1LULA

Db58, a legume lectin from dolichos biflorus
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
235
structure length
228
Chain Sequence
ADIQSFSFKNFSSFILQGDATVSSSKLRLTKVKGNGLPTLSSLGRAFYSSPIQIYDKSTGAVASWATSFTANIFAPNKSSSADGIAFALVPVGSEPKSNFLGVFDSDVYDNSAQTVAVEFDTFSNTWDPTSRHIGIDVNSIKSIRTASWGLANGQNAEILITYNAATSLLVASLVHPSRRTSYIVSERVDITNELPEYVSIGFSATTGLSYTETHDVLSWSFASKLPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lectin
molecule keywords LECTIN DB58
publication title Carbohydrate binding, quaternary structure and a novel hydrophobic binding site in two legume lectin oligomers from Dolichos biflorus.
pubmed doi rcsb
total genus 46
structure length 228
sequence length 235
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 1998-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1lulA00
4L8QA 5LK5A 3T1MA 5T5LA 1LU2A 4LBKA 1WLCA 1SFYA 3NV2A 4BOWA 1LGNA 3VUOA 1A8DA 3CNAA 1Z78A 1MS0A 2ZBJA 5DG2A 3WVJA 5KXDA 4YG6A 4AVVA 3M3CA 1V6IA 1AXKA 2E7TA 3R4UA 3HMYA 3POWA 1LU1A 2VXRA 1YIFA 2ZGMA 5T5JA 5T52A 4ZKTB 1A78A 2Q5TA 1SBDA 1IS3A 3SH3A 1FV3A 3M3QA 3O0WA 3WV6A 2EXIA 4BM8A 1SBEA 2RHPA 4Y22B 1JOJA 1SLTA 2A5ZA 1TEIA 1XQNA 2KM2A 2GMMA 4XILA 3NWKA 4RA0A 1PZ7A 2WNEA 1DGLA 1GKBA 5GLTA 2E53A 1CIWA 4XXPA 5JLVA 1U0AA 2FMDA 4PBOA 4K20A 5DUXA 2E6VA 2ZHNA 1S0JA 3B9CA 3PJQA 3IMNA 4FPEA 3U4XA 1QDOA 4DS0A 5E89A 1CVNA 1APNA 1Y7BA 4M3CF 4NOTA 1J1TA 2PELA 5HCAA 2E7QA 3IM0A 1LHWA 1UKGA 2D6KA 4GKXA 1G9FA 4LBLA 4ZXKA 5GZGA 4TZDA 1DQ0A 2DU0A 3D5OA 4Q2FA 4H55A 4YG3A 4XE9A 1W6MB 1WD3A 3A0NA 3AZVA 3FLTA 4FQZA 4ISQA 4CTEA 2FHRA 2CWMA 4FQ4A 3DUIA 4P9YA 1FV2A 5GM0A 2ZHMA 1WD4A 3B69A 4GWMA 4LBNA 3POSA 2GALA 1V6LA 1Q8QA 4XJZA 1MACA 3LCPA 5DUUA 3WNXA 4UW4A 5GZCA 2CTVA 2WKKA 2ZGRA 1SCRA 1YI7A 3MW4A 4DPNA 1C1FA 4XJ9A 3ZSJA 1MVQA 5FREA 4WVVA 2GDFA 1WW4A 2DVFA 2GNMA 4BMBA 3OPZA 3IPVA 2ES3A 2P3JA 2ZAAA 4YW5A 1G9BA 1W6PB 1OKQA 4FPKA 1N47A 4LBQD 3B3QE 2ZMNA 3WLUA 3ZSMA 1MZ6A 4FPOB 5JVVA 3QCWA 1S0EA 3NV3A 1LODA 3AYCA 3AX4A 1KJRA 4FP2A 2JDZA 4FPGA 3VV1A 5F9TA 1GBGA 4XTPA 4FPHA 1AX2A 1LOFC 4FPJA 1EPWA 1GZWB 1VLNA 2WT1A 1AXZA 1CN1A 4ATEA 4XBLA 5JDBA 1W6PA 4FOWA 4BQ1A 5IK7A 3UJQA 3WUDA 1SCSA 3VKFC 3Q9OA 1DQ5A 2LTNA 3ZYRA 2CNAA 3WDVA 2R0HA 3PVEA 1RINA 4PQ9A 2ZMKA 1DYKA 1S0DA 1AX1A 1D0HA 5DXDA 1MS4A 3N7JA 3ZYPA 1VAVA 1I3HA 4YM2A 2YZ4A 3RQ0A 1LULA 2EALA 1LHUA 2ZGTA 1KRIA 3M2MA 2D43A 3WG2A 1DYPA 4YZ1A 1QGLA 1MS8A 1LHOA 3OBTA 1LOGA 1QNWA 2EIGA 1W6NB 1DFQA 2YV8A 1A3KA 2A3WA 2PHWA 3WHUA 1V6MA 2UWCA 1S0BA 1AJOA 1UL9A 5IUQA 3WCSA 1MR5A 3OYWA 4YM1A 2D6NA 1BQPA 4P9WA 2D6MA 1H9PA 4IQPA 4XJUA 1G7YA 1N1VA 1ZM1A 2I2SA 4XYXA 4YFWA 3ZPYA 1QMJA 3HR9A 2DURA 1W6NA 2OUJA 5EYXA 3RG0A 2NYYA 3N3HA 4XTMA 5H9PA 4YG0A 3VKNA 2XG3A 4XJWA 3V0BA 4BLIA 2SBAA 3RRDA 4GXLA 2ZGOA 1V6NA 2NMNA 2D7FA 4DFSA 4M01A 1ONAA 5H9RA 3UK9A 2DTYA 1LOEA 1ZA4A 3ZVXA 2A6XA 4AVSA 1FYUA 2GNTA 4YZ2A 1VAMA 2P2KA 4DRRA 1MS5A 2NN8A 4YW2A 4YM3A 1MS9A 4HL0A 5DZGA 5EYYA 1N3OA 5FRAA 2G4IA 1FATA 1UZYA 2GNBA 1O4YA 1DHKB 5GALA 1F31A 2D6LX 3V0AA 1V6JA 4JRAA 3A0KA 3M1HA 1Q8PA 4ITCA 4AGGA 1LOFA 5IT6A 4YLZA 1UMZA 2WQZC 2D3SA 1W6OA 2DUOA 1GV9A 2GN7A 1LHNA 2C9AA 3TAYA 2P34A 3INAA 2E51A 5E8AA 2VW2A 3ZSLA 3ZXJA 2W39A 2XB6C 3SH4A 2EXKA 3UJOA 4Q1PA 1HQLA 2EXJA 2DUPA 3AYDA 4F83A 2D3PA 2PHXA 3SITA 4PBPA 1AJKA 2AREA 1SLIA 5SV8A 2NM1A 3BODA 4Q8KA 5JMCA 3OY8A 2H0BA 1S1AA 2SLIA 3TB0A 4Y1YA 1GNHA 1BJQA 1N3PA 2R1BA 2ZABA 3GNEA 1JYIA 5GLWA 1GZCA 1MVEA 2P3KA 2V73A 4LBOA 4PCRA 5DZEA 1PZ9A 2AR6A 4AWDA 5KXBA 1JW6A 1QOTA 4K1ZA 4M00A 1ULDA 3ILRA 2A6YA 3VKMA 2JJ6A 4OZXA 3AP7A 4BPZA 3FLPA 2A6WA 4XXAA 3RSJA 1Q56A 4ATFA 1WW7A 1DBNA 1LGCA 2WSVA 4LBQA 3RMYA 5H9QA 3SNMA 1HDKA 3IPVB 4FOVA 1G9AA 4YZ3A 3WDWA 4WZFA 4YM0A 1WLWA 2GMEA 4FVVA 1MS1A 2PHTA 2R49A 3O5SA 4UW6A 2CYFA 4XMIA 1KJLA 1RITA 2VH9A 1G9DA 4C1XA 1QOSA 2ZGUA 1YO8A 4TYSA 2UWBA 4ASMB 3I8TA 1IS6A 1ENSA 3APBA 5GLZA 2A75A 3AZZA 2HYKA 1GICA 1ENQA 4YZ5A 5T5OA 3V65A 3FUQA 3WHTA 1Q8SA 2VU9A 3GALA 2EAKA 2OW4A 3M3EA 4XHBA 4XMAA 1F9KA 2UURA 3C2UA 2VUAA 5DUVA 4LBJA 3WG1A 4YGDA 1IKQA 2CL2A 4FPCA 2AUYA 4ISRA 3FBYA 1KDKA 3H0OA 1V6KA 4Y1XA 3L2YA 2YROA 3N7KA 5EXOA 2LALA 3WDXA 2WSUA 3WDYA 1C57A 4DQAA 4XBQA 5CBLA 4FOQA 2CWSA 3OYWB 4XIKA 1URXA 1BXHA 5EWSA 4D69A 2R0FA 4XZPA 3ATGA 4YW3A 2AGSA 4XJAA 4PF5A 1LEDA 2W52A 3I4IA 2NP0A 1GYKA 2A3YA 2VW1A 1QU0A 2TEPA 3NV4A 1WW6A 3POYA 4Y20B 2ZZJA 3WDTA 2EXHA 4M3CA 4AVTA 2W08A 3V0BB 3BIWE 4YGEA 1KDMA 4HANA 1CPNA 1BKZA 2GMPA 3IKWA 3PVOA 1H30A 1QNYA 1SLLA 1ULEA 4K21A 3ZSKA 1H9WA 2ERFA 4UW5A 4BMEA 1IKPA 3OGGA 1B09A 1S0FA 3T2TA 3VKLA 2A71A 5GZFA 2A6ZA 4Y20A 2ZGLA 3PMEA 1YRZA 4XBNA 3FFZA 2PHUA 4WVWA 3O0VA 5CAZA 2UU8A 5IK5A 1DQ1A 3WOGA 1LHVA 1UPSA 4AGRA 2ZKNA 2DVAA 1N1YA 2A7AA 5T5PA 1VALA 4CRQA 1LESA 3V0AB 1ULCA 1DQ4A 3LSDA 2R16A 2YMZA 2ZMLA 4LBMA 1ENRA 1I1EA 3USUA 1DQ6A 1JN2P 1JYCA 2EF6A 2GN3A 3D4KA 4Y1ZA 2WT0A 1W6QA 2JE7A 2PHFA 1W6OB 1W0PA 5GLVA 2CY6A 5BYNA 1FAYA 3AYEA 3N7LA 4XJ8A 1V6OA 2ARXA 3AP5A 4U36A 4UW3A 4C1WA 2B7YA 4KBBA 1ULFA 1OFSA 1LENA 3RMXA 4FPFA 4M3CE 1HQWA 4K1YA 1OQ1A 2PHRA 3OY8B 2OUHA 2R1DA 3O12A 3SH5A 1SBFA 5KXCA 2VY0A 