2XG3A

Human galectin-3 in complex with a benzamido-n-acetyllactoseamine inhibitor
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
138
structure length
138
Chain Sequence
ALIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Galectin-3
publication title Protein flexibility and conformational entropy in ligand design targeting the carbohydrate recognition domain of galectin-3.
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2xg3A00
1WW4A 3N35A 1IS6A 4Q26A 2PHUA 5JMCA 5JDBA 2W39A 5T5JA 1AX0A 1LENA 1CPMA 4XBLA 3V0BA 1TEIA 4AVSA 2DWRA 2WT0A 2ZA9A 4Y1XA 1GZWA 1KJRA 4XHXA 3IMNA 4FPGA 4PF5A 2GNMA 2P3IA 3R4SA 4AVVA 3WG1A 4XJ8A 3KM5A 3WUCA 1SLBA 1IS5A 1MZ5A 1N3OA 4PBOA 4AGGA 4LBQA 2V5YA 2VW0A 2Z42A 2VU9A 3OGGA 1CJPA 1MS8A 1ENSA 3JU9A 4FPCA 4GA9A 4XJZA 2GMEA 1AX2A 2NYYA 2DYCA 2ZGOA 3N36A 3Q9OA 4Y24A 3HMYA 2GMMA 1YYNA 2R49A 1G9CA 1MS9A 4OZXA 1UZZA 3O0XA 1WLDA 3WCRA 4YM1A 2G4IA 2ZGQA 4FP3A 3T1MA 1MVEA 4P9WA 2GN7A 2WJSA 3RS6A 3N7MA 5JOWA 1F9KA 3JUUA 2ARBA 1W6MB 2C5DA 3PVNA 2VW1A 4FPEA 1LHNA 2XG3A 2ZHMA 4M3CE 1NLSA 2E7TA 5EYYA 3AP7A 2ZMLA 2VUAA 4FQ4A 1LHWA 5GZDA 3UL2A 5H9QA 3O5SA 1IKPA 4L8QA 4YG6A 3ZXJA 3AZWA 4XTMA 5GLTA 1WD3A 4M00A 1GSLA 2CL2A 3FLRA 3VKMA 2P3KA 2UWAA 4HL0A 3ILRA 4Y1YA 1QMJA 4YFWA 1SCSA 1GZ9A 3ZSKA 5T5LA 4Y26A 2R1BA 3WV6A 2A3WA 3BIWE 2DVDA 5DUVA 1BZWA 1O4ZA 2D44A 2GNDA 1LOFC 3A4UA 5CAZA 3BODA 2D7FA 4LBQD 2R0FA 3HN1A 2DUOA 3R05A 4BM8A 1BJQA 4HANA 3PJQA 1FX5A 1UZYA 2ZABA 2WLQA 4NOTA 2OVUA 1W0OA 2EF6A 3AXEA 3ZSJA 2CY6A 3V0BB 3WDVA 4CTEA 1W6PB 2DVFA 1IOAA 1WBLA 3POYA 1DQ5A 1GZWB 2CWSA 3B69A 4FPYA 3N7LA 2ZGRA 4XMAA 3RQ0A 1UX6A 4XZPA 4AGVA 2ZGNA 3FLPA 3MPPG 4PQ9A 1SLTA 2A7AA 2D6NA 1KITA 1LOFA 2D6LX 1LTEA 2JECA 1W6NA 1YI7A 2BQPA 2WSUA 3AP5A 1D2SA 2A3XA 2A6WA 4I30A 2NMNA 1LCLA 2OW4A 1QDCA 2NMOA 2WQZC 4LBQB 4PCRA 2WT1A 5GLZA 4ISQA 1NXD1 2ZGPA 1SLIA 1FV2A 1WD4A 1A78A 1YO8A 5F9TA 3AZZA 