1ULOA

N-terminal cellulose-binding domain from cellulomonas fimi beta-1,4-glucanase c, nmr, minimized average structure
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
152
structure length
152
Chain Sequence
ASPIGEGTFDDGPEGWVAYGTDGPLDTSTGALCVAVPAGSAQYGVGVVLNGVAIEEGTTYTLRYTATASTDVTVRALVGQNGAPYGTVLDTSPALTSEPRQVTETFTASATYPATPAADDPEGQIAFQLGGFSADAWTLCLDDVALDSEVEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOGLUCANASE C
publication title Structure of the N-terminal cellulose-binding domain of Cellulomonas fimi CenC determined by nuclear magnetic resonance spectroscopy.
pubmed doi rcsb
source organism Cellulomonas fimi
molecule tags Cellulose degradation
total genus 11
structure length 152
sequence length 152
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 1996-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02018 CBM_4_9 Carbohydrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1uloA00
4XUNA 2QQKA 2V5DA 2Y6KA 1K3IA 2E26A 2CDOA 5FUIA 3NJXA 2X05A 1SHWB 2VMFA 3A23A 1PX4A 3OGSA 4BK5A 3I2JA 4BJ0A 3K75B 1SG3A 3ECQA 4RYDA 1US2A 1OF4A 4CU8A 1DLCA 1OH4A 3WEZA 2YG0A 4L0PA 4DUWA 1UWWA 3IDAA 3BGAA 4A45A 2VL4A 1GOFA 1O59A 2VZQA 3LQCA 3W5MA 4QX3A 1UY1A 3MV01 1JU4A 4OUEA 3FHQA 2Y6HA 3OGVA 1JHJA 2J22A 3WNMA 2XHNA 4MGQA 2XQXA 3SKVA 3SEPA 1OF3A 2J1AA 2J1VA 4DEQA 5JR2A 3CDZB 3T08A 2EIDA 2ORZA 2DCKA 1CZVA 3P6BA 3THCA 4QB6A 3WNLA 4ZZ5A 3T0DA 1W0NA 4CU9A 3MUZ1 4QX2A 3C7FA 3CQOA 2XOMA 1EUUA 1XNTA 4D8MA 1SDDB 4UOJA 2RJ2A 4LKSA 5DPNA 3CKHA 2JKXA 5DN2A 3I3EA 5CYYA 2VZPA 1L7RA 2EICA 3DECA 1IQDC 4GZ9A 5JXGA 1XNAA 5EIYB 5A1AA 2KD7A 4GWIA 5C71A 3I2KA 2VC9A 3T2QA 3WQBA 1H6YA 4QDSA 4A6OA 2J1UA 3DYOA 1CZTA 4A3ZA 5C7GA 1YQ2A 2Y64A 1UYZA 4DXTA 4PF1A 2BBAA 1W8NA 1XPWA 2W5FA 1W99A 2J1RA 2VOTA 2BGOA 1PMJX 5G04L 3IB3A 5F7UA 3T0AA 2WDBA 3MO4A 4BDVB 2J1TA 5HPOA 2J7MA 4TXWA 3P1IA 3GGLA 3NRUA 3OEBA 4OMDA 1W8OA 4OMCA 5LA2A 4ARXA 2W9XA 5JXIA 3UETA 2W94A 2QBXA 4LPLA 4BXSV 4PT6A 3SEEA 3WF1A 3FL7A 1O8PA 4XUQA 3OB8A 1HN1A 3HEIA 3K4AA 3WF4A 4CVUA 3MUY1 3IIIA 4QDQA 4CUCA 5DMYA 2PQSA 4XZUG 2E33A 2JE8A 3GXUA 1L7QA 2V4VA 4MADA 3HJRA 3PUHA 3U37A 2YFUA 5IJRA 4A4AA 1LNSA 3EB7A 1WCQA 2LW8A 2YC2A 3BN6A 5LA1A 2X10A 1GNYA 2VZUA 3I2FA 2W47A 4QAWA 4OZOA 5CZKA 2DCJA 1P8JA 3ABZA 4QPWA 1ULPA 3ACIA 2W1WA 4DXSA 1J83A 2YC4A 2XONA 3THDA 2EIBA 2QQMA 2VO5A 3VDCA 1UZ0A 4ZZ8A 3VDAA 2Y6LA 2JDAA 4ZY9A 4A42A 2W91A 5B4XA 3T09A 2VZVA 4QX0A 4XVHA 5JUVA 3K4DA 1JYXA 1JZ7A 3K77A 3DYMA 4ZXEA 4AAXA 5IHRA 3I2IA 2OKXA 3D3AA 4KI5M 3LEKA 1GOGA 1JU3A 2WUHA 3HN3A 1UY2A 3FHAA 1WKYA 3HOBA 2QQJA 1UXZA 3MBWA 5C70A 2QQIA 4ARYA 1R64A 3T2OA 5JMOA 3NJVA 3WSOA 4M4PA 1JZ2A 1XC6A 2W92A 5J1XA 1NX9A 1W9TA 4P02B 1F4AA 4ET7A 2R7EB 5LCWL 2WZEA 2HYXA 1CIYA 4Z2AA 3J7HA 2WABA 1UXXX 4AG4A 4UAPA 3CZUA 4DEVA 2E32A 2BGPA 3C7GA 4MO3M 3K46A 4CU6A 1US3A 3HNBM 1GUIA 1UMHA 4QB1A 4UI9L 2W1UA 3VDBA 3UESA 4QB2A 2C26A 1GQPA 2VCAA 4QDRA 2W87A 1J84A 1JI6A 3CZJA 3LEGA 2C9KA 1DYOA 3WNKA 1BHGA 2W95A 4DUXA 2EIEA 2J1EA 4M4RA 5EJZB 1GOHA 5JXHA 2VZSA 4HG6B 1I5PA 1EUTA 1UY4A 3NNGA 3I97A 4E8CA 2ID4A 4RN5A 3OBAA 2WN3A 2ZEYA 4PQQA 4P08A 3GM8A 3OG2A 4MOAA 3NQHA 3A7QA 2JD9A 4A41A 2B9VA 3W5NA 3LPFA 4P00B 1UMIA 1W9WA 2W1SA 1H6XA 4P5YA 1NUKA 3ZM8A 4OYUA 4FI9A 1DP0A 2W46A 3C8XA 3EYPA 3GDBA 4QX1A 2VCBA 5LA0A 1UYYA 2WO2A 3LE0A 4XURA 3I3BA 4GWJA 2VMCA 1UX7A 5B4NA 2DDUA 4JKKA 5I0DA 2WBKA 3ACHA 4DUVA 2WZ8A 1OD3A 2WQ8A 3WNNA 2WN2A 3CIHA 5JXJA 2E31A 3E1F1 2C4XA 2YFZA 3F2ZA 3I2GA 1JYVA 2J1SA 2WO3A 1JZ8A 1JZ6A 3WF3A 3LEIA 1UYXA 4LQRA 4CUAA 4XUTA 4KWUA 3VD5A 3VD7A 2VM9A 1W9SA 2WO1A 2WAAA 2BERA 4XUPA 2ZEZA 3AC0A 2VMDA 2VQUA 1K12A 3IAQA 3I2HA 3VD3A 1UY0A 2VQTA 4CU7A 3LPGA 3ETPA 1OT5A 4JKLA 4IUGA 2VZOA 3T2PA 2VR4A 1KEXA 2W1QA 3VD9A 1NKGA 4JX0A 1K42A 1KGYA 2VJXA 4A44A 1JZ4A 3HPNA 1MPXA 4YPJA 4KMQA 2WYSA 3OGRA 2B4KA 4D0QA 4W50A 1JYNA 3HNYM 5EJ1B 3WNOA 2ZEWA 3DYPA 4LHSA 4W8JA 3K4ZA 4MGSA 1GU3A 3WF0A 2V72A 1JYWA 4JKMA 5DQ0A 1CX1A 2CDPA 2VZ1A 3PUIA 3OEAA 3T0BA 1O8SA 3ACGA 1UY3A 4BK4A 5IYYA 1ULOA 5IFTA 1GMMA 2QQNA 3SKJE 2L9LA 3C7HA 3ACFA 1K45A 5HXMA 3C7EA 1JZ3A 2ZXQA 3C7OA 3JXSA 1PMHX 1PX3A 4CUBA 1TG7A 1T2XA 2Y6GA 2Y6JA 2ORXA 3A21A 1F4HA 5G05L 2WAOA 3WNPA 1D7PM 2BZDA 3VD4A 4W4ZA 3IAPA 2Z4FA 3FN9A 1TVGA 4XUOA 2LS6A 2QQLA 2HLEA 2Y8KA 1RYYA 2X09A 1CZSA 4E8DA 3WF2A 3CMGA 2QQOA 2ZEXA 4JHZA 2VZRA 2VTFA 3UNPA 1NAEA 2YB7A 4DXRA 2RV9A 2W3JA 2RVAA 3MV11 2VZ3A 3HNMA 2VZTA 5IFPA 1JZ5A 2VMEA 3A22A 4TTGA 2VCCA 3I3DA
chains in the Genus database with same CATH superfamily
5FLIA 1Y3TA 4XUNA 3WLUA 4HFSA 4N7UA 1W6QA 3ZFFB 3D8CA 5J37A 3HWJA 2BYVE 3M3OA 3WQ7A 3ZYGA 1O3SA 1R083 4OUSA 5L7OC 2EF6A 4NAMA 3WDTA 3PUQA 4Q4X3 5E16A 2VH9A 5DAXA 4XC9A 3MPPG 3OGSA 2XLFA 3I2JA 4XJWA 3ZDVA 2Q4SA 1I3HA 1SG3A 3ECQA 3AKRA 1Z7S3 5EZWA 2VW1A 1DLCA 4MV2A 1JOBA 2YG0A 1DZQA 5M0TA 1YUDA 2PLV2 4IGOA 4CDWA 2EXJA 4Y5SA 2RDRA 2WWJA 3BGAA 3H3LA 1WGPA 1YXWA 2HWB2 2PYTA 2X5IC 4GALA 2AREA 5EJ3A 3RMYA 5BXXA 1K5MB 2ZHNA 4QX3A 3BIEA 1JUHA 1J58A 5E8AA 4YZ3A 5I8YA 5IK4A 3UKNA 4QPGB 1NE4A 1TME1 4HMZA 3LDKA 4AVBA 3FHQA 2Y6HA 5FZ1A 3KLSA 1BBT2 2J22A 2JD4A 2F6BA 4UFIA 1ZZ8A 3KGZA 5FO9B 4GJYA 2J1AA 1U12A 2NYYA 4CCNA 1RITA 4Q0SA 2P6CA 2O14A 3LIHA 1R093 1E5RA 2QZ3A 2EIDA 1LB2A 3I4IA 2JIGA 2YU2A 4FCAA 3THCA 4LTAA 1NZIA 3AZYA 5FXVA 5ACA3 1COV3 2XJQA 4YVSB 4OHYA 2D5FA 2R073 1W0NA 4ES9A 3MZHA 3BKZA 1GP6A 4PLNA 5FQ0A 1PNGA 3UJQA 3C7FA 1QQP1 2WZPP 3IPVB 3AKPA 4Q1PA 4D8MA 1SDDB 4O65A 3WV6A 1PO13 3F95A 3NV4A 5DPNA 3CKHA 4Y1XA 2VULA 2JKXA 2XJVA 1HQWA 4BOWA 4PLMA 3H1MA 4KWJA 2JDNA 5KR7A 4OUMA 4YW4A 3AP4A 1W2UA 1RUJ2 4K8FA 4RR3A 5CEHA 3E6DA 4HPKA 1AR92 1RXGA 2CNAA 4HKWA 5FPZA 1ZRDA 3O1OA 1X33A 2XR4A 1RB8G 2VQAA 2ZMKA 4HN1A 1QJZA 1VRH1 3GHMA 4KBBA 4LKFA 1KFUL 1XNAA 5A1AA 2KD7A 1YEWA 1RHI1 5JI7A 4LO5B 3CHXA 2V73A 3WQBA 2FMDA 3JQXA 4A6OA 4FPCA 4DB5A 1SLLA 1H2LA 1UZZA 3B93A 1RUF3 4YFWA 1PIV3 1SQ4A 5FXZA 4NRPA 1UYZA 4DXTA 2OQ6A 1AR73 1WLCA 5FYSA 3H8RA 4NR1A 4JVAA 1CJDA 3ZFGA 4RQPA 1U0AA 2XKPA 3MLJA 1QY4A 1HW5A 1V6JA 3ZN4A 3ZXAC 1RUNA 4AQTA 4P9XA 5F7UA 2WDBA 2YHJA 5HPOA 3VBOA 2A6YA 4GQ7A 2J7MA 3WG1A 4C8DA 1OFSA 3A4UA 1OFNA 3J7LA 4KU8A 1ULCA 4MH0E 1Z7S1 3P1IA 1OPMA 4KU7A 1FOD3 3OEBA 4OMDA 4RR3C 5FYVA 5FZ7A 2YYOA 1DFQA 1SBEA 4OMCA 1OVPA 1ZRCA 5ABJB 1SCSA 2C5DA 4AEJA 3M3QA 1B35A 5LA9A 3T4VA 4L99A 2DCYA 4CDXC 3JBG3 4XYXA 2IZWA 1BCXA 2WNVA 2PHDA 2VW2A 3NMBA 1GLHA 1O8PA 1ZRIA 3H8UA 4XHXA 3POWA 4A6SA 5CFCA 1UL9A 4GA9A 1FMD2 3I2DA 3ZKYA 1Y4WA 4XF4A 1SPPB 3TEZA 3BI3A 4LO6B 2QDRA 2VW0A 1AR62 3LSDA 5FBJA 2OS2A 2ZGUA 3WX5A 5JPMB 4AFAA 1R091 4QDQA 4QPIA 3ZFGC 4FXGB 4IEYA 3ROUA 4DQAA 2OPKA 4BQ5A 5DMYA 3L2YA 1S1AA 4XZUG 5FY8A 5IW0A 5ACA1 1COV1 2HWC3 2JE8A 2OUHA 4UWDA 2V4VA 5A32A 1RGSA 1CIWA 3H3UA 1OC1A 3PUHA 3U37A 4Y5TA 3VBOC 1Q43A 3MF9A 3D82A 3OPZA 5IJRA 4AWDA 1ODNA 3P3PA 5FWEA 4PIYA 3THPA 3O1UA 1LNSA 1PO11 5FMOS 2LW8A 3J26N 5LA1A 1O4YA 3BU7A 1IPSA 3WZ1A 2X10A 1GNYA 3I2FA 4XILA 4DY3A 1P8JA 1BJQA 1L7LA 1B35C 4BISA 1ULPA 4Q5OA 3J7MA 2FCVA 5FY5A 4EN7B 1CAWA 1GQHA 2BJSA 2R062 3MW2A 2OPWA 2YC4A 2OVUA 2WNVC 1YQCA 3H3ZA 3N35A 4IV3A 4JDNA 2WZR3 4WVMA 4C90A 2EIBA 5L36A 2R1DA 2XLAA 3LB9A 2HWE2 5BPXA 3P5BA 2VECA 4FFFA 4XJAA 3VKMA 5AFEA 5GZDA 3TYJA 1UZ0A 5CFCC 3CBNA 3B9CA 1W8HA 3JD72 5AVPA 4AFBA 4QHOA 4AVAA 5BYNA 2OA2A 5CFDB 3VBSA 2W91A 3T09A 2QFEA 2AYHA 4XVHA 4F83A 3RS6A 3SH3A 4AAPA 3QCWA 5ANNA 4R4ZA 2JDYA 4KBZA 1PIV1 3IIAA 3K3NA 3IDCB 3O0WA 4JGZC 2UYAA 3FUQA 4IEVA 1RIRA 3C3VA 3PLQA 1AR71 2VNOA 4XFHA 4NHXA 1VALA 4Y3OA 1DDLA 3Q8BA 2DVGA 3HN3A 3FHAA 4DS0A 1UXZA 2P37A 3MBWA 1ND3B 1IKQA 2QQIA 4ARYA 4LXLA 5A7OA 2ZGNA 3V0BA 5A33B 1GZCA 2PLV3 3PJYA 3PTRB 5DUXA 4Z07A 1Y9QA 4JCKA 5A70A 4M4PA 1ACCA 2D6LX 2IXIA 5FJKA 1XC6A 2IXJA 1FOD1 3NSTA 4NAOA 4ZU4A 2VCMA 1E5SA 4PIZA 5DAPA 2IFRA 1VLNA 1YFWA 1RVF1 5F6KA 1CIYA 1S0EA 4ORFA 3JBG1 4G3YC 4CRQA 2DCZA 2OZJA 4Q0UA 1MACA 2ZHKA 1ZZCA 3LA7A 1D2SA 4QXCA 4UAPA 1TNFA 3CZUA 1W8ZA 4MYEA 4FAHA 3TN91 2B7YA 3ZMNA 4AHZA 1UU6A 5F8PA 3K46A 3AJZA 4RFT0 1QJU2 1US3A 1MS0A 2V5YA 5TSWA 4FPGA 1SFNA 3DKWA 3CU7A 1GUIA 1T6GC 1QKQA 1UMHA 1WA6X 4YW5A 4PI2A 1AYM2 1J3PA 1F35A 4XJZA 4RSUA 3UESA 4H7MA 4QB2A 3ZSKA 3JUUA 4S2HA 1W2NA 4QDRA 2K2SA 3VL9A 1UKGA 4L92A 5C9AB 1NCQC 3B00A 3POJA 2F4PA 2HWC1 4LBOA 1N1TA 3B69A 3V56A 4QHZA 4QM8A 2C9KA 2LROA 3K48A 5JOZA 4QPIB 5FBZA 4XQ4A 2N7GA 3RYKA 4UF0B 3KQRA 5A7WA 2Y60A 3KF3A 1RUJ3 4OI4A 4Q4V2 4UT5A 1AR93 3M8LA 4GXLA 2VZSA 4HG6B 4UFHA 3WW2A 4Z1VA 2DURA 1I5PA 4B1LA 4JGYA 3Q9OA 4W6WA 4Y4RA 5EYYA 1UY4A 1AR82 2CGPA 2KA3A 4RN5A 3OBAA 5CG9A 1PO22 2Q1ZB 2VVEA 2ZEYA 2BOIA 2A70A 1Q56A 2D3RA 3BPSA 5T3NA 4NJ4A 3WINE 2WZR1 3OG2A 4P9IA 3JCIA 3OGGA 2RMU2 5IUQA 4A41A 1UMZA 3POYA 4MLOA 4MZUA 3RJRA 3W5NA 1W05A 1PK6A 3LPFA 4PLOA 4D94A 1DZRA 3LFMA 3KT4A 4XOGA 4P5YA 3GNEA 1NUKA 4H2AA 4LBQA 4OYUA 2WQ4A 1YJLA 3VKFC 3C8XA 2C0ZA 4ARXA 5FZOB 1REDA 2C6SA 1JTZX 1TEIA 2ET1A 1UCXA 2MHFA 4WM7A 1NCRA 3VZKA 1NG0A 5C3OA 1YO8A 2VUAA 3DXTA 3AVRA 2WA4A 3LE0A 4LHNA 2ZTNA 1J1LA 1T6BX 4IEOA 3I3BA 2NP0A 1UX7A 2FZ1A 1Q8PA 2NPIA 4GULA 1WLDA 5EWSA 2YZ4A 4JKKA 2WBKA 5FP3A 5GLWA 1MS9A 4LA2A 1GBGA 2WN2A 3CIHA 1VBA2 4Q0VA 2YPDA 3VKLA 2PLV1 1KFXL 1QU0A 2QKDA 3I2GA 4KG8A 3ZIWA 2XJTA 4QT6A 1VB2A 1Q8QA 2HWB1 3S0MA 4AQSA 4BQ2A 1XNKA 2J42A 4XUTA 3ILRA 4IEQA 1QJEA 1YIPA 3WVJA 3H42B 3O1VA 2RS12 1VP6A 1I9RA 2VM9A 3R4UA 2WO1A 2JECA 3OGJA 1DYPA 1PK6C 2DUOA 4E9KA 1DYKA 1BBT1 2ZEZA 5KC6A 1FMD3 5FLHA 1LOFA 3I2HA 3VLBB 4BU2A 1AXYA 3MICA 1UY0A 4QGNA 5FPXA 4YGBA 4CU7A 4CDQA 4MXWA 5J7MA 1AR63 1HQNA 3LPGA 4K7JA 3OYWA 3PIGA 4XW3A 4YVWB 2Q0AA 4TZDA 2VUJA 3NO8A 4WM7C 3PVBB 1ULFA 3D5OA 3U78A 1LKNA 4B8EA 1RMU1 3OTFA 4BQ1A 1W03A 2W1QA 4OI2A 1AYN2 2RDSA 3VD9A 4JX0A 4OZXA 4XFBA 1WCKA 1KGYA 3OCPA 3ZSJA 3MIHA 2VJXA 5K0UA 1KITA 3WG3A 3HPNA 2EXHA 1WCUA 5C5TA 4BQ3A 3ETQA 3WW3A 2ERFA 3URFA 3ZSMA 4R9AA 1ULGA 5LK7B 2GNTA 3WNOA 4XAEA 2ES3A 1KJLA 1SFPA 1RUJ1 4XDPA 4LHSA 1AR91 2HWF2 4EN0A 3E97A 5A7NA 3N9MA 3VZNA 3VDDB 5LK5A 3WDUA 1CJPA 2HWE3 2ZZQA 5FYTA 5FOJB 2V72A 5DQ0A 2BVBA 2G9GA 5A7QA 3UGFA 3JD73 1IOAA 4I3PA 4LK6A 3ZR5A 5AC92 1IPKA 4AFMA 1CGPA 3H7JA 2GMPA 2R1BA 3PVEA 4CDQC 5FPLA 5EQUA 2WIIB 3MHZA 2PN5A 1O3RA 5EPAA 5IATA 3WG4A 4BK4A 3ILFA 4YW2A 2Q30A 4M0HA 1ULOA 5IFTA 1OLRA 3AP5A 1HN0A 4JDMA 5BNOC 3D0JA 5FUNA 4WV8A 4M3CF 2WNUA 1VRBA 2RR13 2BGCA 1WLTA 4N53B 4QX7A 1WMEA 3PUAA 4CCCA 1RUE2 2FDJA 3GBGA 5K0UC 4IEUA 3C7HA 2C9AA 4AVTA 2Z42A 4HN0A 2IXCA 2VBBA 4LNVA 4R4XA 5C33A 4FFIA 4LULA 2ARBA 2FDKA 2Y34A 4KGQA 2ZGQA 1RJ7A 1JZ3A 2VD7A 4LOSA 1H8TB 1WW5A 4Y24A 4D7SA 1G6NA 1F2NA 