2C5DA 1AZDA 5GZEA 3AZYA 3NV1A 1CJPA 1GANA 3BTAA 4YGCA 3B00A 4CZSA 2JD4A 1O4ZA 1DIWA 1QOOA 1WCSA 2ZA9A 2DVBA 3DGTA 3W59A 5JOXA 3AYAA 1NXD1 4DRVA 5DG1A 1R1ZA 5E88A 1JBCA 4Q8LA 2ZGSA 3ZXKA 4Z8BA 4Y1UA 4WV8A 4R9BA 4Q26A 4LBQB 3AZWA 5CNAA 5GLUA 3V64A 1HLCA 5IK8A 1AXYA 1WBLA 2WT2A 4Y1VA 4YGBA 3ILNA 2YY1A 4R9CA 2Z42A 2AH2A 1WBFA 3B01A 3WG3A 1G86A 4GA9A 3R4SA 4Y26A 5JOWA 1D2SA 1W0OA 4XIOA 1LOBA 1DLLA 2W68A 4XHXA 4Y22A 2DYCA 1MS3A 2ZHKA 1JHNA 2JECA 1FNZA 1FX5A 3HN1A 4MYEA 4Q1RA 1F5FA 3N35A 1QDCA 5T54A 5T55A 2DU1A 3QLQA 3AXEA 4XOGA 3OBRA 3ILFA 4GWNA 3FUOA 3WCRA 4FOYA 1LECA 3AK0A 2ZGQA 1QKQA 3MW3A 2ENRA 3UL2A 2DVGA 1JUIA 3KQRA 1CONA 1IS4A 3AXDA 1SLAA 1GLHA 1GNZA 1UZZA 3IN9A 5KXEA 2DV9A 4AYUA 4Q27A 1IOAA 2NZ9A 1S0IA 1N1SA 1W6MA 2DWRA 1CESA 2DUQA 5F5QA 2BQPA 2ARBA 3M3OA 3W58A 2JE9A 4FP3A 1S0CA 2DTWA 2UWAA 4Y24A 1VIWB 1CQ9A 1KQRA 3MEPA 3MPPG 1N3QA 1MZ5A 1UX6A 4JCKA 1X50A 1LGBA 1SLCA 2D6PA 4FPLA 4U2AA 4W65A 2D44A 2ZGKA 3AJZA 1LOAA 1NLSA 1YXWA 2JKBA 4I30A 3AP6A 2A3XA 4YZ4A 2ZACA 3SLIA 1AVBA 4JC1A 5DUWA 3D6EA 3WZ1A 1UN1A 3KM5A 1HKDA 1V00A 1LCLA 3RS6A 3VKOA 5GZDA 3BOPA 3AFKA 3JUUA 4M3CB 4GKYA 2GNDA 3AZXA 5CB7A 3O0XA 5HCBA 1AX0A 2AYHA 1ULGA 1LOCA 2OVUA 1QF3A 1Z0HA 1Q8VA 5IK4A 1WLDA 1N1TA 1GSLA 3AP4A 2ZGNA 2NMOA 1G8WA 1SACA 3JU9A 1PZ8A 3LSEA 1WW5A 3SISA 4NO4A 1BZWA 1BYHA 2P3IA 5JOYA 3FLRA 1GZWA 1LJ7A 5HCFA 1CR7A 5L73A 3MW2A 3R05A 3PVNA 2WLQA 1SLBA 4XDQA 4FPYA 3A4UA 1C1LA 2D6OX 4GALA 3WUCA 1FNYA 1G9CA 4P9XA 3ENRA 4R9DA 1IS5A 3AP9A 3OJBA 5H9SA 3USUB 4P14A 1JXNA 5DZFA 2ZGPA 1C4RA 2A6VA 1W6QB 2P37A 1RIRA 3ZXLA 1DZQA 5GJ6A 3ZXEA 3ASIA 3ZXFA 2AENA 1AF9A 2VW0A 1LTEA 1WUVA 1UAIA 1CPMA 3N36A 4YW4A 1S0GA 3WG4A 5T50A 1DQ2A 2WJSA 3N7MA 5JOZA 4YW1A 3T1LA 2YXSA 2ZHLA 3WDUA 4AGVA 2V5YA 3AJYA 2D3RA 2A70A 4SLIA 1LEMA 4RL7A 4YFZA 1YYNA 5CA6A 4R9AA 4BLJA 5AVAA 1GZ9A 2DVDA 1KITA 1Q8OA
chains in the Genus database with same CATH superfamily
5LK5A 1L7LA 3T1MA 1RUNA 4LBKA 4LE3A 1H2LA 3ZFGB 4BOWA 5FBZA 1DCSA 5FKCA 5KXDA 1Z78A 1MS0A 5A6ZA 3IAPA 1BK0A 4A7ZA 3J7LA 1V6IA 3HQXA 5FZ8A 5AC93 5JZGB 4BK4A 3NQHA 3SC7X 2VCMA 3R4UA 2JDPA 3NNGA 4DNYA 3WY6A 5A7QA 3WW2A 5C4WC 4ZKTB 4MXVA 1GU3A 4CA9A 1IS3A 1ZBA2 2W1QA 5FUNA 3UGFA 1FV3A 4NUBA 3O0WA 3CQOA 1QJY2 2EXIA 1OUSA 1W8TA 4BQWA 2XQXA 5JWPA 4OHXA 3TN92 1JOJA 1SLTA 2A5ZA 2WFPA 1RHI2 1OH3A 1VPHA 3AMHA 1XQNA 3ZMNA 4TTGA 1Z7S3 4ASLA 1M06G 3DF0A 3VZKA 4GMP1 1GR3A 1NA1C 1DGLA 5JLVA 1HXS2 1CIWA 1HN1A 2E53A 3P3PA 2FMDA 3RVHA 3RZZA 4K20A 4E2QA 3B93A 4I0WB 2ZHNA 2Q1MA 3NKTA 3CJIC 3WP6A 3AC0A 3WNKA 2ZX2A 1RUF2 2AEZA 3IT8A 1MZEA 1QDOA 1RVF1 2LM3A 3MFCA 2BBAA 3B02A 1EPZA 1O3RA 4NHLA 1PX4A 1RUD2 2YPJA 1TMF2 1J1TA 1JUHA 4GWIA 4LJHA 1O8SA 1G9FA 3LDKA 4ZXKA 2EAAA 2G9GA 3M8LA 4B29A 1DQ0A 1NLQA 4FSJA 4H55A 4YG3A 5L7OA 2ILMA 1NXMA 3AZVA 1CZVA 2CWMA 4FQ4A 1CIYA 1OA3A 3FC0A 1S2BA 1UYZA 5F32A 5LBBA 4DEQA 1D4VB 3X29B 3K4AA 3PMSA 4PDWC 4BHPA 5C3OA 2ZHMA 3DYOA 5FPXA 5J48A 1WD4A 4HPKA 2HYXA 5TSWA 2GALA 4CDQC 2RS53 3WNXA 4CXWA 1POV3 3DPRA 2ZEWA 4NAOA 2JDKA 1STMA 4H7MA 1BVVA 1MVQA 4NRMA 2JB4A 1DGWA 5FREA 3ZO0B 1NE6A 1W8HA 1O6UA 2PLV3 1OOPB 3LD8A 3ZSEA 3OPZA 4B7EA 2FZ1A 1RUI2 2HLEA 4YW5A 2ZAAA 1G9BA 4R8HA 3LQCA 1RJ7A 3RJ2X 1ODNA 3B3QE 2QDNA 4LKEA 5JVVA 1XPWA 3NV3A 3O1VA 5F9TA 4FPGA 2XWBB 5FQ0A 1AR71 1R64A 1F8VA 4AQTA 1VRBA 2WWSA 5HV0A 3Q8BA 2GC0A 1UO9A 3GZUC 2JWPA 4FPJA 1EPWA 1VLNA 4F8AA 3CJXA 5FDBA 1CN1A 5C4WA 5FP8A 1ODMA 2XJQA 2QQPA 3PVBB 2B9UA 1SCSA 1GP6A 2ORZA 3Q9OA 3ZYRA 3ZIXA 4Z1VA 4WVMB 2XWJB 1ST8A 4Q4X3 4PQ9A 4QX5A 1CZSA 3C7EA 3HBZA 4NR1A 4QB2A 1DYKA 1S0DA 3LEMA 4AQ2A 1QJU1 1OVPA 5I0UA 3AB0A 4NRPA 3RQ0A 2EALA 3DN7A 4W6XA 5F6KA 3I3MA 5LW9A 3KT1A 3ZN4A 3ETPA 3RWNA 3L9JT 4A41A 4I3GA 4WM7B 1OMIA 2QQJA 4YZ1A 1KGYA 4OZOA 1LHOA 3N9QA 1QNWA 5JI9A 1HRV2 5FP7A 2XPJA 1HV1A 5T3NA 3PNAA 4INDA 3KCYA 4ZONA 4B4PA 2A3WA 2PHWA 4Q0VA 5JXJA 5K7PA 5FJKA 4XFBA 3T2PA 2R062 3UKVA 1UL9A 1ZBA1 1UOFA 3I59B 1BQPA 3GBGA 4BQYA 2D6MA 3ME2A 4IQPA 2ZEYA 3UV9A 4E9KA 4LTAA 1OBNA 1QJY1 1JOBA 2HWD3 3ZPYA 5FPBA 3ES1A 1JZ2A 1XSQA 3NW4A 2W91A 4IEXA 4PDWA 1MEC3 2WYSA 2NYYA 2QQLA 4XTMA 3RG0A 1W2OA 2X5IB 4YG0A 3THDA 4OHWA 4CDQA 3FE5A 4BLIA 3RRDA 2G9ZA 1HXS1 2W3JA 3PUQA 4R52A 1HRI3 1YJKA 2D7FA 4AOCA 5FYSA 3UK9A 3KWVA 4IEWA 1J3QA 1LOEA 1NX9A 5K9YA 4I01A 1UU5A 2D5FA 3AM2A 3NNMA 4HK9A 5LK7B 2BDRA 3FZ3A 4IERA 2RMU2 2NN8A 1TMF1 2IVIB 3CF6E 3ST7A 4D6QA 1EV13 3AMMA 5CKQA 3BPSA 5BNPA 2VMEA 3ABZA 5G04L 1K42A 3KT7A 3Q8FA 4CU9A 4JRAA 4FFHA 4ES9A 1Q8PA 5CU1A 4YNIA 1O3TA 3D82A 4KU8A 1RVF3 1UMZA 2WQZC 5EFUA 1W6OA 1C8M1 2G19A 3TAYA 2XOMA 4AXOA 1NE4A 3S57A 5APAA 1W06A 4GULA 2RS12 3SH4A 1FMD1 4HT1T 4OI4A 2EICA 2WNUC 1HQLA 2EXJA 1PMJX 4Q1PA 1X7NA 4BQ5A 3JD72 5C6CA 1AJKA 1OH4A 2NM1A 5BNQA 4NHXA 2X53S 1I9RA 1VB4A 2H0BA 4F3JA 1PO13 1EAH3 2SLIA 4UBGA 3TB0A 3VDCA 3WP5A 3H3UA 5FYHA 1GNHA 2R1BA 4CPBA 4XURA 4XFHA 5HI0A 5GLWA 4DY3A 1GZCA 2P3KA 3NAPC 3N9OA 4UAPA 3THTA 1JW6A 4QDQA 4G4FA 3OGJA 2GU9A 4EYUA 1ULDA 1AYN3 3BI3A 1W05A 2E9QA 4QPGC 2BPA2 2VNGA 2VUJA 5EJ3A 2CGPA 2XLGA 2WSVA 1OLMA 2LS6A 2WC2A 3MUZ1 4FFIA 4GAZA 1HDKA 3AMPA 4HN1A 1C28A 1PM7A 4YVSC 4EWAA 5CFDB 