1ULOA

N-terminal cellulose-binding domain from cellulomonas fimi beta-1,4-glucanase c, nmr, minimized average structure
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
152
structure length
152
Chain Sequence
ASPIGEGTFDDGPEGWVAYGTDGPLDTSTGALCVAVPAGSAQYGVGVVLNGVAIEEGTTYTLRYTATASTDVTVRALVGQNGAPYGTVLDTSPALTSEPRQVTETFTASATYPATPAADDPEGQIAFQLGGFSADAWTLCLDDVALDSEVEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cellulose degradation
molecule keywords ENDOGLUCANASE C
publication title Structure of the N-terminal cellulose-binding domain of Cellulomonas fimi CenC determined by nuclear magnetic resonance spectroscopy.
pubmed doi rcsb
source organism Cellulomonas fimi
total genus 11
structure length 152
sequence length 152
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 1996-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02018 CBM_4_9 Carbohydrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1uloA00
4GWIA 5CZKA 2QQOA 1JYWA 1WKYA 2YC4A 2VCCA 1YQ2A 3C8XA 4L0PA 3MBWA 1EUTA 3HPNA 3GXUA 3T2PA 4BK5A 2PQSA 3LPGA 3WNOA 5C71A 5FUIA 3IAPA 2YFZA 1NUKA 3LEKA 1K45A 2VZSA 1I5PA 2EIEA 2Y6JA 5HPOA 4CU7A 3P1IA 3CZUA 2DDUA 2ORXA 3OGSA 1MPXA 2C4XA 2Y6GA 1ULPA 2WZEA 2QQIA 3A21A 2B4KA 3K4DA 3NNGA 4P5YA 2C26A 4OUEA 4A6OA 1XNTA 2J1VA 1IQDC 2W1WA 3HJRA 4P00B 4QDSA 1US3A 5JXHA 3CDZB 3UETA 1RYYA 5JXJA 1UYYA 4JKKA 4ARXA 3T08A 2QQJA 2J1TA 1KEXA 4BXSV 4ZZ8A 5IFPA 3VDBA 2ID4A 3FL7A 4QDQA 2ZXQA 4BK4A 4W8JA 4XVHA 4FI9A 3C7OA 5JR2A 1DLCA 1K12A 5C70A 2W3JA 2ORZA 3GM8A 4A42A 2B9VA 1H6YA 3WNLA 1UYXA 4XUTA 2VL4A 2WYSA 2WDBA 5IHRA 3ABZA 2VMDA 2J1AA 2VZRA 2W1QA 5G05L 4W50A 2QQMA 2RV9A 3C7HA 4OMCA 3GGLA 3OB8A 4CUAA 5CYYA 4KI5M 3DYPA 5LCWL 2QQNA 2BGOA 2BZDA 2VM9A 1PMHX 3U37A 3LQCA 3WSOA 4QB2A 1UY0A 5IFTA 1JZ2A 4TXWA 3UNPA 3THDA 4QDRA 4ZZ5A 4CUBA 2VC9A 1BHGA 3ECQA 3NJVA 3IAQA 1HN1A 2Y6LA 3K4AA 4Z2AA 5B4XA 4MOAA 2C9KA 4A4AA 4GZ9A 2WABA 2WN2A 5LA1A 2VOTA 4RYDA 1DYOA 3MV11 2V4VA 2W95A 2W1SA 4MGQA 1GOHA 3EYPA 4MADA 4ZXEA 4CU9A 3D3AA 3E1F1 1O8SA 1US2A 4ZY9A 2E33A 2X09A 3HNBM 3IB3A 4JX0A 3HNYM 5DPNA 2L9LA 4D8MA 2J1EA 5EJ1B 4UI9L 3HEIA 1OH4A 3PUIA 3A7QA 2EIDA 2V5DA 3T0BA 3I3EA 1UX7A 3MUZ1 1GMMA 2XOMA 3WF1A 2WN3A 2W94A 2WO3A 2X10A 3MUY1 4PF1A 5IJRA 3VDCA 3VD9A 2JD9A 2JKXA 3W5NA 1F4HA 3PUHA 2XONA 5DN2A 3VD3A 5EJZB 2LW8A 3IIIA 4UAPA 5EIYB 2VMFA 3CIHA 1GNYA 2R7EB 5J1XA 2VTFA 1T2XA 2VCBA 3ACIA 3NQHA 2WQ8A 3T2OA 1JYVA 5JUVA 3WNKA 2WO2A 1CX1A 2VZUA 3C7FA 1GOGA 4KWUA 5JXIA 3K46A 5HXMA 1UY4A 2JDAA 1GQPA 2VZPA 3IDAA 3BGAA 2E31A 2ZEYA 5JMOA 3NJXA 1CIYA 3P6BA 2YFUA 1O8PA 1WCQA 3CKHA 1UXXX 4TTGA 3FHQA 2HLEA 2YC2A 4A3ZA 1SG3A 2EICA 4XUNA 1UMHA 2OKXA 2JE8A 1D7PM 3ACGA 4DXRA 2VO5A 2W87A 2XHNA 4CU6A 2RJ2A 2WBKA 3NRUA 1O59A 3W5MA 3WNPA 3FHAA 2VZ3A 2VZQA 3DECA 4RN5A 1XC6A 4LHSA 4W4ZA 5C7GA 2YG0A 5G04L 3LE0A 3WF4A 3ACHA 2W47A 1JZ8A 3VD5A 3ACFA 1OF4A 4LQRA 2E26A 4CVUA 4CU8A 1JYNA 5DMYA 3A23A 1UYZA 1UWWA 4P08A 2BERA 4M4RA 4JKLA 1W9TA 3WF0A 3CZJA 2W9XA 3A22A 3LPFA 2CDOA 2VZVA 4BDVB 3K4ZA 3CQOA 4LPLA 2WZ8A 2QQLA 1LNSA 5B4NA 3AC0A 3MV01 2WAOA 3FN9A 2X05A 3HNMA 4BJ0A 2HYXA 2VCAA 3VD7A 3WF2A 3WEZA 1CZSA 2DCJA 2VZOA 5DQ0A 3OEBA 1F4AA 1TG7A 4AG4A 4QX0A 4QX1A 4ARYA 1UY1A 1NKGA 1SDDB 2ZEWA 3I97A 2BBAA 3WNMA 1W99A 2LS6A 4DEQA 3GDBA 1OT5A 1JZ5A 1K3IA 1OF3A 3T0AA 1NX9A 2QBXA 4A45A 3LEIA 4OYUA 4QB1A 2KD7A 2J1SA 3JXSA 5F7UA 5IYYA 2J22A 3DYMA 4P02B 3I2JA 3SKJE 2RVAA 4XZUG 1JU4A 3EB7A 1W8NA 2QQKA 1W9WA 5LA2A 3I2GA 5I0DA 3LEGA 1JYXA 2WAAA 1CZVA 2VJXA 2DCKA 2W46A 2VQTA 4MO3M 3THCA 4XUPA 3I2FA 2EIBA 3BN6A 3I3BA 4A44A 3F2ZA 3SEPA 2W5FA 1DP0A 2VMEA 4PQQA 2BGPA 4XURA 4CUCA 4MGSA 4XUOA 1GOFA 3OGVA 1L7QA 1JU3A 2Y6HA 4QX3A 3T09A 1JZ3A 2W91A 2Z4FA 2XQXA 4A41A 3OEAA 1GUIA 1K42A 1XNAA 3VD4A 1JZ4A 1PX4A 2WUHA 3WF3A 1GU3A 3ETPA 2WO1A 4AAXA 4D0QA 4XUQA 4QPWA 4QX2A 1UY3A 1J83A 1JI6A 4GWJA 4KMQA 1UY2A 2ZEXA 1PX3A 3ZM8A 5JXGA 3MO4A 2W1UA 2Y6KA 3I2IA 1L7RA 4E8CA 4OMDA 3SEEA 1R64A 4QAWA 1W0NA 1W9SA 2W92A 3J7HA 1NAEA 4YPJA 3VDAA 1W8OA 2ZEZA 3I3DA 1J84A 2VQUA 4DUWA 1UXZA 4DEVA 3K77A 3I2KA 3WNNA 2J7MA 1H6XA 1UZ0A 1JHJA 2E32A 1ULOA 1XPWA 2VR4A 4IUGA 1PMJX 2CDPA 2VMCA 1JZ6A 1CZTA 4DUXA 2V72A 1OD3A 4DXSA 2VZ1A 3C7EA 4DUVA 2Y8KA 3C7GA 1P8JA 3T2QA 2YB7A 4M4PA 4E8DA 3CMGA 3T0DA 1TVGA 1KGYA 3DYOA 4UOJA 3SKVA 4PT6A 1SHWB 3HOBA 4LKSA 1EUUA 5A1AA 4ET7A 3I2HA 4HG6B 1UMIA 4QB6A 2J1RA 2J1UA 3OG2A 4JKMA 3UESA 3OBAA 4DXTA 4JHZA 3WQBA 2Y64A 3OGRA 1JZ7A 4OZOA 3K75B 5LA0A 3HN3A 2VZTA
chains in the Genus database with same CATH superfamily
2XBO1 3FZ3A 3OUIA 5FY9A 1QOOA 5A3MA 5FPUA 1VBA2 2XWJB 4D7TA 4LJHA 2JB4A 1W6NA 2JDZA 2XLFA 4BQ1A 5FYUA 2VU9A 1ND2B 4XIOA 1D0HA 1YQ2A 4AEJA 5JPNB 3PVOA 1COV1 2PHXA 5FP4A 1HQNA 4L9BA 3MBWA 1EUTA 2O0OA 3GJBA 3HPNA 1IS4A 4A6SA 3T2PA 4BK5A 4HETA 3M3CA 4OUMA 4XETA 3ETQA 3MLJA 4QKDA 5ERLA 1J3PA 3FLPA 1W2OA 4KWJA 2ET7A 3GBWA 4HKWA 1NUKA 4MH0E 5CFCA 2RG4A 1POV1 1I5PA 4AAPA 5FQ0A 1J1LA 2ZGUA 3P1IA 4EWDA 1WW5A 3ST7A 1HRV3 5FZOA 3N7MA 1VBD3 2Y6GA 3VL9A 4GB32 4I01A 3O1TA 1IGOA 1ULPA 4XOGA 4ZXKA 4EJRA 1OMIA 4JGZA 2ILMA 4CDWC 4CEWB 3A21A 3MPPG 3VBSB 1GSLA 2YUEA 5JOXA 1PO21 2MEV1 2JDUA 2OS2A 3LOIA 4OUEA 3RMYA 3WHTA 1VRH1 1IQDC 2W1WA 3HJRA 2VTXJ 4QDSA 1US3A 4LLOA 4NO4A 2ES3A 2R1DA 3AFGA 4ONUA 5JXJA 1JOJA 4FPKA 1BLZA 4JKKA 2MHFA 1DFQA 4AVBA 3CL1A 4CCNA 1CAUA 1GBGA 1F31A 1NY72 1TMF3 1CN1A 4K8FA 4AFBA 5C6CA 2VUAA 2P2KA 1SFPA 3TOJA 2D3PA 4AVTA 4BISA 1QJFA 2E7AA 2LTNA 4NVPA 4K1YA 4DS0A 3V0AB 4BK4A 1G7YA 2VBPA 2Z42A 5C9AA 3L2HA 5FAXA 3MFCA 5EHDA 4FI9A 3VBRA 1DLCA 2RM22 3P3NA 3JU9A 2W3JA 5FZLA 3D82A 5CAZA 2FDJA 3USUB 2ORZA 2FDGA 3NV3A 2Y60A 1C57A 1CAVB 3RDIA 4I0WB 2PHUA 1CJPA 1RUC3 5F2SA 2YY1A 1DYKA 3P3PA 2WYSA 4XABA 2WDBA 3ALQA 4XF9A 5AVAA 5FYMA 3FHIB 4Q26A 5F32A 3BKZA 3H1MA 2J1AA 3W20A 1VALA 2CGNA 4W50A 2RV9A 3VKOA 4QGLA 4Q4W3 1FX5A 1W3VA 4KI5M 4BQ5A 5I8YA 4IEOA 1NXD1 5H9SA 4H7MA 1HX6A 2QQNA 5A7WA 1PMHX 4OI1A 1JBCA 3NNLA 3U37A 1W6OA 4KG8A 5LWBA 1R093 4LEJA 1X36A 1OHFA 2R063 4AGRA 4UYBA 4YVWC 4XTPA 4JQTA 2XGXA 1A78A 2A5ZA 3O0VA 1CAXA 1JZ2A 3MZHA 1HDKA 3UNPA 1S0JA 3THDA 5M0TA 4QM9A 1NA1B 2GDFA 2MPFA 1G9DA 1XJAA 2VC9A 1BHGA 1CJDA 3TRSB 2IC1A 3KF3A 5KHGA 1K5MA 2Y6LA 4ATEA 4FPHA 5EFUA 4MOAA 1OKOA 4I30A 4R4XA 3UK9A 4A4AA 1RUH2 5JOWA 2VTXA 4FPFA 4CDQA 3LA3A 5LEJA 2V09A 2SLIA 2ZA9A 3HT2A 1V70A 1XE8A 4DFSA 2A3XA 2WN2A 4XJ8A 4EN9B 1JYTA 3H8XA 3AL6A 1DYOA 2DUPA 4GJYA 4QQOA 2V4VA 2ZABA 3WDYA 4Z1VA 3ITQA 1XYPA 4V2WA 4XTMA 3J9SA 3PHMA 5F3IA 3ZYBA 5IK8A 4MADA 2PFWA 5I0TA 3ZFFB 1OOPC 1PO12 4IE7A 4CU9A 1YO8A 3D3AA 4XJUA 3WXPA 1XU2A 4OFGA 1JUHA 1O8SA 2UY8A 4NN0A 2V4AA 1R1A2 3KVAA 5L7OA 4HN0A 3ZMNA 1NLQA 3SCFA 3WLUA 2VNOA 5L9BA 4XFHA 4YLZA 3ZKUA 4OI0A 1QKQA 3FLRA 4NRMA 4UI9L 3KV6A 2JG9C 3A7QA 2GH8A 3RZKA 1RJ7A 4P9YA 1VAVA 1M06G 5KHHA 3MFAA 4NHLA 3T0BA 1GMMA 2FDKA 5BNOC 3MUY1 3WG2A 4PF1A 3PDQA 3V64A 4AFCA 1X9TA 1QIQA 3GZTB 4GMP3 2EXIA 2RE9A 2RS33 3AYDA 4TN7A 3RYRA 4Q4V2 3PUHA 1SCRA 2OA2A 1H8TA 2VW1A 3MW3A 2VOWA 5EJZB 1AYM2 1MQTB 1OD5A 4HVOA 2WJSA 2Y0OA 1AR72 2VTFA 3AKRA 1Z7S3 1ALYA 3ACIA 4R9DA 4D94A 2CWMA 2VMGA 2QFEA 2VECA 3MPBA 3WQ0A 4B1LA 3DXUA 2RS13 1QXJA 3C7FA 1IG3A 3ZXEA 5C3RA 3K46A 4XFFA 2ZPXA 1AX2A 5KWRA 4YYOA 4PDWB 5HCHA 3DCQA 4LKEA 3IDAA 3HWJA 2NQYA 2E7TA 3BIEA 2ZEYA 3AYCA 3PJQA 1LHVA 1WLCA 3EMRA 1CIYA 3IPVA 1S4CA 1LULA 5FWEA 3CKHA 3W58A 2ZGQA 4V2VA 1X8EA 2O8QA 4D6RA 1LGCA 3UL2A 1SEFA 1RB8G 1KQRA 4UFMA 2ZGKA 1IKQA 1ND3A 5ACA3 2P3IA 1UOFA 4K7JA 5L36A 2XVGA 1FT9A 1M4WA 3ACGA 2HWC1 1MEC2 1V6NA 5FRAA 4PJYA 2F4LA 1AR92 2RJ2A 3RMXA 3AJZA 3C2UA 1O59A 1VAMA 2IVJA 2PN5A 1WA6X 2ZGLA 2ZX3A 4Q4X3 3S7IA 1LOCA 1NQJA 3M3QA 3OPTA 1ZREA 2ZX2A 1YCIA 1EV11 1XC6A 5CFCC 2CNAA 2GP5A 4DINB 1ASJ2 2ZGRA 3ACHA 4U2AA 3VD5A 4XILA 4RR3C 5BV6A 5C33A 1OVSA 5FZDA 3USSA 2VNGA 4LQRA 4PCRA 3QOPA 4I3GA 1KDMA 4JGZC 3WP6A 1RUC1 5CADA 2Z5WA 2RDRA 2WNEA 1WW7A 3NL1A 4TYSA 1KITA 2XKOA 5HCBA 5IUQA 1QJY3 5CBLA 1WMDA 1JYNA 4WM7A 3A23A 2WNVA 1UYZA 3WZ1A 1UWWA 1W9YA 4N7UA 4BWOA 4RS5B 2BERA 2DU0A 2VPVA 5DAQA 3N7LA 4JKLA 1W9TA 2CGPA 1PGW2 2A6VA 4GMP0 4MLOA 4AHWA 4D7YA 2ZGNA 2DFCA 2OVUA 1MS1A 3A22A 1QJX1 1ZZ6A 1WD4A 2DBNA 3LPFA 4PF5A 4UF0B 5AC91 3MIGA 2XVKA 2RS52 1H2LA 1XNBA 1RVF3 2WZ8A 3PVBB 5GZFA 3WR0A 3SH4A 4AQ2A 1VBB3 1LNSA 5B4NA 2JDNA 1R091 2R061 5T5JA 2WZR2 2FCUA 2ZOEB 5C9AC 4CA9A 2X05A 1LENA 1UU5A 2R073 3VBRC 5J09A 3SHRA 1ZBA1 1IPJA 4Q4Y2 5C4WB 4C8DA 5JSOA 3IN9A 3VKNA 4CTEA 1H8VA 3M3OA 2HWB3 2XXZA 3VD7A 3J7LA 1FAYA 3LWCA 4P14A 4OQ9A 3KCCA 3WEZA 1RUG3 1NE6A 1HXS3 1S0EA 1YFUA 2D5HA 2Y34A 2VZOA 1ENRA 1LRHA 1RUF3 3WVJA 4W6XA 1DGLA 1W6QB 1F4AA 3KM5A 5LBFA 1TG7A 1BK0A 1OSGA 1W8FA 2KR2A 4QGNA 4QXHA 5DDJ2 4DNYA 2CTVA 3Q8BA 4PQ9A 1NLRA 2RR13 2WFF1 4QX0A 2VVEA 1O3RA 5LK7B 1IQAA 3ZYPA 3I97A 3KD4A 3POJA 1HW5A 4DEQA 1PZ8A 3GDBA 3RI8A 1V6OA 3DPRA 3VZJA 4FSJA 4JRLA 3WW3A 1JZ5A 5FJKA 1OA3A 5KR7A 1I9RA 1QQP3 3H8UA 4HK9A 3BI3A 4M01A 1NX9A 5A3OA 5T5LA 2WT2A 2DVBA 4OYUA 2HWE2 2IWGB 3TNPB 3JXSA 4HZFA 3JD72 4MG2A 3DYMA 1Q8OA 1GNZA 2R6QA 2EVXA 2D3SA 3W9AA 4C91A 2RVAA 1YEWA 3JCIA 4NAOA 3EB7A 1AUYA 3ZO0B 4D69A 4IV3B 1CR7A 2ADEA 1K5MC 2DTWA 1HV0A 1VR3A 2D98A 2NN8A 1AXYA 4XHXA 5FLIA 5FYZA 5LA2A 1AXZA 4GMP1 3ZN6A 2VJXA 1AHSA 1B35B 5A7NA 2W46A 2E63A 3KT7A 3LDKA 3R4SA 3CNAA 4CDQC 1NZCA 3KHCA 4UW5A 2R16A 3H3UA 4HVRA 2XUEA 3I3BA 4E9KA 2LM3A 3OBZA 4P5HA 2XJUA 3AKTA 2XWBB 4KGQA 1QXRA 1AR63 1U12A 2BGPA 5J98B 5A33B 1RL3A 2WINB 3PU8A 4PI2A 3VBFB 4RGGA 5T50A 4F8AA 2XJQA 1XRUA 3HR9A 1E5RA 4YW2A 5L7OC 3OY8B 3ES4A 4QX3A 2W91A 1Q56A 5FY5A 1VBE1 1W9FA 1JZ3A 1MZ5A 1V6IA 4Q0SA 3D8CA 1GUIA 5I8SA 3SITA 3VD4A 4YW7A 4RGKA 5FPAA 4AEDB 4CPBD 4AHYA 2EA7A 2GC1A 3WF3A 2LUWA 3VBOA 1HB1A 2RDQA 3ETPA 3KV5A 3ZN4A 3ZSLA 3B01A 5E89A 5JPMB 4MXWB 4LE4A 4FOQA 2ZHKA 1JI6A 5FMOL 2P3KA 1XYOA 4ZS2A 2ZKLA 3KB5A 1H8TC 4L97A 3O1PA 2EXJA 3AKPA 4HPKB 3AMQA 2ZEXA 2EAAA 3QD6A 1GFF2 2PLV1 1W8TA 3ZM8A 3RQ0A 5A32A 1XNKA 3WINE 2HEWF 3SCGA 2G9FA 2Y6KA 1BBT1 4IE6A 2WLQA 3ZXGA 4E8CA 2YYOA 2YV8A 3MW4A 5FZ3A 4OMDA 3SEEA 3EJKA 5FMCA 3O1RA 2ZHMA 1TME1 4JGYA 4N53B 2BTVC 4I2OA 1GP4A 4UFJA 1PGSA 3E5XA 4CP1A 1NAEA 1W0OA 3VDAA 2W0XA 3J26N 1RUI2 1W2NA 5FZMA 3ZXLA 3N7KA 5SV5A 3QACA 4HKLA 1WCSA 1R081 3B7MA 4NWVA 5FREA 1QJY1 4DRRA 1GZWB 1H6XA 3E6BA 2PQQA 3SNMA 2UY9A 1UZ0A 5FPXA 2DCYA 1X33A 2QQVA 1JHJA 2E32A 1VBC1 1ND3C 1PNFA 1DGRN 1QU0A 4CEWA 3QH7A 1BEV2 1XPWA 1Z0HA 1D2QA 1SACA 1LTEA 1W06A 2QZ3A 3S6PA 2CDPA 5DUWA 1DCSA 1YQCA 3J8F2 3VZLA 3R4DB 1YIPA 4R52A 4QPGB 2PHRA 1JZ6A 2R041 4I09A 2V72A 4NUBA 2VZ1A 2ZKNA 5ISLA 3VDDB 4O9GA 1DZQA 3C7GA 