1LULA

Db58, a legume lectin from dolichos biflorus
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
235
structure length
228
Chain Sequence
ADIQSFSFKNFSSFILQGDATVSSSKLRLTKVKGNGLPTLSSLGRAFYSSPIQIYDKSTGAVASWATSFTANIFAPNKSSSADGIAFALVPVGSEPKSNFLGVFDSDVYDNSAQTVAVEFDTFSNTWDPTSRHIGIDVNSIKSIRTASWGLANGQNAEILITYNAATSLLVASLVHPSRRTSYIVSERVDITNELPEYVSIGFSATTGLSYTETHDVLSWSFASKLPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LECTIN DB58
publication title Carbohydrate binding, quaternary structure and a novel hydrophobic binding site in two legume lectin oligomers from Dolichos biflorus.
pubmed doi rcsb
molecule tags Lectin
total genus 46
structure length 228
sequence length 235
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 1998-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1lulA00
1WW5A 1Z78A 1C1LA 5HCFA 3ZPYA 4FOYA 1W6QB 1GZWB 2AYHA 4Q2FA 4XMIA 4YZ1A 1GBGA 4XBQA 1SBDA 4M01A 4BM8A 4TZDA 4PBOA 1ULDA 3N7KA 3USUB 4AGRA 1G9AA 3O5SA 4XXAA 2GMPA 3WHTA 2NM1A 4YW4A 4MYEA 1W0PA 1MS5A 2GN7A 4DPNA 2JD4A 1LULA 1NLSA 1VALA 1MS4A 1R1ZA 2D3RA 2P3IA 3CNAA 3O0XA 4RA0A 1IS3A 4XJ9A 5DXDA 3TB0A 2DUOA 1QKQA 4TYSA 4U2AA 5GZFA 5T5OA 5JOXA 2ZGSA 2GNMA 1ENQA 3V64A 3W58A 3OYWA 2ZMNA 1Y7BA 2UWCA 3JUUA 1N1YA 2DWRA 4I30A 5E89A 4ASMB 3A0NA 5KXBA 1GKBA 1SLLA 2UWAA 2ZHLA 3QLQA 3D6EA 3PVNA 5IUQA 1HLCA 1W6MA 3LSDA 4R9CA 5DG1A 3OYWB 1G9FA 3WZ1A 2OUHA 3SLIA 5DUVA 1Q56A 3BTAA 4AGVA 2EIGA 1W6MB 2H0BA 1IKQA 3D5OA 3ILNA 5DZGA 2CTVA 1W6OA 3B00A 1SBEA 1F31A 2D6PA 3BOPA 3I4IA 3WUDA 4XTMA 1LGCA 1FATA 1QNYA 1S0DA 4OZXA 4CTEA 3SH5A 3FUOA 5DG2A 3VKFC 4ISRA 2SBAA 2JJ6A 1ZM1A 4XJAA 3WV6A 3JU9A 2DTWA 5GLTA 2CWMA 4XBNA 1V00A 4XE9A 4AGGA 3UJOA 4LBQA 1WD3A 4GALA 1HQWA 1V6KA 2GALA 4Y1UA 1ONAA 1QMJA 4CRQA 4BLIA 1AXYA 3IN9A 3O12A 5IK8A 2AREA 2D3SA 1KDMA 1F5FA 2DU0A 1AZDA 1JHNA 1UZZA 1IOAA 2ARXA 2DV9A 4Z8BA 5GZGA 3AXEA 1Q8SA 1CIWA 3OJBA 4XHBA 4JRAA 2EXIA 2P34A 2NN8A 1BKZA 5EYXA 2A7AA 2PHTA 2JECA 5DUXA 1S0CA 5LK5A 4Y24A 1C1FA 2A3WA 2XG3A 1Q8QA 4GWNA 1GZCA 5DUWA 1DLLA 3WDTA 2CYFA 1LOCA 3WCRA 2ZMKA 1DZQA 2GNTA 1DHKB 1FX5A 1V6MA 4ATFA 3I8TA 3TAYA 4UW6A 5T5LA 3B01A 2DVAA 3KM5A 2E6VA 2WT1A 3H0OA 5GZEA 1MVQA 4BMEA 1OQ1A 1DYPA 4K1ZA 3WDXA 4XILA 4F83A 5CBLA 2CWSA 2DVGA 1CPMA 1UMZA 1JN2P 3N7JA 1JOJA 2NYYA 3WOGA 4AVSA 1LENA 4M3CE 3INAA 4P9WA 5DZFA 2EAKA 1FV3A 1LODA 2KM2A 2CY6A 2AENA 3WDYA 1DQ5A 1LOFC 3Q9OA 4XIKA 3OBTA 5KXCA 1IS4A 3L2YA 2W08A 1D0HA 1V6NA 2NP0A 4YW2A 4YW3A 1CN1A 5JLVA 3WLUA 5F5QA 1UL9A 3AZXA 2P3JA 3WDUA 1LECA 1LGNA 4P9XA 1LHNA 5IK4A 4FOQA 4K20A 2WQZC 3C2UA 4FPEA 5JMCA 4XDQA 4P14A 2DYCA 5BYNA 1W6PB 3AYDA 2R0HA 5H9SA 3AYCA 2DU1A 2GNBA 2YY1A 3OY8A 4PCRA 5T52A 2PHXA 2VW1A 2XB6C 4ISQA 2P3KA 4YZ4A 1DBNA 3RQ0A 4AVTA 3OY8B 1WCSA 4LBMA 4YM1A 3HMYA 4BLJA 1S0BA 3WVJA 2LTNA 4XYXA 2R49A 3PVEA 4YFWA 3B3QE 4GA9A 1A3KA 3AP4A 3SNMA 3A0KA 5CAZA 2VUAA 2GDFA 4YG0A 3USUA 1S0GA 2FHRA 4ITCA 4FPGA 5E8AA 3OPZA 4Q26A 5GLUA 1W0OA 3PJQA 4XBLA 1YO8A 3D4KA 1AX0A 4FPLA 3O0VA 2W52A 4C1XA 1SLCA 1BQPA 1WW6A 4WVWA 4FPJA 3WG2A 1MS9A 4FPOB 3FLPA 5FRAA 1XQNA 3AXDA 1V6IA 4HL0A 4Q1PA 5JOYA 1DQ2A 2R1DA 2EF6A 1IS6A 4XJWA 1G9CA 5KXDA 1QOOA 3AZVA 4WV8A 3WUCA 4ATEA 2EXHA 4GXLA 1I3HA 1A78A 4Q27A 4Y1ZA 3M3CA 3R4SA 4YM0A 5T50A 3VKNA 1WBLA 4YGEA 1N3QA 1LOEA 2D6MA 5JDBA 4XJZA 4YM2A 1DFQA 5GLWA 1EPWA 2D6KA 2ZAAA 2YMZA 1QNWA 2OVUA 2R1BA 2A71A 1FV2A 3ZVXA 1CR7A 1WLCA 2GN3A 3N3HA 3LCPA 3LSEA 2GMMA 4YZ2A 5EXOA 1KITA 2D6NA 3ILFA 4JC1A 4M00A 2EALA 1VAMA 2A6XA 1QDCA 4M3CF 1WUVA 1S0EA 1WLDA 3AX4A 4K21A 3M3QA 1MS1A 2V5YA 2WT2A 2DTYA 1VLNA 3AZWA 2D44A 1JBCA 1KQRA 4FOVA 2ZGNA 3RMXA 2W39A 3T1MA 1ULCA 4BPZA 1WBFA 1I1EA 1SLAA 4XZPA 3O0WA 2WKKA 4UW4A 1PZ8A 2DUQA 5H9PA 1G9DA 4XJ8A 1LOBA 2C9AA 3GALA 1AXKA 3AFKA 3HN1A 3DUIA 1G7YA 1GICA 3ASIA 3B69A 1N47A 3V0BA 2I2SA 4FPHA 1Q8VA 3RG0A 3WG4A 4Q1RA 1SCRA 1UZYA 3AZYA 3NV1A 5T5PA 1LOGA 3ZSKA 2A75A 3V0BB 5H9RA 3AP7A 2ARBA 3N36A 2UURA 2ZGLA 4WZFA 3R05A 4LBNA 2YZ4A 2R16A 2PHRA 1JUIA 1MS8A 3PVOA 2AR6A 3FLTA 5EYYA 3WNXA 1V6JA 2ZKNA 3UK9A 1OFSA 1GYKA 1ULEA 2ZHKA 4DRRA 1GNZA 5SV8A 3FFZA 1B09A 2D3PA 1N1SA 1H30A 2BQPA 5GALA 2ERFA 1MR5A 4XOGA 4Y1YA 2P37A 1LTEA 5IK7A 1LJ7A 4FP3A 1AXZA 1SCSA 2E7TA 2WSVA 1MACA 2ZMLA 1QGLA 2AUYA 4FPYA 4DS0A 4YLZA 2EXJA 2LALA 1HDKA 4PQ9A 4YFZA 1BXHA 1LHVA 1RIRA 4PF5A 2NZ9A 3IPVA 4LBLA 1V6LA 1W6PA 5JVVA 1U0AA 1AVBA 2Z42A 2ZBJA 4K1YA 1DIWA 3VUOA 1UN1A 1MZ5A 1C57A 2ZGUA 3IPVB 4FQ4A 5FREA 4CZSA 1X50A 2ZA9A 5IT6A 1SLIA 1LHWA 4XMAA 1YIFA 1IKPA 1YXWA 2ZABA 2ES3A 4XTPA 1CESA 2PHUA 2UU8A 4FOWA 1N3OA 3BODA 4RL7A 1BYHA 4YZ3A 3OBRA 2VXRA 4R9BA 1S1AA 3ZXJA 1GV9A 3AJYA 4BQ1A 2D6LX 4FP2A 3ILRA 2HYKA 2WLQA 1CONA 3ZSJA 1AX1A 4NO4A 3SITA 1DGLA 3OGGA 2Q5TA 5AVAA 1ENRA 3NWKA 5T5JA 1V6OA 1ENSA 1G86A 2A6WA 1CQ9A 2GMEA 2JE7A 5GZDA 5GJ6A 1YRZA 1LOAA 4Y20A 1MS0A 2W68A 4YZ5A 1GLHA 4Y26A 5H9QA 4YGCA 5JOWA 1JYCA 1LGBA 3KQRA 1URXA 4DFSA 2DVDA 2ZGTA 5T54A 3V0AB 4Y20B 3VKOA 2JDZA 1DYKA 3WG3A 3AP9A 3ZXFA 1BZWA 1FYUA 1ULFA 1TEIA 3WDVA 5CB7A 3POYA 1UKGA 2ZZJA 1N1TA 1BJQA 3WCSA 1KJLA 1LU1A 1RINA 4DQAA 2DUPA 2YROA 5CNAA 5IK5A 4UW3A 1GNHA 3N7MA 3MEPA 