1AYN2

Human rhinovirus 16 coat protein
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
252
structure length
252
Chain Sequence
SDRIIQITRGDSTITSQDVANAVVGYGVWPHYLTPQDATAIDKPTQPDTSSNRFYTLDSKMWNSTSKGWWWKLPDALKDMGIFGENMFYHFLGRSGYTVHVQCNASKFHQGTLLVVMIPEHQLATVNKGNVNAGYKYTHPGEAGREVGTQVENEKQPSDDNWLNFDGTLLGNLLIFPHQFINLRSNNSATLIVPYVNAVPMDSMVRHNNWSLVIIPVCQLQSNNISNIVPITVSISPMCAEFSGARAKTVVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords HUMAN RHINOVIRUS 16 COAT PROTEIN
publication title The structure of human rhinovirus 16.
pubmed doi rcsb
source organism Human rhinovirus sp.
total genus 59
structure length 252
sequence length 252
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1997-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ayn200
1VB2A 1CJDA 3ZFGB 5C9AA 5C9AC 1OPOA 3HAGA 4RS5B 4CDUB 4NWWA 1AR72 1C8M2 2IZWA 1VBE2 1QJX1 1AR83 1F8VA 1TME2 4Q4W2 1ND2A 2R063 4N53B 4RQPB 1COV3 1V9U1 2R072 4CDQB 1BBT1 1HRV2 1M06G 1AL0G 1R1A3 1QQP1 2FZ2A 1RUJ3 1AR92 1R091 2MEV2 1HX6A 2PLV1 3VBHA 3VBHC 1PO21 4N43A 4WM8B 1ZBA2 1PVC2 5BNNB 3JBG1 1POV3 1D4M1 1VBA3 3IDEA 1ND3B 1Z7S3 1VBB2 4QPGB 2RR12 1PO11 4Q4Y1 1HXS1 1QJY1 4N53C 4IV1B 2HWD3 1VRH3 4AEDA 1ZBE1 5BNOB 4AEDC 1RUC3 1ASJ3 1AYM1 4GMP0 1AYN1 1NA1B 5DDJ1 4GH4B 3VDDB 5ACA3 2WWSA 5AC92 2RS13 1RMU3 2X5IB 5C4WB 1QJX2 1W39A 3VBSB 4QPGC 5BNPB 2GSYA 4JGZB 5D8AB 1OOPB 1V9U2 1VBD1 4YVWB 1RHI2 1RVF2 1HRI1 1BMV1 3VBUA 5BNOC 1AR81 1PIV3 2BBVA 1R092 1VAKA 4PDWA 4PDWC 1AR71 1NA1C 4YVSB 1PO22 5C8CA 1FOD3 3JBG2 4Z92B 1R1A1 4Y5Z0 3LOBA 4Q4W1 2WFF3 4IV3B 1HXS2 1QJY2 2R071 1OOPC 3NAPA 4SBVA 1HRV1 2HWE3 5L7OA 2XBO2 1ZBE2 1VBA1 4WM7A 1RUF3 1Z7S1 3TN93 1B35A 1B35C 1AYM2 2R043 5GKAC 5DDJ2 1MQTB 1VRH1 5ABJA 1RB8G 5ABJC 1RUE3 4RHV3 1K5MA 1TMF3 5LK7B 1VBC1 1C8NA 3VBFB 4EJRA 4CEWA 4RR3A 4JGYB 1AR82 1NOVA 5JZGB 2R062 2WZR3 5CFCA 2QQPA 5CFCC 2HWF3 1COV2 5CFDB 1GFF2 1MQTC 5AC91 4Y4YA 1PIV1 5K0UB 3VBOB 1R1A2 5A33A 3J8F3 1NY71 4Q4V3 3DPRB 2Y26A 3JD73 1RHI1 1RVF1 1FOD1 4CDWB 5A32A 1BEV3 1EAH3 2HWB3 1VBA2 4JGYC 1Z7S2 3ZFGA 3ZFGC 4CDXB 4RS5A 4CDUA 4RS5C 4CDUC 1RUG3 5CFDC 4FTEA 2HWE1 1NCQB 2HWD2 3VBRB 4CEYB 1VRH2 2BPA2 1RUC2 1ASJ2 5K0UC 4FSJA 2R041 4N53A 1VBC2 1R083 4RQPA 2ZTNA 4RQPC 3DPRC 1VBE3 4CDQA 4CDQC 2BFUS 2XBO1 3CJIB 1AL23 5ACA2 1PGL2 4RHV1 2RS12 1RMU2 1PGW2 1RUI3 4CDXC 1FMD3 4QPIB 4WM8A 4WM8C 4CEYC 1RUH3 1RUD3 5BNNA 5BNNC 1FPN3 2MEV3 2RS53 2RS33 3S6PA 1H8TB 1PIV2 1ND3C 3ZFFB 4GB33 1NY72 4QPGA 2HWF1 1QJU3 2WLPA 4NWVA 4IV1C 1NG0A 2RM23 4LLFA 1FOD2 1VBB3 5BNOA 2ZZQA 1F2NA 1NCRB 2R061 5FOJB 2WS93 3FBMA 1COV1 2HWC3 1NA1A 4GH4A 3VDDA 2HWE2 1BEV1 4GH4C 3VDDC 1EAH1 5C4WA 1EV13 2X5IA 1WCDJ 5C4WC 1H8TC 2X5IC 4Q4X3 3ZFEB 1RUJ1 3TN92 2RMU3 3JB8A 5FMOS 3VBSA 2R042 3VBSC 5BNPA 5BNPC 4JGZA 2BUKA 5D8AA 4JGZC 1OOPA 5D8AC 2ZAHA 4YVWA 4YVWC 1POV1 1RUE2 4RHV2 1V9U3 1HQNA 1R081 1BBT3 4YVSA 4YVSC 2HWD1 1AR63 1K5MB 1QQP3 3M8LA 1RUC1 4GMP3 1ASJ1 2PLV3 1PO23 2WZR2 4IV3A 2HWF2 1AUYA 4IV3C 1D4M3 5ACA1 1POV0 1PGL1 1FPN1 5C9AB 2RS11 1PO13 1RMU1 2RS51 2RS31 4Q4Y3 1QJY3 1PGW1 3J8F2 1IHMA 3JD72 1MQTA 1BEV2 1ND2B 5J96B 1EAH2 1AYN3 2HWB2 2WS91 1RUJ2 3VBFA 3VBFC 1MEC3 1QJZA 1RUG2 1DDLA 1EV11 4JGYA 2WFF1 4Q4X1 3VBHB 2RMU1 1VBD3 5JZGA 4N43B 5JZGC 1R082 1HRI3 5CFDA 1AL22 1ND2C 1RUF1 5K0UA 3VBOA 3VBOC 3TN91 2GH8A 1AR73 1RUI2 1C8M3 1SMVA 1E57A 3DPRA 4AEDB 1FMD2 1X33A 1AR61 1TME3 4Q4W3 4CDWA 4CDWC 1RUH2 1RUD2 1RUE1 4GMP1 1FPN2 2RS52 2RS32 1TMF1 2R073 4GB32 4CDXA 1A6CA 4N43C 1HRV3 1QJU2 4FTSA 1NCQA 2RM22 3VBRA 1NCQC 4CEYA 3VBRC 1AR93 1ND3A 2WZR1 2WS92 1ZBA3 1PVC3 3JB4C 2HWC2 3VBUB 4IV1A 2TBVA 2RR13 3CJIA 1VBC3 3CJIC 4PDWB 1EV12 3J8F1 2WFF2 4Q4X2 4BCUA 2RMU2 4Q4V1 5C8CB 1MEC1 4RFT0 3JD71 4QPIA 4QPIC 2HWB1 2DF7A 1H8TA 1RUF2 2BFUL 3ZFFA 3ZFFC 3NAPB 1BBT2 5L7OB 1RUG1 5AC93 3VBUC 4WM7B 1QJX3 1AR62 1QQP2 1B35B 5J98B 1TMF2 2PLV2 1NCRA 1C8M1 1NCRC 1RHI3 1RVF3 5C8CC 5ABJB 1VBE1 2FZ1A 1TME1 2XPJA 1D4M2 1AL21 1PO12 1R093 4Q4Y2 4CEWB 1RUI1 3ZFEA 3ZFEC 3NAPC 4RR3B 1FMD1 1OHFA 5L7OC 3JBG3 4FTBA 4WM7C 1RUH1 1RUD1 1AR91 2MEV1 5CFCB 1HXS3 1AYN2 4GB31 1ZBA1 1CD3G 1PVC1 1QJU1 1X36A 4Q4V2 1MEC2 2XBO3 1ZBE3 5FMOL 2RM21 5A33B 3ZXAC 1K5MC 1VBB1 2RR11 1AYM3 1VB4A 4CEWC 1VBD2 2HWC1 5DDJ3 4RR3C 2VQ0A 5A32B 1HRI2 1BMV2
chains in the Genus database with same CATH superfamily
1JUHA 4TN7A 5IW0A 1VB2A 1CJDA 2DYCA 1OT5A 3N7KA 3PMEA 2HKXA 3MW4A 1J58A 4COUA 4BHPA 3X29B 1OPOA 4JQRA 3RYKA 2GMEA 4BQ5A 2TNFA 2Z5WA 3ZVXA 4NWWA 2XVLA 2WO7A 1FNYA 2ZMNA 2FMYA 2EA7A 2IZWA 1REFA 1OH4A 4UF0B 5FK7A 4D7TA 5F8PA 1Y9QA 1OD5A 5JXIA 1TME2 3POYA 1MZFA 2WC2A 4Z07A 2D6KA 3I3QA 2JWPA 3B5LB 3KQRA 1T6GC 2A75A 4RQPB 1NKGA 2H6CA 4DEVA 4BISA 2R072 2WT0A 1I5ZA 2R30A 2VMDA 3HNYM 3UKTA 1HRV2 2BGCA 1AX1A 1M06G 1NE6A 4QU2A 3FHAA 1R1A3 3ZYHA 3ZXKA 5F2WA 5A3OA 1J1LA 1GBGA 3HD8B 4E4HA 2QQLA 2VH9A 2ZCWA 3VHRA 2E63A 3VBHA 2D3RA 2DV9A 4PIYA 2PXJA 1V6OA 2GAUA 4WV8A 2E7QA 1JW6A 3HIFA 4BPZA 5C3RA 3RZHA 4N7IA 4D94A 3ETQA 5HCFA 5C6CA 5F3CA 1VBB2 5GALA 1PO11 2QDRA 4N53C 4I02A 4AI3A 4LKFA 3JZVA 1B09A 3WF1A 1R64A 2QQJA 1N1YA 2R1BA 4IQPA 1CPMA 5FUPA 1WCQA 2C5DA 