4L2NA

Understanding extradiol dioxygenase mechanism in nad+ biosynthesis by viewing catalytic intermediates - ligand-free structure
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
174
structure length
174
Chain Sequence
MLTYGAPFNFPRWIDEHAHLLKPPVGNRQVWQDSDFIVTVVGGPNHRTDYHDDPLEEFFYQLRGNAYLNLWVDGRRERADLKEGDIFLLPPHVRHSPQRPEAGSACLVIERQRPAGMLDGFEWYCDACGHLVHRVEVQLKSIVTDLPPLFESFYASEDKRRCPHCGQVHPGRAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 3-hydroxyanthranilate 3,4-dioxygenase
publication title An Iron Reservoir to the Catalytic Metal: THE RUBREDOXIN IRON IN AN EXTRADIOL DIOXYGENASE.
pubmed doi rcsb
source organism Cupriavidus metallidurans
total genus 38
structure length 174
sequence length 174
ec nomenclature ec 1.13.11.6: 3-hydroxyanthranilate 3,4-dioxygenase.
pdb deposition date 2013-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06052 3-HAO 3-hydroxyanthranilic acid dioxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4l2nA01
5I0TA 1ZZCA 3C3VA 3SCFA 5BV6A 1CX4A 4FAHA 4Z82A 3SCHA 3I59B 3MPBA 4CYDA 2D5HA 3UKNA 4JTNA 3EHKA 3GYDA 2UY8A 3M70A 1ZZBA 3ROUA 3LA3A 1FXZA 3D0JA 3E5XA 4EWAA 1H1IA 2PAKA 4XF1A 2EAAA 4QGNA 2P17A 5T3NA 3KSCA 5FLIA 4HVQA 4E2QA 5C6CA 2Z69A 1ZRFA 3H7JA 2WC2A 3RYRA 3WW3A 3BCWA 1O7FA 1ZRRA 5AVPA 3EBRA 2OZJA 4R8HA 4XF4A 2O1QA 3R6SA 2QJVA 5J3UA 2CAUA 2H6CA 1ZRCA 2HKXA 4EWEA 2QNKA 4X6QB 2QCSB 4XF3A 1O3SA 3E6BA 5FQ0B 4E2GA 1Q3EA 2MNGA 3D0SA 3PNAA 5JCTA 3B02A 2H0VA 3BPZA 4MGIE 3LOIA 2PQQA 4HBNA 3LAGA 2Q1ZB 4I3PA 3FHIB 1UIJA 2WFPA 3ELNA 4AVCA 5KHIA 1PMIA 1OFNA 4ZU7A 4FT8A 2Z2SB 1XE7A 1CAUA 3KMHA 2OYZA 5JSOA 4ZU4A 5BPXA 4UXAA 4HVRA 3NSTA 4QM8A 4PIZA 5CVRA 4EROA 4Q0VA 3ACLA 4Q0SA 1IPJA 1UCXA 3N4MA 2GC1A 3QOPA 4KL1A 4XFIA 4ORFA 4KWKA 4N9IA 5I8TA 1O3TA 3H9AA 3H1MA 4HMZA 3S7IA 4MUVA 2EA7A 4J1XA 3G7DA 1X7NA 4LULA 2H6BA 4XF9A 4R52A 4YSFA 5BY5A 2CGPA 2OZ6A 1CAVA 3HIFA 5I93A 4J1WA 3BALA 5FDBA 4Z07A 1DZRA 1CAWA 1QXRA 2BNNA 1CAXB 4YYOA 4B29A 4WBBA 1ZZ8A 4O9EA 5JAXA 3DV8A 4L2NA 2UYBA 1QXJA 3S7EA 3LA7A 3H50A 4HN1A 4XFGA 2XLAA 3DL3A 1DGWA 2K9ZA 5J7MA 4ZU5A 2B8MA 4HVOA 2OA2A 5C8WA 3FZ3A 1IPKA 3FFQA 2UY9A 4IEQA 5CU1A 3MZHA 4EWDA 4META 3WW2A 2Q30A 1TQ5A 3RNSA 3U10A 2K0GA 4QM9A 3U11A 2PA7A 4LA2A 4FBFA 5LEJA 1RUNA 2PAMA 1XRUA 4HLTA 4KU8A 2GZWA 5FLHA 1NE6A 2QDRA 2VECA 4XEZA 3WW4A 2IXIA 3USSA 2D5FA 5KBFA 1YWKA 2UYAA 2B5HA 3MYXA 3CF6E 4BH9A 3WW1A 2N7GA 3RYPA 1RGSA 1ZREA 4Q29A 4LUMA 3BU7A 3HQXA 3O14A 3DN7A 5JSPA 1X8EA 1Y3TA 3TNQA 3EJKA 2CV6A 4IERA 2XGXA 3GBFA 4MH0E 4QGMA 4AXOA 1O5UA 1ZZ6A 3RYKA 1NYWA 4IEUA 2GAUA 4I09A 4IEWA 3CEWA 3I54A 4AQ6A 4A2UA 3NL1A 4JV4A 4AVBA 2ZKLA 4Q0UA 4IEVA 4Q0QA 3CO2A 1QWRA 4QGLA 4PIYA 1RC6A 4FAGA 5LEKA 3FWEA 5E1RA 4MGZE 5BXXA 4N9HA 1X82A 4NVPA 1J3RA 4BIFA 4HSJA 3M3IA 4O9GA 3ZDSA 3IWZA 1ZNPA 4WVZA 2OPKA 1YHFA 1O5LA 4IESA 4KWLA 4AVAA 5I91A 4E2SA 2ZCWA 3FE5A 2KXLA 3NW4A 3E6DA 2GC3A 3OD0A 1VJ2A 4LEJA 2ET1A 5BUVA 2CAVA 4D7TA 3EO6A 3NJZA 4F7ZA 2GC2A 3NKTA 4WZCA 5KHKA 3U0ZA 3TNPB 3I7DA 1WLTA 1NZCA 1FT9A 2BEOA 1Y9QA 4TLFA 2GH2A 1CAUB 4OFGA 4BYYA 5JSRA 1J3PA 2PHLA 3KGLA 2ET7A 3CJXA 4KWJA 5FCCA 1L3JA 2F4PA 3KGZA 2XKPA 4I02A 3FX3A 1HW5A 3LA2A 3IBMA 4RD7A 4XF0A 3IDBB 5KHJA 4IEZA 4HSLA 2BYVE 5CADA 1ZZ9A 3ES4A 4I0AA 5J48A 3E6CC 5I0SA 4UBHA 5E16A 3IDCB 3LWCA 3OGJA 3D82A 1CAVB 1G6NA 3HT1A 1NE4A 2PAEA 3PVBB 1YFXA 3E5QA 2C0ZA 1CAWB 5LRRA 3H7YA 1LRHA 3LZZA 1DGRA 3E5UA 2GC0A 2XHKA 1SFNA 3UKTA 5I0UA 1J58A 4XETA 5KHGA 3SMHA 4XFAA 5I0RA 4XFFA 4EV0A 1V70A 1YFYA 1YFUA 3I59A 4LTAA 1I6XA 4QX5A 1OD5A 3ST7A 2BNOA 4KU7A 5LRSA 1U12A 1Q5OA 4JVAA 4QXKA 2XLFA 2Y0OA 2VQAA 3HT2A 3S0MA 1OI6A 2XL7A 2D93A 5D1IA 1J1LA 1X8MA 1PM7A 4IETA 4YARA 4PJYA 4X6RB 2XKOA 1GQGA 1WA4A 4H7LA 2ETEA 1Q43A 4PIXA 1O4TA 4HZFA 2PTMA 1FI2A 5EFUA 4IEXA 4GULA 4MGKE 1H1MA 4L11A 1WGPA 1I5ZA 3KCCA 3RDIA 2XL9A 4I2OA 4MX3A 3SCGA 3IIAA 3L2HA 2IXCA 3SXWA 5FQ0A 4I01A 2IXHA 2Q4SA 4LUKA 2O8QA 5F1RA 1RTVA 2DCTA 2IC1A 3CL1A 1ZX5A 3EQEA 3FJSA 3E97A 3VHRA 1VP6A 4XFCA 3RZZA 4I0BA 4F8AA 4ONUA 2XLGA 1QY4A 1ZVFA 1CGPA 2MHFA 1EP0A 4K8FA 2B9UA 1VR3A 4XFHA 5EZWA 3NVCA 2PFWA 1ZRDA 1SQ4A 2PYTA 3UKVA 2GU9A 1EPZA 1RL3A 5HI0A 4LA3A 5FPXA 3PLQA 4YRDA 2QVSB 2FMYA 5K8SA 5JR7B 2EVXA 1J3QA 2FQPA 3JZVA 1UIKA 2BGCA 1LKNA 1UW8A 3CLPA 1UPIA 1J59A 2ATFA 1YLLA 3RPQA 3ETQA 2E9QA 4BHPA 2IXLA 5I8SA 3SHRA 1CAXA 1JUHA 1YUDA 4UBGA 1UD1A 1O3QA 1SEFA 1XE8A 2VPVA 4IEOA 4Q0PA 4OLLA 1NXMA 1OMIA 4MZUA 3H3UA 3QACA 3ES1A 3H1WA 4LLOA 5FLJA 4QMAA 5I8YA 4MGYE 3OTFA 4P9GA 4XFBA 2D40A 5FPZA 1GQHA 2PHDA 2HJIA 4HN0A 3BB6A 4JTOA 1RUOA 3MDPA 2IXJA 4MV2A 1LR5A 2MPFA 1ZZ7A 1O3RA 2IXKA 1DZTA 1YFWA 2I45A 2Q0AA 3H1YA 1LB2A 3OF1A 4IEPA 1EYBA 2V09A 3DKWA 3OCPA 2BNMA 5KHHA 4IEYA 4DINB 4AQ2A 4YNIA 4D7SA 3H8UA 3H3ZA 1EY2A
chains in the Genus database with same CATH superfamily