1P8JA 1WW6A 4E2QA 1AZDA 4D7SA 3RJ2X 1PIV1 3T0DA 2VXRA 1ZVFA 3DKQA 1SFNA 4IEZA 4B4RA 2AEYA 1RUJ2 5HCAA 3V0BB 2ARBA 2BW8A 2XMLA 1GYKA 1CPMA 5FO8B 4PT6A 1ZRFA 4H7LA 5LEKA 3VKLA 3JZVA 3U4XA 1QJU1 2XBO3 3DEMA 4LKSA 4HG6B 4WM8A 1UMIA 3W59A 5FYSA 2J1RA 1FMD3 2V73A 3WG1A 3I3MA 3BTXA 2C6SA 5DUUA 2ZZJA 4BLIA 5KHKA 5F5CA 2TBVA 3ZFGA 3SMHA 3H50A 2D6PA 4XBQA 4WM7C 1N3QA 2WNVC 4NPRA 4KBZA 2WA3A 4OZOA 1COV3 1JZ7A 3A0KA 4LBQB 4OHYA 2VZTA 2GP3A 4TWTA 3WG4A 3ZPOA 4BIOA 2QQOA 1GP6A 1E57A 4OQ8A 3LEMA 3KV9A 1KFXL 4I02A 3LFMA 5LBCA 2ZX0A 4V1PA 4YG3A 1RUE3 3BPSA 5FK7A 1DG6A 2ZGSA 2PHDA 2X29A 4PI0A 1POV3 3GBGA 3POWA 3EHKA 5FP7A 3CLPA 3NW4A 1W6PB 1MS8A 3O1VA 1AL22 3D0SA 2YGLA 4LR4A 1JN2P 2D44A 1FPN2 4XF3A 5LB6A 1BQPA 2PQSA 1GP5A 4A7ZA 5JDBA 3N4MA 3FC0A 2CAVA 1REFA 2JENA 2A70A 1AX0A 1YIFA 3VLBB 1KS5A 2MEV3 4BE3A 4BMEA 4DIQA 5DAPA 1VRH3 5LZ6A 2VZSA 4OHXA 3RYKA 2EIEA 2Q1MA 1X50A 2VQ0A 3POGA 4R9CA 1G9CA 1ZBE2 3CZUA 4DRVA 2ORXA 3ZXAC 3OGSA 2Y6FA 3TN91 2C4XA 1OLRA 1A3KA 5BNPA 3HAGA 1F5JA 1PM4A 4CCDA 4DPNA 5FY7A 3HIFA 1GZTA 2J1VA 2E9QA 2RDSA 1DQ5A 4Q0UA 3UV9A 2XJVA 1OQDA 4P00B 3CDZB 2CU5A 4YVSB 1RYYA 4XAAA 5FTTC 3WX5A 4COVA 5JSRA 1QJEA 1ST8A 2PMWB 4XQDA 5EP9A 3DPRC 1PO22 1UN1A 4ARXA 1KRIA 1QWRA 1ZRIA 5IVCA 1YFWA 2RMU3 5C8CC 4ZHNA 2QQJA 5T5OA 2WL1A 4QXBA 2J1TA 3OOXA 1OFNA 1U5ZA 3LAGA 4EN6B 1TQ5A 4YM3A 4XPVA 4XCAA 1YQ5A 2ID4A 3VDBA 1RHI1 2D40A 3FL7A 1NXMA 3J7NA 4L8QA 4IV1B 4TSVA 4LOSA 2KA3A 3AJYA 4QDQA 4AI8A 2ZXQA 3ZFFA 2HWD2 4GWMA 1TNFA 1F9KA 4QT6A 5FY0A 2YPDA 1YI7A 1HIXA 4UT5A 1K12A 1NCRB 1YXWA 3MDPA 1POQA 2JECA 1SPPA 1H2KA 2B9VA 2PXJA 2W2IA 4OULA 1MS5A 5LY1A 5HBAA 5JIAA 5C3OA 3U0ZA 5LW9A 2JG8B 1UYXA 1HKDA 1ZM1A 2BNMA 2GC3A 5IHRA 3A0NA 2GMPA 1VMHA 1V9U1 3ABZA 2VMDA 5LASA 2JE7A 5BNQA 1IG0A 4X8NA 2DFBA 3OB8A 1NYWA 5FOBB 2RJLA 3E97A 4YM0A 2XLAA 1O5UA 4Y22B 3KT1A 4FTEA 3PVEA 3IKWA 4G3YC 2CHHA 3VB9A 3E5QA 3J7MA 3WQ7A 4DXZA 5E1RA 4UFLA 1N1TA 3I2OA 1SLCA 1ZA7A 1KJRA 3WD5A 3WSOA 3UJQA 4QB2A 4IDZA 4H3WA 3MIFA 4DZGA 3VBOC 1W03A 3TEYA 3D6EA 4CUBA 1DGWX 1GKBA 4AVCA 4AI9A 4LK6A 4AFAA 2QQUA 4QU1A 1UIJA 1C8M3 2VNVA 4Z2AA 3I7DA 3VKFC 1LESA 1D4M2 2C9KA 2ZAHA 1NCQB 1S55A 3KT4A 2ZTNA 4LKDA 4Y5Z0 1NG0A 4D6QA 3ZIXA 1ULCA 3MYXA 4FQ4A 2GN3A 3WP3A 3MW2A 2BRTA 3KQRA 5FIXA 3KGZA 2WABA 5ABJA 1C4RA 5LA1A 4RYDA 4NAMA 5IVYA 4EZHA 2FBEA 4LO6B 4J1WA 1AF9A 3ES1A 4LULA 5D8AB 1GOHA 4JGYC 1FOD2 4FXGB 3SH5A 1EP0A 2FZ1A 4QPIB 4R8HA 4AGGA 2C5DA 4LBLA 1FMD1 5FLHA 3T30A 1KD7A 5JI9A 3E1F1 3NSTA 4W6WA 4CEYB 4K6BA 3IM0A 3G7DA 1AR81 4CP9A 3KQ4B 4YGBA 4H14A 2X09A 3HNBM 3NO8A 3IB3A 4HFSA 1EY2A 1EAH2 3HNYM 4OLLA 5DPNA 2L9LA 5KXCA 5EJ1B 1TE1B 1OH4A 1V00A 1Y9GA 1GICA 3HEIA 4ISQA 4CEWC 1DQ1A 1PK6B 2VULA 3I3EA 3O0WA 2XOMA 3DUIA 4YGEA 2EIGA 3RFRA 2YXSA 5CFDA 1RUE1 1WCDJ 1F4HA 1YQ8A 4BCUA 4RS5A 3OPZA 4AQTA 1GANA 5E8AA 2XONA 3H42B 4KWLA 5DN2A 1OQ1A 3I4IA 3RYPA 2ZMLA 4UAPA 5CIRA 4WVWA 4GH4B 2VMFA 3CIHA 1O5LA 1DYPA 2B42B 1GWMA 1S2EA 5FK8A 3THPA 2PHLA 1T2XA 1ZZ9A 2VCBA 3ZYIB 3NAPA 3NQHA 4QU2A 4NHKA 2EXKA 5JOYA 2YGMA 3WNKA 1RUD1 2WO2A 2P3JA 1T6BX 3RS6A 4WM8C 4BOWA 5HXMA 3AZVA 1H4GA 4YW1A 3OYWB 2JDAA 2VZPA 3FMGA 3ZFGC 5FKCA 2XJPA 3KMHA 4K40A 5F5IA 2EAKA 3NJXA 5AFEA 1JTZX 4FOVA 1Q8QA 2HWC3 1D4VB 5IVJA 1YNAA 4IEVA 4MGKE 3WOGA 1HRV2 4MUVA 5FZEA 1VBD2 1WLDA 1QNYA 2WYFA 4UFHA 3AMMA 5DAWA 3POBA 2EICA 5FZCA 4BLJA 1SLTA 1EV13 1R1ZA 3AXDA 1UMHA 3GJAA 2OKXA 4NIHA 2RMU1 4DXRA 2O14A 2VO5A 3ZR6A 1L3JA 2VH9A 3KGLA 4INDA 1N1YA 2VD7A 4OCTA 4IEQA 4AL9A 1O4ZA 3I2DA 5CU1A 1ZZ7A 2QJVA 3W5MA 5EYYA 2WA4A 1HLCA 3AVSA 2WO7A 1TMF2 4CDWB 3DECA 3O1MA 1ZRDA 2D7FA 1VP6A 2LALA 4IESA 3M4FA 5C7GA 3GZUC 3LE0A 2VCMA 5T5PA 1EPWA 1UNBA 2DBIA 2W47A 1W8ZA 4AGVA 4ASKA 2PTMA 3L2YA 4M00A 4FPJA 4ES9A 4MV2A 3A4UA 5BNPC 5FOJB 1QJX3 2A3WA 3AKQA 2E26A 2P1BA 3O12A 1GLHA 3DV8A 5AC93 3HQRA 2JEMA 4J25A 1J58A 4LA3A 2D43A 4CDXA 3JBG1 1PHMA 5F3EA 2GALA 5BYNA 4DOUA 1Y43B 4LO5B 2HBUA 1OURA 4N43B 5FP8A 4F7ZA 4DB5A 5IATA 4UW4A 3U75A 4TZDA 3WF0A 4FOYA 4AHXA 3ZFEA 4GWNA 3U78A 3M2MA 3VUOA 1ZBA3 4TLFA 4Z2WA 2YMZA 2JIJA 4BDVB 1MACA 1ONAA 3K4ZA 2SBAA 1GQGA 4FTSA 2JD4A 5FMBA 2H6CA 2IXCA 4LBOA 4Q4W2 3AL5A 5BNNA 1G9BA 3AC0A 3PJYA 4JVAA 4N7IA 3ZFFC 5KXEA 2WT1A 1XNDA 3GCXA 4S2DA 3N3HA 2WAOA 1WLTA 3TEWA 5FFOC 3N9MA 4XAEA 2HWF1 3CHXA 5LRRA 2ZGTA 1QXPA 1E5SA 2WFF3 3BU7A 3MLKA 4MHRA 2DVAA 1VRBA 2DCTA 2ZGPA 1WCKA 2OXBA 5FPZA 3SC7X 1MS9A 5D21A 5CISA 5CG8A 1WA4A 2E6VA 5F6KA 3WF2A 5FY8A 3SLIA 2NYYA 2DCJA 1C8M1 4H55A 4UWDA 2OIIA 4LITA 3B02A 2P17A 3ZPYA 3E6CC 1EPZA 2D93A 2I2SA 4MXWA 1HB2A 3K2OA 3VL8A 2JDYA 4M3CE 4QX1A 2VGDA 4EQVA 1HRI1 1LEMA 2IXIA 4YVWB 4R9BA 1PGL1 4N8MA 4Z07A 2D6OX 2J42A 1OT5A 4XJ9A 4DY3A 2DVGA 5A1FA 3B94A 4AWDA 1VBA1 5A6XA 1J1TA 2AEZA 3NNMA 5APAA 3B5LB 2QBXA 4FTBA 5JZGA 1H9PA 1A8MA 1W6MB 4OZXA 4QQPA 1QGLA 5FYIA 2G1MA 1BMV1 2J22A 3BALA 3GF6A 3ZSJA 3PMSA 4LIVA 5A3UA 4Q8LA 3Q8EA 4XZUG 1JU4A 4WVVA 1L7LA 4NHYA 3LDRA 2IXLA 3LDBA 2QQKA 1PNGA 4C1WA 5I8TA 1GZWA 3I2GA 5I0DA 1CZVA 3S30A 3NNJA 3VN4A 1OOPB 2CYFA 3RNSA 2BPA2 3T4HB 1AL0G 1FYUA 5C3QA 5ABJC 3DL3A 1Q8SA 1ZX5A 5IW0A 1VBE3 2D3RA 1X9PA 2X5IC 3THCA 2RS32 5KC6A 1Q5OA 3I2FA 3MHZA 2R49A 4Y5SA 2ZMKA 2VMEA 3AMNA 4C1XA 4PQQA 1YFYA 4BMBA 2JG9B 2OQ6A 2YBPA 4JDNA 2RDNA 5HI0A 1Z7S2 2BYVE 4PIXA 5FZ9A 5BNOB 3WNXA 2QQPA 3OBRA 3APBA 1JU3A 1I1EA 3RPQA 2MNGA 1NY71 2FQPA 2RS12 2XQXA 3N9NA 4Q2FA 3KZ4C 2PAKA 3WW1A 4D3WA 3AFKA 4MSVA 2A73B 4HSLA 4Y4YA 1D0GA 2AH2A 3LSEA 4N9IA 1K42A 3RZJA 1PX4A 2JICA 2WWJA 1WLWA 3KS7A 4IEPA 1N3PA 4IEWA 3ZN5A 4IE4A 2ZX4A 3ROUA 2G9ZA 2PLV3 2QDNA 4AAXA 3VBHA 2JDMA 4XUQA 4P9GA 4D0QA 1JXNA 2YBKA 4QPWA 1AJOA 1S0GA 1U5YA 1W2UA 1UY3A 1BBT3 4I0AA 4LHNA 4N90A 3ZR5A 3I59A 5CFDC 4JDMA 2JE9A 1H0BA 1ASJ3 4RS5C 5L9VA 2RM21 1MS0A 2VUJA 3N36A 2VE1A 4IGOA 1TME3 4XZPA 3H7JA 4KGGA 3T3YA 4KMQA 5ACA2 5H9PA 2NZ9A 2H6BA 4R4ZA 1W3XA 3DN7A 3NAPC 2QVSB 3ZYHA 3EXUA 5JXGA 3HBKA 2WNUA 2PYTA 4NROA 2ARXA 1R083 1S0CA 1UPSA 3I2IA 4Z82A 5K0UA 4CRQA 2JXAA 4LUMA 5E16A 2VBBA 3NNFA 2HYKA 1R64A 1W6NB 1VBC3 3E5UA 4Q4X2 3VKMA 4COZA 1LKNA 2W92A 2DUOA 2ZEZA 4B8EA 5J3UA 2VQUA 4DUWA 1UXZA 2PHTA 2UU8A 3FBYA 4B3NA 3K77A 3GALA 4YW4A 1NQDA 1XE0A 1W8HA 2R043 1F8VA 2VOKA 3LZZA 3LGRA 3MIHA 4WVMA 3CF6E 4MGZE 1WMEA 5GZEA 5GZCA 4HOOA 1PIV3 5JVVA 3BB6A 4NIIA 5T55A 1XU1A 4KNCA 4RFRB 2BOJA 1Q8PA 5CFCB 1PMJX 2BWCA 4WV8A 2PELA 1OPMA 1QJU3 3GZAA 1S0IA 3OJBA 2HBTA 2O8OA 2VMCA 4LNVA 5KXDA 3O1OA 4GKXA 3ZMOA 1CZTA 3RG0A 1JYCA 4DUXA 4L92A 4DUVA 2FHRA 1YYNA 3C7EA 3K3NA 4RR3B 1QDCA 2Y8KA 5FO9B 3T2QA 1AX1A 2YB7A 4JGZB 4MVTA 5IK7A 1QMJA 2OW4A 1RUH1 1UZWA 3DYOA 4QQLA 4UOJA 3WHUA 1RVF2 3OGJA 3R6SA 1B09A 1DGWA 2F4PA 5K4LA 5DZFA 2ERFA 1VBB2 2WS92 1JH5A 2CV6A 3HOBA 4TLGA 3RZZA 1YLLA 3I2HA 2Q8OA 1QDOA 2EF6A 3PUSA 3ZVXA 2ENRA 1F2NA 3OG2A 4JKMA 3UESA 1CAUB 2R072 4YGDA 3TB0A 4DXTA 3LF7A 4CDXC 3ILNA 4MX3A 3LCPA 4BPZA 1Z78A 3K75B 3WDWA 1FXZA 5I93A 5LA0A 3BUCA 1MR5A 1R1A1 1W2AX 2HWB2 5IVBA 4CCOA 3ZYGA 3LEIA 4GWIA 1RUG2 4SBVA 5CZKA 1HXS2 4BHPA 1RUF2 2DCZA 5C9AB 2XG3A 1GZCA 1RITA 1RMU3 3ZFEC 5JIUA 3VHPA 5L19A 3AXEA 2EXHA 1UOJA 1T6GC 2YC4A 3VBRB 2VCCA 2WQZC 4AXOA 2RR12 4XC9A 4XQ4A 1PZ7A 4QX7A 5LATA 1GWKA 2X8KA 1JODA 3KHBA 2AYHA 5BNNC 1RUOA 2VNRA 3PUQA 3TN93 3GXUA 4PBPA 1AYN2 2D6NA 4Q4V1 3HQXA 4FP3A 3LA7A 4MGIE 4KQ7A 5C8WA 4YZ4A 4M3CA 1VLNA 4IEXA 3WNOA 1YJKA 1NOVA 1QQP2 1AYM1 4RA0A 2JDKA 3IAPA 5FUIA 3RZHA 2YFZA 3LEKA 3S57A 1K45A 3IMNA 2G19A 1VB2A 5IK4A 3S0MA 2K46A 1Q3EA 2QCSB 4FPEA 1FV2A 4A2UA 4QD2A 5C3PA 5I91A 3AX4A 4HK8A 4XDOA 2XJRA 4F3JA 5A7WB 3T4VA 1Q43A 2JWPA 2WZEA 2PAEA 3UGHA 2QQIA 3AP4A 1W6OB 4P9LA 2B4KA 4RHV2 4YNIA 2WLPA 3NNGA 5FZ6A 4P5YA 3VZNA 3WT3A 3K3OA 1JYIA 1XNTA 1LOGA 5FYVA 1RHI3 3TEZA 5JXHA 4Q27A 3S5AA 1OLME 1CAXB 4H2AA 1NCQA 2WSUA 3Q9OA 3RVHA 4EWEA 1SZBA 1UYYA 2OPWA 2A3YA 3NJZA 1OA4A 1QOSA 2ZBJA 3FUQA 1W28A 3T08A 4NWWA 3WW2A 5L9RA 3JB4C 5FUPA 2BJSA 5FR3A 5EXOA 1OH3A 5FP9A 5JZGC 1JUIA 2YDEA 3ON7A 1K5MB 5FYYA 1QH6A 4Q1RA 3TEXA 4BXSV 4ZZ8A 3AMPA 3OD4A 4GXLA 2B7YA 1WMXA 5JWPA 5D8AA 3AZXA 3VZKA 1MEC1 1AR62 3B3QE 4OVEA 4X6QB 1AR91 4XF1A 4ZONA 3I8TA 3DKWA 4CDQB 1RIRA 2N7GA 3H3LA 4E4SA 2FDIA 4KU8A 3R4UA 3B93A 5EWSA 5CKNA 4W8JA 4K20A 4XVHA 1V9U3 1ENQA 3C7OA 1ND2A 1VE0A 2DV9A 2K2SA 5C70A 3U4SA 2ZJCA 1XBFA 4FFGA 4S2HA 4A42A 4COYA 2IUWA 4NPMA 3OPWA 1ASJ1 1LEDA 5D2AA 1H6YA 5KBFA 2JDPA 2YPJA 4NOTA 4FPLA 3NV1A 5L7OB 3BTZA 2YU1A 1AJKA 5FP3A 5FBJA 3RSJA 2V5YA 4JHTA 1O3TA 4RL7A 3JB8A 1VAKA 5G05L 4B7EA 5FPVA 1APNA 2QQMA 3C7HA 4NIGA 2YC0A 4A3XA 5A70A 3CU7A 4FPOB 2XQRA 4BXFA 2E51A 4YM1A 5D1IA 5EV7A 3H8OA 1O6UA 1W05A 1BZWA 4IGPA 3N9PA 5LCWL 4GKYA 4AI0A 4IERA 2A6YA 1ODNA 3D0JA 3VBSA 2NMOA 3LQCA 2XB6C 1XOYA 2RS51 1H8TB 2VUCA 1VMJA 1X82A 3IBMA 4EN7B 2GH2A 2VUDA 4TXWA 1I3HA 3D4KA 3RI9A 5E88A 2DF7A 1REDA 3VBHC 3HN1A 4ZZ5A 2WZR1 1G9AA 1PVC3 3NJVA 4RQPB 3IAQA 4JC1A 1HN1A 3POEA 4OHWA 5LBBA 4AQ6A 2OX0A 3OCPA 3BCWA 2FMYA 3ZXFA 4E4HA 4HVQA 3VGIA 2P34A 3IZOA 3V0AA 2X53S 2JKBA 1OI6A 2WNUC 3W21A 1AR83 4CDUC 3X29B 3THTA 4IGQA 5A7SA 5A3LA 2VAUA 5DDJ1 5K0UC 4I3PA 3MV11 4LIUA 4FFHA 3USUA 1IS6A 2W1SA 1RUNA 4HXCA 1CIWA 4ZXEA 4N9HA 5CB7A 2WIIB 1CAVA 1ND3B 2ZCWA 4Z92B 4XYXA 2OYZA 2NMNA 5F39A 3LFIA 2I74A 1WBLA 2HH9A 2RHPA 3KLSA 1H30A 2IFWA 4IQPA 4QGMA 5I0UA 4D6SA 2KXLA 1LOFA 3ELNA 2VW2A 4PIYA 2XBO2 4MYEA 1ULEA 4ZY9A 3H1YA 3PUAA 3POSA 3B69A 1QJZA 2J1EA 1C1LA 2HWE1 2V5DA 3JD71 1V6LA 3ZDSA 1ZYBA 1E5IA 2R30A 1ENSA 1UX7A 1RMU1 3MUZ1 2NM1A 1COV2 5C5UA 3ZX7A 2W94A 2X10A 1RUD3 3VD9A 2JD9A 3W5NA 4XXAA 4ITCA 1N3OA 1NE4A 1RXGA 3CJIB 4N43A 3B9CA 4YRDA 3VV1A 3VD3A 4KWKA 2LW8A 5DABA 5EIYB 4NHXA 2DURA 5FZ8A 2PA7A 1GNYA 1X7NA 3ORJA 5J1XA 2XKPA 1SFYA 2XLGA 3BPZA 1NA1A 3EBRA 4WM7B 2WNVB 4AK3A 2WR9A 2W08A 3OTFA 4FPCA 5A7QA 2DVFA 4PHZA 5JUVA 1CX1A 1UKGA 2VXJA 3AP5A 4KWUA 1OPOA 4META 3BU0A 1H1IA 2KM2A 1UY4A 5CA6A 2QUOA 2FCVA 2MEV2 4QKFA 1V6MA 5FXVA 5JMOA 1VRH2 2YFUA 1UO9A 3U1XA 1WCQA 4UW6A 4ZU4A 1UXXX 4UFIA 4CCKA 3FHQA 2IFRA 4FO9A 5GLZA 3UJOA 2YC2A 5FJHA 4FP2A 2G9GA 1NLSA 4XQWA 5CG9A 5BXXA 2C9AA 1SG3A 3PVNA 4XUNA 3IWZA 4FBFA 3UKVA 3WDVA 3VZMA 3I49A 4O9EA 1D7PM 4XFAA 5HV4A 4Q8KA 5FZ1A 2W87A 2XHNA 3MI8A 4Z8BA 3GZEA 1RTVA 3SH3A 2GU9A 3HT1A 3NRUA 5EYXA 3VHNA 1XE7A 2Q1FA 4EN0A 4E4ZA 4KL1A 4IE5A 1SBDA 4OHVA 2BOIA 3JBG3 4RN5A 1PVXA 4QQHA 3M1HA 4BB3A 1OBNA 1HQWA 1OLMA 5F9TA 4W4ZA 1UOGA 3ILFA 1FATA 3S5QA 2BGCA 3VBUB 4J1XA 3WF4A 5B2GB 1OF4A 3DPRB 5IVEA 3HQUA 3INAA 5C8CB 1MQTA 3HD8B 1BYHA 1UQXA 5GLUA 4CVUA 2ZAAA 1IS3A 1CAWB 5DMYA 1VIWB 5GZGA 3TBDA 1F35A 1RUI1 3K48A 4K1ZA 1RGSA 4FQZA 2A6WA 2VOXA 4M4RA 2AGSA 1MS4A 1NCQC 4FOWA 1ULFA 1OOPA 