3B02A 1VRBA 4IDZA 5BNOB 5DUUA 4PIZA 4AEDC 4Y1UA 3FBYA 1RUC3 4MXVA 2CGNA 1ASJ3 4GXLA 3NJYA 3WP3A 2YFUA 1QWRA 3I2IA 2E33A 3I54A 1AYN1 3T1MA 5FPUA 1LTEA 3BPZA 2PHWA 1N3OA 2GC0A 4P5YA 1H0BA 1CAVB 2WNUA 3VL8A 2WWSA 5KHGA 2QKDA 3ZMNA 2J1UA 1QJX2 3KSCA 3E6BA 3ACLA 4HVOA 3RWNA 2ARBA 1ZRDA 1XE0A 4OFGA 4DRRA 2A6YA 2CL2A 2RVAA 1XU1A 2JE8A 1UIKA 4W65A 3VBUA 4E4ZA 4ZU5A 4QDSA 3ZN4A 1UQXA 2DUPA 2FCTA 3N3HA 2VUDA 1LOCA 2I74A 4PDWA 1KRIA 2ADEA 1XYNA 1NA1C 5ISLA 4XPVA 3DXUA 4R52A 5H9QA 1DYPA 2CSGA 4HOOA 3WW3A 1NT0A 4CU7A 1QXPA 5JPNB 3ACHA 4Y5Z0 2DCYA 2I07B 1S0BA 3EBRA 2AZ5A 5HCHA 1HXS2 1QJY2 2R071 2VOWA 3I2DA 1GZTA 1OOPC 2H0VA 2ZA9A 3NAPA 5A7OA 4ASMB 5FTTC 1HRV1 1KJRA 1SEFA 3RZJA 2XBO2 5FQ0A 2OX0A 1GUIA 3WP5A 1SBDA 2ORZA 2VQAA 1Z7S1 2B5HA 2JKXA 4S2DA 3VLBB 4CPBA 3LA2A 3WNOA 1QH7A 1S2EA 5E8AA 4I2OA 1R1ZA 2QDNA 3J7LA 3N7JA 1OA2A 2WQ8A 1SPPB 5DDJ2 1OC1A 1MQTB 3FLTA 3LA3A 4A6OA 3ES4A 1MS3A 5ABJA 1H4HA 2W52A 1RUE3 4G3YC 4IL7A 1U5IA 2ZEXA 2W08A 5DPNA 1XRUA 3ON7A 1C8NA 1W6OA 3H1MA 3W59A 3VD3A 2DCTA 5F5CA 4PLNA 5J7MA 3DYOA 1JYNA 5L9RA 1WA4A 4IE5A 2VPVA 5FY5A 4ES8A 2WN3A 2WWUA 4LBOA 4XQ4A 5FYTA 5JR2A 4JGYB 3WD5A 3I7DA 2YBSA 1DZQA 1KGYA 1L7LA 3OGSA 4HKOA 1FI2A 1X9TA 3ALQA 3RG0A 2IC1A 3E5XA 1UWWA 1GFF2 5F5IA 4FPOB 4MGYE 4A3XA 1CJPA 4CCLA 2OS2A 3S0MA 1LOAA 2O8OA 2XUMA 1PIV1 3VBOB 1R1A2 2UURA 4MX3A 1RTVA 1C57A 4LBQB 5DQ0A 1DYKA 1NQDA 1K45A 3O1SA 3IIAA 1D0GA 1JUIA 5FY1A 4M3CB 4QB1A 2JIGA 5JMOA 3KCCA 4TXWA 3UKVA 2VNRA 1O3RA 1PZ7A 1OFSA 2D6MA 2CGOA 3AMMA 5LZ6A 2E26A 4QX0A 3IKWA 1H1IA 1PNFA 1IOAA 3Q9OA 3T0BA 4IEYA 4ZU4A 5L9BA 3ENRA 1ULPA 2G19A 4N90A 1J83A 4CDUC 3MIGA 1RJ8A 1RUG3 5CFDC 2H0BA 3WSOA 4IE6A 2HWE1 1NCQB 5CKNA 3WZ1A 5LY2A 4NJ4A 2BPA2 2PAKA 4UF0A 1RUC2 1SCSA 1BKZA 1ASJ2 5K0UC 1L3JA 5J09A 3JQXA 5F5AA 2YU1A 4FSJA 1OI6A 1YIFA 2D98A 3IAPA 3Q8AA 4RQPA 1WMEA 2QVSB 5JOWA 3DPRC 5A6ZA 3M4FA 4XOGA 4YZ3A 4CDQC 3IAQA 5FZ7A 4UW6A 3U11A 2XBO1 4B4QA 2WZEA 4UW4A 1H9PA 1CN1A 2JDNA 3B3QE 4RHV1 1KJLA 4QHZA 5A70A 1RUI3 2E7TA 3VDCA 2QJVA 3NNGA 3K3NA 1XC6A 4J1WA 3ZX7A 3PMSA 1UF2C 2BP6A 4A7KA 1OKQA 3E5UA 3RI8A 5LA1A 4CEYC 2WO3A 5BNNC 3O0XA 2RS53 1PM7A 3OF1A 2LRPA 1ND3C 1QNWA 4I30A 1V6MA 3ZFFB 4GB33 1NY72 5LBEA 4I3GA 2D5FA 1QJU3 4A4AA 4JRLA 4XVHA 4ATFA 1DZRA 2Q0AA 4IV1C 1NG0A 4LLFA 1HB4A 3U78A 5BNOA 1ULFA 3ZSMA 1X8MA 3AMNA 5FYVA 1H2MA 1U5XA 2OKXA 4OMDA 2ZMLA 1H9WA 1F2NA 4K1ZA 3BODA 5FCCA 4TLGA 3D82A 3FBMA 3OGRA 5IVCA 1ODNA 4YFWA 2Y6LA 1CAVA 2JX9A 5I0TA 2ZMKA 3OY8B 4GH4C 3VDDC 2V5YA 1H30A 3I2KA 4QX8A 4XJZA 5B4NA 2YGMA 4LIVA 1H8TC 3RI9A 5ERLA 5BNPC 2YBKA 4JGZC 3AB0A 2VUCA 2IFWA 3KF5A 2ZAHA 3HVDA 2Q8EA 3OBRA 1MPXA 4ATEA 2J1EA 3CZJA 2NYYA 4ET7A 3PNAA 1BLZA 1RUE2 2XXZA 4NHKA 3OYWB 3ZKYA 1DYOA 1IKQA 4E8DA 5FUIA 3A4UA 1BBT3 2A5ZA 2VZPA 3TEXA 1UPIA 3BTYA 4Z2WA 5IFTA 1GOGA 4LBKA 4MV2A 5LRRA 3FLPA 2P3JA 3QCWA 1QQP3 4ZONA 5FIXA 3BU0A 3K3OA 5FV3A 1WZXA 2W68A 1RUC1 2PQSA 4Y1XA 4AR2A 1ASJ1 2Y6JA 1UMZA 2PLV3 3LKJA 1QXRA 4XZUG 3VUOA 1PO23 5C5TA 3AYEA 4IV3C 3B93A 5BXXA 4CCEA 5AFBA 4FPHA 4K21A 3U4XA 2YROA 4DFSA 1NAEA 2WNOA 3BU7A 1SFPA 4Q4Y3 4FT8A 1E5SA 2BV4A 4GWNA 1OUSA 4JVAA 2K9ZA 5H9PA 1PZ9A 1YIPA 3VHNA 1ZA7A 4CCDA 4D6RA 5IHRA 1GP6A 1ST8A 4WVWA 1SPPA 1MQTA 1IGOA 4YZ5A 1CAUB 2ZBJA 3AYCA 4XIOA 4DY3A 4O9EA 2XL9A 3GBFA 5CNAA 3CDZB 1Q8PA 1W0OA 2CTVA 1XYPA 2QQIA 3OG2A 5FLIA 5BUVA 4FFHA 1O8SA 1LB2A 2WFPA 5FZEA 3ILRA 5LWBA 3MO4A 3POIA 3ZR5A 1RUG2 4IE0A 4JKLA 3A0KA 1GNHA 1TVGA 1W6NB 4UT5A 5L36A 1BVP1 1S0EA 4JGYA 2GC3A 1C1FA 4HONA 2VZ3A 5CA6A 2I2SA 4Q4X1 5GLTA 1XSRA 2AGSA 3VZOA 1GZCA 4LUKA 1VBD3 5HXVA 4AI2A 4AQSA 4N43B 5FZFA 2O8QA 1M4WA 1MS5A 2W1QA 4FO9A 4PLOA 4LNVA 3ZN6B 1UY1A 4FFFA 1UNBA 4BLJA 2NP0A 3AK0A 2W0XA 2JENA 1O8PA 1WBLA 3O1TA 3I2JA 3G7DA 3GBGA 4TLFA 1FYUA 3AKQA 3H7YA 4D0QA 1QOOA 4IXLA 3AMQA 3VBOA 1UOGA 4LBQA 4Q2FA 3ZLIA 3OCPA 4XFHA 4E9KA 1AR73 1RUI2 1C8M3 3W5NA 3WP6A 1SMVA 1C28A 2B7YA 4M3CA 4COWA 1UZ0A 3ILFA 2GP5A 4ONUA 1IPSA 2VW1A 2ORXA 4A41A 1WW5A 2FCVA 4ASLA 1RUE1 5FUNA 2VCBA 2RS52 3PUAA 1GU3A 3CU7A 3OEBA 4GB32 2C26A 3LEMA 4IE7A 1QJU2 4UBHA 4FTSA 3ZO0B 2JG9C 2ZGMA 1SLTA 2VVEA 5FY8A 4BMEA 4LPLA 3RRDA 5IVBA 3VD9A 1NCQA 5LEJA 1KQRA 5FZMA 3VBRC 1P8JA 2JDUA 5CG9A 2YPJA 4OMCA 5K7PA 1Y43B 1H4GA 1X50A 1SLBA 1TG7A 1Y4WA 1ALYA 4L97A 5JVVA 2D6NA 2HEYF 2Y60A 1CAWB 4QQPA 1S0GA 2RR13 1C5HA 3LEKA 3WNXA 1JS9A 5FDBA 4H2AA 4JDNA 3R05A 2WFF2 1QJFA 1XB9A 4HN0A 3VZMA 1S2KA 4C0HA 5C8CB 1MEC1 4RFT0 4CU9A 4XBLA 1LOEA 1HKDA 1YRZA 4LA2A 2G9FA 4I01A 1LU1A 3NV4A 3LE0A 3WINE 3KHBA 1LHWA 2Y0IA 1X7NA 1RUF2 3JU9A 2JD9A 4BQ1A 4BXSV 3ZFFA 3UGFA 2OW4A 4DO0A 4AI8A 3ACFA 2QE3A 1BBT2 1DQ6A 1RUG1 3MW2A 4QHOA 3VBUC 5CADA 4WM7B 1C3HA 1H6YA 1W0NA 3CQOA 3PL0A 1AZDA 1QQP2 1PK6B 3OEAA 2ZEYA 5GZEA 1GICA 2FDIA 4GWIA 1SHWB 5EHDA 1YJKA 5A3UA 5IAVA 1HDKA 2VBBA 2PLV2 3AP4A 4CCKA 3ITQA 4PLMA 3LPGA 2QQOA 5JR7B 2AYHA 1W6MB 1JOJA 4IEXA 4L99A 2VOXA 1W8UA 5H9SA 2ID4A 3WHTA 2P2KA 2W95A 2WRAA 4H14A 3UK9A 4MHRA 4WZCA 1YQ6A 3OY8A 2Z79A 1RUOA 3PU8A 4KGGA 5ANNA 4P9XA 3OGGA 1UOFA 3CL1A 2RDRA 4Q4Y2 4QHBA 4CEWB 1RUI1 1J3PA 4K7JA 3NAPC 4RR3B 1U0AA 1W6QB 2VZVA 2ZHKA 4FCAA 3FLRA 5FYCA 