4RN5A 2DUOA 2VD7A 3C3VA 5LZ6A 5E6HA 3S6PA 3NJYA 1VRH2 2E7AA 1Q8PA 4MLOA 4QB1A 1LU1A 3ZXKA 4EYUA 2DU0A 1LOAA 4HOOA 2D5HA 4M3CA 4AEDB 3TRSB 3M70A 3ROUA 3WF0A 2G19A 4GA9A 1XSRA 4XDOA 1YI9A 4FP2A 3ZN4A 5A6QA 1MPXA 4FOYA 1EAH1 4YW3A 2Y6LA 1GP6A 4OHYA 3MIFA 4AAPA 3RWNA 2YBPA 4B7KA 1MS4A 2ZGQA 1POV1 2ARCA 2DU1A 5JIUA 2EAAA 1XNBA 4CVUA 2RDNA 1OLQA 1US2A 3T0DA 2Z69A 3ZYRA 4YWAA 1ZRFA 5FZ7A 3H7JA 4QX1A 3WDVA 2WC2A 5K0UC 5J96B 3WW3A 3PJYA 4L92A 2GH8A 3PURA 4NAOA 1ZRRA 3EBRA 4XDQA 3H42B 1NXD1 1X33A 2O1QA 3AZYA 3VDCA 1ZBA1 2CSGA 5LY2A 5BNNA 2JE8A 1GZTA 5CFDC 3DYMA 1OOPA 1ZRCA 2HKXA 4M4RA 2CWMA 2VQUA 2XB6C 2RS31 2WFF3 4X6QB 5FMCA 1YI7A 4N7IA 4AQSA 1CR7A 2QCSB 4XUTA 1C8M3 4AHWA 3K51A 2QBXA 1O3SA 4CU8A 1CQ9A 1Q3EA 1VIWB 4KBZA 2HYKA 3OPWA 2V5DA 5CG8A 4QDRA 3BPZA 5FZBA 4CCLA 2WFF2 1QEXA 1OKOA 1SBDA 1C8M2 2PQQA 1NCRC 4QPWA 1VBC3 3RZJA 5FP4A 3KT4A 4WM8A 3RVHA 5DXDA 3ELNA 1W06A 4OQ8A 1PMIA 1DZQA 3P3NA 2VCBA 3IDAA 2YUEA 3AVRA 1ONAA 2C4XA 5LCWL 3LSDA 2WR9A 4ZS2A 3T09A 4YFWA 5BPXA 1R093 4UXAA 1NA1A 1VBC2 3TEWA 4FTBA 1HJFA 4KBBA 3BTYA 2B39A 2ES3A 3I4IA 3W59A 4Q0SA 3WNXA 4DMIA 1KJLA 5FAXA 1IPJA 1WMEA 2LS6A 3I2KA 4Q1PA 4JZRA 1DDLA 1R092 4BM8A 5C3QA 5ANNA 3VB9A 1AYN3 3CQOA 4ITCA 1DHKB 4KWKA 5CZKA 3H1MA 1W8FA 1ODMA 1YCIA 2FDGA 5JI9A 5JVVA 2ZPXA 1W9FA 4Q4X1 3V0AA 2MEV3 4LULA 4XF9A 1D0HA 2OXBA 4IV3A 1LAJA 2X8KA 1SPPB 2RHPA 3M8LA 1C1LA 4DNYA 2YC2A 1W2TA 2VW2A 1MS3A 4PDWC 4TXWA 3WT3A 4C1XA 4RQPC 3BALA 5LK5A 3AP9A 2R16A 2MEV2 1OD3A 2BNNA 4M3CE 4NMIA 3ZO0B 4B29A 1QOSA 1EUUA 1V9U1 2LALA 2VW0A 1ZZ8A 4WBBA 5A3NA 5JXIA 4AEMA 2VXJA 2P3KA 3VBOC 4FI9A 1X50A 5L36A 2YPDA 1RHI3 3A4UA 3H50A 4FOQA 2PN5A 2XLAA 3ZFGB 3DL3A 1QQP1 2X09A 4EN0A 1XB9A 1W05A 2B8MA 1MVQA 2A75A 2PHUA 2OA2A 2RS53 4HVOA 4OI4A 3VKNA 5C8WA 2E63A 4NHXA 3OGGA 5JWPA 1IPKA 2IFWA 1VMFA 3WG2A 2PHTA 3FFQA 1I1EA 1IS6A 1RHI2 2A6YA 2VO5A 4IEQA 4CCCA 1QXPA 2YMZA 4MYEA 3WX5A 5JI7A 5HV0A 5IT6A 4OMDA 3TN93 4CDUA 1PO13 1BKZA 2ZGNA 4RA0A 3ZSJA 4EWDA 2RS52 1W0NA 2AGSA 5FYHA 1O8PA 2Q30A 3LDRA 2V73A 4FPEA 3AL5A 3K4DA 2RM21 1ZA7A 1S2BA 3MIGA 1MZ5A 4FFIA 4HKWA 2YBKA 4W6WA 5F2WA 5LEJA 3VBHA 1BXHA 4K21A 1Y9MA 3TN92 1KFXL 1PO12 1Q8QA 2EIGA 1C57A 2FCVA 3K4AA 2VY0A 1JZ5A 1DQ6A 4HPKB 3USSA 3VL9A 1D7PM 3INAA 5KBFA 1LHNA 1S0CA 1UZYA 3KM5A 3RI8A 4D8MA 1UZVA 2JECA 5JXHA 4GQ7A 4XXAA 2RG4A 3B93A 2VVEA 3C2UA 1Y7BA 3O0XA 4HFSA 4ASMB 3O14A 1GWMA 2VUCA 1OLRA 2XJSA 1UWWA 3MLLA 3WP4A 3TNQA 2ENRA 1QJY3 2BZDA 1DQ5A 5LA0A 1IS3A 4MH0E 1NLQA 4S2HA 4QGMA 3NKGA 3BTZA 4ASLA 1O5UA 2V4VA 3RRDA 4BE3A 1EV13 2VULA 4JGYB 2D6LX 1NYWA 2DBIA 3M2MA 4A4AA 1W39A 3CEWA 3I54A 1QJY2 4A2UA 4AQ6A 3AKPA 3Q8EA 3HBKA 1CX1A 2ZHNA 1S4CA 4Q2FA 5C71A 3VD9A 4KQ7A 1EV12 2ZABA 4H2AA 4B4QA 2ID4A 1RUH3 1Y43B 3OUJA 1GZ9A 4Q0QA 4LE3A 2RJ2A 4GWNA 3TEXA 1RITA 2WAAA 3UT0A 4DQAA 2WQ8A 1BK0A 1RXGA 3FWEA 4N43A 5E1RA 4AFMA 4KG0A 2Q8DA 3JUUA 4QQLA 3APBA 4DO0A 1VBA3 2WN2A 4NVPA 2W0XA 3VLBB 2ZX2A 2HWE1 4BIFA 3NQHA 4YG6A 2J1AA 1WCSA 3D4KA 1VBD3 1RUH2 2ZGKA 3CIHA 3IWZA 3ZDSA 3AMHA 2JKBA 1V6JA 1U5IA 2QQLA 4IGQA 2ZBJA 2D3PA 5I91A 4E2SA 4UOJA 1TZOA 1H4HA 2ZCWA 5CFCC 2BGOA 3WLUA 1VBA2 3E6DA 1ASJ1 1B35B 1CJPA 1S0DA 3LSEA 3OD0A 4Y20A 1H8TC 1VBD2 4BPZA 1MS8A 4W4ZA 2WBKA 4QPGB 1ULFA 1WW5A 3OGRA 2VNRA 3UGFA 1AR71 2XJVA 1F5FA 4CEWB 1HXS1 1K42A 2DVGA 5DUUA 1AL23 3P5BA 3ZYIB 5C9AC 3N7JA 3W5NA 4GB33 3DECA 4MSVA 3ZMNA 1FT9A 2ORZA 1XPWA 4GH4C 1GUIA 3L2YA 2VVFA 2GH2A 5EJ1B 5CAZA 4C1WA 4N8MA 2R30A 5A1AA 4JRLA 3ZN6B 5FZHA 1AL22 1PHMA 4MOAA 4BYYA 5J1XA 2VOKA 2PHLA 4GB32 4Q4V2 2ET7A 3I2OA 4OHZA 3CJXA 4D94A 4CUCA 3NV1A 1HQLA 1L3JA 1SBEA 1OKQA 4DY5A 1QJEA 3GXUA 2JDMA 2VMIA 3HEIA 5A7WB 3GF6A 1J84A 1UYZA 4WM7A 4PCRA 3CDZB 1AYM3 3WF1A 2FDKA 1LOGA 3LA2A 1JOBA 1LOEA 1GV9A 1VBB1 5FPVA 4IL7A 4G9SB 1LHVA 1VE0A 5KHJA 4CDXC 4CEYC 4YVSA 1OVSA 1Y4WA 3OGSA 4CP1A 1W0PA 2ADDA 4QQ2A 3R4SA 2XONA 4Q27A 3OBZA 1GZCA 2WO1A 4PQ9A 1MZ6A 2RDRA 1AYM2 2VZOA 4AI2A 3WDXA 4LLFA 1OUXA 1QOOA 4YFZA 4XILA 3VZOA 3OUIA 1OH3A 1KS4A 2JG8B 4QPIC 2X5IC 4RSUA 1D4M3 2RR11 1RUJ3 5T5OA 4AGVA 4CCMA 3I8TA 3TEYA 1NE4A 2PAEA 4IV1C 4QX7A 1F4AA 1O4ZA 4LK7A 3LF7A 3DYPA 4OHXA 5JOXA 2WO7A 5A33B 2BOJA 1HN1A 2Y26A 3VHOA 5F9TA 1D4VB 3IAPA 1CESA 4COZA 3H7YA 1DQ2A 1W2NA 4DUXA 3SEEA 5FYBA 5AC91 3ZFEC 1JYNA 3E5UA 2GC0A 1D4M2 1UY3A 1RUJ2 4A44A 1ND2B 3ZFFB 4CDQB 5I0UA 2ZKNA 1WW4A 3FBYA 2W92A 3I3EA 5DZGA 5KHGA 2VBPA 3SMHA 2WT2A 1RXFA 5HPOA 4FO9A 1OHFA 4XFFA 4C8DA 4E9KA 1OQ1A 1V70A 4MXVA 1YFYA 5FY7A 1V6MA 3WDWA 5L9BA 1SLAA 4P5HA 3A0KA 1VB2A 5C5UA 3WOGA 1Z78A 1I6XA 1S0IA 2E26A 5T5LA 3TAYA 3ST7A 4BA6A 4NROA 4ZKTB 2BNOA 4NIGA 1RUE1 3IB3A 2WSVA 2AZ5A 4AEDA 3THTA 3ENRA 1T6BX 3MIHA 1NT0A 1W3VA 3RZGA 3GM8A 4NRMA 3ZPYA 3T30A 4Y1YA 3SLIA 3ETPA 4TWTA 1AXYA 3S0MA 2QKDA 3ZYGA 4COUA 1QH7A 4B8EA 1YQ6A 1J1LA 3AK0A 2VOWA 1ALYA 4FPJA 4C0HA 4IETA 3J7NA 4NHLA 1UY4A 4DXTA 4NRPA 4TYSA 1FNZA 3GNEA 4PIXA 5FUPA 4BQ2A 3LEIA 2DCYA 2ZAAA 1V6NA 4HZFA 3OEBA 1PK6B 4AI1A 4IEXA 3T2QA 1SCSA 1CVNA 4EN9B 4ZZ5A 3PVEA 2BWCA 5GLUA 3U1XA 3BVCA 3JD73 3OEAA 4JHTA 5GLZA 2ZGMA 3KCCA 4COYA 2WNOA 3WNMA 2WA3A 3JB4C 1R1A1 3PUSA 4YVWB 5C7GA 3PVOA 3IIAA 2Z79A 4CZSA 1F5JA 1BMV2 1MQTC 2W47A 3CKHA 3JD72 4I01A 4EJRA 1FPN2 2VH9A 4Q1RA 4URTA 5ANQA 2VTXJ 4LOSA 4A45A 2J42A 1NKGA 4XBLA 5EP9A 5DDJ3 2C6SA 2IC1A 3VBRB 4GD4A 4YG3A 3V56A 2VMCA 2ZEWA 4LHSA 1GANA 3JB8A 4Q5OA 1RUF2 1X9TA 5HXVA 1CJDA 1PZ7A 5A3PA 3ACFA 4EE2A 4XJUA 3E97A 3N7LA 1VRBA 4GWMA 1W6MA 5JDBA 1EUTA 4QX0A 3JBG1 1AR93 2VUJA 3SEPA 