2ZHKA 5H9SA 1HKDA 3M3OA 2WSVA 2FMDA 3WDTA 2JE9A 2P2KA 2ZZJA 5HCBA 4ZKTB 2OUJA 3PVOA 1LHOA 1A3KA 1RITA 1V6OA 3L2YA 4P9XA 5BYNA 1SBFA 2PELA 2CWMA 3OJBA 5JOXA 3WG3A 1S0IA 5T54A 2PHRA 3ZYRA 1QOOA 2UURA 3IM0A 4BOWA 1CQ9A 3AP9A 2AH2A 2GN3A 2DVGA 1QNWA 1QNYA 4JCKA 5GLUA 4MYEA 3SNMA 1DQ6A 1BKZA 1SCRA 1SLLA 2R16A 3O0VA 1WLCA 4AWDA 4YGBA 1AZDA 4Y20B 3PMEA 1G9AA 3VKLA 4H55A 2H0BA 1IS3A 5GM0A 2GNBA 3AYCA 1BQPA 1OQ1A 2D6PA 1WLWA 1FNYA 5EWSA 1HQWA 2R0HA 3AP4A 5DUUA 4YM0A 4CZSA 3V0AA 4YZ2A 2DVBA 1VALA 1GLHA 5GZGA 1MS1A 4FPLA 4KBBA 4M3CF 3RRDA 2WKKA 5E8AA 1AX1A 1HLCA 2A6XA 2A6VA 4ATEA 1S0JA 5T5OA 4F83A 3FBYA 1QU0A 2A71A 1LODA 5GZFA 4FOYA 1VIWB 1U0AA 3ENRA 4JC1A 4YW2A 1FAYA 5L73A 4YW4A 1DZQA 1N47A 2A6ZA 5F5QA 2ZGTA 3M3EA 4GWMA 4XIKA 5T52A 1JBCA 1DHKB 1J1TA 2EXHA 1SACA 1W0PA 1FNZA 1UKGA 2SLIA 4BLJA 1CESA 2W52A 4U36A 3UJQA 3WHUA 4C1XA 4Y22A 3NV1A 2DVAA 4GXLA 4YZ1A 1V6MA 1W6OA 3AYDA 1O4YA 3AYAA 4Q1RA 3USUB 1CONA 3VV1A 5DUWA 1D0HA 2E6VA 2LTNA 3ILNA 1BXHA 4UW4A 4XBQA 5EXOA 3UJOA 3WLUA 5T5PA 5CA6A 2JE7A 4YW1A 4YZ5A 1FV3A 1KDKA 3BOPA 4UW6A 1CR7A 3VKOA 1W6QA 4FP2A 4LBKA 3MW3A 3MW2A 1JHNA 1MR5A 3T2TA 5IK8A 4C1WA 1KRIA 1ZM1A 2JJ6A 1URXA 2ES3A 2NM1A 1V6JA 4P14A 2XB6C 5IUQA 3WOGA 3U4XA 3RMXA 1JN2P 1LOCA 2D6KA 2E7QA 2FHRA 1CN1A 1DGLA 1LJ7A 1LOGA 1G8WA 1V6LA 2DU0A 2TEPA 1DQ0A 1ULFA 1UPSA 2DUQA 3NWKA 1S0FA 2YZ4A 3AYEA 2ZBJA 3B00A 3TB0A 1PZ9A 5LK5A 1UL9A 1C1LA 1S0BA 2VW2A 5T55A 1AJKA 4XJUA 1DQ1A 3IKWA 4FVVA 1PZ7A 1G9BA 1WW7A 3ZXLA 3OY8B 2ZGKA 2D3RA 4FOWA 2JKBA 4UW5A 5IK5A 2CTVA 1JW6A 3IPVA 3WG4A 1ULEA 2EXJA 2R1DA 3AZYA 3V0AB 1MS5A 1LOEA 1YIFA 3MEPA 1H30A 1SBEA 3AZXA 3WNXA 3M1HA 4BMBA 1UN1A 4ASMB 3ILFA 3DGTA 3FUOA 4YZ3A 4DRVA 3GALA 4TYSA 3N7JA 4XJWA 3WDYA 5GLWA 1JYIA 3INAA 4FPJA 3PVEA 1IKQA 4FOVA 2DTWA 1LGNA 1H9WA 3HR9A 3FLTA 1SFYA 4ZXKA 1HQLA 3AJYA 4FPOB 4AGRA 1UMZA 1G9FA 2D43A 2E51A 1LEMA 1FATA 5DG1A 2RHPA 4YGCA 5DXDA 