5FWJA 1HB1A 4H7LA 4Y24A 4DUXA 3TWIA 3OYWA 4Q26A 4YW1A 4GB31 2J1SA 3AX4A 2AREA 4DIQA 1QJU1 1KS4A 2JIJA 2P6HA 3RZZA 4ISQA 5FO8B 2PHRA 1PZ8A 2JDPA 4CP1A 3C7EA 4PHZA 3PDQA 4PIXA 5DXDA 5A33B 3KT7A 3SH5A 4QKBA 1ENSA 2KD7A 2WBKA 3T0DA 3MIFA 2YDEA 2GMPA 1VB4A 3LIGA 1AX0A 1MS8A 4YM2A 2PYTA 1VBD2 2O0OA 4HK8A 2A3WA 4HPKB 4XF9A 2VQ0A 1JYCA 2AEZA 4BDVB 3LQCA 3VKMA 3C7FA 1HQLA 3TAYA 5CU1A 3LEIA 3ZFGB 4V1PA 4FPFA 5GZDA 3U75A 1RUNA 3NNJA 5FR3A 5C9AC 1WUVA 4RS5B 1GOHA 5T5PA 4OUEA 1HQWA 1AR72 1C8M2 2BERA 2LTNA 2VMIA 2XJQA 1JZ3A 4JHTA 1JZ5A 3MFCA 4FPGA 1VBE2 1YQ2A 4WZFA 1FNZA 3MEPA 1CAUA 3AZVA 1I9RA 4AFCA 1GYKA 4HSLA 4QQLA 3WCSA 3POSA 1Y9MA 4LO6B 4BE3A 1QKQA 1W2UA 1BBT1 5CAZA 1UYPA 2E7AA 5AVPA 5FZOB 1WD3A 4XURA 3VN4A 4CP2A 5C5UA 3FWEA 3OBZA 5I0RA 2FDFA 1QQP1 1W6NA 2WL1A 2Z42A 4U2AA 1RUJ3 2DFCA 2J1TA 1R091 2MEV2 2RJLA 2V72A 4HBNA 4QKNA 4AGVA 2PLV1 2GNTA 4RYDA 2D7FA 1PO21 3K4DA 4N43A 5DZGA 4WM8B 3ZN6A 4AOCA 3M3OA 2ZABA 2E32A 3MLJA 5FPBA 4CUGA 2A71A 3DYPA 3A7QA 3JBG1 3WF3A 2NMOA 4BWOA 3AYAA 1DQ5A 4FAHA 2WZPP 1Z7S3 2R0FA 3L2YA 5FZ8A 2PAEA 2BNNA 3CLPA 1OXCA 4J6GA 2RR12 4QPGB 5DG1A 4Q4Y1 4DMIA 1YQCA 4RGGA 2VUJA 2X05A 3PJYA 3WHUA 1NQJA 2XB6C 1SLLA 1WA6X 2IXIA 2RDNA 2VTXJ 4PT6A 2RHPA 4XETA 3SCFA 2KXLA 2OQ7A 3C7GA 3H8OA 4LBMA 4LO4B 2BQPA 2HBUA 2YUEA 5EJZB 2BZDA 3O0WA 3PUHA 1XU2A 2RE9A 1IKPA 1JMUB 3S5QA 3C7HA 3PU3A 4GMP0 1IZ3A 2C24A 4AHYA 5JSPA 4S2HA 2OYZA 4CE8A 4QX1A 3HN3A 3HR9A 3IIIA 4CP9B 1YFXA 1TZOA 1GQHA 2GN7A 4EN8B 1JXNA 4IGQA 4DPNA 5CIRA 2W91A 3CO2A 4M0NA 1UXXX 2VQUA 4JRAA 4CXWA 2H6BA 3KV6A 1W39A 4CCMA 3FN9A 3AZWA 2AEYA 1S0FA 4NPLA 4GKXA 4CU8A 3D6EA 3KLSA 3ZIWA 3NNMA 1XXNA 2XOMA 2P3YA 1VBD1 4XACA 4YVWB 1HLCA 1YLLA 4CU6A 5IT6A 2Y33A 3IDAA 3HJRA 5BNOC 2VG9A 4ZKTB 3ZPYA 1CAWA 1PIV3 1IS5A 1CZVA 3BIEA 3HNMA 2YV8A 3O5SA 4X6RB 3ZXJA 1GZ9A 5GLWA 3VDAA 5HI0A 2BBVA 1US3A 1E5RA 4JAAA 1SBEA 1AR71 1PMJX 4HK9A 3N9LA 5C8CA 4CCCA 3OGJA 1DGRN 1O4YA 4QGLA 1UL9A 2W1UA 2Z69A 5FXZA 3AKRA 5F37A 2XL7A 1STMA 2XJSA 2IFRA 1XSQA 1C4RA 2JDKA 1RINA 1AF9A 3AKSA 4SBVA 1SLCA 3FHQA 4QM8A 2HWE3 2PA7A 3NW4A 4P9IA 4EZHA 1U12A 4UFMA 4M3CE 5T50A 4ZHNA 3PJQA 4EN0A 1YYNA 4WM7A 4OUMA 3RJRA 1PK6A 4CXYA 1EYBA 2ZEZA 1B35C 1T2XA 4FPYA 3DGTA 2KA3A 1U5YA 3BN6A 3NQHA 4MGTA 5E6HA 4DY5A 2RDSA 1QH6A 4Z1VA 1W6MA 3B94A 5I0DA 4MOAA 4QXBA 4F83A 1XNBA 4RHV3 4RGAA 1TMF3 1YJLA 2XR4A 5LK7B 1IPKA 4V2WA 4Y5TA 2Q1MA 2CGPA 4BK4A 4XQWA 4CEWA 4LIUA 4QWNA 1PX4A 4RR3A 4ISRA 4YW3A 2Q30A 5T54A 5A6QA 1W6QA 3WF2A 2ZX0A 4OI2A 4YW2A 3I4IA 2IVJA 2C9AA 3UL2A 3POBA 3PTRB 4CVUA 2E9QA 2VW2A 3ZM8A 4Z8BA 2L9LA 4P00B 2VZTA 1DQ0A 2FDKA 1QHDA 2WZR3 5CFCC 5BV6A 1YHFA 1PMIA 3MIHA 2BNMA 3NNFA 5DUVA 5T5LA 3DKWA 1AVBA 3AXDA 3NMBA 4NMIA 4B4RA 1MQTC 2B39A 1HV1A 3WNPA 2EIBA 4NUBA 4Y4YA 4B4PA 3GHMA 4XXPA 5A33A 4NIGA 3J8F3 1BQPA 1LODA 3GJAA 5LA9A 2VGDA 2R32A 3WNMA 4Q4V3 5AVAA 5FPLA 2XKPA 2XVKA 5FMBA 4HPKA 4MGZE 3RYRA 5C71A 3U0ZA 1FOD1 4W6XA 1GLHA 4CDWB 2XLAA 2PQQA 1H2KA 4JGYC 3CZUA 3VHOA 1Z7S2 1W6PB 3RYPA 3ZFGA 3WNNA 1W2AX 4XBQA 2DWRA 4CDXB 1IS3A 4PBPA 5F6LB 2P3KA 4RS5A 1W9SA 5FZIA 2XONA 1LEMA 2IXJA 5K8SA 3URFA 1NLQA 1VR3A 5D2AA 3U10A 2G9GA 4MHUA 4N8MA 2DVGA 4QX7A 5FZGA 3UYJA 4QMAA 4WVZA 5EV7A 4Q0UA 3S30A 1AXKA 2BOJA 2VMFA 4XF3A 4XUNA 5LBBA 4AYUA 5FZOA 5E16A 3RMXA 5APAA 3CJIB 1AL23 3KZ4C 1PGL2 2OT7A 3EB7A 3C8XA 1ZA4A 3LDKA 4B8EA 2ZGSA 5FMDA 4F7ZA 4CZSA 2WQ4A 1WCKA 2JKBA 4XFCA 3J7MA 1OUXA 5JOYA 1L7QA 3R0RA 1UZZA 2XQRA 4QPIB 4WM8A 3KCYA 3WP4A 5A3TA 1KFXL 1W8FA 5EYXA 1YI7A 1PIV2 2DCZA 2K46A 4AFDA 3BKZA 4RN5A 2ZGNA 3BOWA 4QPGA 4M4RA 4AG4A 2HWF1 2WLPA 3USUB 1XE7A 4CXXA 3AYDA 2GNMA 3OD4A 3MFAA 3U07A 3THTA 4DXRA 2SLIA 4KBBA 3VL9A 1J3QA 2RM23 2ZJCA 4RSUA 4QGNA 1W9YA 1QDCA 5F9TA 5C33A 2PTMA 3B9IA 3P6BA 4KWKA 4QXKA 2QNKA 3HPNA 3CNAA 5GJ6A 3SEPA 1WMXA 1SQ4A 3AXEA 4M00A 2HWC3 2DVAA 5FKCA 3ZYJB 2GC1A 2J1AA 5DAVA 3KB5A 5HXMA 4CP9A 4LBNA 2HWE2 2FHRA 4BQYA 4AHXA 4ZY9A 1EAH1 1UN1A 1WCDJ 2V73A 2X5IC 5C4WC 1QJEA 1F9KA 4Q0PA 1RUJ1 1W8ZA 4Q4X3 1MVEA 4Q1RA 2DCJA 3ZFEB 1QXJA 3JB8A 5FMOS 3M2MA 3VBSC 5T5JA 4AE2A 2VD7A 2J1VA 2UWCA 5D8AC 2VOVA 3WQ0A 2WKKA 4YVWA 3TEYA 4OLLA 1Q5OA 3ZYBA 4CRQA 1X9PA 4LT5A 1N3QA 3ES1A 4PBOA 5F32A 2YC2A 5TSWA 3WW4A 4XZPA 3H3UA 4RHV2 1V9U3 1K12A 5HBAA 2EAKA 4HFSA 1LGCA 1R081 3NKTA 2X53S 2EIGA 2VBDA 3ZSEA 5JUVA 2PHUA 2VM9A 4P02B 3O12A 3W21A 4D8MA 5I8TA 1O3SA 4YVSC 1FT9A 4A6SA 1H1AA 4QX5A 5F3GA 4CA9A 1K5MB 1UMHA 3M8LA 4GQ7A 1SCRA 2Y6GA 1LNSA 1WW6A 5HCAA 3HWJA 2BTVC 4X6QB 2IWGB 3MDPA 4Q0SA 1UX6A 2A1XA 2QQWA 4FOVA 2WZR2 4KNCA 2VOKA 1Q8SA 2VMHA 2W94A 2YGLA 3BTAA 1O7FA 3HT2A 1CGPA 1NX9A 1POV0 2P6CA 1FPN1 4OYUA 1A78A 1OQ1A 2IXKA 2RS31 4XHBA 1PGL1 5L19A 1MZ5A 1RC6A 2LW8A 4Y20B 3T09A 1VAVA 3J8F2 4ZZ8A 3SKVA 5F7UA 4CCOA 3GZAA 5F6KA 2PN5A 4O61A 4R4XA 2FD8A 5C3QA 2WO1A 3LCPA 4JZRA 1JYTA 3KVBA 3OUHA 5A80A 2F4LA 3N9NA 5GLUA 4AVSA 4LLOA 1ONAA 4A3ZA 5AFEA 1S2BA 4OQ9A 4AWDA 2W3JA 1NXD1 2YY1A 3I49A 3LAGA 4BB3A 3VBFC 1MEC3 1UU4A 3AKTA 1IS4A 3RFRA 1DLLA 5FP3A 4AAXA 3SQOA 1JODA 3VZLA 5HV4A 2BYVE 2IXHA 1EV11 1MS0A 1XNDA 3E1F1 3RDIA 2TEPA 1XPWA 5JZGC 4K1YA 2ZAAA 1JYIA 2WQZC 1OH3A 3T2OA 4BOWA 1ZYBA 