2DVFA 1YIFA 5BNOB 1D2QA 4KMQA 2XLGA 3ZR6A 4LJHA 2WNVC 4BWOA 3AL6A 1CGPA 5C4WB 2MHFA 4K8FA 2B9UA 1VR3A 4A7ZA 1E5HA 4OCTA 3USUB 1LENA 3AMPA 4XACA 4UFJA 4PI2A 1AR92 1PIV1 2V5YA 3LDKA 4CUBA 1AHSA 4YW7A 2ZS6B 3V0BB 2ZGSA 5C3RA 2OT7A 1RL3A 1C5HA 4BB3A 1K45A 2BVBA 4BQ3A 2QVSB 5LBCA 2FMYA 3WHUA 1J3QA 2FQPA 2VZQA 4LXLA 1SPPA 2A6VA 2BGCA 1DYOA 3RQ0A 4AI9A 5L7OC 5CKMA 3CLPA 1ZYBA 1UPIA 2ATFA 3VD3A 1J59A 4YZ3A 4Z2AA 1TNRA 2WYFA 4LBJA 4LHLA 5JZGC 1VLNA 1QNYA 2WLQA 3S5AA 1ENQA 2XBO1 2ZEXA 3WNNA 3ZXJA 4Q4Y3 2Y33A 1JUHA 4Y1UA 1UZWA 4LORA 3I2JA 3KWVA 4HANA 1SEFA 4IEOA 5C8CB 1XE0A 2R49A 2W95A 2WS91 5FOJB 2GMMA 2VZ1A 2LM3A 4XZPA 3T2OA 3ZFGA 3D3AA 4MZUA 3H3UA 4Q4Y2 4UAPA 5FLJA 3LEKA 1JW6A 4Y4RA 2C9KA 4JKKA 2UWCA 2CTVA 1F2NA 2WWSA 2E7TA 3DUIA 2VJXA 1NCQB 2D6NA 1UX7A 2W68A 3V64A 4ASKA 2YGMA 2YV8A 3PHMA 1UOBA 2VZ3A 2XMLA 4P08A 3MDPA 1XXNA 2ADEA 3HNYM 3MW3A 5FZGA 1LR5A 3SISA 3ZXLA 2MPFA 1JUIA 3UETA 1PX3A 5C3OA 1DZTA 5D8AC 3MIEA 5LW9A 2VAUA 1YQCA 3LKJA 3RMYA 2VGDA 3N9PA 4E4DX 1G7YA 1JXNA 2GP5A 1KFUL 4IEPA 4OUSA 4P9YA 1XYNA 4HPKA 4UFLA 4XCBA 3VZJA 2V09A 3WZ1A 1UYYA 4ZXEA 4IEYA 1QJX3 5FO8B 3ECQA 3A0NA 3VBFA 5JPMB 1A3KA 1WD4A 3H8UA 4A3XA 3H3ZA 2YROA 3RMXA 4CSWA 4CTEA 4DIQA 2UWBA 2QZ3A 3RWKX 3ZMOA 2ZHKA 3POFA 3I49A 5G05L 3ABZA 1CZTA 2VZRA 2VMDA 2A73B 3ON7A 4JAAA 4FAHA 1QJX2 1JU3A 4NHKA 2FCUA 5G04L 3SCHA 3POWA 1C4RA 2EXJA 4FPOB 2TBVA 3N7KA 4JDOA 5GLTA 4AGGA 1UMHA 3WR0A 2BBAA 1ZZBA 1S1AA 2RMU3 1D2SA 1FXZA 3A22A 4AVVA 3AYEA 4JGYA 4FQ4A 1IKQA 3VHPA 3AP6A 5FO7B 2WFF1 3AYAA 3NV4A 1H1IA 4FPFA 5JIAA 4XE9A 1MEC1 2OVUA 1HRI3 1UXXX 4B7EA 2BRTA 4QGNA 2RMU2 4XZUG 4HVQA 4W6YA 2YU2A 1UU6A 2VCMA 2ZAHA 1W04A 4LO7A 1CPMA 1HRI2 1VBC1 4YGEA 4OZOA 3BCWA 1XBFA 4UFHA 4P9JA 1DQ4A 5H9RA 3UESA 2OZJA 2VOXA 3GCWA 2WA4A 4D69A 1DU3D 2VNVA 4F3JA 4GZ9A 5BNNC 1NLSA 1OOPC 2AEZA 2CGOA 2QNKA 4BK4A 4QDSA 1LHWA 2WABA 3MV11 1JYXA 1ND3B 1B35A 2A6WA 1S0EA 1NAEA 4IDZA 4E2GA 4QPGA 4ATFA 2ZOEB 2R063 2I74A 1LHOA 2UU8A 2J1UA 2D43A 3IMNA 3WDUA 1AJOA 4CEWA 4QHOA 2C24A 3LOIA 1CD3G 2WQ4A 2Z4FA 4BMBA 4YM1A 3FHIB 4WM8C 1FYUA 1KDMA 1UIJA 2QQUA 5FREA 4AVCA 3AXDA 2MEV1 2R062 2Z42A 1GU3A 4I3GA 4ZU7A 1JHJA 3HNBM 1FMD1 4FT8A 5E8AA 4OI0A 1RINA 3ZN6A 3MGUA 1ZBE1 3M4FA 5F5QA 2QQPA 4ZU4A 3POSA 1NA1C 3FLRA 1RYYA 4XQDA 4PIZA 3OYWB 4QX8A 1RUC3 5CVRA 4XW3A 3KCXA 5A3OA 3O1MA 5EWSA 3H8RA 3HVDA 3U37A 4EROA 5DZFA 5FK7A 1TVGA 2XOMA 5A7WA 1UCXA 2EICA 3URFA 2A71A 4XYXA 4QB6A 1G9FA 3HAGA 4XFIA 1RHI1 2DUQA 1IQDC 4ORFA 1RUC2 1UYXA 3H8OA 1SZBA 3H9AA 4HMZA 3S7IA 3BPSA 3ZKUA 4MUVA 2FHRA 2ZJCA 1OFSA 3DEMA 1DLLA 3G7DA 2ZMLA 4J1XA 5FYUA 2NLRA 2JB8A 5FZ8A 3O1OA 4IV3C 2QDNA 1BK1A 1SLIA 4YM3A 3FLTA 2JG8A 3WG1A 1OA2A 1LGCA 2P3JA 3HIFA 1YNAA 5I93A 1NX9A 1PVC3 4J1WA 1V6OA 2OIIA 2R073 1W0OA 1W8OA 2WWJA 5A33A 4Z07A 1QXRA 2P6CA 1GFF2 1APNA 2P3YA 3PL0A 4XVHA 5EHDA 4AVSA 4O9EA 5JAXA 4PT6A 4L97A 4R9CA 3WQ7A 1ND2A 1PVC2 3ZFFA 4CDQA 2R072 2DCJA 3LA7A 4GXLA 3A7QA 1ACCA 3U78A 1DGWA 5DUXA 1YEWA 1QIQA 2O0OA 1W6NB 3UK9A 1IS5A 1DG6A 4AR2A 2LUWA 2KR2A 2J22A 3FZ3A 1SFPA 2SBAA 4PDWB 5LA9A 4CCKA 3ZXDA 4BK5A 3AFGA 3VDDB 3NNFA 5FP8A 5CU1A 5HV4A 2WYSA 3MZHA 1OA4A 4CDUC 2PLV3 4M3CF 5FYZA 1VPHA 1WA6X 2NMNA 4META 3WW2A 1TQ5A 4FQZA 3RNSA 1N3OA 3NNGA 4TZDA 2E31A 2PA7A 2YC0A 5F39A 4FBFA 4FFFA 4C90A 3VBHC 5FZ9A 1RUNA 2RJKA 2VQ0A 4A42A 1W9YA 4KU8A 1H1AA 3HWJA 2GZWA 1DQ0A 2PLV2 1C3HA 1EV11 5FLHA 1NE6A 2A6XA 3WW4A 2XJUA 2E51A 4XOGA 2WWUA 5LBBA 1NOVA 2GDFA 4LIVA 1YWKA 2UYAA 3B9IA 5F6LB 5F7UA 5JUVA 2ZZQA 2B5HA 3MYXA 4Y3OA 1CZVA 5HCBA 1PK6A 3OBRA 5GLVA 3AC0A 1YQ8A 4OUMA 1HLCA 5CYYA 5EJ3A 3RSJA 1ZREA 2G9ZA 2GN3A 4Q29A 3UNPA 1GP4A 3A21A 2D6MA 3DN7A 1IOAA 5EPAA 5A1FA 5FZ0A 1X8EA 3EMRA 1R083 1TG7A 1VBA1 4YVWA 5C33A 3AJYA 4Y33A 1BBT1 4Y1ZA 4LKEA 4DRVA 4MVTA 3O0WA 1NLRA 4AXOA 2QQOA 5IK5A 1DBNA 2E33A 5CEHA 3BUCA 1U5YA 4GMP3 2E32A 2X29A 4DUWA 4BOWA 2G9FA 4IEUA 2GAUA 2Q1FA 1R082 5KC6A 3RZMA 5A7PA 1YIPA 3VBRA 3POGA 4P9XA 3NL1A 2VR4A 4AL9A 1POQA 2L9LA 4AVBA 3MO4A 2FDJA 5FXXA 4IE5A 4Q0UA 5IAXA 1KDKA 2BTVC 4Y4YA 2YDEA 4QGLA 5F6KA 4GIQA 5GZEA 1K5JA 4FAGA 4OI2A 3WXPA 1YQ2A 2AC1A 3LPFA 1COV3 3PUHA 4N43C 4MGZE 4P02B 4AAXA 4EZ4A 2H0BA 4GB31 4Q4V1 4Z2WA 5KXCA 1F8VA 3N9QA 5BNOA 1TMF1 2C26A 2IWGB 2C1FA 5C4WA 3N9MA 3WG3A 1A34A 2X53S 2OPKA 1RJ8A 2WN3A 3AJZA 1O5LA 4JGZB 3NAPB 4IESA 3USUA 4XJ9A 1COV2 4AVAA 3IMMA 2YPJA 3RJRA 1ULPA 3DGTA 3KZ4C 4GJYA 1CN1A 5BNPB 5FZIA 3V0BA 5DAQA 5T55A 4LEJA 2ET1A 5JR2A 5JXJA 3ZSEA 3ZOIA 5BUVA 2CAVA 4LITA 5IATA 1LOCA 1VALA 2HWB3 2BW8A 2YZ4A 3EO6A 1S2KA 3NJZA 1ULGA 4F7ZA 4XJAA 3NKTA 2ZX4A 2JD9A 3K48A 1A78A 4WZCA 5J98B 3TNPB 3I7DA 2P3IA 1X36A 1LOBA 3BIEA 1NZCA 2F17A 4Q4W3 2BEOA 1HV0A 2DCKA 1DF0A 4EQVA 2CL2A 5CFCB 2KA3A 3B00A 1JZ6A 2HWB2 5A1LA 1CAUB 3N9OA 2ZEYA 4P9IA 3KLSA 3R4DB 1RUJ1 5D2AA 1OPOA 4PLOA 5JSRA 3KV9A 5C8CA 3PJQA 4M0NA 2E53A 3I97A 4S2GA 3H8XA 4Q4W2 3QBQA 3N7MA 2QUOA 1AYN2 2NN8A 5A7NA 3VZLA 2VXRA 2XKPA 1DYPA 4WM7C 3UJQA 3O1UA 1KQRA 3TWIA 4HT1T 2VTXA 3W21A 4XTMA 3VUOA 3B9CA 2XQXA 3IBMA 1W2UA 4FPCA 1JYTA 2ZX3A 4KI5M 2VNOA 2VG9A 4HSLA 3R05A 2A7AA 1W8WA 2BYVE 4WVMB 4N53C 3VDAA 2XWBB 1NCQA 5CADA 1NQJA 1GQPA 3ES4A 1AR63 2NYYA 