1YYNA 2V73A 3AP5A 3B9CA 1QDOA 3FLRA 3ENRA 3ZXLA 1PZ9A 1WD4A 1KJRA 1DQ0A 1LU2A 3ZXKA 2ZGQA 2R0FA 4R9AA 1H9PA 2A70A 1MS3A 1QOSA 1LHUA 3WDWA 4LBKA 4GWMA 4XJUA 1FNZA 1ULGA 1OKQA 3AYAA 4JCKA 5GZCA 3A4UA 1MZ6A 1CJPA 4L8QA 2E53A 1AF9A 2PHFA 1UPSA 1GSLA 3VKLA 4Y22A 2EXKA 2OW4A 4SLIA 3APBA 5GLZA 2JE9A 2VY0A 1LHOA 1S0FA 4Y22B 1GZ9A 2C5DA 1LEDA 2WJSA 4H55A 2ENRA 2OUJA 2YV8A 3AZZA 4LBQD 4M3CA 4P9YA 4AWDA 2ZGPA 4HANA 4Q8LA 4XIOA 2RHPA 5L73A 4D69A 4Y1VA 1W6OB 1VAVA 1LOFA 2D7FA 3AJZA 4M3CB 2A6YA 3DGTA 1S0JA 2DVFA 1QU0A 1J1TA 2A5ZA 4FVVA 2A3YA 3QCWA 2A6ZA 3RMYA 4AVVA 2JKBA 1LEMA 3VV1A 4BMBA 2B7YA 2WNEA 3UL2A 1AX2A 1PZ7A 3N35A 3V65A 3POSA 5F9TA 3MW4A 1JW6A 2AH2A 4FQZA 5GM0A 3SH4A 1FAYA 2DURA 4LBQB 3M3EA 1RITA 2ZACA 4U36A 1SLBA 1GANA 1SFYA 2ZHNA 4Q8KA 1O4ZA 4Y1XA 3NV3A 1SACA 1LCLA 4W65A 5E88A 1Z0HA 1S0IA 3NV2A 4IQPA 4YG3A 1LESA 2DVBA 4C1WA 3IKWA 1JXNA 4YGBA 4DRVA 3U4XA 3M3OA 4WVVA 4XHXA 4BOWA 5HCAA 2VU9A 2YXSA 1Q8OA 1F9KA 2ZGRA 4NOTA 1CVNA 1DQ6A 3ZYRA 3HR9A 3ZYPA 3T1LA 1QOTA 3VKMA 3NV4A 1APNA 3BIWE 3M2MA 1IS5A 4GKXA 4R9DA 4UW5A 5GLVA 3PMEA 3T2TA 1A8DA 4LBJA 2VW2A 4YG6A 2CL2A 4ZKTB 3ATGA 1JYIA 5HCBA 1KDKA 1N1VA 1KRIA 4FPFA 4KBBA 2SLIA 3AYEA 2NMOA 1WW7A 4YM3A 3W59A 1UAIA 3POWA 2A3XA 2G4IA 2TEPA 1W6NA 3UJQA 1O4YA 1CPNA 1QF3A 3MW2A 1YI7A 4FPKA 3IM0A 3FBYA 4ZXKA 3WHUA 4GKYA 1H9WA 3GNEA 3AP6A 2AGSA 4XXPA 1W6NB 3IMNA 4PBPA 3SISA 1NXD1 3ZXEA 2WT0A 4YW5A 3RSJA 2E7QA 2PELA 4LBOA 3RS6A 3MPPG 4YGDA 3FUQA 1N3PA 2ZHMA 4YW1A 1G8WA 5DUUA 5JOZA 1D2SA 1FNYA 2E51A 2ZGKA 1AJOA 2D6OX 2VH9A 1DQ1A 2ZGOA 2A6VA 5T55A 3SH3A 2ZGMA 4FPCA 3RRDA 1WLWA 2D43A 4AYUA 1VIWB 2CNAA 2PHWA 3N7LA 1G9BA 3ZSMA 2NMNA 2VW0A 3R4UA 1HQLA 2UWBA 5CA6A 1C4RA 3WG1A 2WSUA 3MW3A 1HKDA 1Q8PA 3M1HA 3AK0A 1WW4A 5KXEA 2FMDA 1UX6A 2GNDA 3V0AA 1ZA4A 5DZEA 2P2KA 1MVEA 1SBFA 1W6QA 1DQ4A 1GZWA 3ZSLA 1SLTA 5EWSA 1AJKA
chains in the Genus database with same CATH superfamily
1GP5A 2C26A 2GP3A 1C1LA 1QJU3 4HKLA 3ZN4A 5T52A 2RM21 4BXSV 1DGWX 5FZMA 4K9SA 3LEKA 3SEPA 1OA3A 4Z1VA 4XBQA 1AR71 1XOYA 4FFIA 5A7QA 4Z2WA 3O1UA 3MIBA 1ULDA 3USUB 2BGOA 2WFF2 1AR91 4AGRA 4GH4C 3O5SA 4XXAA 2EICA 5FLHA 4YW4A 2QQJA 3MIHA 4MYEA 4AAPA 4EWEA 1GP6A 1MS5A 2GN7A 4PLMA 5ANQA 1NLSA 2GSYA 3CNAA 1R1ZA 4RA0A 3WNNA 1PNGA 4BK4A 3KZ4C 3TB0A 1L7RA 2DUOA 2J1EA 1QKQA 2WZ8A 4OUEA 5JI9A 3SEEA 3NSTA 1Z7S1 5LBFA 1E5RA 2WAOA 3HAGA 5GZFA 1ENQA 3IDEA 1ND3C 3AB0A 2ZMNA 2UWCA 1VBB3 1FMD3 1N1YA 4I30A 2WL1A 5KXBA 1LB2A 3A0NA 5JWPA 5J3UA 4R9CA 3HQUA 4BQ2A 3OYWB 1NXMA 3SCGA 3WZ1A 4TLGA 4W6YA 5F32A 3SLIA 4CCJA 2PQSA 2QZ2A 4YRDA 4EJRA 1EAH2 5JIUA 1W6MB 3UKNA 2H0BA 1IKQA 1RUF2 3ILNA 5C3OA 2CTVA 2GP5A 1HB3A 1SBEA 2VOXA 3JCIA 5JPMB 3I4IA 5LZ6A 4XTMA 3K4AA 2B46X 1R64A 4CTEA 3SH5A 3FUOA 5DG2A 3KV5A 1KXGA 1YIPA 3VBUA 3RZZA 3WNOA 4LLFA 4TWTA 4XBNA 3UJOA 2JDPA 2YHJA 1WD3A 4LBQA 3A23A 5F2WA 1W9WA 1V6KA 4Y1UA 2JICA 4H7LA 2VBBA 1QMJA 3IIIA 1AXYA 2VNOA 4LITA 4DXTA 2AREA 1AYN3 2K46A 2ARXA 2WWSA 5GZGA 3MFAA 4RR3A 4NHYA 2WS92 3LWCA 5FYIA 2D5FA 3BOWA 1EP0A 2GAUA 4DXRA 1W8UA 2NN8A 2D40A 2ORXA 1YQ8A 4MOAA 5K0UC 1UMIA 2VUJA 3OCPA 5JXIA 5ISLA 2WO2A 3RZLA 3E6BA 1Q8QA 3MDPA 1XXNA 5DUWA 5FZ1A 5A3LA 3IDBB 4IEXA 3FHAA 1UOBA 1OA4A 3JBG3 4WM8C 1ZZBA 2Q1FA 3I8TA 5E1RA 4UW6A 5F6LB 2FCTA 5T5LA 3TAYA 5AC91 1LKNA 2DVAA 1WCDJ 2WT1A 1AUYA 5GZEA 1WZXA 3WDXA 1DYPA 4K1ZA 2JDUA 3RI9A 2DVGA 3VHNA 1UMZA 2VL4A 4L11A 4LK7A 1XE0A 2WWUA 3C3VA 2NYYA 4JX0A 5C4WA 5FZLA 1I5PA 5DZFA 1VE0A 3GJBA 1NKGA 3MI8A 4BQ5A 1YWKA 1DQ5A 5KHHA 3Q9OA 4XIKA 4XAAA 4N7UA 1IS4A 2BBVA 1JYVA 1OOPA 2NP0A 4HPKA 2O0OA 3MIFA 1RXFA 1W2UA 4BXFA 2KXLA 4EWDA 5C7GA 2RM22 4YW3A 3TRSB 1CN1A 5FZIA 3WLUA 5F5IA 4QXBA 4IE6A 5I0SA 2PMWB 2ZX0A 1AR72 1OF3A 3NAPA 5AVPA 2CV6A 1UYZA 3J7MA 3PNAA 1NA1B 1AR92 4QDQA 1UXXX 2WQZC 3WEZA 4LULA 1UOGA 4FPEA 5JMCA 2Y6LA 4BQ4A 1D4M2 2R0HA 3ACIA 5H9SA 1QIQA 2YY1A 3D3AA 3EMRA 3IWZA 2RVAA 2J42A 1JODA 2XB6C 4D8MA 5FJKA 1QQP1 1Z7S2 2P3KA 3EBRA 4CP9A 1EUUA 2DBNA 1YQCA 2HWB1 3KCCA 2RV9A 3OY8B 4PF1A 3WVJA 3QOPA 2LTNA 3N9LA 2FDKA 3PVEA 2J7MA 1H6XA 1YEWA 2VUAA 3WY6A 4OMDA 2GDFA 4M4RA 4UFKA 1S0GA 5FYVA 4ITCA 2VGDA 4E27A 5E8AA 4Q26A 5GLUA 5CFDA 2JIGA 1W0OA 4XBLA 4BIOA 1CAVA 5J36A 3T0DA 1HN1A 1AX0A 2P4EA 2IWGB 4A45A 1WW6A 4WVWA 4MGTA 1C8M1 4NWVA 2BPA2 3MYXA 3ZN6A 4Q4X3 5FRAA 5F2SA 4B1LA 1C8NA 5EQUA 4HL0A 2WQ8A 4QM9A 2FMYA 4GJZA 4XCBA 4OI0A 1OT5A 4HZFA 4ZXEA 2QDRA 3RPQA 3OUHA 4XJWA 1G9CA 5A3NA 5FP8A 3I2OA 1AR83 3WUCA 1RUD1 1IPKA 1UY4A 2YU2A 1RUE1 5KR7A 1A78A 4Y1ZA 5T50A 4R4XA 3AMNA 3RZJA 2JE8A 3OSDA 1N3QA 1UOJA 5F5AA 1PIV3 5FCCA 3VBHA 1EPWA 1NYWA 5J37A 2YB7A 4EN6B 2OVUA 4DMIA 4CU8A 3LOBA 1K5MC 1Q5OA 4CU9A 1CX4A 1COV1 1PNFA 2B42B 2E26A 3HPNA 1GQGA 4N43B 2VAUA 3LSEA 5EXOA 3WQ1A 4XFCA 2D6NA 2RDRA 1J3PA 2R071 2WDBA 2A6XA 3Q8EA 4M00A 4ZPIA 1WUVA 5AFEA 3U1XA 1IPSA 5JSOA 5LBEA 2BOIA 4RGGA 1MS1A 2ZOEB 4AI8A 4NHXA 2V5YA 2WT2A 5D8AA 3J7HA 2BTVC 5G05L 4GMP3 3WINE 2VZUA 5AC92 1ZZ9A 1JBCA 3DYOA 4XUPA 3E6CC 2ZGNA 5BPXA 2W39A 4XFGA 2DFBA 5APAA 4AI1A 2UY9A 4BPZA 4P9LA 4XZPA 4UW4A 1HB2A 2DUQA 3P3NA 2EIBA 2C9AA 2YU1A 2ZEZA 4DUWA 3CHXA 4F7ZA 2BNNA 4JGZA 1G7YA 1POQA 1GICA 2PFWA 