1WBLA 5FYBA 4RHV2 3SNMA 3T1LA 2Y26A 2VVDA 2ZXQA 4FPFA 2HEVF 1NXD1 4COWA 4Y4YA 1X7NA 4CUBA 2HEWF 4EV0A 3FUOA 1SDWA 4Y5Z0 1W2OA 5FZDA 2HBUA 3WDWA 1W6MA 1J59A 3DGTA 4DPNA 2ZS6B 1T2XA 3POFA 4OHWA 2IFWA 2Y6JA 1NE6A 2ORXA 4URTA 4XF1A 4Y22B 3ENRA 5A3OA 5FDBA 2ZX0A 3KSCA 1L3JA 5FYZA 4W4ZA 3IAPA 4C0BA 1OD5A 1IS5A 1Q8SA 5JR7B 1DBNA 2Z4FA 3HQXA 4HONA 3FX3A 1QJU3 5FKBA 1ODMA 1UZVA 3GHNA 4HK8A 1OHFA 3FN9A 1FMD1 1XE0A 3OUHA 4CCOA 3E6CC 1HIXA 5A6QA 2YDEA 1AYM3 2WNUC 2QQLA 3AP9A 1AR61 4V2VA 3TRSB 1RYYA 4XEZA 3THTA 3ZDSA 5T54A 2JG9A 4I0WB 3QLQA 5I8TA 3CMGA 4FBFA 1JHNA 5CKMA 1N1VA 4LITA 2GSYA 2VZRA 1AX2A 2A73B 1UOFA 1S0DA 1LEDA 1EP0A 2BP6A 3POIA 3ZXDA 1LOCA 3A0KA 3AMHA 4JC1A 1OKQA 4DXRA 2FDGA 2W3JA 3INAA 1GZ9A 3MV11 3TAYA 1A34A 2JICA 4XTMA 1IGOA 2H6BA 3DUIA 4Q26A 4Q4V3 1WCSA 5I0TA 4LO8A 3G6JB 4IGPA 5CNAA 2V5DA 2Y6KA 4XFGA 1AR83 1WW7A 2V09A 2NM1A 3BVCA 3H0OA 4QQ2A 3U07A 1PO23 5FPUA 4Y20B 5CB7A 2R061 1QOSA 4O9GA 5CKQA 4IERA 2CDOA 1G86A 3I2OA 5LW9A 3A23A 4D69A 2RMU3 4LO4B 4CEYA 2ADDA 2E9QA 2JB8A 4JV4A 1MS5A 2YGMA 1LRHA 5IAXA 2RM22 3JD71 4RYDA 4XFIA 1HKDA 2D40A 2UY9A 2FZ2A 2JJ6A 2ZX1A 3V0AA 4CU8A 2GALA 1KJRA 2A6VA 4DUWA 2DV9A 1N47A 4QU1A 4CA9A 1UWWA 5KHJA 3IMNA 1GNZA 3IDAA 1QJY2 1SLBA 4YGEA 1LU1A 1O59A 1XNDA 3NNLA 3LQCA 4A3XA 4QGMA 4O7XA 3W5MA 2WL1A 4DOUA 1QXRA 4CDUB 2CGNA 4IE4A 4HLTA 5IVFA 1XB9A 2C24A 1OA4A 2RS32 3KHBA 4PBPA 3SC7X 4X6RB 1RUH3 4FOVA 4CCKA 4OUEA 3W9AA 1JHJA 1OH3A 2JX9A 2MEV3 2WWUA 2XHNA 4MGQA 4N43C 2EAKA 3PVOA 2XXZA 2LUWA 3ZN6A 1F9KA 1VBA3 2HH9A 5LBCA 4QQPA 5CG8A 1IS3A 4AYUA 3POEA 2DCKA 5CU1A 1H2KA 3WP4A 2QJVA 2WSVA 4AEDA 4K8RB 2A75A 3J8F2 3T0DA 3VZOA 4CU9A 2RS13 5FRAA 4CEYC 4QX2A 2BNMA 2MPFA 3CQOA 3S30A 2XOMA 2AENA 4ZS3A 5F5AA 3AKTA 4UOJA 3J7NA 3NV2A 1CAUB 1XNBA 5KXBA 1OA3A 3KCYA 2ZOEB 1ZX5A 2YXSA 3SXWA 4DNYA 4IE0A 5DABA 1GZWA 3BUCA 3I3EA 1AXKA 1QJU1 1CX4A 4W65A 5CYYA 4GH4B 4JRAA 3B94A 3CJIB 3OUIA 5F3GA 4R52A 2YPJA 2EICA 2YC0A 3DECA 4Q4W2 3ZFEA 5A3LA 1AYM1 1IQDC 4GIQA 4NHMA 4EE2A 1EV12 1GWKA 4SLIA 3RGBA 3ES4A 1NOVA 4PCRA 4Y1ZA 3VBFC 4EWAA 1A78A 5FZ8A 4QKBA 2A7AA 3DXUA 1WUVA 1REEA 4M3CB 1SEFA 2Q8EA 5C4WA 3T2QA 5IVBA 1H6YA 1J1TA 1GANA 2VMIA 3KM5A 2J1UA 1X8EA 3FZ3A 4IE7A 5C8CB 5I0RA 5JCTA 2JG9B 2OT7A 4PF5A 5C7GA 1S0GA 2Y6FA 1GWMA 4AEDC 4FOWA 2Y64A 4Q4V1 1DG6A 4Z92B 1S0FA 1XPWA 2W5FA 1W99A 2J1RA 1PMIA 1W90A 2QCSB 2VOTA 3SLIA 4I01A 5JZGB 5D8AC 1AR81 4W6XA 3LKJA 5ANQA 1W2TA 3ZFFC 1VBB1 2BNOA 2RDNA 1LODA 4LBMA 4TSVA 4A7KA 5AC93 5L7OA 1OPOA 3BU0A 5KBFA 2W2IA 3CO2A 4XJ8A 1APNA 2OXBA 1MZ5A 2RMU1 3MO4A 3O14A 4YFZA 3UGGA 1HQLA 3M3EA 1RUC3 5BNPB 4TXWA 4XXPA 1ULEA 1A8MA 1ZBA2 5CA6A 4O61A 1MVQA 2PHLA 1NYWA 3GGLA 3SISA 4O9EA 1W8OA 1H9WA 5T5JA 3M1HA 5LA2A 2RJLA 4IESA 1V9U1 3BALA 3IDEA 1WLWA 4M00A 2W9XA 5FYIA 2A6WA 5FZMA 3N4MA 3UETA 5CISA 2W94A 3N7JA 2JDHA 3HIFA 5BUVA 1RUE3 1BK1A 2QBXA 4BXSV 4LE4A 1BVP1 4YRDA 4F8AA 5BY5A 5I91A 3RZMA 2JG8B 5F1RA 4PT6A 5C4WC 3GCXA 5FYUA 1UKRA 5GZGA 4BA6A 4P9LA 2AR6A 3X29B 4Q29A 3VBUA 4XUQA 2IVJA 4EN9B 2BUKA 4C1WA 2WS92 4JZRA 5D21A 4U36A 5GLZA 2D6PA 3ZLIA 4J1XA 5AVAA 2ZAAA 1VBA1 4CVUA 3LF7A 4LORA 3ZSLA 1AX1A 1U5XA 2DUQA 3OF1A 4URAA 1BKZA 1XBFA 3DPRB 4RS5A 2ZHMA 3TB0A 5J48A 1L7QA 5KXDA 2ARXA 2RS11 3ZYBA 1YIFA 2ATFA 1ZBE2 1KDMA 2DTYA 1HJGA 4INDA 1VBE1 4GWNA 1WCQA 1Y43B 3AVSA 4WM8B 1DF0A 2GNBA 2E7QA 2W47A 3S5QA 2DCJA 1H1AA 3ABZA 3NAPA 5FK8A 5HXVA 1YCIA 1OURA 1V0AA 3MIDA 1MQTB 5FY9A 1NLSA 1YWKA 5F32A 1V00A 4DXSA 3BTAA 4QKDA 1DLLA 4K6BA 5FMDA 4BQYA 2WFF2 2G9FA 5FZCA 4IDZA 1OUXA 4BM8A 1AYN1 3VBUC 2QQMA 2UWCA 5KWRA 4CCLA 4I02A 3MPBA 5DUWA 3I49A 1ZA7A 5DAWA 3ZFEB 4AHWA 4IE6A 4XE9A 5HCBA 4ZY9A 4XIKA 3HVDA 3VHNA 4QX8A 2A6ZA 5B4XA 2VZVA 3UL2A 1JZ7A 3ITQA 3K77A 4LBQD 2JB4A 4XBQA 3MIGA 3DYMA 1BXHA 1XNCA 4ZXEA 4L97A 3TBDA 4AAXA 4RS5C 4FAGA 3I2IA 2I07B 2HWF1 5FYCA 5I8SA 3D3AA 2A5ZA 3VBRB 1F8VA 4KI5M 5SV8A 1E5IA 2E53A 4CUGA 2WUHA 2OYZA 1UY2A 5AC91 4EZ4A 2RM23 2RE9A 5IAVA 1D0GA 3IT8A 5C70A 1XU2A 1C57A 2D43A 2ZGMA 4BPZA 3RZHA 2WT1A 1LHNA 2P3YA 5JMOA 5LEJA 3NAPC 2CSGA 3I59B 4Y33A 2XDVA 1D4M2 1JH5A 1QJY3 4IV1B 4JHTA 4XPVA 3KT7A 5LBBA 5J1XA 3BYWA 3QOPA 1W6OA 1H4HA 1AXZA 1GNHA 1PVC2 1W9TA 3M2MA 4P02B 3R6SA 5LCWL 2WZEA 3E5XA 3SHRA 5ABJC 2RS33 4YM0A 4D7TA 1RXFA 1RUE1 2QQPA 4IW3A 4CDXA 1UXXX 2FCTA 4UW6A 5FO7B 4BQWA 4DEVA 2WA3A 1UIJA 4ITCA 4Z2WA 2E32A 3C7GA 1UX6A 4BLJA 2X5IB 4RHV1 2A1XA 2GMMA 4HT1T 4E4SA 2D97A 3AYCA 1OKOA 1RTVA 3J8F3 2D3PA 3TEWA 4DO0A 2IXLA 3AYAA 3WUDA 5JOXA 1SZBA 1HV1A 2VCAA 1ZM1A 4FO9A 1R081 1WBFA 4J25A 3ZYPA 1J84A 4E2SA 4Q4X1 3CZJA 2VAUA 1LTEA 4LE3A 1IKPA 2UU8A 5BNNC 3WNKA 1W6QB 2W95A 3WP6A 2D5HA 1QNYA 4NWVA 2A6XA 4ONUA 4YM1A 1TE1B 4XMAA 2J1EA 4M4RA 5EJZB 4A7ZA 1JXNA 5JXHA 4Q4W3 3FLPA 1X9TA 3M4FA 1EV13 1XE7A 1PZ7A 1SCRA 5J3UA 1CR7A 4ISRA 1W39A 2ID4A 1H0BA 4ZPIA 5IVEA 1ENSA 2FDIA 1W04A 1W8UA 4AEKA 3QACA 2YMZA 4MOAA 2CGOA 3AP7A 1PHMA 4CDWB 2B9VA 2DTWA 3FWEA 4NIIA 1YFYA 2AZ5A 1HJFA 1W9WA 1D4VB 2AC1A 1H6XA 3KS7A 1S2BA 3PTYA 5A6ZA 3ZM8A 1X36A 2BFUL 2FBEA 2UURA 4YG6A 3ZPYA 4E4DX 5D2AA 5J36A 5HBAA 2G9ZA 2ZCWA 1PGW2 4QX1A 4JGZA 4EJRA 2FQPA 4AI9A 3ELNA 5H9PA 5LA0A 2R071 3OUJA 2D98A 2BVVA 5A1LA 4YG3A 3JQWA 5B4NA 4META 4ATEA 2PA7A 4FVVA 3WR0A 2VQ0A 2RM21 1ZBA3 2JE9A 2WZ8A 4HETA 2QQUA 3N3HA 4GKYA 5HCAA 1PM7A 3B7MA 1STMA 4KWLA 1MVEA 1DQ4A 2YFZA 2DFCA 2ZAHA 3AXDA 3F2ZA 1RJ8A 3E1F1 4NVPA 5FQ0B 5T5OA 3ZKUA 4AI3A 4UW4A 3PHMA 2TBVA 1QJY1 3LA2A 2WO3A 4H3WA 3DF0A 1WCDJ 1QNWA 1BQPA 4P9WA 1PGL2 4KWUA 4K20A 3VD5A 4BCUA 1GP5A 4P14A 3IBMA 1JUIA 1K5JA 3HN1A 3ZYFA 5IK5A 4AE2A 4XUPA 3JB4C 3MW3A 2WS93 2BW8A 4RR3B 1CN1A 5A7PA 4HPKB 3AC0A 3U14A 3WNXA 1U5ZA 4CCJA 4CXWA 3IAQA 1REFA 1VJ2A 1KDKA 1S2KA 2WLPA 4PI0A 3S7EA 3VD3A 2W39A 3SCGA 4EN6B 2JDPA 4AGGA 4P5HA 4XHBA 4N8MA 4AOCA 3ETPA 4XQWA 1HX6A 1BVVA 1RUF1 4CDXB 2O8OA 3A0NA 2ZGSA 1V6LA 2VZOA 3T2PA 2DYCA 3RI8A 1OOPA 3RVHA 2RR12 3I3MA 5IT6A 3J8F1 3WY6A 3SQOA 4XCBA 1NKGA 1S0BA 3O0VA 3AZVA 2IVIB 3RDIA 1ZBE3 1PZ9A 3W59A 1NCQA 1JZ4A 3ILNA 2VU9A 2E7AA 2JE7A 3PDQA 4S2GA 2HYKA 2CYFA 4FTEA 1RUI2 3ZFGB 1JYNA 4RQPB 3HNYM 4X8NA 5IVVA 2P2KA 2P5BA 4N9IA 4Q4W1 4LKDA 1VMHA 4BZ4A 3KVAA 2WFF3 1EV11 3VBOB 1W06A 4CYDA 2ZPXA 4GMP3 3QBQA 4XABA 4DFSA 3AMNA 4QQOA 1W2AX 1GU3A 3WF0A 1JYWA 3APBA 3P3NA 2GN3A 1DQ6A 2CDPA 2YUEA 3ZO0B 2KR2A 4CZSA 5BV6A 2ZX2A 1JOJA 3KCCA 3OEAA 1EPWA 1YQ8A 1O8SA 1B35B 2VY0A 3EMRA 3VZLA 1LOGA 1MS4A 4X6QB 3AFGA 1QIQA 4XXAA 1GMMA 2WNVB 5K9YA 4B4QA 2QQNA 1DQ0A 4TYSA 1OOPC 4BB3A 4MG2A 5L9BA 4LJHA 4ZHNA 1DGRA 3WUCA 5FZHA 5CFCB 3V64A 2O8QA 1H9PA 2O1QA 3AMPA 3E5QA 1UPIA 2BWCA 5DXDA 1C8M2 3AZZA 3ACFA 4AFCA 5FZBA 1K45A 4FT8A 1D0HA 1QDOA 1LECA 2WWSA 4CEWA 5JAXA 3PL0A 4LT5A 1ZRFA 4MX3A 1D4M3 1VBC2 1ZBA1 3C7OA 1UPSA 4N9HA 5FY0A 3MGUA 3BB6A 1H4GA 5A32B 4MXVA 4F3JA 1W6PA 3RZJA 1PVC3 1BMV2 2LM3A 2BQPA 3CL1A 4FQZA 3FFQA 1JBCA 4YM3A 5FPVA 1HV0A 2Y6GA 1ALYA 1ND2C 1NA1A 2XJUA 3AX4A 3KT1A 5L19A 1CWPA 4AVVA 1R1A2 1F4HA 2R30A 2D44A 2BV4A 4Q0PA 2Y0OA 1YLLA 1WD4A 2WS91 1CAWB 4FPLA 4IV3B 1XQNA 2XBO2 1RUG2 4OQ9A 1KRIA 4WVMB 4E27A 2DFBA 4DMIA 5EP9A 4WBBA 2HLEA 4AEMA 2H0VA 3HBZA 1XYOA 2XUEA 4ZU5A 5CADA 3WF2A 4NN0A 2QQOA 4YVWC 1LOBA 1GP4A 1UOJA 2ZEXA 4FOYA 5F5QA 3AKQA 4FPEA 4Q4Y2 3VBSB 2VTFA 4PHZA 2OX0A 3UNPA 3KB5A 1NAEA 3N9PA 1RUH2 2GC1A 3FC0A 2R042 4M01A 4CEWC 4XBNA 1ZBE1 3HD8B 3AK0A 2RV9A 2YY1A 5FAXA 2AEZA 4K9SA 4GB32 4LHLA 2MEV2 3WG2A 1MZ6A 3FJSA 3I3QA 3B5LB 4XCAA 4FPKA 5FP4A 3A22A 1DGWX 4JTOA 2GC2A 3OD0A 4TTGA 2XWBB 1F5JA 2ZA9A 2XLGA 3VGIA 2B8MA 4D6QA 4AVSA 5GJ6A 2XJPA 5FJHA 1NA1C 2E26A 1QDCA 2PMWB 2WFF1 5J09A 1U5YA 1O4ZA 3KF5A 2VMFA 3V0BB 2W0XA 1PX4A 3NJZA 4BK5A 1S0CA 1YYNA 5FYHA 5L9VA 4BJ0A 2WNOA 3K75B 3FBYA 3MYXA 3N9OA 1S0JA 1ZRRA 3ZIXA 1OF4A 1QWRA 4YZ5A 1OH4A 4L0PA 4OLLA 4PDWA 1DU3D 3WW4A 1I6XA 1TMF3 1SLIA 4XJUA 5BNOA 1GOFA 2VZQA 2YBSA 4HXCA 5GLUA 4K40A 2B9UA 2VXRA 3CNAA 1JS9A 1JU4A 4N53C 2GAUA 3OGVA 4S2DA 3NW4A 2DVFA 4A7YA 3LFIA 1LHOA 2WLQA 3SKVA 1OF3A 1SMVA 3SEPA 4BLIA 4DEQA 5A1FA 3RZLA 4IETA 3ACLA 3OY8A 5IVJA 1BLZA 3CDZB 5SV5A 2XG3A 4NUBA 3T08A 2ORZA 1D4M1 3P6BA 3RWNA 1JYCA 1FPN2 3WNLA 1V6OA 3DKQA 3GF6A 1PVC1 5FUPA 3IM0A 5FY7A 5D8AB 2BEOA 1WA4A 1DGRN 2D3SA 5A7WB 2W52A 2Q1MA 1RC6A 3RJ2X 4GJZA 4RA0A 4JGYB 2W68A 3UGHA 2ENRA 2HBTA 1XOYA 2GDFA 1NQJA 1YFUA 1RUC2 4PDWC 5DN2A 4YW7A 4CP0A 5JLVA 4MHUA 1FXZA 5GKAC 1BEV2 4P9YA 1V6MA 2VZPA 2Y0IA 3LOIA 5IWFA 1L7RA 2Z69A 5GLTA 2GC3A 1O5UA 5FZ0A 2GH8A 1WD3A 4LOTA 2UWAA 4GZ9A 4XFCA 1SLAA 1PK6B 1Z0HA 5JPNB 1X50A 4GWIA 4PIXA 1W3VA 5GM0A 3VBHA 4I2OA 3QH7A 1AHSA 3I2KA 4XFFA 1ENRA 4LBQB 3GZUC 2P6HA 4QDSA 3DYOA 4MVTA 1RUI3 1URXA 4CP9A 3T2TA 1UQXA 1YRZA 2PHUA 4QHBA 4WM7B 1YQ2A 3R4SA 1NCRB 4B4PA 2EIGA 5CAZA 5F3CA 4B1MA 2BBAA 2PHWA 5FLJA 3K51A 3KV6A 4NHLA 2WFPA 1J3RA 4HSLA 1JYTA 4NPMA 5LASA 4QM9A 3NV1A 2TUNA 4CP2A 5KXCA 3U1XA 5CVRA 2AUYA 2X53S 5LY2A 1ZREA 3T0AA 3LCPA 3I54A 4KL1A 2HEYF 3T1MA 4BDVB 2ZKNA 1F15A 2JXAA 4YYOA 1IS6A 4OQ8A 1DIWA 2GH2A 2NMOA 5FZ4A 3NRUA 1LOEA 4RGAA 1VMJA 2BRTA 1NLRA 3QH6A 4JQRA 4CXYA 5DG2A 2GN7A 2AH2A 2VVFA 3IMMA 4I0BA 2OZ6A 2VG9A 2R0HA 1X9PA 2IWGB 2P3KA 3DV8A 3UJOA 5JXIA 5F37A 4AHXA 4RL7A 1PGW1 2OUJA 2RJKA 4ZXKA 3VBHC 2DU1A 3RNSA 1VB4A 2JDMA 4QU2A 3RFRA 1C8M3 1UU5A 2BU9A 3AZXA 4WVZA 4MXWB 4CDQB 5KHKA 3HQUA 4K21A 3DCQA 3SEEA 3WF1A 3OYWB 4CDUC 2E51A 4JTNA 3OB8A 1I1EA 3LAGA 3AL6A 1FYUA 4E2GA 1VBC3 4N43A 1HN1A 2OW4A 5FZKA 5FYMA 3WF4A 2EALA 4W6YA 1CPNA 5DUUA 4KGGA 3GZEA 5FMOL 4NHYA 1NLQA 4JAAA 5K0UB 4FSJA 5I0UA 4BWOA 4OULA 2PQSA 1CAXA 4ES8A 2XGXA 1Q8OA 2E33A 2NQYA 1LGBA 5FXXA 1PGL1 1FX5A 4AR2A 1R1A3 2HWE1 3HJRA 1AL23 2YFUA 2VTXA 4LUMA 4HVRA 5FZ9A 3RQ0A 3CJXA 1S2EA 2CWSA 5JVVA 4CXXA 1W9FA 4G4FA 1O91A 4HKLA 2XBO3 1RUG3 4FXKB 4Y1YA 5FK7A 1KS5A 1V6IA 2Q5TA 3ATGA 4QAWA 5A3UA 5CZKA 1UYPA 2YGLA 1NXMA 3AJYA 4YSFA 3ACIA 2W1WA 3MEPA 4GH4C 1DGWA 1VMFA 3CJIC 2XONA 3THDA 1O3QA 3AKSA 4Q4Y3 2RR11 4XZPA 1VIWB 3VBFA 2VO5A 2R043 3GCWA 2P17A 3KZ4C 3ST7A 4Z8BA 1ENXA 1LGNA 3AFKA 3VDAA 2Y6LA 3FLTA 2GNDA 3NNJA 4GB33 4UW5A 2JDAA 1FT9A 1O6UA 2WNUB 4MUVA 5FP9A 3H9AA 1Y7BA 4IEWA 4QMAA 3O1PA 3H8XA 4QX0A 1RUI1 1N3OA 1XYPA 1JYXA 1YQ5A 3U10A 1MZFA 1G9BA 4XTPA 4WVVA 5IVCA 5FREA 5IHRA 3RZKA 2CV6A 1B09A 2VNGA 3ORJA 2NZ9A 2F17A 5D8AA 1C5HA 5DG1A 4XIOA 1JU3A 3ZFFA 5FOBB 4WZFA 4LLFA 3MIEA 1HXS2 2RHPA 4FOQA 4YNIA 1WKYA 1E57A 4I30A 2QQJA 2LALA 1HRV2 5H9SA 1GZTA 2WRAA 1W6MB 1ST8A 2BNNA 3NJVA 4BE3A 2P3IA 3WSOA 4LHKA 3VZJA 5GZCA 4CCDA 3D4KA 2VNVA 4I3GA 3VUOA 1QEXA 1NX9A 3MFCA 3KHCA 2QE3A 3B01A 1C1LA 1XXNA 4J1WA 1POV3 4TLGA 4L2NA 3ZVXA 4PBOA 4Z2AA 3J7HA 4QX5A 2E6VA 2XVKA 5T50A 3RZGA 1C8M1 4DRRA 