1CZSA 3C8XA 3FC0A 1BCXA 3KS7A 1N3QA 4UBHA 4YW2A 5J09A 1RB8G 2AENA 1CAVB 1F15A 3B69A 3VGIA 2JE7A 1RVF3 3AZVA 3HN1A 5GZFA 1YFXA 2HBUA 2VW1A 2ZGOA 3ZXAC 4A6OA 1AR62 1QH6A 5T5PA 1CAWB 1W8UA 2W87A 3E1F1 3J26N 5LB6A 2PHXA 1H30A 1REFA 1LRHA 4V1PA 5LRRA 4CDXB 4J25A 2VMHA 4UW4A 1K5MB 3BIWE 3T2PA 1MVEA 3OPZA 2XHKA 1WD3A 3IT8A 4PLNA 1AR81 4FPHA 1RVF2 4EN6B 5CBLA 4H3WA 4YG0A 1KXGA 4H55A 4Y5TA 4Y26A 4YZ5A 2YFUA 4K40A 4XETA 5FP9A 2WZ8A 3KVBA 5FMOL 4XFAA 5FJHA 2CU5A 2WSUA 2WT1A 2BU9A 1Q8OA 2D3RA 2RDQA 2VU9A 1AZDA 3H3LA 2JDHA 3W20A 4DEQA 3QD6A 3VD7A 1OD5A 3WSOA 2DYCA 2VBBA 5EIYB 3FUQA 4MGSA 4AEDC 3ZYFA 3R0RA 1IQAA 2DFCA 5A80A 4AVTA 5LRSA 1BMV1 1YJLA 1U12A 3THDA 3ZFEB 1Q5OA 1WBLA 5JOYA 2W1UA 2OX0A 4ZY9A 3ZX7A 1FPN1 1SLBA 1RUD3 2B7YA 2VL4A 2XLFA 2Y0OA 5FZMA 3EXUA 5F2SA 1UOGA 2EALA 4DZGA 4FTSA 3MBWA 3FMGA 2GALA 4BIOA 4XAAA 2YXSA 1OI6A 3WEZA 3LQCA 3RZLA 2D93A 1CPNA 2EXHA 5IWFA 1UU5A 1X8MA 1RUF1 5FYMA 3ACGA 3B5LB 1J1TA 4SBVA 4PJYA 4D0QA 1RUD2 3K77A 4NPRA 1GQGA 4H7LA 4M4PA 5D21A 5FFOC 1JU4A 2ETEA 3IDEA 5FY9A 3T4HB 5KWRA 4XCAA 4CP2A 1O4TA 3BTAA 2LRPA 1V6IA 2Y60A 4D6SA 3H0OA 1JBCA 1Y9GA 2HWF3 4GULA 1VBE1 4GAZA 4L11A 3GBGA 3I2GA 5E89A 3BYWA 1I5ZA 4MGTA 1N47A 1CONA 1LECA 1AR91 1W8TA 3LE0A 5F3GA 4I2OA 1ND3A 3GHMA 4M01A 4NWWA 1OC1A 2R1BA 2JB4A 1UO9A 3SXWA 1H6YA 4NAMA 4ET7A 3T4VA 2DCZA 5F5CA 2CY6A 5C5TA 1E57A 2W08A 4FPYA 2Q1MA 3MLKA 4LUKA 4QQPA 5F1RA 1PGW2 4QU2A 2V72A 4PF5A 1PGL2 1PO21 3CL1A 1ST8A 1RJ7A 1UOFA 2RS13 3MFCA 1ZX5A 5K7PA 1VAKA 3POYA 3LEMA 5I0DA 4WV8A 2QTWB 3IN9A 4QXCA 3VBUB 2B42B 3WV6A 1VP6A 1LEMA 3R4UA 4UFIA 3WCSA 2RS12 2W1SA 3PMSA 4D6QA 3RZZA 4I0BA 3OYWA 4F8AA 5K9YA 4AHZA 3GJAA 3J7LA 4NPLA 4FP3A 2FZ2A 4TN7A 1LGBA 4NWVA 1NG0A 1TME3 4D3WA 3FBMA 4XFHA 2BP6A 4QXHA 5EJZB 3D8CA 2JG9C 4M00A 4A41A 1P8JA 2PHFA 1SLCA 1MR5A 3TYJA 2PYTA 3WHTA 1UN1A 1ZBA3 2J1RA 4NN0A 2JDPA 3WDYA 5T52A 4DXZA 1TME2 4LR4A 5HBAA 1ULDA 5A7QA 3PU3A 2DVAA 2RS33 1BVVA 2ZACA 4LBKA 1UIKA 4RL7A 3VV1A 4DUVA 1RMU3 1LKNA 3OGVA 5FY5A 1LU2A 4K7JA 4QHBA 2JEMA 1F31A 1KS5A 3VDBA 1JTZX 1SACA 4IGPA 1GLHA 1ZBA2 1XC6A 3B94A 3ETQA 5E88A 5IK4A 1TEIA 2E9QA 4BHPA 5LK7B 1O91A 2VCCA 2VZSA 4XBNA 3CMGA 2D3SA 2RS32 1W6QB 1H9WA 2B9VA 3JCIA 1YC61 4UBGA 1RMU2 3ZPOA 4Q0PA 1KGYA 2WRAA 1DP0A 5LASA 4LBMA 4JCKA 1N1SA 1DIWA 1OQDA 2NPIA 4Y1VA 1X9PA 1W6NA 2XUMA 4QMAA 1QJX1 5ABJB 1PMJX 4MADA 5IVEA 3JXSA 2J1VA 3OTFA 5F3IA 1KITA 3UL2A 2GNMA 2JX9A 1BHGA 5IAVA 3VDDA 4AW7A 4QHZA 4LO6B 2HYXA 2R1DA 1D0GA 4XUPA 2IZWA 4BQXA 1JODA 3I2FA 5M0TA 2HJIA 2DURA 2QQVA 4KWUA 3BB6A 1S0FA 1Z7S1 2IXJA 1OLMA 5LATA 1IHMA 1C1FA 5A70A 2JIJA 2BWAA 1ZZ7A 2LW8A 4LO5B 3ZIWA 2IXKA 4X8NA 5FMDA 1FOD1 2GN7A 2HEYF 4XPVA 4WVVA 4L9BA 1F35A 3H1YA 4JQRA 5FTTC 1WCQA 2JDZA 4FFHA 4HKOA 4CA9A 3PVNA 4BXFA 3T3YA 2B46X 3DKWA 3OCPA 1W99A 2BNMA 2W5FA 1BEV1 2Y6JA 4Y5Z0 3VBSB 2CHHA 5FZLA 1DFQA 3VBFC 1HRI1 1W8NA 3NO8A 3OPTA 5GZDA 5I0TA 5A32B 4OULA 4B1LA 1GNHA 2FZ1A 2WZR3 3I2IA 3IIIA 3SCFA 5A3WA 3Q8CA 5A6ZA 4RGKA 5KR7A 5D8AB 4Z82A 1AVBA 1OA3A 3ZSLA 3I59B 4HL0A 3ACIA 2D97A 4CYDA 1QQP3 4N7UA 3KD4A 2HBTA 4QWNA 2JDNA 4JTNA 3EHKA 2WZR2 2UY8A 1N1VA 5JXGA 3OOXA 2YB7A 4HK8A 2P6HA 3DXTA 3LA3A 3PUQA 3AKSA 4MGQA 5FRAA 2JWPA 3D0JA 3PTRB 4JGYC 3E5XA 1UKGA 1RUI1 1L7RA 3ZXFA 1LNSA 1QQP2 1IS4A 2PAKA 4K6BA 4A6SA 2EIDA 1MS1A 2W46A 1W6PB 3KSCA 3MW2A 5C6CA 5JMOA 1WWYA 5J37A 2FBEA 2RM23 2QQWA 1TNFA 5C70A 5GZGA 3WNOA 4G4FA 4E8CA 5FWEA 5GJ6A 1JMUB 3RYRA 3MF9A 5FMOS 4UW3A 4GMP0 1O8SA 5AVPA 5JOZA 5FZOB 2P2KA 2RM22 3KB5A 4XF4A 1K3IA 1SMVA 3NRUA 3R6SA 4JGZA 3GZEA 2VM9A 3NAPA 5J3UA 2H6CA 3FUOA 3T2TA 1LESA 4EWEA 2VBDA 2JIGA 2WL1A 1XNCA 4FOWA 4UF0B 1RUC1 4LO4B 1B35C 5K4LA 5BNPA 2FMDA 5DDJ2 3AKRA 1BYHA 3NV2A 2PHRA 4WZFA 4XTPA 4YM2A 5FQ0B 5H9PA 2NZ9A 2D6OX 5IUQA 3SKJE 4TSVA 5FYCA 2MNGA 4QPGC 3MIBA 3MUZ1 3J8F3 1KD7A 2DBNA 1E5IA 3SKVA 3P6BA 3PNAA 3WD5A 3M3EA 4CP9B 3B02A 2RDSA 4MGIE 4CU6A 4CEWC 5JCTA 1XJAA 3J4UH 5FYIA 4EN7B 1QGLA 3A23A 4INDA 4RR3B 5IVBA 3GALA 4HBNA 3RS6A 5FPUA 3AKQA 4IUGA 4NO4A 2WFPA 1E5SA 5KHIA 5CKNA 4IW3A 5DQ0A 3J8F2 1UZZA 1S0BA 3ILNA 5FP7A 5CFCA 2Y6HA 4DB5A 1GICA 1XE7A 1CAUA 2Z2SB 1ZRIA 3ZIXA 1STMA 2OYZA 2SLIA 4XJZA 5JSOA 1PVC1 1OLME 4DY3A 4CU7A 2R071 4QM8A 2CYFA 2WNUB 1PM4A 1ODNA 1OXCA 3ILRA 2EAKA 1OURA 1GWLA 1XNDA 2BFUL 4A3ZA 1PX4A 4JQTA 1V00A 3LDBA 1FV3A 4XURA 4XUNA 5FZ1A 5T5JA 2F4LA 2R041 4LOTA 2GMPA 2Y38A 3KHBA 3ZYPA 3AMMA 4WVMA 4N9IA 4QXBA 2R6QA 1Q56A 1XOYA 3K46A 4XABA 3KVAA 2A70A 3J7MA 1FATA 2VE1A 3MUY1 1NA1B 2QQKA 4AG4A 5IHRA 3JQXA 1VRH1 4R52A 4YSFA 5A3MA 2OZ6A 2JG8C 3POJA 5FK8A 1CAVA 2VOTA 1V6KA 2DF7A 1WMXA 2EIBA 1W3XA 3KCYA 4Y22B 1AR73 1DZRA 1CAWA 1US3A 1UQXA 3WF3A 4QAWA 4YYOA 2VC9A 2JE9A 2ZHLA 4CDXA 1K5MA 1LULA 4L2NA 2G1MA 2UYBA 1DYKA 1ND2C 1QXJA 2HWC3 2VQTA 4KNCA 3S7EA 3ZFFC 4CDQC 2CNAA 5KXBA 3CZJA 4IQPA 1AR72 1W9WA 3WINE 5J7MA 2ZGRA 3PIGA 1V0AA 2DVBA 2ZGLA 3NNLA 1CIYA 2Q8EA 4DS0A 1WLWA 5IJRA 3AMQA 2HWC2 4FXGB 2UY9A 2KM2A 1YXWA 2TNFA 3C7GA 4AK3A 4BU2A 4CDWB 1REEA 3O1TA 1WMFA 1K12A 1WW7A 3ZFEA 2WO2A 3X29B 4GALA 1VBB3 1XQNA 5BNQA 3AP7A 2K0GA 1R081 2ZHMA 3IPVB 5APAA 3MW4A 2PAMA 5LBEA 4YZ2A 3DPRB 4E8DA 1XRUA 2W2IA 2EIEA 4GKXA 4RS5B 