3CZJA 3B69A 5LASA 4COYA 4AF9A 1GOFA 2WINB 4XAEA 3CZUA 5FMOL 4ORFA 1SCRA 4C0HA 1UZYA 4IW3A 4PDWA 3BIEA 1WCKA 1OKOA 3VDDB 1VBE3 2W87A 3WSOA 3D0SA 1RGSA 5H9RA 4B1MA 1K45A 5IVEA 3AP7A 1WCUA 5DAXA 1US3A 2R061 4YVSA 1L7LA 2UYBA 4LBNA 1RUJ1 1GNYA 5E6HA 2R16A 5FMDA 3W9AA 1PK6A 1UY2A 2AC1A 4AFDA 1HQNA 2QBXA 1MS8A 1RMU1 1QH7A 2ZHKA 3WQBA 1XB9A 1B09A 1SPPB 1YQ6A 2D3PA 5DPNA 5FFOC 1CJDA 3N9NA 2BQPA 3AKTA 4QGNA 3W5MA 3I49A 2HWB2 4DIQA 4XOGA 4Y1YA 5A32A 1PO23 3E1F1 3D82A 3N9QA 3VBUC 3ROUA 5A33B 2EAAA 3HT1A 1YCIA 2ZMLA 4JKMA 2WFF3 1CAUB 1W05A 1PM4A 2W47A 4EN0A 4Q29A 4PQ9A 3S5AA 2J22A 4QPGB 1REFA 1RIRA 1W06A 2NZ9A 3IPVA 4D3WA 1V6LA 3ETPA 3WT3A 3K4DA 1U0AA 1UOFA 3VZJA 4K1YA 3WW1A 2C0ZA 1NQDA 1DIWA 4RR3C 1VBB1 1FMD1 1OLME 4QXHA 5K9YA 1C8M2 2CDPA 4UXAA 3OD0A 3ZYIB 2QCSB 3LDRA 3DEMA 1JYTA 2AACA 4I0WB 1XYNA 2ES3A 4J6GA 1VMFA 2DCYA 4LA3A 1W8FA 3WW2A 1H2KA 3GHMA 3HWJA 4XDOA 2H6CA 3M8LA 4FOWA 1W3VA 4WM7B 5LEJA 1N3OA 3BODA 1RUD2 2JDMA 3THCA 3VDCA 3GGLA 4CCNA 1EAH3 1RUE2 5C71A 5JR7B 2A1XA 2GU9A 1YFUA 4FP2A 1RUI3 2XJVA 2QQVA 3GCWA 3ON7A 3ZSJA 3I3BA 3MLLA 3SITA 3S5QA 4DUXA 3KGLA 5T5JA 4IGQA 4CEWA 1COV2 4BQYA 4Y5SA 2A6WA 1CQ9A 2WBKA 4QB1A 5C4WC 4Y5Z0 5J7MA 4AHZA 2R072 2LRPA 1AYN1 1QJX1 1SHWB 4YGCA 2OIIA 1ZZ6A 5L7OA 4KGGA 1HW5A 3D8CA 4DFSA 4EE2A 2GC0A 1OOPC 1M4WA 3VKOA 1O5UA 1VR3A 4JGYB 5FZCA 5LY1A 5FP9A 1OC1A 1JU3A 2ZZJA 3WXPA 3HNBM 4XACA 3NO8A 4NR1A 3NAPC 2X05A 2YROA 5CNAA 4Q0VA 3ZO0B 4QHBA 2ZTNA 3R0RA 3USSA 5IK5A 2XHNA 1OUXA 1YYNA 2GH8A 3AP5A 3JD71 2BNOA 1KJRA 3S6PA 1NUKA 4LHLA 2R0FA 1OF4A 1QOSA 3LDKA 4I3GA 3WDWA 4FFFA 3CJXA 4MGZE 4OHWA 4GWMA 3C7EA 4NHMA 1MEC3 4LO6B 4PHZA 3VHRA 1REEA 1BEV3 4IGOA 3O1SA 2HWE3 5GZCA 1EV13 4AVBA 4N53A 4OI1A 1UPSA 2R062 3EYPA 1TNFA 5A3OA 4EN9B 2EXKA 4FT8A 1NY71 4QGMA 3G6JB 5I8TA 1AL23 4QQLA 3I2GA 4LO5B 4CXXA 1RMU2 4H3WA 1ULOA 2VY0A 5B4NA 1GZ9A 2WJSA 5CFDC 5HBAA 4FTEA 1TG7A 2LS6A 2YV8A 3PDQA 1X8EA 5FY0A 3RZKA 1OURA 4HANA 1JTZX 4IL7A 1HB1A 4LHKA 3AJZA 2WFPA 1LOFA 1NT0A 4M3CB 4NPRA 2G9ZA 2A6YA 5D1IA 5FZDA 4DNYA 3ZN5A 1POV3 2OZ6A 4FVVA 2A3YA 1AR73 4AVVA 3IZOA 3VV1A 3O1PA 2V4VA 4IE0A 2VZQA 1AX2A 3UL2A 3N35A 5IVBA 2YBSA 1CIYA 1JOPA 1O8SA 4FQZA 4MGYE 1D4M3 4LBQB 1JOBA 1WA4A 4S2FA 1O5LA 5GM0A 4CCMA 2VTFA 4XQWA 5EV7A 2ZHNA 1VBB2 1FMD2 1O4ZA 3VBHC 1Z7S3 3NV3A 2BYVE 3UV9A 4IQPA 4YG3A 2DVBA 3B93A 4OVEA 1JZ8A 3U4XA 5I8SA 5JIAA 3THTA 2Z79A 4NAOA 2ZGRA 4NOTA 3ZYRA 3BTXA 1DQ6A 4XEZA 4E4DX 1QOTA 1KD7A 1OVSA 2Z5WA 3VKMA 3MPBA 3M2MA 3LEIA 2BDRA 3W20A 3T2TA 4XCAA 1F2NA 3VBFB 5D8AC 1A8DA 4Q4X1 4AHYA 3VBRB 5AFBA 1GWLA 1JYIA 5HCBA 1KDKA 1N1VA 4B4QA 4YM3A 2NMOA 1WW7A 4NMIA 1YFWA 4PIXA 2A3XA 4K8FA 1WMFA 3UJQA 4E8DA 1AR81 1YFXA 1W99A 5FPZA 3LPGA 4IEOA 1GUIA 3H9AA 4LLOA 5ANNA 3FBYA 3A21A 4ASLA 5IFPA 4GKYA 1H9WA 1QJX2 1W6NB 3IMNA 4PBPA 4JGZC 1PIV1 1DG6A 3SISA 3C7GA 3A7QA 5BNNA 2C4XA 2MHFA 2PELA 3CJIA 2RG4A 4H2AA 3FUQA 2K2SA 4PDWC 4S2DA 1G8WA 3NNJA 3FN9A 4LNVA 3RWNA 1D2SA 4LOTA 2ZGKA 1OOPB 4HPKB 2P6HA 1DQ1A 1X7NA 3EO6A 5A6QA 1UY1A 3K3OA 3UGGA 1KS4A 4RS5B 4YVSC 3RRDA 4COVA 3GBGA 1QXPA 5FPLA 1WLWA 1V9U3 4AYUA 3LE0A 3EQEA 3ZYFA 2CNAA 2RDNA 1G9BA 3SQOA 3JD72 2NMNA 4IEPA 5IVCA 5I93A 1XE8A 2BNMA 3MW3A 5BNOB 1HKDA 3ZYGA 5I91A 4OFGA 4QQPA 1UIJA 3PUIA 1UYXA 4V2WA 2GNDA 2Q1ZB 2W9XA 3V0AA 2VZTA 4G9SB 4LT5A 5AC93 1ZRDA 2OPWA 3ZPOA 1AHSA 3H1WA 4A6OA 4CDUB 4OI4A 5EWSA 3RGBA 3M7AA 1WW5A 4CP9B 3ZPYA 2WAAA 4FOYA 1NY72 4XZUG 2RDSA 1W6QB 2AYHA 5EJ1B 4Q2FA 2QQNA 2XPJA 3F2ZA 4XABA 1SBDA 4M01A 4AR2A 5KHGA 4LKDA 2QDNA 5JSPA 5HPOA 5FQ0B 5CVRA 5A3PA 5J96B 4KWUA 3IT8A 4UOJA 1HX6A 4A3XA 4X8NA 1JYWA 1TQ5A 2JD4A 1LULA 1VALA 1HIXA 2D3RA 2P3IA 3BVCA 2YPDA 3E97A 3KD4A 3CU7A 4KWJA 1DZTA 4U2AA 2Y6JA 3VLBB 1PM7A 2W1QA 3ELNA 3VN4A 4AW7A 5JOXA 2ZGSA 3KVBA 3JUUA 4DUVA 2XONA 1GKBA 5IUQA 5FY4A 1HLCA 4BIFA 3GDBA 1G9FA 2XJUA 4AFCA 1PO21 4GZ9A 4KQ7A 4LE3A 5DUVA 1W8ZA 2DBIA 1FPN3 4LMFA 5JXJA 2EIGA 4MHRA 2JDNA 2HWB3 2Y38A 3D5OA 4CEWC 1W6OA 1F31A 1Y3TA 3VBHB 4B29A 2XJTA 4RQPA 4DEVA 4OZXA 5FYUA 4JDNA 1FI2A 1W9FA 3VKFC 3BI3A 3MIGA 3HIFA 4FFGA 2FDHA 2CWMA 2JKXA 3LOIA 4N7IA 5L7OC 1F8VA 3LA3A 4AAXA 2OYZA 3ZXAC 2Y6FA 4GALA 2YDEA 3MIEA 4Q4X2 2OKXA 1HQWA 3CL1A 5FMCA 4L92A 1ONAA 2PHLA 3UETA 1RUC1 3IN9A 3AMQA 4CCLA 2YC0A 5FMOS 5BXXA 1JHNA 2DV9A 1IOAA 3AKRA 1W3XA 2VTXJ 1AR82 3ZIXA 1H6YA 4MSVA 3TEWA 1WA6X 5CG8A 3MUY1 4GQ7A 1H8TA 4A7YA 4QHZA 2VBPA 5DUXA 1S0CA 2WNVB 2E9QA 2G9GA 1D4VB 1RUI1 2AZ5A 2QQKA 1RUE3 2VQTA 4Y24A 5F3IA 3TN93 4GWNA 2XG3A 2EVXA 5LBCA 4NIHA 3ME2A 1KFXL 5LCWL 4I0AA 4KMQA 3CQOA 1FOD1 2CYFA 4NHLA 4N53C 4P5YA 4IV1A 3U75A 2ZMKA 1DZQA 4A7ZA 1DHKB 1FX5A 1V6MA 2VQUA 4ZU7A 1XBFA 1QJZA 2QQLA 5KBFA 4NIGA 3B7MA 3MZHA 1MVQA 4BMEA 1OQ1A 3OUJA 4F83A 5IHRA 5CBLA 2W95A 2D93A 4H14A 2VO5A 1JOJA 3WOGA 4AVSA 2RDQA 1LENA 1RJ7A 3BU7A 3PIGA 4IGPA 4M3CE 1LODA 3K4ZA 2LW8A 2O8OA 1P8JA 1LOFC 3J8F3 5LA2A 4CCCA 2HWD1 3OBTA 5CU1A 1D0HA 1V6NA 3VZNA 3U11A 5FY9A 1UW8A 3I54A 2BEOA 4NIAA 3HNMA 1UL9A 1DF0A 5FBJA 5JAXA 4BWOA 3ZIWA 1LGNA 5FOBB 3K2OA 3POFA 5FKBA 1MEC1 4FOQA 1BEV1 4K20A 3Q8BA 2HWE1 4CDXA 1EV11 4P14A 2DYCA 5BYNA 3FZ3A 1NLQA 3VZOA 4P9JA 2Y6GA 3ST7A 4PCRA 1UNBA 