4XMAA 1REEA 3VHRA 1PMIA 4PDWA 2HWF3 3V56A 3RGBA 5A3TA 3MIEA 1AVBA 4NHMA 3CQOA 4ZU7A 2QQLA 3WQ1A 2Q30A 5ANQA 5D8AC 3ZN6B 1GQHA 4LTAA 3TNQA 1Q8VA 3J8F1 3ZDVA 3N35A 4LE3A 4BZ4A 3MV01 2R0FA 5L73A 2PAMA 3FN9A 4FFIA 4YGCA 1UKRA 2YU2A 1WZXA 1ZZ8A 1GZ9A 3ILRA 1CONA 1ND2C 3HNMA 3TYJA 4FT8A 1DBNA 3K51A 2OUJA 1HRI3 3KCYA 1RUJ1 4XFGA 1AXKA 1OKQA 2VCAA 1PVC1 5GLTA 3FLTA 4JDOA 2CSGA 5FV3A 1CZSA 4EWAA 5GZDA 1VBA3 5DQ0A 3PL0A 5A3WA 4CZSA 4Q5OA 2I07B 4A7KA 2OQ7A 3IT8A 4MGYE 5TSWA 3KCXA 3FUOA 3O14A 3NV2A 1NKGA 2ZEWA 4Y20B 4JTOA 4MZUA 4LO4B 3U11A 2LS6A 3VBOB 3WNMA 1OFSA 3D5OA 2GMMA 3N9LA 4Y1UA 1KDKA 2QNKA 1VPHA 5A80A 1MZ6A 4LKFA 3GHMA 3GNEA 2AACA 2HJIA 1W0PA 1BKZA 2JIGA 3VBSC 2AREA 1CWPA 4XF4A 5DAXA 2P37A 2Q1ZB 4M0NA 1LCLA 1YRZA 2WKKA 2C0ZA 2KD7A 4JAAA 4BU2A 5IYYA 1QHDA 4YW5A 1C5HA 4ASLA 5A6YA 2BP6A 1AL21 3I2JA 3SKJE 1K5JA 4NPLA 5A32B 5IK5A 1FPN1 4GB33 4CXYA 1UD1A 1W8NA 5I0SA 4K8RB 1VMFA 2GMEA 4UF0A 5DG1A 3DXTA 5FXXA 1BMV2 4XEZA 2JX9A 1W9WA 5BY5A 1DQ4A 3DF0A 4HMZA 4UW3A 3LEGA 1IS5A 4JGYB 4XACA 3LKJA 3RZMA 3MEPA 5FY1A 3TWIA 1LHWA 4URAA 2ZS6B 2AUYA 1ZBE1 1YHFA 2VQTA 4L99A 4NMIA 4HBNA 3LIGA 2P3YA 3ZXJA 2BNOA 3CBNA 1U5IA 4CCEA 1NZIA 5FXWA 5LRSA 1I5ZA 1SLBA 2BV4A 4XUPA 5CNAA 2EIBA 4PBOA 2AZ5A 4A44A 2ZGOA 5C4WA 1S0BA 5SV8A 2W5FA 3SEPA 4CXXA 4QM8A 4RR3A 1DQ0A 5FZ7A 3WY6A 2ZHLA 4NRPA 5CKMA 5JCTA 4FPGA 4LBQD 1OVPA 2BDRA 3I54A 4XURA 1GOFA 1UPIA 1L7QA 4BQ2A 2UWAA 1CVNA 1LOFC 2Y6HA 4YFZA 1LB2A 1W6QA 3AZWA 4B1MA 2Z4FA 4UBGA 4WVZA 4A41A 1CD3G 1SMVA 4IE0A 2RM23 4GQ7A 5DXDA 2DVDA 2VMIA 1IKPA 2Q8CA 1LODA 2ARAA 4E27A 4EROA 4S2GA 1DU3D 3AVRA 5F3CA 5GLWA 3BIWE 3Q8CA 2YHJA 2OZJA 2VVFA 2WO1A 2CGOA 3AYEA 3NMBA 5JSPA 3ZYJB 1S1AA 4RFT0 2HWC2 2XDVA 2H0VA 2HWD1 2VOVA 3VHOA 4Q1PA 5F2WA 5F5AA 3O1SA 4IW3A 4WM8B 2BQPA 4OI2A 4GWJA 4N43C 4Y5TA 2GN7A 2XPJA 4FAGA 3URFA 2O1QA 4YM2A 1UY2A 3ZFGB 1EV12 2XL7A 4NIDA 1PX3A 1NA1C 1PM7A 5AFBA 3IIAA 4LMFA 4M0HA 1H1AA 5EPAA 3MO4A 2W1UA 4AZZA 2W68A 5IAXA 4G4FA 2TUNA 4QHBA 4AF9A 4IV3A 3ZIWA 1DQ2A 4W65A 1LAJA 3OGGA 4C90A 4QAWA 4AR2A 1LGBA 1RUC2 3AMHA 4RGAA 1BCXA 3JQWA 1B35A 5FO7B 5FZBA 2WSVA 1W8OA 3I3DA 5A7OA 1OLQA 2XR4A 4DEVA 1HV1A 3UKNA 2GNBA 3I2KA 4C0BA 3ZSMA 4COUA 3IDEA 5CVRA 2P6HA 4XE9A 2J7MA 4LBJA 2E53A 1N1SA 3KVBA 1QJX2 4XCBA 1CX4A 2D5FA 4FCAA 3WG3A 2F17A 2GSYA 3M8LA 5AC92 4X8PA 1ULOA 1WUVA 3ZKYA 1RUH3 1U0AA 5A33A 5LY2A 3N9OA 1JS9A 3VBFA 2CWSA 4UXAA 3M3IA 3AZZA 3OY8A 4NR1A 1R092 1Y4WA 4AYUA 2R062 4LOTA 4XMIA 1O3QA 4BH9A 4PLOA 4YG6A 5LK5A 5LA9A 1OD3A 5BNPB 3BTYA 2BVVA 4FPYA 1DLLA 4AEDA 5FCCA 1J3RA 1ZBA2 1D4M1 2YZ4A 3L9JT 4M4PA 4AFMA 4Y1ZA 3CMGA 3WDUA 1PO13 2GNTA 1IHMA 1TVGA 3SKVA 3RWKX 1IPKA 2ZX1A 1R1A3 2K9ZA 1HQLA 4QPYA 5T52A 1BK1A 5A1AA 1STMA 1W04A 5C5TA 3AP6A 3LB9A 5FLJA 5FMOS 4QB6A 1ULGA 2NPIA 5H9RA 3N9QA 1A6CA 4ZKTB 3WW4A 2Z79A 3PNAA 1MQTC 1MZFA 3OBAA 1FOD1 4NJ4A 4HPKA 3WQBA 1OUXA 2I45A 4HKOA 5EZWA 2Y64A 2WFF2 1A8DA 1KJLA 3LOBA 3OGRA 1JOBA 3HN3A 5T3NA 4YZ5A 2P6CA 3ZOIA 2GC0A 4Q4V3 5FXZA 1GR3A 1EAH1 2RJKA 2R1BA 4PDWC 1I6XA 3FBMA 4N53A 1JYWA 4WZCA 1WKYA 1AYM3 3RWNA 1UYPA 4CCJA 4ZS3A 1DZTA 1AR73 1F5FA 1LOAA 1SPPB 3C8XA 1G9FA 2WFPA 3AB0A 4E2GA 2DU1A 1BJQA 4IL7A 2TEPA 2FMDA 2BNNA 3CO2A 4L0PA 4SLIA 5BPXA 5J37A 1ZNPA 4GJZA 3LPGA 4Y33A 2VY0A 4YWAA 4U36A 5C71A 5IVVA 4GB31 3IMMA 5DAVA 4GD4A 4BQ3A 5HPOA 2Y6JA 1ULDA 4CU7A 3IDCB 5DZEA 5GLVA 2DDUA 4QPGA 5J48A 4P9WA 4Y26A 3OF1A 1MPXA 1MVEA 3FWEA 1XNCA 3BVCA 4RSUA 3POYA 4YW6A 3VDDA 4Y24A 3K4DA 4LT5A 2H0BA 2C26A 4QKBA 4A6OA 4RQPA 3V0BA 5JOZA 3OUHA 1YJLA 2IVIB 4CP2A 1JOPA 3AM2A 4CCMA 1MEC3 3UETA 1LHNA 2CAUA 3WUDA 1XXNA 2XHKA 5HCFA 4EYUA 1AR93 2D6MA 2ZZQA 4AI1A 1HRV1 2XVLA 4WBBA 5IT6A 2ATFA 1VBD1 1G86A 5A6ZA 1VBE2 2HEYF 2C1FA 3M7AA 4AQSA 4CYDA 5FYTA 4NIAA 3KSCA 2XH6A 1KEXA 1E5HA 4G9SB 1HB4A 4QX8A 1ZZBA 2ETEA 5IFPA 1ZRCA 2A6ZA 4LBQA 5JI7A 1JMUB 3AYAA 1LJ7A 4CP0A 3CEWA 1H9WA 3B00A 3EQEA 1CPNA 2OUHA 2Q0AA 4LBKA 5ABJB 2HEVF 2BFUS 2X5IB 5JR2A 1TMF1 3PIJA 5DZGA 1HB3A 1N47A 2B9UA 2WQ4A 3ZYFA 3GM8A 2QE3A 2ZMNA 3MGUA 3FFQA 1W6PA 4YG0A 2PLV2 3WNLA 2IZWA 5FYCA 4XUTA 2VL4A 1BBT2 4CP9B 2VZRA 2W1QA 3PU3A 4WZFA 2RS53 1ODMA 4YZ3A 5C4WC 1TME2 1WBFA 2OPKA 4OMCA 1UU6A 3OUJA 3CJIA 4BM8A 4CE8A 4JTNA 4DMIA 5FWJA 5JMCA 3GGLA 3B9IA 4CUAA 1W39A 3PURA 5CYYA 3HBZA 3LD8A 3AZYA 3FE5A 2WZR3 3DYPA 2WC2A 2P4EA 2QDRA 4IEYA 1R082 1S2KA 2BGOA 2BZDA 2VM9A 2ARCA 3UGGA 1QJY2 5CFDB 2FDFA 4GA9A 5FYBA 4Q4Y3 1HJFA 1FNYA 1LECA 4ZPIA 1JHNA 1VBC2 4O7XA 1UY0A 5FQ0B 5IFTA 1O3SA 4MGTA 3ZSKA 3UGFA 4YVSA 3GYDA 4Q4W1 5FZOB 1ZRRA 3AK0A 1YC61 1RJ8A 2VBDA 4QDRA 1YQ6A 1C28A 1WMFA 1GNHA 1W2TA 1YWKA 3NAPB 2A71A 4K3UA 5EJ3A 5FKBA 4IXLA 1UX6A 3O5SA 2XJSA 1LGNA 3ECQA 2R042 4QMAA 5DDJ3 3WDXA 2WS93 3FFZA 4Y4RA 3K4AA 1SBEA 3H7YA 4LBMA 2LROA 5B4XA 3UKTA 1PIV2 2VG9A 2HKXA 2QTWB 4BQWA 4IV1A 3U14A 1ACCA 4AI3A 1SLLA 2GC2A 1H2MA 2PHWA 1QNWA 3H1WA 3MLLA 4GZ9A 3WP5A 2XJTA 4MXVA 1QJU2 2VOTA 1UZYA 3HMYA 5A3NA 1PO11 4W6YA 1NCRA 4IV3C 3J4UH 3NJYA 2JDHA 1VB4A 2W95A 3BOPA 4MGQA 1RINA 1UW8A 3ME2A 3I3QA 2IXKA 2HWE3 3EYPA 4K9SA 4AEKA 3PTRB 3JD73 1B35C 2XUMA 1DQ6A 1SBFA 2R0HA 1XYNA 1OC1A 1G6NA 2JG8A 4Q0VA 2VVDA 4P9JA 4XFBA 4FAHA 2CL2A 1JW6A 3BODA 4I0BA 4O65A 1US2A 4Q0PA 4ES8A 1LHUA 2E33A 2JJ6A 2BUKA 3VBUA 4JX0A 1YFXA 3PMEA 4XIKA 1W8UA 3ENRA 4AOCA 4D8MA 5F1RA 4LO7A 4B7KA 1AYN3 2GNMA 1HJGA 3PUIA 2AC1A 1XQNA 4FXKB 5BUVA 5J36A 2EIDA 5DG2A 4BIFA 5C8CA 1GV9A 4AW7A 3BOWA 3VBFC 3PLQA 4Y22A 4GAZA 3WF1A 5A1LA 1WGPA 2WN3A 2WO3A 1CAWA 1WCUA 2YBSA 3KV4A 4LO8A 5IJRA 3VZOA 3VDCA 4ORFA 1BVP1 2B46X 2JKXA 1AR71 4KU7A 2CY6A 4ASMB 1OQEA 2OZ6A 1FV3A 1RMU2 5GKAC 3IIIA 4AEDC 1XB9A 4URTA 5FUNA 1MS3A 4E4DX 5FBZA 4JQRA 2R7EB 4XJZA 4CDXB 3G6JB 3LA2A 3HVDA 5FZHA 2WT0A 4QXCA 4RHV3 4GALA 1OXCA 4BQYA 2WQ8A 3T2OA 1JYVA 1U5XA 4FFFA 4LXLA 2VZUA 5JXIA 1GOGA 2Q8EA 2RS31 2Q8DA 3TN92 3AKSA 4KBBA 1WW4A 5GALA 3S7EA 2G4IA 5HV0A 4UBHA 1TNRA 3ZFEB 3O7OA 4EN8B 4XFCA 1GQPA 3IDBB 4IETA 2BEOA 2E31A 3BGAA 4YARA 3NVCA 1X8MA 1O4TA 3P6BA 1O8PA 1C8NA 1Z7S1 1LU2A 3WCSA 5CEHA 4CDUA 5BNNB 4XDPA 4TTGA 5FPBA 3R05A 2RS11 2HLEA 2A1XA 2QZ2A 1ZZCA 3FJSA 1Y7BA 1EYBA 4A3ZA 1UAIA 3PIGA 4N53C 4PLNA 4Q0QA 4ZU5A 4QPIA 1KFUL 3UT0A 1YI9A 2JE8A 2Y26A 1C1FA 1HN0A 1RHI2 4CEYA 1Y9QA 5J7MA 4CU6A 2BWAA 2B45X 2WBKA 3AP9A 4Y20A 2A75A 1C3HA 1UU4A 3WNPA 3FHAA 4XJAA 4HT1T 5K8SA 2VZ3A 2VZQA 5ACA1 3ATGA 3MF6A 3RZLA 3WCRA 2AENA 1KS4A 1PK6A 4LHSA 1RUI3 4OUSA 4XXPA 4AEMA 4JRAA 2VMHA 3N7JA 1TEIA 1QOTA 2YG0A 5G04L 5F37A 4EE2A 4QPGC 3H3ZA 3POIA 1JZ8A 3MIBA 3SQOA 1KXGA 3ACFA 3WUCA 1S0DA 1BXHA 3QH6A 4QXKA 3VDDC 1H4HA 3BYWA 5FZFA 4YSFA 1V9U2 4GH4A 4Q4X1 1PZ9A 3AP7A 1PGW1 3NWKA 4X6RB 5KHIA 4CU8A 5JZGB 2XL9A 3M3EA 1BEV3 4LHLA 4RQPC 3P5BA 1RC6A 4P08A 4CSWA 4O61A 4QQ2A 5FMDA 1LU1A 3J8F3 5JR7B 2QKDA 2UWBA 3DGTA 3CZJA 2W9XA 2GAUA 4E2SA 3OYWA 3WV6A 3T2TA 2EALA 2CDOA 4EZ4A 2VZVA 2P5BA 1SCSA 1URXA 3EO6A 2PHFA 1RUJ3 3POFA 4LPLA 2B5HA 4BQXA 1Y3TA 2WNOA 4RD7A 4Q4Y1 4QKNA 2FZ2A 5JAXA 5K7PA 4C0HA 4YZ1A 4YFWA 5IVFA 4DO0A 4B4PA 5A7PA 1H1MA 4NRQA 4BYYA 1Y9MA 1QF3A 3IPVB 3KWVA 1VJ2A 2Y0IA 2NP0A 5K9YA 5ANNA 1SLAA 4BJ0A 1UZVA 2HYXA 4LLFA 5HXVA 4QX5A 2JB8A 1RVF1 4A7YA 1LR5A 2DTYA 2ZACA 3ASIA 1G8WA 4CXWA 2WS91 1VBB1 2W39A 5LBEA 1UZZA 2Q4SA 1H2NA 3OEBA 2F6BA 2UWCA 4XBNA 3GHNA 3O0XA 2IXJA 4JV4A 2R071 1PVC2 4CDWA 3ZSEA 5EQUA 3V65A 4AG4A 1SDWA 3RRDA 1BVVA 3CJIC 1OA2A 4ARYA 1UY1A 1SDDB 3ZXDA 2BBAA 2HWB1 1W99A 1ENXA 1FMD2 4LK7A 1AL23 2DWRA 1IOAA 1RUG1 5FPLA 3VBHB 1HXS1 1FPN3 3E6DA 3LIHA 1AR82 1RUF1 1RXFA 4L2NA 4M3CF 3I59B 4JZRA 3MICA 1K3IA 1UOBA 4HN1A 1DHKB 1OF3A 2K0GA 1FI2A 2Y38A 4L11A 3T0AA 4A45A 4LA2A 2RR11 2D6LX 4P9XA 2C24A 4KH9A 4QB1A 5F5QA 4Q29A 4DQAA 3QBQA 2WZPP 2J1SA 1TZOA 3TAYA 3OBTA 5F7UA 4HSJA 4YVSC 1D2SA 1OUSA 1ZBE3 2BFUL 2IXHA 1S2BA 4P02B 5FY4A 5FZ0A 4EV0A 1O91A 1AYN1 1V0AA 1QH7A 2UURA 4R9AA 1MZEA 4Y3OA 2WNUB 4CDUB 1RUE2 4YZ2A 4DY5A 1V6KA 1QQP1 4COWA 5K0UB 1N1VA 3NKTA 4XHBA 4LUKA 2UYBA 5KXBA 1JYXA 5JLVA 4GULA 4B4QA 2WAAA 3MF9A 1UIKA 2DCKA 3LSDA 4IV1C 5FZ4A 3ZLIA 1CGPA 2VW0A 3SCHA 4MHUA 4ATFA 2BU9A 4MO3M 4OHZA 1V6JA 4Y1VA 1W90A 1PO23 2ADDA 1RUD2 4GIQA 3FX3A 1W8WA 4XF0A 3ZYRA 1UCXA 3H9AA 1NCRC 4K21A 5A6QA 1O4YA 1IZ3A 3BN6A 4RHV1 1SLIA 1J59A 4WVMB 3F2ZA 4HONA 2FD8A 1DP0A 5GJ6A 3OSDA 1YUDA 3M70A 4QHOA 2JG8C 2ZHNA 4CUCA 2HWD3 4MGSA 4XUOA 3OGVA 4AI2A 4FVVA 3C3VA 4P9IA 3T09A 1DDLA 3VBUC 3OEAA 4AHZA 4LBNA 3KF5A 1C5IA 1DGRA 1XNAA 2ZGMA 1JZ4A 3NKGA 4YW3A 3Q8AA 4AVAA 2WUHA 5FYHA 4YVWA 5I0RA 1S0FA 1GU3A 1AR61 1UF2C 2UYAA 4CUGA 2FDHA 3QLQA 2RMU2 2DUQA 4QX2A 3O1UA 4XW3A 3H0OA 1FNZA 1J83A 2D6KA 4HLTA 1SQ4A 1QEXA 2ET1A 1A34A 4BA6A 4F83A 3BTAA 5FZKA 1WD3A 3SXWA 1W6MA 1O7FA 5FZIA 4QHZA 5F3GA 2OT7A 1J3QA 5A3PA 5DUVA 1UL9A 2WWSA 4XFIA 4XDQA 4CPBA 2E7QA 5FDBA 1ZA4A 5E6HA 5F8PA 1L7RA 3MIDA 4PIZA 5DUXA 1LOBA 3WP4A 3PTYA 4CCCA 1NT0A 1DF0A 2TNFA 3NV4A 1W0NA 1W9SA 3R0RA 3T1LA 2Z69A 4CCLA 4Y1XA 1DIWA 3JBG2 3J7HA 4YPJA 4LORA 3JQXA 1J84A 3UYJA 1GWLA 2VQAA 3RJRA 2LRPA 3OD0A 3ZXKA 3QCWA 1CQ9A 5F6LB 3WNNA 1POV0 3CJXA 4QWNA 1BEV1 5FZGA 1F15A 2DYCA 1IPSA 1D4M3 4M3CB 2JG9A 4QPIC 2B39A 4ISRA 5IWFA 4XJWA 4AVVA 2WWUA 3Q8FA 2VR4A 4IUGA 3ACLA 1WWYA 4CEYC 5BNOA 2FCTA 3H8RA 2BVBA 4AVSA 5IAVA 1XSQA 5FZAA 5GM0A 3JUUA 4DXSA 1XSRA 1MVQA 2QQWA 2BBVA 4OI4A 4HANA 4Y1YA 1FOD3 2GZWA 2HWF2 4IEUA 5H9QA 3T1MA 4AE2A 2Q5TA 4UFKA 4B29A 3WDTA 4AFDA 2W52A 4E8DA 1PK6C 1KGYA 4HL0A 2YROA 2B8MA 1DZRA 1UMZA 5J96B 4XBLA 4BQ4A 2Y33A 2Z2SB 4JCKA 5KHJA 1SHWB 3F95A 2GNDA 3GBFA 1EUUA 1C8M2 1CESA 4ET7A 1LOEA 4S2FA 1EAH3 2J1UA 4J6GA 2NLRA 1QY4A 5T54A 2AR6A 3GCWA 3U10A 4GH4C 4JHZA 1LHOA 3SISA 2WRAA 3U07A 2X5IA 4LHKA 4NE9A 4KG0A 1HRI2 2R32A 3RZGA 4PLMA 5AVPA 5KC5A 5CKQA 5C3SA 1PGL2 2A7AA 2A6XA 2D97A
chains in the Genus database with same CATH topology