1G9AA 3VBHA 1YQCA 4XFAA 4A6SA 4I0AA 3WDWA 1W39A 4XZUG 3RYPA 3VZLA 4LO4B 2HWB3 3C7HA 1SFNA 2QJVA 3MIGA 4ARYA 3H3ZA 4ES8A 3ZFFB 2PHTA 2CYFA 4XMIA 1KJLA 1OKOA 4C1XA 1YUDA 2WAOA 4MO3M 4D94A 4NIGA 2EIEA 2UY8A 2RJ2A 1PIV2 4QXBA 3AZZA 3OCPA 1NT0A 2UYBA 4MXWA 3WR0A 4E2SA 3V65A 1KS4A 1PX3A 3WHTA 1QH7A 3OUJA 3GALA 3M3EA 1F9KA 4MG2A 4Y5SA 3ZMOA 2R061 1RUH1 1W9TA 3ZYBA 1DGWX 3KQ4B 4N9HA 2QQWA 1XRUA 3I2FA 3I3EA 3PUSA 1WLTA 4ISRA 5FMBA 2Y6GA 3IAQA 3FBYA 1OA2A 1CX4A 3ZFGC 4IXLA 3PJYA 3MV11 2BNMA 3AKRA 3L2YA 2YROA 3A21A 5LY2A 1DDLA 5EXOA 2LALA 5KR7A 3WDYA 1C57A 4DY5A 1FI2A 1US3A 2BRTA 3IIIA 2CWSA 1X9TA 1COV2 1URXA 3MGUA 4FOQA 4J1WA 4K6BA 4D69A 1CX1A 3P6BA 2W46A 5FCCA 5LCWL 4XUNA 1LEDA 5LZ6A 3TN93 2E26A 1ZRCA 5HBAA 3P3NA 1RHI3 2OT7A 3KS7A 3BKZA 3ES4A 2RMU1 2JG8A 1XE0A 3NAPA 2JEMA 2Q4SA 2W1SA 4YGEA 3V0BB 2R32A 1CPNA 3RFRA 2GMPA 2XJTA 1SLLA 4XFGA 4B4QA 3RDIA 4QPGA 2ERFA 4UW5A 4BMEA 4XC9A 2WABA 1FPN2 1FOD2 1S0FA 4RHV3 3LE0A 1RUF3 3J4UH 5GKAC 4E8CA 4YVSA 3O0VA 5CAZA 2UU8A 3ITQA 1RUD3 4RSUA 3MUY1 2F4PA 4IE5A 1CAXB 1I6XA 2Y38A 2JDAA 2RS11 3LFMA 5FZAA 5IHRA 5IK5A 1DQ1A 2B45X 4A45A 1DZRA 3JD71 2DVAA 2A7AA 5T5PA 4C90A 3LSDA 1BBT1 2R16A 3BTXA 2HH9A 2ZMLA 3MLJA 4QM9A 1XNTA 2EF6A 1PGL1 1UF2C 1UYYA 4XCBA 1W6QA 2IVJA 2PHFA 5BV6A 4GMP0 2CY6A 5BYNA 3AYEA 4P02B 1V6OA 1UY0A 4P9LA 1KD7A 3JB4C 2O0OA 2VO5A 4FPFA 3MHZA 1S55A 1BCXA 3FHAA 2PHRA 3O12A 2YGLA 1SBFA 5KXCA 4GB32 1RUI3 2XJPA 1K3IA 2W1UA 4Q0QA 3A22A 3B00A 4CZSA 2JD4A 2XR4A 3AKQA 2ZA9A 1JYTA 1OOPC 2DVBA 2IZWA 4AFMA 4BXFA 3W59A 4S2GA 4Q4Y2 1NXD1 1VR3A 3I2JA 1VBC3 2WWJA 2WIIB 3KZ4C 3ZFGA 4CDWB 5IVBA 1R1ZA 5JXIA 2PA7A 1KFXL 4IGQA 3NRUA 4Q8LA 3ZXKA 3DXTA 3WX5A 3J8F2 4R9BA 5JZGA 1VB2A 3MIDA 1HLCA 5FZEA 5GLUA 3VZOA 1UOBA 3E5UA 3LAGA 4RGGA 5FBJA 3N4MA 4XDOA 1H0BA 1PIV1 1WMEA 5FZMA 5JR7B 2YY1A 3B9IA 4KG0A 3PHMA 5FZBA 1G86A 4LULA 4Y26A 5JOWA 1ZVFA 4MHUA 1H2NA 2W1WA 5JCTA 4XHXA 5FZFA 3VBSB 2YBPA 5C3RA 2VMCA 3U75A 4LO5B 4MYEA 3K4ZA 1F5FA 2NLRA 3EYPA 2ZEXA 4IE4A 3H1MA 4N9IA 1O7FA 5EV7A 5FUPA 5FWEA 2VUDA 2GZWA 4GH4B 3IMMA 3OBRA 3T0DA 2Y0IA 1HRV3 3FUOA 3FWEA 4D0QA 2A73B 5IVJA 4FOYA 3AK0A 4NHMA 4WM7C 2C1FA 1CONA 2YC2A 2Y6FA 1SLAA 3H3LA 1O91A 4JTNA 1JU3A 1TNFA 1V0AA 5KHGA 1BMV2 1F15A 2HWF2 2NZ9A 1E5HA 1HB3A 1S0IA 3TNQA 2WNVB 5IVVA 1QJFA 1A6CA 3RZGA 3OBZA 2G9FA 3SCGA 2P17A 5F5QA 3KB5A 4HXCA 4XQWA 2KXLA 3I3BA 3HEIA 4Y24A 5EJZB 3ZYHA 3KHBA 1MZ5A 3BB6A 1SLCA 2JG9B 1KEXA 4NE9A 2JENA 2YG0A 3MLKA 4Q29A 1VBB2 3LEGA 4W65A 3WT3A 1LR5A 1QY4A 1YXWA 2X5IC 5F3IA 1TE1B 4I30A 2HWE2 1RC6A 5JIUA 3EBRA 2ZACA 3SLIA 1GWLA 3WNNA 1FOD1 5LBCA 3D6EA 4NAMA 1UOGA 1LNSA 2VOTA 3RS6A 3DXUA 3JB8A 2HEVF 3IDBB 3ON7A 1VAKA 4JHZA 3SHRA 4AHXA 4D3WA 4GKYA 1OOPA 4LO6B 3F2ZA 2Y8KA 2AYHA 2KA3A 4LHLA 5A32B 2ID4A 4YPJA 1Q8VA 3E1F1 4MGQA 3RI9A 2JDYA 3VBRB 4QDRA 3AP4A 3VN4A 1XNBA 2RE9A 4CE8A 2GAUA 3TWIA 3Q8AA 3SEPA 1AR81 1XYNA 1UXXX 3FLRA 3T2OA 5HCFA 1CR7A 4BJ0A 1NG0A 2QFEA 3ZDVA 4XDQA 4CUCA 4GALA 3WEZA 5A6QA 1FNYA 1G9CA 3WSOA 4P9XA 4R9DA 4AQ6A 3VD9A 3VHOA 2GC2A 1AL22 4P14A 2QZ3A 4GB31 1C4RA 1UW8A 2BZDA 3TRSB 1RUE3 1U5IA 3DYPA 1AHSA 4KGQA 3N36A 3KD4A 4M4RA 1S0GA 3WG4A 5T50A 2IXLA 3ZN5A 1AR93 5A1FA 1DQ2A 2QKDA 4NWWA 1GQGA 5JSRA 5FTTC 1IPKA 2DCYA 1OVSA 2C9KA 3LGRA 3ZFEB 3AJYA 4WM7A 2A70A 3OB8A 4SLIA 2AEYA 1LEMA 3FJSA 3MF9A 4RL7A 3WXPA 1YYNA 3J8F1 2ZAHA 3U10A 1EUUA 1TZOA 5AVAA 4COVA 3GM8A 5CA6A 1GWMA 2DVDA 2XQRA 1KITA 4FO9A 4FTBA 5FLJA 1UIKA 2ZOEB 4L8QA 1QQP1 1VP6A 1H2MA 1SFYA 5CFDC 2D98A 5C8CB 3ACLA 3I59A 3NNJA 5C3QA 2YPDA 3NV2A 3VUOA 2ZBJA 3WVJA 5FXXA 1G6NA 5DDJ2 1XC6A 1SEFA 1W2UA 5FY9A 5D1IA 2VQUA 1AXKA 3T2QA 2X5IA 3ZFFC 4QQLA 1LU1A 2VXRA 1K5MB 4O7XA 1W9SA 3AKSA 5FP9A 4A3XA 5T52A 1PIV3 5A7OA 1ENXA 3I2IA 3VDAA 4LA3A 3H9AA 4COWA 1GQHA 3CEWA 3ZKUA 3OTFA 3WV6A 2XXZA 4CCMA 4BIOA 3CDZB 1SBEA 1TME3 3DECA 4AVAA 2ZEZA 4NHYA 1TEIA 4CVUA 3HNBM 4EN0A 1RB8G 4BH9A 2CDPA 2WFF3 4UWDA 1OI6A 1WCKA 2VBBA 4XILA 3NWKA 2WYFA 4P5YA 4X8PA 2HWF1 5I0SA 1BMV1 5GLTA 1GKBA 4PLMA 2BNNA 2BGPA 2VGDA 3HT1A 2VULA 4HG6B 4PBOA 5DUXA 5CKNA 2VBDA 3B9CA 3HD8B 3PJQA 3IZOA 4L9BA 4D8MA 3AL5A 1UIJA 3EHKA 4DS0A 2Z79A 3KLSA 3UETA 1Y7BA 1XE7A 1RYYA 4M3CF 4XEZA 5FZCA 4BK5A 1COV3 1NYWA 2D6KA 3RZLA 4AK3A 5LWBA 3VZMA 4JTOA 1WD3A 3GHNA 3A0NA 3C7GA 4QDSA 5B4XA 5DQ0A 4CTEA 1OA4A 4N43B 5FZ9A 4W50A 4P9YA 4AVBA 1XJAA 2W87A 4IEQA 2GP5A 3OOXA 1JHJA 1WMDA 4XF1A 5D8AA 3KGLA 2VOKA 3B69A 5KHHA 4LOSA 5I8YA 1V6LA 1Q8QA 2V5DA 2VQ0A 4OCTA 1FPN3 5DUUA 5FZ4A 4UW4A 3NL1A 5GZCA 1FXZA 2CTVA 2ZGRA 1SCRA 1YI7A 2BGCA 4LHKA 4O61A 2VE1A 1AR62 2B9VA 5FZDA 3WQ0A 1NY72 1XB9A 4MGKE 2WO3A 3K3NA 4QQOA 5CFDA 2ES3A 1QJEA 4JVAA 1ZZ9A 1OKQA 1SPPB 1ND2B 4WZCA 3T3YA 4LBQD 3WLUA 3H8XA 3ZSMA 1K45A 1MZ6A 3QCWA 5F5AA 1S0EA 1LODA 4L92A 2V72A 4TLGA 1AL21 2JDZA 3VV1A 1JI6A 4IEUA 1ZA7A 1W0NA 2VMIA 4XTPA 5J36A 2V4VA 1Y9MA 1NCQB 1AX2A 4OFGA 3TYJA 2WT1A 1AXZA 4Q4V2 1SDWA 3VBUB 5A1LA 1W6PA 3I2GA 3ZYIB 4BIFA 1NQJA 1PVC3 5D2AA 4JZRA 3WUDA 3GBWA 3VBOB 3OUHA 4W8JA 4QQ2A 3WD5A 3LA3A 3MIBA 2R0HA 3I2DA 3PVEA 2ZMKA 1AX1A 3NJXA 4HSLA 4JGYC 2VNRA 4PT6A 1HJFA 3N7JA 2RG4A 2VZSA 1Y9GA 4W4ZA 3ZXGA 4COUA 1VAVA 5A3MA 3W5NA 