2XQRA 1K5MA 2JG8C 3ZX7A 5FO8B 4R9DA 3WOGA 2HWD2 4NRMA 1M06G 2BGPA 1GSLA 3N9QA 3O1SA 2I45A 4QPGA 4CU6A 3W21A 3M70A 3HNBM 1VBC1 1FPN3 5FR3A 2DBIA 4UI9L 1UW8A 3VDBA 4OFGA 1OUSA 1BMV1 2Z2SB 2DU0A 1PO21 5E89A 4AQ6A 2W87A 3HMYA 4N43B 3ZR6A 3HR9A 2QZ2A 4YZ4A 4FTBA 5F5CA 1W9YA 1JI6A 1SLCA 5F2WA 1UZWA 3DPRC 4QQLA 2PTMA 4YVSA 2LTNA 1BHGA 1HB1A 3AYEA 1N3QA 3TN92 3OOXA 5AFBA 4PQ9A 4DUXA 2IXHA 1BEV3 2JKBA 3WCRA 2XBO1 1RUG1 2VE1A 3NNFA 4WM8C 4WZCA 3W20A 4CEYB 4ZKTB 5K7PA 1JODA 1OVSA 3N9NA 4XACA 4E8CA 5JDBA 3VKOA 2DCTA 1ASJ2 2WN3A 4YZ2A 5A3PA 4LKEA 3MLKA 4OI1A 1LAJA 4NO4A 4LMFA 3V0AB 1MQTC 3GM8A 3OBZA 4XF9A 4K3UA 4Q4Y1 2ZZJA 3ZOIA 1CQ9A 1K5MC 1H30A 3OPWA 2QQVA 2JD9A 3WQ1A 1RUH1 1YFXA 3BPZA 3OJBA 5FFOC 2R041 4P00B 4QPGC 4GB31 2W1SA 2MEV1 3AYDA 4FPJA 2YROA 5CKNA 4COYA 3SITA 1FNZA 5FKCA 4AI0A 4YW3A 2B5HA 3USUA 4AI2A 1DP0A 2O0OA 4KH9A 1QMJA 3EYPA 4XDOA 3GJBA 1N3PA 1RHI3 1SBFA 4XQDA 3G7DA 2XMLA 3RI9A 4HKOA 3ZN6B 4DZGA 2I74A 4YGCA 4YVSC 4XURA 3UT0A 2WT0A 2VMCA 4GWJA 1BZWA 2VBPA 3NWKA 4QPYA 2DDUA 3B3QE 4M3CE 4AEDB 2VOXA 2NN8A 1MS1A 1DHKB 2XL7A 1OD3A 2WQ8A 4E2QA 3NVCA 4BXFA 3RSJA 4MGYE 3POGA 2E31A 2FDFA 1RUOA 1AX0A 3TEXA 1WWYA 3TWIA 4FTSA 1C5IA 1LU2A 3LD8A 3Q8FA 3VN4A 1JYVA 2R16A 2BBVA 2P1BA 1JZ6A 3WF3A 2XWJB 4IV1C 1QHDA 5GLVA 5I93A 1S0IA 2ILMA 3BTZA 5C3RA 3VD7A 1POV1 1GZWB 1XSRA 2VNRA 4V2WA 4YW6A 1W9SA 3ZYHA 5ABJA 2WAAA 3W58A 1GWLA 1XU1A 2BTVC 2VMDA 3GALA 5HI0A 3Q8CA 4AF9A 2SLIA 4NIDA 2FD8A 3EO6A 2A3YA 2UYBA 1R1ZA 1OXCA 3H1WA 1OT5A 1WMXA 2PAMA 4MGIE 5JI9A 3BOPA 1OLME 2WYFA 2VR4A 1FPN1 5C4WB 1FI2A 5FTTC 1FNYA 1LGCA 4IL7A 4E4HA 1G9CA 4DY5A 4OVEA 2G1MA 1RUD2 1SPPA 4AZZA 2NLRA 1K42A 4QXKA 3MI8A 1EAH2 1VE0A 3S6PA 4DINB 3I8TA 3OSDA 1BK0A 2RDQA 4A44A 1MPXA 4TWTA 4YPJA 1KS4A 2WYSA 2B4KA 5T5PA 5BNNA 4D0QA 3LZZA 1UZYA 1RUC1 1Q8VA 5F2SA 4QWNA 5F6LB 3CF6E 5EJ1B 2K46A 1BEV1 2Q8CA 5L7OB 2HJIA 2ZEWA 4ZS2A 2YV8A 5LBEA 3DN7A 5FZ6A 1ZYBA 1RMU2 3J4UH 3K4ZA 1F5FA 5FXWA 2AACA 4DRVA 5F9TA 3WW1A 4XAAA 3JU9A 3KCXA 3PIJA 2PHRA 2ZMLA 3PMSA 1ULDA 4NPLA 3EQEA 5APAA 5IK8A 5LWBA 1QJFA 2X29A 3T0BA 1A8DA 3WT3A 2KXLA 3J9SA 3TNQA 4CDWC 2QQWA 3ACGA 1H8VA 1UY3A 5E6HA 3ZXFA 3ZSEA 3BCWA 4HSJA 5E1RA 3WP5A 5H9RA 4DXZA 2R0FA 2D93A 5FZFA 4YLZA 1UOBA 5I0SA 4K1YA 5CIRA 3LIGA 3VBUB 5CFDA 4BQXA 1PZ8A 1OSGA 3TEYA 3E5UA 4EWEA 4LUKA 1HXS3 3EXUA 4CE8A 3USUB 2QDNA 2XVLA 2VGDA 1CAVA 1YI7A 3VV1A 1I5ZA 1HRV3 5HCFA 2XKOA 5FY1A 1UAIA 3PUSA 4EROA 3L2HA 1W3XA 4YWAA 4RS5B 1OBNA 1EPZA 3U0ZA 1ND3A 4XMIA 1C1FA 3I7DA 4D7YA 5A3NA 3RRDA 1H2NA 1GQGA 5DZFA 3LOBA 5FYYA 5A33A 1H1MA 4PJYA 2ZGOA 1MEC2 3KVBA 5L9RA 1OMIA 2WAOA 3KV9A 5L73A 3B02A 3WNPA 1D7PM 2PELA 3NAPB 2GP3A 2HWD3 3SH4A 2XH6A 3IDBB 2K0GA 1N1SA 4YM2A 2R49A 1TVGA 4XUOA 5LB6A 4C1XA 1YQ6A 1LULA 1AJOA 3POBA 4QXBA 5CFDC 2Y8KA 1TMF2 3WCSA 2X09A 1RVF3 3VKNA 1ZZ9A 3WD5A 4E8DA 4QQHA 3KWVA 1GV9A 2D7FA 5LEKA 3O5SA 2OIIA 4IXLA 4JHZA 1OQ1A 1QF3A 3M7AA 3ON7A 3U4SA 4AI8A 4D6RA 4R9BA 2JEMA 2YB7A 2P3JA 2XJRA 3GZAA 3TN93 1JYIA 4Q0QA 2ZX3A 3KMHA 1NZCA 2VZ3A 1C28A 2VZTA 4XETA 5C9AA 5IFPA 2IUWA 1VAVA 2VMEA 3AZWA 1JOPA 1ND3C 2TNFA 3DL3A 3O1MA 2GNMA 1F31A 1KXGA 2QQKA 5HV0A 4RQPC 2ETEA 1DCSA 1ASJ3 3LA3A 2EAAA 4UF0A 1K3IA 1WW4A 4C0HA 2C1FA 3RG0A 3S57A 1HB3A 5FUIA 3NJXA 5BNNB 2ET7A 2X05A 1SHWB 2RS31 2WSUA 4Q8KA 4J6GA 2VPVA 2WNEA 3PU8A 1US2A 1LENA 1W6OB 5DDJ2 3ZMOA 1Y9GA 4TLFA 2JWPA 1ONAA 2XL9A 5JWPA 1FATA 3WEZA 2D6NA 2DF7A 5KHGA 1XSQA 4UFJA 2ZMNA 1POV0 4A45A 2VL4A 2B45X 1HB2A 2A3WA 2V4AA 5J98B 2DVAA 4BHPA 1AZDA 1UY1A 3MV01 2VXJA 4NRQA 1MZEA 4FFGA 3EHKA 4COZA 2QNKA 1PNFA 3IKWA 2WKKA 4LLOA 4OCTA 4YG0A 1NQDA 1SACA 1HXS1 5FZOA 4R8HA 3WNMA 2EXIA 5C9AC 2XQXA 5HV4A 2ZGTA 3E6BA 1HRV1 2J1VA 1JMUB 5JR2A 3Q8AA 4MGZE 5GALA 2JDZA 3WP3A 3O1RA 4QPIC 3GBWA 1CZVA 1GICA 2WINB 4BMEA 4QB6A 4ZZ5A 1Q3EA 1CVNA 1CAVB 1TQ5A 4BIOA 3H7YA 3MUZ1 4EWDA 3TNPB 1NY72 4XDQA 3D6EA 2I2SA 3OBTA 4G9SB 4HANA 1EUUA 4IEPA 1XNTA 4LIUA 1ND2A 4UXAA 2ZHLA 3WDYA 4EZHA 2ARAA 2RJ2A 2XB6C 1ZZ7A 2ZX4A 3KV4A 4LKSA 5DUVA 4HZFA 1MS3A 1HDKA 1YC61 2HWD1 4I09A 1KD7A 2W08A 5GZFA 5LATA 2ZBJA 4OHZA 2RS52 3HT1A 2PHXA 5FZIA 2HWB3 3UKVA 3KGLA 4ATFA 5ERLA 2CY6A 3ALQA 4IV3C 5FZ3A 5LRRA 2YBKA 4FP3A 5FPAA 3LEMA 1JN2P 5T52A 1RUD3 1X8MA 5JXGA 1QJX2 4C91A 4H14A 5EIYB 4CPBA 4CP1A 1EAH3 2F4LA 3AMQA 3GJAA 4KG0A 3T4HB 4MHRA 4YVWA 5C71A 2PAEA 4LK7A 3KQ4B 1BBT3 4UFMA 2VC9A 2Z5WA 4LR4A 2B42B 3VBSC 2BPA2 3EBRA 5FIXA 1GR3A 1CZTA 4JGZB 1XRUA 4A3ZA 5K8SA 1G9DA 5BNQA 1IG3A 2JDKA 4RGKA 4Y1VA 2YBPA 4FFHA 2PHFA 5F39A 4PF1A 4CCEA 1KQRA 1UNBA 1W8NA 1RMU3 2MNGA 2BGOA 3ZYJB 4Y26A 4COVA 2XUMA 1DGLA 1LHWA 4U2AA 1ASJ1 3HBKA 1PMJX 3POSA 3MIBA 5G04L 4QD2A 3IB3A 1AL22 5JIAA 2CWMA 2J1TA 3VDDA 2D6KA 3MLLA 1GKBA 2OQ7A 1TZOA 4UBGA 3T30A 2BOJA 2JIJA 5A6YA 1LEMA 4EN8B 1UO9A 2VOVA 3VL8A 3N7KA 1S4CA 4LPLA 1VBB2 4QKFA 3UK9A 2YU1A 4AQ2A 5B2GB 3PMEA 4BQ4A 4NIHA 1CD3G 2ZGKA 1IQAA 4RD7A 3FL7A 2FDHA 3N7MA 5IK7A 4AI1A 4N53A 3AB0A 3ZPOA 1MS8A 1ZZ6A 1W8TA 1O3TA 5K4LA 4XFAA 1OOPB 3LSEA 3FFZA 3HEIA 3K4AA 4NROA 4QGLA 1UOGA 1V9U2 4LBJA 3C2UA 1VBD2 2TEPA 2D6OX 3MUY1 1WMDA 2VOKA 3IIIA 4RGGA 3NNMA 4DIQA 1H8TA 4Q8LA 1NCQB 3RZZA 1HRI2 2ZGPA 4CUCA 4IGQA 1MEC3 1QH6A 3OBRA 3GXUA 3Q8EA 2R32A 4EYUA 1OI6A 4MADA 4GMP1 3NKTA 3WDVA 3VDDC 5A6XA 4RFRB 5EYXA 1UF2C 1VPHA 3ZXLA 4A4AA 2ZABA 4Y1UA 1AJKA 5DAQA 4GWMA 5EV7A 2Q8OA 3EB7A 2YC2A 4D6SA 5JSPA 3NV3A 3BN6A 4Y22A 5H9QA 2FMYA 4N7IA 2VZUA 4JGYC 4OZOA 4HK9A 5C5UA 2H6CA 5KHHA 4QPWA 3KV5A 2WJSA 1ND2B 2ADEA 1J83A 1W8WA 1C3HA 4P9JA 3TOJA 3UYJA 2ARCA 1LR5A 2A3XA 1RUD1 1W8FA 2CHHA 5FZLA 1DQ1A 5GZEA 5C3SA 2RG4A 2CAVA 1EAH1 3VDCA 4ZZ8A 2PHTA 4NHKA 2ZKLA 5EHDA 5LRSA 1CONA 4EQVA 3MDPA 1VBE2 1V6NA 4SBVA 1HB4A 1W0PA 3R0RA 1M4WA 2GMEA 2WQZC 4A42A 5JUVA 1FAYA 3K4DA 3AP6A 1SBDA 2Z79A 1ZNPA 2H0BA 1H8TC 2QUOA 3RWKX 3HAGA 4ASKA 1NCRC 5C3PA 5FV3A 2OKXA 3VB9A 3FMGA 4UFKA 4CEWB 1LOAA 2UWBA 3LEKA 1TME2 1GOGA 3IWZA 2DUPA 2BWAA 4B7KA 1YI9A 2DVBA 2EXKA 3K3OA 3R05A 4NIAA 5LZ6A 3HOBA 3PU3A 1AL0G 2CAUA 4FPHA 3CEWA 4Y20A 1W6PB 5DDJ3 2P34A 2D6MA 1UN1A 4GD4A 5A80A 5C6CA 1R64A 1LHVA 3MW4A 3M3CA 3T2OA 4M0NA 1SLTA 1JZ2A 2P4EA 4UBHA 1NA1B 4QKNA 2W92A 3LDBA 2R063 3LGRA 4B29A 1XYNA 1F4AA 4UW3A 1ZZBA 4ET7A 1DQ5A 2R7EB 2Y33A 2HYXA 1QQP2 1ZVFA 2WABA 4B3NA 3KD4A 3PURA 4HOOA 4Q27A 4AG4A 4ASLA 4CSWA 4CTEA 4E4ZA 1LOFC 3BOWA 1DZTA 1N1YA 4CDUA 3WQ0A 4MO3M 4MGKE 3WDXA 3V65A 1HLCA 4NIGA 2GP5A 1IHMA 2NMNA 1W28A 4QB1A 3L9JT 4BYYA 4FPOB 3ZYRA 5FCCA 1WMFA 2W1UA 1VRH2 5T55A 1E5HA 1AVBA 3RPQA 3WHUA 2C26A 3O0XA 2IXKA 5DZGA 1GQPA 3ZYIB 3D0SA 1LHUA 1RHI2 1MEC1 2FCUA 3SCFA 4LIVA 4AGRA 3LEGA 3MFAA 4ISQA 1DYOA 5KHIA 5HCHA 3FLRA 3N7LA 1FV3A 2E63A 2R6QA 3USSA 4BIFA 3IZOA 1Z78A 2G4IA 2EIEA 1C4RA 1GYKA 1IPJA 2CL2A 2RS53 3EJKA 1GOHA 1O5LA 1SFYA 2XHKA 5F3EA 1D2QA 1CAUA 3ZXKA 4XJ9A 1AF9A 1EUTA 3H8OA 1ENQA 1TMF1 3N9LA 3NNGA 1PVXA 1QJX3 3I97A 5CBLA 1YHFA 3O12A 4P9GA 1EYBA 1R082 3PJQA 4PQQA 1CESA 4GH4A 4P08A 3CJIA 3VZMA 4N90A 4CCMA 4Q4X2 4ZU7A 3NQHA 4PDWB 4WVWA 3A7QA 4MSVA 1GFF2 4XBLA 4QXHA 4I0AA 4XF0A 4OI0A 2AEYA 5KC5A 3PNAA 3PVNA 1UMIA 5BNOB 1G9FA 1Z7S2 2VUCA 3S7IA 1W6NA 4M3CA 2QTWB 3ASIA 4JDOA 4YARA 2ZACA 2DWRA 4AW7A 4FI9A 1JW6A 3CLPA 2W46A 2K9ZA 1POQA 5C8CA 4K1ZA 4L9BA 3GDBA 2VCBA 1RINA 3HQRA 4X8PA 1UYYA 2Y38A 3ME2A 2WO2A 1U5IA 4OHXA 5A3MA 1BYHA 1MR5A 1OQDA 2JENA 3OY8B 4AL9A 3NJYA 1C8NA 5JOYA 3RMXA 4UFLA 5JZGA 4NPRA 1UD1A 2BFUS 3ACHA 3MIFA 4DUVA 5I0DA 1O4TA 5DDJ1 1V70A 1G8WA 3WNNA 1OLQA 2AGSA 5C3QA 3ZXJA 5JSOA 5JXJA 2VUDA 2C4XA 3B9IA 4ASMB 5A3TA 1R092 4GMP0 1V6KA 3JZVA 2J1SA 4COUA 5BNPA 1JZ8A 4L11A 2XVGA 1VBB3 2DBNA 3LEIA 1COV2 1UYXA 4LQRA 4CUAA 5ACA2 2R072 3BTYA 1OLMA 5FWJA 4LEJA 3U75A 4AXOA 3HT2A 4YW1A 4KWKA 1QH7A 2BERA 4XF3A 4B7EA 5JMCA 5FZAA 2SBAA 1PO12 2GZWA 2VQUA 1K12A 2JG8A 2VQTA 2PQQA 1QOTA 4H55A 3DEMA 3R4DB 5J96B 1V9U3 4FPYA 2XPJA 1VBD3 3LWCA 3JB8A 3ZN5A 1Y9MA 5C8CC 5F5IA 2JG9C 3UKTA 4JKLA 3VBHB 3OD4A 3MF6A 4IUGA 3WXPA 1HRI3 5FP8A 1KEXA 5FY4A 2GU9A 3BIWE 4JRLA 2Q8DA 3WHTA 3U11A 4CP9B 2ZJCA 3BTXA 1NY71 1OQEA 1AUYA 5T5LA 5JZGC 1VAKA 2EA7A 3SCHA 2Q1FA 2B46X 3GBFA 4KMQA 3DPRA 3OGRA 5FMCA 1LESA 3QD6A 2WO7A 3UV9A 5F3IA 3RYRA 1XJAA 4W50A 2PXJA 3VHPA 2IC1A 1X82A 1RUF2 1PIV2 1DQ2A 5BNPC 2RS51 3GZTB 1UIKA 5DAVA 5A7SA 3O1TA 3DYPA 3FE5A 4IE5A 4W8JA 5LBFA 4UYBA 4WM8A 1AR72 4L8QA 4MGSA 3ES1A 1QJX1 1G9AA 1LJ7A 1W0OA 4HL0A 4JKMA 1CX1A 2BDRA 2VZ1A 4YGDA 1QXJA 3PUIA 4V1PA 1MQTA 4S2FA 5FZGA 3VHRA 1VBE3 4ZONA 5JOWA 4NE9A 2PFWA 4R9CA 3AL5A 2B39A 1XE8A 2E7TA 2VBDA 1G7YA 1S55A 4IEZA 5IYYA 4TN7A 3U4XA 1FOD2 1WZXA 3RYPA 3O7OA 2VMHA 2HKXA 4F7ZA 2VOWA 5FP7A 2WR9A 1H2MA 2A71A 3M3IA 1RVF2 2VMGA 3ZXEA 1AYN3 2GC0A 4JQTA 3SKJE 1TME3 3S5AA 2QVSB 3JBG2 3NKGA 1TNRA 2CU5A 1W6NB 2L9LA 3AM2A 3IN9A 4HBNA 4MGTA 1CPMA 1Q5OA 3FHIB 2XJSA 1R1A1 5FMBA 1AL21 5HXMA 4LBKA 4NWWA 3SH5A 3C7EA 4AK3A 3VBRA 3ZXGA 5LY1A 3VHOA 1PGSA 2VTXJ 1YNAA 1CAXB 3IPVA 1OA2A 4LA3A 5FZEA 5KXEA 4Q1RA 1EY2A 4LO7A 3JXSA 1QGLA 3AXEA 1PMHX 1PX3A 4NMIA 1VAMA 5E88A 4NOTA 1TG7A 2ZGRA 2HWF3 3N36A 5ISLA 2G19A 1IS4A 2EVXA 3FBMA 1QQP3 1PM4A 1WW6A 2DVDA 3I59A 4BH9A 4KNCA 4AGVA 4IV1A 2HWC2 2WC2A 5DZEA 3H1YA 1YJKA 3A21A 3K2OA 5G05L 5D1IA 1RL3A 4KQ7A 3GYDA 2BZDA 2FHRA 5EXOA 3VD4A 1QOOA 4LBNA 2ZGLA 4H7LA 1FV2A 1UU4A 4AHYA 5JSRA 4FQ4A 5IVYA 1NT0A 5JIUA 1O7FA 4IQPA 3ZFEC 2LS6A 3LDRA 4AFDA 1H1IA 2UY8A 3SMHA 3VBFB 1VBD1 1VRH3 4HVOA 4D3WA 1J3QA 1A3KA 1CZSA 1IG0A 4FP2A 1IZ3A 1HRI1 4YZ1A 2X5IA 5C8WA 3BODA 2X8KA 3AMMA 3T3YA 4AVCA 2WZR2 4GAZA 2WT2A 4LBLA 4CPBD 5EFUA 1QXPA 4Q2FA 1A6CA 4B4RA 1VR3A 1ZA4A 2LRPA 3H50A 4BMBA 3VBRC 2KM2A 4A2UA 4HVQA 3NL1A 5A3WA 2RVAA 4Z82A 4RHV3 3HNMA 4GKXA 3OPTA 4OHVA 2JDUA 1JZ5A 2PAKA 5FPBA 4IEXA 2CTVA 2VCCA 1LCLA 3I3DA
chains in the Genus database with same CATH topology