4GWIA 5CZKA 2QQOA 1JYWA 1WKYA 2YC4A 2VCCA 1YQ2A 3C8XA 4L0PA 3MBWA 1EUTA 3HPNA 3GXUA 3T2PA 4BK5A 2PQSA 3LPGA 3WNOA 5C71A 5FUIA 3IAPA 2YFZA 1NUKA 3LEKA 1K45A 2VZSA 1I5PA 2EIEA 2Y6JA 5HPOA 4CU7A 3P1IA 3CZUA 2DDUA 2ORXA 3OGSA 1MPXA 2C4XA 2Y6GA 1ULPA 2WZEA 2QQIA 3A21A 2B4KA 3K4DA 3NNGA 4P5YA 2C26A 4OUEA 4A6OA 1XNTA 2J1VA 1IQDC 2W1WA 3HJRA 4P00B 4QDSA 1US3A 5JXHA 3CDZB 3UETA 1RYYA 5JXJA 1UYYA 4JKKA 4ARXA 3T08A 2QQJA 2J1TA 1KEXA 4BXSV 4ZZ8A 5IFPA 3VDBA 2ID4A 3FL7A 4QDQA 2ZXQA 4BK4A 4W8JA 4XVHA 4FI9A 3C7OA 5JR2A 1DLCA 1K12A 5C70A 2W3JA 2ORZA 3GM8A 4A42A 2B9VA 1H6YA 3WNLA 1UYXA 4XUTA 2VL4A 2WYSA 2WDBA 5IHRA 3ABZA 2VMDA 2J1AA 2VZRA 2W1QA 5G05L 4W50A 2QQMA 2RV9A 3C7HA 4OMCA 3GGLA 3OB8A 4CUAA 5CYYA 4KI5M 3DYPA 5LCWL 2QQNA 2BGOA 2BZDA 2VM9A 1PMHX 3U37A 3LQCA 3WSOA 4QB2A 1UY0A 5IFTA 1JZ2A 4TXWA 3UNPA 3THDA 4QDRA 4ZZ5A 4CUBA 2VC9A 1BHGA 3ECQA 3NJVA 3IAQA 1HN1A 2Y6LA 3K4AA 4Z2AA 5B4XA 4MOAA 2C9KA 4A4AA 4GZ9A 2WABA 2WN2A 5LA1A 2VOTA 4RYDA 1DYOA 3MV11 2V4VA 2W95A 2W1SA 4MGQA 1GOHA 3EYPA 4MADA 4ZXEA 4CU9A 3D3AA 3E1F1 1O8SA 1US2A 4ZY9A 2E33A 2X09A 3HNBM 3IB3A 4JX0A 3HNYM 5DPNA 2L9LA 4D8MA 2J1EA 5EJ1B 4UI9L 3HEIA 1OH4A 3PUIA 3A7QA 2EIDA 2V5DA 3T0BA 3I3EA 1UX7A 3MUZ1 1GMMA 2XOMA 3WF1A 2WN3A 2W94A 2WO3A 2X10A 3MUY1 4PF1A 5IJRA 3VDCA 3VD9A 2JD9A 2JKXA 3W5NA 1F4HA 3PUHA 2XONA 5DN2A 3VD3A 5EJZB 2LW8A 3IIIA 4UAPA 5EIYB 2VMFA 3CIHA 1GNYA 2R7EB 5J1XA 2VTFA 1T2XA 2VCBA 3ACIA 3NQHA 2WQ8A 3T2OA 1JYVA 5JUVA 3WNKA 2WO2A 1CX1A 2VZUA 3C7FA 1GOGA 4KWUA 5JXIA 3K46A 5HXMA 1UY4A 2JDAA 1GQPA 2VZPA 3IDAA 3BGAA 2E31A 2ZEYA 5JMOA 3NJXA 1CIYA 3P6BA 2YFUA 1O8PA 1WCQA 3CKHA 1UXXX 4TTGA 3FHQA 2HLEA 2YC2A 4A3ZA 1SG3A 2EICA 4XUNA 1UMHA 2OKXA 2JE8A 1D7PM 3ACGA 4DXRA 2VO5A 2W87A 2XHNA 4CU6A 2RJ2A 2WBKA 3NRUA 1O59A 3W5MA 3WNPA 3FHAA 2VZ3A 2VZQA 3DECA 4RN5A 1XC6A 4LHSA 4W4ZA 5C7GA 2YG0A 5G04L 3LE0A 3WF4A 3ACHA 2W47A 1JZ8A 3VD5A 3ACFA 1OF4A 4LQRA 2E26A 4CVUA 4CU8A 1JYNA 5DMYA 3A23A 1UYZA 1UWWA 4P08A 2BERA 4M4RA 4JKLA 1W9TA 3WF0A 3CZJA 2W9XA 3A22A 3LPFA 2CDOA 2VZVA 4BDVB 3K4ZA 3CQOA 4LPLA 2WZ8A 2QQLA 1LNSA 5B4NA 3AC0A 3MV01 2WAOA 3FN9A 2X05A 3HNMA 4BJ0A 2HYXA 2VCAA 3VD7A 3WF2A 3WEZA 1CZSA 2DCJA 2VZOA 5DQ0A 3OEBA 1F4AA 1TG7A 4AG4A 4QX0A 4QX1A 4ARYA 1UY1A 1NKGA 1SDDB 2ZEWA 3I97A 2BBAA 3WNMA 1W99A 2LS6A 4DEQA 3GDBA 1OT5A 1JZ5A 1K3IA 1OF3A 3T0AA 1NX9A 2QBXA 4A45A 3LEIA 4OYUA 4QB1A 2KD7A 2J1SA 3JXSA 5F7UA 5IYYA 2J22A 3DYMA 4P02B 3I2JA 3SKJE 2RVAA 4XZUG 1JU4A 3EB7A 1W8NA 2QQKA 1W9WA 5LA2A 3I2GA 5I0DA 3LEGA 1JYXA 2WAAA 1CZVA 2VJXA 2DCKA 2W46A 2VQTA 4MO3M 3THCA 4XUPA 3I2FA 2EIBA 3BN6A 3I3BA 4A44A 3F2ZA 3SEPA 2W5FA 1DP0A 2VMEA 4PQQA 2BGPA 4XURA 4CUCA 4MGSA 4XUOA 1GOFA 3OGVA 1L7QA 1JU3A 2Y6HA 4QX3A 3T09A 1JZ3A 2W91A 2Z4FA 2XQXA 4A41A 3OEAA 1GUIA 1K42A 1XNAA 3VD4A 1JZ4A 1PX4A 2WUHA 3WF3A 1GU3A 3ETPA 2WO1A 4AAXA 4D0QA 4XUQA 4QPWA 4QX2A 1UY3A 1J83A 1JI6A 4GWJA 4KMQA 1UY2A 2ZEXA 1PX3A 3ZM8A 5JXGA 3MO4A 2W1UA 2Y6KA 3I2IA 1L7RA 4E8CA 4OMDA 3SEEA 1R64A 4QAWA 1W0NA 1W9SA 2W92A 3J7HA 1NAEA 4YPJA 3VDAA 1W8OA 2ZEZA 3I3DA 1J84A 2VQUA 4DUWA 1UXZA 4DEVA 3K77A 3I2KA 3WNNA 2J7MA 1H6XA 1UZ0A 1JHJA 2E32A 1ULOA 1XPWA 2VR4A 4IUGA 1PMJX 2CDPA 2VMCA 1JZ6A 1CZTA 4DUXA 2V72A 1OD3A 4DXSA 2VZ1A 3C7EA 4DUVA 2Y8KA 3C7GA 1P8JA 3T2QA 2YB7A 4M4PA 4E8DA 3CMGA 3T0DA 1TVGA 1KGYA 3DYOA 4UOJA 3SKVA 4PT6A 1SHWB 3HOBA 4LKSA 1EUUA 5A1AA 4ET7A 3I2HA 4HG6B 1UMIA 4QB6A 2J1RA 2J1UA 3OG2A 4JKMA 3UESA 3OBAA 4DXTA 4JHZA 3WQBA 2Y64A 3OGRA 1JZ7A 4OZOA 3K75B 5LA0A 3HN3A 2VZTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GWI A;  5CZK A;  2QQO A;  1JYW A;  1WKY A;  2YC4 A;  2VCC A;  1YQ2 A;  3C8X A;  4L0P A;  3MBW A;  1EUT A;  3HPN A;  3GXU A;  3T2P A;  4BK5 A;  2PQS A;  3LPG A;  3WNO A;  5C71 A;  5FUI A;  3IAP A;  2YFZ A;  1NUK A;  3LEK A;  1K45 A;  2VZS A;  1I5P A;  2EIE A;  2Y6J A;  5HPO A;  4CU7 A;  3P1I A;  3CZU A;  2DDU A;  2ORX A;  3OGS A;  1MPX A;  2C4X A;  2Y6G A;  1ULP A;  2WZE A;  2QQI A;  3A21 A;  2B4K A;  3K4D A;  3NNG A;  4P5Y A;  2C26 A;  4OUE A;  4A6O A;  1XNT A;  2J1V A;  1IQD C;  2W1W A;  3HJR A;  4P00 B;  4QDS A;  1US3 A;  5JXH A;  3CDZ B;  3UET A;  1RYY A;  5JXJ A;  1UYY A;  4JKK A;  4ARX A;  3T08 A;  2QQJ A;  2J1T A;  1KEX A;  4BXS V;  4ZZ8 A;  5IFP A;  3VDB A;  2ID4 A;  3FL7 A;  4QDQ A;  2ZXQ A;  4BK4 A;  4W8J A;  4XVH A;  4FI9 A;  3C7O A;  5JR2 A;  1DLC A;  1K12 A;  5C70 A;  2W3J A;  2ORZ A;  3GM8 A;  4A42 A;  2B9V A;  1H6Y A;  3WNL A;  1UYX A;  4XUT A;  2VL4 A;  2WYS A;  2WDB A;  5IHR A;  3ABZ A;  2VMD A;  2J1A A;  2VZR A;  2W1Q A;  5G05 L;  4W50 A;  2QQM A;  2RV9 A;  3C7H A;  4OMC A;  3GGL A;  3OB8 A;  4CUA A;  5CYY A;  4KI5 M;  3DYP A;  5LCW L;  2QQN A;  2BGO A;  2BZD A;  2VM9 A;  1PMH X;  3U37 A;  3LQC A;  3WSO A;  4QB2 A;  1UY0 A;  5IFT A;  1JZ2 A;  4TXW A;  3UNP A;  3THD A;  4QDR A;  4ZZ5 A;  4CUB A;  2VC9 A;  1BHG A;  3ECQ A;  3NJV A;  3IAQ A;  1HN1 A;  2Y6L A;  3K4A A;  4Z2A A;  5B4X A;  4MOA A;  2C9K A;  4A4A A;  4GZ9 A;  2WAB A;  2WN2 A;  5LA1 A;  2VOT A;  4RYD A;  1DYO A;  3MV1 1;  2V4V A;  2W95 A;  2W1S A;  4MGQ A;  1GOH A;  3EYP A;  4MAD A;  4ZXE A;  4CU9 A;  3D3A A;  3E1F 1;  1O8S A;  1US2 A;  4ZY9 A;  2E33 A;  2X09 A;  3HNB M;  3IB3 A;  4JX0 A;  3HNY M;  5DPN A;  2L9L A;  4D8M A;  2J1E A;  5EJ1 B;  4UI9 L;  3HEI A;  1OH4 A;  3PUI A;  3A7Q A;  2EID A;  2V5D A;  3T0B A;  3I3E A;  1UX7 A;  3MUZ 1;  1GMM A;  2XOM A;  3WF1 A;  2WN3 A;  2W94 A;  2WO3 A;  2X10 A;  3MUY 1;  4PF1 A;  5IJR A;  3VDC A;  3VD9 A;  2JD9 A;  2JKX A;  3W5N A;  1F4H A;  3PUH A;  2XON A;  5DN2 A;  3VD3 A;  5EJZ B;  2LW8 A;  3III A;  4UAP A;  5EIY B;  2VMF A;  3CIH A;  1GNY A;  2R7E B;  5J1X A;  2VTF A;  1T2X A;  2VCB A;  3ACI A;  3NQH A;  2WQ8 A;  3T2O A;  1JYV A;  5JUV A;  3WNK A;  2WO2 A;  1CX1 A;  2VZU A;  3C7F A;  1GOG A;  4KWU A;  5JXI A;  3K46 A;  5HXM A;  1UY4 A;  2JDA A;  1GQP A;  2VZP A;  3IDA A;  3BGA A;  2E31 A;  2ZEY A;  5JMO A;  3NJX A;  1CIY A;  3P6B A;  2YFU A;  1O8P A;  1WCQ A;  3CKH A;  1UXX X;  4TTG A;  3FHQ A;  2HLE A;  2YC2 A;  4A3Z A;  1SG3 A;  2EIC A;  4XUN A;  1UMH A;  2OKX A;  2JE8 A;  1D7P M;  3ACG A;  4DXR A;  2VO5 A;  2W87 A;  2XHN A;  4CU6 A;  2RJ2 A;  2WBK A;  3NRU A;  1O59 A;  3W5M A;  3WNP A;  3FHA A;  2VZ3 A;  2VZQ A;  3DEC A;  4RN5 A;  1XC6 A;  4LHS A;  4W4Z A;  5C7G A;  2YG0 A;  5G04 L;  3LE0 A;  3WF4 A;  3ACH A;  2W47 A;  1JZ8 A;  3VD5 A;  3ACF A;  1OF4 A;  4LQR A;  2E26 A;  4CVU A;  4CU8 A;  1JYN A;  5DMY A;  3A23 A;  1UYZ A;  1UWW A;  4P08 A;  2BER A;  4M4R A;  4JKL A;  1W9T A;  3WF0 A;  3CZJ A;  2W9X A;  3A22 A;  3LPF A;  2CDO A;  2VZV A;  4BDV B;  3K4Z A;  3CQO A;  4LPL A;  2WZ8 A;  2QQL A;  1LNS A;  5B4N A;  3AC0 A;  3MV0 1;  2WAO A;  3FN9 A;  2X05 A;  3HNM A;  4BJ0 A;  2HYX A;  2VCA A;  3VD7 A;  3WF2 A;  3WEZ A;  1CZS A;  2DCJ A;  2VZO A;  5DQ0 A;  3OEB A;  1F4A A;  1TG7 A;  4AG4 A;  4QX0 A;  4QX1 A;  4ARY A;  1UY1 A;  1NKG A;  1SDD B;  2ZEW A;  3I97 A;  2BBA A;  3WNM A;  1W99 A;  2LS6 A;  4DEQ A;  3GDB A;  1OT5 A;  1JZ5 A;  1K3I A;  1OF3 A;  3T0A A;  1NX9 A;  2QBX A;  4A45 A;  3LEI A;  4OYU A;  4QB1 A;  2KD7 A;  2J1S A;  3JXS A;  5F7U A;  5IYY A;  2J22 A;  3DYM A;  4P02 B;  3I2J A;  3SKJ E;  2RVA A;  4XZU G;  1JU4 A;  3EB7 A;  1W8N A;  2QQK A;  1W9W A;  5LA2 A;  3I2G A;  5I0D A;  3LEG A;  1JYX A;  2WAA A;  1CZV A;  2VJX A;  2DCK A;  2W46 A;  2VQT A;  4MO3 M;  3THC A;  4XUP A;  3I2F A;  2EIB A;  3BN6 A;  3I3B A;  4A44 A;  3F2Z A;  3SEP A;  2W5F A;  1DP0 A;  2VME A;  4PQQ A;  2BGP A;  4XUR A;  4CUC A;  4MGS A;  4XUO A;  1GOF A;  3OGV A;  1L7Q A;  1JU3 A;  2Y6H A;  4QX3 A;  3T09 A;  1JZ3 A;  2W91 A;  2Z4F A;  2XQX A;  4A41 A;  3OEA A;  1GUI A;  1K42 A;  1XNA A;  3VD4 A;  1JZ4 A;  1PX4 A;  2WUH A;  3WF3 A;  1GU3 A;  3ETP A;  2WO1 A;  4AAX A;  4D0Q A;  4XUQ A;  4QPW A;  4QX2 A;  1UY3 A;  1J83 A;  1JI6 A;  4GWJ A;  4KMQ A;  1UY2 A;  2ZEX A;  1PX3 A;  3ZM8 A;  5JXG A;  3MO4 A;  2W1U A;  2Y6K A;  3I2I A;  1L7R A;  4E8C A;  4OMD A;  3SEE A;  1R64 A;  4QAW A;  1W0N A;  1W9S A;  2W92 A;  3J7H A;  1NAE A;  4YPJ A;  3VDA A;  1W8O A;  2ZEZ A;  3I3D A;  1J84 A;  2VQU A;  4DUW A;  1UXZ A;  4DEV A;  3K77 A;  3I2K A;  3WNN A;  2J7M A;  1H6X A;  1UZ0 A;  1JHJ A;  2E32 A;  1ULO A;  1XPW A;  2VR4 A;  4IUG A;  1PMJ X;  2CDP A;  2VMC A;  1JZ6 A;  1CZT A;  4DUX A;  2V72 A;  1OD3 A;  4DXS A;  2VZ1 A;  3C7E A;  4DUV A;  2Y8K A;  3C7G A;  1P8J A;  3T2Q A;  2YB7 A;  4M4P A;  4E8D A;  3CMG A;  3T0D A;  1TVG A;  1KGY A;  3DYO A;  4UOJ A;  3SKV A;  4PT6 A;  1SHW B;  3HOB A;  4LKS A;  1EUU A;  5A1A A;  4ET7 A;  3I2H A;  4HG6 B;  1UMI A;  4QB6 A;  2J1R A;  2J1U A;  3OG2 A;  4JKM A;  3UES A;  3OBA A;  4DXT A;  4JHZ A;  3WQB A;  2Y64 A;  3OGR A;  1JZ7 A;  4OZO A;  3K75 B;  5LA0 A;  3HN3 A;  2VZT A; 
#chains in the Genus database with same CATH topology
 2XBO 1;  3FZ3 A;  3OUI A;  5FY9 A;  1QOO A;  5A3M A;  5FPU A;  1VBA 2;  2XWJ B;  4D7T A;  4LJH A;  2JB4 A;  1W6N A;  2JDZ A;  2XLF A;  4BQ1 A;  5FYU A;  2VU9 A;  1ND2 B;  4XIO A;  1D0H A;  1YQ2 A;  4AEJ A;  5JPN B;  3PVO A;  1COV 1;  2PHX A;  5FP4 A;  1HQN A;  4L9B A;  3MBW A;  1EUT A;  2O0O A;  3GJB A;  3HPN A;  1IS4 A;  4A6S A;  3T2P A;  4BK5 A;  4HET A;  3M3C A;  4OUM A;  4XET A;  3ETQ A;  3MLJ A;  4QKD A;  5ERL A;  1J3P A;  3FLP A;  1W2O A;  4KWJ A;  2ET7 A;  3GBW A;  4HKW A;  1NUK A;  4MH0 E;  5CFC A;  2RG4 A;  1POV 1;  1I5P A;  4AAP A;  5FQ0 A;  1J1L A;  2ZGU A;  3P1I A;  4EWD A;  1WW5 A;  3ST7 A;  1HRV 3;  5FZO A;  3N7M A;  1VBD 3;  2Y6G A;  3VL9 A;  4GB3 2;  4I01 A;  3O1T A;  1IGO A;  1ULP A;  4XOG A;  4ZXK A;  4EJR A;  1OMI A;  4JGZ A;  2ILM A;  4CDW C;  4CEW B;  3A21 A;  3MPP G;  3VBS B;  1GSL A;  2YUE A;  5JOX A;  1PO2 1;  2MEV 1;  2JDU A;  2OS2 A;  3LOI A;  4OUE A;  3RMY A;  3WHT A;  1VRH 1;  1IQD C;  2W1W A;  3HJR A;  2VTX J;  4QDS A;  1US3 A;  4LLO A;  4NO4 A;  2ES3 A;  2R1D A;  3AFG A;  4ONU A;  5JXJ A;  1JOJ A;  4FPK A;  1BLZ A;  4JKK A;  2MHF A;  1DFQ A;  4AVB A;  3CL1 A;  4CCN A;  1CAU A;  1GBG A;  1F31 A;  1NY7 2;  1TMF 3;  1CN1 A;  4K8F A;  4AFB A;  5C6C A;  2VUA A;  2P2K A;  1SFP A;  3TOJ A;  2D3P A;  4AVT A;  4BIS A;  1QJF A;  2E7A A;  2LTN A;  4NVP A;  4K1Y A;  4DS0 A;  3V0A B;  4BK4 A;  1G7Y A;  2VBP A;  2Z42 A;  5C9A A;  3L2H A;  5FAX A;  3MFC A;  5EHD A;  4FI9 A;  3VBR A;  1DLC A;  2RM2 2;  3P3N A;  3JU9 A;  2W3J A;  5FZL A;  3D82 A;  5CAZ A;  2FDJ A;  3USU B;  2ORZ A;  2FDG A;  3NV3 A;  2Y60 A;  1C57 A;  1CAV B;  3RDI A;  4I0W B;  2PHU A;  1CJP A;  1RUC 3;  5F2S A;  2YY1 A;  1DYK A;  3P3P A;  2WYS A;  4XAB A;  2WDB A;  3ALQ A;  4XF9 A;  5AVA A;  5FYM A;  3FHI B;  4Q26 A;  5F32 A;  3BKZ A;  3H1M A;  2J1A A;  3W20 A;  1VAL A;  2CGN A;  4W50 A;  2RV9 A;  3VKO A;  4QGL A;  4Q4W 3;  1FX5 A;  1W3V A;  4KI5 M;  4BQ5 A;  5I8Y A;  4IEO A;  1NXD 1;  5H9S A;  4H7M A;  1HX6 A;  2QQN A;  5A7W A;  1PMH X;  4OI1 A;  1JBC A;  3NNL A;  3U37 A;  1W6O A;  4KG8 A;  5LWB A;  1R09 3;  4LEJ A;  1X36 A;  1OHF A;  2R06 3;  4AGR A;  4UYB A;  4YVW C;  4XTP A;  4JQT A;  2XGX A;  1A78 A;  2A5Z A;  3O0V A;  1CAX A;  1JZ2 A;  3MZH A;  1HDK A;  3UNP A;  1S0J A;  3THD A;  5M0T A;  4QM9 A;  1NA1 B;  2GDF A;  2MPF A;  1G9D A;  1XJA A;  2VC9 A;  1BHG A;  1CJD A;  3TRS B;  2IC1 A;  3KF3 A;  5KHG A;  1K5M A;  2Y6L A;  4ATE A;  