1RMU2 3OF1A 4Q4Y3 4QX7A 1LHUA 2LW8A 2ZGTA 5C3PA 4YRDA 5IYYA 1KRIA 2X8KA 1ACCA 4IEZA 1Y9QA 2Y6LA 3WG2A 4IE6A 2VD7A 4O9GA 5DDJ1 4CDWC 5FWJA 3DL3A 1XNCA 3BTYA 1W6NB 1PHMA 3WNLA 4CDUB 2AC1A 1V6MA 4JGZB 5FP4A 1S0BA 3HPNA 5F3GA 3K4DA 2CSGA 2W9XA 4YM1A 4CDXB 2D97A 2D6NA 5A6XA 2DCZA 1H9PA 4XJUA 1ZM1A 4XYXA 4YFWA 1CAUB 3VL8A 4J25A 2JDUA 4D7SA 1JYXA 2WO2A 1BLZA 1ZRIA 4LK7A 3DEMA 5EYXA 2ZXQA 4Q4W2 1UD1A 1QJU2 1F5JA 3NKGA 3KF3A 4UFLA 4N53B 2HWC3 3V0BA 1W90A 3RPQA 3KF5A 1DU3D 1W8OA 3VBSC 5G05L 1TQ5A 4OUMA 2WQ4A 1V6NA 1VBD2 4YW6A 4DFSA 4M01A 5IFTA 5FZKA 2DTYA 3LA2A 4XABA 5FMDA 3HIFA 4KWLA 4OUEA 4GH4C 1RXFA 5IVEA 4PI0A 2GNTA 1J83A 5JSOA 2P2KA 4OQ8A 1VBA1 4DRRA 3POIA 4DIQA 5HV4A 2ADEA 1CAXA 2CAUA 5DZGA 4A42A 1Q3EA 1ZREA 3ZPOA 1UZYA 1GUIA 5GALA 2WS92 3ZXDA 1F31A 4QGLA 3VL9A 4ZU4A 3A0KA 1L7QA 4ITCA 2Q30A 2WNVC 2ZJCA 3UGGA 4AI1A 4I09A 1XYPA 4ONUA 5IT6A 4QPWA 2DUOA 2ZCWA 2GN7A 1RUC3 1VBB3 2ARCA 2RDNA 4K3UA 4KQ7A 2E51A 4LUMA 1Y3TA 1QJX3 1PVXA 3M7AA 1BK1A 3MI8A 4UBHA 3ZXJA 2HWE3 2EXKA 4NPLA 1CAWB 2JG9C 4FT8A 3MZHA 2FDGA 3LOBA 1BEV3 1T6BX 2D3PA 2PHXA 2CGOA 2AREA 3JBG3 1SLIA 1AR61 4CCLA 5ANQA 4AEDA 1W9YA 4URAA 4P9GA 2VPVA 2X10A 2PAKA 2VOVA 4Y1YA 4BWOA 1NY71 1HB4A 3DKQA 4IDZA 2PHDA 2V73A 4PCRA 4LBOA 5DZEA 3V56A 2K9ZA 3USSA 1R092 1QOTA 1RUJ2 1SG3A 3MFAA 5CISA 2D93A 4GWJA 4Y5Z0 3Q8CA 4CDWA 5JSPA 1ZRFA 4BPZA 1J58A 3VBRC 4ZZ5A 1OF4A 1UZ0A 3RSJA 1Q56A 4LO8A 1X8EA 1WW7A 1C8M2 1DBNA 1LGCA 4RR3B 5FPLA 4Q4V1 5FZ6A 3RYRA 5H9QA 5A3PA 3IPVB 1RUG2 1S2KA 4JHTA 1UX7A 1FMD2 2GH2A 5HCHA 1HN0A 2FDJA 4YZ3A 2GC3A 4MLOA 5LA2A 4AG4A 4A7KA 5A33B 4L2NA 4OHZA 4A4AA 4CP9B 1WLWA 1HB2A 3TEWA 3Q8EA 1F4AA 3I54A 5FPUA 4KG8A 2C6SA 4QGMA 3O5SA 4QT6A 4AW7A 1W8ZA 3VBSA 4E8DA 1G9DA 3G6JB 2ZGUA 3KVBA 1D4M3 4TYSA 1RMU1 3W21A 2P6HA 2YUEA 3OGRA 4GH4A 4YZ5A 4SBVA 3ZFEC 1KXGA 2VU9A 2UY9A 4QX8A 2EAKA 4XMAA 4XHBA 3PU3A 3HBKA 4B7KA 4CU7A 2UURA 3C2UA 2VUAA 1HW5A 1H1AA 1HB1A 4GJYA 4Q0PA 2QTWB 4CUBA 2AUYA 2WNVA 1DLCA 5C8CC 1KDKA 1U12A 5I0TA 4ASKA 3U78A 3M3IA 1V9U3 2J1VA 2R7EB 3H0OA 4AHWA 3KCCA 4Q4W1 3N7KA 5EZWA 5JIAA 4E4HA 1NA1A 2R042 4NIHA 1OSGA 4KU7A 2JG9A 3CBNA 3GDBA 3O14A 1GOFA 2VCBA 1FT9A 3PDQA 4M4PA 4DQAA 4BYYA 1O5UA 3CJIA 1VBD1 2C4XA 3OYWB 4TN7A 4XIKA 1O59A 1K5MC 5EWSA 4XZPA 3ATGA 4X6QB 4AF9A 3D8CA 4NJ4A 4DINB 1GYKA 1REDA 4UFHA 3E5QA 2TEPA 4Y20B 4IUGA 3HJRA 1BHGA 3WDTA 2EXHA 1W03A 3QH6A 1DP0A 1RUH2 3GBFA 4AFAA 3PVOA 3CU7A 3IKWA 2O1QA 4IW3A 1QNYA 1ULEA 4K21A 2WS91 3VBFB 3VBRA 3MPBA 4HLTA 3WQ1A 2ZS6B 4C91A 1B09A 3O1UA 4W6YA 2A71A 3QBQA 3PMEA 5CYYA 2DF7A 2W5FA 4WBBA 1R082 2QQVA 4V1PA 2ADDA 4WVWA 4IEVA 5FYIA 2IC1A 1VMFA 1ND3B 5F8PA 1F2NA 4JKLA 2HEWF 3I3DA 5FPZA 2JKXA 3LKJA 1LHVA 1UPSA 3SCFA 4OVEA 2P3YA 1LESA 4QQHA 3T0BA 1HQNA 1WA6X 5J7MA 3V0AB 2YMZA 2FCTA 1DQ6A 1JN2P 4A6OA 4C8DA 2GN3A 4EWDA 3D4KA 4IGOA 3GCWA 2JE7A 3PUHA 1W28A 4D7YA 4GMP3 1NOVA 4N43C 4AEJA 2ARXA 3AP5A 2VVEA 3I2KA 5FYZA 5LA0A 2E31A 2B8MA 2IFWA 2QVSB 1R091 1OFSA 2B42B 2XONA 5IW0A 3WW1A 5KC6A 1RUJ1 4LQRA 5E16A 1K5JA 4M3CE 3ZFEA 1HQWA 4DUXA 5FO8B 1W9FA 3OY8B 4K7JA 5FY7A 2VY0A 2OQ6A 1AZDA 5GZEA 2WZR2 1OLRA 2J7MA 4CCNA 1RUG1 3BTAA 4XFCA 4DMIA 2Y33A 2WRAA 1DIWA 3DGTA 5A7SA 2P1BA 2ZX3A 1M4WA 3K46A 5C8CA 5JOXA 1BBT2 1DZTA 1OXCA 2ZX1A 1ND2C 1PGL2 2FMYA 4XF3A 4GIQA 1QXRA 3ZYGA 4Q26A 3V64A 2Y26A 3IIAA 2JDNA 2VVDA 3KV4A 2RVAA 5IK8A 1NCQC 1WBLA 5FYYA 3BVCA 1REFA 4FXGB 1K5MA 5F2WA 2Q1FA 3VD4A 4JV4A 3GJBA 3VBUC 4HN0A 3GZEA 4R9CA 2AH2A 2BJSA 3CMGA 1WBFA 5AVPA 4OI0A 3VBOC 2IXHA 1W0OA 4KWJA 2W68A 2HEYF 5CKMA 1SDDB 1JHNA 2CAVA 3GCXA 4LT5A 1AL0G 1QEXA 2BFUS 1B35C 1JS9A 2RM22 4QKBA 5T54A 3KT4A 3MO4A 3HQRA 4AHZA 1AR73 5T55A 3U14A 5JXGA 1DF0A 3ILFA 1VBE2 4X8NA 4NVPA 4OQ9A 3HQUA 1LECA 2H0VA 1QKQA 4BXSV 4LLFA 2R041 3T09A 3UL2A 2DVGA 5LRSA 4O65A 4BA6A 1W8WA 1QXPA 1O4TA 3K48A 4BCUA 4CDUC 2K2SA 2R072 4KWKA 1F35A 4KMQA 3MIEA 2AACA 5FZGA 4AYUA 3I2OA 4JGZC 3N9MA 1N1SA 4UFKA 1O8PA 2ORXA 2Q8DA 3W58A 4CDXC 2DUQA 4EV0A 2BQPA 1YFUA 3POBA 2JE9A 5L9BA 2RV9A 1CGPA 1CQ9A 1QJU3 3MPPG 1N3QA 1UX6A 3OD4A 1GP5A 1X50A 4JCKA 4M0NA 5HXVA 4FPLA 3H8OA 3S7IA 5A7WB 5DABA 2D44A 1XYOA 3GJAA 1NLSA 2VMHA 2JKBA 5FR3A 2GSYA 3BALA 2B4KA 4N53C 5FYVA 4CP1A 1DG6A 5FYBA 2PYTA 3KM5A 3PUIA 1HKDA 1V00A 1ZZ8A 1R081 5K8SA 1MPXA 5GZDA 2FBEA 3BOPA 2WNUA 2WA3A 4M3CB 3O1OA 3WW3A 5CB7A 4MVTA 1ZBA3 3RWKX 3O0XA 4GD4A 4I2OA 1ULGA 1QF3A 1Z0HA 3K3OA 1SPPA 1ND2A 1QJY3 1WLDA 4ORFA 3HNMA 1QWRA 3DYMA 3K77A 1Q43A 2JE8A 5EQUA 2NMOA 3WP3A 1ZBE2 1JZ7A 1PZ8A 3O1SA 4Y3OA 1VRH2 4ZS3A 2IXJA 5FXVA 2VMDA 1UZVA 4E4ZA 1BZWA 2K0GA 4URTA 1PO22 4EN8B 1BYHA 1W8NA 3FN9A 1NCQA 3TEYA 3WNOA 5FZ3A 3EMRA 1HXS3 3K75B 1R1A2 1SLBA 3WUCA 4FPYA 3A4UA 4IEYA 4PLNA 3ZIWA 4CCCA 2BGOA 4CP0A 1W2AX 4YYOA 1W2NA 4IE7A 5L36A 2E63A 3VBOA 3ENRA 5EIYB 1IS5A 1NQDA 5DZFA 2A6VA 2WBKA 1RIRA 2WZR1 1TMF3 1DZQA 1U5XA 3ZXEA 3ZXLA 4QWNA 1WWYA 5K0UB 2AENA 2VW0A 2GC1A 1UAIA 2XJUA 2W92A 5F39A 4CSWA 3H7YA 2Y34A 3N7MA 5JOZA 3GZAA 4KBZA 2G1MA 4MV2A 2LUWA 2D3RA 3LIHA 1UCXA 2FCUA 1C8M3 1W8FA 1AR82 4PJYA 3WF0A 2Y6HA 1GZ9A 4LKSA 4QGNA 1FMD3 4CDUA 4LIVA 4NMIA 4RR3C 5C9AC 5T5LA 4JGZA 2EVXA 2X29A 1BVP1 4CCJA 3U11A 