1VBB2 2P4EA 5FZ3A 4OQ9A 2IXIA 5GM0A 2WZPP 3WQ0A 2D5FA 5EXOA 5FXZA 4Z92B 4QKFA 1H8VA 4QDQA 3CJIB 2QE3A 3AZWA 3CF6E 5JPNB 4BH9A 1R64A 1YO8A 2N7GA 3WY6A 2TEPA 3WQBA 2W9XA 1JZ2A 3RI9A 1WKYA 3RYPA 3ZKYA 1GNYA 1RGSA 1C8M1 3KQRA 1N1YA 4WVWA 1QJZA 3WUDA 3BU7A 1B09A 1KJRA 5FR3A 1COV1 1NQDA 3AFKA 1Y3TA 4LE4A 2BJSA 3EJKA 5IYYA 4AEKA 4IERA 2OUJA 1LEDA 1OPMA 4JKLA 4PBOA 3GGLA 4Y5SA 4P9LA 5IW0A 2GNBA 2V4AA 3Q8AA 1RUE3 2ARAA 2XR4A 2XVKA 4GKYA 4IEWA 3MFAA 4UFKA 2WIIB 3VBRC 5F5AA 1HN0A 2PELA 4R9AA 4CCDA 1R091 3OY8B 5H9SA 4Q26A 4CCEA 3CO2A 2HWB1 1QWRA 3VBUA 1RUE2 5LEKA 1A8DA 3LCPA 1G86A 2OQ7A 4TTGA 5BXXA 4BXSV 5K0UB 3MV01 1PMHX 1J3RA 5BNOC 4HSJA 1AYN1 3M3IA 5L9VA 5C4WC 1AX1A 1ZNPA 4WVZA 2DTYA 1W2OA 3W58A 1R1ZA 4KWLA 3VKFC 5CFDB 3WQ1A 3FE5A 2KXLA 1GWKA 2IVJA 1WMDA 3JU9A 3M3CA 3WP5A 4IE7A 1H4GA 1JOPA 1LCLA 1POV0 1U5XA 3I3DA 4OVEA 4R9BA 3VHNA 4CPBA 2VTFA 5FPLA 1R1A3 1AX2A 5F8PA 2JJ6A 3ZXGA 1UY2A 3U0ZA 3FN9A 1YYNA 1SLLA 1W03A 1NCRB 3QH7A 2W94A 1AR61 1WLTA 2I2SA 2W3JA 1HB2A 3PUIA 1IG0A 4ZXKA 1OT5A 5EQUA 3ZR5A 1QMJA 3AB0A 1RUG3 4C0BA 3GZAA 1FNYA 1W6QA 3C7OA 4FFGA 4DRRA 4OFGA 1QF3A 2WJSA 3P3PA 2RS51 1URXA 1RVF1 3K4ZA 1WZXA 3QCWA 3AZXA 4MXWB 5DAXA 1OSGA 1J3PA 3CNAA 5F3EA 4AQTA 3UGGA 3OUHA 4XMIA 3WUCA 1HB3A 2XPJA 4KWJA 2XWJB 5FCCA 5FV3A 1CWPA 1ENRA 3KGZA 4NIHA 1RUG2 2EF6A 4ZZ8A 5DMYA 5IVFA 3RJ2X 2ZEZA 3TN91 4AFAA 1PO11 5ABJA 3JBG3 4XQ4A 1HW5A 2A5ZA 3ZN5A 5FXWA 2FCTA 1SDDB 3IDBB 4HETA 4IEZA 2W91A 3POEA 1WUVA 2WO3A 3QH6A 3QLQA 5J48A 1N1TA 1BZWA 2VNGA 3OBAA 5I0SA 3JBG2 2WUHA 1QDOA 1W28A 1LGNA 5E16A 1WLCA 3O1PA 1IKPA 3D82A 3VN4A 1G6NA 5A6XA 5KXDA 5B4NA 1HRV3 4YGDA 4RQPB 5HCAA 2QQJA 2TUNA 3THCA 2WINB 1UMIA 4FXKB 4YLZA 4COVA 1RUD1 2AEYA 2D6KA 1VB4A 2OS2A 3LZZA 3ME2A 4N53B 3VBSA 3WG4A 2HWD3 2RVAA 1SFNA 4CXWA 3VBOB 4BQ1A 3UKTA 1HV1A 1HRV2 2GSYA 3S5QA 4AFDA 5LA1A 1UF2C 4IE0A 2VVDA 5A32A 4XDPA 3PIJA 1QJY1 3AP4A 1AJKA 4QKNA 3Q8FA 3WVJA 5I0RA 2NMOA 3PU8A 5D8AA 2HWD2 1AF9A 3I59A 4FCAA 4LTAA 2B45X 1HKDA 3K3OA 4QX5A 4FPKA 4FOVA 3T1LA 4KU7A 3VD4A 2XVGA 5FKCA 1GZWB 5FJKA 1JZ8A 1W8ZA 3LIHA 3O1RA 1NY72 1F9KA 2VQAA 2HEWF 4HONA 4LBQB 5IVYA 1RUH1 3N9NA 1PGW1 1ENSA 4V2VA 1W9TA 1WCDJ 3MIDA 1PGL1 3LFIA 2XL7A 2X10A 3GDBA 5D1IA 1W6PA 4ISQA 4CXYA 4GWJA 2RJLA 1WW6A 5L19A 5FZAA 1IZ3A 1VBD1 2Q8OA 1Q43A 4COWA 1MS9A 3ZSMA 1XU1A 3K2OA 3AX4A 2J1EA 2RS11 3OSDA 4G3YC 5EFUA 1J83A 1FI2A 3ZYBA 1E5RA 4UW6A 3GZTB 5FZOA 5FZ6A 1H1MA 5DG2A 1WGPA 2Q5TA 3VL8A 3B3QE 5DAWA 2EXKA 3BU0A 3RDIA 4ES9A 2AUYA 2YY1A 3JQWA 3TBDA 1XU2A 3AP5A 4UF0A 5FYSA 1ND3C 1H6XA 3L2HA 1NUKA 2ZMNA 3VZKA 1AL21 2WNEA 2IXCA 5FQ0A 1TME1 2FDHA 2VOVA 1XNKA 1PGSA 4RFRB 1L7LA 2IXHA 2ZA9A 4RFT0 2Q4SA 4ARYA 4CP9A 1VAVA 2O8QA 1ULEA 1RTVA 2DCTA 5CIRA 2XG3A 4RR3A 4H14A 5DG1A 2NQYA 4W65A 2QQMA 4DXSA 5DAPA 3BN6A 3I3BA 4XHBA 4OI1A 1OF4A 1RMU1 1MEC3 2R0HA 1JN2P 1AYM1 1VMHA 4BLIA 4UYBA 1W6OB 2WNUA 4LBLA 4XJ8A 1G9BA 4QKDA 2WAOA 1GOGA 4AF9A 5DZEA 1ZVFA 3THPA 3ZVXA 1UOJA 2JDKA 5F3CA 2FD8A 1QJU3 5SV8A 4LQRA 1MEC2 4UT5A 5FXVA 3NMBA 3NVCA 1M4WA 2A6ZA 2CDOA 2PFWA 1JYVA 4KGGA 5FYVA 4J6GA 1SQ4A 4O7XA 3P1IA 1D4M1 1EPZA 1H8TB 5HI0A 1IGOA 4LA3A 1W6MB 3DXUA 1QJU2 1SLTA 5FPXA 5KC5A 5K8SA 4AEJA 5JR7B 1HB1A 5T50A 4AI8A 4MO3M 3HOBA 4AOCA 1I3HA 1UW8A 1V6LA 4U2AA 4NR1A 1DGRN 1UU4A 1YLLA 3RPQA 5C9AB 3GJBA 3KT1A 2JDAA 1UZ0A 4Y22A 2AH2A 2IXLA 2PHWA 3PUAA 3SHRA 4DOUA 4GH4B 4YVSC 2JG9B 4B4PA 4P9WA 1DGWX 1U0AA 2QQNA 1YUDA 1OBNA 1O3QA 1QOTA 3GHNA 2NM1A 3TOJA 2VPVA 4NPMA 4OLLA 5BYNA 5FZDA 5IFPA 4CU9A 3O1VA 4K1YA 4P5YA 3M3QA 1HDKA 1OMIA 1FMD3 3HPNA 4OZXA 3VKLA 2Y6KA 3QACA 1UKRA 4LLOA 1ZBE3 3EB7A 4K9SA 5LWBA 1GNZA 4QT6A 5I8YA 1W2AX 3C7FA 4BQ5A 4P9GA 5HXMA 2P5BA 3VDDC 2F6BA 4CDWA 4CEYB 4UFMA 2D40A 4XFBA 5FPZA 1GQHA 3AMNA 2WZR1 2FDIA 1FMD2 2PHDA 1LOFA 3J9SA 2CWSA 3IZOA 5HCHA 3POIA 1ZBE2 3WNKA 4A7YA 3C7EA 4OHWA 4OUEA 4QD2A 3NV3A 4MV2A 3IPVA 4QPIB 1O3RA 2X5IB 3POBA 2NP0A 5DABA 3C7HA 5ACA3 4IV1B 3DPRA 4BDVB 1LB2A 2C5DA 5L9RA 4E27A 4QX3A 4RS5A 5GKAC 2XUEA 3N3HA 3UGHA 1UYPA 4DFSA 4C91A 3I2DA 5KHHA 5JOWA 4RHV3 4AQ2A 3NJXA 2VMEA 3JD71 4XBQA 3CJIA 3AM2A 5ACA2 4NIIA 3SITA 1EY2A 3J7HA 4EZHA 4Z1VA 1G9CA 1ZZCA 3ATGA 4YW4A 4FSJA 1VMJA 4UW5A 2DVDA 3WF4A 2RV9A 1CX4A 5BV6A 2VZTA 4CXXA 4RHV2 2HEVF 3IKWA 2R32A 3HQRA 3MPBA 3NNMA 1L7QA 1OUSA 5HCFA 5AFEA 3IAQA 3UKNA 3KQ4B 4Y1XA 5DDJ1 3GYDA 1H2KA 2DFBA 5IVVA 5B2GB 1KEXA 3PDQA 3VBFB 2G9GA 2YU1A 3BI3A 3ACHA 1M06G 1ULCA 1ULOA 3HN3A 3ORJA 4OHVA 4FPGA 4LNVA 1Q8SA 1N3PA 4XXPA 5T54A 4EWAA 1HQWA 4SLIA 5CKQA 4Q8KA 1W8HA 2P34A 4XF1A 4FTEA 3M3OA 2W1WA 2P17A 5T3NA 2A3XA 1GYKA 2QZ2A 3OY8A 5FLIA 4E2QA 4BMEA 3J8F1 4P00B 1SCRA 2BOIA 2HWF2 2VZPA 2G4IA 1PNFA 1JYCA 2WQZC 2UWAA 1QJFA 1BLZA 3LD8A 1PZ9A 5K0UA 3M7AA 3MPPG 2ARXA 1O7FA 4RYDA 4CPBD 1DLCA 3CU7A 1LTEA 4R8HA 3B7MA 3SH5A 5DAVA 4UI9L 4CCNA 1H9PA 4JGZC 5CB7A 3NAPC 2QJVA 2CAUA 5CFDA 2XVLA 3AKTA 1EAH3 2IVIB 3SH4A 3SNMA 5BNPC 4BQ4A 4XF3A 1POV3 3AYDA 3E6BA 3KT7A 1WLDA 4X8PA 1MQTB 2X05A 5ISLA 3OG2A 3D0SA 4PLMA 2DTWA 2RE9A 4JRAA 4LKSA 4Y24A 5FY0A 2H0VA 1BBT3 1MZFA 1EAH2 3EYPA 4Q4Y1 3FL7A 3RG0A 3WCRA 1JZ3A 2XJTA 5GALA 4CE8A 1NCRA 1UPSA 2Q1ZB 3LAGA 3N36A 4I3PA 4OMCA 4ZHNA 