4XUNA 2QQKA 2V5DA 2Y6KA 1K3IA 2E26A 2CDOA 5FUIA 3NJXA 2X05A 1SHWB 2VMFA 3A23A 1PX4A 3OGSA 4BK5A 3I2JA 4BJ0A 3K75B 1SG3A 3ECQA 4RYDA 1US2A 1OF4A 4CU8A 1DLCA 1OH4A 3WEZA 2YG0A 4L0PA 4DUWA 1UWWA 3IDAA 3BGAA 4A45A 2VL4A 1GOFA 1O59A 2VZQA 3LQCA 3W5MA 4QX3A 1UY1A 3MV01 1JU4A 4OUEA 3FHQA 2Y6HA 3OGVA 1JHJA 2J22A 3WNMA 2XHNA 4MGQA 2XQXA 3SKVA 3SEPA 1OF3A 2J1AA 2J1VA 4DEQA 5JR2A 3CDZB 3T08A 2EIDA 2ORZA 2DCKA 1CZVA 3P6BA 3THCA 4QB6A 3WNLA 4ZZ5A 3T0DA 1W0NA 4CU9A 3MUZ1 4QX2A 3C7FA 3CQOA 2XOMA 1EUUA 1XNTA 4D8MA 1SDDB 4UOJA 2RJ2A 4LKSA 5DPNA 3CKHA 2JKXA 5DN2A 3I3EA 5CYYA 2VZPA 1L7RA 2EICA 3DECA 1IQDC 4GZ9A 5JXGA 1XNAA 5EIYB 5A1AA 2KD7A 4GWIA 5C71A 3I2KA 2VC9A 3T2QA 3WQBA 1H6YA 4QDSA 4A6OA 2J1UA 3DYOA 1CZTA 4A3ZA 5C7GA 1YQ2A 2Y64A 1UYZA 4DXTA 4PF1A 2BBAA 1W8NA 1XPWA 2W5FA 1W99A 2J1RA 2VOTA 2BGOA 1PMJX 5G04L 3IB3A 5F7UA 3T0AA 2WDBA 3MO4A 4BDVB 2J1TA 5HPOA 2J7MA 4TXWA 3P1IA 3GGLA 3NRUA 3OEBA 4OMDA 1W8OA 4OMCA 5LA2A 4ARXA 2W9XA 5JXIA 3UETA 2W94A 2QBXA 4LPLA 4BXSV 4PT6A 3SEEA 3WF1A 3FL7A 1O8PA 4XUQA 3OB8A 1HN1A 3HEIA 3K4AA 3WF4A 4CVUA 3MUY1 3IIIA 4QDQA 4CUCA 5DMYA 2PQSA 4XZUG 2E33A 2JE8A 3GXUA 1L7QA 2V4VA 4MADA 3HJRA 3PUHA 3U37A 2YFUA 5IJRA 4A4AA 1LNSA 3EB7A 1WCQA 2LW8A 2YC2A 3BN6A 5LA1A 2X10A 1GNYA 2VZUA 3I2FA 2W47A 4QAWA 4OZOA 5CZKA 2DCJA 1P8JA 3ABZA 4QPWA 1ULPA 3ACIA 2W1WA 4DXSA 1J83A 2YC4A 2XONA 3THDA 2EIBA 2QQMA 2VO5A 3VDCA 1UZ0A 4ZZ8A 3VDAA 2Y6LA 2JDAA 4ZY9A 4A42A 2W91A 5B4XA 3T09A 2VZVA 4QX0A 4XVHA 5JUVA 3K4DA 1JYXA 1JZ7A 3K77A 3DYMA 4ZXEA 4AAXA 5IHRA 3I2IA 2OKXA 3D3AA 4KI5M 3LEKA 1GOGA 1JU3A 2WUHA 3HN3A 1UY2A 3FHAA 1WKYA 3HOBA 2QQJA 1UXZA 3MBWA 5C70A 2QQIA 4ARYA 1R64A 3T2OA 5JMOA 3NJVA 3WSOA 4M4PA 1JZ2A 1XC6A 2W92A 5J1XA 1NX9A 1W9TA 4P02B 1F4AA 4ET7A 2R7EB 5LCWL 2WZEA 2HYXA 1CIYA 4Z2AA 3J7HA 2WABA 1UXXX 4AG4A 4UAPA 3CZUA 4DEVA 2E32A 2BGPA 3C7GA 4MO3M 3K46A 4CU6A 1US3A 3HNBM 1GUIA 1UMHA 4QB1A 4UI9L 2W1UA 3VDBA 3UESA 4QB2A 2C26A 1GQPA 2VCAA 4QDRA 2W87A 1J84A 1JI6A 3CZJA 3LEGA 2C9KA 1DYOA 3WNKA 1BHGA 2W95A 4DUXA 2EIEA 2J1EA 4M4RA 5EJZB 1GOHA 5JXHA 2VZSA 4HG6B 1I5PA 1EUTA 1UY4A 3NNGA 3I97A 4E8CA 2ID4A 4RN5A 3OBAA 2WN3A 2ZEYA 4PQQA 4P08A 3GM8A 3OG2A 4MOAA 3NQHA 3A7QA 2JD9A 4A41A 2B9VA 3W5NA 3LPFA 4P00B 1UMIA 1W9WA 2W1SA 1H6XA 4P5YA 1NUKA 3ZM8A 4OYUA 4FI9A 1DP0A 2W46A 3C8XA 3EYPA 3GDBA 4QX1A 2VCBA 5LA0A 1UYYA 2WO2A 3LE0A 4XURA 3I3BA 4GWJA 2VMCA 1UX7A 5B4NA 2DDUA 4JKKA 5I0DA 2WBKA 3ACHA 4DUVA 2WZ8A 1OD3A 2WQ8A 3WNNA 2WN2A 3CIHA 5JXJA 2E31A 3E1F1 2C4XA 2YFZA 3F2ZA 3I2GA 1JYVA 2J1SA 2WO3A 1JZ8A 1JZ6A 3WF3A 3LEIA 1UYXA 4LQRA 4CUAA 4XUTA 4KWUA 3VD5A 3VD7A 2VM9A 1W9SA 2WO1A 2WAAA 2BERA 4XUPA 2ZEZA 3AC0A 2VMDA 2VQUA 1K12A 3IAQA 3I2HA 3VD3A 1UY0A 2VQTA 4CU7A 3LPGA 3ETPA 1OT5A 4JKLA 4IUGA 2VZOA 3T2PA 2VR4A 1KEXA 2W1QA 3VD9A 1NKGA 4JX0A 1K42A 1KGYA 2VJXA 4A44A 1JZ4A 3HPNA 1MPXA 4YPJA 4KMQA 2WYSA 3OGRA 2B4KA 4D0QA 4W50A 1JYNA 3HNYM 5EJ1B 3WNOA 2ZEWA 3DYPA 4LHSA 4W8JA 3K4ZA 4MGSA 1GU3A 3WF0A 2V72A 1JYWA 4JKMA 5DQ0A 1CX1A 2CDPA 2VZ1A 3PUIA 3OEAA 3T0BA 1O8SA 3ACGA 1UY3A 4BK4A 5IYYA 1ULOA 5IFTA 1GMMA 2QQNA 3SKJE 2L9LA 3C7HA 3ACFA 1K45A 5HXMA 3C7EA 1JZ3A 2ZXQA 3C7OA 3JXSA 1PMHX 1PX3A 4CUBA 1TG7A 1T2XA 2Y6GA 2Y6JA 2ORXA 3A21A 1F4HA 5G05L 2WAOA 3WNPA 1D7PM 2BZDA 3VD4A 4W4ZA 3IAPA 2Z4FA 3FN9A 1TVGA 4XUOA 2LS6A 2QQLA 2HLEA 2Y8KA 1RYYA 2X09A 1CZSA 4E8DA 3WF2A 3CMGA 2QQOA 2ZEXA 4JHZA 2VZRA 2VTFA 3UNPA 1NAEA 2YB7A 4DXRA 2RV9A 2W3JA 2RVAA 3MV11 2VZ3A 3HNMA 2VZTA 5IFPA 1JZ5A 2VMEA 3A22A 4TTGA 2VCCA 3I3DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XUN A;  2QQK A;  2V5D A;  2Y6K A;  1K3I A;  2E26 A;  2CDO A;  5FUI A;  3NJX A;  2X05 A;  1SHW B;  2VMF A;  3A23 A;  1PX4 A;  3OGS A;  4BK5 A;  3I2J A;  4BJ0 A;  3K75 B;  1SG3 A;  3ECQ A;  4RYD A;  1US2 A;  1OF4 A;  4CU8 A;  1DLC A;  1OH4 A;  3WEZ A;  2YG0 A;  4L0P A;  4DUW A;  1UWW A;  3IDA A;  3BGA A;  4A45 A;  2VL4 A;  1GOF A;  1O59 A;  2VZQ A;  3LQC A;  3W5M A;  4QX3 A;  1UY1 A;  3MV0 1;  1JU4 A;  4OUE A;  3FHQ A;  2Y6H A;  3OGV A;  1JHJ A;  2J22 A;  3WNM A;  2XHN A;  4MGQ A;  2XQX A;  3SKV A;  3SEP A;  1OF3 A;  2J1A A;  2J1V A;  4DEQ A;  5JR2 A;  3CDZ B;  3T08 A;  2EID A;  2ORZ A;  2DCK A;  1CZV A;  3P6B A;  3THC A;  4QB6 A;  3WNL A;  4ZZ5 A;  3T0D A;  1W0N A;  4CU9 A;  3MUZ 1;  4QX2 A;  3C7F A;  3CQO A;  2XOM A;  1EUU A;  1XNT A;  4D8M A;  1SDD B;  4UOJ A;  2RJ2 A;  4LKS A;  5DPN A;  3CKH A;  2JKX A;  5DN2 A;  3I3E A;  5CYY A;  2VZP A;  1L7R A;  2EIC A;  3DEC A;  1IQD C;  4GZ9 A;  5JXG A;  1XNA A;  5EIY B;  5A1A A;  2KD7 A;  4GWI A;  5C71 A;  3I2K A;  2VC9 A;  3T2Q A;  3WQB A;  1H6Y A;  4QDS A;  4A6O A;  2J1U A;  3DYO A;  1CZT A;  4A3Z A;  5C7G A;  1YQ2 A;  2Y64 A;  1UYZ A;  4DXT A;  4PF1 A;  2BBA A;  1W8N A;  1XPW A;  2W5F A;  1W99 A;  2J1R A;  2VOT A;  2BGO A;  1PMJ X;  5G04 L;  3IB3 A;  5F7U A;  3T0A A;  2WDB A;  3MO4 A;  4BDV B;  2J1T A;  5HPO A;  2J7M A;  4TXW A;  3P1I A;  3GGL A;  3NRU A;  3OEB A;  4OMD A;  1W8O A;  4OMC A;  5LA2 A;  4ARX A;  2W9X A;  5JXI A;  3UET A;  2W94 A;  2QBX A;  4LPL A;  4BXS V;  4PT6 A;  3SEE A;  3WF1 A;  3FL7 A;  1O8P A;  4XUQ A;  3OB8 A;  1HN1 A;  3HEI A;  3K4A A;  3WF4 A;  4CVU A;  3MUY 1;  3III A;  4QDQ A;  4CUC A;  5DMY A;  2PQS A;  4XZU G;  2E33 A;  2JE8 A;  3GXU A;  1L7Q A;  2V4V A;  4MAD A;  3HJR A;  3PUH A;  3U37 A;  2YFU A;  5IJR A;  4A4A A;  1LNS A;  3EB7 A;  1WCQ A;  2LW8 A;  2YC2 A;  3BN6 A;  5LA1 A;  2X10 A;  1GNY A;  2VZU A;  3I2F A;  2W47 A;  4QAW A;  4OZO A;  5CZK A;  2DCJ A;  1P8J A;  3ABZ A;  4QPW A;  1ULP A;  3ACI A;  2W1W A;  4DXS A;  1J83 A;  2YC4 A;  2XON A;  3THD A;  2EIB A;  2QQM A;  2VO5 A;  3VDC A;  1UZ0 A;  4ZZ8 A;  3VDA A;  2Y6L A;  2JDA A;  4ZY9 A;  4A42 A;  2W91 A;  5B4X A;  3T09 A;  2VZV A;  4QX0 A;  4XVH A;  5JUV A;  3K4D A;  1JYX A;  1JZ7 A;  3K77 A;  3DYM A;  4ZXE A;  4AAX A;  5IHR A;  3I2I A;  2OKX A;  3D3A A;  4KI5 M;  3LEK A;  1GOG A;  1JU3 A;  2WUH A;  3HN3 A;  1UY2 A;  3FHA A;  1WKY A;  3HOB A;  2QQJ A;  1UXZ A;  3MBW A;  5C70 A;  2QQI A;  4ARY A;  1R64 A;  3T2O A;  5JMO A;  3NJV A;  3WSO A;  4M4P A;  1JZ2 A;  1XC6 A;  2W92 A;  5J1X A;  1NX9 A;  1W9T A;  4P02 B;  1F4A A;  4ET7 A;  2R7E B;  5LCW L;  2WZE A;  2HYX A;  1CIY A;  4Z2A A;  3J7H A;  2WAB A;  1UXX X;  4AG4 A;  4UAP A;  3CZU A;  4DEV A;  2E32 A;  2BGP A;  3C7G A;  4MO3 M;  3K46 A;  4CU6 A;  1US3 A;  3HNB M;  1GUI A;  1UMH A;  4QB1 A;  4UI9 L;  2W1U A;  3VDB A;  3UES A;  4QB2 A;  2C26 A;  1GQP A;  2VCA A;  4QDR A;  2W87 A;  1J84 A;  1JI6 A;  3CZJ A;  3LEG A;  2C9K A;  1DYO A;  3WNK A;  1BHG A;  2W95 A;  4DUX A;  2EIE A;  2J1E A;  4M4R A;  5EJZ B;  1GOH A;  5JXH A;  2VZS A;  4HG6 B;  1I5P A;  1EUT A;  1UY4 A;  3NNG A;  3I97 A;  4E8C A;  2ID4 A;  4RN5 A;  3OBA A;  2WN3 A;  2ZEY A;  4PQQ A;  4P08 A;  3GM8 A;  3OG2 A;  4MOA A;  3NQH A;  3A7Q A;  2JD9 A;  4A41 A;  2B9V A;  3W5N A;  3LPF A;  4P00 B;  1UMI A;  1W9W A;  2W1S A;  1H6X A;  4P5Y A;  1NUK A;  3ZM8 A;  4OYU A;  4FI9 A;  1DP0 A;  2W46 A;  3C8X A;  3EYP A;  3GDB A;  4QX1 A;  2VCB A;  5LA0 A;  1UYY A;  2WO2 A;  3LE0 A;  4XUR A;  3I3B A;  4GWJ A;  2VMC A;  1UX7 A;  5B4N A;  2DDU A;  4JKK A;  5I0D A;  2WBK A;  3ACH A;  4DUV A;  2WZ8 A;  1OD3 A;  2WQ8 A;  3WNN A;  2WN2 A;  3CIH A;  5JXJ A;  2E31 A;  3E1F 1;  2C4X A;  2YFZ A;  3F2Z A;  3I2G A;  1JYV A;  2J1S A;  2WO3 A;  1JZ8 A;  1JZ6 A;  3WF3 A;  3LEI A;  1UYX A;  4LQR A;  4CUA A;  4XUT A;  4KWU A;  3VD5 A;  3VD7 A;  2VM9 A;  1W9S A;  2WO1 A;  2WAA A;  2BER A;  4XUP A;  2ZEZ A;  3AC0 A;  2VMD A;  2VQU A;  1K12 A;  3IAQ A;  3I2H A;  3VD3 A;  1UY0 A;  2VQT A;  4CU7 A;  3LPG A;  3ETP A;  1OT5 A;  4JKL A;  4IUG A;  2VZO A;  3T2P A;  2VR4 A;  1KEX A;  2W1Q A;  3VD9 A;  1NKG A;  4JX0 A;  1K42 A;  1KGY A;  2VJX A;  4A44 A;  1JZ4 A;  3HPN A;  1MPX A;  4YPJ A;  4KMQ A;  2WYS A;  3OGR A;  2B4K A;  4D0Q A;  4W50 A;  1JYN A;  3HNY M;  5EJ1 B;  3WNO A;  2ZEW A;  3DYP A;  4LHS A;  4W8J A;  3K4Z A;  4MGS A;  1GU3 A;  3WF0 A;  2V72 A;  1JYW A;  4JKM A;  5DQ0 A;  1CX1 A;  2CDP A;  2VZ1 A;  3PUI A;  3OEA A;  3T0B A;  1O8S A;  3ACG A;  1UY3 A;  4BK4 A;  5IYY A;  1ULO A;  5IFT A;  1GMM A;  2QQN A;  3SKJ E;  2L9L A;  3C7H A;  3ACF A;  1K45 A;  5HXM A;  3C7E A;  1JZ3 A;  2ZXQ A;  3C7O A;  3JXS A;  1PMH X;  1PX3 A;  4CUB A;  1TG7 A;  1T2X A;  2Y6G A;  2Y6J A;  2ORX A;  3A21 A;  1F4H A;  5G05 L;  2WAO A;  3WNP A;  1D7P M;  2BZD A;  3VD4 A;  4W4Z A;  3IAP A;  2Z4F A;  3FN9 A;  1TVG A;  4XUO A;  2LS6 A;  2QQL A;  2HLE A;  2Y8K A;  1RYY A;  2X09 A;  1CZS A;  4E8D A;  3WF2 A;  3CMG A;  2QQO A;  2ZEX A;  4JHZ A;  2VZR A;  2VTF A;  3UNP A;  1NAE A;  2YB7 A;  4DXR A;  2RV9 A;  2W3J A;  2RVA A;  3MV1 1;  2VZ3 A;  3HNM A;  2VZT A;  5IFP A;  1JZ5 A;  2VME A;  3A22 A;  4TTG A;  2VCC A;  3I3D A; 
#chains in the Genus database with same CATH topology
 5FLI A;  1Y3T A;  4XUN A;  3WLU A;  4HFS A;  4N7U A;  1W6Q A;  3ZFF B;  3D8C A;  5J37 A;  3HWJ A;  2BYV E;  3M3O A;  3WQ7 A;  3ZYG A;  1O3S A;  1R08 3;  4OUS A;  5L7O C;  2EF6 A;  4NAM A;  3WDT A;  3PUQ A;  4Q4X 3;  5E16 A;  2VH9 A;  5DAX A;  4XC9 A;  3MPP G;  3OGS A;  2XLF A;  3I2J A;  4XJW A;  3ZDV A;  2Q4S A;  1I3H A;  1SG3 A;  3ECQ A;  3AKR A;  1Z7S 3;  5EZW A;  2VW1 A;  1DLC A;  4MV2 A;  1JOB A;  2YG0 A;  1DZQ A;  5M0T A;  1YUD A;  2PLV 2;  4IGO A;  4CDW A;  2EXJ A;  4Y5S A;  2RDR A;  2WWJ A;  3BGA A;  3H3L A;  1WGP A;  1YXW A;  2HWB 2;  2PYT A;  2X5I C;  4GAL A;  2ARE A;  5EJ3 A;  3RMY A;  5BXX A;  1K5M B;  2ZHN A;  4QX3 A;  3BIE A;  1JUH A;  1J58 A;  5E8A A;  4YZ3 A;  5I8Y A;  5IK4 A;  3UKN A;  4QPG B;  1NE4 A;  1TME 1;  4HMZ A;  3LDK A;  4AVB A;  3FHQ A;  2Y6H A;  5FZ1 A;  3KLS A;  1BBT 2;  2J22 A;  2JD4 A;  2F6B A;  4UFI A;  1ZZ8 A;  3KGZ A;  5FO9 B;  4GJY A;  2J1A A;  1U12 A;  2NYY A;  4CCN A;  1RIT A;  4Q0S A;  2P6C A;  2O14 A;  3LIH A;  1R09 3;  1E5R A;  2QZ3 A;  2EID A;  1LB2 A;  3I4I A;  2JIG A;  2YU2 A;  4FCA A;  3THC A;  4LTA A;  1NZI A;  3AZY A;  5FXV A;  5ACA 3;  1COV 3;  2XJQ A;  4YVS B;  4OHY A;  2D5F A;  2R07 3;  1W0N A;  4ES9 A;  3MZH A;  3BKZ A;  1GP6 A;  4PLN A;  5FQ0 A;  1PNG A;  3UJQ A;  3C7F A;  1QQP 1;  2WZP P;  3IPV B;  3AKP A;  4Q1P A;  4D8M A;  1SDD B;  4O65 A;  3WV6 A;  1PO1 3;  3F95 A;  3NV4 A;  5DPN A;  3CKH A;  4Y1X A;  2VUL A;  2JKX A;  2XJV A;  1HQW A;  4BOW A;  4PLM A;  3H1M A;  4KWJ A;  2JDN A;  5KR7 A;  4OUM A;  4YW4 A;  3AP4 A;  1W2U A;  1RUJ 2;  4K8F A;  4RR3 A;  5CEH A;  3E6D A;  4HPK A;  1AR9 2;  1RXG A;  2CNA A;  4HKW A;  5FPZ A;  1ZRD A;  3O1O A;  1X33 A;  2XR4 A;  1RB8 G;  2VQA A;  2ZMK A;  4HN1 A;  1QJZ A;  1VRH 1;  3GHM A;  4KBB A;  4LKF A;  1KFU L;  1XNA A;  5A1A A;  2KD7 A;  1YEW A;  1RHI 1;  5JI7 A;  4LO5 B;  3CHX A;  2V73 A;  3WQB A;  2FMD A;  3JQX A;  4A6O A;  4FPC A;  4DB5 A;  1SLL A;  1H2L A;  1UZZ A;  3B93 A;  1RUF 3;  4YFW A;  1PIV 3;  1SQ4 A;  5FXZ A;  4NRP A;  1UYZ A;  4DXT A;  2OQ6 A;  1AR7 3;  1WLC A;  5FYS A;  3H8R A;  4NR1 A;  4JVA A;  1CJD A;  3ZFG A;  4RQP A;  1U0A A;  2XKP A;  3MLJ A;  1QY4 A;  1HW5 A;  1V6J A;  3ZN4 A;  3ZXA C;  1RUN A;  4AQT A;  4P9X A;  5F7U A;  2WDB A;  2YHJ A;  5HPO A;  3VBO A;  2A6Y A;  4GQ7 A;  2J7M A;  3WG1 A;  4C8D A;  1OFS A;  3A4U A;  1OFN A;  3J7L A;  4KU8 A;  1ULC A;  4MH0 E;  1Z7S 1;  3P1I A;  1OPM A;  4KU7 A;  1FOD 3;  3OEB