1RUOA 4DXRA 4CDXA 4L97A 2XJRA 2VTFA 4E4SA 1LGNA 4JGYB 4XUTA 3O1RA 1CAUA 2XBO1 4AVVA 3M3CA 3ZOIA 1UY2A 2VQTA 2RR11 1YC61 3EO6A 5FK7A 4ZY9A 5F1RA 2E7TA 5SV5A 4DEVA 5FUIA 2XKPA 3POWA 4Y4YA 4H2AA 4N53A 5FMOL 2ZGMA 3S7EA 4BQXA 2RM21 2Z5WA 3OUIA 3LPFA 1A78A 5LB6A 3U37A 3UKTA 1C5HA 5LRRA 2GH8A 1GWKA 5FY8A 2P4EA 1VBE1 3SH3A 4RGKA 5F5CA 3S0MA 1XE8A 4OMDA 4Y22B 1I5PA 5A1AA 3H50A 5DAXA 1QQP2 2BOIA 4DUWA 1AYM1 1YQ5A 4EWEA 2R071 4FFFA 3ZYJB 1PZ7A 2I45A 4JQTA 2MEV1 4MZUA 2VVFA 4QPIB 3THPA 3PTYA 5DN2A 4AR2A 4LIUA 2OIIA 3DKWA 3KV9A 4AHYA 4MHRA 1CVNA 2RDRA 1APNA 3IWZA 4NOTA 2PELA 5HCAA 5HXMA 2E7QA 1CAWA 5A3WA 4AFCA 3UKNA 3ZX7A 5GZGA 1E5SA 2CGNA 1NZIA 3D5OA 4IV3B 4XE9A 1W6MB 4FQZA 4ISQA 2PN5A 4JDMA 4HBNA 5I8SA 1H1IA 4XUOA 2R063 2XMLA 5FZ0A 1RUH3 3GHMA 5GM0A 5ABJB 2W47A 1ZZ7A 4LBNA 2XVKA 2Q8OA 3HT2A 2IWGB 2XVLA 1MACA 3LCPA 4CPBD 2H6BA 2TNFA 1ZBE1 3HOBA 4FCAA 4DPNA 3MW4A 1VRH1 4KI5M 4QMAA 2YC4A 2YYOA 4XJ9A 5DAWA 3VBFC 3ZSJA 1R083 1PO21 1WMXA 2CU5A 2GDFA 1CAVB 1X82A 5CADA 3IPVA 5AC92 3RJRA 1R1A1 2C24A 2P3JA 4CEWB 4FPKA 1ND3C 4PIXA 4HVRA 1ZRRA 5A33A 4FPOB 5JR2A 5A3OA 3AYCA 3AX4A 1KJRA 3NO8A 4NPRA 2RMU3 2JDMA 4CP9A 4FPHA 2XL9A 4CUAA 4DUVA 1O5LA 2BUKA 2XUMA 2J1RA 3NJVA 5A7NA 4FAHA 5IK7A 3RGBA 1ASJ1 3MF6A 4QU2A 1Z7S2 4UT5A 3UJQA 1EY2A 4P00B 2QZ2A 2QQNA 3VKFC 3EJKA 1DQ5A 1PGSA 3NVCA 4QXCA 1RINA 3D3AA 3LDRA 5FAXA 1GNYA 2PHLA 2RS13 3HN3A 1D0HA 1MS4A 5KC5A 5A80A 3JD73 3ZYPA 1OPMA 3S5AA 1I3HA 3T0AA 3PU8A 3FMGA 3LZZA 4YM2A 1BBT3 1LULA 4A3ZA 2BW8A 3M2MA 3WNPA 2X09A 1WZXA 1WGPA 4WVMA 3SQOA 3SEEA 4CEYB 1QGLA 4ZXEA 2QQUA 1LOGA 3OBTA 4LKFA 1X8MA 2EIGA 1DFQA 2YV8A 4LR4A 5FY1A 1OQEA 1XU1A 1IQDC 2QCSB 4NIDA 1PMHX 5JI7A 5FO9B 5IUQA 3WCSA 5B4NA 1MR5A 3OYWA 3ZR6A 4P9WA 2VZOA 1SZBA 5BY5A 1QJZA 2I2SA 3HWJA 4E27A 1QMJA 2RS52 4XF4A 2WLPA 2OUJA 3BGAA 2C0ZA 3N3HA 5AFEA 2QDRA 2YU2A 5H9PA 3C3VA 2XG3A 4LXLA 4XJWA 5IATA 4EN6B 3IBMA 2PLV2 2SBAA 4GXLA 2VOXA 2ZGOA 5F6LB 4CYDA 1UY3A 2VCAA 3POGA 5C3SA 1ONAA 4AI2A 1YQ2A 2VZUA 3QACA 4AVSA 1FYUA 4YZ2A 2FQPA 1VAMA 1NKGA 5I0RA 1MZFA 4AFDA 1MS5A 2E7AA 5BXXA 1JYNA 2XJSA 4YW2A 2R073 4XFIA 1MS9A 5J1XA 3K2OA 3BU0A 4OULA 2G4IA 3S30A 2OQ7A 3V0AA 2D6LX 4B1MA 3M1HA 4UOJA 1JTZX 4AGGA 2B39A 2BOJA 2Y0OA 3EQEA 5DAVA 1E5IA 2BV4A 2D3SA 4RFRB 5CVRA 1LHNA 2C9AA 4D7TA 4Q4X2 1OUXA 1XU2A 3INAA 3HNYM 2VW2A 3MIFA 1EUTA 2W39A 4IESA 4Y5TA 3UT0A 3UJOA 2BWAA 3TEZA 4BQ4A 3E6BA 2DUPA 3BPZA 3WW4A 4F83A 3SITA 5C5UA 5CFCB 4PBPA 3TNPB 2RJKA 4C0HA 5JMCA 3OY8A 4N8MA 4EROA 4X6RB 4OHYA 1VBA2 2BNOA 4PHZA 5BNNC 2ZABA 5AC91 3GNEA 1LAJA 4RD7A 1MVEA 2BFUL 3RNSA 4IE0A 4AWDA 2AR6A 2BVBA 3P5BA 3AFGA 5KXBA 2IUWA 1W3VA 3D0SA 3MV01 2RDSA 4K1ZA 3THCA 3I7DA 5KBFA 4M00A 1UXZA 1VRH3 3CO2A 3ILRA 3ZLIA 2A6YA 3VKMA 2JJ6A 1JZ8A 3WF4A 3DCQA 3FL7A 3FLPA 2A6WA 3C8XA 4TSVA 1OPOA 4UI9L 4XXAA 4CCDA 3O1PA 2HWD2 5FO7B 3LF7A 5LBFA 2VJXA 1UOJA 4FOVA 1MEC2 3PL0A 5J09A 1Z7S1 2WZEA 1FOD3 4CXXA 4QAWA 4PIYA 4HMZA 1QHDA 3JQWA 3ZDSA 4FVVA 1HRI2 1HJGA 1W9WA 4MXWB 1MS1A 3OEBA 2XHNA 1H6YA 2OX0A 2WR9A 3LFIA 4YARA 1CWPA 3JQXA 4QKNA 2VH9A 1RITA 5K0UC 1QOSA 3JCIA 1YO8A 3H7JA 4XQ4A 4CCOA 2O8OA 4PQQA 1GOGA 3L2HA 4B4RA 3I8TA 1IS6A 1ENSA 1LKNA 2A75A 1EV12 2HYKA 1GICA 3GGLA 1ENQA 1AR83 4NRQA 3ZM8A 3B5LB 3FUQA 4BQ3A 4MOAA 3ZFFA 5FLIA 1T6GC 4AEKA 1NAEA 4GZ9A 4RFT0 5CBLA 5BPXA 1IQAA 3RZMA 3WG1A 1W8UA 5BNOB 1IKQA 4OYUA 2CL2A 1RGSA 5BUVA 5FMCA 4FPCA 4Z2AA 4BB3A 4GB33 2RS51 4MSVA 1POV1 3I2HA 1GMMA 5FZHA 2YBSA 3MLLA 2VMGA 1VMHA 1B35B 1D0GA 3C7OA 4B3NA 5F7UA 4IL7A 1PO12 1UMHA 4QX3A 5A7WA 2PLV1 2E33A 4XBQA 4JKMA 1BXHA 1SHWB 3N9PA 4YW3A 4XJAA 3J8F3 2VZPA 2DBNA 3PTRB 4PF5A 2W52A 3OD0A 3UYJA 4ZHNA 2NP0A 2A3YA 2F17A 2QQKA 2VW1A 4FFGA 4LITA 1AYN2 1WW6A 1QQP3 1NZCA 3AMNA 4L99A 4M3CA 3T4VA 3FHIB 2OA2A 1H8TB 1REEA 2J42A 1H30A 1UZWA 2VQAA 5FYCA 5FOJB 5L9VA 1E57A 4GJZA 1H9WA 1PM4A 2OPWA 4LLOA 1IKPA 3OGGA 4QKDA 4EN7B 1UU6A 3EXUA 1UPIA 2A6ZA 2ZGLA 3IDCB 1YRZA 4QPIC 3FFZA 4HONA 2HWB2 3VDBA 4Q4X1 1YFXA 3WF3A 3R0RA 4AI9A 2BEOA 3WOGA 3I49A 5LA9A 2CV6A 5ISLA 4AGRA 2CDOA 3VHPA 2ZKNA 1L3JA 1N1YA 2XDVA 1VALA 5KHJA 1ULCA 1DQ4A 3H1WA 4LBMA 1I1EA 1X9PA 1EP0A 1Q5OA 1AUYA 4IV3C 4OUSA 4Y1ZA 5FZOB 5K0UA 2VCCA 2PAEA 1W04A 3LEKA 5GLVA 4PIZA 2HWF3 4AI8A 4U36A 2Z69A 2JICA 3U07A 1ULFA 5ABJC 3AL6A 3RMXA 2O8QA 3POJA 1CD3G 1OQ1A 2OUHA 5D21A 3TEXA 3SH5A 5ACA1 2UYAA 3I97A 2C5DA 2HWD1 4XETA 4A44A 3VD5A 3OPTA 5CEHA 1CJPA 5IAXA 4YGCA 5FMOS 1MEC1 1ULPA 4RYDA 3T08A 1QOOA 1MQTB 1WCSA 2WUHA 4IEPA 3AYAA 4FTSA 4BQ2A 4CEWC 4JAAA 4EN9B 1J84A 1PK6B 5DG1A 4JGYA 4R4ZA 1HRI1 2VXJA 2P6CA 1JBCA 5JMOA 2DCKA 1OC1A 4Y1UA 4WV8A 4LBQB 1US2A 3AZWA 5CNAA 3HAGA 5FZIA 4W6WA 5A6YA 4Y1VA 1YNAA 2F6BA 4FXKB 4YW7A 3PIJA 1EV11 3SXWA 2QUOA 2Z42A 5FJHA 1YEWA 1YWKA 5IJRA 1DGRA 1RTVA 3UGHA 2FCVA 5C70A 3AVRA 4N7IA 5C9AB 1LOBA 1DLLA 4Y22A 2DYCA 2WAAA 4RHV2 4Z82A 4Q1RA 4AI0A 1U5ZA 2HBUA 4Z2WA 4JKKA 4S2DA 1QDCA 1ALYA 2WN3A 3OGSA 4XF0A 1AL23 3A7QA 4DXSA 1TG7A 1IGOA 2DU1A 2VBPA 2QNKA 3QLQA 4XOGA 4QPIA 3CZUA 4HKLA 3VHRA 4NROA 4B8EA 1PGW2 2PQSA 2BTVC 3BIEA 4CEYC 1XNAA 3BCWA 1PO11 1EAH1 2B46X 2VR4A 4UXAA 4AVCA 1GNZA 2DV9A 4Q27A 1IOAA 5LASA 1JODA 2WINB 