4L97A 2JDHA 2PHXA 4N9HA 4SBVA 1BLZA 1AL21 3EJKA 4B4PA 1ZBA3 4AEDA 3LPFA 1PO11 1DBNA 4JQTA 3S30A 4FTSA 3ACLA 4QD2A 2ARAA 5FTTC 2XDVA 5FYHA 4XF0A 1S0BA 1BHGA 3I3QA 5FKCA 5FXZA 3UGFA 1RMU3 5IJRA 2R49A 2PTMA 3B3QE 5IVJA 2IZWA 2ARCA 3A0KA 4OCTA 3C7FA 4JTNA 4KH9A 4YG0A 2VZSA 3WHTA 4CP0A 1ZREA 1PO22 2FHRA 3QH7A 1J59A 4FSJA 1POV1 5FV3A 5IFTA 1ZRFA 3ZLIA 2ZX4A 3OPZA 4KG0A 3O1VA 2XKOA 2C24A 3NRUA 4X6QB 2F6BA 4QXKA 5LA1A 4FPLA 4CXYA 3O0VA 4C1XA 5C8CA 1BQPA 5FYYA 1LRHA 3KMHA 5IATA 3LIGA 2B4KA 4FPJA 1D4M1 1R1A3 1ZNPA 2PHDA 2XJRA 3JZVA 2JDAA 4LO4B 5FY8A 4AI3A 3AXDA 3AFGA 4YVWB 3TWIA 1DQ2A 2XBO2 1OI6A 4KGQA 2JG9A 3ZDSA 3OB8A 3CJIC 1IS6A 1ZZCA 1U5ZA 4WZCA 3AZVA 5IAXA 2FDJA 4WV8A 4BJ0A 4PLNA 4ATEA 1RUC2 3CLPA 3J7NA 4GXLA 4Q27A 4CDWB 2EIEA 2YFUA 3LFMA 5FPAA 5FO7B 3T3YA 3VKNA 4YGEA 2QTWB 1RHI3 2P3YA 3R4DB 4XJZA 2XVKA 4YM2A 1GQPA 4AOCA 2ZAAA 1OFNA 1C5IA 2QFEA 3FMGA 1OLRA 3LIHA 3ZVXA 1WLCA 3N3HA 4QKNA 4NIIA 5EZWA 4ES9A 2O8QA 1RUI2 3G7DA 3NW4A 4CVUA 1QDCA 5FZ0A 2VVDA 1NCRA 2XXZA 4TLFA 2QQOA 1FOD2 3VD5A 2VECA 2DTYA 2ZS6B 1SZBA 2ZEYA 2D44A 4QU2A 4B8EA 3H8RA 1G6NA 1I5ZA 2G19A 4FOVA 4LXLA 4AZZA 2ET1A 3R6SA 1ULCA 2QNKA 1I1EA 1QJX3 1V70A 2JG8A 2VOTA 3U07A 4MVTA 1RYYA 1PZ8A 5ABJB 3S7IA 4XUNA 4XJ8A 3FE5A 2FCUA 1XE7A 5EHDA 1AXKA 5A80A 3AFKA 3HN1A 3T2PA 3KV6A 3WF1A 4XQDA 1UZVA 2HWD2 3K48A 1N47A 1V9U1 2Y0IA 3ECQA 1W8TA 3RG0A 3WG4A 4Q1RA 1NCQA 1B35A 2MEV3 3AZYA 2ILMA 2OA2A 1VBD3 4AFBA 3V0BB 2OQ7A 4CEYB 5FZOA 4NRMA 3JD73 2ARBA 4CSWA 2WR9A 2UURA 1HV1A 3R05A 4CUGA 2PLV3 1MEC2 2PHRA 1BEV2 2HWE2 2VC9A 1H2LA 1EV12 2AR6A 3FLTA 5DAQA 1JUHA 5CKMA 1OFSA 2X8KA 3NJZA 3MLJA 4BCUA 2WNUB 2Y64A 1GNZA 2WC2A 4NAMA 4WVMA 1AL22 2VUDA 5L9RA 3TEYA 4RQPC 1PO12 3HOBA 3AVSA 4W50A 2VTXA 5FUNA 1MZFA 2ERFA 2GC2A 1XNTA 2VOWA 4OUMA 1LJ7A 1Y9GA 3WP5A 3N9OA 2W1SA 4MX3A 3AVRA 3LA7A 1PMJX 2D97A 1QGLA 2AUYA 4KG8A 4DS0A 2LALA 3ZFGB 3AKPA 1PX3A 2R043 4P00B 5F37A 1BXHA 1LHVA 2OT7A 1XYPA 2BBAA 5FZFA 5FPUA 4KWLA 2WA3A 3ES4A 3UESA 4ZHNA 4UBGA 3RZGA 1Y9MA 2JX9A 3CBNA 4OUSA 3VUOA 1C57A 5CFCA 2WRAA 2VQAA 2ADEA 1SLIA 4Q4W1 1LHWA 4GH4B 3LFIA 1H8TC 3CMGA 3PJYA 1IKPA 4AVCA 4XTPA 4W6XA 5LW9A 1FPN1 2B45X 1OD5A 3CDZB 1PGW1 2VUCA 4COUA 1O4TA 4CA9A 4R9BA 2VXRA 1OD3A 4HT1T 3U4SA 1M06G 1HXS3 1S1AA 4IV1C 1ND3B 1GV9A 3AJYA 2VMDA 5HCHA 2HLEA 3ZXGA 1QXRA 1BBT1 3P5BA 3NNFA 1NLRA 1S2EA 2BU9A 4HVOA 1DGLA 3VD4A 4QKBA 1ENRA 3KS7A 1TMF3 3RYPA 1I6XA 2JE7A 5GJ6A 1YRZA 1LOAA 4Y20A 1F4HA 1GLHA 4Y26A 5FYZA 5H9QA 1W04A 3KQRA 1URXA 4GIQA 2DVDA 1XNCA 2BVVA 1H8VA 2ZGTA 3L9JT 2V5DA 5F7UA 3V0AB 1K3IA 2JDZA 3WG3A 3RI8A 5C6CA 3WNMA 5A7PA 4IEYA 3ZXFA 1XPWA 1ULFA 1VB4A 3WDVA 1YC61 1JYNA 4AL9A 2WABA 3TN91 5C9AA 4Q0PA 5FZ3A 5L19A 1BJQA 2WYSA 1ZX5A 5FY7A 2DUPA 2XOMA 3I2KA 2W94A 4UW3A 4CDXC 5A1AA 1XJAA 4J25A 3ZXLA 4XUOA 1WD4A 3LKJA 1LU2A 1VMJA 2ZGQA 2A70A 1H9PA 1IG0A 1V9U2 4LBKA 4AEDC 1SMVA 2YGLA 3AL5A 3PL0A 2TBVA 5K0UB 1ULGA 3WQ0A 1OKQA 4JCKA 2BJSA 4LORA 3N4MA 5K4LA 4HG6B 4UFJA 5JXGA 2E53A 1AF9A 2FD8A 1JHJA 4LO7A 3VKLA 4Y22A 4CPBA 1VBA1 4UF0B 4SLIA 3J8F1 1H0BA 5GLZA 5LK7B 4WM8B 5I0UA 1NE4A 1S0FA 2C5DA 1VJ2A 2QJVA 2YFZA 3AZZA 3GZTB 4LBQD 5LBBA 2YBPA 5C8CC 2ZGPA 4XF1A 2FQPA 4Q8LA 2RHPA 3GCXA 4S2HA 1W6OB 1XYOA 2TNFA 4RD7A 3ZFFA 2DVFA 2QE3A 3HBKA 1QU0A 1J1TA 3BGAA 3RMYA 2JG9C 1SQ4A 2JKBA 1LEMA 4NN0A 4Z82A 3KB5A 1NX9A 4AVAA 1DCSA 5A3MA 5F1RA 3NL1A 1ZBA1 3PVBB 2X10A 1ZRCA 1J1LA 3PUHA 5CEHA 1FAYA 1RITA 4U36A 5FAXA 3BTYA 4GJYA 2E31A 2QQPA 2Q8CA 1GANA 2MNGA 3C7HA 5FZ9A 3ZFEA 4Y1XA 3J4UH 3GJAA 4HXCA 4W65A 5CZKA 2LM3A 4E2SA 4Q4W2 4BYYA 1HRV1 1GQHA 4YGBA 2MPFA 5HCAA 1FPN2 3LEMA 4FXKB 4UAPA 2VCCA 1F9KA 1H8TB 1PGW2 1CVNA 4MV2A 5A7WA 5T3NA 2PAEA 3ZYPA 3H3ZA 4Z92B 4UFIA 1NCRC 3GZUC 4TSVA 1APNA 3M3IA 3MUZ1 1IS5A 1TME2 4R9DA 2DCTA 1R1A1 2VQ0A 5GLVA 2VW2A 2VZRA 2WN2A 1RB8G 2JB4A 5EFUA 1BBT2 4KBBA 3WW4A 4K6BA 4L9BA 3KT7A 4ET7A 3BB6A 1O4YA 2JG8C 2RE9A 2XBO3 2VNVA 4H7MA 1QF3A 5C9AC 1YI9A 4FPKA 1K42A 1CAWB 4KBZA 5C3RA 2XHKA 3GNEA 2AGSA 2X5IA 1RHI1 3DPRA 3M70A 1TZOA 1RUC3 2WT0A 3OBAA 2HWC1 1S4CA 4LBOA 1ND2A 1NCQC 3MPPG 2ZHMA 3GBWA 1B35C 2PYTA 4YGDA 1RTVA 3WNKA 3I59A 5DUUA 5C5UA 3DN7A 4NPLA 1FNYA 2E51A 4HN0A 5FIXA 2BZDA 2D6OX 2ZGOA 5IWFA 3TN92 3DXTA 4IV3A 1ODMA 4FPCA 4KNCA 5T55A 3SH3A 4G3YC 1CAXA 3AMHA 1UZ0A 2Y8KA 5DDJ3 1R091 3ZSMA 2VW0A 5CA6A 1HQLA 3H42B 3NQHA 4M4PA 4JKLA 1SFNA 4MXWB 4B7KA 4TTGA 3M1HA 4HKWA 4OQ8A 3WP6A 2J1TA 5FWEA 3VDAA 1FOD3 3V56A 5I0RA 1K5MB 5KXEA 1UX6A 2IXHA 1GOGA 4QDRA 1PHMA 3QACA 3PUAA 5KC5A 3ZSLA 5KC6A 3AM2A 2P17A 3OPWA 1JU4A 4AEDB 4O61A 3RNSA 3TNPB 2X29A 1RVF2 5FK8A 5HCFA 1VBA2 3BALA 2UYAA 2WQ4A 3J8F2 1GZWB 4CE8A 3I2HA 4MO3M 4E4HA 2QVSB 4IESA 4YZ1A 4W8JA 4BM8A 2LUWA 4PBOA 2MEV1 3N7KA 4RSUA 4DY5A 1G9AA 2HEVF 2HWD3 2W91A 1IZ3A 1GP4A 4ONUA 1VBD1 2NM1A 2XUEA 3HNYM 3OOXA 1HB4A 5DN2A 1W0PA 3EXUA 5B4XA 4IEZA 2XQXA 3SC7X 5CFCC 1ZBE1 3IAPA 1MS4A 4XJ9A 3O0XA 1IS3A 2PLV1 5JZGA 5DXDA 3WF2A 3KCXA 1UU6A 5C8CB 2Z4FA 4XF3A 1VMHA 2WA4A 3W58A 3OYWA 1Y7BA 1IQDC 2FCVA 2DWRA 2Q0AA 5E89A 4ASMB 1ZBA2 4XFBA 2UWAA 5KHKA 4MH0E 1R081 3QLQA 3D6EA 3PVNA 4QQ2A 4JZRA 3EB7A 1W6MA 3FWEA 5DG1A 4C91A 4AHXA 2IVJA 