4FPH A;  5EFU A;  4MOA A;  1OKO A;  4I30 A;  4R4X A;  3UK9 A;  4A4A A;  1RUH 2;  5JOW A;  2VTX A;  4FPF A;  4CDQ A;  3LA3 A;  5LEJ A;  2V09 A;  2SLI A;  2ZA9 A;  3HT2 A;  1V70 A;  1XE8 A;  4DFS A;  2A3X A;  2WN2 A;  4XJ8 A;  4EN9 B;  1JYT A;  3H8X A;  3AL6 A;  1DYO A;  2DUP A;  4GJY A;  4QQO A;  2V4V A;  2ZAB A;  3WDY A;  4Z1V A;  3ITQ A;  1XYP A;  4V2W A;  4XTM A;  3J9S A;  3PHM A;  5F3I A;  3ZYB A;  5IK8 A;  4MAD A;  2PFW A;  5I0T A;  3ZFF B;  1OOP C;  1PO1 2;  4IE7 A;  4CU9 A;  1YO8 A;  3D3A A;  4XJU A;  3WXP A;  1XU2 A;  4OFG A;  1JUH A;  1O8S A;  2UY8 A;  4NN0 A;  2V4A A;  1R1A 2;  3KVA A;  5L7O A;  4HN0 A;  3ZMN A;  1NLQ A;  3SCF A;  3WLU A;  2VNO A;  5L9B A;  4XFH A;  4YLZ A;  3ZKU A;  4OI0 A;  1QKQ A;  3FLR A;  4NRM A;  4UI9 L;  3KV6 A;  2JG9 C;  3A7Q A;  2GH8 A;  3RZK A;  1RJ7 A;  4P9Y A;  1VAV A;  1M06 G;  5KHH A;  3MFA A;  4NHL A;  3T0B A;  1GMM A;  2FDK A;  5BNO C;  3MUY 1;  3WG2 A;  4PF1 A;  3PDQ A;  3V64 A;  4AFC A;  1X9T A;  1QIQ A;  3GZT B;  4GMP 3;  2EXI A;  2RE9 A;  2RS3 3;  3AYD A;  4TN7 A;  3RYR A;  4Q4V 2;  3PUH A;  1SCR A;  2OA2 A;  1H8T A;  2VW1 A;  3MW3 A;  2VOW A;  5EJZ B;  1AYM 2;  1MQT B;  1OD5 A;  4HVO A;  2WJS A;  2Y0O A;  1AR7 2;  2VTF A;  3AKR A;  1Z7S 3;  1ALY A;  3ACI A;  4R9D A;  4D94 A;  2CWM A;  2VMG A;  2QFE A;  2VEC A;  3MPB A;  3WQ0 A;  4B1L A;  3DXU A;  2RS1 3;  1QXJ A;  3C7F A;  1IG3 A;  3ZXE A;  5C3R A;  3K46 A;  4XFF A;  2ZPX A;  1AX2 A;  5KWR A;  4YYO A;  4PDW B;  5HCH A;  3DCQ A;  4LKE A;  3IDA A;  3HWJ A;  2NQY A;  2E7T A;  3BIE A;  2ZEY A;  3AYC A;  3PJQ A;  1LHV A;  1WLC A;  3EMR A;  1CIY A;  3IPV A;  1S4C A;  1LUL A;  5FWE A;  3CKH A;  3W58 A;  2ZGQ A;  4V2V A;  1X8E A;  2O8Q A;  4D6R A;  1LGC A;  3UL2 A;  1SEF A;  1RB8 G;  1KQR A;  4UFM A;  2ZGK A;  1IKQ A;  1ND3 A;  5ACA 3;  2P3I A;  1UOF A;  4K7J A;  5L36 A;  2XVG A;  1FT9 A;  1M4W A;  3ACG A;  2HWC 1;  1MEC 2;  1V6N A;  5FRA A;  4PJY A;  2F4L A;  1AR9 2;  2RJ2 A;  3RMX A;  3AJZ A;  3C2U A;  1O59 A;  1VAM A;  2IVJ A;  2PN5 A;  1WA6 X;  2ZGL A;  2ZX3 A;  4Q4X 3;  3S7I A;  1LOC A;  1NQJ A;  3M3Q A;  3OPT A;  1ZRE A;  2ZX2 A;  1YCI A;  1EV1 1;  1XC6 A;  5CFC C;  2CNA A;  2GP5 A;  4DIN B;  1ASJ 2;  2ZGR A;  3ACH A;  4U2A A;  3VD5 A;  4XIL A;  4RR3 C;  5BV6 A;  5C33 A;  1OVS A;  5FZD A;  3USS A;  2VNG A;  4LQR A;  4PCR A;  3QOP A;  4I3G A;  1KDM A;  4JGZ C;  3WP6 A;  1RUC 1;  5CAD A;  2Z5W A;  2RDR A;  2WNE A;  1WW7 A;  3NL1 A;  4TYS A;  1KIT A;  2XKO A;  5HCB A;  5IUQ A;  1QJY 3;  5CBL A;  1WMD A;  1JYN A;  4WM7 A;  3A23 A;  2WNV A;  1UYZ A;  3WZ1 A;  1UWW A;  1W9Y A;  4N7U A;  4BWO A;  4RS5 B;  2BER A;  2DU0 A;  2VPV A;  5DAQ A;  3N7L A;  4JKL A;  1W9T A;  2CGP A;  1PGW 2;  2A6V A;  4GMP 0;  4MLO A;  4AHW A;  4D7Y A;  2ZGN A;  2DFC A;  2OVU A;  1MS1 A;  3A22 A;  1QJX 1;  1ZZ6 A;  1WD4 A;  2DBN A;  3LPF A;  4PF5 A;  4UF0 B;  5AC9 1;  3MIG A;  2XVK A;  2RS5 2;  1H2L A;  1XNB A;  1RVF 3;  2WZ8 A;  3PVB B;  5GZF A;  3WR0 A;  3SH4 A;  4AQ2 A;  1VBB 3;  1LNS A;  5B4N A;  2JDN A;  1R09 1;  2R06 1;  5T5J A;  2WZR 2;  2FCU A;  2ZOE B;  5C9A C;  4CA9 A;  2X05 A;  1LEN A;  1UU5 A;  2R07 3;  3VBR C;  5J09 A;  3SHR A;  1ZBA 1;  1IPJ A;  4Q4Y 2;  5C4W B;  4C8D A;  5JSO A;  3IN9 A;  3VKN A;  4CTE A;  1H8V A;  3M3O A;  2HWB 3;  2XXZ A;  3VD7 A;  3J7L A;  1FAY A;  3LWC A;  4P14 A;  4OQ9 A;  3KCC A;  3WEZ A;  1RUG 3;  1NE6 A;  1HXS 3;  1S0E A;  1YFU A;  2D5H A;  2Y34 A;  2VZO A;  1ENR A;  1LRH A;  1RUF 3;  3WVJ A;  4W6X A;  1DGL A;  1W6Q B;  1F4A A;  3KM5 A;  5LBF A;  1TG7 A;  1BK0 A;  1OSG A;  1W8F A;  2KR2 A;  4QGN A;  4QXH A;  5DDJ 2;  4DNY A;  2CTV A;  3Q8B A;  4PQ9 A;  1NLR A;  2RR1 3;  2WFF 1;  4QX0 A;  2VVE A;  1O3R A;  5LK7 B;  1IQA A;  3ZYP A;  3I97 A;  3KD4 A;  3POJ A;  1HW5 A;  4DEQ A;  1PZ8 A;  3GDB A;  3RI8 A;  1V6O A;  3DPR A;  3VZJ A;  4FSJ A;  4JRL A;  3WW3 A;  1JZ5 A;  5FJK A;  1OA3 A;  5KR7 A;  1I9R A;  1QQP 3;  3H8U A;  4HK9 A;  3BI3 A;  4M01 A;  1NX9 A;  5A3O A;  5T5L A;  2WT2 A;  2DVB A;  4OYU A;  2HWE 2;  2IWG B;  3TNP B;  3JXS A;  4HZF A;  3JD7 2;  4MG2 A;  3DYM A;  1Q8O A;  1GNZ A;  2R6Q A;  2EVX A;  2D3S A;  3W9A A;  4C91 A;  2RVA A;  1YEW A;  3JCI A;  4NAO A;  3EB7 A;  1AUY A;  3ZO0 B;  4D69 A;  4IV3 B;  1CR7 A;  2ADE A;  1K5M C;  2DTW A;  1HV0 A;  1VR3 A;  2D98 A;  2NN8 A;  1AXY A;  4XHX A;  5FLI A;  5FYZ A;  5LA2 A;  1AXZ A;  4GMP 1;  3ZN6 A;  2VJX A;  1AHS A;  1B35 B;  5A7N A;  2W46 A;  2E63 A;  3KT7 A;  3LDK A;  3R4S A;  3CNA A;  4CDQ C;  1NZC A;  3KHC A;  4UW5 A;  2R16 A;  3H3U A;  4HVR A;  2XUE A;  3I3B A;  4E9K A;  2LM3 A;  3OBZ A;  4P5H A;  2XJU A;  3AKT A;  2XWB B;  4KGQ A;  1QXR A;  1AR6 3;  1U12 A;  2BGP A;  5J98 B;  5A33 B;  1RL3 A;  2WIN B;  3PU8 A;  4PI2 A;  3VBF B;  4RGG A;  5T50 A;  4F8A A;  2XJQ A;  1XRU A;  3HR9 A;  1E5R A;  4YW2 A;  5L7O C;  3OY8 B;  3ES4 A;  4QX3 A;  2W91 A;  1Q56 A;  5FY5 A;  1VBE 1;  1W9F A;  1JZ3 A;  1MZ5 A;  1V6I A;  4Q0S A;  3D8C A;  1GUI A;  5I8S A;  3SIT A;  3VD4 A;  4YW7 A;  4RGK A;  5FPA A;  4AED B;  4CPB D;  4AHY A;  2EA7 A;  2GC1 A;  3WF3 A;  2LUW A;  3VBO A;  1HB1 A;  2RDQ A;  3ETP A;  3KV5 A;  3ZN4 A;  3ZSL A;  3B01 A;  5E89 A;  5JPM B;  4MXW B;  4LE4 A;  4FOQ A;  2ZHK A;  1JI6 A;  5FMO L;  2P3K A;  1XYO A;  4ZS2 A;  2ZKL A;  3KB5 A;  1H8T C;  4L97 A;  3O1P A;  2EXJ A;  3AKP A;  4HPK B;  3AMQ A;  2ZEX A;  2EAA A;  3QD6 A;  1GFF 2;  2PLV 1;  1W8T A;  3ZM8 A;  3RQ0 A;  5A32 A;  1XNK A;  3WIN E;  2HEW F;  3SCG A;  2G9F A;  2Y6K A;  1BBT 1;  4IE6 A;  2WLQ A;  3ZXG A;  4E8C A;  2YYO A;  2YV8 A;  3MW4 A;  5FZ3 A;  4OMD A;  3SEE A;  3EJK A;  5FMC A;  3O1R A;  2ZHM A;  1TME 1;  4JGY A;  4N53 B;  2BTV C;  4I2O A;  1GP4 A;  4UFJ A;  1PGS A;  3E5X A;  4CP1 A;  1NAE A;  1W0O A;  3VDA A;  2W0X A;  3J26 N;  1RUI 2;  1W2N A;  5FZM A;  3ZXL A;  3N7K A;  5SV5 A;  3QAC A;  4HKL A;  1WCS A;  1R08 1;  3B7M A;  4NWV A;  5FRE A;  1QJY 1;  4DRR A;  1GZW B;  1H6X A;  3E6B A;  2PQQ A;  3SNM A;  2UY9 A;  1UZ0 A;  5FPX A;  2DCY A;  1X33 A;  2QQV A;  1JHJ A;  2E32 A;  1VBC 1;  1ND3 C;  1PNF A;  1DGR N;  1QU0 A;  4CEW A;  3QH7 A;  1BEV 2;  1XPW A;  1Z0H A;  1D2Q A;  1SAC A;  1LTE A;  1W06 A;  2QZ3 A;  3S6P A;  2CDP A;  5DUW A;  1DCS A;  1YQC A;  3J8F 2;  3VZL A;  3R4D B;  1YIP A;  4R52 A;  4QPG B;  2PHR A;  1JZ6 A;  2R04 1;  4I09 A;  2V72 A;  4NUB A;  2VZ1 A;  2ZKN A;  5ISL A;  3VDD B;  4O9G A;  1DZQ A;  3C7G A;  1P8J A;  1WW6 A;  4E2Q A;  1AZD A;  4D7S A;  3RJ2 X;  1PIV 1;  3T0D A;  2VXR A;  1ZVF A;  3DKQ A;  1SFN A;  4IEZ A;  4B4R A;  2AEY A;  1RUJ 2;  5HCA A;  3V0B B;  2ARB A;  2BW8 A;  2XML A;  1GYK A;  1CPM A;  5FO8 B;  4PT6 A;  1ZRF A;  4H7L A;  5LEK A;  3VKL A;  3JZV A;  3U4X A;  1QJU 1;  2XBO 3;  3DEM A;  4LKS A;  4HG6 B;  4WM8 A;  1UMI A;  3W59 A;  5FYS A;  2J1R A;  1FMD 3;  2V73 A;  3WG1 A;  3I3M A;  3BTX A;  2C6S A;  5DUU A;  2ZZJ A;  4BLI A;  5KHK A;  5F5C A;  2TBV A;  3ZFG A;  3SMH A;  3H50 A;  2D6P A;  4XBQ A;  4WM7 C;  1N3Q A;  2WNV C;  4NPR A;  4KBZ A;  2WA3 A;  4OZO A;  1COV 3;  1JZ7 A;  3A0K A;  4LBQ B;  4OHY A;  2VZT A;  2GP3 A;  4TWT A;  3WG4 A;  3ZPO A;  4BIO A;  2QQO A;  1GP6 A;  1E57 A;  4OQ8 A;  3LEM A;  3KV9 A;  1KFX L;  4I02 A;  3LFM A;  5LBC A;  2ZX0 A;  4V1P A;  4YG3 A;  1RUE 3;  3BPS A;  5FK7 A;  1DG6 A;  2ZGS A;  2PHD A;  2X29 A;  4PI0 A;  1POV 3;  3GBG A;  3POW A;  3EHK A;  5FP7 A;  3CLP A;  3NW4 A;  1W6P B;  1MS8 A;  3O1V A;  1AL2 2;  3D0S A;  2YGL A;  4LR4 A;  1JN2 P;  2D44 A;  1FPN 2;  4XF3 A;  5LB6 A;  1BQP A;  2PQS A;  1GP5 A;  4A7Z A;  5JDB A;  3N4M A;  3FC0 A;  2CAV A;  1REF A;  2JEN A;  2A70 A;  1AX0 A;  1YIF A;  3VLB B;  1KS5 A;  2MEV 3;  4BE3 A;  4BME A;  4DIQ A;  5DAP A;  1VRH 3;  5LZ6 A;  2VZS A;  4OHX A;  3RYK A;  2EIE A;  2Q1M A;  1X50 A;  2VQ0 A;  3POG A;  4R9C A;  1G9C A;  1ZBE 2;  3CZU A;  4DRV A;  2ORX A;  3ZXA C;  3OGS A;  2Y6F A;  3TN9 1;  2C4X A;  1OLR A;  1A3K A;  5BNP A;  3HAG A;  1F5J A;  1PM4 A;  4CCD A;  4DPN A;  5FY7 A;  3HIF A;  1GZT A;  2J1V A;  2E9Q A;  2RDS A;  1DQ5 A;  4Q0U A;  3UV9 A;  2XJV A;  1OQD A;  4P00 B;  3CDZ B;  2CU5 A;  4YVS B;  1RYY A;  4XAA A;  5FTT C;  3WX5 A;  4COV A;  5JSR A;  1QJE A;  1ST8 A;  2PMW B;  4XQD A;  5EP9 A;  3DPR C;  1PO2 2;  1UN1 A;  4ARX A;  1KRI A;  1QWR A;  1ZRI A;  5IVC A;  1YFW A;  2RMU 3;  5C8C C;  4ZHN A;  2QQJ A;  5T5O A;  2WL1 A;  4QXB A;  2J1T A;  3OOX A;  1OFN A;  1U5Z A;  3LAG A;  4EN6 B;  1TQ5 A;  4YM3 A;  4XPV A;  4XCA A;  1YQ5 A;  2ID4 A;  3VDB A;  1RHI 1;  2D40 A;  3FL7 A;  1NXM A;  3J7N A;  4L8Q A;  4IV1 B;  4TSV A;  4LOS A;  2KA3 A;  3AJY A;  4QDQ A;  4AI8 A;  2ZXQ A;  3ZFF A;  2HWD 2;  4GWM A;  1TNF A;  1F9K A;  4QT6 A;  5FY0 A;  2YPD A;  1YI7 A;  1HIX A;  4UT5 A;  1K12 A;  1NCR B;  1YXW A;  3MDP A;  1POQ A;  2JEC A;  1SPP A;  1H2K A;  2B9V A;  2PXJ A;  2W2I A;  4OUL A;  1MS5 A;  5LY1 A;  5HBA A;  5JIA A;  5C3O A;  3U0Z A;  5LW9 A;  2JG8 B;  1UYX A;  1HKD A;  1ZM1 A;  2BNM A;  2GC3 A;  5IHR A;  3A0N A;  2GMP A;  1VMH A;  1V9U 1;  3ABZ A;  2VMD A;  5LAS A;  2JE7 A;  5BNQ A;  1IG0 A;  4X8N A;  2DFB A;  3OB8 A;  1NYW A;  5FOB B;  2RJL A;  3E97 A;  4YM0 A;  2XLA A;  1O5U A;  4Y22 B;  3KT1 A;  4FTE A;  3PVE A;  3IKW A;  4G3Y C;  2CHH A;  3VB9 A;  3E5Q A;  3J7M A;  3WQ7 A;  4DXZ A;  5E1R A;  4UFL A;  1N1T A;  3I2O A;  1SLC A;  1ZA7 A;  1KJR A;  3WD5 A;  3WSO A;  3UJQ A;  4QB2 A;  4IDZ A;  4H3W A;  3MIF A;  4DZG A;  3VBO C;  1W03 A;  3TEY A;  3D6E A;  4CUB A;  1DGW X;  1GKB A;  4AVC A;  4AI9 A;  4LK6 A;  4AFA A;  2QQU A;  4QU1 A;  1UIJ A;  1C8M 3;  2VNV A;  4Z2A A;  3I7D A;  3VKF C;  1LES A;  1D4M 2;  2C9K A;  2ZAH A;  1NCQ B;  1S55 A;  3KT4 A;  2ZTN A;  4LKD A;  4Y5Z 0;  1NG0 A;  4D6Q A;  3ZIX A;  1ULC A;  3MYX A;  4FQ4 A;  2GN3 A;  3WP3 A;  3MW2 A;  2BRT A;  3KQR A;  5FIX A;  3KGZ A;  2WAB A;  5ABJ A;  1C4R A;  5LA1 A;  4RYD A;  4NAM A;  5IVY A;  4EZH A;  2FBE A;  4LO6 B;  4J1W A;  1AF9 A;  3ES1 A;  4LUL A;  5D8A B;  1GOH A;  4JGY C;  1FOD 2;  4FXG B;  3SH5 A;  1EP0 A;  2FZ1 A;  4QPI B;  4R8H A;  4AGG A;  2C5D A;  4LBL A;  1FMD 1;  5FLH A;  3T30 A;  1KD7 A;  5JI9 A;  3E1F 1;  3NST A;  4W6W A;  4CEY B;  4K6B A;  3IM0 A;  3G7D A;  1AR8 1;  4CP9 A;  3KQ4 B;  4YGB A;  4H14 A;  2X09 A;  3HNB M;  3NO8 A;  3IB3 A;  4HFS A;  1EY2 A;  1EAH 2;  3HNY M;  4OLL A;  5DPN A;  2L9L A;  5KXC A;  5EJ1 B;  1TE1 B;  1OH4 A;  1V00 A;  1Y9G A;  1GIC A;  3HEI A;  4ISQ A;  4CEW C;  1DQ1 A;  