5JIUA 1O91A 3IMMA 2OQ6A 5FYUA 1AL22 1QNYA 2WO2A 4Y4RA 3ZKUA 1DIWA 5FZCA 3H9AA 3BTXA 3KCXA 2GH8A 2FDGA 2D43A 2I45A 4AEDB 5E1RA 4EN6B 1OKOA 2JDYA 3ZSLA 2VY0A 3WG3A 5A6YA 1ZREA 2DUOA 5JDBA 4CDWA 3AC0A 1F4HA 3WQBA 4GMP1 2AH2A 4KL1A 1RXGA 1TMF1 4A45A 4XUTA 1W6PA 3WW2A 3H3LA 2D5HA 1A6CA 3K2OA 4YGCA 4CDXA 2VZ1A 2VMEA 3AJYA 4N43C 3LDRA 4D69A 4MG2A 3K4ZA 3ZXLA 1ZM1A 1K3IA 4UAPA 3AFKA 4MXWB 1YO8A 4Y33A 3GCWA 2RM22 4XC9A 4X8PA 4IEQA 2GNDA 4YG3A 4XJAA 4FVVA 3AFGA 3LOIA 5CBLA 4LR4A 3WDYA 2WZR1 3JB4C 2HWC2 5GZGA 1RJ7A 2TBVA 5FFOC 3CJIA 1VBC3 2VNVA 1NLRA 2AC1A 1FV3A 3IPVB 2Q8DA 3J8F1 2R7EB 2ETEA 2XQXA 4I3PA 4Q4X2 4YW6A 4BCUA 2K2SA 1J3RA 2E53A 1DQ4A 2LS6A 3AL5A 4Q4V1 3UT0A 3GCXA 4BQ2A 2IVIB 4QPIA 2VCMA 2YMZA 3AVSA 5FREA 3K75B 3R4DB 4B3NA 2ZKLA 2GP3A 2DCKA 3MUZ1 4COVA 3POEA 1BK0A 4UFHA 5FZLA 5D1IA 2Y6HA 4XFFA 5CKMA 4KMQA 4W6WA 5EZWA 2R6QA 5L7OB 3P5BA 2WN2A 1PVXA 2BWAA 1CZSA 3RNSA 3USUA 2VCCA 2VVFA 2AENA 1BVVA 1LHOA 2LUWA 4COYA 3OPZA 4H3WA 4NOTA 5JI7A 2ZS6B 4NPRA 1DF0A 3OTFA 3RWKX 3G6JB 3RSJA 3USSA 2JDZA 1NCRC 1RHI3 3LFMA 4HZFA 4JDMA 3WCRA 1RVF3 5C8CC 2FZ1A 2XPJA 2WWJA 5I91A 1AL21 1KXGA 2DTYA 4CP0A 1R093 3GNEA 3JXSA 3KWVA 5A6XA 4HVQA 4JCKA 3ZFEA 2BNOA 1Z78A 2VOTA 3H8XA 4IE4A 1XNAA 1Y3TA 5A1FA 4UI9L 3LWCA 3WUCA 1OA3A 3JBG3 2P17A 1JU4A 1V6IA 4WM7C 2MNGA 3SLIA 1WMFA 5IWFA 1AR91 1PK6C 1G9DA 3CHXA 4TYSA 3FUOA 2QQKA 3OPWA 5JOZA 2WA3A 3OSDA 3ACGA 4A7YA 3V0BB 5CVRA 4XQDA 2MHFA 1ZBA1 2QQMA 1PVC1 2NQYA 3QH6A 4P9GA 1MEC2 3WNKA 4XJWA 1JYVA 2J7MA 5FZ1A 2CDPA 2RM21 3R4SA 5J3UA 2ZPXA 3WG4A 2DURA 4L92A 1E5HA 4OCTA 4ZZ5A 1N1TA 1ACCA 3R6SA 5JWPA 2PMWB 3N7MA 3NO8A 4LMFA 5T52A 3HQXA 4HSJA 3MIDA 5FYZA 4CEWC 3V56A 5K9YA 3KS7A 2HWC1 3ZSJA 1BXHA 2FBEA 2OXBA 4RR3C 5KC6A 3UNPA 5A32B 5LCWL 1F15A 2DFBA 2WNVB 1GR3A 2QQVA 4QKFA 2WA4A 5BPXA 1ZZ7A 5JMCA 1TEIA 3I2GA 4CDUB 4Y20A 5FP8A 5LW9A 1CAXB 3I3BA 1Q8QA 2AR6A 4OI4A 2ZGPA 2C1FA 1OF3A 2D97A 3FE5A 1YCIA 4NRPA 1UU6A 4XUOA 4AEJA 4AQ6A 4AZZA 1WWYA 1F8VA 1LU2A 1GWMA 4DQAA 2JECA 2R063 1F5FA 4C1XA 1EP0A 3J26N 1V9U1 3KM5A 5F3EA 1GMMA 5FY7A 1K42A 3L9JT 3NL1A 3VKLA 4CDQB 3GZEA 5LEKA 3NKGA 4EV0A 4CSWA 4B7EA 4GWJA 3MYXA 5KXBA 4AVVA 3OD0A 4N9IA 5IK4A 4ZS3A 2ET7A 3QD6A 3D5OA 1PHMA 1LAJA 4G9SB 2FZ2A 2ZACA 3ROUA 3ZYIB 4DINB 1JYXA 3E6CC 2V5DA 4DB5A 3VBHC 4SLIA 2YB7A 5DMYA 2IUWA 2NPIA 1CIWA 1YEWA 2R16A 1YUDA 2A70A 2VMCA 3D0SA 3IZOA 3MBWA 4IUGA 2JDMA 1TQ5A 4E27A 4Q27A 1ND3B 2ET1A 1DQ1A 2LROA 3D4KA 4LEJA 5DAQA 4XCAA 2W87A 3DYMA 3ELNA 5FO7B 4IV1B 5FZ3A 3RJ2X 1HN0A 2JJ6A 4QAWA 2VU9A 1TNFA 3H3ZA 2DVBA 3KHCA 2EIDA 1FAYA 1Q8OA 4AEDA 1ZBE1 4MADA 4EYUA 4YGEA 3N36A 1AYM1 1VIWB 2YZ4A 3N9MA 2VZUA 2JB4A 3VD5A 1A8DA 4BZ4A 2X10A 4D7YA 1MS1A 1NLSA 2P5BA 5FPAA 4GH4B 1RGSA 2WNUC 3VDDB 4ZU7A 4B1LA 4MXWA 3SMHA 1RMU3 4OUSA 2W9XA 4LBJA 4LJHA 3N9OA 4QB2A 2Q8CA 3O1OA 4UFLA 3PVOA 1XNKA 4OULA 4QPGC 5BNPB 2X8KA 2ZX4A 4JGZB 1WCSA 2CWMA 4KG8A 5FYMA 3W9AA 4TSVA 1LRHA 1RHI2 4JKMA 1IS6A 1RVF2 3VD4A 1F5JA 1REDA 5KXDA 5FYSA 5LRSA 2G1MA 4Y26A 2OUHA 3Q8CA 1AR81 1PX3A 2ZX2A 2G4IA 4R9CA 2B8MA 2GMMA 3I3DA 1DLCA 4KI5M 4QM9A 4ZS2A 4C0BA 1R092 1VAKA 2WNEA 3IPVA 3KD4A 4L9BA 4LUMA 4PDWC 4W4ZA 1UOBA 4Z82A 3M3QA 4BQ4A 2KM2A 1LOBA 3RVHA 1PO22 4JHZA 1BK1A 1FOD3 1XNCA 3FHIB 4UW5A 1QDOA 1Q43A 3JBG2 4PI0A 3RPQA 4BQWA 5FJKA 3R4UA 5FXVA 4BQ3A 4COZA 3SCGA 5A1LA 3LOBA 1JOBA 3E6DA 3SCHA 4IV3B 2VNGA 3MPBA 1UMIA 1BHGA 4MGQA 2Y0OA 3POFA 1V6NA 4P9JA 4LULA 3TRSB 5L7OA 2D6LX 2ZX3A 5DG2A 3K4AA 3T2PA 1VBA1 4KWJA 1UZWA 4AVCA 3NV2A 3I59B 2VJXA 2GH2A 3T4HB 1UOJA 5JSRA 2VQTA 2LALA 4EWDA 3HNBM 4INDA 1GP4A 3S7IA 1NYWA 1GP5A 1G9FA 1BJQA 4K8FA 1G8WA 3GZUC 1VRH1 3UKNA 1AHSA 1NZIA 3H8UA 3LB9A 1RB8G 5ABJC 3HEIA 3ZXGA 3AP9A 1W3VA 4FFIA 3THCA 5DZFA 1VBC1 2VL4A 1F4AA 3PHMA 2Y64A 3A21A 4FAGA 1ZRCA 1XQNA 2ENRA 4DNYA 2WAAA 2D3PA 5GLVA 1GSLA 1UIJA 2VZOA 2CWSA 1A3KA 4XE9A 4AQ2A 5FK8A 5DUWA 1NOVA 5DUXA 1YQ8A 2XJVA 3N35A 2R062 3J7HA 4XABA 4E2SA 2DTWA 2HWF3 1VALA 3I2HA 5A7SA 1QOSA 3V0BA 4JDOA 4QX3A 5L73A 3PUSA 1JZ2A 4XDOA 1UKRA 4KH9A 3SH4A 1SLIA 3KMHA 1EUUA 4Z2AA 3VHPA 3VGIA 3ZSKA 2DDUA 4AQTA 5F5QA 3UGGA 1W3XA 3BUCA 3W5MA 1WLWA 3GM8A 4IEVA 4CUAA 2DBNA 5IYYA 1GNYA 1AJOA 1XE8A 2Y26A 3JD73 4TTGA 1BCXA 1C1LA 1RHI1 3AZZA 3JUUA 5DAWA 1QU0A 1RVF1 5EPAA 3WVJA 3ZPOA 1ULOA 5B2GB 3J4UH 3WOGA 5A32A 4DZGA 3D3AA 3MPPG 2HYXA 1EAH3 4FOYA 2HWB3 3WX5A 1GANA 1LCLA 1UYYA 2WNVA 2Q1FA 3NJXA 1UZYA 2QQUA 3LSDA 4LO7A 1LGNA 1Q56A 1LOFA 1JTZX 1UCXA 2B46X 3I2FA 1BZWA 2JG9B 4AVBA 4CDUA 5FZHA 1CAXA 4FTEA 4JQTA 3VBRB 3O1PA 4UW3A 1V6JA 3WF0A 4P14A 4YARA 2XGXA 1HN1A 1KITA 2EVXA 2R041 3EXUA 2DU1A 1OBNA 1IG3A 1R083 3HBKA 3KVAA 3WY6A 5A3PA 1FATA 4RQPC 2J1RA 3H50A 1GKBA 3ECQA 4CDQA 4MLOA 4CCJA 2BFUS 1CX4A 1CIYA 2ZX1A 3ZR6A 4FBFA 2Y38A 2BGPA 3FFQA 3PIJA 5JOXA 1N3PA 2CAUA 2JEMA 1RMU2 3T1LA 2XHNA 3C3VA 4XFBA 5HV0A 4CDXC 4P08A 2OPKA 1X82A 2PHFA 4QQ2A 3T2QA 3PLQA 1W28A 2VBPA 4LE3A 3O1VA 4LKEA 4XUQA 5FPZA 3TEZA 1LOGA 1RUD3 1RUH3 5BNNA 1FPN3 3ZIXA 2RS33 3S6PA 3P3NA 4Q8KA 4FQ4A 2FCUA 1YI9A 4QDRA 3NV1A 4NWVA 4AFMA 4I0BA 3AMPA 4LHSA 1RYYA 4XEZA 3EYPA 1FOD2 1KFUL 1OPMA 1VBB3 3CKHA 1AX2A 4K40A 1G9CA 2ZZQA 