5EJZB 3OPTA 3WF4A 4NVPA 2D98A 4B7EA 4ZU5A 4AGVA 1PO13 3ETQA 4IEVA 2Z2SB 5DZGA 4CCKA 3B00A 4KL1A 1HRV2 5EJ3A 3VZMA 3MBWA 2R041 5C5TA 1RL3A 2D6PA 3CF6E 2DFCA 4K8RB 2HKXA 3WUDA 1QNYA 4A41A 5FO8B 1S0DA 4ZZ8A 3THDA 2BFUL 2JJ6A 3WR0A 4P08A 3SHRA 4QX7A 3WV6A 3JU9A 2DTWA 5GLTA 2HBUA 4HN1A 4XE9A 3TNQA 1R1A2 3WF0A 5HXVA 3MIDA 3URFA 3VBUB 2FBEA 2ZJCA 3MGUA 2G1MA 4HVRA 3LEGA 4IE5A 4CRQA 2YC2A 4BLIA 3KV9A 3I2JA 4K3UA 1C28A 2D3SA 5IK8A 1F5FA 1HJFA 1OLMA 1DZRA 1AZDA 1FXZA 4YPJA 3HT2A 4Z8BA 3WX5A 1Q8SA 2GC1A 1J3QA 1CIWA 2HEWF 3OJBA 5F6KA 3PTYA 4XHBA 2EXIA 1HXS1 2P34A 5A6XA 5DQ0A 5EYXA 2VG9A 4RR3B 1RHI2 2PHTA 4MGSA 5FPVA 5LK5A 1UQXA 5FPXA 1KS5A 2RMU2 2HWC2 4JDOA 1L7QA 3KCYA 5A1LA 4AI2A 2YC4A 1A34A 1W2AX 3RJ2X 1J3RA 3BPZA 4XETA 2Y26A 1TMF1 1EPZA 4ATFA 2GNTA 3HVDA 1CGPA 2RS53 3B01A 5LY2A 2XL9A 3KM5A 2E6VA 5FYBA 2RR11 3I2FA 1R092 2JXAA 1GFF2 1YHFA 3NJXA 4XILA 2VNGA 2CWSA 1U5IA 1TNRA 1CPMA 2WNOA 4QB6A 4E2GA 1JN2P 3N7JA 1K5JA 4Q4Y3 1CZTA 1T6BX 3J9SA 4TN7A 5FDBA 3WDYA 2KM2A 3MV01 2AENA 4LE4A 4F8AA 1NZCA 4LPLA 3ZFFC 4EROA 5KXCA 5C4WB 5C70A 3L2YA 4GB31 5I8YA 4QT6A 1ZZ8A 5DAWA 4YW2A 3ES1A 4DXSA 2ETEA 4EN7B 2BP6A 3LGRA 1NA1A 5F3CA 2DF7A 5F5QA 3AZXA 3DECA 1ZRRA 2P3JA 3WDUA 1XU2A 1LECA 4O7XA 4P9XA 3T0BA 2MEV2 1LHNA 2D5HA 4AG4A 1SEFA 1UKRA 1PK6C 1VBD2 3C2UA 3H3LA 2HBTA 1SG3A 3ZFEC 1U12A 3T2OA 1ZBE2 3AYDA 3NAPB 5K8SA 3MV11 5J1XA 2GNBA 4OULA 5FP4A 1T2XA 3OY8A 2PLV2 2ZEXA 2VW1A 4QB2A 5A7OA 4AE2A 4A3ZA 3VBSA 1JZ5A 4AVTA 2C1FA 1WCSA 3POIA 4HSJA 4LBMA 3ZX7A 3POEA 4PQQA 2VOVA 4LKEA 3O1MA 1R082 1A3KA 2NPIA 3AP4A 4OZOA 3GZEA 4XQ4A 4TXWA 4KU8A 4ZS2A 3LDBA 1DYOA 5G04L 1JYXA 3K46A 4O65A 3VL9A 4ZU4A 1UXZA 4FPGA 3OGRA 1DGRN 5FUPA 2RJ2A 1ZZ7A 5FXXA 3PJQA 3D4KA 2FZ1A 4OMCA 1XSRA 2R042 4MZUA 4R4ZA 2J1UA 1OMIA 1SLCA 3WNPA 1O3SA 5CFDB 3ALQA 4MG2A 1CAVB 4YWAA 2BUKA 1MS9A 4FPOB 3RZHA 3FLPA 1JS9A 5FP7A 2X5IC 1XQNA 4ZS3A 2OXBA 4A44A 5JOYA 2XVLA 1OLQA 3DPRC 2GH2A 5HI0A 1PVC2 2R1DA 1W2OA 1NE6A 1YJKA 2EF6A 2Q1MA 4QPWA 5F8PA 3ZN6B 4AEMA 2K9ZA 1DU3D 1GU3A 1ND2C 1UYPA 4QQHA 5BUVA 3T2QA 4DB5A 4CUBA 1HRI1 2EXHA 3VZLA 2JEMA 3R4SA 4YM0A 4HFSA 4IV3C 4Q4W3 4UFHA 5HV4A 1STMA 4LUMA 2D6MA 3NKGA 5FY5A 5JDBA 1QJFA 1UF2C 4N43A 1DFQA 5GLWA 2YMZA 1QNWA 2VMEA 2R1BA 1HXS2 1O3TA 3FC0A 5FZEA 1FV2A 1CR7A 1W90A 3N9PA 3LCPA 1X9PA 4UFMA 1KITA 1KGYA 1ODNA 1TME3 3BN6A 1ZYBA 3ILFA 4JC1A 3ORJA 4ARYA 2CAVA 4FFHA 4M3CF 5LB6A 5A7NA 3ZYJB 3AX4A 1WLDA 1W8WA 4B4RA 1BBT3 2OZJA 4HSLA 2XBO1 2IVIB 3M3QA 2F17A 3DKQA 4K21A 4CYDA 1TMF2 2CGPA 2I45A 3AZWA 2IC1A 1KQRA 2RR12 1V0AA 4QU1A 1O8PA 4UI9L 4AFMA 3RMXA 1RC6A 5D8AB 4FTBA 2YGMA 1OHFA 1SLAA 3O0WA 1W0NA 2WKKA 5FLJA 1F35A 5EIYB 1W8OA 5H9PA 5A6ZA 1LOBA 4DZGA 3ABZA 1Y4WA 4AI0A 3EHKA 2BOJA 4OYUA 1IG3A 4FAHA 3VDDA 3ASIA 3L2HA 5JZGC 3VD9A 2ADDA 5DDJ1 2I2SA 3ACFA 4GB32 5LEKA 1Q8VA 2JDYA 1S55A 2W92A 5FO9B 1W9SA 5CKNA 4JGZB 4D7TA 3NV1A 1SDWA 2XMLA 3ZSKA 3WP4A 3KT4A 4COZA 2F4LA 2W3JA 4JAAA 2B9UA 4XF9A 3N36A 4PDWB 2ZGLA 4WZFA 1GR3A 3I2IA 3KLSA 4GMP0 5JCTA 4AQ6A 2B9VA 1SPPA 3KGZA 3PVOA 4KWKA 5DMYA 4Z2AA 1D0GA 1V6JA 2ZKNA 3WNXA 4YVSB 1ULEA 3FFQA 2IXJA 2O14A 3T30A 1PK6B 4QMAA 5FYMA 3ZFEB 4RHV1 3PU3A 1AYM3 5FUIA 1N1SA 4JDMA 3VZKA 1RVF3 5A33A 4C0BA 4LTAA 5GALA 3KT1A 1VBA3 2BWCA 2VE1A 1VPHA 1MR5A 1CAUA 1LTEA 4Q0QA 4FP3A 1X82A 2WZPP 3CO2A 1SCSA 1UPIA 2IXCA 2WSVA 4QPGA 4BU2A 4FO9A 5KHIA 5A7WB 3J7LA 5FXWA 3T4VA 5A32B 2EXJA 1HDKA 1W8HA 4YFZA 2WZR3 1E57A 1ENXA 4LBLA 1UD1A 3W5NA 1CWPA 1W6PA 1W2TA 1AVBA 2Z42A 2XR4A 4QX2A 1OXCA 1WMDA 4PI0A 3ZKUA 3OG2A 3U0ZA 1MZ5A 2ZGUA 3IPVB 3P1IA 4CZSA 2ZA9A 4D0QA 5BNPA 1FT9A 2P6CA 4XFHA 3NNLA 3M4FA 2QQMA 4WM7A 1YIFA 4XMAA 4E4SA 3TBDA 1YXWA 2BERA 1E5HA 2W1WA 4NRPA 4FAGA 3POBA 2YPJA 4DO0A 4MADA 1CESA 2WYFA 1O59A 4I0BA 4HONA 2UU8A 4F3JA 4XFAA 2CGOA 3OUIA 1K12A 4RL7A 3VHPA 1VB2A 2DCJA 3T0AA 2OS2A 2JDKA 1HRI2 3IDAA 3POGA 3S57A 2ATFA 1BVVA 3AMPA 4OLLA 3ZXJA 5CG9A 4MGIE 1XRUA 2V72A 4BQ1A 1HRV3 4NUBA 2XGXA 1VAKA 2JENA 4CXWA 5CISA 3HQRA 2HYKA 3ILRA 4BDVB 1HV0A 2IFRA 1U5YA 1KFUL 3RYKA 4BE3A 3VDBA 4D6SA 3OGGA 5AVAA 1V6OA 1ENSA 1G86A 2R30A 2Y0OA 4LJHA 2VMGA 3HEIA 1MQTA 2GMEA 2IUWA 4CEWB 3CKHA 3WW3A 1WMEA 4YZ5A 5F5CA 4JGYA 3ZDVA 1LGBA 1QWRA 1BCXA 1VRH1 5FBZA 4OHYA 3D0JA 5T54A 5BNNC 3E6DA 1DYKA 2C9KA 3GHNA 3AP9A 5C3QA 1BZWA 1C5HA 5L7OB 1NA1C 1TEIA 1WCQA 3ZKYA 2CDOA 4ASKA 3POYA 1GZTA 1N1TA 5FY1A 3WCSA 1KJLA 5CKQA 1PVXA 3J26N 2QQIA 1JZ7A 2RMU3 2HWC3 4L2NA 2V73A 3B9CA 1DGWA 2BGPA 1QDOA 3FLRA 3ENRA 3HBZA 4Q0SA 3WF3A 2RS51 1DQ0A 1QJY1 3ACGA 3VD7A 3ZXKA 4R9AA 1DLCA 4FXGB 5L36A 5DDJ2 3KHCA 1U5XA 3PMSA 4JQRA 4O9EA 3VBSC 2J1VA 4OI2A 1X8MA 1TVGA 1W8NA 1JH5A 1Q43A 1FNZA 2W0XA 2WZEA 4XJUA 5JZGB 3MF9A 1NQJA 2EA7A 1R093 3DYPA 4Q4Y1 4L8QA 4EV0A 5LRRA 2QUOA 2RS13 3KF5A 2ZX3A 3O7OA 1AR63 4GWJA 2BFUS 1NAEA 2OW4A 3APBA 4MUVA 4OHVA 4N53B 2JE9A 5FZ8A 3TYJA 4CUAA 4D6RA 1LHOA 2W5FA 1VRBA 1LEDA 4DEQA 2ENRA 1OQDA 4AWDA 4M3CA 3SKVA 4RHV2 4XFIA 5A70A 2RS33 4GWIA 1CZVA 1NOVA 4XIOA 1QY4A 5L73A 3ZM8A 2BWAA 4D69A 3VD3A 2D7FA 5FK7A 3SKJE 5GKAC 4LKSA 3TEXA 1S0JA 2Q30A 4YW6A 3QCWA 4UT5A 4E9KA 3LQCA 3WNLA 4D7SA 5A3WA 1E5IA 3TEZA 2W1UA 1BMV1 2WNEA 4P5HA 