1PK6 B;  2VUL A;  3I3E A;  3O0W A;  2XOM A;  3DUI A;  4YGE A;  2EIG A;  3RFR A;  2YXS A;  5CFD A;  1RUE 1;  1WCD J;  1F4H A;  1YQ8 A;  4BCU A;  4RS5 A;  3OPZ A;  4AQT A;  1GAN A;  5E8A A;  2XON A;  3H42 B;  4KWL A;  5DN2 A;  1OQ1 A;  3I4I A;  3RYP A;  2ZML A;  4UAP A;  5CIR A;  4WVW A;  4GH4 B;  2VMF A;  3CIH A;  1O5L A;  1DYP A;  2B42 B;  1GWM A;  1S2E A;  5FK8 A;  3THP A;  2PHL A;  1T2X A;  1ZZ9 A;  2VCB A;  3ZYI B;  3NAP A;  3NQH A;  4QU2 A;  4NHK A;  2EXK A;  5JOY A;  2YGM A;  3WNK A;  1RUD 1;  2WO2 A;  2P3J A;  1T6B X;  3RS6 A;  4WM8 C;  4BOW A;  5HXM A;  3AZV A;  1H4G A;  4YW1 A;  3OYW B;  2JDA A;  2VZP A;  3FMG A;  3ZFG C;  5FKC A;  2XJP A;  3KMH A;  4K40 A;  5F5I A;  2EAK A;  3NJX A;  5AFE A;  1JTZ X;  4FOV A;  1Q8Q A;  2HWC 3;  1D4V B;  5IVJ A;  1YNA A;  4IEV A;  4MGK E;  3WOG A;  1HRV 2;  4MUV A;  5FZE A;  1VBD 2;  1WLD A;  1QNY A;  2WYF A;  4UFH A;  3AMM A;  5DAW A;  3POB A;  2EIC A;  5FZC A;  4BLJ A;  1SLT A;  1EV1 3;  1R1Z A;  3AXD A;  1UMH A;  3GJA A;  2OKX A;  4NIH A;  2RMU 1;  4DXR A;  2O14 A;  2VO5 A;  3ZR6 A;  1L3J A;  2VH9 A;  3KGL A;  4IND A;  1N1Y A;  2VD7 A;  4OCT A;  4IEQ A;  4AL9 A;  1O4Z A;  3I2D A;  5CU1 A;  1ZZ7 A;  2QJV A;  3W5M A;  5EYY A;  2WA4 A;  1HLC A;  3AVS A;  2WO7 A;  1TMF 2;  4CDW B;  3DEC A;  3O1M A;  1ZRD A;  2D7F A;  1VP6 A;  2LAL A;  4IES A;  3M4F A;  5C7G A;  3GZU C;  3LE0 A;  2VCM A;  5T5P A;  1EPW A;  1UNB A;  2DBI A;  2W47 A;  1W8Z A;  4AGV A;  4ASK A;  2PTM A;  3L2Y A;  4M00 A;  4FPJ A;  4ES9 A;  4MV2 A;  3A4U A;  5BNP C;  5FOJ B;  1QJX 3;  2A3W A;  3AKQ A;  2E26 A;  2P1B A;  3O12 A;  1GLH A;  3DV8 A;  5AC9 3;  3HQR A;  2JEM A;  4J25 A;  1J58 A;  4LA3 A;  2D43 A;  4CDX A;  3JBG 1;  1PHM A;  5F3E A;  2GAL A;  5BYN A;  4DOU A;  1Y43 B;  4LO5 B;  2HBU A;  1OUR A;  4N43 B;  5FP8 A;  4F7Z A;  4DB5 A;  5IAT A;  4UW4 A;  3U75 A;  4TZD A;  3WF0 A;  4FOY A;  4AHX A;  3ZFE A;  4GWN A;  3U78 A;  3M2M A;  3VUO A;  1ZBA 3;  4TLF A;  4Z2W A;  2YMZ A;  2JIJ A;  4BDV B;  1MAC A;  1ONA A;  3K4Z A;  2SBA A;  1GQG A;  4FTS A;  2JD4 A;  5FMB A;  2H6C A;  2IXC A;  4LBO A;  4Q4W 2;  3AL5 A;  5BNN A;  1G9B A;  3AC0 A;  3PJY A;  4JVA A;  4N7I A;  3ZFF C;  5KXE A;  2WT1 A;  1XND A;  3GCX A;  4S2D A;  3N3H A;  2WAO A;  1WLT A;  3TEW A;  5FFO C;  3N9M A;  4XAE A;  2HWF 1;  3CHX A;  5LRR A;  2ZGT A;  1QXP A;  1E5S A;  2WFF 3;  3BU7 A;  3MLK A;  4MHR A;  2DVA A;  1VRB A;  2DCT A;  2ZGP A;  1WCK A;  2OXB A;  5FPZ A;  3SC7 X;  1MS9 A;  5D21 A;  5CIS A;  5CG8 A;  1WA4 A;  2E6V A;  5F6K A;  3WF2 A;  5FY8 A;  3SLI A;  2NYY A;  2DCJ A;  1C8M 1;  4H55 A;  4UWD A;  2OII A;  4LIT A;  3B02 A;  2P17 A;  3ZPY A;  3E6C C;  1EPZ A;  2D93 A;  2I2S A;  4MXW A;  1HB2 A;  3K2O A;  3VL8 A;  2JDY A;  4M3C E;  4QX1 A;  2VGD A;  4EQV A;  1HRI 1;  1LEM A;  2IXI A;  4YVW B;  4R9B A;  1PGL 1;  4N8M A;  4Z07 A;  2D6O X;  2J42 A;  1OT5 A;  4XJ9 A;  4DY3 A;  2DVG A;  5A1F A;  3B94 A;  4AWD A;  1VBA 1;  5A6X A;  1J1T A;  2AEZ A;  3NNM A;  5APA A;  3B5L B;  2QBX A;  4FTB A;  5JZG A;  1H9P A;  1A8M A;  1W6M B;  4OZX A;  4QQP A;  1QGL A;  5FYI A;  2G1M A;  1BMV 1;  2J22 A;  3BAL A;  3GF6 A;  3ZSJ A;  3PMS A;  4LIV A;  5A3U A;  4Q8L A;  3Q8E A;  4XZU G;  1JU4 A;  4WVV A;  1L7L A;  4NHY A;  3LDR A;  2IXL A;  3LDB A;  2QQK A;  1PNG A;  4C1W A;  5I8T A;  1GZW A;  3I2G A;  5I0D A;  1CZV A;  3S30 A;  3NNJ A;  3VN4 A;  1OOP B;  2CYF A;  3RNS A;  2BPA 2;  3T4H B;  1AL0 G;  1FYU A;  5C3Q A;  5ABJ C;  3DL3 A;  1Q8S A;  1ZX5 A;  5IW0 A;  1VBE 3;  2D3R A;  1X9P A;  2X5I C;  3THC A;  2RS3 2;  5KC6 A;  1Q5O A;  3I2F A;  3MHZ A;  2R49 A;  4Y5S A;  2ZMK A;  2VME A;  3AMN A;  4C1X A;  4PQQ A;  1YFY A;  4BMB A;  2JG9 B;  2OQ6 A;  2YBP A;  4JDN A;  2RDN A;  5HI0 A;  1Z7S 2;  2BYV E;  4PIX A;  5FZ9 A;  5BNO B;  3WNX A;  2QQP A;  3OBR A;  3APB A;  1JU3 A;  1I1E A;  3RPQ A;  2MNG A;  1NY7 1;  2FQP A;  2RS1 2;  2XQX A;  3N9N A;  4Q2F A;  3KZ4 C;  2PAK A;  3WW1 A;  4D3W A;  3AFK A;  4MSV A;  2A73 B;  4HSL A;  4Y4Y A;  1D0G A;  2AH2 A;  3LSE A;  4N9I A;  1K42 A;  3RZJ A;  1PX4 A;  2JIC A;  2WWJ A;  1WLW A;  3KS7 A;  4IEP A;  1N3P A;  4IEW A;  3ZN5 A;  4IE4 A;  2ZX4 A;  3ROU A;  2G9Z A;  2PLV 3;  2QDN A;  4AAX A;  3VBH A;  2JDM A;  4XUQ A;  4P9G A;  4D0Q A;  1JXN A;  2YBK A;  4QPW A;  1AJO A;  1S0G A;  1U5Y A;  1W2U A;  1UY3 A;  1BBT 3;  4I0A A;  4LHN A;  4N90 A;  3ZR5 A;  3I59 A;  5CFD C;  4JDM A;  2JE9 A;  1H0B A;  1ASJ 3;  4RS5 C;  5L9V A;  2RM2 1;  1MS0 A;  2VUJ A;  3N36 A;  2VE1 A;  4IGO A;  1TME 3;  4XZP A;  3H7J A;  4KGG A;  3T3Y A;  4KMQ A;  5ACA 2;  5H9P A;  2NZ9 A;  2H6B A;  4R4Z A;  1W3X A;  3DN7 A;  3NAP C;  2QVS B;  3ZYH A;  3EXU A;  5JXG A;  3HBK A;  2WNU A;  2PYT A;  4NRO A;  2ARX A;  1R08 3;  1S0C A;  1UPS A;  3I2I A;  4Z82 A;  5K0U A;  4CRQ A;  2JXA A;  4LUM A;  5E16 A;  2VBB A;  3NNF A;  2HYK A;  1R64 A;  1W6N B;  1VBC 3;  3E5U A;  4Q4X 2;  3VKM A;  4COZ A;  1LKN A;  2W92 A;  2DUO A;  2ZEZ A;  4B8E A;  5J3U A;  2VQU A;  4DUW A;  1UXZ A;  2PHT A;  2UU8 A;  3FBY A;  4B3N A;  3K77 A;  3GAL A;  4YW4 A;  1NQD A;  1XE0 A;  1W8H A;  2R04 3;  1F8V A;  2VOK A;  3LZZ A;  3LGR A;  3MIH A;  4WVM A;  3CF6 E;  4MGZ E;  1WME A;  5GZE A;  5GZC A;  4HOO A;  1PIV 3;  5JVV A;  3BB6 A;  4NII A;  5T55 A;  1XU1 A;  4KNC A;  4RFR B;  2BOJ A;  1Q8P A;  5CFC B;  1PMJ X;  2BWC A;  4WV8 A;  2PEL A;  1OPM A;  1QJU 3;  3GZA A;  1S0I A;  3OJB A;  2HBT A;  2O8O A;  2VMC A;  4LNV A;  5KXD A;  3O1O A;  4GKX A;  3ZMO A;  1CZT A;  3RG0 A;  1JYC A;  4DUX A;  4L92 A;  4DUV A;  2FHR A;  1YYN A;  3C7E A;  3K3N A;  4RR3 B;  1QDC A;  2Y8K A;  5FO9 B;  3T2Q A;  1AX1 A;  2YB7 A;  4JGZ B;  4MVT A;  5IK7 A;  1QMJ A;  2OW4 A;  1RUH 1;  1UZW A;  3DYO A;  4QQL A;  4UOJ A;  3WHU A;  1RVF 2;  3OGJ A;  3R6S A;  1B09 A;  1DGW A;  2F4P A;  5K4L A;  5DZF A;  2ERF A;  1VBB 2;  2WS9 2;  1JH5 A;  2CV6 A;  3HOB A;  4TLG A;  3RZZ A;  1YLL A;  3I2H A;  2Q8O A;  1QDO A;  2EF6 A;  3PUS A;  3ZVX A;  2ENR A;  1F2N A;  3OG2 A;  4JKM A;  3UES A;  1CAU B;  2R07 2;  4YGD A;  3TB0 A;  4DXT A;  3LF7 A;  4CDX C;  3ILN A;  4MX3 A;  3LCP A;  4BPZ A;  1Z78 A;  3K75 B;  3WDW A;  1FXZ A;  5I93 A;  5LA0 A;  3BUC A;  1MR5 A;  1R1A 1;  1W2A X;  2HWB 2;  5IVB A;  4CCO A;  3ZYG A;  3LEI A;  4GWI A;  1RUG 2;  4SBV A;  5CZK A;  1HXS 2;  4BHP A;  1RUF 2;  2DCZ A;  5C9A B;  2XG3 A;  1GZC A;  1RIT A;  1RMU 3;  3ZFE C;  5JIU A;  3VHP A;  5L19 A;  3AXE A;  2EXH A;  1UOJ A;  1T6G C;  2YC4 A;  3VBR B;  2VCC A;  2WQZ C;  4AXO A;  2RR1 2;  4XC9 A;  4XQ4 A;  1PZ7 A;  4QX7 A;  5LAT A;  1GWK A;  2X8K A;  1JOD A;  3KHB A;  2AYH A;  5BNN C;  1RUO A;  2VNR A;  3PUQ A;  3TN9 3;  3GXU A;  4PBP A;  1AYN 2;  2D6N A;  4Q4V 1;  3HQX A;  4FP3 A;  3LA7 A;  4MGI E;  4KQ7 A;  5C8W A;  4YZ4 A;  4M3C A;  1VLN A;  4IEX A;  3WNO A;  1YJK A;  1NOV A;  1QQP 2;  1AYM 1;  4RA0 A;  2JDK A;  3IAP A;  5FUI A;  3RZH A;  2YFZ A;  3LEK A;  3S57 A;  1K45 A;  3IMN A;  2G19 A;  1VB2 A;  5IK4 A;  3S0M A;  2K46 A;  1Q3E A;  2QCS B;  4FPE A;  1FV2 A;  4A2U A;  4QD2 A;  5C3P A;  5I91 A;  3AX4 A;  4HK8 A;  4XDO A;  2XJR A;  4F3J A;  5A7W B;  3T4V A;  1Q43 A;  2JWP A;  2WZE A;  2PAE A;  3UGH A;  2QQI A;  3AP4 A;  1W6O B;  4P9L A;  2B4K A;  4RHV 2;  4YNI A;  2WLP A;  3NNG A;  5FZ6 A;  4P5Y A;  3VZN A;  3WT3 A;  3K3O A;  1JYI A;  1XNT A;  1LOG A;  5FYV A;  1RHI 3;  3TEZ A;  5JXH A;  4Q27 A;  3S5A A;  1OLM E;  1CAX B;  4H2A A;  1NCQ A;  2WSU A;  3Q9O A;  3RVH A;  4EWE A;  1SZB A;  1UYY A;  2OPW A;  2A3Y A;  3NJZ A;  1OA4 A;  1QOS A;  2ZBJ A;  3FUQ A;  1W28 A;  3T08 A;  4NWW A;  3WW2 A;  5L9R A;  3JB4 C;  5FUP A;  2BJS A;  5FR3 A;  5EXO A;  1OH3 A;  5FP9 A;  5JZG C;  1JUI A;  2YDE A;  3ON7 A;  1K5M B;  5FYY A;  1QH6 A;  4Q1R A;  3TEX A;  4BXS V;  4ZZ8 A;  3AMP A;  3OD4 A;  4GXL A;  2B7Y A;  1WMX A;  5JWP A;  5D8A A;  3AZX A;  3VZK A;  1MEC 1;  1AR6 2;  3B3Q E;  4OVE A;  4X6Q B;  1AR9 1;  4XF1 A;  4ZON A;  3I8T A;  3DKW A;  4CDQ B;  1RIR A;  2N7G A;  3H3L A;  4E4S A;  2FDI A;  4KU8 A;  3R4U A;  3B93 A;  5EWS A;  5CKN A;  4W8J A;  4K20 A;  4XVH A;  1V9U 3;  1ENQ A;  3C7O A;  1ND2 A;  1VE0 A;  2DV9 A;  2K2S A;  5C70 A;  3U4S A;  2ZJC A;  1XBF A;  4FFG A;  4S2H A;  4A42 A;  4COY A;  2IUW A;  4NPM A;  3OPW A;  1ASJ 1;  1LED A;  5D2A A;  1H6Y A;  5KBF A;  2JDP A;  2YPJ A;  4NOT A;  4FPL A;  3NV1 A;  5L7O B;  3BTZ A;  2YU1 A;  1AJK A;  5FP3 A;  5FBJ A;  3RSJ A;  2V5Y A;  4JHT A;  1O3T A;  4RL7 A;  3JB8 A;  1VAK A;  5G05 L;  4B7E A;  5FPV A;  1APN A;  2QQM A;  3C7H A;  4NIG A;  2YC0 A;  4A3X A;  5A70 A;  3CU7 A;  4FPO B;  2XQR A;  4BXF A;  2E51 A;  4YM1 A;  5D1I A;  5EV7 A;  3H8O A;  1O6U A;  1W05 A;  1BZW A;  4IGP A;  3N9P A;  5LCW L;  4GKY A;  4AI0 A;  4IER A;  2A6Y A;  1ODN A;  3D0J A;  3VBS A;  2NMO A;  3LQC A;  2XB6 C;  1XOY A;  2RS5 1;  1H8T B;  2VUC A;  1VMJ A;  1X82 A;  3IBM A;  4EN7 B;  2GH2 A;  2VUD A;  4TXW A;  1I3H A;  3D4K A;  3RI9 A;  5E88 A;  2DF7 A;  1RED A;  3VBH C;  3HN1 A;  4ZZ5 A;  2WZR 1;  1G9A A;  1PVC 3;  3NJV A;  4RQP B;  3IAQ A;  4JC1 A;  1HN1 A;  3POE A;  4OHW A;  5LBB A;  4AQ6 A;  2OX0 A;  3OCP A;  3BCW A;  2FMY A;  3ZXF A;  4E4H A;  4HVQ A;  3VGI A;  2P34 A;  3IZO A;  3V0A A;  2X53 S;  2JKB A;  1OI6 A;  2WNU C;  3W21 A;  1AR8 3;  4CDU C;  3X29 B;  3THT A;  4IGQ A;  5A7S A;  5A3L A;  2VAU A;  5DDJ 1;  5K0U C;  4I3P A;  3MV1 1;  4LIU A;  4FFH A;  3USU A;  1IS6 A;  2W1S A;  1RUN A;  4HXC A;  1CIW A;  4ZXE A;  4N9H A;  5CB7 A;  2WII B;  1CAV A;  1ND3 B;  2ZCW A;  4Z92 B;  4XYX A;  2OYZ A;  2NMN A;  5F39 A;  3LFI A;  2I74 A;  1WBL A;  2HH9 A;  2RHP A;  3KLS A;  1H30 A;  2IFW A;  4IQP A;  4QGM A;  5I0U A;  4D6S A;  2KXL A;  1LOF A;  3ELN A;  2VW2 A;  4PIY A;  2XBO 2;  4MYE A;  1ULE A;  4ZY9 A;  3H1Y A;  3PUA A;  3POS A;  3B69 A;  1QJZ A;  2J1E A;  1C1L A;  2HWE 1;  2V5D A;  3JD7 1;  1V6L A;  3ZDS A;  1ZYB A;  1E5I A;  2R30 A;  1ENS A;  1UX7 A;  1RMU 1;  3MUZ 1;  2NM1 A;  1COV 2;  5C5U A;  3ZX7 A;  2W94 A;  2X10 A;  1RUD 3;  3VD9 A;  2JD9 A;  3W5N A;  4XXA A;  4ITC A;  1N3O A;  1NE4 A;  1RXG A;  3CJI B;  4N43 A;  3B9C A;  4YRD A;  3VV1 A;  3VD3 A;  4KWK A;  2LW8 A;  5DAB A;  5EIY B;  4NHX A;  2DUR A;  5FZ8 A;  2PA7 A;  1GNY A;  1X7N A;  3ORJ A;  5J1X A;  2XKP A;  1SFY A;  2XLG A;  3BPZ A;  1NA1 A;  3EBR A;  4WM7 B;  2WNV B;  4AK3 A;  2WR9 A;  2W08 A;  3OTF A;  4FPC A;  5A7Q A;  2DVF A;  4PHZ A;  5JUV A;  1CX1 A;  1UKG A;  2VXJ A;  3AP5 