3ATGA 1NZCA 2ZGOA 2JDAA 4XJUA 2R061 5FOJB 1JI6A 1UYZA 3PVEA 1UY3A 3GGLA 3D8CA 1LENA 2GALA 3LF7A 2KR2A 1HJFA 4DXZA 4DEQA 5JLVA 3B9CA 4O7XA 1S4CA 4GH4A 4GJZA 3VDDA 1BEV1 2JG8B 3AL6A 3LEGA 3HN1A 1YFUA 3KF3A 3M1HA 4AXOA 4P9WA 1EV13 1O4TA 4W8JA 3THDA 3ST7A 2E6VA 5E88A 1D2SA 1PMHX 4PCRA 5BNPA 4I0AA 4JGZA 4EN9B 3RS6A 2OZJA 2Y6FA 4Y1ZA 1SLAA 4K9SA 4CUCA 2D44A 3MI8A 3B69A 1AJKA 5FXXA 1SDWA 2VTXA 1RL3A 5IUQA 5J37A 2VC9A 3HT1A 3BI3A 4XF0A 2HEVF 4Q5OA 4BIOA 5H9RA 3TYJA 1YFWA 2BW8A 2ZXQA 2HYKA 5A3LA 1OURA 4AEKA 3LDBA 1W8WA 3WLUA 1W2OA 4AGRA 3OBTA 4QQOA 4XBNA 3UJQA 5CG8A 5LATA 4YWAA 4GMP3 3WDUA 4PQQA 1I6XA 4YRDA 5FZ9A 4YG6A 1X8EA 4AI0A 5FY0A 2VTFA 3GBWA 2Y34A 4IV3A 5SV8A 2YC0A 4NIAA 2HWF2 1AUYA 2XWBB 3KQ4B 4OHVA 2P3IA 1UY4A 3RGBA 4EN7B 1DBNA 1DG6A 1D4M3 4N7UA 1US2A 4FQZA 2FDHA 2F6BA 4AF9A 4MH0E 5C9AB 1RMU1 4A42A 5JSOA 1QJY3 2MPFA 3AM2A 3IBMA 3HOBA 3JCIA 4ZPIA 2HBTA 3I59A 3N4MA 3RZGA 4HMZA 1HJGA 5FKBA 5I0UA 3RZMA 2GN3A 1OLRA 1IHMA 3DKQA 1VMFA 1ZVFA 3JD72 1UAIA 1APNA 5DN2A 4AFAA 3WQ1A 2ERFA 2VW0A 3KGLA 3ZN5A 1ND2B 4U36A 2W1WA 1EAH2 2HWB2 3WG2A 3FZ3A 5CYYA 2WS91 1RUJ2 3H8RA 1VAMA 4LBLA 4Q0VA 3IWZA 1QJZA 4KBZA 5JXGA 1HIXA 2ZHMA 4BQXA 4YW4A 4ES9A 1DDLA 2VXRA 3MICA 1S0DA 3MUY1 4FPCA 1WW4A 1V6KA 2C9KA 4YFZA 5FYYA 3CEWA 1ZRFA 2RMU1 1DZTA 2DVFA 5KHKA 1GOFA 1R082 2A6XA 3E5QA 1HRI3 2FDJA 2CAVA 1MACA 1UZVA 2Q1ZB 4KWLA 4QQHA 3H1YA 5IVYA 3PVBB 4LKDA 1IPJA 1WMDA 2BU9A 4LORA 4M0HA 4L11A 3KV9A 2N7GA 1MZEA 3NJVA 4NHLA 5GZFA 3VBOC 2C6SA 3V0AB 4K6BA 5KBFA 4OI0A 1E57A 2E51A 4XDQA 4EZ4A 1H6XA 1HB2A 1X33A 5GZCA 1AR61 2OPWA 1OVPA 3OPTA 3MW3A 4Q4W3 4UXAA 3AJZA 5EP9A 1DGLA 1RUH2 1RUD2 1PGSA 3F2ZA 2A6VA 1FPN2 2HLEA 3PUIA 2RS32 5K4LA 5A7PA 1QOTA 2A73B 2D93A 2BEOA 2NZ9A 1VMJA 4F8AA 2JG9A 3FMGA 2RDQA 3KT1A 3RQ0A 1A34A 1I3HA 1DCSA 3VBRA 4UFIA 1NCQC 1TNRA 1AR93 2A7AA 2ZHLA 3ZDSA 5A3MA 4R4ZA 4QB6A 1QGLA 5KC5A 5DABA 4FOWA 5JXJA 4YM0A 4E4DX 4YPJA 1ZBA3 2ZOEB 1PVC3 2K0GA 4HN1A 4KG0A 1MVQA 1KEXA 2Y6KA 3I3MA 4LXLA 2BJSA 3F95A 4NO4A 2P34A 4DOUA 3EO6A 2PHDA 3ABZA 4GJYA 2UY8A 3GYDA 4MO3M 4K20A 2WT2A 1EV12 2WJSA 4URTA 4YGBA 3WR0A 1UXZA 1UPSA 1VLNA 5KWRA 3A23A 1ZZ8A 3JD71 2WT1A 4FPJA 4GAZA 1H2NA 1CPNA 2ARAA 3IB3A 3VZNA 4GALA 1G9BA 4JTOA 3WEZA 3U14A 1OQEA 3EQEA 2HWB1 4LHLA 2HJIA 3NNLA 1MS4A 4XW3A 1MZ6A 3NWKA 3ZFFC 3FX3A 1MR5A 2VMGA 4QKDA 5A3WA 1XYOA 4C8DA 3KV5A 5KHJA 3NV3A 3ZYGA 5AC93 2PELA 4CTEA 2JD4A 3V65A 4YSFA 4R8HA 1UW8A 1B35B 4XAEA 3CBNA 1CZTA 3GXUA 4DUVA 1N47A 1ZZCA 2PHXA 3QOPA 4UWDA 2ARXA 4ARXA 5BYNA 4DXSA 4BXFA 1TMF2 2XG3A 4HXCA 4S2GA 2F4PA 4NHMA 4LK7A 5BNNB 3QH7A 1PNGA 5F2SA 3TNQA 4LHKA 2GU9A 2WIIB 1OD3A 3TB0A 1TME1 1D4M2 1VP6A 4FP3A 4XUPA 5C70A 2JG8A 5KR7A 3BTZA 4C1WA 3MF9A 4RL7A 5DAPA 4E4SA 3QLQA 2V4AA 2A6ZA 1OLMA 3GF6A 5IFPA 3I3EA 3K46A 4IEZA 4WVMB 1KDMA 5T55A 3ZXDA 1ZRRA 4MYEA 4IETA 4XF4A 5L7OC 5IK5A 3MHZA 3PVNA 4K3UA 1CVNA 1LULA 1O6UA 1RUD1 1RUH1 4OZOA 2ZGQA 5JIAA 2UU8A 4DXTA 5CFCB 4IEPA 5F3IA 5T5OA 4FPEA 3JQWA 1Q3EA 1TE1B 3C2UA 3UESA 4AFBA 1X36A 3AP7A 4ITCA 4Q4V2 1ZBE3 5IK8A 5A7NA 3LPFA 5FMOL 3T08A 4AI1A 3ZXAC 3B00A 1VBB1 1VPHA 2XUEA 4L8QA 1AXYA 1AYM3 1YXWA 1E5IA 2J42A 3GJBA 3T4VA 4GZ9A 3W58A 5A1AA 4LBQD 4I09A 3VZKA 4AEMA 1LEDA 5LBFA 1JOPA 2XH6A 2XLGA 1HRI2 1EY2A 5FZAA 1BMV2 2QBXA 5I93A 4NRQA 4XIKA 5B4XA 4LO5B 4XXAA 1XBFA 4HT1T 1KDKA 4FOQA 4CYDA 1O3TA 4BJ0A 4HLTA 2A3YA 5C9AA 1VMHA 3MIEA 3HAGA 1LHNA 1OA4A 1V0AA 2DU0A 2XJPA 1JBCA 5EJ1B 5C7GA 1YWKA 2TUNA 3A22A 4H7MA 1V6LA 3INAA 4PI2A 4XHXA 5A3NA 3O1RA 2OVUA 3U37A 4HETA 1QJX1 4AI9A 1AR83 3NRUA 4O65A 4Q4W2 5J1XA 2VO5A 4FPKA 1ND2A 2IXLA 3DN7A 3M3EA 1PM4A 3PUQA 3POGA 4GKYA 1COV3 4H55A 4XJ8A 3UV9A 4D6QA 1O3QA 1JH5A 2DBIA 1JN2P 2YHJA 1C5IA 2EXIA 3WUDA 3U1XA 1AL0G 2Y8KA 5HCBA 3K77A 4D7SA 5FPXA 2ARCA 4NIDA 2WNVC 5LA2A 2IXCA 1CX1A 1LGBA 1AR92 2A6WA 3OBAA 1W0PA 1LOFC 1HX6A 2XHKA 2XVGA 5FYIA 4LHNA 5FOBB 4MZUA 1WKYA 1ZBA2 1PVC2 4LK6A 4TWTA 1POV3 1OSGA 1D4M1 1VBA3 3IDEA 3DF0A 3UETA 1HB3A 3BVCA 2VAUA 4AVAA 1D4VB 2QQNA 3T2TA 2W5FA 1HXS1 1QJY1 1SBFA 1V00A 3ZYPA 5HPOA 1OLQA 4XDPA 1WGPA 3ZMOA 3V0AA 3P3PA 4KU7A 2GZWA 4IESA 4W50A 2HWD3 4Q8LA 3O1MA 3MGUA 1VRH3 3ZOIA 2PAMA 3ZXEA 2P4EA 1W9WA 3APBA 3WDTA 2YYOA 3WT3A 3POJA 4Y22B 3KGZA 4BMBA 1OFNA 2VCAA 3SISA 3VKNA 4AVTA 2J22A 2YFZA 1G86A 5FXWA 1NA1B 3DECA 4NAOA 5DDJ1 3SEEA 3Q8BA 2QCSB 2DVDA 3J9SA 4MGSA 4YNIA 5ACA3 4Y1VA 2XWJB 3ILNA 5AC92 4ASKA 2RS13 2XJUA 5C4WB 2X5IB 2CU5A 1ODMA 4BLIA 1S55A 4NAMA 4MVTA 1D7PM 3BB6A 3OB8A 2QZ2A 3LA7A 4GIQA 3T30A 2GSYA 3VBSB 3MZHA 3IDBB 2VULA 5D8AB 1OOPB 1V9U2 3ZYFA 2OA2A 2VZSA 5IATA 2VZRA 2X09A 4IEUA 1HRI1 1REEA 2CHHA 1BMV1 4GD4A 5C3SA 1ULDA 4AAPA 5FLJA 2WZ8A 3AKPA 4P9YA 5F39A 3FC0A 2WABA 1LESA 4Y3OA 3CF6E 1I5PA 3SITA 2BVVA 5DZEA 3DUIA 3RZLA 2RJ2A 3M7AA 2D3SA 4YVSB 2R1DA 1H1MA 4E8CA 1RITA 3PTYA 1IQAA 3OUIA 5CB7A 2JB8A 3ME2A 3WG1A 4EE2A 1CONA 1OMIA 1HW5A 1R1A1 4AL9A 4Z92B 2F17A 2W92A 5EQUA 5FO9B 4Q4W1 4UFJA 2BOIA 1W04A 2GC2A 2PHLA 2WFF3 2YBPA 2ZGUA 4QPWA 4FFGA 4HKWA 2BWCA 1W9TA 4KWUA 4OI1A 5I8YA 2VECA 4XILA 4BK5A 4FXKB 3TEWA 1FV2A 4META 1IG0A 1ENXA 1SFNA 1VE0A 1J84A 1ULEA 1ZBE2 4M3CF 4P5HA 1RUF3 4B29A 