 4FPGA 5EJ3A 3FLRA 3M3IA 5CAZA 3KGLA 5AFEA 2RS12 4YVWB 3H9AA 5FTTC 1Q8OA 1QXJA 4YVSB 5ABJC 2D43A 3BALA 4HSLA 4G4FA 1DZRA 5SV8A 1NCRA 2AH2A 1XNDA 4S2DA 4UW3A 2D5FA 3AMPA 1DGWX 5FOBB 1W6NA 1LOFA 2R32A 5LK5A 2Q4SA 4Z82A 1IHMA 4AE2A 2XPJA 4XE9A 2WNUB 2H6CA 1LGCA 4Q4X2 5ACA3 3DF0A 3MW3A 3FE5A 4QPIC 2FZ1A 4DNYA 1YRZA 2A75A 1ZVFA 4GMP3 1DG6A 1ZYBA 2OW4A 2W68A 4HKWA 4LBQB 3ZXFA 4QPYA 1V6KA 4NHLA 4IEZA 3U4XA 2VGDA 1S0IA 1QJY1 5CNAA 1J59A 4NVPA 4YFZA 2VULA 4TLFA 2WSUA 1AR82 4PIYA 4L99A 1MZFA 2K9ZA 1VP6A 1AL22 1FAYA 2GNBA 1AR92 1QOSA 3AJYA 4JC1A 1ENRA 4D7TA 3RPQA 3RYRA 5IT6A 3WVJA 1MEC3 5KBFA 3N35A 1OPMA 2BPA2 4N43A 3TNPB 3PLQA 4PDWA 3EXUA 3WDTA 2GN3A 4XHBA 4Y24A 4YRDA 2ZX4A 4P9JA 1KDKA 4P9XA 3BIWE 4PIZA 1PGW1 1RUNA 1RUC1 3AFKA 4Q4V3 3CO2A 1KS5A 1PZ8A 2XHKA 4AI0A 2UWBA 3DPRC 2R30A 2HWB1 2R16A 3PMSA 5FREA 1J1LA 4NHKA 1COV2 1AJKA 1SLAA 5FRAA 3W9AA 1RC6A 3B5LB 1H4HA 3NV4A 4MH0E 4AEDC 2P17A 3RYKA 4EJRA 1Y9QA 3BU7A 3SMHA 1WD4A 2VVDA 2P34A 1GLHA 4Q2FA 4META 1ZRFA 5AC92 1Z7S3 2MEV3 2JENA 4FTBA 5L73A 4R9CA 4JRAA 1UKRA 3GZAA 4X8NA 2RR12 1Y3TA 2R062 3FLTA 5BNNA 1QH7A 3RJ2X 5JOYA 1HV0A 4KNCA 2Q30A 1CJPA 2R0HA 4GULA 2RS52 3WNXA 1QMJA 3ZFFC 3KT1A 4GIQA 2B7YA 5C4WB 4B7EA 1ZBA3 5K9YA 2E7QA 2VQAA 3JB4C 4Q0QA 1WW4A 5KHHA 2PHRA 3QBQA 2KM2A 2PYTA 1YO8A 5IK4A 1OOPB 1N1YA 3ZPYA 2ZA9A 1SFYA 2P37A 4PQ9A 5J37A 1YFYA 2UU8A 4YVWA 3VKLA 1MVQA 4TSVA 1EAH1 4YVSA 4D3WA 4DXZA 3VBOC 2AREA 5BXXA 1LHNA 3CEWA 3ZXJA 1QQP2 1W0OA 4YW3A 1LHVA 2ZAHA 4AVTA 4YZ2A 3MF9A 4CDQC 2D6PA 2BWAA 1DQ0A 1PVXA 3CLPA 2KA3A 1UZYA 4XJAA 1Q8SA 2PAEA 4COWA 5CG9A 2YMZA 5T5PA 1GANA 5F5QA 3UL2A 2I07B 4HBNA 2W39A 2XJSA 1A3KA 1NA1A 4AGRA 2B39A 3USUA 2XWBB 2PFWA 5I8SA 3EBRA 2XBO3 1EV11 2CL2A 4COVA 2ZOEB 4Q4Y1 4XPVA 1HRI3 4ATFA 