1XQNA 3WDXA 4K1YA 1S0EA 4Y22B 2YROA 2D6MA 3OBRA 3T1LA 1CPNA 1JYCA 3NV4A 3POSA 1W6OB 5GALA 1R1ZA 2AUYA 4DS0A 2ENRA 3WHTA 3A0KA 4GKXA 1DQ4A 3ZYPA 3O12A 3SH3A 4YG0A 1N1VA 3LCPA 4XOGA 1JXNA 4GALA 4DRRA 1LGCA 1LHUA 2B7YA 4R9DA 4XILA 4FPKA 5CB7A 4DPNA 1LHVA 4Y1VA 1CIWA 5IK4A 3I8TA 3FUQA 2ZMKA 2C9AA 2AYHA 5KXBA 1AF9A 1WCSA 5GZCA 3RMYA 3AX4A 2NZ9A 1H9PA 2P3JA 4Z8BA 3WVJA 3CNAA 1YRZA 4AYUA 5GZEA 3IN9A 1WBFA 1A8DA 1CVNA 4XDQA 3ZSLA 1G7YA 2P37A 5JLVA 2AR6A 4M01A 2PHXA 3RSJA 1Z0HA 2SBAA 4U2AA 4XBNA 5CBLA 1GICA 5T50A 4GKYA 2ZKNA 1DIWA 4Y1UA 3W59A 1GKBA 1Q8PA 1MVQA 1Q8VA 3D5OA 3M3CA 1F31A 3WUDA 3ZSMA 2W68A 3B9CA 1QDOA 1RINA 1QF3A 2ZAAA 2P34A 1AVBA 3OPZA 4ITCA 1Y7BA 2EXKA 1C4RA 4Q27A 4M3CA 3NV3A 5HCAA 5DZGA 4YZ4A 4P9YA 4FPHA 2A70A 4R9AA 4WVWA 1KDMA 1RIRA 1LULA 2WNEA 5KXDA 2Q5TA 4K21A 4DQAA 2D6OX 5JVVA 4ATFA 1Q8QA 1GYKA 2V73A 3B3QE 2JD4A 1W6PA 1MACA 4Q8LA 5FREA 1W6NB 3POWA 1BYHA 1LESA 4BQ1A 2A5ZA 5IK7A 2DURA 1AXKA 1DQ2A 4FOQA 1JOJA 4NO4A 3QLQA 3MW4A 1LOAA 4XXAA 1VLNA 4LBOA 1WW5A 4R9CA 2AGSA 3N7KA 3SITA 1GZCA 3AXDA 3VKFC 1ZA4A 5EYXA 2HYKA 2A6YA 1AXZA 1OFSA 2VXRA 3N3HA 4XJ9A 3ZXEA 3ZXFA 4Q8KA 1LU1A 2UU8A 4SLIA 2EXIA 5SV8A 1LOBA 4R9BA 1V6KA 1DYPA 3M3QA 1DBNA 1C1FA 1GBGA 2GMPA 4YGDA 3A0NA 2ZHNA 1AJOA 3M2MA 4FPFA 3BTAA 3APBA 4LBMA 4XJAA 1VAVA 1ONAA 4YFZA 4WZFA 4AVTA 5H9RA 2AENA 5FRAA 3VKNA 2EAKA 2UWCA 5DG2A 1GNHA 2WT2A 4YM3A 1IS4A 1WUVA 2CYFA 4UW3A 2DTYA 3R4UA 1GNZA 1KQRA 4YLZA 3VUOA 3ZPYA 3AK0A 1WW6A 3DUIA 1C57A 2GNTA 3OBTA 1EPWA 2D3SA 1Q8SA 1UAIA 4DFSA 2D3PA 1V6NA 3QCWA 1Q56A 5JOZA 4Y20A 3AFKA 5KXCA 4XTPA 2ZACA 5H9PA 2ZMNA 2PHTA 3ZVXA 2EIGA 4YW3A 4YG3A 1PZ8A 3OYWA 3RG0A 1N1TA 2ZGMA 1LU2A 1AXYA 2E53A 4YM2A 4JRAA 4TZDA 1QGLA 3KQRA 5GJ6A 1SLAA 1DYKA 3H0OA 1N1SA 1G9DA 4LBNA 2ZGLA 1JUIA 4M3CB 2YY1A 4Q1PA 1HDKA 4K1ZA 1I1EA 2LALA 1Z78A 3I4IA 2PHFA 2YXSA 3C2UA 5KXEA 4XHBA 5E88A 1MS3A 3GNEA 2EALA 1LECA 4BPZA 1V00A 