1MZEA 1PZ7A 5BV6A 3A22A 2I07B 2HH9A 2QZ3A 2R7EB 3I97A 3MW4A 2RJLA 2AH2A 4HK8A 4GAZA 4LA2A 1ZBE3 4URAA 3C7OA 3M3EA 2VULA 4YYOA 1QJEA 2YYOA 4D94A 2AEZA 4NE9A 1SLBA 1SFYA 4DINB 3HN3A 3K77A 4N43C 5C33A 1LCLA 5F3GA 1S0IA 3QH6A 3KQ4B 3AKSA 4YNIA 1LESA 1D2QA 2OPKA 3LA2A 4BQ3A 1JXNA 4DRVA 4WVVA 4OQ9A 2C6SA 2E63A 4XPVA 4BOWA 1R083 4I01A 3OGVA 3PIJA 4HBNA 2VU9A 1Q8OA 2UY8A 3SMHA 4Q5OA 3VBFA 3PHMA 3T1LA 3VBRA 1POV0 3BIWE 5FXVA 1W9TA 1H2MA 4UW5A 4MXVA 1YFYA 3JQXA 3PMEA 4YG6A 4P9GA 4ZKTB 2RJKA 2BGCA 2VVEA 5FWJA 4FPFA 2SLIA 3AYEA 3UT0A 2R32A 2VCBA 3IB3A 3W59A 1ST8A 1RUH1 1UAIA 4FI9A 1W6NA 4C90A 2YG0A 4LKFA 3NJVA 1PVC3 3MW2A 1YI7A 3WHUA 3AP6A 4CP1A 3DL3A 1J83A 1MPXA 4HETA 2JB8A 1RUG3 2WO7A 3VDDC 3ZXEA 4YW5A 1O6UA 1VRH2 3HD8B 4Q4V1 4QX1A 2E7QA 5JUVA 1JZ2A 2YBKA 3RS6A 3B94A 1N3PA 4RS5A 4YW1A 2Z69A 1EY2A 4X8PA 5JOZA 1S2KA 1HJGA 1DDLA 2KD7A 1TME1 3CJIB 4MGKE 4ZY9A 5BNNB 1PMHX 4QPIA 3DCQA 3RFRA 5C3SA 3RDIA 5BNOA 4G4FA 1QH6A 4A42A 3R4UA 2UWBA 4IEUA 3AKQA 1C4RA 2RS52 2WSUA 1QJY2 3B5LB 3KVAA 4N8MA 3AC0A 4BQXA 3AK0A 4CDQA 4YSFA 1DGRA 4W6WA 4CDUA 4B3NA 3RJRA 2FMDA 3O1TA 1ZA4A 2XKPA 4BISA 3PTRB 1SBFA 1SFPA 1DQ4A 1W6QA 2RR13 4IDZA 4Q4Y2 4RGKA 3VBSB 5A6YA 1X33A 4QPGC 1D7PM 1Z78A 2O1QA 1UWWA 2J1AA 2LROA 3IDCB 2CGNA 4COWA 5FQ0A 4V2VA 2WLPA 4XMIA 4OHXA 5J48A 1GBGA 1IGOA 5ACA1 4URTA 4TZDA 5F39A 1O3RA 4RN5A 1A6CA 2JIJA 3U10A 3IAQA 2GMPA 1LNSA 4HK9A 4GB33 4DPNA 4AEJA 4BHPA 3K3NA 5BNPC 1PX4A 3KSCA 3QBQA 1RUOA 4Y4YA 3KV4A 4FCAA 4LO8A 4QX3A 4WM7C 2AEYA 2XL7A 1H4HA 4TYSA 4JV4A 4A7KA 5T5OA 2GNMA 1W03A 2J1RA 3VHOA 2Y34A 2CSGA 3V64A 1UY0A 5FZHA 3U14A 1BMV2 5FYTA 4ZONA 4NIDA 1AYM1 4BQWA 1SLLA 3WD5A 2ZHLA 3LF7A 1RVF1 3DV8A 2VXJA 2VCAA 3CEWA 3LSDA 3GZAA 3S7EA 3GBFA 3B9IA 2OUHA 4CCOA 1Q56A 3BTAA 4NROA 2XLAA 4LOSA 2DCZA 1ASJ3 2VNRA 3OGSA 5DAPA 3W21A 1DP0A 4XUQA 4A4AA 5FYCA 4QXCA 3K75B 2FDIA 3BOPA 1WKYA 1LGCA 1FATA 2WZR1 4GULA 3BYWA 1MQTC 3FL7A 4Z07A 3DKWA 4A6SA 5FZGA 4ISRA 4RFT0 2SBAA 1ZM1A 4XJAA 5LA9A 3LD8A 3C8XA 4JGYC 1J84A 1ALYA 4M0NA 4RQPB 3O1OA 5LATA 1V00A 2Q8EA 2BVBA 4AGGA 1Y9QA 5CADA 4HMZA 2GALA 2FZ2A 1NG0A 2FDFA 5F3EA 5FOJB 3O12A 2VBDA 1KDMA 4IEWA 2DU0A 1UZZA 3NNMA 1RUH2 3H1MA 3Q8CA 3AXEA 1W2NA 2HYXA 1H4GA 2VMCA 2WNVA 4LHSA 5D2AA 2XUMA 2HWF1 4JRAA 1VBC3 2XJQA 4Q0UA 1BKZA 3B02A 4HOOA 3I7DA 1XU1A 2A7AA 3MO4A 2JECA 4I02A 4Y4RA 1S2BA 1HRI3 2ZX1A 3DF0A 4R52A 4Q4V2 1XC6A 1C1FA 2A3WA 1JI6A 1GZCA 2JD9A 1DLLA 1OUSA 5E16A 3WDTA 3WCRA 1LOCA 4XDPA 4QDSA 5KWRA 1RUNA 4GD4A 4MGQA 4UWDA 1OH4A 4CU6A 2ZPXA 2WN3A 4P02B 5L9BA 3H0OA 3QD6A 4K7JA 4IV1B 3ZYHA 4IUGA 5M0TA 1W39A 1UU5A 2ET7A 1QJU1 1X9TA 2Q8DA 2R6QA 3OBZA 3IBMA 2E7AA 1QQP2 5D21A 5K7PA 2J1SA 3INAA 4P9WA 2EAKA 1FV3A 2HEYF 3BU0A 2CY6A 1UMHA 3FHQA 4KI5M 1WWYA 4QGLA 2Y6KA 2XQRA 2RMU1 2W08A 1UZWA 1L3JA 1BK0A 4XFFA 4AQSA 3AL6A 1BVP1 3DYMA 3H8UA 3Q8AA 3VBOA 3E5UA 3MF6A 4AK3A 4J1WA 3VGIA 5JLVA 3BPSA 4QX8A 1YLLA 5ACA2 3I3MA 4DOUA 5JMOA 4JHTA 2E32A 3OTFA 2VZ3A 5IK4A 4I09A 1JZ3A 2ZXQA 4QKDA 4XDQA 5CYYA 2RS11 1W6PB 1AR61 3AYCA 2N7GA 2DU1A 3WP3A 4XW3A 4QKFA 1C3HA 3OEAA 4CDXB 4ISQA 2G9FA 5BNPB 3CIHA 4YZ4A 5TSWA 2B8MA 4META 3RQ0A 3NKTA 2P5BA 4YM1A 3VBFC 3HMYA 4BLJA 1F15A 1LR5A 3VBRC 4XYXA 4YFWA 4AHWA 1AYM2 2RS31 4GA9A 3SNMA 1RUF3 3PU8A 5FZ6A 2XWJB 4D6QA 5CAZA 2OX0A 1QHDA 3USUA 4RHV3 3HJRA 2XJSA 3LAGA 2ZCWA 4JRLA 5FYSA 1YO8A 2VZOA 2X09A 1EUTA 4LUKA 2W52A 4YVWA 4CCDA 2EIDA 3N9MA 5JSRA 2WZR2 3WG2A 2H6BA 5FJHA 4AI9A 1ZVFA 3MFCA 4Q1PA 1V6IA 5LRSA 5IVFA 1RJ8A 1MQTB 2Y6HA 3ZSEA 1UU4A 4J1XA 4EN8B 4CDWA 4BB3A 2PA7A 1W28A 4INDA 4RS5C 2WS93 5KXDA 1QOOA 1OH3A 2JG9B 1YUDA 1T6GC 3BTZA 1JZ6A 1I3HA 3M3CA 1XNBA 1HN0A 4PT6A 1WBLA 4QPIC 5L9VA 1LOEA 4EYUA 2D6KA 5BNOC 2IFWA 3JBG1 3X29B 1TE1B 2HWF2 4Y5TA 1XSQA 4N9IA 2A71A 2NQYA 3O1RA 4CPBD 4YZ2A 2GN3A 2GMMA 4IERA 2XH6A 4CDQC 5J98B 2XJPA 4IETA 4CDUC 5J09A 2EALA 1VAMA 3NNGA 3KF3A 1S0EA 4N90A 5I0DA 4EWAA 1GOHA 5JXHA 2HJIA 2BW8A 2VVFA 1PVC1 4NHKA 3UGHA 4UFLA 2PAKA 1VLNA 3NMBA 1F4AA 3P3PA 1RUJ2 5LWBA 1NCRB 1OSGA 2TUNA 1RUG1 3JB4C 1YJLA 3NJYA 5ABJA 3GM8A 3HQXA 3ITQA 3T1MA 1QJU2 1WBFA 4XURA 5KHJA 2F4PA 3U37A 4A2UA 3ZOIA 4WBBA 1VRH3 1ACCA 1PMIA 4CUCA 1G9DA 4X6RB 3GALA 2RM23 4QWNA 3ZR5A 5FR3A 4I3PA 2JG8B 5FLIA 3H8XA 3DUIA 3H7JA 2WUHA 5EP9A 3V0BA 4CEYA 4FPHA 2PQQA 3ZXDA 5I0TA 3GF6A 4NPMA 4KU7A 1AR93 3GYDA 5T5PA 1LOGA 2A75A 2Y60A 4LHNA 2KA3A 3GXUA 2ZZQA 4HLTA 4LR4A 1CZSA 1NCQB 1B35B 2VMIA 2CHHA 4V1PA 1RXGA 1QJY3 2WNUA 2YZ4A 1JUIA 5FZOB 3BCWA 5EYYA 3UK9A 2RS12 2QQUA 1GYKA 1AR62 3UKTA 2CU5A 2K0GA 4DRRA 5SV8A 5DABA 3FFZA 5JPNB 5JI7A 5FZAA 3KWVA 3U78A 4E2QA 1H30A 2ZX2A 4EZ4A 2VCMA 3THPA 4EZHA 3JB8A 4HKOA 5LA0A 2NLRA 2P37A 4WVMB 3ZFGA 5IK7A 1H2NA 3PUQA 1AXZA 4IXLA 4QPYA 2E7TA 1CX1A 1MACA 3BUCA 2RS32 4QX0A 4BA6A 4DXZA 5FPBA 4FPYA 4L0PA 4YLZA 3BKZA 2DCKA 1REDA 4PLOA 1UX7A 2I74A 2BV4A 4PF5A 1IHMA 1O7FA 3H1YA 4ZZ5A 4R8HA 4Y3OA 4MLOA 4IE7A 5JVVA 2ZBJA 3UYJA 4GH4A 3OGJA 3TOJA 1UN1A 4QQOA 1IQAA 5FREA 2WNVC 4FQ4A 2GC3A 1X50A 2VZVA 3SCHA 5IT6A 2E33A 1AYN2 3T08A 1KEXA 1UCXA 3Q8FA 3NVCA 2ZABA 3UKVA 2B39A 5CFCB 3ZMNA 2ZEWA 4LEJA 2PHUA 4NJ4A 1ASJ1 1PGSA 1ND3A 2XVGA 3FBMA 2PN5A 4UBHA 