1H8TC 4LBQA 4DMIA 1LB2A 2VQ0A 1OFSA 2V5YA 4CRQA 4DY5A 5JOXA 1C8M1 3WDWA 4F7ZA 1B09A 5HXVA 2XJPA 1AR91 1RVF1 4MLOA 5C8WA 3AFGA 4CDWB 3IMNA 2F4PA 1ZREA 1VBA2 3MW2A 4R52A 1RUG2 2D7FA 4INDA 1OA3A 3ZFGA 4DQAA 2IC1A 4QD2A 3R4UA 3VKFC 1H1AA 1RUI1 1LKNA 3UKVA 4JTOA 4LUMA 3IKWA 4GXLA 2D6KA 4BIFA 1BCXA 1MVEA 1DIWA 1WLDA 2HWD2 3D6EA 1ENXA 3MEPA 1ALYA 4HETA 1B35C 1LR5A 2EXHA 1QHDA 3J8F3 4B4QA 1UU5A 1G9CA 5LEKA 4M3CF 2ZX0A 2RM22 4JDOA 3VBFC 3X29B 1A8MA 4GQ7A 3DL3A 4WVMA 3SCFA 3CJIC 1PK6A 5C9AC 4AF9A 1VB4A 1VJ2A 4LHNA 4DPNA 3EHKA 2RMU2 5T52A 1PIV2 1MEC2 4XMIA 1QF3A 2K2SA 4D69A 1CJDA 2VY0A 3L2HA 4AQSA 4M01A 1JN2P 3HIFA 3B01A 4NOTA 2Q1ZB 2QDNA 3MFAA 5CVRA 5EV7A 5BNOC 3PTYA 2O8QA 2HWC3 1V9U2 4N53B 4YGEA 1SMVA 2D40A 1ULEA 2B8MA 3AKRA 4EN7B 3DV8A 2VU9A 1BBT3 1PGL1 5KXDA 1R091 4QPGB 4M0HA 2JEMA 4GWMA 1H4GA 4M3CE 4FT8A 1O3TA 1AYN1 4YM1A 2O8OA 3JBG3 3ZIWA 2P3JA 3IWZA 5HI0A 1BYHA 3RG0A 3ZIXA 4DS0A 1QXRA 3WP3A 3M2MA 4FOVA 5EXOA 2ZGSA 5HCFA 3ZFEB 4KH9A 1QJU3 4CDXC 3PJQA 4Q8KA 2QDRA 5A33B 1BZWA 1IKPA 1POV1 1NXD1 5BYNA 1JYCA 1NLRA 3FJSA 1ZBE2 1Z7S2 2W0XA 4LEJA 4JGZB 3AM2A 3OY8B 3KD4A 2WNVA 4NO4A 4XQWA 2QKDA 1AXZA 4ASMB 1BEV3 5DUWA 1AR63 1DQ5A 3M3CA 1O4YA 2UYAA 1PO23 1ND2A 4YNIA 4UW5A 3WT3A 4KWJA 4MGKE 4FAHA 3JZVA 1EYBA 1C4RA 2YC0A 4XF1A 2ZS6B 1AXKA 4RS5C 4LBKA 4J6GA 5FPXA 1RGSA 2WLPA 4X8PA 2XVGA 1QOTA 2CV6A 1CAUB 3OYWA 1JHNA 3M7AA 3FX3A 2BYVE 2Q8OA 4XFHA 3S7EA 1ULGA 1ENSA 1DU3D 1DQ6A 2ZCWA 1FMD3 4LA2A 5I0TA 3ZN6A 3H1MA 3NWKA 3M8LA 4I3PA 4XQ4A 1W39A 1KJLA 4RHV1 3V56A 4C1XA 2P3KA 4W6YA 1DBNA 3MPPG 1WLTA 5AVAA 1TMF2 2LALA 2GMPA 3MDPA 1GR3A 2HWD1 4FQ4A 1AHSA 4HN0A 3J26N 4AI2A 1IS4A 3KQRA 2A5ZA 2GMEA 2ZGPA 4DFSA 3GBGA 4BE3A 3QLQA 2IXCA 2G9FA 2XBO2 1MS5A 3MLKA 4ATEA 5AFBA 1WLWA 4LBOA 