2PHWA 2YV8A 1B09A 2W08A 4RL7A 5GLVA 3WDUA 4IQPA 3SH4A 4YW5A 2A3YA 1ULDA 1VAMA 3ZXKA 3V64A 1ULGA 4ISRA 1ENQA 1ENRA 3WZ1A 2KM2A 1S0CA 1ULCA 2ARXA 1QOTA 2GALA 5AVAA 1DLLA 1GANA 3V65A 3UK9A 3TAYA 2DV9A 4Y1ZA 3WG2A 3ATGA 1S0DA 2I2SA 2A75A 3USUA 5DUXA 4PBPA 4XMIA 1Q8OA 2ZGUA 3SH5A 2AREA 3D4KA 5DZFA 1W6QB 1I3HA 2UWBA 3ASIA 3LSDA 4XE9A 3SLIA 3WDWA 1N3QA 1GV9A 1W6MA 4XXPA 1SBDA 1N3PA 2VH9A 2NN8A 2GDFA 3B01A 4YGEA 5DZEA 1F5FA 2JDZA 5JOYA 3D6EA 3SISA 4RA0A 2VY0A 1QKQA 3FFZA 3O0WA 3LSEA 1V6IA 2ERFA 1N1YA 3AZVA 3W58A 2NP0A 1MZ6A 4FQZA 2ZGSA 4Q2FA 1MS4A 4WV8A 5CNAA 1FYUA 1LEDA 4W65A 4BLIA 5IT6A 1YXWA 2ZHLA 4LBJA 1S1AA 2OUHA 4LBLA 4WVVA 1S0GA 1QOSA 2DU1A 4GWNA 4K20A 3WCSA 2CNAA 2DUPA 4D69A 3AJZA 1OKQA 1DFQA 1MS0A 3NV2A 4BMEA 1APNA 3AP6A 4CRQA 3IPVB 1LGBA 1SLCA 1KJLA 5E89A 3OYWB 3OY8A 4XYXA 5HCFA 2YMZA 1G86A 1X50A 4XIOA
chains in the Genus database with same CATH superfamily
1OF3A 3BALA 3OTFA 3N35A 2WNVB 5I0RA 4ZU7A 4ONUA 3DPRA 3WNMA 1H4HA 5FZHA 3V0BA 1CPMA 1TEIA 4AVSA 3VBOB 3MLKA 2VMIA 1C3HA 1JZ8A 1NKGA 1RTVA 4A3XA 2XMLA 2RV9A 3CZJA 3T3YA 4BK5A 4EN6B 3RPQA 4WM7C 1UMHA 1YEWA 2B5HA 3KVBA 1QY4A 4ZY9A 4HVOA 3EQEA 3RJ2X 4CDWC 4LBQA 4N43C 3N9MA 3OGGA 4QU1A 4FTBA 4Z07A 2KD7A 3DXUA 4FPCA 4GULA 4XFFA 2GMEA 2VR4A 1EV11 2NYYA 1W8OA 2J42A 2ZGOA 3Q9OA 4IERA 1AYN3 3AKRA 1BHGA 3LIHA 3HMYA 1IHMA 1ZZ8A 2GMMA 2UY8A 2VMGA 4S2DA 3ZR5A 1G9CA 1UZZA 5I8SA 4O65A 2J7MA 2PLV1 2BNMA 3P3PA 1AUYA 1OD5A 1JTZX 4FP3A 4OULA 4IEXA 2GN7A 2B4KA 3N7MA 1K5MB 1F9KA 3JUUA 4AEKA 2VW1A 2K2SA 2CDOA 2ZHMA 3LDRA 3S7IA 3LGRA 1QHDA 2RS12 5FPLA 1ND2A 4E2SA 1O3SA 3T2PA 2E7TA 1YUDA 2YC2A 4HN0A 1UF2C 5FO7B 4FT8A 1E5RA 1CIYA 2YBSA 2YG0A 4YG6A 5JWPA 4XTMA 4Z1VA 1ASJ2 2VNVA 2XWJB 3P6BA 5JZGA 1UXZA 3FLRA 4CU8A 3VKMA 3TN93 4AI2A 2FZ1A 1CX4A 4HL0A 4DO0A 4LO4B 1JODA 2DF7A 4Y1YA 4Q4Y3 3T09A 5LASA 5LW9A 1QMJA 2YDEA 3B02A 1SCSA 5FYYA 5A3TA 1TQ5A 3ZSKA 1H2MA 4Y26A 