4NN0A 5B2GB 4IV3A 4IV1B 3AVSA 1W6MA 2DWRA 1CESA 4NWVA 1IHMA 4RQPB 3WP4A 1S0CA 1AYN1 1JZ6A 1YI9A 1OFNA 1WCDJ 3MEPA 3NJZA 4U2AA 2Z2SB 1LGBA 2D6PA 2W95A 1H1MA 3AMQA 5ABJA 1VJ2A 3ZXAC 3I3QA 3AP6A 2DDUA 5DDJ3 3WF2A 5DUWA 4ZS2A 5BNPC 2OPKA 4QB1A 4A2UA 5CG9A 1GP4A 3ACFA 4P5HA 1U5YA 1VBC2 2HWB1 4ZPIA 5J37A 5ACA3 3R6SA 3ZYFA 1CAVA 1H8VA 3OG2A 5HCBA 4OMCA 1LOCA 2OVUA 5DAQA 4CEWA 5M0TA 2O14A 2VZVA 1N1TA 2ZX0A 1PNGA 3S5QA 4QPYA 1GZTA 2XH6A 1G8WA 1SACA 3JU9A 3LSEA 4TLFA 2VC9A 4NO4A 1OD3A 2YC0A 3AKPA 1YQ6A 2MPFA 3FX3A 1LJ7A 3W20A 5A32A 3PVNA 5IVCA 1ZYBA 2WLQA 4MADA 1C1LA 2D6OX 3PIGA 5FPVA 5FZ7A 2OS2A 4BU2A 3OJBA 5CFCC 3KSCA 1GQPA 3USUB 3R4DB 1VBA3 2ZGPA 3SMHA 4QM8A 5GJ6A 4MH0E 3ACHA 4UF0B 3ASIA 1I5ZA 1AF9A 3ZXFA 1CPMA 4YW4A 1J3RA 1X36A 4NPMA 2MNGA 2VL4A 1C8NA 3DV8A 1RL3A 2YXSA 2PTMA 3VBHC 3WDUA 4UFMA 3VDDB 1XXNA 2YGMA 5EJ1B 4CEYA 2TBVA 4OI2A 5J3UA 2VG9A 4YFZA 4R9AA 2FZ2A 3OGVA 3LOIA 3TN91 1JZ4A 4PI2A 2EIDA 1RJ8A 1RHI1 3KV6A 1PMIA 4EZHA 2XHKA 3OBAA 1S4CA 3HVDA 2YDEA 2LROA 4XAAA 1LU2A 1WLCA 4JDNA 5FXZA 1T2XA 2TUNA 1AR63 1EYBA 1VMJA 2PFWA 2OZJA 3CHXA 4QX2A 5C7GA 1A8DA 3CNAA 5DG2A 5FPAA 2XKOA 5FY4A 5ANNA 4YG6A 1NUKA 1WMFA 1UY1A 3J7NA 4YVWB 4RHV1 2A1XA 1RUF1 2P5BA 2WNOA 2QQOA 2VUCA 4A7YA 3HMYA 1RXGA 1JU4A 4RN5A 1YIPA 1YIFA 1RUD1 2WN2A 2OXBA 5T5JA 3WNMA 1ZRDA 2I74A 2Q5TA 1SBDA 4XCAA 1IG3A 3ACIA 5I93A 3J9SA 3M3QA 1PGW1 4BM8A 4Q4V3 5A3NA 2RHPA 4V2VA 2KM2A 5DPNA 2PMWB 4HZFA 4AAXA 2GMMA 5FP3A 3O7OA 3ZKYA 3B7MA 5FOBB 4UFIA 1L7RA 4RA0A 4CP2A 2WNEA 5C5TA 1NLRA 4XXPA 4YWAA 1U0AA 4Z07A 3LIGA 5BNOC 2E6VA 2L9LA 2XBO2 3RYKA 1S0JA 2BWCA 3IMNA 2RS32 3ALQA 2RR12 4FPEA 4H7LA 3U4XA 5E89A 1CZTA 1RMU3 1WCUA 2ZPXA 3IDAA 4PF1A 1D2QA 4BDVB 1RUE2 3IM0A 1RUI1 5D8AB 1LHWA 1UKGA 2JG8C 4GKXA 4LBLA 2CHHA 5CFCA 4TZDA 2WO1A 5FYUA 2DU0A 3MYXA 4Q2FA 1AR92 4ZU7A 3FLTA 2X05A 1QXJA 3G7DA 1W99A 2FHRA 1VBC1 2BYVE 1UY4A 2ETEA 3DUIA 1S2EA 3MIHA 1UQXA 1FV2A 3URFA 4HFSA 4HVOA 4LORA 1AYM2 2W0XA 4HOOA 1YJLA 5K4LA 3J26N 4FAGA 4GWMA 5IFPA 2D5HA 2V09A 3POSA 2FDFA 2MEV2 4XJZA 4LHNA 2Z4FA 1POV0 4XDPA 1H8TC 3CIHA 1H4HA 2WKKA 4K8FA 4LOTA 2WDBA 1C1FA 4N43A 4Q4W3 3VZJA 3KMHA 5AFBA 2NQYA 4WVVA 4TWTA 1WW4A 2DVFA 2GNMA 4BMBA 1C5IA 1HX6A 1VBD3 2VAUA 5F3CA 1XOYA 1QIQA 4S2HA 1W6PB 4COZA 1TVGA 2GP3A 1N47A 4D6SA 4EE2A 2QQMA 2ZMNA 2ZKLA 4QKFA 4YSFA 1LB2A 5C33A 2J22A 5BNNB 3W5MA 5HPOA 2JXAA 4FP2A 4KNCA 2IXIA 4LO7A 1GBGA 4S2FA 3ROUA 3VB9A 4AL9A 1HRV1 2IXKA 2RJLA 1LOFC 3GYDA 3OEAA 4Y4RA 1GZWB 5FK8A 1TME2 3ZN6B 4ATEA 4XBLA 4Q5OA 5JDBA 4FOWA 2HBTA 1NCRB 2J1EA 2WS93 4BQ1A 2OKXA 4WM8B 2BBVA 2WFF2 4AE2A 3T30A 4MGZE 3FFQA 2LTNA 2CNAA 4NHKA 3WDVA 3O1TA 1HIXA 4G9SB 4H14A 1POQA 3BTZA 4ZZ8A 1D7PM 2BU9A 5DXDA 2DBIA 3VBUA 2D40A 4I02A 2VZRA 5IVFA 2IFRA 5EP9A 2YZ4A 5JZGC 2JB8A 5BNOA 4LE4A 3BU7A 3CZJA 4DO0A 4CXYA 1MQTC 2D43A 5F5IA 4E4DX 3LB9A 5DMYA 1DYPA 3D0JA 4EZ4A 2OYZA 1MS8A 4HK8A 1PK6C 4JRLA 4JQRA 5IAVA 4JDOA 4RS5B 5LA1A 3S6PA 4XUQA 1B35A 2DCTA 1A3KA 1OLQA 3T4HB 2QQIA 1R093 3WHUA 4FTEA 1RUJ3 1ULOA 2UWCA 1AJOA 1ASJ2 2J1SA 1ZZCA 3OPWA 1F4HA 5FZ1A 2VZQA 1G7YA 1N1VA 2V4AA 4LMFA 4HKOA 3HR9A 4L11A 2DURA 5FFOC 1W6NA 1RUG3 3LDBA 4XW3A 2XJVA 4K9SA 2IXCA 4MGYE 3KCXA 3VKNA 3PURA 3EB7A 3CLPA 2Y60A 2FDKA 1H8TA 1SFPA 4L0PA 4QXHA 2NMNA 4P9IA 4UYBA 5ERLA 2YU1A 3J7HA 2W2IA 5H9RA 3ZVXA 4AZZA 1ZA4A 1J59A 5IWFA 5KHKA 2A6XA 2RS31 4MUVA 1ZX5A 2DFBA 3M4FA 2XVGA 3CKHA 1RUE1 2VECA 4CU6A 4YM3A 4HL0A 1HV0A 5EYYA 1N3OA 5FRAA 5CIRA 1FATA 3B94A 5KHIA 2GNBA 1AR91 1O4YA 1DHKB 1KS5A 1PVC2 4LEJA 3VZNA 4CCKA 1V6JA 5CG8A 2ET7A 1DYOA 1LOFA 4IV1C 5FY5A 3MDPA 4AEDB 4YLZA 1J1LA 1GOHA 5FZOA 4RQPC 4D6RA 1GV9A 3E97A 4QHZA 4QX1A 2P34A 5E8AA 3ZSLA 5FZLA 2XB6C 2KR2A 4DB5A 4P9JA 5CZKA 5FV3A 4XPVA 2YBKA 5I8TA 4KL1A 4AFBA 3AYDA 4HETA 2WA4A 5L7OB 5FKBA 5SV8A 4DOUA 1A34A 1W2TA 3BODA 4Q8KA 4GQ7A 2ET1A 2R043 1S1AA 5L9RA 2VZ3A 2ATFA 4LUKA 1OQDA 1BJQA 1N3PA 3A23A 3BOWA 4IETA 4Z92B 3NNFA 1UU4A 4BISA 1JYIA 2R6QA 2XLAA 4HPKB 2Q8EA 3W9AA 2JIJA 1PZ9A 1MQTA 2XL7A 3LWCA 3DPRB 3O1MA 3LPGA 1PK6A 5IVYA 4OZXA 3AP7A 3VHNA 4NIIA 4MGSA 4DXTA 4COYA 4ATFA 3QD6A 1VE0A 2VZ1A 4LBQA 1TME1 3RMYA 4CCEA 3SNMA 2ZTNA 2PAMA 2LRPA 2YFUA 5J96B 2K46A 4WVZA 1H4GA 3GF6A 2VZTA 2WFF1 3JXSA 1WA4A 4QQPA 4WZFA 3QH7A 2HWC2 5KWRA 4YM0A 3KGZA 3E6DA 2GMEA 5FQ0B 4QU1A 4E2GA 5LEJA 4N90A 4RR3A 5C9AA 2R49A 4K8RB 4UW6A 2Y64A 3H1YA 5C4WB 2QE3A 5I0DA 3ELNA 2UWBA 2JIGA 5EHDA 5A7PA 3CL1A 4ASMB 1UYPA 3APBA 4QD2A 5GLZA 1COV1 4AI3A 3NJYA 1ZZ6A 2QBXA 5T5OA 1SQ4A 1UNBA 5A3UA 4RGAA 3ZR5A 1Q8SA 3SKJE 3VDDC 2OW4A 2E32A 4LNVA 3LA7A 3BYWA 1NA1B 1JYWA 4MGIE 1WKYA 3KVAA 5DUVA 2W94A 4LBJA 1RUC2 2JX9A 4YGDA 3OSDA 4IGPA 3CJIB 1QJX2 2FDHA 1OLME 5F3EA 3WF1A 3MBWA 4P08A 4IV1A 3UESA 2WZR3 1FPN1 1BEV2 4DZGA 5JAXA 4RQPA 4I3PA 1V6KA 3JBG2 3PUAA 4I0BA 4Y1XA 5E6HA 4CU8A 2ZZQA 5KXEA 2VNVA 4LK6A 3J7MA 3WDXA 3VD7A 1ZZBA 2WSUA 4H3WA 2PXJA 4XFFA 4YVWC 4XVHA 4TXWA 3VLBB 2VNOA 4MX3A 4J6GA 4N7UA 5J98B 5FYMA 2R0FA 4BE3A 2AGSA 2WO7A 4HSJA 3I4IA 2H6CA 2WL1A 1XNDA 1QU0A 2C26A 3NV4A 3POYA 2Q1ZB 3N9LA 2ZZJA 4PDWB 3WQ7A 5L19A 1IZ3A 5FXWA 4AVTA 4CDQB 2W08A 3BIWE 5FLHA 1KDMA 5FYTA 4HANA 1W3XA 5DAPA 