2WINB 5GZGA 1R1A1 3AMQA 1QJX1 3AP4A 5E16A 1PIV1 2JX9A 4FOQA 3LCPA 2WFF1 4IEQA 1XYOA 2ZGMA 2GNMA 4YARA 2H6BA 4CTEA 3NAPB 4GH4B 1UD1A 1JTZX 3PHMA 4K20A 4OI4A 2ZX2A 3ST7A 5DUXA 2JECA 3G7DA 2E63A 4QGLA 2GH2A 3O0XA 1RHI2 3FWEA 4S2GA 3AK0A 3WW3A 4EWAA 1CX4A 4WM7A 4R4XA 1VBB1 3VHRA 3GYDA 2HWE1 1A8DA 2I74A 1S0EA 3BTAA 1XNBA 2OZ6A 1YWKA 1M4WA 1MZEA 3PVOA 3E5XA 2RHPA 1RL3A 4IEVA 3WV6A 3KT4A 4HKLA 1RUC3 4N53A 1I9RA 3SCHA 1RUD2 2GC3A 3AYDA 1D4VB 1AL0G 4QPGA 3SHRA 3VKMA 1OLRA 4HMZA 2YYOA 2MPFA 1KJRA 2ZX1A 3CU7A 3LKJA 4Q0PA 4E4DX 2A7AA 3I54A 2JG8B 1ZZ9A 2Z5WA 4LE3A 5FLIA 2WL1A 2FZ2A 4KU8A 2BNNA 4YGCA 4PLNA 5D1IA 3SLIA 2NM1A 1W6MB 4C90A 2PHFA 5T50A 2GMMA 5BNQA 3JD73 2HWF3 1W6PB 2HJIA 4K7JA 2ET7A 4BMBA 2Y26A 4UBHA 4JDMA 1MQTB 3NV1A 4JGYA 4AHWA 1MS9A 5JVVA 4FPHA 1LOEA 3OY8A 1BBT2 5LEJA 1AYM3 5BPXA 5T5OA 1SCSA 4XTPA 3LSEA 1VLNA 1WLCA 2R072 3VZLA 1BMV2 3NVCA 4QGMA 4QXKA 2B45X 4WV8A 3FFQA 3PVNA 1W0PA 3D0SA 5C8CB 3H7YA 1HIXA 1OMIA 4LO8A 3UV9A 4AK3A 5ABJA 5C4WC 1YI9A 1D4M1 1ND3C 4ES8A 3BOPA 3A4UA 1S0JA 1PO12 4LBJA 4Y1UA 3ES1A 3T2TA 2DCTA 3O12A 1QJU2 1EAH3 1XE7A 1HRV2 3JUUA 1X7NA 1FOD1 4CDUC 1NY71 4E2SA 2XL7A 1NCRB 4FSJA 2JXAA 2BUKA 2NP0A 2B9UA 1KXGA 2YXSA 4IEWA 1W6NB 1SLBA 2Y0OA 3SNMA 3FBYA 1K5MA 1YNAA 1SBDA 5A32A 1X8EA 4YZ1A 1ZA4A 4MZUA 1H2MA 3E6BA 5I0UA 1DFQA 3LSDA 2O0OA 3OGJA 2R1DA 4M0NA 3IN9A 1TME3 1FV2A 4AFCA 5JOWA 1EV13 2DV9A 3VKNA 5L7OC 4Q4Y3 4WM8C 2GAUA 5JMCA 4K40A 1DGLA 3QD6A 4FOYA 2GNDA 3ENRA 1S0CA 1NCQA 1WGPA 2XJTA 3B00A 1EY2A 3ECQA 3FFZA 1C8M3 4RQPC 4LT5A 2VNOA 1J1TA 1RVF3 4AW7A 4W6WA 1XXNA 1R1ZA 3N36A 3B93A 3GF6A 1XYPA 3WP5A 4CDWC 1FMD2 2A71A 4OI1A 2BQPA 4AQ6A 1PHMA 5DDJ1 5EYXA 5FQ0A 1TNRA 2XUMA 4QM8A 3ZN4A 3AMNA 5CIRA 3ZSEA 1RUI3 2PAMA 2VOWA 1QH6A 4N43B 4A7KA 