A;  4KWU A;  1OPO A;  4MET A;  3BU0 A;  1H1I A;  2KM2 A;  1UY4 A;  5CA6 A;  2QUO A;  2FCV A;  2MEV 2;  4QKF A;  1V6M A;  5FXV A;  5JMO A;  1VRH 2;  2YFU A;  1UO9 A;  3U1X A;  1WCQ A;  4UW6 A;  4ZU4 A;  1UXX X;  4UFI A;  4CCK A;  3FHQ A;  2IFR A;  4FO9 A;  5GLZ A;  3UJO A;  2YC2 A;  5FJH A;  4FP2 A;  2G9G A;  1NLS A;  4XQW A;  5CG9 A;  5BXX A;  2C9A A;  1SG3 A;  3PVN A;  4XUN A;  3IWZ A;  4FBF A;  3UKV A;  3WDV A;  3VZM A;  3I49 A;  4O9E A;  1D7P M;  4XFA A;  5HV4 A;  4Q8K A;  5FZ1 A;  2W87 A;  2XHN A;  3MI8 A;  4Z8B A;  3GZE A;  1RTV A;  3SH3 A;  2GU9 A;  3HT1 A;  3NRU A;  5EYX A;  3VHN A;  1XE7 A;  2Q1F A;  4EN0 A;  4E4Z A;  4KL1 A;  4IE5 A;  1SBD A;  4OHV A;  2BOI A;  3JBG 3;  4RN5 A;  1PVX A;  4QQH A;  3M1H A;  4BB3 A;  1OBN A;  1HQW A;  1OLM A;  5F9T A;  4W4Z A;  1UOG A;  3ILF A;  1FAT A;  3S5Q A;  2BGC A;  3VBU B;  4J1X A;  3WF4 A;  5B2G B;  1OF4 A;  3DPR B;  5IVE A;  3HQU A;  3INA A;  5C8C B;  1MQT A;  3HD8 B;  1BYH A;  1UQX A;  5GLU A;  4CVU A;  2ZAA A;  1IS3 A;  1CAW B;  5DMY A;  1VIW B;  5GZG A;  3TBD A;  1F35 A;  1RUI 1;  3K48 A;  4K1Z A;  1RGS A;  4FQZ A;  2A6W A;  2VOX A;  4M4R A;  2AGS A;  1MS4 A;  1NCQ C;  4FOW A;  1ULF A;  1OOP A;  4XMA A;  1REE A;  3VHR A;  1PMI A;  4PDW A;  2HWF 3;  3V56 A;  3RGB A;  5A3T A;  3MIE A;  1AVB A;  4NHM A;  3CQO A;  4ZU7 A;  2QQL A;  3WQ1 A;  2Q30 A;  5ANQ A;  5D8A C;  3ZN6 B;  1GQH A;  4LTA A;  3TNQ A;  1Q8V A;  3J8F 1;  3ZDV A;  3N35 A;  4LE3 A;  4BZ4 A;  3MV0 1;  2R0F A;  5L73 A;  2PAM A;  3FN9 A;  4FFI A;  4YGC A;  1UKR A;  2YU2 A;  1WZX A;  1ZZ8 A;  1GZ9 A;  3ILR A;  1CON A;  1ND2 C;  3HNM A;  3TYJ A;  4FT8 A;  1DBN A;  3K51 A;  2OUJ A;  1HRI 3;  3KCY A;  1RUJ 1;  4XFG A;  1AXK A;  1OKQ A;  2VCA A;  1PVC 1;  5GLT A;  3FLT A;  4JDO A;  2CSG A;  5FV3 A;  1CZS A;  4EWA A;  5GZD A;  1VBA 3;  5DQ0 A;  3PL0 A;  5A3W A;  4CZS A;  4Q5O A;  2I07 B;  4A7K A;  2OQ7 A;  3IT8 A;  4MGY E;  5TSW A;  3KCX A;  3FUO A;  3O14 A;  3NV2 A;  1NKG A;  2ZEW A;  4Y20 B;  4JTO A;  4MZU A;  4LO4 B;  3U11 A;  2LS6 A;  3VBO B;  3WNM A;  1OFS A;  3D5O A;  2GMM A;  3N9L A;  4Y1U A;  1KDK A;  2QNK A;  1VPH A;  5A80 A;  1MZ6 A;  4LKF A;  3GHM A;  3GNE A;  2AAC A;  2HJI A;  1W0P A;  1BKZ A;  2JIG A;  3VBS C;  2ARE A;  1CWP A;  4XF4 A;  5DAX A;  2P37 A;  2Q1Z B;  4M0N A;  1LCL A;  1YRZ A;  2WKK A;  2C0Z A;  2KD7 A;  4JAA A;  4BU2 A;  5IYY A;  1QHD A;  4YW5 A;  1C5H A;  4ASL A;  5A6Y A;  2BP6 A;  1AL2 1;  3I2J A;  3SKJ E;  1K5J A;  4NPL A;  5A32 B;  5IK5 A;  1FPN 1;  4GB3 3;  4CXY A;  1UD1 A;  1W8N A;  5I0S A;  4K8R B;  1VMF A;  2GME A;  4UF0 A;  5DG1 A;  3DXT A;  5FXX A;  1BMV 2;  4XEZ A;  2JX9 A;  1W9W A;  5BY5 A;  1DQ4 A;  3DF0 A;  4HMZ A;  4UW3 A;  3LEG A;  1IS5 A;  4JGY B;  4XAC A;  3LKJ A;  3RZM A;  3MEP A;  5FY1 A;  3TWI A;  1LHW A;  4URA A;  2ZS6 B;  2AUY A;  1ZBE 1;  1YHF A;  2VQT A;  4L99 A;  4NMI A;  4HBN A;  3LIG A;  2P3Y A;  3ZXJ A;  2BNO A;  3CBN A;  1U5I A;  4CCE A;  1NZI A;  5FXW A;  5LRS A;  1I5Z A;  1SLB A;  2BV4 A;  4XUP A;  5CNA A;  2EIB A;  4PBO A;  2AZ5 A;  4A44 A;  2ZGO A;  5C4W A;  1S0B A;  5SV8 A;  2W5F A;  3SEP A;  4CXX A;  4QM8 A;  4RR3 A;  1DQ0 A;  5FZ7 A;  3WY6 A;  2ZHL A;  4NRP A;  5CKM A;  5JCT A;  4FPG A;  4LBQ D;  1OVP A;  2BDR A;  3I54 A;  4XUR A;  1GOF A;  1UPI A;  1L7Q A;  4BQ2 A;  2UWA A;  1CVN A;  1LOF C;  2Y6H A;  4YFZ A;  1LB2 A;  1W6Q A;  3AZW A;  4B1M A;  2Z4F A;  4UBG A;  4WVZ A;  4A41 A;  1CD3 G;  1SMV A;  4IE0 A;  2RM2 3;  4GQ7 A;  5DXD A;  2DVD A;  2VMI A;  1IKP A;  2Q8C A;  1LOD A;  2ARA A;  4E27 A;  4ERO A;  4S2G A;  1DU3 D;  3AVR A;  5F3C A;  5GLW A;  3BIW E;  3Q8C A;  2YHJ A;  2OZJ A;  2VVF A;  2WO1 A;  2CGO A;  3AYE A;  3NMB A;  5JSP A;  3ZYJ B;  1S1A A;  4RFT 0;  2HWC 2;  2XDV A;  2H0V A;  2HWD 1;  2VOV A;  3VHO A;  4Q1P A;  5F2W A;  5F5A A;  3O1S A;  4IW3 A;  4WM8 B;  2BQP A;  4OI2 A;  4GWJ A;  4N43 C;  4Y5T A;  2GN7 A;  2XPJ A;  4FAG A;  3URF A;  2O1Q A;  4YM2 A;  1UY2 A;  3ZFG B;  1EV1 2;  2XL7 A;  4NID A;  1PX3 A;  1NA1 C;  1PM7 A;  5AFB A;  3IIA A;  4LMF A;  4M0H A;  1H1A A;  5EPA A;  3MO4 A;  2W1U A;  4AZZ A;  2W68 A;  5IAX A;  4G4F A;  2TUN A;  4QHB A;  4AF9 A;  4IV3 A;  3ZIW A;  1DQ2 A;  4W65 A;  1LAJ A;  3OGG A;  4C90 A;  4QAW A;  4AR2 A;  1LGB A;  1RUC 2;  3AMH A;  4RGA A;  1BCX A;  3JQW A;  1B35 A;  5FO7 B;  5FZB A;  2WSV A;  1W8O A;  3I3D A;  5A7O A;  1OLQ A;  2XR4 A;  4DEV A;  1HV1 A;  3UKN A;  2GNB A;  3I2K A;  4C0B A;  3ZSM A;  4COU A;  3IDE A;  5CVR A;  2P6H A;  4XE9 A;  2J7M A;  4LBJ A;  2E53 A;  1N1S A;  3KVB A;  1QJX 2;  4XCB A;  1CX4 A;  2D5F A;  4FCA A;  3WG3 A;  2F17 A;  2GSY A;  3M8L A;  5AC9 2;  4X8P A;  1ULO A;  1WUV A;  3ZKY A;  1RUH 3;  1U0A A;  5A33 A;  5LY2 A;  3N9O A;  1JS9 A;  3VBF A;  2CWS A;  4UXA A;  3M3I A;  3AZZ A;  3OY8 A;  4NR1 A;  1R09 2;  1Y4W A;  4AYU A;  2R06 2;  4LOT A;  4XMI A;  1O3Q A;  4BH9 A;  4PLO A;  4YG6 A;  5LK5 A;  5LA9 A;  1OD3 A;  5BNP B;  3BTY A;  2BVV A;  4FPY A;  1DLL A;  4AED A;  5FCC A;  1J3R A;  1ZBA 2;  1D4M 1;  2YZ4 A;  3L9J T;  4M4P A;  4AFM A;  4Y1Z A;  3CMG A;  3WDU A;  1PO1 3;  2GNT A;  1IHM A;  1TVG A;  3SKV A;  3RWK X;  1IPK A;  2ZX1 A;  1R1A 3;  2K9Z A;  1HQL A;  4QPY A;  5T52 A;  1BK1 A;  5A1A A;  1STM A;  1W04 A;  5C5T A;  3AP6 A;  3LB9 A;  5FLJ A;  5FMO S;  4QB6 A;  1ULG A;  2NPI A;  5H9R A;  3N9Q A;  1A6C A;  4ZKT B;  3WW4 A;  2Z79 A;  3PNA A;  1MQT C;  1MZF A;  3OBA A;  1FOD 1;  4NJ4 A;  4HPK A;  3WQB A;  1OUX A;  2I45 A;  4HKO A;  5EZW A;  2Y64 A;  2WFF 2;  1A8D A;  1KJL A;  3LOB A;  3OGR A;  1JOB A;  3HN3 A;  5T3N A;  4YZ5 A;  2P6C A;  3ZOI A;  2GC0 A;  4Q4V 3;  5FXZ A;  1GR3 A;  1EAH 1;  2RJK A;  2R1B A;  4PDW C;  1I6X A;  3FBM A;  4N53 A;  1JYW A;  4WZC A;  1WKY A;  1AYM 3;  3RWN A;  1UYP A;  4CCJ A;  4ZS3 A;  1DZT A;  1AR7 3;  1F5F A;  1LOA A;  1SPP B;  3C8X A;  1G9F A;  2WFP A;  3AB0 A;  4E2G A;  2DU1 A;  1BJQ A;  4IL7 A;  2TEP A;  2FMD A;  2BNN A;  3CO2 A;  4L0P A;  4SLI A;  5BPX A;  5J37 A;  1ZNP A;  4GJZ A;  3LPG A;  4Y33 A;  2VY0 A;  4YWA A;  4U36 A;  5C71 A;  5IVV A;  4GB3 1;  3IMM A;  5DAV A;  4GD4 A;  4BQ3 A;  5HPO A;  2Y6J A;  1ULD A;  4CU7 A;  3IDC B;  5DZE A;  5GLV A;  2DDU A;  4QPG A;  5J48 A;  4P9W A;  4Y26 A;  3OF1 A;  1MPX A;  1MVE A;  3FWE A;  1XNC A;  3BVC A;  4RSU A;  3POY A;  4YW6 A;  3VDD A;  4Y24 A;  3K4D A;  4LT5 A;  2H0B A;  2C26 A;  4QKB A;  4A6O A;  4RQP A;  3V0B A;  5JOZ A;  3OUH A;  1YJL A;  2IVI B;  4CP2 A;  1JOP A;  3AM2 A;  4CCM A;  1MEC 3;  3UET A;  1LHN A;  2CAU A;  3WUD A;  1XXN A;  2XHK A;  5HCF A;  4EYU A;  1AR9 3;  2D6M A;  2ZZQ A;  4AI1 A;  1HRV 1;  2XVL A;  4WBB A;  5IT6 A;  2ATF A;  1VBD 1;  1G86 A;  5A6Z A;  1VBE 2;  2HEY F;  2C1F A;  3M7A A;  4AQS A;  4CYD A;  5FYT A;  4NIA A;  3KSC A;  2XH6 A;  1KEX A;  1E5H A;  4G9S B;  1HB4 A;  4QX8 A;  1ZZB A;  2ETE A;  5IFP A;  1ZRC A;  2A6Z A;  4LBQ A;  5JI7 A;  1JMU B;  3AYA A;  1LJ7 A;  4CP0 A;  3CEW A;  1H9W A;  3B00 A;  3EQE A;  1CPN A;  2OUH A;  2Q0A A;  4LBK A;  5ABJ B;  2HEV F;  2BFU S;  2X5I B;  5JR2 A;  1TMF 1;  3PIJ A;  5DZG A;  1HB3 A;  1N47 A;  2B9U A;  2WQ4 A;  3ZYF A;  3GM8 A;  2QE3 A;  2ZMN A;  3MGU A;  3FFQ A;  1W6P A;  4YG0 A;  2PLV 2;  3WNL A;  2IZW A;  5FYC A;  4XUT A;  2VL4 A;  1BBT 2;  4CP9 B;  2VZR A;  2W1Q A;  3PU3 A;  4WZF A;  2RS5 3;  1ODM A;  4YZ3 A;  5C4W C;  1TME 2;  1WBF A;  2OPK A;  4OMC A;  1UU6 A;  3OUJ A;  3CJI A;  4BM8 A;  4CE8 A;  4JTN A;  4DMI A;  5FWJ A;  5JMC A;  3GGL A;  3B9I A;  4CUA A;  1W39 A;  3PUR A;  5CYY A;  3HBZ A;  3LD8 A;  3AZY A;  3FE5 A;  2WZR 3;  3DYP A;  2WC2 A;  2P4E A;  2QDR A;  4IEY A;  1R08 2;  1S2K A;  2BGO A;  2BZD A;  2VM9 A;  2ARC A;  3UGG A;  1QJY 2;  5CFD B;  2FDF A;  4GA9 A;  5FYB A;  4Q4Y 3;  1HJF A;  1FNY A;  1LEC A;  4ZPI A;  1JHN A;  1VBC 2;  4O7X A;  1UY0 A;  5FQ0 B;  5IFT A;  1O3S A;  4MGT A;  3ZSK A;  3UGF A;  4YVS A;  3GYD A;  4Q4W 1;  5FZO B;  1ZRR A;  3AK0 A;  1YC6 1;  1RJ8 A;  2VBD A;  4QDR A;  1YQ6 A;  1C28 A;  1WMF A;  1GNH A;  1W2T A;  1YWK A;  3NAP B;  2A71 A;  4K3U A;  5EJ3 A;  5FKB A;  4IXL A;  1UX6 A;  3O5S A;  2XJS A;  1LGN A;  3ECQ A;  2R04 2;  4QMA A;  5DDJ 3;  3WDX A;  2WS9 3;  3FFZ A;  4Y4R A;  3K4A A;  1SBE A;  3H7Y A;  4LBM A;  2LRO A;  5B4X A;  3UKT A;  1PIV 2;  2VG9 A;  2HKX A;  2QTW B;  4BQW A;  4IV1 A;  3U14 A;  1ACC A;  4AI3 A;  1SLL A;  2GC2 A;  1H2M A;  2PHW A;  1QNW A;  3H1W A;  3MLL A;  4GZ9 A;  3WP5 A;  2XJT A;  4MXV A;  1QJU 2;  2VOT A;  1UZY A;  3HMY A;  5A3N A;  1PO1 1;  4W6Y A;  1NCR A;  4IV3 C;  3J4U H;  3NJY A;  2JDH A;  1VB4 A;  2W95 A;  3BOP A;  4MGQ A;  1RIN A;  1UW8 A;  3ME2 A;  3I3Q A;  2IXK A;  2HWE 3;  3EYP A;  4K9S A;  4AEK A;  3PTR B;  3JD7 3;  1B35 C;  2XUM A;  1DQ6 A;  1SBF A;  2R0H A;  1XYN A;  1OC1 A;  1G6N A;  2JG8 A;  4Q0V A;  2VVD A;  4P9J A;  4XFB A;  4FAH A;  2CL2 A;  1JW6 A;  3BOD A;  4I0B A;  4O65 A;  1US2 A;  4Q0P A;  4ES8 A;  1LHU A;  2E33 A;  2JJ6 A;  2BUK A;  3VBU A;  4JX0 A;  1YFX A;  3PME A;  4XIK A;  1W8U A;  3ENR A;  4AOC A;  4D8M A;  5F1R A;  4LO7 A;  4B7K A;  1AYN 3;  2GNM A;  1HJG A;  3PUI A;  2AC1 A;  1XQN A;  4FXK B;  5BUV A;  5J36 A;  2EID A;  5DG2 A;  4BIF A;  5C8C A;  1GV9 A;  4AW7 A;  3BOW A;  3VBF C;  3PLQ A;  4Y22 A;  4GAZ A;  3WF1 A;  5A1L A;  1WGP A;  2WN3 A;  2WO3 A;  1CAW A;  1WCU A;  2YBS A;  3KV4 A;  4LO8 A;  5IJR A;  3VZO A;  3VDC A;  4ORF A;  1BVP 1;  2B46 X;  2JKX A;  1AR7 1;  4KU7 A;  2CY6 A;  4ASM B;  1OQE A;  2OZ6 A;  1FV3 A;  1RMU 2;  5GKA C;  3III A;  4AED C;  1XB9 A;  4URT A;  5FUN A;  1MS3 A;  4E4D X;  5FBZ A;  4JQR A;  2R7E B;  4XJZ A;  4CDX B;  3G6J B;  3LA2 A;  3HVD A;  5FZH A;  2WT0 A;  4QXC A;  4RHV 3;  4GAL A;  1OXC A;  4BQY A;  2WQ8 A;  3T2O A;  1JYV A;  1U5X A;  4FFF A;  4LXL A;  2VZU A;  5JXI A;  1GOG A;  2Q8E A;  2RS3 1;  2Q8D A;  3TN9 2;  3AKS A;  4KBB A;  1WW4 A;  5GAL A;  3S7E A;  2G4I A;  5HV0 A;  4UBH A;  1TNR A;  3ZFE B;  3O7O A;  4EN8 B;  4XFC A;  1GQP A;  3IDB B;  4IET A;  2BEO A;  2E31 A;  3BGA A;  4YAR A;  3NVC A;  1X8M A;  1O4T A;  3P6B A;  1O8P A;  1C8N A;  1Z7S 1;  1LU2 A;  3WCS A;  5CEH A;  4CDU A;  5BNN B;  4XDP A;  4TTG A;  5FPB A;  3R05 A;  2RS1 1;  2HLE A;  2A1X A;  2QZ2 A;  1ZZC A;  3FJS A;  1Y7B A;  1EYB A;  4A3Z A;  1UAI A;  3PIG A;  4N53 C;  4PLN A;  4Q0Q A;  4ZU5 A;  4QPI A;  1KFU L;  3UT0 A;  1YI9 A;  2JE8 A;  2Y26 A;  1C1F A;  1HN0 A;  1RHI 2;  4CEY A;  1Y9Q A;  5J7M A;  4CU6 A;  