1BKZA 4META 1TNRA 4XAEA 2YB7A 1Y43B 3ZSKA 2XBO3 1PVC1 4QX0A 3VGIA 2RS33 3T2TA 2RR13 5GZFA 3VKLA 3RZKA 1J3PA 4Y20A 2DCJA 4XBNA 2PHUA 1XNKA 3F95A 1QH6A 2RM23 1PNFA 2WWUA 3E5XA 4PLOA 3MICA 4MGTA 4ARXA 1KFUL 4XQDA 4HKWA 1JMUB 5BNPB 1OD5A 4HVQA 2FDIA 1VBE3 4ZU5A 3VBFA 3H8RA 4CRQA 1D4M2 5D8AC 2KD7A 4Q4Y1 4AAPA 4J1XA 4ET7A 1ENRA 4FBFA 3USUA 3JZVA 1JYCA 2WQ8A 3E6CC 2XUEA 2ZX4A 2WT0A 3BUCA 3M70A 3TOJA 1AYM3 1W6OB 1W0PA 1JOPA 1ND3A 1UKRA 4UF0A 3NMBA 1FAYA 3N7LA 3POEA 4XJ8A 1O3SA 4C1WA 4UW3A 2B7YA 2MEV3 2PQQA 4KBBA 1H6XA 4QHOA 1LENA 3POFA 4AEMA 4CUGA 1P8JA 2EIBA 2MHFA 4K1YA 5JPNB 1IPJA 2J1TA 2R1DA 3VDDA 1YQ8A 1A8MA 3ECQA 4C0BA 3AZYA 3NV1A 4Q0UA 1IG0A 1GANA 1V9U2 4LA2A 4OI1A 3SKVA 1YHFA 1O4ZA 3WQBA 2HJIA 2HWC1 5LY1A 3NSTA 3P1IA 4DRVA 5F37A 2NPIA 4V2WA 2BERA 4OLLA 5E88A 2XLFA 2XGXA 4LPLA 1YFYA 3QOPA 5I91A 3BN6A 4AQSA 2ZGSA 4Z8BA 2EA7A 4YVWA 3PLQA 4LKDA 1AXYA 2WT2A 3GXUA 3VBHB 1YFWA 1JYVA 3LEIA 1H2KA 1SMVA 1ZBE3 1OT5A 4YGBA 3ILNA 4F7ZA 2DFCA 1NCRC 2YFZA 3TBDA 4B1LA 3B01A 1PO23 4WM8C 3AKTA 1XSRA 4GA9A 3R4SA 4K40A 4Y33A 3WG3A 5ACA2 1D2SA 5C8WA 4XIOA 2B5HA 5JPMB 1MS3A 1R1A3 2ZHKA 2JECA 1FNZA 1FX5A 3WINE 3HN1A 3IDEA 2AZ5A 5A3LA 1ZNPA 1RUC1 1VBB1 4NIAA 3N35A 2R30A 2VOWA 1QJX1 1JH5A 2BVVA 2HWE1 2VTXA 2WZ8A 3AXEA 1BEV1 2N7GA 4GWNA 4OHVA 3N9NA 3JBG1 3VD3A 3WCRA 2ZGQA 3MW3A 2ENRA 1YLLA 4IEOA 1JUIA 3U1XA 3KQRA 1K12A 1X33A 4QXKA 4R4XA 1IS4A 1ASJ3 3AXDA 4RS5C 3KHCA 1UZZA 1GLHA 3H42B 3IN9A 2Y6KA 5LBEA 2I07B 2J1UA 2VM9A 5LEKA 1OHFA 5E1RA 1WCQA 2ARBA 3M3OA 4FP3A 2DTWA 1Y4WA 2UWAA 1VIWB 1KQRA 5FY0A 2JDHA 3U4SA 1RVF2 3SCHA 1OURA 3ACGA 4M0HA 2WNUB 2ZGKA 3AJZA 1LOAA 3ETQA 2HKXA 2A3XA 1UMIA 1CJDA 4YZ4A 4G3YC 1AVBA 3H8UA 4JC1A 3WZ1A 1UN1A 2WZPP 2ARAA 3C7FA 3U0ZA 1LRHA 2RDQA 2Y6JA 1LCLA 3VKOA 2JG8B 1EAH2 3NAPB 1GFF2 1E5RA 3AFKA 3JUUA 2GNDA 1JZ3A 3AZXA 1AX0A 1C3HA 1OF3A 5LATA 5IK4A 2J1AA 1D4M1 4QPGB 1GSLA 4UFJA 1UWWA 4QB6A 2ZGNA 4LHSA 4FI9A 5BNNA 1WW5A 2Q0AA 2OZ6A 4O9EA 3SISA 5A70A 4XUPA 4YVSB 2P3IA 3NNLA 5JOYA 1GZWA 3FBMA 4KGGA 3ZN6A 4AEDC 3GZTB 3MW2A 5EPAA 3R05A 2JD9A 5L73A 4EQVA 1IPSA 3KV5A 1XBFA 5C71A 1NCRA 5JUVA 4WM8A 4KWUA 4XF9A 4QHBA 5F2SA 5JXHA 2FD8A 3IB3A 3FHQA 1JZ5A 3K51A 3AP9A 2VMFA 5H9SA 3RZHA 1UYXA 1JXNA 5L7OC 1AR72 4EJRA 1W6QB 2P37A 3RZJA 1O3QA 4XACA 1V9U1 1LTEA 1WUVA 4BZ4A 2F4LA 2WJSA 2Q8CA 4JX0A 1V70A 2VTXJ 4YW1A 3RI8A 3T1LA 1DGRN 1YCIA 2ZHLA 2V5YA 5FIXA 4AGVA 2BP6A 3DPRC 3ORJA 4BLJA 4KH9A 2YHJA 3UNPA 5A3TA 4RS5A 1Q8OA 4Q0SA 4DXZA
chains in the Genus database with same CATH topology
5LK5A 3T1MA 1RUNA 4LBKA 4LE3A 1H2LA 3ZFGB 4BOWA 5FBZA 5KXDA 1Z78A 1MS0A 4A7ZA 5AC93 1V6IA 3HQXA 5JZGB 3R4UA 4DNYA 3WY6A 3WW2A 5C4WC 4ZKTB 4MXVA 1IS3A 1ZBA2 1FV3A 3O0WA 1QJY2 2EXIA 5JWPA 4OHXA 3TN92 1JOJA 1SLTA 2A5ZA 2WFPA 1RHI2 3AMHA 1XQNA 3ZMNA 1Z7S3 4ASLA 1M06G 3DF0A 3VZKA 4GMP1 1GR3A 1NA1C 1DGLA 5JLVA 1HXS2 1CIWA 2E53A 3RZZA 3P3PA 2FMDA 4E2QA 4K20A 3B93A 4I0WB 2ZHNA 2Q1MA 3NKTA 3CJIC 3WP6A 2ZX2A 1RUF2 3IT8A 1MZEA 1QDOA 1RVF1 2LM3A 3MFCA 3B02A 1EPZA 1O3RA 4NHLA 2YPJA 1RUD2 1TMF2 1J1TA 1JUHA 1G9FA 4ZXKA 2EAAA 2G9GA 3M8LA 4B29A 1DQ0A 4FSJA 4H55A 4YG3A 5L7OA 2ILMA 1NXMA 3AZVA 2CWMA 4FQ4A 1OA3A 3FC0A 1S2BA 1D4VB 3X29B 3PMSA 4PDWC 4BHPA 2ZHMA 5FPXA 5J48A 1WD4A 4HPKA 5TSWA 2GALA 4CDQC 2RS53 3WNXA 1POV3 3DPRA 4H7MA 1BVVA 1MVQA 1DGWA 5FREA 3ZO0B 1NE6A 2PLV3 1OOPB 3ZSEA 3OPZA 4B7EA 2FZ1A 1RUI2 4YW5A 2ZAAA 1G9BA 4R8HA 1RJ7A 3RJ2X 3B3QE 2QDNA 5JVVA 3NV3A 5F9TA 4FPGA 2XWBB 5FQ0A 1AR71 1F8VA 4AQTA 2WWSA 2GC0A 3GZUC 4F8AA 4FPJA 1EPWA 1VLNA 3CJXA 5FDBA 1CN1A 5C4WA 2XJQA 2QQPA 3PVBB 2B9UA 1SCSA 3Q9OA 3ZYRA 3ZIXA 4Z1VA 4WVMB 2XWJB 4Q4X3 4PQ9A 4QX5A 4NR1A 3HBZA 1DYKA 1S0DA 4AQ2A 1QJU1 5I0UA 3AB0A 3RQ0A 2EALA 3DN7A 4W6XA 5F6KA 3KT1A 3ZN4A 3RWNA 3L9JT 4I3GA 4WM7B 1OMIA 4YZ1A 5JI9A 1LHOA 1QNWA 1HRV2 2XPJA 1HV1A 5T3NA 3PNAA 4INDA 3KCYA 4B4PA 2A3WA 2PHWA 4Q0VA 5K7PA 4XFBA 2R062 3UKVA 1UL9A 1ZBA1 3I59B 1BQPA 3GBGA 5CG9A 2D6MA 3ME2A 4IQPA 3UV9A 4E9KA 5ACA3 4LTAA 1QJY1 2HWD3 3ZPYA 3ES1A 3NW4A 4IEXA 4PDWA 1MEC3 3RG0A 2NYYA 4XTMA 2X5IB 4YG0A 4OHWA 4CDQA 3FE5A 4BLIA 3RRDA 1HXS1 4R52A 1HRI3 1YJKA 2D7FA 3UK9A 4IEWA 1J3QA 1LOEA 5K9YA 4I01A 1UU5A 2D5FA 3AM2A 4HK9A 5LK7B 3FZ3A 4IERA 2RMU2 2NN8A 1TMF1 3CF6E 3ST7A 1EV13 3AMMA 5BNPA 3KT7A 4JRAA 4ES9A 1Q8PA 5CU1A 4YNIA 1O3TA 3D82A 4KU8A 1RVF3 1UMZA 2WQZC 5EFUA 1W6OA 1C8M1 4AXOA 3TAYA 1NE4A 4GULA 2RS12 3SH4A 1FMD1 4HT1T 4OI4A 2WNUC 1HQLA 2EXJA 4Q1PA 1X7NA 3JD72 5C6CA 1AJKA 2NM1A 5BNQA 2X53S 1I9RA 1VB4A 2H0BA 4F3JA 1PO13 1EAH3 2SLIA 4UBGA 3TB0A 3WP5A 3H3UA 1GNHA 2R1BA 4XFHA 5HI0A 5GLWA 4DY3A 1GZCA 2P3KA 3NAPC 3THTA 1JW6A 4G4FA 3OGJA 2GU9A 1ULDA 1AYN3 2E9QA 4QPGC 2BPA2 2VNGA 2VUJA 5EJ3A 2CGPA 2XLGA 2WSVA 4HN1A 2WC2A 5CFDB 1HDKA 3AMPA 4YVSC 1C28A 1PM7A 4EWAA 1G9AA 3VBHA 4XFAA 4I0AA 3WDWA 1W39A 3RYPA 3VZLA 4LO4B 2HWB3 1SFNA 2QJVA 3MIGA 3H3ZA 4ES8A 3ZFFB 2PHTA 2CYFA 4XMIA 1KJLA 4C1XA 1YUDA 4D94A 2UY8A 1PIV2 3AZZA 3OCPA 2UYBA 4MXWA 3WR0A 4E2SA 3V65A 1KS4A 3WHTA 1QH7A 3GALA 3M3EA 1F9KA 3ZMOA 2R061 1RUH1 1DGWX 4N9HA 1XRUA 1WLTA 4ISRA 3FBYA 1OA2A 1CX4A 3ZFGC 4IXLA 3PJYA 2BNMA 3AKRA 3L2YA 2YROA 1DDLA 5EXOA 