2BPA2 3MF6A 2ARBA 5C3SA 3MEPA 1OFNA 3U75A 4NOTA 2JDUA 3OD4A 4BQYA 4EN8B 1U5ZA 1BBT2 4NUBA 3KMHA 2XJPA 3TEZA 4MXWA 3FFZA 3UYJA 4HVRA 4DXRA 5A3LA 2AACA 3NSTA 1C28A 1JYIA 1H2LA 1S0JA 3N35A 3FHAA 4H7MA 2P1BA 1UX6A 2WNVB 3ACLA 4L0PA 4Q0VA 5TSWA 4IGOA 4BISA 5LY1A 4AI3A 4YZ4A 1PVXA 4Q4V3 2A3YA 4YPJA 3N4MA 2GC1A 5FPBA 3QOPA 2HWC1 4KL1A 3LOBA 1TMF3 1H2MA 4ZONA 2AYHA 4QQHA 5I8TA 4LBOA 2EXIA 3TB0A 3RZKA 1O3TA 2DWRA 2C9AA 2EA7A 3HNMA 1EPWA 5FY4A 2HH9A 1X7NA 4I0WB 2H6BA 3VZMA 3ZFGC 4PI0A 5BY5A 2O14A 2YC4A 5L7OB 2CGPA 4FPLA 1JH5A 1TMF2 2W1QA 3LFMA 2PMWB 5CA6A 2J7MA 5JZGB 3DKQA 5IFTA 1UY0A 3ALQA 4PDWA 4RQPA 5FDBA 3F95A 3IM0A 2YG0A 4O61A 1CAXB 3LEGA 2D98A 1K5MC 4N53A 2JENA 3DV8A 3MLJA 4JHZA 3WF2A 3VBOA 2E6VA 4N90A 1MZEA 1DCSA 2K2SA 4HN1A 3O5SA 4XFGA 1S2EA 3KF3A 5A7OA 1JOJA 5LBFA 2GP3A 2K9ZA 4ZU5A 2LROA 4Q4X3 2RMU1 4I30A 1PZ8A 4IE6A 3T0AA 2D7FA 3ZXEA 2WLPA 4CRQA 5FZEA 1GZWA 2BBVA 4XHXA 4YGBA 2JD4A 4E4ZA 1AXZA 2VZVA 3HJRA 2D44A 1QKQA 4Q4X2 3SH3A 1OVPA 3NWKA 2JXAA 3AXEA 4LBQA 1V9U3 3U10A 2BVVA 4QM9A 4K3UA 4D6RA 3U11A 4LA2A 3FLPA 1CIWA 4GJZA 1XNAA 3KV6A 4HLTA 5FY1A 4NHYA 5DUVA 2YFZA 4KH9A 5FUNA 4E4SA 1ZM1A 2QDRA 2VECA 4HG6B 4XEZA 5F32A 4AI0A 1V9U2 3W9AA 1AXKA 5CISA 3I3QA 4PF1A 4LMFA 2BQPA 3WW1A 1AX0A 4LIUA 3Q9OA 3ASIA 2W52A 4B1MA 3LGRA 2ZTNA 4JDMA 4LUMA 1H0BA 1AR83 4XMAA 3HQXA 5DN2A 2Y8KA 4F83A 4NIAA 4IE4A 5JSPA 2R061 5AFBA 2YHJA 4CCOA 2D6PA 1O59A 4OYUA 5DPNA 3VKMA 2ZX1A 4AFBA 2CV6A 4JX0A 4M3CB 2XGXA 2ZX0A 3GBFA 4QQOA 3KV5A 5F5IA 3Q8BA 1LHUA 2DDUA 4NHMA 3ZLIA 1ZZ6A 1AR82 3RYKA 4TLGA 2JICA 4I09A 4JC1A 3UV9A 2DUPA 1WCUA 4S2DA 2BUKA 5DUWA 1SHWB 4AHXA 2BDRA 5F37A 1BQPA 1FPN3 1QU0A 1AUYA 2HLEA 4JV4A 4FVVA 1YJKA 1RIRA 2ZKLA 3HQUA 5FWJA 4IEVA 4PIYA 3VBUC 1RC6A 2Y6FA 2IUWA 3U14A 2Y6GA 4IXLA 4N9HA 1JZ7A 5GLWA 1RUF3 2YGLA 1W6OA 1X82A 4RGGA 4B4RA 3BODA 3I3MA 1RUG1 4O9GA 1WCKA 2VZUA 2O8OA 3B01A 5FPAA 4A7KA 2KD7A 1YHFA 5BNNB 3O7OA 3M1HA 4QKBA 4BJ0A 1OOPB 5IK7A 2K46A 4CP0A 3NW4A 2GC3A 2XQRA 1VBE3 1A8MA 3ILFA 4PQQA 3FHQA 1VJ2A 1H8TA 3ZYHA 2ILMA 4HXCA 4MHUA 1I9RA 3RFRA 4D7TA 4NJ4A 4CUGA 5FO9B 2IFRA 3MHZA 1NZIA 1OQEA 2XJQA 1DQ1A 2GC2A 3HR9A 1VBE2 3PTYA 5C9AA 5KHKA 4JDNA 3U4XA 1G8WA 4WM8B 2ZGPA 4XUOA 3GZUC 2HWE3 4MG2A 1Y9QA 3G6JB 2GNTA 1FX5A 2JG9A 4GH4A 4TLFA 3ZDVA 2A1XA 1UY1A 1PO23 1UXZA 1IG3A 3BKZA 1MS0A 3N9LA 4GWIA 4DPNA 2OW4A 1HRV1 1T6GC 3KGLA 4AHYA 3BGAA 4LO8A 1ASJ3 2F4PA 4URAA 2HWE2 4L99A 3VKOA 5IVJA 1WBFA 4BCUA 4ARXA 3PMEA 4I02A 1PO22 5ABJC 2HWD1 1W90A 2PLV1 3FX3A 2BV4A 2E7QA 3SQOA 3NNJA 2QFEA 4YM0A 4RD7A 4XF0A 2FDFA 1HXS3 2ORXA 3KV4A 3MI8A 4PBPA 2OUHA 4CEYA 1ASJ2 4PHZA 1HX6A 1ZZ9A 4I0AA 3U4SA 4YZ1A 3E6CC 2YYOA 3BOPA 1NY71 4U36A 3V0AB 1G9AA 1GSLA 4IV3B 2JDYA 3IDCB 3LWCA 3OGJA 1PNGA 5A3UA 4QPIA 1HXS2 4W50A 2X5IA 5FMBA 5FZCA 5FZFA 3HT1A 1IPSA 4HK9A 5SV5A 3U07A 4AFCA 3PVBB 4IV1A 5FY8A 3E5QA 1SDWA 1G9DA 4QB2A 2C0ZA 3K3NA 2Y0IA 1UL9A 3K75B 1DGRA 3VBSC 5J36A 5FZ4A 4K1ZA 1MS5A 1I5PA 2ZGUA 4K20A 4BZ4A 1J58A 1S0GA 2R7EB 2WDBA 2I07B 1C5IA 3HMYA 2VMGA 3BTXA 4EV0A 5FUIA 1YFUA 4O65A 1QDCA 1JYWA 1LJ7A 2GMEA 2ZMKA 4GMP1 2BGPA 2BERA 2RR13 5KXEA 2ZXQA 4Z8BA 1QNWA 1BVP1 4CDUB 1S55A 1UAIA 5FOBB 4LPLA 1PK6C 1ENXA 4JVAA 1H2NA 4L8QA 4QXKA 4XAEA 3WNPA 2ERFA 3CBNA 1T2XA 3HT2A 5AC93 3CZUA 2CGNA 3LPGA 2RR12 3NJVA 2B4KA 3UJOA 3VBHB 3VZNA 4LT5A 1KRIA 4UWDA 4D7YA 3OB8A 1Z7S3 4NRQA 1GMMA 4QU1A 4YVWC 1PM7A 3GCXA 4XQWA 3VD5A 4AE2A 2QQIA 4YARA 2XJRA 5C3PA 4X6RB 1FAYA 1XYOA 2XKOA 4ISRA 1SFYA 1WA4A 1FOD3 3WNLA 5AC92 5FIXA 1UMZA 4AYUA 1Q8VA 1UNBA 1HIXA 2PTMA 5A7SA 3T1MA 4BQWA 1Z7S2 5A6YA 2W39A 2OPWA 5A3TA 3O0VA 2J1TA 1BEV3 2WT0A 4MGKE 1XSQA 1FOD2 3HD8B 2R0FA 1VAMA 1XNTA 4YW5A 2XL9A 3O12A 2OKXA 3ZYJB 5H9QA 2YBSA 3RZHA 2Y64A 5IVCA 2VUDA 4MX3A 3RGBA 3SCGA 4AWDA 3BOWA 3T0BA 3T08A 5JMCA 1BEV2 4NIDA 1MQTA 1HQNA 1QJU1 5EV7A 5ERLA 3WP3A 1A6CA 1C8NA 2LTNA 4Q4W1 3DF0A 1HB4A 3LB9A 4YGCA 3W5MA 1GOHA 4RR3C 2OQ6A 4ES8A 4LKFA 4XIOA 3EQEA 3MICA 3AVSA 4HKLA 2ZZJA 1RUI3 3FJSA 4R9DA 4LKDA 4QX2A 3KF5A 4W6XA 4N43B 3SC7X 3VHRA 2XDVA 4XFCA 4JKMA 4LK6A 1ZA4A 2WNUC 5FKBA 5FYYA 4ONUA 3GBWA 4P14A 1QHDA 1QY4A 2WNVA 2P37A 1RUI2 1SBFA 1EP0A 4LHKA 1GBGA 2Z5WA 3L9JT 4XJWA 4XC9A 1TE1B 5EZWA 4BLJA 3O1SA 1R1A2 3WP6A 2Y34A 4KG8A 2J1SA 1ZRDA 2Q8CA 4DEVA 4V2WA 4YW6A 2ZGTA 3UKVA 2GU9A 1MACA 4Y20B 1JZ4A 4M0HA 5C8CC 1JHNA 3PLQA 4K8RB 4NE9A 4YRDA 1LODA 5CG9A 2CDPA 2EVXA 4AGRA 2AREA 2WZEA 3JZVA 1JI6A 5L7OA 1W9SA 1OF3A 4XUQA 5JZGA 4W8JA 3ITQA 5LA2A 3ZSKA 1FV2A 4XIKA 5FYTA 3AZZA 4CCJA 2GNDA 3WDTA 2PXJA 5FBZA 5I8SA 2VMFA 5GZCA 3I2HA 1CAXA 3V65A 1YQ5A 4ZPIA 4ZS3A 1NCQC 1O6UA 1YRZA 5EYXA 1GKBA 2PQSA 5FZKA 1UD1A 1HJGA 3LIGA 3D6EA 1Z0HA 1XE8A 4YW1A 5ACA1 1AL0G 1PIV3 1NXMA 2UURA 1XYPA 3DCQA 5AVAA 3OBTA 1OH4A 4Q8LA 5FP3A 4AZZA 4S2FA 3ES1A 3H1WA 4LBQD 4B3NA 4WM7B 1GR3A 4RHV1 4MGYE 3S57A 4LHNA 1REDA 4RGAA 1GP5A 1PIV2 5L73A 4CDWC 4QPYA 2VCAA 4YVSB 2XXZA 1LOFC 3F2ZA 4LBNA 4R4XA 5CNAA 2XHNA 4HN0A 5JLVA 3OJBA 1SG3A 5B4XA 5IK8A 4JTOA 1RUOA 2XBO3 1F4HA 3S30A 2R043 2BFUS 2JKXA 3ZM8A 2WKKA 1JS9A 2XH6A 4MHRA 1YFWA 2I45A 3KHCA 1O4YA 1GOFA 3DPRC 2AR6A 2Q0AA 3AYCA 2WS93 3HBZA 2DV9A 3DYOA 3OF1A 4R4ZA 4ATEA 4CUAA 4KGQA 3CHXA 2VUAA 1VRH3 2XBO2 4RS5C 5FBJA 2HWF1 2R042 1EYBA 3D5OA 4DINB 4YNIA 2A3WA 1DGLA 4D7SA 3CJIC 5EYYA 4E4HA 1BJQA 2WS92