A;  4OMD A;  4RR3 C;  5FYV A;  5FZ7 A;  2YYO A;  1DFQ A;  1SBE A;  4OMC A;  1OVP A;  1ZRC A;  5ABJ B;  1SCS A;  2C5D A;  4AEJ A;  3M3Q A;  1B35 A;  5LA9 A;  3T4V A;  4L99 A;  2DCY A;  4CDX C;  3JBG 3;  4XYX A;  2IZW A;  1BCX A;  2WNV A;  2PHD A;  2VW2 A;  3NMB A;  1GLH A;  1O8P A;  1ZRI A;  3H8U A;  4XHX A;  3POW A;  4A6S A;  5CFC A;  1UL9 A;  4GA9 A;  1FMD 2;  3I2D A;  3ZKY A;  1Y4W A;  4XF4 A;  1SPP B;  3TEZ A;  3BI3 A;  4LO6 B;  2QDR A;  2VW0 A;  1AR6 2;  3LSD A;  5FBJ A;  2OS2 A;  2ZGU A;  3WX5 A;  5JPM B;  4AFA A;  1R09 1;  4QDQ A;  4QPI A;  3ZFG C;  4FXG B;  4IEY A;  3ROU A;  4DQA A;  2OPK A;  4BQ5 A;  5DMY A;  3L2Y A;  1S1A A;  4XZU G;  5FY8 A;  5IW0 A;  5ACA 1;  1COV 1;  2HWC 3;  2JE8 A;  2OUH A;  4UWD A;  2V4V A;  5A32 A;  1RGS A;  1CIW A;  3H3U A;  1OC1 A;  3PUH A;  3U37 A;  4Y5T A;  3VBO C;  1Q43 A;  3MF9 A;  3D82 A;  3OPZ A;  5IJR A;  4AWD A;  1ODN A;  3P3P A;  5FWE A;  4PIY A;  3THP A;  3O1U A;  1LNS A;  1PO1 1;  5FMO S;  2LW8 A;  3J26 N;  5LA1 A;  1O4Y A;  3BU7 A;  1IPS A;  3WZ1 A;  2X10 A;  1GNY A;  3I2F A;  4XIL A;  4DY3 A;  1P8J A;  1BJQ A;  1L7L A;  1B35 C;  4BIS A;  1ULP A;  4Q5O A;  3J7M A;  2FCV A;  5FY5 A;  4EN7 B;  1CAW A;  1GQH A;  2BJS A;  2R06 2;  3MW2 A;  2OPW A;  2YC4 A;  2OVU A;  2WNV C;  1YQC A;  3H3Z A;  3N35 A;  4IV3 A;  4JDN A;  2WZR 3;  4WVM A;  4C90 A;  2EIB A;  5L36 A;  2R1D A;  2XLA A;  3LB9 A;  2HWE 2;  5BPX A;  3P5B A;  2VEC A;  4FFF A;  4XJA A;  3VKM A;  5AFE A;  5GZD A;  3TYJ A;  1UZ0 A;  5CFC C;  3CBN A;  3B9C A;  1W8H A;  3JD7 2;  5AVP A;  4AFB A;  4QHO A;  4AVA A;  5BYN A;  2OA2 A;  5CFD B;  3VBS A;  2W91 A;  3T09 A;  2QFE A;  2AYH A;  4XVH A;  4F83 A;  3RS6 A;  3SH3 A;  4AAP A;  3QCW A;  5ANN A;  4R4Z A;  2JDY A;  4KBZ A;  1PIV 1;  3IIA A;  3K3N A;  3IDC B;  3O0W A;  4JGZ C;  2UYA A;  3FUQ A;  4IEV A;  1RIR A;  3C3V A;  3PLQ A;  1AR7 1;  2VNO A;  4XFH A;  4NHX A;  1VAL A;  4Y3O A;  1DDL A;  3Q8B A;  2DVG A;  3HN3 A;  3FHA A;  4DS0 A;  1UXZ A;  2P37 A;  3MBW A;  1ND3 B;  1IKQ A;  2QQI A;  4ARY A;  4LXL A;  5A7O A;  2ZGN A;  3V0B A;  5A33 B;  1GZC A;  2PLV 3;  3PJY A;  3PTR B;  5DUX A;  4Z07 A;  1Y9Q A;  4JCK A;  5A70 A;  4M4P A;  1ACC A;  2D6L X;  2IXI A;  5FJK A;  1XC6 A;  2IXJ A;  1FOD 1;  3NST A;  4NAO A;  4ZU4 A;  2VCM A;  1E5S A;  4PIZ A;  5DAP A;  2IFR A;  1VLN A;  1YFW A;  1RVF 1;  5F6K A;  1CIY A;  1S0E A;  4ORF A;  3JBG 1;  4G3Y C;  4CRQ A;  2DCZ A;  2OZJ A;  4Q0U A;  1MAC A;  2ZHK A;  1ZZC A;  3LA7 A;  1D2S A;  4QXC A;  4UAP A;  1TNF A;  3CZU A;  1W8Z A;  4MYE A;  4FAH A;  3TN9 1;  2B7Y A;  3ZMN A;  4AHZ A;  1UU6 A;  5F8P A;  3K46 A;  3AJZ A;  4RFT 0;  1QJU 2;  1US3 A;  1MS0 A;  2V5Y A;  5TSW A;  4FPG A;  1SFN A;  3DKW A;  3CU7 A;  1GUI A;  1T6G C;  1QKQ A;  1UMH A;  1WA6 X;  4YW5 A;  4PI2 A;  1AYM 2;  1J3P A;  1F35 A;  4XJZ A;  4RSU A;  3UES A;  4H7M A;  4QB2 A;  3ZSK A;  3JUU A;  4S2H A;  1W2N A;  4QDR A;  2K2S A;  3VL9 A;  1UKG A;  4L92 A;  5C9A B;  1NCQ C;  3B00 A;  3POJ A;  2F4P A;  2HWC 1;  4LBO A;  1N1T A;  3B69 A;  3V56 A;  4QHZ A;  4QM8 A;  2C9K A;  2LRO A;  3K48 A;  5JOZ A;  4QPI B;  5FBZ A;  4XQ4 A;  2N7G A;  3RYK A;  4UF0 B;  3KQR A;  5A7W A;  2Y60 A;  3KF3 A;  1RUJ 3;  4OI4 A;  4Q4V 2;  4UT5 A;  1AR9 3;  3M8L A;  4GXL A;  2VZS A;  4HG6 B;  4UFH A;  3WW2 A;  4Z1V A;  2DUR A;  1I5P A;  4B1L A;  4JGY A;  3Q9O A;  4W6W A;  4Y4R A;  5EYY A;  1UY4 A;  1AR8 2;  2CGP A;  2KA3 A;  4RN5 A;  3OBA A;  5CG9 A;  1PO2 2;  2Q1Z B;  2VVE A;  2ZEY A;  2BOI A;  2A70 A;  1Q56 A;  2D3R A;  3BPS A;  5T3N A;  4NJ4 A;  3WIN E;  2WZR 1;  3OG2 A;  4P9I A;  3JCI A;  3OGG A;  2RMU 2;  5IUQ A;  4A41 A;  1UMZ A;  3POY A;  4MLO A;  4MZU A;  3RJR A;  3W5N A;  1W05 A;  1PK6 A;  3LPF A;  4PLO A;  4D94 A;  1DZR A;  3LFM A;  3KT4 A;  4XOG A;  4P5Y A;  3GNE A;  1NUK A;  4H2A A;  4LBQ A;  4OYU A;  2WQ4 A;  1YJL A;  3VKF C;  3C8X A;  2C0Z A;  4ARX A;  5FZO B;  1RED A;  2C6S A;  1JTZ X;  1TEI A;  2ET1 A;  1UCX A;  2MHF A;  4WM7 A;  1NCR A;  3VZK A;  1NG0 A;  5C3O A;  1YO8 A;  2VUA A;  3DXT A;  3AVR A;  2WA4 A;  3LE0 A;  4LHN A;  2ZTN A;  1J1L A;  1T6B X;  4IEO A;  3I3B A;  2NP0 A;  1UX7 A;  2FZ1 A;  1Q8P A;  2NPI A;  4GUL A;  1WLD A;  5EWS A;  2YZ4 A;  4JKK A;  2WBK A;  5FP3 A;  5GLW A;  1MS9 A;  4LA2 A;  1GBG A;  2WN2 A;  3CIH A;  1VBA 2;  4Q0V A;  2YPD A;  3VKL A;  2PLV 1;  1KFX L;  1QU0 A;  2QKD A;  3I2G A;  4KG8 A;  3ZIW A;  2XJT A;  4QT6 A;  1VB2 A;  1Q8Q A;  2HWB 1;  3S0M A;  4AQS A;  4BQ2 A;  1XNK A;  2J42 A;  4XUT A;  3ILR A;  4IEQ A;  1QJE A;  1YIP A;  3WVJ A;  3H42 B;  3O1V A;  2RS1 2;  1VP6 A;  1I9R A;  2VM9 A;  3R4U A;  2WO1 A;  2JEC A;  3OGJ A;  1DYP A;  1PK6 C;  2DUO A;  4E9K A;  1DYK A;  1BBT 1;  2ZEZ A;  5KC6 A;  1FMD 3;  5FLH A;  1LOF A;  3I2H A;  3VLB B;  4BU2 A;  1AXY A;  3MIC A;  1UY0 A;  4QGN A;  5FPX A;  4YGB A;  4CU7 A;  4CDQ A;  4MXW A;  5J7M A;  1AR6 3;  1HQN A;  3LPG A;  4K7J A;  3OYW A;  3PIG A;  4XW3 A;  4YVW B;  2Q0A A;  4TZD A;  2VUJ A;  3NO8 A;  4WM7 C;  3PVB B;  1ULF A;  3D5O A;  3U78 A;  1LKN A;  4B8E A;  1RMU 1;  3OTF A;  4BQ1 A;  1W03 A;  2W1Q A;  4OI2 A;  1AYN 2;  2RDS A;  3VD9 A;  4JX0 A;  4OZX A;  4XFB A;  1WCK A;  1KGY A;  3OCP A;  3ZSJ A;  3MIH A;  2VJX A;  5K0U A;  1KIT A;  3WG3 A;  3HPN A;  2EXH A;  1WCU A;  5C5T A;  4BQ3 A;  3ETQ A;  3WW3 A;  2ERF A;  3URF A;  3ZSM A;  4R9A A;  1ULG A;  5LK7 B;  2GNT A;  3WNO A;  4XAE A;  2ES3 A;  1KJL A;  1SFP A;  1RUJ 1;  4XDP A;  4LHS A;  1AR9 1;  2HWF 2;  4EN0 A;  3E97 A;  5A7N A;  3N9M A;  3VZN A;  3VDD B;  5LK5 A;  3WDU A;  1CJP A;  2HWE 3;  2ZZQ A;  5FYT A;  5FOJ B;  2V72 A;  5DQ0 A;  2BVB A;  2G9G A;  5A7Q A;  3UGF A;  3JD7 3;  1IOA A;  4I3P A;  4LK6 A;  3ZR5 A;  5AC9 2;  1IPK A;  4AFM A;  1CGP A;  3H7J A;  2GMP A;  2R1B A;  3PVE A;  4CDQ C;  5FPL A;  5EQU A;  2WII B;  3MHZ A;  2PN5 A;  1O3R A;  5EPA A;  5IAT A;  3WG4 A;  4BK4 A;  3ILF A;  4YW2 A;  2Q30 A;  4M0H A;  1ULO A;  5IFT A;  1OLR A;  3AP5 A;  1HN0 A;  4JDM A;  5BNO C;  3D0J A;  5FUN A;  4WV8 A;  4M3C F;  2WNU A;  1VRB A;  2RR1 3;  2BGC A;  1WLT A;  4N53 B;  4QX7 A;  1WME A;  3PUA A;  4CCC A;  1RUE 2;  2FDJ A;  3GBG A;  5K0U C;  4IEU A;  3C7H A;  2C9A A;  4AVT A;  2Z42 A;  4HN0 A;  2IXC A;  2VBB A;  4LNV A;  4R4X A;  5C33 A;  4FFI A;  4LUL A;  2ARB A;  2FDK A;  2Y34 A;  4KGQ A;  2ZGQ A;  1RJ7 A;  1JZ3 A;  2VD7 A;  4LOS A;  1H8T B;  1WW5 A;  4Y24 A;  4D7S A;  1G6N A;  1F2N A;  1WBL A;  5FYB A;  4RHV 2;  3SNM A;  3T1L A;  2Y26 A;  2VVD A;  2ZXQ A;  4FPF A;  2HEV F;  1NXD 1;  4COW A;  4Y4Y A;  1X7N A;  4CUB A;  2HEW F;  4EV0 A;  3FUO A;  1SDW A;  4Y5Z 0;  1W2O A;  5FZD A;  2HBU A;  3WDW A;  1W6M A;  1J59 A;  3DGT A;  4DPN A;  2ZS6 B;  1T2X A;  3POF A;  4OHW A;  2IFW A;  2Y6J A;  1NE6 A;  2ORX A;  4URT A;  4XF1 A;  4Y22 B;  3ENR A;  5A3O A;  5FDB A;  2ZX0 A;  3KSC A;  1L3J A;  5FYZ A;  4W4Z A;  3IAP A;  4C0B A;  1OD5 A;  1IS5 A;  1Q8S A;  5JR7 B;  1DBN A;  2Z4F A;  3HQX A;  4HON A;  3FX3 A;  1QJU 3;  5FKB A;  1ODM A;  1UZV A;  3GHN A;  4HK8 A;  1OHF A;  3FN9 A;  1FMD 1;  1XE0 A;  3OUH A;  4CCO A;  3E6C C;  1HIX A;  5A6Q A;  2YDE A;  1AYM 3;  2WNU C;  2QQL A;  3AP9 A;  1AR6 1;  4V2V A;  3TRS B;  1RYY A;  4XEZ A;  3THT A;  3ZDS A;  5T54 A;  2JG9 A;  4I0W B;  3QLQ A;  5I8T A;  3CMG A;  4FBF A;  1JHN A;  5CKM A;  1N1V A;  4LIT A;  2GSY A;  2VZR A;  1AX2 A;  2A73 B;  1UOF A;  1S0D A;  1LED A;  1EP0 A;  2BP6 A;  3POI A;  3ZXD A;  1LOC A;  3A0K A;  3AMH A;  4JC1 A;  1OKQ A;  4DXR A;  2FDG A;  2W3J A;  3INA A;  1GZ9 A;  3MV1 1;  3TAY A;  1A34 A;  2JIC A;  4XTM A;  1IGO A;  2H6B A;  3DUI A;  4Q26 A;  4Q4V 3;  1WCS A;  5I0T A;  4LO8 A;  3G6J B;  4IGP A;  5CNA A;  2V5D A;  2Y6K A;  4XFG A;  1AR8 3;  1WW7 A;  2V09 A;  2NM1 A;  3BVC A;  3H0O A;  4QQ2 A;  3U07 A;  1PO2 3;  5FPU A;  4Y20 B;  5CB7 A;  2R06 1;  1QOS A;  4O9G A;  5CKQ A;  4IER A;  2CDO A;  1G86 A;  3I2O A;  5LW9 A;  3A23 A;  4D69 A;  2RMU 3;  4LO4 B;  4CEY A;  2ADD A;  2E9Q A;  2JB8 A;  4JV4 A;  1MS5 A;  2YGM A;  1LRH A;  5IAX A;  2RM2 2;  3JD7 1;  4RYD A;  4XFI A;  1HKD A;  2D40 A;  2UY9 A;  2FZ2 A;  2JJ6 A;  2ZX1 A;  3V0A A;  4CU8 A;  2GAL A;  1KJR A;  2A6V A;  4DUW A;  2DV9 A;  1N47 A;  4QU1 A;  4CA9 A;  1UWW A;  5KHJ A;  3IMN A;  1GNZ A;  3IDA A;  1QJY 2;  1SLB A;  4YGE A;  1LU1 A;  1O59 A;  1XND A;  3NNL A;  3LQC A;  4A3X A;  4QGM A;  4O7X A;  3W5M A;  2WL1 A;  4DOU A;  1QXR A;  4CDU B;  2CGN A;  4IE4 A;  4HLT A;  5IVF A;  1XB9 A;  2C24 A;  1OA4 A;  2RS3 2;  3KHB A;  4PBP A;  3SC7 X;  4X6R B;  1RUH 3;  4FOV A;  4CCK A;  4OUE A;  3W9A A;  1JHJ A;  1OH3 A;  2JX9 A;  2MEV 3;  2WWU A;  2XHN A;  4MGQ A;  4N43 C;  2EAK A;  3PVO A;  2XXZ A;  2LUW A;  3ZN6 A;  1F9K A;  1VBA 3;  2HH9 A;  5LBC A;  4QQP A;  5CG8 A;  1IS3 A;  4AYU A;  3POE A;  2DCK A;  5CU1 A;  1H2K A;  3WP4 A;  2QJV A;  2WSV A;  4AED A;  4K8R B;  2A75 A;  3J8F 2;  3T0D A;  3VZO A;  4CU9 A;  2RS1 3;  5FRA A;  4CEY C;  4QX2 A;  2BNM A;  2MPF A;  3CQO A;  3S30 A;  2XOM A;  2AEN A;  4ZS3 A;  5F5A A;  3AKT A;  4UOJ A;  3J7N A;  3NV2 A;  1CAU B;  1XNB A;  5KXB A;  1OA3 A;  3KCY A;  2ZOE B;  1ZX5 A;  2YXS A;  3SXW A;  4DNY A;  4IE0 A;  5DAB A;  1GZW A;  3BUC A;  3I3E A;  1AXK A;  1QJU 1;  1CX4 A;  4W65 A;  5CYY A;  4GH4 B;  4JRA A;  3B94 A;  3CJI B;  3OUI A;  5F3G A;  4R52 A;  2YPJ A;  2EIC A;  2YC0 A;  3DEC A;  4Q4W 2;  3ZFE A;  5A3L A;  1AYM 1;  1IQD C;  4GIQ A;  4NHM A;  4EE2 A;  1EV1 2;  1GWK A;  4SLI A;  3RGB A;  3ES4 A;  1NOV A;  4PCR A;  4Y1Z A;  3VBF C;  4EWA A;  1A78 A;  5FZ8 A;  4QKB A;  2A7A A;  3DXU A;  1WUV A;  1REE A;  4M3C B;  1SEF A;  2Q8E A;  5C4W A;  3T2Q A;  5IVB A;  1H6Y A;  1J1T A;  1GAN A;  2VMI A;  3KM5 A;  2J1U A;  1X8E A;  3FZ3 A;  4IE7 A;  5C8C B;  5I0R A;  5JCT A;  2JG9 B;  2OT7 A;  4PF5 A;  5C7G A;  1S0G A;  2Y6F A;  1GWM A;  4AED C;  4FOW A;  2Y64 A;  4Q4V 1;  1DG6 A;  4Z92 B;  1S0F A;  1XPW A;  2W5F A;  1W99 A;  2J1R A;  1PMI A;  1W90 A;  2QCS B;  2VOT A;  3SLI A;  4I01 A;  5JZG B;  5D8A C;  1AR8 1;  4W6X A;  3LKJ A;  5ANQ A;  1W2T A;  3ZFF C;  1VBB 1;  2BNO A;  2RDN A;  1LOD A;  4LBM A;  4TSV A;  4A7K A;  5AC9 3;  5L7O A;  1OPO A;  3BU0 A;  5KBF A;  2W2I A;  3CO2 A;  4XJ8 A;  1APN A;  2OXB A;  1MZ5 A;  2RMU 1;  3MO4 A;  3O14 A;  4YFZ A;  3UGG A;  1HQL A;  3M3E A;  1RUC 3;  5BNP B;  4TXW A;  4XXP A;  1ULE A;  1A8M A;  1ZBA 2;  5CA6 A;  4O61 A;  1MVQ A;  2PHL A;  1NYW A;  3GGL A;  3SIS A;  4O9E A;  