2LALA 3WDYA 1C57A 4DY5A 1FI2A 5CBLA 4FOQA 2CWSA 3MGUA 1COV2 1URXA 4J1WA 4K6BA 4D69A 5FCCA 1LEDA 3TN93 1ZRCA 5HBAA 3P3NA 1RHI3 3KS7A 3ES4A 2RMU1 2JG8A 3NAPA 2JEMA 2Q4SA 4YGEA 3V0BB 2R32A 1CPNA 2GMPA 2XJTA 1SLLA 4XFGA 4B4QA 3RDIA 4QPGA 2ERFA 4UW5A 4BMEA 1FPN2 1FOD2 1S0FA 4RHV3 1RUF3 3J4UH 5GKAC 4YVSA 3O0VA 5CAZA 2UU8A 1RUD3 4RSUA 2F4PA 1CAXB 1I6XA 2Y38A 2RS11 5IK5A 1DQ1A 2B45X 1DZRA 3JD71 2DVAA 2A7AA 5T5PA 4C90A 3LSDA 1BBT1 2R16A 2ZMLA 3MLJA 4QM9A 2EF6A 1PGL1 1UF2C 1W6QA 2PHFA 5BV6A 4GMP0 2CY6A 5BYNA 3AYEA 1V6OA 4P9LA 1KD7A 3JB4C 2O0OA 4FPFA 1S55A 1BCXA 2PHRA 3O12A 2YGLA 1SBFA 5KXCA 4GB32 1RUI3 2XJPA 4Q0QA 3B00A 4CZSA 2JD4A 3AKQA 2ZA9A 1OOPC 2DVBA 2IZWA 4AFMA 3W59A 4S2GA 4Q4Y2 1NXD1 1VR3A 4CDWB 1VBC3 2WIIB 3KZ4C 3ZFGA 1R1ZA 2PA7A 1KFXL 4Q8LA 3ZXKA 3WX5A 3J8F2 4R9BA 5JZGA 1VB2A 3MIDA 1HLCA 5GLUA 3VZOA 3E5UA 3LAGA 4RGGA 3N4MA 1H0BA 1PIV1 1WMEA 5JR7B 2YY1A 3B9IA 4KG0A 3PHMA 1G86A 4LULA 4Y26A 5JOWA 1ZVFA 1H2NA 5JCTA 4XHXA 3VBSB 4LO5B 4MYEA 1F5FA 2NLRA 5EV7A 3H1MA 4N9IA 1O7FA 2GZWA 4GH4B 3OBRA 2Y0IA 1HRV3 3FUOA 3FWEA 2A73B 4FOYA 3AK0A 4NHMA 4WM7C 2C1FA 1CONA 1SLAA 1O91A 4JTNA 1TNFA 5KHGA 1BMV2 2HWF2 2NZ9A 1S0IA 3TNQA 2WNVB 1A6CA 2G9FA 3SCGA 2P17A 5F5QA 3KB5A 4XQWA 2KXLA 4Y24A 1MZ5A 3BB6A 1SLCA 2JG9B 4Q29A 3WT3A 2JENA 3MLKA 4W65A 1VBB2 1LR5A 1QY4A 1YXWA 2X5IC 1TE1B 4I30A 2HWE2 1RC6A 5JIUA 3EBRA 2ZACA 3SLIA 1FOD1 3D6EA 3RS6A 3JB8A 2HEVF 3IDBB 3SHRA 1VAKA 4D3WA 4AHXA 4GKYA 1OOPA 4LO6B 2AYHA 2KA3A 4LHLA 5A32B 1Q8VA 3RI9A 3VBRB 3AP4A 3VN4A 1XNBA 2RE9A 2GAUA 3TWIA 1AR81 1XYNA 3FLRA 5HCFA 1CR7A 1NG0A 2QFEA 4XDQA 4GALA 1FNYA 1G9CA 4P9XA 4R9DA 4AQ6A 3VHOA 2GC2A 1AL22 4P14A 2QZ3A 4GB31 1C4RA 1UW8A 3TRSB 1RUE3 1U5IA 1AHSA 4KGQA 3N36A 3KD4A 1S0GA 3WG4A 5T50A 2IXLA 3ZN5A 1AR93 1DQ2A 2QKDA 4NWWA 1GQGA 5JSRA 5FTTC 1IPKA 2DCYA 3LGRA 3ZFEB 3AJYA 4WM7A 2A70A 4SLIA 3WXPA 3FJSA 1LEMA 4RL7A 3MF9A 4COVA 1YYNA 3J8F1 2ZAHA 3U10A 5AVAA 5CA6A 2DVDA 4FO9A 4FTBA 1KITA 5FLJA 1UIKA 2ZOEB 4L8QA 1QQP1 1VP6A 1H2MA 1SFYA 5CFDC 2D98A 5C8CB 3ACLA 3I59A 3NV2A 3VUOA 2ZBJA 3WVJA 1G6NA 5DDJ2 1SEFA 1W2UA 5D1IA 1AXKA 2X5IA 3ZFFC 4QQLA 1LU1A 2VXRA 1K5MB 4A3XA 3AKSA 5T52A 1PIV3 1ENXA 4LA3A 3H9AA 4COWA 1GQHA 3CEWA 3OTFA 3WV6A 4BIOA 1SBEA 1TME3 4AVAA 1TEIA 4EN0A 1RB8G 4BH9A 2WFF3 1OI6A 1WCKA 4XILA 3NWKA 4X8PA 1BMV1 2HWF1 5I0SA 5GLTA 1GKBA 4PLMA 2BNNA 2VGDA 3HT1A 2VULA 4PBOA 5DUXA 3B9CA 3HD8B 3PJQA 4L9BA 1UIJA 3EHKA 4DS0A 2Z79A 3KLSA 1Y7BA 1XE7A 4M3CF 4XEZA 1COV3 1NYWA 2D6KA 4AK3A 3VZMA 4JTOA 1WD3A 3GHNA 3A0NA 4CTEA 1OA4A 4N43B 4P9YA 4AVBA 4IEQA 5D8AA 1WMDA 4XF1A 3KGLA 2VOKA 3B69A 5KHHA 5I8YA 1V6LA 1Q8QA 2VQ0A 1FPN3 5DUUA 4UW4A 3NL1A 5GZCA 1FXZA 2CTVA 2ZGRA 1SCRA 1YI7A 2BGCA 4LHKA 1AR62 3WQ0A 1NY72 4MGKE 4QQOA 5CFDA 2ES3A 4JVAA 1ZZ9A 1OKQA 1ND2B 4WZCA 4LBQD 3WLUA 3ZSMA 1MZ6A 3QCWA 1S0EA 1LODA 4L92A 1AL21 2JDZA 3VV1A 4IEUA 4XTPA 2VMIA 5J36A 1NCQB 1AX2A 4OFGA 3TYJA 2WT1A 1AXZA 4Q4V2 1SDWA 3VBUB 1W6PA 3ZYIB 4BIFA 1NQJA 1PVC3 3WUDA 3GBWA 3VBOB 4QQ2A 3WD5A 3LA3A 3MIBA 2R0HA 3I2DA 3PVEA 2ZMKA 1AX1A 4HSLA 4JGYC 2VNRA 3N7JA 3ZXGA 4COUA 1VAVA 5A3MA 1RMU2 3OF1A 4Q4Y3 1LHUA 2ZGTA 1KRIA 4YRDA 2X8KA 4IEZA 1Y9QA 3WG2A 4O9GA 5DDJ1 4CDWC 3DL3A 1XNCA 1W6NB 1PHMA 4CDUB 1V6MA 4JGZB 1S0BA 4YM1A 4CDXB 2D97A 2D6NA 2DCZA 1H9PA 4XJUA 1ZM1A 4XYXA 4YFWA 1CAUB 3VL8A 4D7SA 5EYXA 4Q4W2 1UD1A 1QJU2 1F5JA 3NKGA 4N53B 2HWC3 3V0BA 3RPQA 1DU3D 3VBSC 1TQ5A 4OUMA 2WQ4A 1V6NA 1VBD2 4DFSA 4M01A 2DTYA 3LA2A 3HIFA 4KWLA 4GH4C 2GNTA 5JSOA 2P2KA 1VBA1 4DRRA 1CAXA 2CAUA 5DZGA 1Q3EA 1ZREA 1UZYA 5GALA 2WS92 3ZXDA 1F31A 4QGLA 3VL9A 4ZU4A 3A0KA 4ITCA 2Q30A 2WNVC 2ZJCA 4AI1A 4I09A 1XYPA 4ONUA 5IT6A 2DUOA 2ZCWA 1RUC3 1VBB3 2GN7A 4K3UA 4LUMA 4KQ7A 2E51A 1Y3TA 1QJX3 1PVXA 3M7AA 1BK1A 3MI8A 4UBHA 3ZXJA 2HWE3 2EXKA 1CAWB 2JG9C 4FT8A 3MZHA 3LOBA 1BEV3 2D3PA 2PHXA 2CGOA 2AREA 3JBG3 1SLIA 1AR61 4AEDA 4P9GA 2VPVA 2PAKA 2VOVA 4Y1YA 4BWOA 1NY71 2PHDA 2V73A 4PCRA 4LBOA 5DZEA 3V56A 2K9ZA 3USSA 1R092 1QOTA 1RUJ2 3MFAA 2D93A 4Y5Z0 4CDWA 5JSPA 1ZRFA 4BPZA 1J58A 3VBRC 3RSJA 1Q56A 4LO8A 1X8EA 1WW7A 1C8M2 1DBNA 1LGCA 4RR3B 4Q4V1 3RYRA 5H9QA 3IPVB 1RUG2 1S2KA 1FMD2 2GH2A 4YZ3A 2GC3A 4MLOA 4AG4A 4A7KA 5A33B 4L2NA 4OHZA 1WLWA 3I54A 4KG8A 4QGMA 3O5SA 4QT6A 4AW7A 3VBSA 1G9DA 3G6JB 2ZGUA 1D4M3 4TYSA 1RMU1 2YUEA 4GH4A 4YZ5A 4SBVA 3ZFEC 1KXGA 2VU9A 2UY9A 2EAKA 4XMAA 4XHBA 4B7KA 2UURA 3C2UA 2VUAA 1HW5A 1H1AA 4Q0PA 2AUYA 2WNVA 5C8CC 1KDKA 1U12A 5I0TA 3M3IA 1V9U3 3H0OA 4AHWA 3KCCA 4Q4W1 3N7KA 5EZWA 5JIAA 1NA1A 2R042 1OSGA 4KU7A 2JG9A 3O14A 1FT9A 4DQAA 4BYYA 1O5UA 3CJIA 1VBD1 3OYWB 4XIKA 5EWSA 1K5MC 4XZPA 3ATGA 4X6QB 4AF9A 3D8CA 4DINB 1GYKA 1REDA 3E5QA 2TEPA 4Y20B 3WDTA 2EXHA 3QH6A 1RUH2 3GBFA 4AFAA 3PVOA 3CU7A 3IKWA 2O1QA 1QNYA 1ULEA 4K21A 2WS91 3VBFB 3VBRA 3MPBA 4HLTA 3WQ1A 2ZS6B 4C91A 1B09A 4W6YA 2A71A 3QBQA 3PMEA 2DF7A 4WBBA 1R082 4V1PA 4WVWA 4IEVA 2IC1A 1ND3B 1F2NA 2HEWF 5FPZA 3LKJA 1LHVA 1UPSA 3SCFA 4OVEA 4QQHA 1LESA 3V0AB 1HQNA 5J7MA 2YMZA 1DQ6A 1JN2P 4EWDA 2GN3A 3D4KA 2JE7A 4D7YA 4GMP3 1NOVA 4N43C 4AEJA 2ARXA 3AP5A 2VVEA 2IFWA 2B8MA 2QVSB 1R091 1OFSA 2B42B 3WW1A 5KC6A 1RUJ1 5E16A 4M3CE 3ZFEA