1BYHA 4YZ3A 3RZMA 3OBRA 5EPAA 4YARA 3H8OA 1LAJA 5FP3A 1H1AA 2ID4A 4M0HA 2D6LX 2W2IA 1QXJA 2VZ1A 5C8WA 2WLQA 1CONA 5IVYA 3JBG2 1AX1A 4NO4A 4LIVA 2VMFA 4IEQA 4QPIB 1F5JA 2Q5TA 3NWKA 4GMP1 3ZMOA 2JWPA 4RFRB 5GZDA 1XNDA 1YQ2A 2V4AA 2FDGA 4FBFA 1MS0A 2W68A 3I2DA 4CDQB 4EQVA 5JOWA 2VMHA 1JYCA 4XF4A 5FZ4A 4K40A 4E8CA 3E5XA 3H50A 1VBC1 1XNAA 2PXJA 4Y20B 1RUH3 5IAVA 3F95A 3VBOC 5HXMA 1FYUA 4QAWA 5BNQA 4UYBA 1RUG2 3WQ7A 5CB7A 2L9LA 1UKGA 2PAMA 5A3UA 2ZAHA 3VL8A 1WGPA 4OHZA 1EYBA 2IXKA 2QQWA 4PJYA 1LU1A 2OQ6A 1RINA 2XLGA 3H7YA 4DQAA 4I2OA 1O3QA 1VBE1 3JQWA 3IMMA 2P1BA 1GNHA 3N7MA 1OVPA 3MEPA 4Q4V3 4AQ2A 4NWWA 4CU7A 1Q3EA 5BY5A 5C9AB 4O9GA 1PGL1 1PZ9A 2GZWA 1I9RA 2W46A 1XNKA 5K0UA 5SV5A 1ZRIA 1MS3A 2WIIB 1LHUA 3MHZA 4MHUA 1NZIA 2H0VA 4JHZA 3RYRA 3UNPA 3I3EA 3S0MA 3LZZA 2BRTA 4UF0A 4XVHA 1JMUB 3AYAA 1VP6A 2ZKLA 1MZ6A 1CJPA 3A4UA 4L99A 2PHFA 3K51A 4JVAA 4RGAA 4WM8A 4S2GA 5FZBA 1GSLA 4AXOA 4XUTA 1QQP3 4AQTA 2WO1A 2Q4SA 2VOKA 2XWBB 4H55A 4Y22B 2OUJA 2WFF1 4XC9A 1OPOA 4P9YA 1O91A 5CIRA 4YVWC 1UIKA 1ZA7A 1GWKA 5ERLA 1QEXA 4PI2A 4Y1VA 1VAVA 3DGTA 2A5ZA 2VR4A 3POJA 2A6ZA 5ACA3 4NRQA 4JKKA 5FMBA 4W4ZA 4CDWC 3DXUA 3ZFFB 4BMBA 2B7YA 2Y33A 3FJSA 3V65A 2IXLA 3POSA 4QM8A 5F9TA 1JW6A 2VZPA 4IE4A 1C8M3 4LIUA 3SH4A 2DURA 4AFAA 3O14A 5A7SA 3SCFA 3T4HB 3T09A 2ZACA 1JZ4A 3OEBA 1GWMA 3SXWA 3ZR6A 4Q8KA 4BZ4A 3ACHA 1EAH1 1SACA 5E88A 1Z0HA 1W9YA 2WO3A 1RUF1 1OA2A 3NV2A 4AEKA 4C1WA 3IKWA 2VPVA 1Y43B 1PIV2 1RUD3 1OPMA 1H1MA 3M3OA 4LQRA 4XHXA 1H1IA 2VJXA 5A3TA 1ASJ2 2YXSA 3P6BA 5B2GB 4BK5A 5JR2A 3HR9A 4HVQA 3PUSA 1UO9A 4JTOA 3NV4A 5C3PA 2WWJA 4Y33A 4GKXA 4WVZA 5IYYA 1COV3 1WLTA 4LBJA 3VB9A 3H3UA 4PIYA 2CL2A 2CAUA 2Q8OA 3ATGA 4ES8A 1GMMA 2KR2A 3KHBA 1KRIA 5ABJC 1CAWA 2R073 5FZ7A 1OQEA 3POWA 3MLKA 2TEPA 1US2A 1WMXA 2G4IA 4P9IA 2WS91 5HV0A 1CPNA 4BH9A 4ZXKA 3IM0A 1J58A 5DAVA 2VD7A 4QHOA 3FX3A 4XXPA 4C8DA 1E5SA 4CCEA 4D7YA 4PIZA 1UY3A 2DDUA 1NXD1 3FHIB 3ZYBA 1X36A 3RWKX 1BK1A 4CEYC 3RSJA 1VBC2 1A8MA 2X5IB 3E5QA 3OD4A 4RYDA 2IXIA 3LB9A 3OF1A 3DPRB 5IVVA 1IPJA 1SDDB 1ULPA 2ORZA 2V09A 4YW7A 1AJOA 2VH9A 2HWF3 2A6VA 4DY3A 1ND2B 2ZGMA 3IIAA 3PURA 3VBOB 4MXWA 2XLFA 3I59B 2WNUC 1YNAA 2B5HA 1VBE2 3JXSA 2D43A 4CP2A 1VIWB 2PHWA 3I3DA 3MICA 3N7LA 1K5MA 1CD3G 3PLQA 4IV3B 4QX5A 5A1FA 2A73B 1PGL2 2QKDA 3AMMA 5FZKA 2X53S 1CAXB 2YUEA 3WG1A 1Q8PA 1OBNA 2VM9A 4ARXA 1WW4A 1UYYA 4LK6A 1AL0G 2R063 1RUJ3 1YQ5A 5DZEA 3RVHA 2P2KA 4E4ZA 1MVEA 3ZFGC 1GZWA 5IW0A 1SLTA 1AJKA
chains in the Genus database with same CATH topology
1C1LA 1QJU3 4HKLA 3ZN4A 2RM21 1DGWX 4K9SA 1OA3A 4Z1VA 4XBQA 1AR71 4Z2WA 3MIBA 1ULDA 3USUB 4AGRA 2WFF2 1AR91 4GH4C 3O5SA 4XXAA 5FLHA 4EWEA 4YW4A 3MIHA 4MYEA 1MS5A 2GN7A 4PLMA 1NLSA 2GSYA 3CNAA 1R1ZA 4RA0A 1PNGA 3KZ4C 3TB0A 2DUOA 1QKQA 5JI9A 3NSTA 1Z7S1 3HAGA 5GZFA 1ENQA 3IDEA 1ND3C 3AB0A 2ZMNA 2UWCA 1VBB3 1FMD3 1N1YA 4I30A 2WL1A 5KXBA 1LB2A 3A0NA 5JWPA 5J3UA 4R9CA 3OYWB 1NXMA 3SCGA 3WZ1A 4W6YA 3SLIA 4YRDA 2QZ2A 4EJRA 1EAH2 5JIUA 1W6MB 3UKNA 2H0BA 1IKQA 1RUF2 3ILNA 2CTVA 1SBEA 2VOXA 3JCIA 5JPMB 3I4IA 4XTMA 2B46X 4CTEA 3SH5A 3FUOA 5DG2A 1KXGA 1YIPA 3VBUA 3RZZA 4LLFA 4TWTA 4XBNA 3UJOA 2YHJA 4LBQA 1WD3A 1V6KA 4Y1UA 2JICA 4H7LA 1QMJA 1AXYA 2VNOA 2AREA 1AYN3 2ARXA 2WWSA 5GZGA 3MFAA 4RR3A 2WS92 3LWCA 2D5FA 3BOWA 1EP0A 2GAUA 2NN8A 2D40A 5K0UC 3OCPA 2VUJA 3E6BA 1Q8QA 3MDPA 1XXNA 5DUWA 5A3LA 3IDBB 4IEXA 3JBG3 1OA4A 4WM8C 1ZZBA 5E1RA 3I8TA 5F6LB 4UW6A 5T5LA 3TAYA 5AC91 1LKNA 2DVAA 1WCDJ 2WT1A 1AUYA 5GZEA 3WDXA 1DYPA 4K1ZA 3RI9A 2DVGA 3VHNA 1UMZA 4L11A 3C3VA 2NYYA 5C4WA 5DZFA 3MI8A 1YWKA 1DQ5A 5KHHA 3Q9OA 4XIKA 4N7UA 1IS4A 2BBVA 1OOPA 2NP0A 4HPKA 2O0OA 3MIFA 1W2UA 4EWDA 2KXLA 2RM22 4YW3A 3TRSB 1CN1A 3WLUA 5I0SA 2ZX0A 1AR72 5AVPA 3NAPA 2CV6A 3PNAA 1NA1B 1AR92 2WQZC 4LULA 4FPEA 5JMCA 1D4M2 2R0HA 5H9SA 2YY1A 3IWZA 2XB6C 1QQP1 1Z7S2 2P3KA 3EBRA 2HWB1 3OY8B 3KCCA 3WVJA 3QOPA 2LTNA 3PVEA 2VUAA 3WY6A 2GDFA 1S0GA 4ITCA 2VGDA 4E27A 5E8AA 4Q26A 5GLUA 5CFDA 4BIOA 1W0OA 4XBLA 5J36A 1CAVA 1AX0A 2IWGB 1WW6A 4WVWA 1C8M1 4NWVA 2BPA2 3MYXA 3ZN6A 4Q4X3 5FRAA 1C8NA 4HL0A 4QM9A 2FMYA 4OI0A 4HZFA 2QDRA 3RPQA 4XJWA 1G9CA 1AR83 3WUCA 1RUD1 1IPKA 1RUE1 1A78A 4Y1ZA 5T50A 4R4XA 3AMNA 1N3QA 1PIV3 5FCCA 3VBHA 1EPWA 1NYWA 5J37A 4EN6B 2OVUA 4DMIA 3LOBA 1K5MC 1Q5OA 1CX4A 1COV1 1PNFA 2B42B 1GQGA 4N43B 3LSEA 5EXOA 3WQ1A 4XFCA 2D6NA 1J3PA 2R071 4M00A 2A6XA 5AFEA 1WUVA 5JSOA 4RGGA 1MS1A 2ZOEB 4AI8A 2V5YA 2WT2A 5D8AA 3WINE 2BTVC 4GMP3 5AC92 1ZZ9A 1JBCA 3E6CC 2ZGNA 5BPXA 2W39A 4XFGA 2DFBA 4AI1A 2UY9A 4BPZA 4P9LA 4XZPA 4UW4A 2DUQA 3P3NA 2C9AA 4F7ZA 2BNNA 4JGZA 1G7YA 1GICA 2PFWA 3B69A 4COYA 4AF9A 2WINB 5FMOL 4ORFA 1SCRA 4C0HA 1UZYA 4PDWA 1WCKA 3VDDB 1VBE3 3D0SA 1RGSA 5H9RA 3AP7A 2R061 4YVSA 2UYBA 4LBNA 1RUJ1 4AFDA 2R16A 3W9AA 1PK6A 1HQNA 1MS8A 1RMU1 1QH7A 2ZHKA 1B09A 2D3PA 5FFOC 1CJDA 2BQPA 3AKTA 4QGNA 2HWB2 4XOGA 4Y1YA 5A32A 1PO23 3D82A 3VBUC 3ROUA 5A33B 2EAAA 3HT1A 1YCIA 2ZMLA 2WFF3 1CAUB 4EN0A 4Q29A 4PQ9A 4QPGB 1REFA 1RIRA 2NZ9A 3IPVA 4D3WA 1V6LA 3WT3A 1U0AA 3VZJA 4K1YA 3WW1A 2C0ZA 1NQDA 1DIWA 4RR3C 1VBB1 1FMD1 5K9YA 1C8M2 4UXAA 3OD0A 3ZYIB 2QCSB 4I0WB 1XYNA 2ES3A 