2BWA A;  2B45 X;  2WBK A;  3AP9 A;  4Y20 A;  2A75 A;  1C3H A;  1UU4 A;  3WNP A;  3FHA A;  4XJA A;  4HT1 T;  5K8S A;  2VZ3 A;  2VZQ A;  5ACA 1;  3ATG A;  3MF6 A;  3RZL A;  3WCR A;  2AEN A;  1KS4 A;  1PK6 A;  4LHS A;  1RUI 3;  4OUS A;  4XXP A;  4AEM A;  4JRA A;  2VMH A;  3N7J A;  1TEI A;  1QOT A;  2YG0 A;  5G04 L;  5F37 A;  4EE2 A;  4QPG C;  3H3Z A;  3POI A;  1JZ8 A;  3MIB A;  3SQO A;  1KXG A;  3ACF A;  3WUC A;  1S0D A;  1BXH A;  3QH6 A;  4QXK A;  3VDD C;  1H4H A;  3BYW A;  5FZF A;  4YSF A;  1V9U 2;  4GH4 A;  4Q4X 1;  1PZ9 A;  3AP7 A;  1PGW 1;  3NWK A;  4X6R B;  5KHI A;  4CU8 A;  5JZG B;  2XL9 A;  3M3E A;  1BEV 3;  4LHL A;  4RQP C;  3P5B A;  1RC6 A;  4P08 A;  4CSW A;  4O61 A;  4QQ2 A;  5FMD A;  1LU1 A;  3J8F 3;  5JR7 B;  2QKD A;  2UWB A;  3DGT A;  3CZJ A;  2W9X A;  2GAU A;  4E2S A;  3OYW A;  3WV6 A;  3T2T A;  2EAL A;  2CDO A;  4EZ4 A;  2VZV A;  2P5B A;  1SCS A;  1URX A;  3EO6 A;  2PHF A;  1RUJ 3;  3POF A;  4LPL A;  2B5H A;  4BQX A;  1Y3T A;  2WNO A;  4RD7 A;  4Q4Y 1;  4QKN A;  2FZ2 A;  5JAX A;  5K7P A;  4C0H A;  4YZ1 A;  4YFW A;  5IVF A;  4DO0 A;  4B4P A;  5A7P A;  1H1M A;  4NRQ A;  4BYY A;  1Y9M A;  1QF3 A;  3IPV B;  3KWV A;  1VJ2 A;  2Y0I A;  2NP0 A;  5K9Y A;  5ANN A;  1SLA A;  4BJ0 A;  1UZV A;  2HYX A;  4LLF A;  5HXV A;  4QX5 A;  2JB8 A;  1RVF 1;  4A7Y A;  1LR5 A;  2DTY A;  2ZAC A;  3ASI A;  1G8W A;  4CXW A;  2WS9 1;  1VBB 1;  2W39 A;  5LBE A;  1UZZ A;  2Q4S A;  1H2N A;  3OEB A;  2F6B A;  2UWC A;  4XBN A;  3GHN A;  3O0X A;  2IXJ A;  4JV4 A;  2R07 1;  1PVC 2;  4CDW A;  3ZSE A;  5EQU A;  3V65 A;  4AG4 A;  1SDW A;  3RRD A;  1BVV A;  3CJI C;  1OA2 A;  4ARY A;  1UY1 A;  1SDD B;  3ZXD A;  2BBA A;  2HWB 1;  1W99 A;  1ENX A;  1FMD 2;  4LK7 A;  1AL2 3;  2DWR A;  1IOA A;  1RUG 1;  5FPL A;  3VBH B;  1HXS 1;  1FPN 3;  3E6D A;  3LIH A;  1AR8 2;  1RUF 1;  1RXF A;  4L2N A;  4M3C F;  3I59 B;  4JZR A;  3MIC A;  1K3I A;  1UOB A;  4HN1 A;  1DHK B;  1OF3 A;  2K0G A;  1FI2 A;  2Y38 A;  4L11 A;  3T0A A;  4A45 A;  4LA2 A;  2RR1 1;  2D6L X;  4P9X A;  2C24 A;  4KH9 A;  4QB1 A;  5F5Q A;  4Q29 A;  4DQA A;  3QBQ A;  2WZP P;  2J1S A;  1TZO A;  3TAY A;  3OBT A;  5F7U A;  4HSJ A;  4YVS C;  1D2S A;  1OUS A;  1ZBE 3;  2BFU L;  2IXH A;  1S2B A;  4P02 B;  5FY4 A;  5FZ0 A;  4EV0 A;  1O91 A;  1AYN 1;  1V0A A;  1QH7 A;  2UUR A;  4R9A A;  1MZE A;  4Y3O A;  2WNU B;  4CDU B;  1RUE 2;  4YZ2 A;  4DY5 A;  1V6K A;  1QQP 1;  4COW A;  5K0U B;  1N1V A;  3NKT A;  4XHB A;  4LUK A;  2UYB A;  5KXB A;  1JYX A;  5JLV A;  4GUL A;  4B4Q A;  2WAA A;  3MF9 A;  1UIK A;  2DCK A;  3LSD A;  4IV1 C;  5FZ4 A;  3ZLI A;  1CGP A;  2VW0 A;  3SCH A;  4MHU A;  4ATF A;  2BU9 A;  4MO3 M;  4OHZ A;  1V6J A;  4Y1V A;  1W90 A;  1PO2 3;  2ADD A;  1RUD 2;  4GIQ A;  3FX3 A;  1W8W A;  4XF0 A;  3ZYR A;  1UCX A;  3H9A A;  1NCR C;  4K21 A;  5A6Q A;  1O4Y A;  1IZ3 A;  3BN6 A;  4RHV 1;  1SLI A;  1J59 A;  4WVM B;  3F2Z A;  4HON A;  2FD8 A;  1DP0 A;  5GJ6 A;  3OSD A;  1YUD A;  3M70 A;  4QHO A;  2JG8 C;  2ZHN A;  4CUC A;  2HWD 3;  4MGS A;  4XUO A;  3OGV A;  4AI2 A;  4FVV A;  3C3V A;  4P9I A;  3T09 A;  1DDL A;  3VBU C;  3OEA A;  4AHZ A;  4LBN A;  3KF5 A;  1C5I A;  1DGR A;  1XNA A;  2ZGM A;  1JZ4 A;  3NKG A;  4YW3 A;  3Q8A A;  4AVA A;  2WUH A;  5FYH A;  4YVW A;  5I0R A;  1S0F A;  1GU3 A;  1AR6 1;  1UF2 C;  2UYA A;  4CUG A;  2FDH A;  3QLQ A;  2RMU 2;  2DUQ A;  4QX2 A;  3O1U A;  4XW3 A;  3H0O A;  1FNZ A;  1J83 A;  2D6K A;  4HLT A;  1SQ4 A;  1QEX A;  2ET1 A;  1A34 A;  4BA6 A;  4F83 A;  3BTA A;  5FZK A;  1WD3 A;  3SXW A;  1W6M A;  1O7F A;  5FZI A;  4QHZ A;  5F3G A;  2OT7 A;  1J3Q A;  5A3P A;  5DUV A;  1UL9 A;  2WWS A;  4XFI A;  4XDQ A;  4CPB A;  2E7Q A;  5FDB A;  1ZA4 A;  5E6H A;  5F8P A;  1L7R A;  3MID A;  4PIZ A;  5DUX A;  1LOB A;  3WP4 A;  3PTY A;  4CCC A;  1NT0 A;  1DF0 A;  2TNF A;  3NV4 A;  1W0N A;  1W9S A;  3R0R A;  3T1L A;  2Z69 A;  4CCL A;  4Y1X A;  1DIW A;  3JBG 2;  3J7H A;  4YPJ A;  4LOR A;  3JQX A;  1J84 A;  3UYJ A;  1GWL A;  2VQA A;  3RJR A;  2LRP A;  3OD0 A;  3ZXK A;  3QCW A;  1CQ9 A;  5F6L B;  3WNN A;  1POV 0;  3CJX A;  4QWN A;  1BEV 1;  5FZG A;  1F15 A;  2DYC A;  1IPS A;  1D4M 3;  4M3C B;  2JG9 A;  4QPI C;  2B39 A;  4ISR A;  5IWF A;  4XJW A;  4AVV A;  2WWU A;  3Q8F A;  2VR4 A;  4IUG A;  3ACL A;  1WWY A;  4CEY C;  5BNO A;  2FCT A;  3H8R A;  2BVB A;  4AVS A;  5IAV A;  1XSQ A;  5FZA A;  5GM0 A;  3JUU A;  4DXS A;  1XSR A;  1MVQ A;  2QQW A;  2BBV A;  4OI4 A;  4HAN A;  4Y1Y A;  1FOD 3;  2GZW A;  2HWF 2;  4IEU A;  5H9Q A;  3T1M A;  4AE2 A;  2Q5T A;  4UFK A;  4B29 A;  3WDT A;  4AFD A;  2W52 A;  4E8D A;  1PK6 C;  1KGY A;  4HL0 A;  2YRO A;  2B8M A;  1DZR A;  1UMZ A;  5J96 B;  4XBL A;  4BQ4 A;  2Y33 A;  2Z2S B;  4JCK A;  5KHJ A;  1SHW B;  3F95 A;  2GND A;  3GBF A;  1EUU A;  1C8M 2;  1CES A;  4ET7 A;  1LOE A;  4S2F A;  1EAH 3;  2J1U A;  4J6G A;  2NLR A;  1QY4 A;  5T54 A;  2AR6 A;  3GCW A;  3U10 A;  4GH4 C;  4JHZ A;  1LHO A;  3SIS A;  2WRA A;  3U07 A;  2X5I A;  4LHK A;  4NE9 A;  4KG0 A;  1HRI 2;  2R32 A;  3RZG A;  4PLM A;  5AVP A;  5KC5 A;  5CKQ A;  5C3S A;  1PGL 2;  2A7A A;  2A6X A;  2D97 A; 
#chains in the Genus database with same CATH homology
 4GWI A;  5CZK A;  2QQO A;  1JYW A;  1WKY A;  2YC4 A;  2VCC A;  1YQ2 A;  3C8X A;  4L0P A;  3MBW A;  1EUT A;  3HPN A;  3GXU A;  3T2P A;  4BK5 A;  2PQS A;  3LPG A;  3WNO A;  5C71 A;  5FUI A;  3IAP A;  2YFZ A;  1NUK A;  3LEK A;  1K45 A;  2VZS A;  1I5P A;  2EIE A;  2Y6J A;  5HPO A;  4CU7 A;  3P1I A;  3CZU A;  2DDU A;  2ORX A;  3OGS A;  1MPX A;  2C4X A;  2Y6G A;  1ULP A;  2WZE A;  2QQI A;  3A21 A;  2B4K A;  3K4D A;  3NNG A;  4P5Y A;  2C26 A;  4OUE A;  4A6O A;  1XNT A;  2J1V A;  1IQD C;  2W1W A;  3HJR A;  4P00 B;  4QDS A;  1US3 A;  5JXH A;  3CDZ B;  3UET A;  1RYY A;  5JXJ A;  1UYY A;  4JKK A;  4ARX A;  3T08 A;  2QQJ A;  2J1T A;  1KEX A;  4BXS V;  4ZZ8 A;  5IFP A;  3VDB A;  2ID4 A;  3FL7 A;  4QDQ A;  2ZXQ A;  4BK4 A;  4W8J A;  4XVH A;  4FI9 A;  3C7O A;  5JR2 A;  1DLC A;  1K12 A;  5C70 A;  2W3J A;  2ORZ A;  3GM8 A;  4A42 A;  2B9V A;  1H6Y A;  3WNL A;  1UYX A;  4XUT A;  2VL4 A;  2WYS A;  2WDB A;  5IHR A;  3ABZ A;  2VMD A;  2J1A A;  2VZR A;  2W1Q A;  5G05 L;  4W50 A;  2QQM A;  2RV9 A;  3C7H A;  4OMC A;  3GGL A;  3OB8 A;  4CUA A;  5CYY A;  4KI5 M;  3DYP A;  5LCW L;  2QQN A;  2BGO A;  2BZD A;  2VM9 A;  1PMH X;  3U37 A;  3LQC A;  3WSO A;  4QB2 A;  1UY0 A;  5IFT A;  1JZ2 A;  4TXW A;  3UNP A;  3THD A;  4QDR A;  4ZZ5 A;  4CUB A;  2VC9 A;  1BHG A;  3ECQ A;  3NJV A;  3IAQ A;  1HN1 A;  2Y6L A;  3K4A A;  4Z2A A;  5B4X A;  4MOA A;  2C9K A;  4A4A A;  4GZ9 A;  2WAB A;  2WN2 A;  5LA1 A;  2VOT A;  4RYD A;  1DYO A;  3MV1 1;  2V4V A;  2W95 A;  2W1S A;  4MGQ A;  1GOH A;  3EYP A;  4MAD A;  4ZXE A;  4CU9 A;  3D3A A;  3E1F 1;  1O8S A;  1US2 A;  4ZY9 A;  2E33 A;  2X09 A;  3HNB M;  3IB3 A;  4JX0 A;  3HNY M;  5DPN A;  2L9L A;  4D8M A;  2J1E A;  5EJ1 B;  4UI9 L;  3HEI A;  1OH4 A;  3PUI A;  3A7Q A;  2EID A;  2V5D A;  3T0B A;  3I3E A;  1UX7 A;  3MUZ 1;  1GMM A;  2XOM A;  3WF1 A;  2WN3 A;  2W94 A;  2WO3 A;  2X10 A;  3MUY 1;  4PF1 A;  5IJR A;  3VDC A;  3VD9 A;  2JD9 A;  2JKX A;  3W5N A;  1F4H A;  3PUH A;  2XON A;  5DN2 A;  3VD3 A;  5EJZ B;  2LW8 A;  3III A;  4UAP A;  5EIY B;  2VMF A;  3CIH A;  1GNY A;  2R7E B;  5J1X A;  2VTF A;  1T2X A;  2VCB A;  3ACI A;  3NQH A;  2WQ8 A;  3T2O A;  1JYV A;  5JUV A;  3WNK A;  2WO2 A;  1CX1 A;  2VZU A;  3C7F A;  1GOG A;  4KWU A;  5JXI A;  3K46 A;  5HXM A;  1UY4 A;  2JDA A;  1GQP A;  2VZP A;  3IDA A;  3BGA A;  2E31 A;  2ZEY A;  5JMO A;  3NJX A;  1CIY A;  3P6B A;  2YFU A;  1O8P A;  1WCQ A;  3CKH A;  1UXX X;  4TTG A;  3FHQ A;  2HLE A;  2YC2 A;  4A3Z A;  1SG3 A;  2EIC A;  4XUN A;  1UMH A;  2OKX A;  2JE8 A;  1D7P M;  3ACG A;  4DXR A;  2VO5 A;  2W87 A;  2XHN A;  4CU6 A;  2RJ2 A;  2WBK A;  3NRU A;  1O59 A;  3W5M A;  3WNP A;  3FHA A;  2VZ3 A;  2VZQ A;  3DEC A;  4RN5 A;  1XC6 A;  4LHS A;  4W4Z A;  5C7G A;  2YG0 A;  5G04 L;  3LE0 A;  3WF4 A;  3ACH A;  2W47 A;  1JZ8 A;  3VD5 A;  3ACF A;  1OF4 A;  4LQR A;  2E26 A;  4CVU A;  4CU8 A;  1JYN A;  5DMY A;  3A23 A;  1UYZ A;  1UWW A;  4P08 A;  2BER A;  4M4R A;  4JKL A;  1W9T A;  3WF0 A;  3CZJ A;  2W9X A;  3A22 A;  3LPF A;  2CDO A;  2VZV A;  4BDV B;  3K4Z A;  3CQO A;  4LPL A;  2WZ8 A;  2QQL A;  1LNS A;  5B4N A;  3AC0 A;  3MV0 1;  2WAO A;  3FN9 A;  2X05 A;  3HNM A;  4BJ0 A;  2HYX A;  2VCA A;  3VD7 A;  3WF2 A;  3WEZ A;  1CZS A;  2DCJ A;  2VZO A;  5DQ0 A;  3OEB A;  1F4A A;  1TG7 A;  4AG4 A;  4QX0 A;  4QX1 A;  4ARY A;  1UY1 A;  1NKG A;  1SDD B;  2ZEW A;  3I97 A;  2BBA A;  3WNM A;  1W99 A;  2LS6 A;  4DEQ A;  3GDB A;  1OT5 A;  1JZ5 A;  1K3I A;  1OF3 A;  3T0A A;  1NX9 A;  2QBX A;  4A45 A;  3LEI A;  4OYU A;  4QB1 A;  2KD7 A;  2J1S A;  3JXS A;  5F7U A;  5IYY A;  2J22 A;  3DYM A;  4P02 B;  3I2J A;  3SKJ E;  2RVA A;  4XZU G;  1JU4 A;  3EB7 A;  1W8N A;  2QQK A;  1W9W A;  5LA2 A;  3I2G A;  5I0D A;  3LEG A;  1JYX A;  2WAA A;  1CZV A;  2VJX A;  2DCK A;  2W46 A;  2VQT A;  4MO3 M;  3THC A;  4XUP A;  3I2F A;  2EIB A;  3BN6 A;  3I3B A;  4A44 A;  3F2Z A;  3SEP A;  2W5F A;  1DP0 A;  2VME A;  4PQQ A;  2BGP A;  4XUR A;  4CUC A;  4MGS A;  4XUO A;  1GOF A;  3OGV A;  1L7Q A;  1JU3 A;  2Y6H A;  4QX3 A;  3T09 A;  1JZ3 A;  2W91 A;  2Z4F A;  2XQX A;  4A41 A;  3OEA A;  1GUI A;  1K42 A;  1XNA A;  3VD4 A;  1JZ4 A;  1PX4 A;  2WUH A;  3WF3 A;  1GU3 A;  3ETP A;  2WO1 A;  4AAX A;  4D0Q A;  4XUQ A;  4QPW A;  4QX2 A;  1UY3 A;  1J83 A;  1JI6 A;  4GWJ A;  4KMQ A;  1UY2 A;  2ZEX A;  1PX3 A;  3ZM8 A;  5JXG A;  3MO4 A;  2W1U A;  2Y6K A;  3I2I A;  1L7R A;  4E8C A;  4OMD A;  3SEE A;  1R64 A;  4QAW A;  1W0N A;  1W9S A;  2W92 A;  3J7H A;  1NAE A;  4YPJ A;  3VDA A;  1W8O A;  2ZEZ A;  3I3D A;  1J84 A;  2VQU A;  4DUW A;  1UXZ A;  4DEV A;  3K77 A;  3I2K A;  3WNN A;  2J7M A;  1H6X A;  1UZ0 A;  1JHJ A;  2E32 A;  1ULO A;  1XPW A;  2VR4 A;  4IUG A;  1PMJ X;  2CDP A;  2VMC A;  1JZ6 A;  1CZT A;  4DUX A;  2V72 A;  1OD3 A;  4DXS A;  2VZ1 A;  3C7E A;  4DUV A;  2Y8K A;  3C7G A;  1P8J A;  3T2Q A;  2YB7 A;  4M4P A;  4E8D A;  3CMG A;  3T0D A;  1TVG A;  1KGY A;  3DYO A;  4UOJ A;  3SKV A;  4PT6 A;  1SHW B;  3HOB A;  4LKS A;  1EUU A;  5A1A A;  4ET7 A;  3I2H A;  4HG6 B;  1UMI A;  4QB6 A;  2J1R A;  2J1U A;  3OG2 A;  4JKM A;  3UES A;  3OBA A;  4DXT A;  4JHZ A;  3WQB A;  2Y64 A;  3OGR A;  1JZ7 A;  4OZO A;  3K75 B;  5LA0 A;  3HN3 A;  2VZT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...