4YM3A 3GZTB 5IVFA 3EJKA 5A7WB 1KD7A 2WINB 1B35A 3MLKA 3TN93 1SG3A 3VV1A 1AYM2 1DU3D 2R043 3MIBA 5GKAC 2ATFA 2EIEA 2YC4A 4L0PA 4OZXA 2A3XA 3VKFC 5F1RA 4LQRA 5IJRA 3SKJE 3VKOA 5LBCA 1EPZA 2JE9A 2PFWA 3DXTA 4JX0A 4NVPA 1K5MA 3C7OA 2ZHNA 5LA0A 4I0WB 1UD1A 1W05A 5FBJA 4LTAA 2B4KA 3H42B 3VBFB 2HH9A 2W47A 5FZ0A 3TOJA 4EJRA 2FQPA 4XF1A 4WVMA 4N53B 2EALA 4GA9A 2AUYA 4R9DA 2Z4FA 2VR4A 2W2IA 1AR82 4M4PA 4XFIA 5FPVA 3WNLA 4QDQA 2W1SA 5JZGB 5CFCA 2QQPA 4QXHA 1G7YA 1COV2 3BPSA 1OQDA 1GQPA 4QT6A 5FZBA 2ILMA 2D6OX 5CFDB 5JI9A 3OUJA 4LITA 1UYXA 1UKGA 3H0OA 5EXOA 5EYYA 4F3JA 5AC91 1W2NA 5K0UB 1SDDB 1POQA 2CDOA 2X29A 1NY71 4QXCA 4IGPA 5LB6A 1LKNA 2JE7A 3WDXA 3DPRB 4CCNA 3ORJA 3N9PA 2R0HA 3O7OA 4RFRB 4EWAA 1U5ZA 1WLTA 1DGWX 4NIIA 5GM0A 2BVBA 3QACA 4PF5A 3RMYA 4WBBA 1BEV3 4OVEA 4PQ9A 3ZYRA 5FP7A 3DL3A 3AP6A 4EQVA 4S2FA 5JCTA 1VBA2 2UYBA 1FXZA 4LOSA 2WSUA 1ZZ9A 4TZDA 3I8TA 3ZFGC 3I2OA 1JZ6A 4QD2A 4Q29A 2EXJA 4IEWA 3T3YA 4RS5C 4ARYA 3ZDVA 3SNMA 3VD7A 3E97A 3WV6A 3IM0A 4PJYA 2HWD2 3OJBA 2OZ6A 1MS9A 4CEYB 4YZ2A 1VRH2 2C0ZA 5T3NA 2EXHA 4NN0A 4HL0A 5BNQA 1DFQA 1Y9GA 4YZ1A 1QIQA 2P1BA 2ZGTA 2NLRA 4N53A 1VBC2 4V2VA 2V09A 4D6SA 2ZTNA 4J1XA 1W90A 1VBE3 1ZZBA 3ASIA 1OLME 4RGKA 1ZZ6A 4UYBA 5ACA2 4B7KA 2RS12 5J36A 1JHJA 2EICA 1PGW2 3OOXA 1XJAA 3MLLA 5KHHA 2B9UA 2Q5TA 2ADDA 4LOTA 1FMD3 5GLZA 2W39A 5FY4A 1D0HA 2RG4A 2P37A 2WDBA 3K48A 4R9BA 5EFUA 2B42B 4WM8C 3BIWE 5FP4A 1ENRA 1GNZA 2MEV3 4NRMA 1H8TB 4JC1A 1WCUA 1HV0A 5KXCA 1UO9A 1BYHA 3N9QA 2HEWF 3HBZA 3O0VA 1NXMA 1Y7BA 3FL7A 2ZGKA 4BU2A 5KXEA 3P1IA 4LE4A 1H8VA 3TNPB 1FX5A 3GALA 1W2TA 2D6PA 2CY6A 3IN9A 4FPLA 4Y22A 2VVDA 4UFKA 1NCRB 4YW5A 2O14A 1S0IA 2WS93 3WXPA 4AHWA 5EIYB 1LR5A 1COV1 2QZ3A 3B01A 4DS0A 1GZWB 1YQ5A 4MGKE 4UBGA 1NA1A 4PF1A 3LGRA 2C4XA 5ANQA 4C90A 4YLZA 2DUQA 3LD8A 3MF6A 2YU2A 5C4WA 2X5IA 3WDVA 2ES3A 2ZEWA 1W03A 1CWPA 3TN92 1A8MA 2RMU3 2YPDA 3H1WA 3LFIA 4L2NA 1Z0HA 3V64A 3MV01 2R042 3A0NA 4J25A 5FRAA 3VBSA 2BUKA 5D8AA 5M0TA 4YG0A 1OOPA 4XFGA 5BY5A 2ZGRA 4YVWC 3LIHA 4ZXEA 4NIHA 2PHTA 1POV1 3S7EA 5C8WA 1RIRA 2VE1A 2XJRA 2V4VA 2B9VA 3NJZA 3VB9A 2XLFA 5I8SA 3S5AA 1F31A 1HQNA 2OUJA 2YXSA 4Q0QA 4QPYA 4YVSA 2WUHA 2HWD1 4AHZA 1W8OA 1AR63 3CMGA 4C91A 3AP5A 5FBZA 1JU3A 2JG8C 5IVJA 2Z2SB 1W8NA 5CZKA 1F35A 4IERA 5C3PA 3U4SA 3WQ7A 1DGWA 2JDHA 3AVRA 4A7ZA 3QBQA 3FUQA 3W20A 4JTNA 3UGHA 4CUBA 1SZBA 1EUTA 1VJ2A 2BBAA 5ACA1 5KHIA 2RS11 1PO13 2RS51 1RXFA 1PGW1 4GULA 3Q8EA 5IK7A 2EAAA 5A7WA 5G04L 4ZXKA 4XYXA 3GDBA 1W99A 1GQGA 5FZ6A 1N1SA 3WW1A 2GNBA 3LSEA 1W06A 5LASA 2WYSA 3FJSA 5A7QA 4D3WA 2BDRA 1N1VA 4IEOA 4O9GA 1BEV2 4G4FA 2QUOA 2VUAA 2LM3A 4IW3A 5FZKA 5J96B 1CR7A 3NVCA 3SHRA 1AYN3 5CISA 2WR9A 1ULCA 5CEHA 2XJTA 3VBFA 4BH9A 4YGDA 1LJ7A 2RV9A 1Q8VA 3DV8A 1JZ8A 4Q1PA 5C3OA 2EF6A 4W6YA 3O14A 3M3IA 4FP2A 1QY4A 4EROA 1S1AA 1W8HA 5JAXA 4MUVA 2XMLA 4JV4A 2FMDA 2WFF1 1DGRA 3VBHB 1SACA 3PIGA 2O1QA 1D2QA 5JZGA 3MV11 1UX7A 1O5UA 4KGQA 4RA0A 5CFDA 1WLDA 2UYAA 4AW7A 1ZRIA 3AZXA 3TBDA 1ND2C 1RUF1 5K0UA 5L9VA 3TN91 1W9FA 1NE4A 5JPMB 3DPRA 1FMD2 1WD4A 2UWBA 4XCBA 2XDVA 3BGAA 1YC61 1YNAA 3KV4A 4HVRA 1TME3 4KU8A 5SV5A 2VXJA 2WLQA 4XAAA 4CDWC 2GDFA 1G9AA 4HG6B 1JZ7A 3D0JA 2CYFA 2R073 4A2UA 2WNUB 3HMYA 1HRV3 1QF3A 4DUWA 5LY1A 5FYHA 2SBAA 4M01A 4OHWA 4UOJA 4MSVA 5I0SA 1WBFA 1G6NA 4NPMA 4ORFA 1CQ9A 5LK5A 3BCWA 4B1MA 4CEYA 1ENQA 5G05L 4URAA 3ACIA 3N7LA 4NHXA 3BOPA 2ZGLA 2D40A 1ND3A 3M70A 4BIFA 3BALA 4LO8A 4P9LA 3KT4A 4YM1A 5FP9A 2BGOA 5FWEA 4A44A 2WS92 2EXKA 2VNOA 4IGOA 1H2LA 3VZJA 1O5LA 4NE9A 3AZYA 3SXWA 5IAXA 3VBUB 1OF4A 4FI9A 4IV1A 4R9AA 3O1UA 3LZZA 2QFEA 1UU5A 4E2QA 3POWA 4OQ8A 3GHNA 4DRVA 2Q4SA 3CJIC 4OHZA 4PDWB 1UY0A 1O4ZA 3VDBA 4K8RB 4CPBD 4NROA 2XKOA 2RMU2 5E89A 5FYBA 5FZDA 2R49A 3J7NA 1XOYA 2AACA 2NM1A 1I1EA 4OHYA 4KQ7A 4E2GA 2UWAA 2W46A 1V70A 3PURA 4Y1YA 3AMHA 4QPIC 3S57A 1LECA 4Y5SA 3EHKA 1J1TA 2RJKA 3H7JA 4XMIA 2NN8A 2YG0A 2WSVA 2DF7A 1H8TA 2BFUL 1QMJA 3DCQA 5EJ3A 5FJHA 4AK3A 2BRTA 3BYWA 3NAPB 4HANA 4FXGB 4BYYA 1WW7A 1AXZA 1DHKB 5FQ0B 1LHUA 1QJX3 3IDCB 3M3CA 1AR62 5JXHA 1CESA 1ULGA 1URXA 3T0AA 2JICA 4XTPA 5J98B 4MGIE 3CJXA 5J48A 4QU1A 3I97A 2UY9A 4XMAA 4RD7A 5FMCA 4BM8A 1NCRA 1C8M1 3THPA 1DQ2A 3WF4A 3SC7X 2WYFA 3ETPA 1OVSA 5CKQA 1GZWA 5ABJB 1VBE1 3ZXFA 3OGVA 4NR1A 3FFZA 3IMNA 1SFYA 1L7RA 1S0JA 3RZKA 4XFAA 1W6OB 2CNAA 5D21A 1PO12 2OIIA 2VZQA 5FAXA 1T6BX 4EWEA 4QX2A 4XTMA 3DEMA 2NMNA 2QTWB 3ZFEC 4BA6A 5DAXA 5IVEA 1LHVA 1FMD1 1GV9A 1IQDC 1OHFA 4LKSA 1XNTA 2B45X 1UY2A 4HKLA 1J59A 4FTBA 2G9ZA 1W8TA 1YFYA 1K5JA 2MEV1 1O59A 4X8NA 1HXS3 5IVVA 1AYN2 1WLCA 1GWLA 4LA3A 4QGMA 2Q8OA 3NSTA 3UJOA 4AGGA 1CD3G 1JHNA 1S0CA 1KS5A 1DP0A 2JXAA 2ZZJA 2XBO3 3SH3A 1JZ4A 5EWSA 1JYWA 4YYOA 4XJ9A 5FLHA 4N9HA 4NHYA 3Q8FA 2WAOA 1K5MC 2RR11 2ZKNA 3CIHA 3HQUA 5FZ4A 4GWMA 4JKKA 1ZX5A 3L2HA 1ZNPA 4YW7A 3WDWA 1QEXA 3B7MA 3IT8A 1EPWA 2CV6A 4YZ4A 1NUKA 3K51A 5FY9A 3EMRA 5DDJ3 4WVVA 1GWKA 2E31A 4OHXA 3HQRA
chains in the Genus database with same CATH topology