4PDWB 1HXS2 1NE6A 4CEWA 3TN92 3WCSA 3FUQA 3PMEA 3J9SA 3AYEA 1G9BA 2Q1MA 5EWSA 1OLQA 1VBC1 4AEMA 3HQXA 1DDLA 5KXCA 2IXLA 5KHKA 1VBE2 4LLFA 4ZU4A 4AFAA 2WZR2 4OUMA 3AZWA 4B4PA 1ZNPA 1VRH3 2IXHA 4DB5A 4XJ8A 1FT9A 1PVC1 2VVFA 4MV2A 4H7MA 2D44A 3OTFA 3KCYA 4QQHA 1UPSA 2FMDA 4HVQA 4Y22A 1XRUA 3THPA 4TYSA 2D97A 1MACA 1ZX5A 3SXWA 1WCSA 1R093 1OKQA 5HCAA 2OVUA 4YGBA 5KXEA 1MZ6A 3WDVA 5D8AC 3VL8A 2JD4A 1R083 4DZGA 3C2UA 1AR71 3RMXA 1UU6A 4AGGA 4I3GA 1YIFA 2JKBA 2MHFA 5SV5A 3HWJA 4FVVA 3RDIA 5GLTA 3VBOA 2GC1A 4IEPA 2XB6C 4P9YA 5GLWA 1SQ4A 3ZSLA 2XLGA 1RUJ1 2X5IB 3LOBA 1G6NA 1RMU1 2ZGUA 3JD72 2HWF2 4AHYA 1CPNA 3VBSB 1CAVB 1RUH3 4K6BA 1OQ1A 1H9WA 1GQHA 4BIOA 1POV3 4CDQA 3KGZA 4IEOA 3ZXEA 4I0WB 4AI8A 3FBMA 2WT2A 1RUE2 3WQ7A 3DGTA 4JGZC 1N1TA 4XOGA 4MXVA 2JG9A 1AYM2 1CAXA 2NYYA 4FPCA 1FX5A 2PLV2 4QMAA 5BNPC 1DQ1A 5J7MA 1VBD1 2XLFA 5FFOC 4FQZA 1H8TA 4KWKA 1TE1B 1YJKA 4CEYB 4DY3A 1NA1B 3VBHA 3USUB 3TRSB 2E7TA 3SITA 3P3NA 1G8WA 1NXMA 3BPZA 1AXYA 5H9PA 3H3ZA 5BUVA 2ZTNA 3MIDA 3BODA 4UXAA 2WJSA 1PNFA 2B42B 2RS31 3WQ0A 2DUOA 3OJBA 1HX6A 3LZZA 1C28A 3ASIA 4MXWB 2XL9A 4RHV3 1MS8A 3VN4A 3ZMOA 2RJLA 1YUDA 1RUOA 3WQ1A 3ZFGB 5J3UA 2FMYA 3QH7A 1LTEA 5FLJA 3B9CA 2D3SA 3MIBA 4XQDA 5K8SA 4WVZA 4X6QB 1UN1A 4GB31 2ERFA 2OPKA 4Q0VA 5IK8A 1TME2 2R6QA 2Y0IA 3THTA 3NO8A 1FPN3 1RB8G 2ZBJA 4Q4W2 3V65A 1ENQA 1G9FA 4FXGB 1VAVA 1QJX3 3IT8A 2YY1A 2WFF3 3RZZA 5J48A 4WVMB 4FP2A 1PK6B 2HEYF 2X29A 4NR1A 4BWOA 4GH4C 2BEOA 4KG0A 3VBRC 1W2UA 5C33A 2GSYA 3MW4A 1V6JA 2VW1A 4Q27A 1VBB3 1V6OA 2HWE3 1WA4A 4Q8LA 3VZMA 2JJ6A 5CFDC 4XTMA 3KLSA 3S30A 3MLLA 1X82A 2PHDA 4Z2WA 1RJ8A 4AVSA 2YPJA 1OA2A 3AYCA 3O0VA 3H8UA 4N7IA 2VOKA 3APBA 3IDCB 5TSWA 1MS4A 1LESA 5JI9A 4R9AA 5JIUA 1DLLA 1ASJ1 1L3JA 5K0UC 2CAUA 4PF5A 