4J6GA 2DCYA 4LA3A 3WW2A 1H2KA 3GHMA 3HWJA 2H6CA 3M8LA 4FOWA 4WM7B 5LEJA 1N3OA 3BODA 1RUD2 1EAH3 1RUE2 5JR7B 2GU9A 1YFUA 4FP2A 1RUI3 2XJVA 3ZSJA 3MLLA 3SITA 3KGLA 5T5JA 4CEWA 1COV2 2A6WA 1CQ9A 5C4WC 4Y5Z0 5J7MA 4AHZA 2R072 1AYN1 1QJX1 4YGCA 2OIIA 1ZZ6A 5L7OA 4KGGA 1HW5A 3D8CA 4DFSA 2GC0A 1OOPC 1M4WA 3VKOA 1O5UA 1VR3A 4JGYB 2ZZJA 3WXPA 3NO8A 4NR1A 3NAPC 2YROA 5CNAA 4Q0VA 3ZO0B 4QHBA 2ZTNA 3R0RA 3USSA 5IK5A 1YYNA 2GH8A 3AP5A 3JD71 2BNOA 1KJRA 3S6PA 4LHLA 2R0FA 1QOSA 4I3GA 3WDWA 4MGZE 3CJXA 4OHWA 4GWMA 4NHMA 1MEC3 4LO6B 3VHRA 1REEA 1BEV3 2HWE3 5GZCA 1EV13 4AVBA 4N53A 4OI1A 1UPSA 2R062 4EN9B 1TNFA 2EXKA 4FT8A 1NY71 4QGMA 3G6JB 5I8TA 1AL23 4QQLA 4LO5B 1RMU2 4H3WA 2VY0A 1GZ9A 2WJSA 5CFDC 5HBAA 4FTEA 2YV8A 1X8EA 4HANA 1JTZX 4IL7A 4LHKA 3AJZA 2WFPA 1LOFA 4M3CB 4NPRA 2A6YA 5D1IA 4DNYA 3ZN5A 1POV3 2OZ6A 4FVVA 2A3YA 1AR73 4AVVA 3VV1A 3UL2A 1AX2A 3N35A 4FQZA 4MGYE 1D4M3 4LBQB 4S2FA 1WA4A 5GM0A 1O5LA 4XQWA 5EV7A 2ZHNA 1VBB2 1FMD2 1O4ZA 3VBHC 1Z7S3 3NV3A 2BYVE 3UV9A 4IQPA 4YG3A 2DVBA 3B93A 4OVEA 3U4XA 5I8SA 5JIAA 3THTA 2Z79A 2ZGRA 4NOTA 3ZYRA 1DQ6A 4XEZA 4E4DX 1QOTA 1KD7A 2Z5WA 3VKMA 3MPBA 3M2MA 3T2TA 3VBFB 1F2NA 5D8AC 1A8DA 4Q4X1 4AHYA 3VBRB 5AFBA 1JYIA 5HCBA 1KDKA 1N1VA 4B4QA 4YM3A 2NMOA 1WW7A 1YFWA 4PIXA 2A3XA 4K8FA 1WMFA 3UJQA 1AR81 1YFXA 5FPZA 4LLOA 4IEOA 3H9AA 4ASLA 3FBYA 4GKYA 1H9WA 1QJX2 1W6NB 3IMNA 4PBPA 4JGZC 1PIV1 1DG6A 3SISA 5BNNA 2MHFA 3CJIA 2PELA 3FUQA 2K2SA 4PDWC 4S2DA 1G8WA 4LNVA 3RWNA 1D2SA 2ZGKA 1OOPB 4HPKB 1DQ1A 1X7NA 3EO6A 4COVA 1KS4A 4RS5B 4YVSC 3RRDA 3GBGA 1QXPA 1WLWA 1V9U3 4AYUA 3EQEA 2CNAA 1G9BA 3JD72 2NMNA 4IEPA 5I93A 1XE8A 2BNMA 3MW3A 5BNOB 1HKDA 3ZYGA 5I91A 4OFGA 4QQPA 1UIJA 2GNDA 2Q1ZB 3V0AA 4LT5A 4G9SB 5AC93 1ZRDA 1AHSA 3H1WA 4CDUB 4OI4A 5EWSA 3M7AA 1WW5A 3ZPYA 4FOYA 1NY72 1W6QB 2AYHA 4Q2FA 2XPJA 1SBDA 4M01A 5KHGA 2QDNA 5JSPA 5FQ0B 5CVRA 5J96B 3IT8A 1HX6A 4A3XA 4X8NA 1TQ5A 2JD4A 1LULA 1VALA 1HIXA 2D3RA 2P3IA 3E97A 3KD4A 3CU7A 4KWJA 1DZTA 4U2AA 3VLBB 1PM7A 3ELNA 3VN4A 4AW7A 5JOXA 2ZGSA 3JUUA 1GKBA 5IUQA 1HLCA 4BIFA 1G9FA 2XJUA 4AFCA 1PO21 4KQ7A 4LE3A 5DUVA 1FPN3 2EIGA 2HWB3 2Y38A 3D5OA 4CEWC 1W6OA 1F31A 1Y3TA 3VBHB 4B29A 2XJTA 4RQPA 4OZXA 4JDNA 1FI2A 3VKFC 3MIGA 3HIFA 2CWMA 3LOIA 4N7IA 5L7OC 1F8VA 3LA3A 2OYZA 3ZXAC 4GALA 2YDEA 3MIEA 4Q4X2 1HQWA 3CL1A 4L92A 1ONAA 2PHLA 1RUC1 3IN9A 3AMQA 2YC0A 5FMOS 5BXXA 1JHNA 2DV9A 1IOAA 3AKRA 1AR82 3ZIXA 4MSVA 5CG8A 4GQ7A 1H8TA 4A7YA 5DUXA 1S0CA 2WNVB 2E9QA 2G9GA 1D4VB 1RUI1 2AZ5A 4Y24A 1RUE3 3TN93 4GWNA 2XG3A 2EVXA 3ME2A 1KFXL 4I0AA 1FOD1 2CYFA 4NHLA 4N53C 4IV1A 2ZMKA 1DZQA 4A7ZA 1DHKB 1FX5A 1V6MA 4ZU7A 1QJZA 5KBFA 3B7MA 3MZHA 1MVQA 4BMEA 1OQ1A 4F83A 5CBLA 2D93A 4H14A 1JOJA 3WOGA 4AVSA 1LENA 1RJ7A 3BU7A 4M3CE 1LODA 2O8OA 1LOFC 3J8F3 2HWD1 3OBTA 5CU1A 1D0HA 1V6NA 3VZNA 3U11A 1UW8A 3I54A 2BEOA 1UL9A 1DF0A 5JAXA 4BWOA 3ZIWA 1LGNA 5FOBB 1MEC1 4FOQA 1BEV1 4K20A 2HWE1 4CDXA 1EV11 4P14A 2DYCA 5BYNA 3FZ3A 3VZOA 4P9JA 3ST7A 4PCRA 4L97A 4N9HA 2PHXA 4SBVA 4B4PA 1AL21 3EJKA 1ZBA3 4AEDA 1PO11 1DBNA 3S30A 4FTSA 3ACLA 4QD2A 5FTTC 4XF0A 1S0BA 1RMU3 2R49A 2PTMA 3B3QE 2IZWA 3A0KA 4JTNA 4KH9A 4YG0A 4CP0A 1ZREA 1PO22 2FHRA 3QH7A 1J59A 4FSJA 1POV1 1ZRFA 2ZX4A 3OPZA 4KG0A 2XKOA 4X6QB 2F6BA 4QXKA 4FPLA 3O0VA 4C1XA 5C8CA 1BQPA 1LRHA 3KMHA 4FPJA 1D4M1 1R1A3 1ZNPA 2PHDA 2XJRA 3JZVA 4LO4B 4AI3A 3AXDA 3AFGA 4YVWB 3TWIA 1DQ2A 2XBO2 1OI6A 4KGQA 2JG9A 3ZDSA 3CJIC 1IS6A 1ZZCA 1U5ZA 4WZCA 3AZVA 4WV8A 4PLNA 4ATEA 1RUC2 3CLPA 4GXLA 4Q27A 4CDWB 5FO7B 3VKNA 4YGEA 1RHI3 3R4DB 4XJZA 2XVKA 4YM2A 2ZAAA 1OFNA 1C5IA 2QFEA 3FMGA 1OLRA 3ZVXA 1WLCA 3N3HA 5EZWA 4ES9A 2O8QA 1RUI2 3G7DA 3NW4A 1QDCA 2VVDA 1NCRA 4TLFA 1FOD2 2VECA 2DTYA 2ZS6B 2D44A 4QU2A 4B8EA 1G6NA 1I5ZA 4FOVA 2ET1A 3R6SA 1ULCA 2QNKA 1I1EA 1QJX3 1V70A 2JG8A 3U07A 4MVTA 1PZ8A 5ABJB 3S7IA 4XJ8A 3FE5A 1XE7A 1AXKA 3AFKA 3HN1A 4XQDA 2HWD2 3K48A 1N47A 1V9U1 2Y0IA 3ECQA 3RG0A 3WG4A 4Q1RA 1NCQA 1B35A 2MEV3 3AZYA 2ILMA 2OA2A 1VBD3 4AFBA 3V0BB 4CEYB 3JD73 2ARBA 2UURA 1HV1A 3R05A 2PLV3 1MEC2 2PHRA 1BEV2 2HWE2 1H2LA 1EV12 2AR6A 3FLTA 4D7YA 1JUHA 1OFSA 2X8KA 3NJZA 3MLJA 4BCUA 2WNUB 1GNZA 2WC2A 4WVMA 1AL22 4RQPC 1PO12 1MZFA 2VOWA 2ERFA 2GC2A 4OUMA 1LJ7A 3WP5A 4MX3A 3LA7A 2D97A 1QGLA 2AUYA 4KG8A 4DS0A 2LALA 3ZFGB 3AKPA 2R043 1BXHA 1LHVA 1XYPA 4KWLA 2WA3A 3ES4A 4UBGA 2JX9A 4OUSA 3VUOA 1C57A 5CFCA 2VQAA 1SLIA 4Q4W1 1LHWA 4GH4B 1H8TC 3PJYA 1IKPA 4AVCA 4XTPA 4W6XA 1FPN1 2B45X 1OD5A 4COUA 1PGW1 1O4TA 4R9BA 2VXRA 4HT1T 1M06G 1HXS3 1S1AA 4IV1C 1ND3B 1GV9A 3AJYA 3ZXGA 1QXRA 1BBT1 1NLRA 4HVOA 1DGLA 1ENRA 3KS7A 1TMF3 3RYPA 1I6XA 2JE7A 5GJ6A 1YRZA 1LOAA 4Y20A 1GLHA 4Y26A 5H9QA 3KQRA 1URXA 4GIQA 2DVDA 1XNCA 2BVVA 1H8VA 2ZGTA 3L9JT 3V0AB 2JDZA 3WG3A 3RI8A 5C6CA 3ZXFA 4IEYA 1ULFA 1VB4A 3WDVA 3TN91 5C9AA 4Q0PA 5L19A 1BJQA 1ZX5A 2DUPA 4UW3A 4CDXC 3ZXLA 1WD4A 3LKJA 1LU2A 2ZGQA 1H9PA 2A70A 1V9U2 4LBKA 4AEDC 1SMVA 2YGLA 2TBVA 5K0UB 1ULGA 3WQ0A 1OKQA 4JCKA 3N4MA 2E53A 1AF9A 4LO7A 3VKLA 4Y22A 1VBA1 4SLIA 3J8F1 1H0BA 5GLZA 5LK7B 4WM8B 5I0UA 1NE4A 1S0FA 2C5DA 1VJ2A 2QJVA 3AZZA 3GZTB 4LBQD 5C8CC 2ZGPA 4XF1A 2FQPA 4Q8LA 2RHPA 4S2HA 1W6OB 1XY