1JUHA 1VB2A 1CJDA 2DYCA 3N7KA 3PMEA 2HKXA 3MW4A 1J58A 4COUA 4BHPA 3X29B 1OPOA 4JQRA 3RYKA 2GMEA 2TNFA 2Z5WA 3ZVXA 4NWWA 2XVLA 1FNYA 2ZMNA 2FMYA 2EA7A 2IZWA 1REFA 4D7TA 1Y9QA 1OD5A 1TME2 3POYA 1MZFA 2WC2A 4Z07A 2D6KA 3KQRA 3B5LB 1T6GC 2A75A 4RQPB 2H6CA 2R072 2WT0A 1I5ZA 2R30A 3UKTA 1HRV2 2BGCA 1AX1A 1M06G 1NE6A 4QU2A 1R1A3 3ZXKA 1J1LA 1GBGA 3HD8B 2VH9A 2ZCWA 3VHRA 2E63A 3VBHA 2D3RA 2DV9A 4PIYA 4WV8A 1V6OA 2GAUA 2E7QA 1JW6A 3HIFA 4BPZA 4N7IA 4D94A 3ETQA 5HCFA 5C6CA 1VBB2 5GALA 1PO11 2QDRA 4N53C 4I02A 4AI3A 3JZVA 1B09A 1N1YA 2R1BA 4IQPA 1CPMA 2C5DA 3B02A 5BNOB 5DUUA 4PIZA 4AEDC 4Y1UA 3FBYA 1RUC3 4MXVA 2CGNA 1ASJ3 4GXLA 3WP3A 1QWRA 3I54A 1AYN1 3T1MA 1LTEA 3BPZA 2PHWA 1N3OA 2GC0A 1H0BA 1CAVB 2WNUA 3VL8A 2WWSA 5KHGA 2QKDA 3ZMNA 1QJX2 3KSCA 3E6BA 3ACLA 4HVOA 3RWNA 2ARBA 1ZRDA 4OFGA 4DRRA 2A6YA 2CL2A 1XU1A 1UIKA 4W65A 3VBUA 4E4ZA 4ZU5A 3ZN4A 2DUPA 3N3HA 1LOCA 2I74A 4PDWA 1KRIA 1XYNA 1NA1C 4XPVA 5H9QA 4R52A 1DYPA 3WW3A 1QXPA 5JPNB 4Y5Z0 2DCYA 2I07B 1S0BA 3EBRA 2AZ5A 1HXS2 1QJY2 2R071 2VOWA 3I2DA 1OOPC 2H0VA 2ZA9A 3NAPA 4ASMB 5FTTC 1HRV1 1KJRA 1SEFA 2XBO2 5FQ0A 3WP5A 1SBDA 2VQAA 1Z7S1 2B5HA 4S2DA 3VLBB 3LA2A 1QH7A 5E8AA 4I2OA 1R1ZA 2QDNA 3N7JA 1OA2A 5DDJ2 1MQTB 3FLTA 3LA3A 3ES4A 1MS3A 5ABJA 1H4HA 2W52A 1RUE3 4G3YC 4IL7A 1U5IA 2W08A 1XRUA 1C8NA 1W6OA 3H1MA 3W59A 2DCTA 4PLNA 5J7MA 1WA4A 2VPVA 4ES8A 4XQ4A 4LBOA 4JGYB 3WD5A 3I7DA 1DZQA 4HKOA 1FI2A 3ALQA 3RG0A 2IC1A 3E5XA 1GFF2 4FPOB 4MGYE 4A3XA 1CJPA 3S0MA 1LOAA 2O8OA 2XUMA 1PIV1 3VBOB 1R1A2 2UURA 4MX3A 1RTVA 1C57A 4LBQB 1DYKA 1NQDA 3IIAA 1D0GA 1JUIA 4M3CB 3KCCA 3UKVA 2VNRA 1PZ7A 1OFSA 2D6MA 2CGOA 3AMMA 3IKWA 1H1IA 1PNFA 1IOAA 3Q9OA 4IEYA 4ZU4A 3ENRA 4N90A 4CDUC 3MIGA 1RJ8A 1RUG3 5CFDC 2H0BA 2HWE1 1NCQB 3WZ1A 2BPA2 2PAKA 1RUC2 1SCSA 1BKZA 1ASJ2 5K0UC 1L3JA 5J09A 3JQXA 4FSJA 1OI6A 1YIFA 2D98A 4RQPA 5JOWA 1WMEA 2QVSB 3DPRC 3M4FA 4XOGA 4YZ3A 4CDQC 4UW6A 3U11A 2XBO1 4B4QA 4UW4A 1H9PA 1CN1A 3B3QE 4RHV1 1KJLA 1RUI3 2E7TA 2QJVA 4J1WA 3ZX7A 3PMSA 1UF2C 4A7KA 1OKQA 3E5UA 3RI8A 4CEYC 5BNNC 3O0XA 2RS53 1PM7A 3OF1A 1ND3C 1QNWA 4I30A 1V6MA 3ZFFB 4GB33 1NY72 4I3GA 2D5FA 1QJU3 4JRLA 4ATFA 1DZRA 2Q0AA 4IV1C 1NG0A 4LLFA 5BNOA 1ULFA 3ZSMA 1X8MA 3AMNA 1H2MA 1U5XA 2ZMLA 1H9WA 1F2NA 4K1ZA 3BODA 5FCCA 3D82A 3FBMA 4YFWA 1CAVA 2JX9A 5I0TA 2ZMKA 3OY8B 4GH4C 3VDDC 2V5YA 1H30A 4XJZA 2YGMA 1H8TC 3RI9A 5BNPC 4JGZC 3AB0A 2IFWA 2ZAHA 3OBRA 4ATEA 2NYYA 3PNAA 1RUE2 4NHKA 3OYWB 1IKQA 3A4UA 1BBT3 2A5ZA 1UPIA 4Z2WA 4MV2A 4LBKA 5LRRA 3FLPA 2P3JA 3QCWA 1QQP3 2W68A 1RUC1 4Y1XA 1ASJ1 1UMZA 2PLV3 3LKJA 1QXRA 3VUOA 1PO23 3AYEA 4IV3C 3B93A 5BXXA 5AFBA 4FPHA 4K21A 3U4XA 2YROA 4DFSA 3BU7A 4Q4Y3 4FT8A 4GWNA 4JVAA 2K9ZA 5H9PA 1PZ9A 1YIPA 3VHNA 4WVWA 1MQTA 1IGOA 4YZ5A 1CAUB 2ZBJA 3AYCA 4XIOA 4DY3A 4O9EA 2XL9A 3GBFA 5CNAA 1Q8PA 1W0OA 2CTVA 1XYPA 5FLIA 5BUVA 1LB2A 2WFPA 3ILRA 1RUG2 3A0KA 1GNHA 1W6NB 5L36A 1BVP1 1S0EA 4JGYA 1C1FA 2GC3A 5CA6A 2I2SA 4Q4X1 5GLTA 4D3WA 2AGSA 3VZOA 1GZCA 4LUKA 1VBD3 5HXVA 4AI2A 4AQSA 4N43B 2O8QA 1M4WA 1MS5A 4FO9A 4PLOA 4LNVA 3ZN6B 4BLJA 2NP0A 3AK0A 2W0XA 2JENA 1WBLA 3G7DA 3GBGA 4TLFA 1FYUA 3AKQA 3H7YA 1QOOA 4IXLA 3AMQA 3VBOA 4Q2FA 4LBQA 3OCPA 4XFHA 4E9KA 1AR73 1RUI2 1C8M3 3WP6A 1SMVA 1C28A 2B7YA 4M3CA 4COWA 3ILFA 4ONUA 2VW1A 1WW5A 4ASLA 1RUE1 2RS52 4GB32 3CU7A 4UBHA 1QJU2 4FTSA 3ZO0B 2JG9C 2ZGMA 1SLTA 2VVEA 4BMEA 3RRDA 1NCQA 5LEJA 1KQRA 3VBRC 5CG9A 2YPJA 5K7PA 1Y43B 1H4GA 1X50A 1SLBA 1ALYA 4L97A 5JVVA 2D6NA 2HEYF 1CAWB 4QQPA 1S0GA 2RR13 1C5HA 3WNXA 5FDBA 4JDNA 3R05A 2WFF2 4HN0A 3VZMA 4C0HA 1S2KA 5C8CB 1MEC1 4RFT0 4XBLA 1LOEA 1HKDA 1YRZA 4LA2A 2G9FA 4I01A 1LU1A 3NV4A 3WINE 2Y0IA 1LHWA 1X7NA 1RUF2 3JU9A 4BQ1A 3ZFFA 2OW4A 4AI8A 2QE3A 1BBT2 1DQ6A 1RUG1 3MW2A 3VBUC 5CADA 4WM7B 1C3HA 4C1WA 1AZDA 1QQP2 1PK6B 5GZEA 1GICA 1YJKA 1HDKA 3AP4A 2PLV2 4PLMA 5JR7B 2AYHA 1W6MB 1JOJA 4IEXA 4L99A 2VOXA 5H9SA 3WHTA 2P2KA 4H14A 3UK9A 4WZCA 3OY8A 2Z79A 1RUOA 4KGGA 4P9XA 3OGGA 4Q4Y2 3CL1A 5JCTA 4QHBA 4CEWB 1RUI1 1J3PA 4K7JA 3NAPC 4RR3B 1U0AA 1W6QB 2ZHKA 4FCAA 3FLRA 4H7LA 4Y24A 3TWIA 3OYWA 4Q26A 4YW1A 4GB31 3AX4A 2AREA 1QJU1 1KS4A 3RZZA 4ISQA 5FO8B 2PHRA 1PZ8A 4CP1A 4PIXA 5DXDA 5A33B 3KT7A 3SH5A 1ENSA 3MIFA 2YDEA 2GMPA 1VB4A 4YM2A 1AX0A 1MS8A 2PYTA 1VBD2 2O0OA 4HK8A 2A3WA 4HPKB 4XF9A 2VQ0A 1JYCA 3VKMA 1HQLA 3TAYA 5CU1A 3ZFGB 4V1PA 4FPFA 5GZDA 1RUNA 5C9AC 1WUVA 4RS5B 1HQWA 1AR72 1C8M2 2XJQA 2LTNA 2VMIA 3MFCA 4FPGA 1VBE2 4WZFA 1FNZA 3MEPA 1CAUA 3AZVA 1I9RA 4AFCA 1GYKA 4HSLA 4QQLA 3WCSA 3POSA 4LO6B 4BE3A 1QKQA 1W2UA 1BBT1 5CAZA 2E7AA 5AVPA 1WD3A 3VN4A 4CP2A 3FWEA 5I0RA 1QQP1 1W6NA 2WL1A 2Z42A 4U2AA 1RUJ3 2DFCA 1R091 2MEV2 2RJLA 4HBNA 4AGVA 2PLV1 2GNTA 2D7FA 1PO21 4N43A 5DZGA 4WM8B 3ZN6A 3M3OA 2ZABA 3MLJA 2A71A 3JBG1 2NMOA 4BWOA 3AYAA 1DQ5A 4FAHA 2WZPP 1Z7S3 2R0FA 3L2YA 2PAEA 2BNNA 3CLPA 4J6GA 2RR12 4QPGB 5DG1A 4Q4Y1 4DMIA 4RGGA 2VUJA 3PJYA 3WHUA 1NQJA 2XB6C 1SLLA 2IXIA 2RHPA 4XETA 3SCFA 2KXLA 4LBMA 4LO4B 2BQPA 2YUEA 3O0WA 1XU2A 2RE9A 1IKPA 4GMP0 1IZ3A 4AHYA 5JSPA 4S2HA 2OYZA 3HR9A 1YFXA 1GQHA 2GN7A 4EN8B 1JXNA 4DPNA 5CIRA 3CO2A 4M0NA 4JRAA 2H6BA 1W39A 3AZWA 1S0FA 4GKXA 3D6EA 3KLSA 3ZIWA 1XXNA 1VBD1 4YVWB 1HLCA 1YLLA 5IT6A 5BNOC 2VG9A 4ZKTB 3ZPYA 1CAWA 1PIV3 1IS5A 2YV8A 3O5SA 4X6RB 3ZXJA 1GZ9A 5GLWA 5HI0A 2BBVA 