3FZ3A 4ORFA 3HT1A 5CB7A 2JG8C 2VMIA 4CDXA 1VRH2 2UWAA 3ZO0B 2CAVA 2VVEA 3POSA 4U2AA 2RS11 2D98A 2WNEA 3KM5A 3WP4A 4W65A 2IXIA 4HSJA 1LOBA 2AENA 3ATGA 4B29A 2X5IA 5I8TA 3WHUA 1G9AA 3VBSA 4P9WA 1CAVA 2LTNA 2D6MA 3V0BA 2WIIB 3WHTA 3R6SA 4FO9A 3KCCA 4NWWA 1DGRN 2A73B 3JB8A 3VHPA 3C3VA 2R043 5JZGC 2X53S 2WNVB 4Q4X1 2IZWA 2D5HA 4LO5B 1EP0A 4OVEA 2E53A 1IOAA 4AQTA 1R082 2CNAA 4RSUA 1ND2B 2PQQA 3Q9OA 4AEJA 4XW3A 4Y20B 1VR3A 3HBZA 4BLJA 4OI2A 5C8CC 2IXJA 1D4M3 4CEYA 1O91A 3USSA 3OCPA 2ZHLA 5I0RA 4HFSA 1NE4A 3DKWA 4XEZA 1DZQA 3G6JB 2DCYA 3MICA 4OUSA 4ZXKA 4NHMA 1FXZA 1AR81 1O5UA 3E97A 1RUH2 1FOD3 3OYWB 3WG2A 1APNA 1AL21 1ZRCA 2WWSA 4RR3C 1V00A 4ONUA 3RYPA 3ZN6B 4MXWA 3ZVXA 3PJYA 1AX0A 1HQWA 1X36A 1LOFC 4KG8A 4ZU5A 3RMYA 2YHJA 3VBUC 2Q0AA 2GU9A 4XYXA 5JCTA 2CTVA 4EV0A 5GKAC 5ACA2 1CGPA 1H2NA 2XG3A 2QCSB 1GSLA 1UL9A 2PHWA 5LRSA 1V6NA 2A6YA 1UIKA 4Z1VA 2ZMKA 4L92A 1WCKA 4AHZA 4KQ7A 1UMZA 1S0BA 3W59A 1LCLA 3U10A 1H2LA 1RUF3 4YM0A 1COV1 1MS1A 1OSGA 2O1QA 2PTMA 5E89A 1H1IA 2OUHA 3I59A 1U0AA 2ILMA 1YIPA 5DDJ3 3LGRA 4FBFA 3K51A 1WBLA 5GALA 5GLVA 5AC91 3KB5A 4WM7B 1AZDA 3DUIA 2PHXA 2AUYA 2RR11 4AFBA 3U0ZA 2R061 4QU2A 1FPN2 1X50A 1VIWB 3B7MA 4L11A 4PJYA 3ROUA 2GNTA 4I2OA 2RS51 5GJ6A 3MPBA 4Q4V2 3I8TA 4UW6A 4AVAA 3WZ1A 3AX4A 4IV1C 3VDDC 5BV6A 4YG0A 1GQGA 2OA2A 4HVOA 5JPNB 2VUAA 1CONA 2H0BA 4P9GA 5JSOA 4FPYA 3ZXAC 4E2QA 3B69A 2XLAA 4YZ3A 4R9BA 1PVC3 4K9SA 2WS93 4RGGA 4EROA 4AFDA 5J98B 1QXPA 2FQPA 2B5HA 1QQP1 1HQNA 1GNHA 2VW2A 1IS5A 2D3RA 2ENRA 3LA7A 1F5FA 1ULDA 1MS0A 3M70A 5DUVA 2EXJA 4JGYB 2AGSA 3WP6A 1SLCA 1UF2C 2MEV2 1V6MA 5KC5A 3KZ4C 4LHKA 1ND3A 1PMIA 4N90A 5BNNC 5FO9B 2YDEA 4LBQD 5JIAA 1AR73 2DF7A 4DOUA 2XGXA 3WR0A 1C5IA 2ZKNA 1LENA 4Y20A 3R0RA 3M1HA 3UJQA 2DFBA 4FXKB 5ABJ