1W8O A;  1H9W A;  5T5J A;  3M1H A;  5LA2 A;  2RJL A;  4IES A;  1V9U 1;  3BAL A;  3IDE A;  1WLW A;  4M00 A;  2W9X A;  5FYI A;  2A6W A;  5FZM A;  3N4M A;  3UET A;  5CIS A;  2W94 A;  3N7J A;  2JDH A;  3HIF A;  5BUV A;  1RUE 3;  1BK1 A;  2QBX A;  4BXS V;  4LE4 A;  1BVP 1;  4YRD A;  4F8A A;  5BY5 A;  5I91 A;  3RZM A;  2JG8 B;  5F1R A;  4PT6 A;  5C4W C;  3GCX A;  5FYU A;  1UKR A;  5GZG A;  4BA6 A;  4P9L A;  2AR6 A;  3X29 B;  4Q29 A;  3VBU A;  4XUQ A;  2IVJ A;  4EN9 B;  2BUK A;  4C1W A;  2WS9 2;  4JZR A;  5D21 A;  4U36 A;  5GLZ A;  2D6P A;  3ZLI A;  4J1X A;  5AVA A;  2ZAA A;  1VBA 1;  4CVU A;  3LF7 A;  4LOR A;  3ZSL A;  1AX1 A;  1U5X A;  2DUQ A;  3OF1 A;  4URA A;  1BKZ A;  1XBF A;  3DPR B;  4RS5 A;  2ZHM A;  3TB0 A;  5J48 A;  1L7Q A;  5KXD A;  2ARX A;  2RS1 1;  3ZYB A;  1YIF A;  2ATF A;  1ZBE 2;  1KDM A;  2DTY A;  1HJG A;  4IND A;  1VBE 1;  4GWN A;  1WCQ A;  1Y43 B;  3AVS A;  4WM8 B;  1DF0 A;  2GNB A;  2E7Q A;  2W47 A;  3S5Q A;  2DCJ A;  1H1A A;  3ABZ A;  3NAP A;  5FK8 A;  5HXV A;  1YCI A;  1OUR A;  1V0A A;  3MID A;  1MQT B;  5FY9 A;  1NLS A;  1YWK A;  5F32 A;  1V00 A;  4DXS A;  3BTA A;  4QKD A;  1DLL A;  4K6B A;  5FMD A;  4BQY A;  2WFF 2;  2G9F A;  5FZC A;  4IDZ A;  1OUX A;  4BM8 A;  1AYN 1;  3VBU C;  2QQM A;  2UWC A;  5KWR A;  4CCL A;  4I02 A;  3MPB A;  5DUW A;  3I49 A;  1ZA7 A;  5DAW A;  3ZFE B;  4AHW A;  4IE6 A;  4XE9 A;  5HCB A;  4ZY9 A;  4XIK A;  3HVD A;  3VHN A;  4QX8 A;  2A6Z A;  5B4X A;  2VZV A;  3UL2 A;  1JZ7 A;  3ITQ A;  3K77 A;  4LBQ D;  2JB4 A;  4XBQ A;  3MIG A;  3DYM A;  1BXH A;  1XNC A;  4ZXE A;  4L97 A;  3TBD A;  4AAX A;  4RS5 C;  4FAG A;  3I2I A;  2I07 B;  2HWF 1;  5FYC A;  5I8S A;  3D3A A;  2A5Z A;  3VBR B;  1F8V A;  4KI5 M;  5SV8 A;  1E5I A;  2E53 A;  4CUG A;  2WUH A;  2OYZ A;  1UY2 A;  5AC9 1;  4EZ4 A;  2RM2 3;  2RE9 A;  5IAV A;  1D0G A;  3IT8 A;  5C70 A;  1XU2 A;  1C57 A;  2D43 A;  2ZGM A;  4BPZ A;  3RZH A;  2WT1 A;  1LHN A;  2P3Y A;  5JMO A;  5LEJ A;  3NAP C;  2CSG A;  3I59 B;  4Y33 A;  2XDV A;  1D4M 2;  1JH5 A;  1QJY 3;  4IV1 B;  4JHT A;  4XPV A;  3KT7 A;  5LBB A;  5J1X A;  3BYW A;  3QOP A;  1W6O A;  1H4H A;  1AXZ A;  1GNH A;  1PVC 2;  1W9T A;  3M2M A;  4P02 B;  3R6S A;  5LCW L;  2WZE A;  3E5X A;  3SHR A;  5ABJ C;  2RS3 3;  4YM0 A;  4D7T A;  1RXF A;  1RUE 1;  2QQP A;  4IW3 A;  4CDX A;  1UXX X;  2FCT A;  4UW6 A;  5FO7 B;  4BQW A;  4DEV A;  2WA3 A;  1UIJ A;  4ITC A;  4Z2W A;  2E32 A;  3C7G A;  1UX6 A;  4BLJ A;  2X5I B;  4RHV 1;  2A1X A;  2GMM A;  4HT1 T;  4E4S A;  2D97 A;  3AYC A;  1OKO A;  1RTV A;  3J8F 3;  2D3P A;  3TEW A;  4DO0 A;  2IXL A;  3AYA A;  3WUD A;  5JOX A;  1SZB A;  1HV1 A;  2VCA A;  1ZM1 A;  4FO9 A;  1R08 1;  1WBF A;  4J25 A;  3ZYP A;  1J84 A;  4E2S A;  4Q4X 1;  3CZJ A;  2VAU A;  1LTE A;  4LE3 A;  1IKP A;  2UU8 A;  5BNN C;  3WNK A;  1W6Q B;  2W95 A;  3WP6 A;  2D5H A;  1QNY A;  4NWV A;  2A6X A;  4ONU A;  4YM1 A;  1TE1 B;  4XMA A;  2J1E A;  4M4R A;  5EJZ B;  4A7Z A;  1JXN A;  5JXH A;  4Q4W 3;  3FLP A;  1X9T A;  3M4F A;  1EV1 3;  1XE7 A;  1PZ7 A;  1SCR A;  5J3U A;  1CR7 A;  4ISR A;  1W39 A;  2ID4 A;  1H0B A;  4ZPI A;  5IVE A;  1ENS A;  2FDI A;  1W04 A;  1W8U A;  4AEK A;  3QAC A;  2YMZ A;  4MOA A;  2CGO A;  3AP7 A;  1PHM A;  4CDW B;  2B9V A;  2DTW A;  3FWE A;  4NII A;  1YFY A;  2AZ5 A;  1HJF A;  1W9W A;  1D4V B;  2AC1 A;  1H6X A;  3KS7 A;  1S2B A;  3PTY A;  5A6Z A;  3ZM8 A;  1X36 A;  2BFU L;  2FBE A;  2UUR A;  4YG6 A;  3ZPY A;  4E4D X;  5D2A A;  5J36 A;  5HBA A;  2G9Z A;  2ZCW A;  1PGW 2;  4QX1 A;  4JGZ A;  4EJR A;  2FQP A;  4AI9 A;  3ELN A;  5H9P A;  5LA0 A;  2R07 1;  3OUJ A;  2D98 A;  2BVV A;  5A1L A;  4YG3 A;  3JQW A;  5B4N A;  4MET A;  4ATE A;  2PA7 A;  4FVV A;  3WR0 A;  2VQ0 A;  2RM2 1;  1ZBA 3;  2JE9 A;  2WZ8 A;  4HET A;  2QQU A;  3N3H A;  4GKY A;  5HCA A;  1PM7 A;  3B7M A;  1STM A;  4KWL A;  1MVE A;  1DQ4 A;  2YFZ A;  2DFC A;  2ZAH A;  3AXD A;  3F2Z A;  1RJ8 A;  3E1F 1;  4NVP A;  5FQ0 B;  5T5O A;  3ZKU A;  4AI3 A;  4UW4 A;  3PHM A;  2TBV A;  1QJY 1;  3LA2 A;  2WO3 A;  4H3W A;  3DF0 A;  1WCD J;  1QNW A;  1BQP A;  4P9W A;  1PGL 2;  4KWU A;  4K20 A;  3VD5 A;  4BCU A;  1GP5 A;  4P14 A;  3IBM A;  1JUI A;  1K5J A;  3HN1 A;  3ZYF A;  5IK5 A;  4AE2 A;  4XUP A;  3JB4 C;  3MW3 A;  2WS9 3;  2BW8 A;  4RR3 B;  1CN1 A;  5A7P A;  4HPK B;  3AC0 A;  3U14 A;  3WNX A;  1U5Z A;  4CCJ A;  4CXW A;  3IAQ A;  1REF A;  1VJ2 A;  1KDK A;  1S2K A;  2WLP A;  4PI0 A;  3S7E A;  3VD3 A;  2W39 A;  3SCG A;  4EN6 B;  2JDP A;  4AGG A;  4P5H A;  4XHB A;  4N8M A;  4AOC A;  3ETP A;  4XQW A;  1HX6 A;  1BVV A;  1RUF 1;  4CDX B;  2O8O A;  3A0N A;  2ZGS A;  1V6L A;  2VZO A;  3T2P A;  2DYC A;  3RI8 A;  1OOP A;  3RVH A;  2RR1 2;  3I3M A;  5IT6 A;  3J8F 1;  3WY6 A;  3SQO A;  4XCB A;  1NKG A;  1S0B A;  3O0V A;  3AZV A;  2IVI B;  3RDI A;  1ZBE 3;  1PZ9 A;  3W59 A;  1NCQ A;  1JZ4 A;  3ILN A;  2VU9 A;  2E7A A;  2JE7 A;  3PDQ A;  4S2G A;  2HYK A;  2CYF A;  4FTE A;  1RUI 2;  3ZFG B;  1JYN A;  4RQP B;  3HNY M;  4X8N A;  5IVV A;  2P2K A;  2P5B A;  4N9I A;  4Q4W 1;  4LKD A;  1VMH A;  4BZ4 A;  3KVA A;  2WFF 3;  1EV1 1;  3VBO B;  1W06 A;  4CYD A;  2ZPX A;  4GMP 3;  3QBQ A;  4XAB A;  4DFS A;  3AMN A;  4QQO A;  1W2A X;  1GU3 A;  3WF0 A;  1JYW A;  3APB A;  3P3N A;  2GN3 A;  1DQ6 A;  2CDP A;  2YUE A;  3ZO0 B;  2KR2 A;  4CZS A;  5BV6 A;  2ZX2 A;  1JOJ A;  3KCC A;  3OEA A;  1EPW A;  1YQ8 A;  1O8S A;  1B35 B;  2VY0 A;  3EMR A;  3VZL A;  1LOG A;  1MS4 A;  4X6Q B;  3AFG A;  1QIQ A;  4XXA A;  1GMM A;  2WNV B;  5K9Y A;  4B4Q A;  2QQN A;  1DQ0 A;  4TYS A;  1OOP C;  4BB3 A;  4MG2 A;  5L9B A;  4LJH A;  4ZHN A;  1DGR A;  3WUC A;  5FZH A;  5CFC B;  3V64 A;  2O8Q A;  1H9P A;  2O1Q A;  3AMP A;  3E5Q A;  1UPI A;  2BWC A;  5DXD A;  1C8M 2;  3AZZ A;  3ACF A;  4AFC A;  5FZB A;  1K45 A;  4FT8 A;  1D0H A;  1QDO A;  1LEC A;  2WWS A;  4CEW A;  5JAX A;  3PL0 A;  4LT5 A;  1ZRF A;  4MX3 A;  1D4M 3;  1VBC 2;  1ZBA 1;  3C7O A;  1UPS A;  4N9H A;  5FY0 A;  3MGU A;  3BB6 A;  1H4G A;  5A32 B;  4MXV A;  4F3J A;  1W6P A;  3RZJ A;  1PVC 3;  1BMV 2;  2LM3 A;  2BQP A;  3CL1 A;  4FQZ A;  3FFQ A;  1JBC A;  4YM3 A;  5FPV A;  1HV0 A;  2Y6G A;  1ALY A;  1ND2 C;  1NA1 A;  2XJU A;  3AX4 A;  3KT1 A;  5L19 A;  1CWP A;  4AVV A;  1R1A 2;  1F4H A;  2R30 A;  2D44 A;  2BV4 A;  4Q0P A;  2Y0O A;  1YLL A;  1WD4 A;  2WS9 1;  1CAW B;  4FPL A;  4IV3 B;  1XQN A;  2XBO 2;  1RUG 2;  4OQ9 A;  1KRI A;  4WVM B;  4E27 A;  2DFB A;  4DMI A;  5EP9 A;  4WBB A;  2HLE A;  4AEM A;  2H0V A;  3HBZ A;  1XYO A;  2XUE A;  4ZU5 A;  5CAD A;  3WF2 A;  4NN0 A;  2QQO A;  4YVW C;  1LOB A;  1GP4 A;  1UOJ A;  2ZEX A;  4FOY A;  5F5Q A;  3AKQ A;  4FPE A;  4Q4Y 2;  3VBS B;  2VTF A;  4PHZ A;  2OX0 A;  3UNP A;  3KB5 A;  1NAE A;  3N9P A;  1RUH 2;  2GC1 A;  3FC0 A;  2R04 2;  4M01 A;  4CEW C;  4XBN A;  1ZBE 1;  3HD8 B;  3AK0 A;  2RV9 A;  2YY1 A;  5FAX A;  2AEZ A;  4K9S A;  4GB3 2;  4LHL A;  2MEV 2;  3WG2 A;  1MZ6 A;  3FJS A;  3I3Q A;  3B5L B;  4XCA A;  4FPK A;  5FP4 A;  3A22 A;  1DGW X;  4JTO A;  2GC2 A;  3OD0 A;  4TTG A;  2XWB B;  1F5J A;  2ZA9 A;  2XLG A;  3VGI A;  2B8M A;  4D6Q A;  4AVS A;  5GJ6 A;  2XJP A;  5FJH A;  1NA1 C;  2E26 A;  1QDC A;  2PMW B;  2WFF 1;  5J09 A;  1U5Y A;  1O4Z A;  3KF5 A;  2VMF A;  3V0B B;  2W0X A;  1PX4 A;  3NJZ A;  4BK5 A;  1S0C A;  1YYN A;  5FYH A;  5L9V A;  4BJ0 A;  2WNO A;  3K75 B;  3FBY A;  3MYX A;  3N9O A;  1S0J A;  1ZRR A;  3ZIX A;  1OF4 A;  1QWR A;  4YZ5 A;  1OH4 A;  4L0P A;  4OLL A;  4PDW A;  1DU3 D;  3WW4 A;  1I6X A;  1TMF 3;  1SLI A;  4XJU A;  5BNO A;  1GOF A;  2VZQ A;  2YBS A;  4HXC A;  5GLU A;  4K40 A;  2B9U A;  2VXR A;  3CNA A;  1JS9 A;  1JU4 A;  4N53 C;  2GAU A;  3OGV A;  4S2D A;  3NW4 A;  2DVF A;  4A7Y A;  3LFI A;  1LHO A;  2WLQ A;  3SKV A;  1OF3 A;  1SMV A;  3SEP A;  4BLI A;  4DEQ A;  5A1F A;  3RZL A;  4IET A;  3ACL A;  3OY8 A;  5IVJ A;  1BLZ A;  3CDZ B;  5SV5 A;  2XG3 A;  4NUB A;  3T08 A;  2ORZ A;  1D4M 1;  3P6B A;  3RWN A;  1JYC A;  1FPN 2;  3WNL A;  1V6O A;  3DKQ A;  3GF6 A;  1PVC 1;  5FUP A;  3IM0 A;  5FY7 A;  5D8A B;  2BEO A;  1WA4 A;  1DGR N;  2D3S A;  5A7W B;  2W52 A;  2Q1M A;  1RC6 A;  3RJ2 X;  4GJZ A;  4RA0 A;  4JGY B;  2W68 A;  3UGH A;  2ENR A;  2HBT A;  1XOY A;  2GDF A;  1NQJ A;  1YFU A;  1RUC 2;  4PDW C;  5DN2 A;  4YW7 A;  4CP0 A;  5JLV A;  4MHU A;  1FXZ A;  5GKA C;  1BEV 2;  4P9Y A;  1V6M A;  2VZP A;  2Y0I A;  3LOI A;  5IWF A;  1L7R A;  2Z69 A;  5GLT A;  2GC3 A;  1O5U A;  5FZ0 A;  2GH8 A;  1WD3 A;  4LOT A;  2UWA A;  4GZ9 A;  4XFC A;  1SLA A;  1PK6 B;  1Z0H A;  5JPN B;  1X50 A;  4GWI A;  4PIX A;  1W3V A;  5GM0 A;  3VBH A;  4I2O A;  3QH7 A;  1AHS A;  3I2K A;  4XFF A;  1ENR A;  4LBQ B;  3GZU C;  2P6H A;  4QDS A;  3DYO A;  4MVT A;  1RUI 3;  1URX A;  4CP9 A;  3T2T A;  1UQX A;  1YRZ A;  2PHU A;  4QHB A;  4WM7 B;  1YQ2 A;  3R4S A;  1NCR B;  4B4P A;  2EIG A;  5CAZ A;  5F3C A;  4B1M A;  2BBA A;  2PHW A;  5FLJ A;  3K51 A;  3KV6 A;  4NHL A;  2WFP A;  1J3R A;  4HSL A;  1JYT A;  4NPM A;  5LAS A;  4QM9 A;  3NV1 A;  2TUN A;  4CP2 A;  5KXC A;  3U1X A;  5CVR A;  2AUY A;  2X53 S;  5LY2 A;  1ZRE A;  3T0A A;  3LCP A;  3I54 A;  4KL1 A;  2HEY F;  3T1M A;  4BDV B;  2ZKN A;  1F15 A;  2JXA A;  4YYO A;  1IS6 A;  4OQ8 A;  1DIW A;  2GH2 A;  2NMO A;  5FZ4 A;  3NRU A;  1LOE A;  4RGA A;  1VMJ A;  2BRT A;  1NLR A;  3QH6 A;  4JQR A;  4CXY A;  5DG2 A;  2GN7 A;  2AH2 A;  2VVF A;  3IMM A;  4I0B A;  2OZ6 A;  2VG9 A;  2R0H A;  1X9P A;  2IWG B;  2P3K A;  3DV8 A;  3UJO A;  5JXI A;  5F37 A;  4AHX A;  4RL7 A;  1PGW 1;  2OUJ A;  2RJK A;  4ZXK A;  3VBH C;  2DU1 A;  3RNS A;  1VB4 A;  2JDM A;  4QU2 A;  3RFR A;  1C8M 3;  1UU5 A;  2BU9 A;  3AZX A;  4WVZ A;  4MXW B;  4CDQ B;  5KHK A;  3HQU A;  4K21 A;  3DCQ A;  3SEE A;  3WF1 A;  3OYW B;  4CDU C;  2E51 A;  4JTN A;  3OB8 A;  1I1E A;  3LAG A;  3AL6 A;  1FYU A;  4E2G A;  1VBC 3;  4N43 A;  1HN1 A;  2OW4 A;  5FZK A;  5FYM A;  3WF4 A;  2EAL A;  4W6Y A;  1CPN A;  5DUU A;  4KGG A;  3GZE A;  5FMO L;  4NHY A;  1NLQ A;  4JAA A;  5K0U B;  4FSJ A;  5I0U A;  4BWO A;  4OUL A;  2PQS A;  1CAX A;  4ES8 A;  2XGX A;  1Q8O A;  2E33 A;  2NQY A;  1LGB A;  5FXX A;  1PGL 1;  1FX5 A;  4AR2 A;  1R1A 3;  2HWE 1;  3HJR A;  1AL2 3;  2YFU A;  2VTX A;  4LUM A;  4HVR A;  5FZ9 A;  3RQ0 A;  3CJX A;  1S2E A;  2CWS A;  5JVV A;  4CXX A;  1W9F A;  4G4F A;  1O91 A;  4HKL A;  2XBO 3;  1RUG 3;  4FXK B;  4Y1Y A;  5FK7 A;  1KS5 A;  1V6I A;  2Q5T A;  3ATG A;  4QAW A;  5A3U A;  5CZK A;  1UYP A;  2YGL