chains in the Genus database with same CATH topology
2DUOA 3C3VA 3S6PA 1VRH2 2E7AA 1Q8PA 4MLOA 3ZXKA 1LU1A 2DU0A 1LOAA 2D5HA 4M3CA 4AEDB 3TRSB 3M70A 3ROUA 4GA9A 1YI9A 4FP2A 3ZN4A 4FOYA 4YW3A 1EAH1 4OHYA 3MIFA 3RWNA 4B7KA 1MS4A 2ZGQA 1POV1 5JIUA 2DU1A 2EAAA 1XNBA 1OLQA 2Z69A 3ZYRA 1ZRFA 3H7JA 3WDVA 2WC2A 5K0UC 5J96B 3WW3A 3PJYA 4L92A 2GH8A 1ZRRA 3EBRA 4XDQA 1NXD1 1X33A 2O1QA 3AZYA 1ZBA1 5BNNA 5CFDC 1ZRCA 1OOPA 2HKXA 2CWMA 2XB6C 2RS31 2WFF3 4X6QB 4AQSA 1YI7A 4N7IA 1CR7A 2QCSB 4AHWA 1C8M3 3K51A 1O3SA 1CQ9A 1Q3EA 1VIWB 2HYKA 5CG8A 3BPZA 2WFF2 1SBDA 1C8M2 2PQQA 1NCRC 1VBC3 3KT4A 4WM8A 5DXDA 3ELNA 1PMIA 1DZQA 3P3NA 2YUEA 1ONAA 3LSDA 4YFWA 5BPXA 1R093 4UXAA 1NA1A 1VBC2 4FTBA 4KBBA 2B39A 2ES3A 3I4IA 3W59A 4Q0SA 3WNXA 4DMIA 1KJLA 5FAXA 1IPJA 1WMEA 4Q1PA 1DDLA 1R092 4BM8A 1AYN3 4ITCA 1DHKB 4KWKA 3H1MA 1YCIA 5JI9A 5JVVA 2ZPXA 4Q4X1 3V0AA 2MEV3 4LULA 4XF9A 1D0HA 4IV3A 2X8KA 2RHPA 3M8LA 1C1LA 4DNYA 2VW2A 1MS3A 4PDWC 3WT3A 4C1XA 4RQPC 3BALA 5LK5A 3AP9A 2R16A 2MEV2 2BNNA 4M3CE 3ZO0B 4B29A 1QOSA 1V9U1 4WBBA 2LALA 2VW0A 1ZZ8A 4AEMA 2P3KA 3VBOC 1X50A 5L36A 1RHI3 3A4UA 3H50A 4FOQA 2PN5A 2XLAA 3ZFGB 3DL3A 1QQP1 4EN0A 2PHUA 2B8MA 1MVQA 2A75A 2RS53 2OA2A 4HVOA 3VKNA 4OI4A 5C8WA 2E63A 5JWPA 3OGGA 1IPKA 2IFWA 3WG2A 2PHTA 3FFQA 1I1EA 1IS6A 1RHI2 2A6YA 4IEQA 5IT6A 1QXPA 2YMZA 4MYEA 3WX5A 5JI7A 3TN93 4CDUA 1PO13 1BKZA 2ZGNA 4RA0A 3ZSJA 4EWDA 2RS52 2AGSA 2Q30A 4FPEA 2V73A 2RM21 3MIGA 1S2BA 4HKWA 1MZ5A 4W6WA 5LEJA 3VBHA 1BXHA 4K21A 3TN92 1KFXL 1PO12 1Q8QA 2EIGA 1C57A 2VY0A 1DQ6A 4HPKB 3USSA 3VL9A 3INAA 5KBFA 1LHNA 1S0CA 1UZYA 3KM5A 3RI8A 2JECA 4GQ7A 4XXAA 3B93A 2VVEA 3C2UA 1Y7BA 3O0XA 4HFSA 4ASMB 3O14A 1OLRA 2XJSA 3MLLA 3WP4A 3TNQA 2ENRA 1QJY3 1DQ5A 1IS3A 4MH0E 4S2HA 4QGMA 3NKGA 4ASLA 1O5UA 3RRDA 4BE3A 1EV13 2VULA 4JGYB 2D6LX 1NYWA 3M2MA 1W39A 3CEWA 3I54A 1QJY2 4A2UA 4AQ6A 3AKPA 2ZHNA 4Q2FA 4KQ7A 1EV12 2ZABA 4B4QA 1RUH3 1Y43B 4Q0QA 1GZ9A 4LE3A 4GWNA 4DQAA 1RITA 4AFMA 3FWEA 4N43A 5E1RA 4KG0A 3JUUA 4QQLA 3APBA 1VBA3 4NVPA 2W0XA 3VLBB 2ZX2A 2HWE1 4BIFA 4YG6A 1WCSA 3D4KA 1VBD3 1RUH2 2ZGKA 3IWZA 3ZDSA 3AMHA 2JKBA 1V6JA 1U5IA 2ZBJA 2D3PA 5I91A 4E2SA 1H4HA 2ZCWA 5CFCC 3WLUA 1VBA2 3E6DA 1ASJ1 1B35B 1CJPA 1S0DA 3LSEA 3OD0A 4Y20A 1H8TC 1VBD2 4BPZA 1MS8A 4QPGB 1ULFA 1WW5A 2VNRA 1AR71 2XJVA 1F5FA 4CEWB 1HXS1 2DVGA 5DUUA 1AL23 3ZYIB 5C9AC 3N7JA 4GB33 4MSVA 3ZMNA 1FT9A 4GH4C 3L2YA 2VVFA 2GH2A 5CAZA 4C1WA 2R30A 4JRLA 3ZN6B 1AL22 1PHMA 4BYYA 2VOKA 2PHLA 4GB32 4Q4V2 2ET7A 4OHZA 3CJXA 4D94A 3NV1A 1HQLA 1L3JA 1SBEA 1OKQA 4DY5A 2VMIA 3GF6A 4WM7A 4PCRA 1AYM3 1LOGA 3LA2A 1LOEA 1GV9A 1VBB1 4IL7A 4G9SB 1LHVA 5KHJA 4CDXC 4CEYC 4YVSA 4CP1A 1W0PA 4QQ2A 3R4SA 4Q27A 1GZCA 4PQ9A 1MZ6A 1AYM2 4AI2A 3WDXA 4LLFA 1QOOA 4YFZA 4XILA 3VZOA 4QPIC 1KS4A 2JG8B 4RSUA 2X5IC 1D4M3 2RR11 1RUJ3 5T5OA 4AGVA 3I8TA 1NE4A 2PAEA 4IV1C 1O4ZA 5JOXA 4OHXA 5A33B 3VHOA 2Y26A 5F9TA 1D4VB 1CESA 4COZA 3H7YA 1DQ2A 5AC91 3ZFEC 3E5UA 2GC0A 1D4M2 1RUJ2 1ND2B 3ZFFB 4CDQB 5I0UA 2ZKNA 1WW4A 3FBYA 5DZGA 5KHGA 3SMHA 2WT2A 4FO9A 1OHFA 4XFFA 4E9KA 1OQ1A 1V70A 4MXVA 1YFYA 1V6MA 3WDWA 1SLAA 4P5HA 3A0KA 1VB2A 3WOGA 1Z78A 1I6XA 1S0IA 5T5LA 3TAYA 4BA6A 3ST7A 4ZKTB 2BNOA 1RUE1 2WSVA 2AZ5A 4AEDA 3THTA 3ENRA 3MIHA 3ZPYA 4Y1YA 3SLIA 4TWTA 1AXYA 3S0MA 2QKDA 3ZYGA 4COUA 1QH7A 4B8EA 3AK0A 1J1LA 4C0HA 2VOWA 1ALYA 4FPJA 4IETA 4NHLA 4TYSA 1FNZA 3GNEA 4PIXA 2DCYA 2ZAAA 1V6NA 4HZFA 4AI1A 1PK6B 4IEXA 1SCSA 1CVNA 4EN9B 3PVEA 2BWCA 5GLUA 3JD73 5GLZA 2ZGMA 3KCCA 4COYA 2WA3A 3JB4C 1R1A1 4YVWB 3PVOA 3IIAA 2Z79A 4CZSA 1F5JA 1BMV2 1MQTC 3JD72 4I01A 4EJRA 1FPN2 2VH9A 4Q1RA 4URTA 4XBLA 5DDJ3 2IC1A 3VBRB 4YG3A 3V56A 1GANA 3JB8A 5HXVA 1RUF2 1CJDA 1PZ7A 4XJUA 3E97A 3N7LA 4GWMA 1W6MA 5JDBA 3JBG1 1AR93 2VUJA 2DVFA 1YIFA 5BNOB 1D2QA 2XLGA 1CGPA 2WNVC 4BWOA 5C4WB 2MHFA 4K8FA 2B9UA 1VR3A 4A7ZA 3USUB 1LENA 3AMPA 1AR92 1PIV1 2V5YA 1AHSA 3V0BB 2ZS6B 2ZGSA 1RL3A 1C5HA 2BVBA 2QVSB 2FMYA 3WHUA 1J3QA 2FQPA 5L7OC 2BGCA 2A6VA 3RQ0A 1J59A 3CLPA 1UPIA 1ZYBA 2ATFA 4YZ3A 5JZGC 1TNRA 4LBJA 4LHLA 1VLNA 1QNYA 2WLQA 1ENQA 2XBO1 3ZXJA 4Q4Y3 1JUHA 4Y1UA 4HANA 1SEFA 4IEOA 5C8CB 2R49A 5FOJB 2WS91 2GMMA 4XZPA 2LM3A 3ZFGA 4MZUA 3H3UA 4Q4Y2 5FLJA 1JW6A 2UWCA 2CTVA 1F2NA 2WWSA 2E7TA 3DUIA 1NCQB 2D6NA 2W68A 3V64A 2YGMA 2YV8A 3PHMA 3MDPA 1XXNA 3MW3A 1LR5A 3SISA 3ZXLA 2MPFA 1JUIA 1DZTA 5D8AC 3MIEA 3LKJA 3RMYA 2VGDA 4E4DX 1G7YA 1JXNA 1KFUL 4IEPA 4OUSA 4P9YA 1XYNA 4HPKA 3VZJA 3WZ1A 2V09A 4IEYA 1QJX3 5FO8B 3ECQA 3A0NA 3VBFA 5JPMB 1A3KA 1WD4A 3H8UA 4A3XA 3H3ZA 2YROA 3RMXA 4CTEA 2UWBA 2QZ3A 3ZMOA 2ZHKA 2A73B 4JAAA 4FAHA 1QJX2 4NHKA 3SCHA 3POWA 1C4RA 2EXJA 4FPOB 2TBVA 3N7KA 4JDOA 5GLTA 4AGGA 3WR0A 1ZZBA 1S1AA 2RMU3 1D2SA 1FXZA 4AVVA 3AYEA 4JGYA 4FQ4A 1IKQA 3VHPA 3AP6A 5FO7B 2WFF1 3AYAA 3NV4A 1H1IA 4FPFA 5JIAA 4XE9A 1MEC1 2OVUA 1HRI3 4B7EA 4QGNA 2RMU2 4HVQA 4W6YA 1UU6A 2ZAHA 4LO7A 1CPMA 1HRI2 1VBC1 4YGEA 3BCWA 4P9JA 1DQ4A 5H9RA 2OZJA 2VOXA 2WA4A 4D69A 1DU3D 4F3JA 5BNNC 1NLSA 1OOPC 2CGOA 2QNKA 1LHWA 1ND3B 1B35A 2A6WA 1S0EA 4E2GA 4QPGA 