4JAAA 1SBEA 1AR71 4HK9A 5C8CA 3OGJA 1DGRN 1O4YA 4QGLA 1UL9A 2Z69A 3AKRA 2XL7A 2XJSA 2IFRA 1C4RA 3AKSA 1RINA 1AF9A 4SBVA 1SLCA 4QM8A 2HWE3 2PA7A 3NW4A 4P9IA 1U12A 4M3CE 5T50A 3PJQA 4EN0A 1YYNA 4WM7A 4OUMA 3RJRA 1PK6A 1EYBA 1B35C 4FPYA 3DGTA 2KA3A 1U5YA 4DY5A 1QH6A 4Z1VA 1W6MA 3B94A 4F83A 1XNBA 4RHV3 4RGAA 1TMF3 1YJLA 5LK7B 1IPKA 2Q1MA 2CGPA 4XQWA 4CEWA 4RR3A 4ISRA 4YW3A 2Q30A 5T54A 1W6QA 2ZX0A 4OI2A 4YW2A 3I4IA 3UL2A 2C9AA 1O3RA 4Z8BA 2E9QA 2VW2A 1DQ0A 1QHDA 2WZR3 5CFCC 5BV6A 1YHFA 1PMIA 3MIHA 2BNMA 5DUVA 5T5LA 3DKWA 1AVBA 3AXDA 4B4RA 1MQTC 2B39A 1HV1A 4Y4YA 4B4PA 3GHMA 4XXPA 5A33A 3J8F3 1BQPA 1LODA 2VGDA 2R32A 4Q4V3 5AVAA 2XKPA 2XVKA 3RYRA 4HPKA 4MGZE 3U0ZA 1FOD1 4W6XA 1GLHA 4CDWB 2XLAA 2PQQA 1H2KA 4JGYC 3VHOA 1Z7S2 1W6PB 3RYPA 3ZFGA 4XBQA 2DWRA 4CDXB 1IS3A 4PBPA 5F6LB 2P3KA 4RS5A 1LEMA 2IXJA 5K8SA 3URFA 1VR3A 3U10A 2G9GA 2DVGA 4QMAA 4WVZA 5EV7A 4Q0UA 3S30A 1AXKA 4CZSA 4XF3A 4AYUA 5E16A 3RMXA 3CJIB 1AL23 3KZ4C 1PGL2 1ZA4A 4B8EA 2ZGSA 4F7ZA 2WQ4A 1WCKA 2JKBA 4XFCA 5JOYA 3R0RA 1UZZA 4QPIB 4WM8A 3KCYA 3WP4A 1KFXL 5EYXA 1YI7A 1PIV2 2DCZA 4AFDA 2ZGNA 3BOWA 4QPGA 4AG4A 2HWF1 2WLPA 3USUB 1XE7A 3AYDA 2GNMA 3OD4A 3MFAA 3U07A 3THTA 2SLIA 4KBBA 3VL9A 1J3QA 2RM23 2ZJCA 4RSUA 4QGNA 5F9TA 1QDCA 5C33A 2PTMA 3B9IA 4KWKA 4QXKA 2QNKA 3CNAA 5GJ6A 1SQ4A 3AXEA 4M00A 2HWC3 2DVAA 3ZYJB 2GC1A 3KB5A 4LBNA 2HWE2 2FHRA 4AHXA 1EAH1 1UN1A 1WCDJ 2V73A 2X5IC 5C4WC 4Q4X3 1F9KA 4Q0PA 1RUJ1 3ZFEB 1MVEA 4Q1RA 2DCJA 4AE2A 1QXJA 3JB8A 5FMOS 3M2MA 3VBSC 5T5JA 2UWCA 5D8AC 2VOVA 3WQ0A 2WKKA 4YVWA 4OLLA 1Q5OA 4CRQA 4LT5A 1N3QA 3ES1A 4PBOA 5TSWA 3WW4A 4XZPA 3H3UA 4RHV2 1V9U3 5HBAA 2EAKA 4HFSA 1LGCA 1R081 3NKTA 2X53S 2EIGA 3ZSEA 2PHUA 5I8TA 3O12A 1O3SA 4YVSC 1FT9A 1H1AA 4QX5A 1K5MB 3M8LA 4GQ7A 1SCRA 1WW6A 5HCAA 3HWJA 2BTVC 4X6QB 2IWGB 3MDPA 4Q0SA 1UX6A 4FOVA 2WZR2 4KNCA 2VOKA 1Q8SA 2VMHA 2YGLA 3BTAA 1O7FA 3HT2A 1CGPA 1POV0 1PGL1 1FPN1 1A78A 1OQ1A 2RS31 2IXKA 4XHBA 5L19A 1MZ5A 1RC6A 4Y20B 1VAVA 3J8F2 3GZAA 5F6KA 2PN5A 4R4XA 3LCPA 5GLUA 4AVSA 4LLOA 1ONAA 5AFEA 1S2BA 4AWDA 2YY1A 1NXD1 3LAGA 3VBFC 1MEC3 1UU4A 3AKTA 1IS4A 1DLLA 3VZLA 2BYVE 2IXHA 1EV11 1MS0A 1XNDA 3RDIA 2TEPA 5JZGC 4K1YA 2ZAAA 1JYIA 2WQZC 4BOWA 1ZYBA 5JIUA 1O91A 1AL22 1QNYA 1DIWA 3H9AA 3KCXA 2GH8A 2D43A 2I45A 4AEDB 5E1RA 4EN6B 3ZSLA 1ZREA 2VY0A 3WG3A 2DUOA 5JDBA 4CDWA 4GMP1 2AH2A 4KL1A 1TMF1 1W6PA 3WW2A 2D5HA 1A6CA 4YGCA 4CDXA 4D69A 3AJYA 4N43C 3ZXLA 1ZM1A 3AFKA 4MXWB 1YO8A 2RM22 4X8PA 4IEQA 2GNDA 4YG3A 4XJAA 4FVVA 3AFGA 3LOIA 5CBLA 4LR4A 3WDYA 2WZR1 3JB4C 2HWC2 5GZGA 1RJ7A 2TBVA 5FFOC 3CJIA 1VBC3 1NLRA 3IPVB 1FV3A 3J8F1 2ETEA 4I3PA 4Q4X2 4BCUA 2K2SA 1J3RA 2E53A 1DQ4A 4Q4V1 4QPIA 2YMZA 5FREA 3R4DB 4B3NA 2ZKLA 2DCKA 4COVA 5D1IA 4XFFA 4W6WA 5EZWA 2R6QA 5L7OB 1PVXA 2BWAA 3RNSA 3USUA 2VVFA 2AENA 1BVVA 1LHOA 2LUWA 4COYA 3OPZA 4H3WA 4NOTA 5JI7A 2ZS6B 4NPRA 1DF0A 3OTFA 3G6JB 3RSJA 3USSA 2JDZA 1NCRC 1RHI3 4HZFA 3WCRA 4JDMA 1RVF3 5C8CC 2FZ1A 2XPJA 5I91A 1AL21 1KXGA 2DTYA 4CP0A 1R093 3GNEA 4HVQA 4JCKA 3ZFEA 2BNOA 1Z78A 1Y3TA 3LWCA 3WUCA 1OA3A 3JBG3 2P17A 1V6IA 4WM7C 2MNGA 3SLIA 1WMFA 1AR91 1PK6C 1G9DA 5JOZA 4TYSA 3FUOA 2WA3A 4A7YA 3V0BB 5CVRA 4XQDA 2MHFA 1ZBA1 1PVC1 2NQYA 3QH6A 4P9GA 1MEC2 4XJWA 2RM21 3R4SA 5J3UA 2ZPXA 3WG4A 2DURA 4L92A 1N1TA 3R6SA 5JWPA 3N7MA 3NO8A 5T52A 3HQXA 4HSJA 3MIDA 4CEWC 3V56A 5K9YA 3KS7A 2HWC1 3ZSJA 1BXHA 2FBEA 4RR3C 5KC6A 5A32B 2DFBA 2WNVB 1GR3A 2WA4A 5BPXA 1ZZ7A 5JMCA 1TEIA 4CDUB 4Y20A 1CAXB 1Q8QA 2AR6A 4OI4A 2ZGPA 2C1FA 2D97A 3FE5A 1YCIA 1UU6A 4AEJA 4AQ6A 1F8VA 1LU2A 4DQAA 2JECA 2R063 1F5FA 4C1XA 1EP0A 3J26N 1V9U1 3KM5A 3L9JT 3NL1A 3VKLA 4CDQB 5LEKA 3NKGA 4EV0A 4B7EA 3MYXA 5KXBA 4AVVA 3OD0A 4N9IA 5IK4A 2ET7A 3QD6A 3D5OA 1PHMA 2FZ2A 4G9SB 2ZACA 3ROUA 3ZYIB 4DINB 3E6CC 4DB5A 3VBHC 4SLIA 2R16A 2NPIA 1CIWA 3D0SA 1YUDA 2A70A 4E27A 5BNNB 1TQ5A 4Q27A 1ND3B 2ET1A 1DQ1A 3D4KA 4LEJA 3ELNA 5FO7B 4IV1B 3RJ2X 2JJ6A 2VU9A 1TNFA 3H3ZA 2DVBA 1FAYA 1Q8OA 4AEDA 1ZBE1 4YGEA 3N36A 1AYM1 1VIWB 2YZ4A 1A8DA 4BZ4A 4D7YA 1MS1A 1NLSA 4GH4B 1RGSA 2WNUC 3VDDB 4ZU7A 4MXWA 3SMHA 1RMU3 4OUSA 4LBJA 3PVOA 1XNKA 4OULA 4QPGC 5BNPB 2X8KA 2ZX4A 4JGZB 1WCSA 2CWMA 4KG8A 3W9AA 4TSVA 1LRHA 1RHI2 1IS6A 1RVF2 5LRSA 1F5JA 1REDA 5KXDA 4Y26A 2OUHA 1AR81 2ZX2A 2G4IA 4R9CA 2B8MA 2GMMA 4QM9A 4C0BA 1R092 1VAKA 2WNEA 3IPVA 3KD4A 4L9BA 4LUMA 4PDWC 4Z82A 3M3QA 2KM2A 1LOBA 1PO22 4UW5A 1BK1A 1FOD3 1XNCA 3FHIB 1QDOA 1Q43A 3JBG2 3RPQA 4COZA 3R4UA 3LOBA 3SCGA 3E6DA 3SCHA 4IV3B 2VNGA 3MPBA 2Y0OA 1V6NA 4P9JA 4LULA 3TRSB 5L7OA 2D6LX 2ZX3A 5DG2A 1VBA1 4KWJA 4AVCA 3NV2A 3I59B 2GH2A 5JSRA 2LALA 4EWDA 4INDA 3S7IA 1NYWA 1G9FA 1BJQA 4K8FA 1G8WA 3GZUC 1VRH1 3UKNA 1AHSA 3H8UA 3LB9A 1RB8G 5ABJC 3ZXGA 3AP9A 5DZFA 1VBC1 3PHMA 4FAGA 1ZRCA 1XQNA 2ENRA 4DNYA 5GLVA 2D3PA 1GSLA 1UIJA 2CWSA 1A3KA 4XE9A 4AQ2A 5DUWA 1NOVA 5DUXA 2XJVA 3N35A 2R062 4E2SA 2DTWA 2HWF3 1VALA 1QOSA 3V0BA 4JDOA 5L73A 1UKRA 4KH9A 3SH4A 1SLIA 3KMHA 3VHPA 3VGIA 3ZSKA 4AQTA 5F5QA 1WLWA 4IEVA 1AJOA 1XE8A 2Y26A 3JD73 1BCXA 1C1LA 1RHI1 3AZZA 3JUUA 3WVJA 1QU0A 1RVF1 5B2GB 3J4UH 3WOGA 5A32A 4DZGA 3MPPG 1EAH3 4FOYA 2HWB3 3WX5A 1GANA 2WNVA