A;  1NXM A;  3AJY A;  4YSF A;  3ACI A;  2W1W A;  3MEP A;  4GH4 C;  1DGW A;  1VMF A;  3CJI C;  2XON A;  3THD A;  1O3Q A;  3AKS A;  4Q4Y 3;  2RR1 1;  4XZP A;  1VIW B;  3VBF A;  2VO5 A;  2R04 3;  3GCW A;  2P17 A;  3KZ4 C;  3ST7 A;  4Z8B A;  1ENX A;  1LGN A;  3AFK A;  3VDA A;  2Y6L A;  3FLT A;  2GND A;  3NNJ A;  4GB3 3;  4UW5 A;  2JDA A;  1FT9 A;  1O6U A;  2WNU B;  4MUV A;  5FP9 A;  3H9A A;  1Y7B A;  4IEW A;  4QMA A;  3O1P A;  3H8X A;  4QX0 A;  1RUI 1;  1N3O A;  1XYP A;  1JYX A;  1YQ5 A;  3U10 A;  1MZF A;  1G9B A;  4XTP A;  4WVV A;  5IVC A;  5FRE A;  5IHR A;  3RZK A;  2CV6 A;  1B09 A;  2VNG A;  3ORJ A;  2NZ9 A;  2F17 A;  5D8A A;  1C5H A;  5DG1 A;  4XIO A;  1JU3 A;  3ZFF A;  5FOB B;  4WZF A;  4LLF A;  3MIE A;  1HXS 2;  2RHP A;  4FOQ A;  4YNI A;  1WKY A;  1E57 A;  4I30 A;  2QQJ A;  2LAL A;  1HRV 2;  5H9S A;  1GZT A;  2WRA A;  1W6M B;  1ST8 A;  2BNN A;  3NJV A;  4BE3 A;  2P3I A;  3WSO A;  4LHK A;  3VZJ A;  5GZC A;  4CCD A;  3D4K A;  2VNV A;  4I3G A;  3VUO A;  1QEX A;  1NX9 A;  3MFC A;  3KHC A;  2QE3 A;  3B01 A;  1C1L A;  1XXN A;  4J1W A;  1POV 3;  4TLG A;  4L2N A;  3ZVX A;  4PBO A;  4Z2A A;  3J7H A;  4QX5 A;  2E6V A;  2XVK A;  5T50 A;  3RZG A;  1C8M 1;  4DRR A;  2XQR A;  1K5M A;  2JG8 C;  3ZX7 A;  5FO8 B;  4R9D A;  3WOG A;  2HWD 2;  4NRM A;  1M06 G;  2BGP A;  1GSL A;  3N9Q A;  3O1S A;  2I45 A;  4QPG A;  4CU6 A;  3W21 A;  3M70 A;  3HNB M;  1VBC 1;  1FPN 3;  5FR3 A;  2DBI A;  4UI9 L;  1UW8 A;  3VDB A;  4OFG A;  1OUS A;  1BMV 1;  2Z2S B;  2DU0 A;  1PO2 1;  5E89 A;  4AQ6 A;  2W87 A;  3HMY A;  4N43 B;  3ZR6 A;  3HR9 A;  2QZ2 A;  4YZ4 A;  4FTB A;  5F5C A;  1W9Y A;  1JI6 A;  1SLC A;  5F2W A;  1UZW A;  3DPR C;  4QQL A;  2PTM A;  4YVS A;  2LTN A;  1BHG A;  1HB1 A;  3AYE A;  1N3Q A;  3TN9 2;  3OOX A;  5AFB A;  4PQ9 A;  4DUX A;  2IXH A;  1BEV 3;  2JKB A;  3WCR A;  2XBO 1;  1RUG 1;  2VE1 A;  3NNF A;  4WM8 C;  4WZC A;  3W20 A;  4CEY B;  4ZKT B;  5K7P A;  1JOD A;  1OVS A;  3N9N A;  4XAC A;  4E8C A;  5JDB A;  3VKO A;  2DCT A;  1ASJ 2;  2WN3 A;  4YZ2 A;  5A3P A;  4LKE A;  3MLK A;  4OI1 A;  1LAJ A;  4NO4 A;  4LMF A;  3V0A B;  1MQT C;  3GM8 A;  3OBZ A;  4XF9 A;  4K3U A;  4Q4Y 1;  2ZZJ A;  3ZOI A;  1CQ9 A;  1K5M C;  1H30 A;  3OPW A;  2QQV A;  2JD9 A;  3WQ1 A;  1RUH 1;  1YFX A;  3BPZ A;  3OJB A;  5FFO C;  2R04 1;  4P00 B;  4QPG C;  4GB3 1;  2W1S A;  2MEV 1;  3AYD A;  4FPJ A;  2YRO A;  5CKN A;  4COY A;  3SIT A;  1FNZ A;  5FKC A;  4AI0 A;  4YW3 A;  2B5H A;  3USU A;  4AI2 A;  1DP0 A;  2O0O A;  4KH9 A;  1QMJ A;  3EYP A;  4XDO A;  3GJB A;  1N3P A;  1RHI 3;  1SBF A;  4XQD A;  3G7D A;  2XML A;  3RI9 A;  4HKO A;  3ZN6 B;  4DZG A;  2I74 A;  4YGC A;  4YVS C;  4XUR A;  3UT0 A;  2WT0 A;  2VMC A;  4GWJ A;  1BZW A;  2VBP A;  3NWK A;  4QPY A;  2DDU A;  3B3Q E;  4M3C E;  4AED B;  2VOX A;  2NN8 A;  1MS1 A;  1DHK B;  2XL7 A;  1OD3 A;  2WQ8 A;  4E2Q A;  3NVC A;  4BXF A;  3RSJ A;  4MGY E;  3POG A;  2E31 A;  2FDF A;  1RUO A;  1AX0 A;  3TEX A;  1WWY A;  3TWI A;  4FTS A;  1C5I A;  1LU2 A;  3LD8 A;  3Q8F A;  3VN4 A;  1JYV A;  2R16 A;  2BBV A;  2P1B A;  1JZ6 A;  3WF3 A;  2XWJ B;  4IV1 C;  1QHD A;  5GLV A;  5I93 A;  1S0I A;  2ILM A;  3BTZ A;  5C3R A;  3VD7 A;  1POV 1;  1GZW B;  1XSR A;  2VNR A;  4V2W A;  4YW6 A;  1W9S A;  3ZYH A;  5ABJ A;  2WAA A;  3W58 A;  1GWL A;  1XU1 A;  2BTV C;  2VMD A;  3GAL A;  5HI0 A;  3Q8C A;  4AF9 A;  2SLI A;  4NID A;  2FD8 A;  3EO6 A;  2A3Y A;  2UYB A;  1R1Z A;  1OXC A;  3H1W A;  1OT5 A;  1WMX A;  2PAM A;  4MGI E;  5JI9 A;  3BOP A;  1OLM E;  2WYF A;  2VR4 A;  1FPN 1;  5C4W B;  1FI2 A;  5FTT C;  1FNY A;  1LGC A;  4IL7 A;  4E4H A;  1G9C A;  4DY5 A;  4OVE A;  2G1M A;  1RUD 2;  1SPP A;  4AZZ A;  2NLR A;  1K42 A;  4QXK A;  3MI8 A;  1EAH 2;  1VE0 A;  3S6P A;  4DIN B;  3I8T A;  3OSD A;  1BK0 A;  2RDQ A;  4A44 A;  1MPX A;  4TWT A;  4YPJ A;  1KS4 A;  2WYS A;  2B4K A;  5T5P A;  5BNN A;  4D0Q A;  3LZZ A;  1UZY A;  1RUC 1;  1Q8V A;  5F2S A;  4QWN A;  5F6L B;  3CF6 E;  5EJ1 B;  2K46 A;  1BEV 1;  2Q8C A;  5L7O B;  2HJI A;  2ZEW A;  4ZS2 A;  2YV8 A;  5LBE A;  3DN7 A;  5FZ6 A;  1ZYB A;  1RMU 2;  3J4U H;  3K4Z A;  1F5F A;  5FXW A;  2AAC A;  4DRV A;  5F9T A;  3WW1 A;  4XAA A;  3JU9 A;  3KCX A;  3PIJ A;  2PHR A;  2ZML A;  3PMS A;  1ULD A;  4NPL A;  3EQE A;  5APA A;  5IK8 A;  5LWB A;  1QJF A;  2X29 A;  3T0B A;  1A8D A;  3WT3 A;  2KXL A;  3J9S A;  3TNQ A;  4CDW C;  2QQW A;  3ACG A;  1H8V A;  1UY3 A;  5E6H A;  3ZXF A;  3ZSE A;  3BCW A;  4HSJ A;  5E1R A;  3WP5 A;  5H9R A;  4DXZ A;  2R0F A;  2D93 A;  5FZF A;  4YLZ A;  1UOB A;  5I0S A;  4K1Y A;  5CIR A;  3LIG A;  3VBU B;  5CFD A;  4BQX A;  1PZ8 A;  1OSG A;  3TEY A;  3E5U A;  4EWE A;  4LUK A;  1HXS 3;  3EXU A;  4CE8 A;  3USU B;  2QDN A;  2XVL A;  2VGD A;  1CAV A;  1YI7 A;  3VV1 A;  1I5Z A;  1HRV 3;  5HCF A;  2XKO A;  5FY1 A;  1UAI A;  3PUS A;  4ERO A;  3L2H A;  1W3X A;  4YWA A;  4RS5 B;  1OBN A;  1EPZ A;  3U0Z A;  1ND3 A;  4XMI A;  1C1F A;  3I7D A;  4D7Y A;  5A3N A;  3RRD A;  1H2N A;  1GQG A;  5DZF A;  3LOB A;  5FYY A;  5A33 A;  1H1M A;  4PJY A;  2ZGO A;  1MEC 2;  3KVB A;  5L9R A;  1OMI A;  2WAO A;  3KV9 A;  5L73 A;  3B02 A;  3WNP A;  1D7P M;  2PEL A;  3NAP B;  2GP3 A;  2HWD 3;  3SH4 A;  2XH6 A;  3IDB B;  2K0G A;  1N1S A;  4YM2 A;  2R49 A;  1TVG A;  4XUO A;  5LB6 A;  4C1X A;  1YQ6 A;  1LUL A;  1AJO A;  3POB A;  4QXB A;  5CFD C;  2Y8K A;  1TMF 2;  3WCS A;  2X09 A;  1RVF 3;  3VKN A;  1ZZ9 A;  3WD5 A;  4E8D A;  4QQH A;  3KWV A;  1GV9 A;  2D7F A;  5LEK A;  3O5S A;  2OII A;  4IXL A;  4JHZ A;  1OQ1 A;  1QF3 A;  3M7A A;  3ON7 A;  3U4S A;  4AI8 A;  4D6R A;  4R9B A;  2JEM A;  2YB7 A;  2P3J A;  2XJR A;  3GZA A;  3TN9 3;  1JYI A;  4Q0Q A;  2ZX3 A;  3KMH A;  1NZC A;  2VZ3 A;  1C28 A;  2VZT A;  4XET A;  5C9A A;  5IFP A;  2IUW A;  1VAV A;  2VME A;  3AZW A;  1JOP A;  1ND3 C;  2TNF A;  3DL3 A;  3O1M A;  2GNM A;  1F31 A;  1KXG A;  2QQK A;  5HV0 A;  4RQP C;  2ETE A;  1DCS A;  1ASJ 3;  3LA3 A;  2EAA A;  4UF0 A;  1K3I A;  1WW4 A;  4C0H A;  2C1F A;  3RG0 A;  3S57 A;  1HB3 A;  5FUI A;  3NJX A;  5BNN B;  2ET7 A;  2X05 A;  1SHW B;  2RS3 1;  2WSU A;  4Q8K A;  4J6G A;  2VPV A;  2WNE A;  3PU8 A;  1US2 A;  1LEN A;  1W6O B;  5DDJ 2;  3ZMO A;  1Y9G A;  4TLF A;  2JWP A;  1ONA A;  2XL9 A;  5JWP A;  1FAT A;  3WEZ A;  2D6N A;  2DF7 A;  5KHG A;  1XSQ A;  4UFJ A;  2ZMN A;  1POV 0;  4A45 A;  2VL4 A;  2B45 X;  1HB2 A;  2A3W A;  2V4A A;  5J98 B;  2DVA A;  4BHP A;  1AZD A;  1UY1 A;  3MV0 1;  2VXJ A;  4NRQ A;  1MZE A;  4FFG A;  3EHK A;  4COZ A;  2QNK A;  1PNF A;  3IKW A;  2WKK A;  4LLO A;  4OCT A;  4YG0 A;  1NQD A;  1SAC A;  1HXS 1;  5FZO A;  4R8H A;  3WNM A;  2EXI A;  5C9A C;  2XQX A;  5HV4 A;  2ZGT A;  3E6B A;  1HRV 1;  2J1V A;  1JMU B;  5JR2 A;  3Q8A A;  4MGZ E;  5GAL A;  2JDZ A;  3WP3 A;  3O1R A;  4QPI C;  3GBW A;  1CZV A;  1GIC A;  2WIN B;  4BME A;  4QB6 A;  4ZZ5 A;  1Q3E A;  1CVN A;  1CAV B;  1TQ5 A;  4BIO A;  3H7Y A;  3MUZ 1;  4EWD A;  3TNP B;  1NY7 2;  4XDQ A;  3D6E A;  2I2S A;  3OBT A;  4G9S B;  4HAN A;  1EUU A;  4IEP A;  1XNT A;  4LIU A;  1ND2 A;  4UXA A;  2ZHL A;  3WDY A;  4EZH A;  2ARA A;  2RJ2 A;  2XB6 C;  1ZZ7 A;  2ZX4 A;  3KV4 A;  4LKS A;  5DUV A;  4HZF A;  1MS3 A;  1HDK A;  1YC6 1;  2HWD 1;  4I09 A;  1KD7 A;  2W08 A;  5GZF A;  5LAT A;  2ZBJ A;  4OHZ A;  2RS5 2;  3HT1 A;  2PHX A;  5FZI A;  2HWB 3;  3UKV A;  3KGL A;  4ATF A;  5ERL A;  2CY6 A;  3ALQ A;  4IV3 C;  5FZ3 A;  5LRR A;  2YBK A;  4FP3 A;  5FPA A;  3LEM A;  1JN2 P;  5T52 A;  1RUD 3;  1X8M A;  5JXG A;  1QJX 2;  4C91 A;  4H14 A;  5EIY B;  4CPB A;  4CP1 A;  1EAH 3;  2F4L A;  3AMQ A;  3GJA A;  4KG0 A;  3T4H B;  4MHR A;  4YVW A;  5C71 A;  2PAE A;  4LK7 A;  3KQ4 B;  1BBT 3;  4UFM A;  2VC9 A;  2Z5W A;  4LR4 A;  2B42 B;  3VBS C;  2BPA 2;  3EBR A;  5FIX A;  1GR3 A;  1CZT A;  4JGZ B;  1XRU A;  4A3Z A;  5K8S A;  1G9D A;  5BNQ A;  1IG3 A;  2JDK A;  4RGK A;  4Y1V A;  2YBP A;  4FFH A;  2PHF A;  5F39 A;  4PF1 A;  4CCE A;  1KQR A;  1UNB A;  1W8N A;  1RMU 3;  2MNG A;  2BGO A;  3ZYJ B;  4Y26 A;  4COV A;  2XUM A;  1DGL A;  1LHW A;  4U2A A;  1ASJ 1;  3HBK A;  1PMJ X;  3POS A;  3MIB A;  5G04 L;  4QD2 A;  3IB3 A;  1AL2 2;  5JIA A;  2CWM A;  2J1T A;  3VDD A;  2D6K A;  3MLL A;  1GKB A;  2OQ7 A;  1TZO A;  4UBG A;  3T30 A;  2BOJ A;  2JIJ A;  5A6Y A;  1LEM A;  4EN8 B;  1UO9 A;  2VOV A;  3VL8 A;  3N7K A;  1S4C A;  4LPL A;  1VBB 2;  4QKF A;  3UK9 A;  2YU1 A;  4AQ2 A;  5B2G B;  3PME A;  4BQ4 A;  4NIH A;  1CD3 G;  2ZGK A;  1IQA A;  4RD7 A;  3FL7 A;  2FDH A;  3N7M A;  5IK7 A;  4AI1 A;  4N53 A;  3AB0 A;  3ZPO A;  1MS8 A;  1ZZ6 A;  1W8T A;  1O3T A;  5K4L A;  4XFA A;  1OOP B;  3LSE A;  3FFZ A;  3HEI A;  3K4A A;  4NRO A;  4QGL A;  1UOG A;  1V9U 2;  4LBJ A;  3C2U A;  1VBD 2;  2TEP A;  2D6O X;  3MUY 1;  1WMD A;  2VOK A;  3III A;  4RGG A;  3NNM A;  4DIQ A;  1H8T A;  4Q8L A;  1NCQ B;  3RZZ A;  1HRI 2;  2ZGP A;  4CUC A;  4IGQ A;  1MEC 3;  1QH6 A;  3OBR A;  3GXU A;  3Q8E A;  2R32 A;  4EYU A;  1OI6 A;  4MAD A;  4GMP 1;  3NKT A;  3WDV A;  3VDD C;  5A6X A;  4RFR B;  5EYX A;  1UF2 C;  1VPH A;  3ZXL A;  4A4A A;  2ZAB A;  4Y1U A;  1AJK A;  5DAQ A;  4GWM A;  5EV7 A;  2Q8O A;  3EB7 A;  2YC2 A;  4D6S A;  5JSP A;  3NV3 A;  3BN6 A;  4Y22 A;  5H9Q A;  2FMY A;  4N7I A;  2VZU A;  4JGY C;  4OZO A;  4HK9 A;  5C5U A;  2H6C A;  5KHH A;  4QPW A;  3KV5 A;  2WJS A;  1ND2 B;  2ADE A;  1J83 A;  1W8W A;  1C3H A;  4P9J A;  3TOJ A;  3UYJ A;  2ARC A;  1LR5 A;  2A3X A;  1RUD 1;  1W8F A;  2CHH A;  5FZL A;  1DQ1 A;  5GZE A;  5C3S A;  2RG4 A;  2CAV A;  1EAH 1;  3VDC A;  4ZZ8 A;  2PHT A;  4NHK A;  2ZKL A;  5EHD A;  5LRS A;  1CON A;  4EQV A;  3MDP A;  1VBE 2;  1V6N A;  4SBV A;  1HB4 A;  1W0P A;  3R0R A;  1M4W A;  2GME A;  2WQZ C;  4A42 A;  5JUV A;  1FAY A;  3K4D A;  3AP6 A;  1SBD A;  2Z79 A;  1ZNP A;  2H0B A;  1H8T C;  2QUO A;  3RWK X;  3HAG A;  4ASK A;  1NCR C;  5C3P A;  5FV3 A;  2OKX A;  3VB9 A;  3FMG A;  4UFK A;  4CEW B;  1LOA A;  2UWB A;  3LEK A;  1TME 2;  1GOG A;  3IWZ A;  2DUP A;  2BWA A;  4B7K A;  1YI9 A;  2DVB A;  2EXK A;  3K3O A;  3R05 A;  4NIA A;  5LZ6 A;  3HOB A;  3PU3 A;  1AL0 G;  2CAU A;  4FPH A;  3CEW A;  4Y20 A;  1W6P B;  5DDJ 3;  2P34 A;  2D6M A;  1UN1 A;  4GD4 A;  5A80 A;  5C6C A;  1R64 A;  1LHV A;  3MW4 A;  3M3C A;  3T2O A;  4M0N A;  1SLT A;  1JZ2 A;  2P4E A;  4UBH A;  1NA1 B;  4QKN A;  2W92 A;  3LDB A;  2R06 3;  3LGR A;  4B29 A;  1XYN A;  1F4A A;  4UW3 A;  1ZZB A;  4ET7 A;  1DQ5 A;  2R7E B;  2Y33 A;  2HYX A;  1QQP 2;  