4ATFA 2ZOEB 2R063 2I74A 1LHOA 2UU8A 3WDUA 2D43A 3IMNA 1AJOA 4CEWA 3LOIA 1CD3G 2WQ4A 4BMBA 4YM1A 3FHIB 4WM8C 1FYUA 1KDMA 1UIJA 5FREA 4AVCA 3AXDA 2MEV1 2R062 2Z42A 4I3GA 4ZU7A 4FT8A 5E8AA 1FMD1 4OI0A 1RINA 3ZN6A 3MGUA 1ZBE1 3M4FA 5F5QA 2QQPA 4ZU4A 3POSA 1NA1C 3FLRA 4XQDA 4PIZA 3OYWB 1RUC3 5CVRA 4XW3A 3KCXA 5EWSA 4EROA 5DZFA 1UCXA 3URFA 2A71A 4XYXA 1G9FA 3HAGA 4XFIA 1RHI1 2DUQA 4ORFA 1RUC2 3H9AA 4HMZA 3S7IA 4MUVA 2FHRA 2ZJCA 1OFSA 1DLLA 3G7DA 2ZMLA 4J1XA 2NLRA 4IV3C 2QDNA 1BK1A 1SLIA 4YM3A 3FLTA 2JG8A 3WG1A 1OA2A 1LGCA 2P3JA 3HIFA 1YNAA 5I93A 1PVC3 4J1WA 1V6OA 2OIIA 2R073 1W0OA 5A33A 4Z07A 1QXRA 1GFF2 1APNA 4AVSA 4O9EA 5JAXA 4R9CA 4L97A 3WQ7A 1ND2A 1PVC2 3ZFFA 4CDQA 2R072 2DCJA 3LA7A 4GXLA 1DGWA 5DUXA 2O0OA 1W6NB 3UK9A 1IS5A 1DG6A 2LUWA 3FZ3A 4PDWB 2SBAA 3ZXDA 3AFGA 3VDDB 5CU1A 3MZHA 1OA4A 4CDUC 2PLV3 4M3CF 2NMNA 4META 3WW2A 1TQ5A 4FQZA 3RNSA 1N3OA 4TZDA 2PA7A 2YC0A 4FBFA 4C90A 3VBHC 1RUNA 2RJKA 2VQ0A 4KU8A 1H1AA 3HWJA 2GZWA 1DQ0A 2PLV2 1C3HA 1EV11 5FLHA 1NE6A 2A6XA 3WW4A 2XJUA 2E51A 4XOGA 1NOVA 2GDFA 5F6LB 1YWKA 2UYAA 3B9IA 2ZZQA 2B5HA 3MYXA 5HCBA 1PK6A 3OBRA 5GLVA 4OUMA 1HLCA 1ZREA 5EJ3A 3RSJA 2GN3A 4Q29A 2D6MA 3DN7A 1IOAA 1X8EA 1R083 1VBA1 4YVWA 5C33A 3AJYA 1BBT1 4Y1ZA 4DRVA 4MVTA 3O0WA 1NLRA 4AXOA 5IK5A 1DBNA 1U5YA 4GMP3 2X29A 4BOWA 2G9FA 4IEUA 2GAUA 1R082 5KC6A 1YIPA 3VBRA 4P9XA 3NL1A 4AVBA 4Q0UA 1KDKA 2BTVC 4Y4YA 2YDEA 4QGLA 5F6KA 4GIQA 5GZEA 4FAGA 4OI2A 3WXPA 4N43C 1COV3 4Z2WA 4MGZE 5KXCA 2H0BA 4GB31 4Q4V1 1F8VA 5BNOA 1TMF1 2IWGB 2C1FA 5C4WA 3WG3A 2X53S 2OPKA 1RJ8A 3AJZA 4JGZB 1O5LA 3NAPB 4IESA 3USUA 4XJ9A 1COV2 4AVAA 2YPJA 3RJRA 3DGTA 3KZ4C 1CN1A 5BNPB 3V0BA 5T55A 4LEJA 2ET1A 3ZSEA 5BUVA 2CAVA 1LOCA 1VALA 2HWB3 2BW8A 2YZ4A 3EO6A 1S2KA 3NJZA 1ULGA 4F7ZA 4XJAA 3NKTA 2ZX4A 3K48A 4WZCA 1A78A 5J98B 3TNPB 3I7DA 2P3IA 1X36A 1LOBA 1NZCA 4Q4W3 2BEOA 1HV0A 2DCKA 1DF0A 2CL2A 5CFCB 2KA3A 3B00A 2HWB2 1CAUB 4P9IA 3KLSA 3R4DB 1RUJ1 1OPOA 4PLOA 5JSRA 5C8CA 3PJQA 4M0NA 2E53A 4S2GA 4Q4W2 3QBQA 3N7MA 2QUOA 1AYN2 2NN8A 3VZLA 2VXRA 2XKPA 1DYPA 4WM7C 3UJQA 1KQRA 3TWIA 4HT1T 4XTMA 3VUOA 3B9CA 3IBMA 1W2UA 4FPCA 2ZX3A 2VNOA 2VG9A 4HSLA 3R05A 2A7AA 4WVMB 2BYVE 4N53C 2XWBB 1NCQA 5CADA 1NQJA 3ES4A 1AR63 2NYYA 3FC0A 1BCXA 3KS7A 1N3QA 4UBHA 4YW2A 5J09A 1RB8G 2AENA 1CAVB 3B69A 3VGIA 2JE7A 1RVF3 3AZVA 3HN1A 5GZFA 1YFXA 2VW1A 2ZGOA 3ZXAC 1AR62 1QH6A 5T5PA 1CAWB 3J26N 2PHXA 1H30A 1REFA 1LRHA 4V1PA 5LRRA 4CDXB 2VMHA 4UW4A 1K5MB 3BIWE 1MVEA 3OPZA 2XHKA 1WD3A 3IT8A 4PLNA 1AR81 4FPHA 1RVF2 4EN6B 5CBLA 4H3WA 4YG0A 1KXGA 4H55A 4Y26A 4YZ5A 4K40A 4XETA 5FMOL 4XFAA 2WSUA 2WT1A 1Q8OA 2D3RA 2VU9A 1AZDA 3QD6A 1OD5A 2DYCA 3FUQA 4AEDC 4AVTA 3R0RA 1IQAA 2DFCA 5LRSA 1BMV1 1YJLA 1U12A 3ZFEB 1Q5OA 1WBLA 5JOYA 3ZX7A 1FPN1 1SLBA 1RUD3 2B7YA 2XLFA 2Y0OA 4FTSA 3EXUA 2EALA 4DZGA 3FMGA 2GALA 4BIOA 2YXSA 1OI6A 2D93A 1CPNA 2EXHA 1UU5A 1X8MA 1RUF1 3B5LB 4SBVA 1J1TA 4PJYA 1RUD2 4NPRA 1GQGA 4H7LA 5FFOC 2ETEA 3IDEA 5KWRA 4CP2A 1O4TA 3BTAA 1V6IA 3H0OA 1JBCA 2HWF3 4GULA 1VBE1 4L11A 3GBGA 5E89A 1I5ZA 1N47A 1CONA 1LECA 1AR91 4I2OA 1ND3A 3GHMA 4M01A 4NWWA 2R1BA 3SXWA 2DCZA 2CY6A 1E57A 2W08A 4FPYA 2Q1MA 3MLKA 4LUKA 4QQPA 5F1RA 1PGW2 4QU2A 4PF5A 1PGL2 1PO21 3CL1A 2RS13 1RJ7A 3MFCA 1ZX5A 5K7PA 1VAKA 3POYA 4WV8A 3IN9A 3VBUB 2B42B 3WV6A 1VP6A 1LEMA 3R4UA 3WCSA 2RS12 3PMSA 3RZZA 4I0BA 3OYWA 4F8AA 5K9YA 4AHZA 4FP3A 2FZ2A 1LGBA 4NWVA 1NG0A 1TME3 4D3WA 3FBMA 4XFHA 3D8CA 2JG9C 4M00A 2PHFA 1SLCA 1MR5A 3TYJA 2PYTA 3WHTA 1UN1A 1ZBA3 4NN0A 3WDYA 5T52A 4DXZA 1TME2 4LR4A 5HBAA 1ULDA 2DVAA 2RS33 1BVVA 2ZACA 4LBKA 1UIKA 4RL7A 3VV1A 1RMU3 1LKNA 1LU2A 4K7JA 4QHBA 2JEMA 1F31A 1KS5A 1JTZX 1SACA 1GLHA 1ZBA2 5E88A 3B94A 3ETQA 5IK4A 1TEIA 2E9QA 4BHPA 5LK7B 1O91A 4XBNA 2D3SA 2RS32 1H9WA 1W6QB 3JCIA 4UBGA 1RMU2 4Q0PA 4LBMA 4JCKA 1N1SA 1DIWA 1OQDA 2NPIA 4Y1VA 1W6NA 2XUMA 4QMAA 1QJX1 5ABJB 3OTFA 3UL2A 1KITA 2GNMA 2JX9A 4AW7A 3VDDA 4LO6B 2R1DA 1D0GA 2IZWA 2HJIA 2DURA 3BB6A 1S0FA 1Z7S1 2IXJA 1IHMA 1C1FA 2BWAA 1ZZ7A 4LO5B 3ZIWA 2IXKA 4X8NA 1FOD1 2GN7A 2HEYF 4XPVA 4WVVA 4L9BA 3H1YA 4JQRA 5FTTC 2JDZA 4HKOA 3PVNA 2B46X 3DKWA 3OCPA 2BNMA 1BEV1 3VBSB 4Y5Z0 1DFQA 3VBFC 1HRI1 3NO8A 5GZDA 5I0TA 5A32B 4OULA 1GNHA 2FZ1A 2WZR3 3SCFA 5D8AB 4Z82A 1AVBA 1OA3A 3ZSLA 3I59B 4HL0A 2D97A 4CYDA 1QQP3 4N7UA 3KD4A 4JTNA 3EHKA 2WZR2 2UY8A 1N1VA 4HK8A 3LA3A 5FRAA 3AKSA 3D0JA 4JGYC 3E5XA 1UKGA 1RUI1 3ZXFA 1QQP2 1IS4A 2PAKA 4K6BA 1MS1A 3KSCA 1W6PB 3MW2A 5C6CA 5J37A 2FBEA 2RM23 1TNFA 5GZGA 4G4FA 5GJ6A 3RYRA 3MF9A 5FMOS 4UW3A 4GMP0 5AVPA 5JOZA 2P2KA 2RM22 3KB5A 4XF4A 1SMVA 3R6SA 4JGZA 3NAPA 5J3UA 2H6CA 3FUOA 3T2TA 1LESA 4EWEA 2WL1A 1XNCA 4FOWA 1RUC1 4LO4B 1B35C 5BNPA 2FMDA 5DDJ2 3AKRA 1BYHA 3NV2A 2PHRA 4WZFA 4XTPA 4YM2A 5FQ0B 5H9PA 2NZ9A 2D6OX 5IUQA 4TSVA 2MNGA 4QPGC 3MIBA 3J8F3 1KD7A 3WD5A 3PNAA 5JCTA 3M3EA 3B02A 4MGIE 4CEWC 3J4UH 4EN7B 1QGLA 4INDA 4RR3B 3GALA 4HBNA 3RS6A 3AKQA 4NO4A 2WFPA 5KHIA 3J8F2 1UZZA 1S0BA 3ILNA 5CFCA 4DB5A 1GICA 1XE7A 1CAUA 2Z2SB 3ZIXA 2OYZA 2SLIA 4XJZA 5JSOA 1PVC1 4DY3A 2R071 4QM8A 2CYFA 2WNUB 3ILRA 2EAKA 1XNDA 2BFUL 1V00A 1FV3A 5T5JA 2R041 3ZYPA 2GMPA 2Y38A 3AMMA 4WVMA 4N9IA 2R6QA