1ZVF A;  2WAB A;  4B3N A;  3KD4 A;  3PUR A;  4HOO A;  4Q27 A;  4AG4 A;  4ASL A;  4CSW A;  4CTE A;  4E4Z A;  1LOF C;  3BOW A;  1DZT A;  1N1Y A;  4CDU A;  3WQ0 A;  4MO3 M;  4MGK E;  3WDX A;  3V65 A;  1HLC A;  4NIG A;  2GP5 A;  1IHM A;  2NMN A;  1W28 A;  4QB1 A;  3L9J T;  4BYY A;  4FPO B;  3ZYR A;  5FCC A;  1WMF A;  2W1U A;  1VRH 2;  5T55 A;  1E5H A;  1AVB A;  3RPQ A;  3WHU A;  2C26 A;  3O0X A;  2IXK A;  5DZG A;  1GQP A;  3ZYI B;  3D0S A;  1LHU A;  1RHI 2;  1MEC 1;  2FCU A;  3SCF A;  4LIV A;  4AGR A;  3LEG A;  3MFA A;  4ISQ A;  1DYO A;  5KHI A;  5HCH A;  3FLR A;  3N7L A;  1FV3 A;  2E63 A;  2R6Q A;  3USS A;  4BIF A;  3IZO A;  1Z78 A;  2G4I A;  2EIE A;  1C4R A;  1GYK A;  1IPJ A;  2CL2 A;  2RS5 3;  3EJK A;  1GOH A;  1O5L A;  1SFY A;  2XHK A;  5F3E A;  1D2Q A;  1CAU A;  3ZXK A;  4XJ9 A;  1AF9 A;  1EUT A;  3H8O A;  1ENQ A;  1TMF 1;  3N9L A;  3NNG A;  1PVX A;  1QJX 3;  3I97 A;  5CBL A;  1YHF A;  3O12 A;  4P9G A;  1EYB A;  1R08 2;  3PJQ A;  4PQQ A;  1CES A;  4GH4 A;  4P08 A;  3CJI A;  3VZM A;  4N90 A;  4CCM A;  4Q4X 2;  4ZU7 A;  3NQH A;  4PDW B;  4WVW A;  3A7Q A;  4MSV A;  1GFF 2;  4XBL A;  4QXH A;  4I0A A;  4XF0 A;  4OI0 A;  2AEY A;  5KC5 A;  3PNA A;  3PVN A;  1UMI A;  5BNO B;  1G9F A;  1Z7S 2;  2VUC A;  3S7I A;  1W6N A;  4M3C A;  2QTW B;  3ASI A;  4JDO A;  4YAR A;  2ZAC A;  2DWR A;  4AW7 A;  4FI9 A;  1JW6 A;  3CLP A;  2W46 A;  2K9Z A;  1POQ A;  5C8C A;  4K1Z A;  4L9B A;  3GDB A;  2VCB A;  1RIN A;  3HQR A;  4X8P A;  1UYY A;  2Y38 A;  3ME2 A;  2WO2 A;  1U5I A;  4OHX A;  5A3M A;  1BYH A;  1MR5 A;  1OQD A;  2JEN A;  3OY8 B;  4AL9 A;  3NJY A;  1C8N A;  5JOY A;  3RMX A;  4UFL A;  5JZG A;  4NPR A;  1UD1 A;  2BFU S;  3ACH A;  3MIF A;  4DUV A;  5I0D A;  1O4T A;  5DDJ 1;  1V70 A;  1G8W A;  3WNN A;  1OLQ A;  2AGS A;  5C3Q A;  3ZXJ A;  5JSO A;  5JXJ A;  2VUD A;  2C4X A;  3B9I A;  4ASM B;  5A3T A;  1R09 2;  4GMP 0;  1V6K A;  3JZV A;  2J1S A;  4COU A;  5BNP A;  1JZ8 A;  4L11 A;  2XVG A;  1VBB 3;  2DBN A;  3LEI A;  1COV 2;  1UYX A;  4LQR A;  4CUA A;  5ACA 2;  2R07 2;  3BTY A;  1OLM A;  5FWJ A;  4LEJ A;  3U75 A;  4AXO A;  3HT2 A;  4YW1 A;  4KWK A;  1QH7 A;  2BER A;  4XF3 A;  4B7E A;  5JMC A;  5FZA A;  2SBA A;  1PO1 2;  2GZW A;  2VQU A;  1K12 A;  2JG8 A;  2VQT A;  2PQQ A;  1QOT A;  4H55 A;  3DEM A;  3R4D B;  5J96 B;  1V9U 3;  4FPY A;  2XPJ A;  1VBD 3;  3LWC A;  3JB8 A;  3ZN5 A;  1Y9M A;  5C8C C;  5F5I A;  2JG9 C;  3UKT A;  4JKL A;  3VBH B;  3OD4 A;  3MF6 A;  4IUG A;  3WXP A;  1HRI 3;  5FP8 A;  1KEX A;  5FY4 A;  2GU9 A;  3BIW E;  4JRL A;  2Q8D A;  3WHT A;  3U11 A;  4CP9 B;  2ZJC A;  3BTX A;  1NY7 1;  1OQE A;  1AUY A;  5T5L A;  5JZG C;  1VAK A;  2EA7 A;  3SCH A;  2Q1F A;  2B46 X;  3GBF A;  4KMQ A;  3DPR A;  3OGR A;  5FMC A;  1LES A;  3QD6 A;  2WO7 A;  3UV9 A;  5F3I A;  3RYR A;  1XJA A;  4W50 A;  2PXJ A;  3VHP A;  2IC1 A;  1X82 A;  1RUF 2;  1PIV 2;  1DQ2 A;  5BNP C;  2RS5 1;  3GZT B;  1UIK A;  5DAV A;  5A7S A;  3O1T A;  3DYP A;  3FE5 A;  4IE5 A;  4W8J A;  5LBF A;  4UYB A;  4WM8 A;  1AR7 2;  4L8Q A;  4MGS A;  3ES1 A;  1QJX 1;  1G9A A;  1LJ7 A;  1W0O A;  4HL0 A;  4JKM A;  1CX1 A;  2BDR A;  2VZ1 A;  4YGD A;  1QXJ A;  3PUI A;  4V1P A;  1MQT A;  4S2F A;  5FZG A;  3VHR A;  1VBE 3;  4ZON A;  5JOW A;  4NE9 A;  2PFW A;  4R9C A;  3AL5 A;  2B39 A;  1XE8 A;  2E7T A;  2VBD A;  1G7Y A;  1S55 A;  4IEZ A;  5IYY A;  4TN7 A;  3U4X A;  1FOD 2;  1WZX A;  3RYP A;  3O7O A;  2VMH A;  2HKX A;  4F7Z A;  2VOW A;  5FP7 A;  2WR9 A;  1H2M A;  2A71 A;  3M3I A;  1RVF 2;  2VMG A;  3ZXE A;  1AYN 3;  2GC0 A;  4JQT A;  3SKJ E;  1TME 3;  3S5A A;  2QVS B;  3JBG 2;  3NKG A;  1TNR A;  2CU5 A;  1W6N B;  2L9L A;  3AM2 A;  3IN9 A;  4HBN A;  4MGT A;  1CPM A;  1Q5O A;  3FHI B;  2XJS A;  1R1A 1;  5FMB A;  1AL2 1;  5HXM A;  4LBK A;  4NWW A;  3SH5 A;  3C7E A;  4AK3 A;  3VBR A;  3ZXG A;  5LY1 A;  3VHO A;  1PGS A;  2VTX J;  1YNA A;  1CAX B;  3IPV A;  1OA2 A;  4LA3 A;  5FZE A;  5KXE A;  4Q1R A;  1EY2 A;  4LO7 A;  3JXS A;  1QGL A;  3AXE A;  1PMH X;  1PX3 A;  4NMI A;  1VAM A;  5E88 A;  4NOT A;  1TG7 A;  2ZGR A;  2HWF 3;  3N36 A;  5ISL A;  2G19 A;  1IS4 A;  2EVX A;  3FBM A;  1QQP 3;  1PM4 A;  1WW6 A;  2DVD A;  3I59 A;  4BH9 A;  4KNC A;  4AGV A;  4IV1 A;  2HWC 2;  2WC2 A;  5DZE A;  3H1Y A;  1YJK A;  3A21 A;  3K2O A;  5G05 L;  5D1I A;  1RL3 A;  4KQ7 A;  3GYD A;  2BZD A;  2FHR A;  5EXO A;  3VD4 A;  1QOO A;  4LBN A;  2ZGL A;  4H7L A;  1FV2 A;  1UU4 A;  4AHY A;  5JSR A;  4FQ4 A;  5IVY A;  1NT0 A;  5JIU A;  1O7F A;  4IQP A;  3ZFE C;  2LS6 A;  3LDR A;  4AFD A;  1H1I A;  2UY8 A;  3SMH A;  3VBF B;  1VBD 1;  1VRH 3;  4HVO A;  4D3W A;  1J3Q A;  1A3K A;  1CZS A;  1IG0 A;  4FP2 A;  1IZ3 A;  1HRI 1;  4YZ1 A;  2X5I A;  5C8W A;  3BOD A;  2X8K A;  3AMM A;  3T3Y A;  4AVC A;  2WZR 2;  4GAZ A;  2WT2 A;  4LBL A;  4CPB D;  5EFU A;  1QXP A;  4Q2F A;  1A6C A;  4B4R A;  1VR3 A;  1ZA4 A;  2LRP A;  3H50 A;  4BMB A;  3VBR C;  2KM2 A;  4A2U A;  4HVQ A;  3NL1 A;  5A3W A;  2RVA A;  4Z82 A;  4RHV 3;  3HNM A;  4GKX A;  3OPT A;  4OHV A;  2JDU A;  1JZ5 A;  2PAK A;  5FPB A;  4IEX A;  2CTV A;  2VCC A;  1LCL A;  3I3D A; 
#chains in the Genus database with same CATH homology
 4XUN A;  2QQK A;  2V5D A;  2Y6K A;  1K3I A;  2E26 A;  2CDO A;  5FUI A;  3NJX A;  2X05 A;  1SHW B;  2VMF A;  3A23 A;  1PX4 A;  3OGS A;  4BK5 A;  3I2J A;  4BJ0 A;  3K75 B;  1SG3 A;  3ECQ A;  4RYD A;  1US2 A;  1OF4 A;  4CU8 A;  1DLC A;  1OH4 A;  3WEZ A;  2YG0 A;  4L0P A;  4DUW A;  1UWW A;  3IDA A;  3BGA A;  4A45 A;  2VL4 A;  1GOF A;  1O59 A;  2VZQ A;  3LQC A;  3W5M A;  4QX3 A;  1UY1 A;  3MV0 1;  1JU4 A;  4OUE A;  3FHQ A;  2Y6H A;  3OGV A;  1JHJ A;  2J22 A;  3WNM A;  2XHN A;  4MGQ A;  2XQX A;  3SKV A;  3SEP A;  1OF3 A;  2J1A A;  2J1V A;  4DEQ A;  5JR2 A;  3CDZ B;  3T08 A;  2EID A;  2ORZ A;  2DCK A;  1CZV A;  3P6B A;  3THC A;  4QB6 A;  3WNL A;  4ZZ5 A;  3T0D A;  1W0N A;  4CU9 A;  3MUZ 1;  4QX2 A;  3C7F A;  3CQO A;  2XOM A;  1EUU A;  1XNT A;  4D8M A;  1SDD B;  4UOJ A;  2RJ2 A;  4LKS A;  5DPN A;  3CKH A;  2JKX A;  5DN2 A;  3I3E A;  5CYY A;  2VZP A;  1L7R A;  2EIC A;  3DEC A;  1IQD C;  4GZ9 A;  5JXG A;  1XNA A;  5EIY B;  5A1A A;  2KD7 A;  4GWI A;  5C71 A;  3I2K A;  2VC9 A;  3T2Q A;  3WQB A;  1H6Y A;  4QDS A;  4A6O A;  2J1U A;  3DYO A;  1CZT A;  4A3Z A;  5C7G A;  1YQ2 A;  2Y64 A;  1UYZ A;  4DXT A;  4PF1 A;  2BBA A;  1W8N A;  1XPW A;  2W5F A;  1W99 A;  2J1R A;  2VOT A;  2BGO A;  1PMJ X;  5G04 L;  3IB3 A;  5F7U A;  3T0A A;  2WDB A;  3MO4 A;  4BDV B;  2J1T A;  5HPO A;  2J7M A;  4TXW A;  3P1I A;  3GGL A;  3NRU A;  3OEB A;  4OMD A;  1W8O A;  4OMC A;  5LA2 A;  4ARX A;  2W9X A;  5JXI A;  3UET A;  2W94 A;  2QBX A;  4LPL A;  4BXS V;  4PT6 A;  3SEE A;  3WF1 A;  3FL7 A;  1O8P A;  4XUQ A;  3OB8 A;  1HN1 A;  3HEI A;  3K4A A;  3WF4 A;  4CVU A;  3MUY 1;  3III A;  4QDQ A;  4CUC A;  5DMY A;  2PQS A;  4XZU G;  2E33 A;  2JE8 A;  3GXU A;  1L7Q A;  2V4V A;  4MAD A;  3HJR A;  3PUH A;  3U37 A;  2YFU A;  5IJR A;  4A4A A;  1LNS A;  3EB7 A;  1WCQ A;  2LW8 A;  2YC2 A;  3BN6 A;  5LA1 A;  2X10 A;  1GNY A;  2VZU A;  3I2F A;  2W47 A;  4QAW A;  4OZO A;  5CZK A;  2DCJ A;  1P8J A;  3ABZ A;  4QPW A;  1ULP A;  3ACI A;  2W1W A;  4DXS A;  1J83 A;  2YC4 A;  2XON A;  3THD A;  2EIB A;  2QQM A;  2VO5 A;  3VDC A;  1UZ0 A;  4ZZ8 A;  3VDA A;  2Y6L A;  2JDA A;  4ZY9 A;  4A42 A;  2W91 A;  5B4X A;  3T09 A;  2VZV A;  4QX0 A;  4XVH A;  5JUV A;  3K4D A;  1JYX A;  1JZ7 A;  3K77 A;  3DYM A;  4ZXE A;  4AAX A;  5IHR A;  3I2I A;  2OKX A;  3D3A A;  4KI5 M;  3LEK A;  1GOG A;  1JU3 A;  2WUH A;  3HN3 A;  1UY2 A;  3FHA A;  1WKY A;  3HOB A;  2QQJ A;  1UXZ A;  3MBW A;  5C70 A;  2QQI A;  4ARY A;  1R64 A;  3T2O A;  5JMO A;  3NJV A;  3WSO A;  4M4P A;  1JZ2 A;  1XC6 A;  2W92 A;  5J1X A;  1NX9 A;  1W9T A;  4P02 B;  1F4A A;  4ET7 A;  2R7E B;  5LCW L;  2WZE A;  2HYX A;  1CIY A;  4Z2A A;  3J7H A;  2WAB A;  1UXX X;  4AG4 A;  4UAP A;  3CZU A;  4DEV A;  2E32 A;  2BGP A;  3C7G A;  4MO3 M;  3K46 A;  4CU6 A;  1US3 A;  3HNB M;  1GUI A;  1UMH A;  4QB1 A;  4UI9 L;  2W1U A;  3VDB A;  3UES A;  4QB2 A;  2C26 A;  1GQP A;  2VCA A;  4QDR A;  2W87 A;  1J84 A;  1JI6 A;  3CZJ A;  3LEG A;  2C9K A;  1DYO A;  3WNK A;  1BHG A;  2W95 A;  4DUX A;  2EIE A;  2J1E A;  4M4R A;  5EJZ B;  1GOH A;  5JXH A;  2VZS A;  4HG6 B;  1I5P A;  1EUT A;  1UY4 A;  3NNG A;  3I97 A;  4E8C A;  2ID4 A;  4RN5 A;  3OBA A;  2WN3 A;  2ZEY A;  4PQQ A;  4P08 A;  3GM8 A;  3OG2 A;  4MOA A;  3NQH A;  3A7Q A;  2JD9 A;  4A41 A;  2B9V A;  3W5N A;  3LPF A;  4P00 B;  1UMI A;  1W9W A;  2W1S A;  1H6X A;  4P5Y A;  1NUK A;  3ZM8 A;  4OYU A;  4FI9 A;  1DP0 A;  2W46 A;  3C8X A;  3EYP A;  3GDB A;  4QX1 A;  2VCB A;  5LA0 A;  1UYY A;  2WO2 A;  3LE0 A;  4XUR A;  3I3B A;  4GWJ A;  2VMC A;  1UX7 A;  5B4N A;  2DDU A;  4JKK A;  5I0D A;  2WBK A;  3ACH A;  4DUV A;  2WZ8 A;  1OD3 A;  2WQ8 A;  3WNN A;  2WN2 A;  3CIH A;  5JXJ A;  2E31 A;  3E1F 1;  2C4X A;  2YFZ A;  3F2Z A;  3I2G A;  1JYV A;  2J1S A;  2WO3 A;  1JZ8 A;  1JZ6 A;  3WF3 A;  3LEI A;  1UYX A;  4LQR A;  4CUA A;  4XUT A;  4KWU A;  3VD5 A;  3VD7 A;  2VM9 A;  1W9S A;  2WO1 A;  2WAA A;  2BER A;  4XUP A;  2ZEZ A;  3AC0 A;  2VMD A;  2VQU A;  1K12 A;  3IAQ A;  3I2H A;  3VD3 A;  1UY0 A;  2VQT A;  4CU7 A;  3LPG A;  3ETP A;  1OT5 A;  4JKL A;  4IUG A;  2VZO A;  3T2P A;  2VR4 A;  1KEX A;  2W1Q A;  3VD9 A;  1NKG A;  4JX0 A;  1K42 A;  1KGY A;  2VJX A;  4A44 A;  1JZ4 A;  3HPN A;  1MPX A;  4YPJ A;  4KMQ A;  2WYS A;  3OGR A;  2B4K A;  4D0Q A;  4W50 A;  1JYN A;  3HNY M;  5EJ1 B;  3WNO A;  2ZEW A;  3DYP A;  4LHS A;  4W8J A;  3K4Z A;  4MGS A;  1GU3 A;  3WF0 A;  2V72 A;  1JYW A;  4JKM A;  5DQ0 A;  1CX1 A;  2CDP A;  2VZ1 A;  3PUI A;  3OEA A;  3T0B A;  1O8S A;  3ACG A;  1UY3 A;  4BK4 A;  5IYY A;  1ULO A;  5IFT A;  1GMM A;  2QQN A;  3SKJ E;  2L9L A;  3C7H A;  3ACF A;  1K45 A;  5HXM A;  3C7E A;  1JZ3 A;  2ZXQ A;  3C7O A;  3JXS A;  1PMH X;  1PX3 A;  4CUB A;  1TG7 A;  1T2X A;  2Y6G A;  2Y6J A;  2ORX A;  3A21 A;  1F4H A;  5G05 L;  2WAO A;  3WNP A;  1D7P M;  2BZD A;  3VD4 A;  4W4Z A;  3IAP A;  2Z4F A;  3FN9 A;  1TVG A;  4XUO A;  2LS6 A;  2QQL A;  2HLE A;  2Y8K A;  1RYY A;  2X09 A;  1CZS A;  4E8D A;  3WF2 A;  3CMG A;  2QQO A;  2ZEX A;  4JHZ A;  2VZR A;  2VTF A;  3UNP A;  1NAE A;  2YB7 A;  4DXR A;  2RV9 A;  2W3J A;  2RVA A;  3MV1 1;  2VZ3 A;  3HNM A;  2VZT A;  5IFP A;  1JZ5 A;  2VME A;  3A22 A;  4TTG A;  2VCC A;  3I3D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...