5T5LA 3ES1A 3K3OA 4V2VA 3WV6A 4B29A 4C8DA 2A3WA 1H8VA 1O4ZA 1TMF1 5FZ0A 2HWE2 3KV6A 4XCBA 5FUIA 5CFDA 1GU3A 4LBQD 4B7KA 2R0FA 2ZOEB 2WYFA 3HN1A 3PJQA 2ZX4A 4ARXA 2WLQA 2E9QA 5CYYA 5FYTA 2OS2A 3OSDA 1JZ4A 1BBT2 1FPN1 3HBKA 3EHKA 5A32B 4MGSA 2Y8KA 1QJY2 4QXHA 4CPBA 4FAGA 5C3PA 1PVC3 1EAH1 1SFPA 4KGGA 3V0BB 2WZR1 1W6PB 1BLZA 2WRAA 4YVSC 3POYA 2YC0A 4ZU4A 4XMAA 3B69A 4GWIA 3VDDC 1UX6A 2JDYA 2ZGNA 2IVJA 2W3JA 3A22A 1SLTA 2A7AA 2WSUA 3AP5A 2QNKA 3HJRA 4I30A 2HWF1 3BYWA 4NAOA 2NMNA 1TME2 3PMSA 1LCLA 2R063 4L92A 1PMHX 2OW4A 3ITQA 1QDCA 4TSVA 3ZMOA 4LBQB 4QPGB 3WQBA 4OI1A 1ZREA 2WZPP 1ZRIA 4RR3A 2QQOA 4ISQA 3P5BA 1SLIA 1FV2A 4L97A 1HV1A 3KV9A 1AL21 4AI1A 5H9SA 4CEWA 3M3OA 3HIFA 1H2NA 1JS9A 4LMFA 4MGQA 5FPVA 3VLBB 1RUJ3 3PVOA 4QKNA 1JMUB 1LHOA 2EVXA 4XQDA 3VD9A 4RHV3 5FMBA 2BGPA 4ASLA 1V6OA 3HQXA 3L2YA 5FZ6A 1YFWA 1REDA 4JAAA 1ZVFA 2FDHA 2EIDA 4FTSA 1V9U2 3ZYRA 4L99A 5F6LB 2WWUA 3AP9A 2WS91 4IV1C 1NA1C 2AH2A 1B35C 2FBEA 4AQ6A 4BOWA 4D7SA 2E7AA 5FJKA 5FZOA 5CG9A 1VBE2 1FOD1 5M0TA 5AFBA 4FXKB 2VCCA 4H7LA 1X33A 4QMAA 1H2LA 1QXJA 1DQ6A 1XNAA 1BKZA 4QXKA 2ZJCA 1R093 1Y9QA 3T08A 1U5IA 3VBHB 1AZDA 5F8PA 3ZFFC 5JIUA 1G9AA 4Q4V3 2QZ2A 1OVSA 3H8XA 4RN5A 1BQPA 1OQ1A 2D6PA 3RYKA 1WLWA 4KL1A 5EWSA 1HQWA 4NHXA 4GZ9A 3AP4A 4MXVA 1PGL2 3TOJA 1J59A 1JU4A 4UFIA 5L19A 4PIZA 4D6SA 3QACA 2PA7A 1VBC1 4OUEA 1MS1A 5CFDB 4FPLA 4QX1A 4W50A 5GZGA 5IVBA 4ZHNA 1T6BX 5E8AA 4TLFA 1HLCA 3LZZA 4AOCA 4FFHA 2A6XA 2A6VA 5T5OA 3GBWA 4YVWA 4G4FA 5CKNA 2YU1A 3RZHA 4FOYA 4YW2A 3ENRA 2WIIB 1EUUA 4JGYB 3VBUA 1FAYA 4JX0A 1UKRA 3GZTB 5FLIA 5C7GA 2ZGTA 4XIKA 5FYZA 3W9AA 5T52A 1W9FA 4B7EA 1SACA 1Q43A 1W0PA 2FZ2A 1WGPA 4U36A 3WHUA 5FYSA 2WC2A 3NV1A 2VECA 1WCDJ 2WFF3 2Y64A 3RVHA 4GIQA 3VDAA 2OZJA 4LPLA 5K0UA 2ZEYA 3NVCA 3MO4A 4AZZA 1KS5A 5LRSA 3NJYA 4NIGA 3GDBA 3WINE 1D0HA 2E6VA 4XBQA 5CA6A 3UJOA 2JE7A 1ZYBA 3VBRC 1DYOA 4RS5C 4AQTA 1UZ0A 1W9SA 3BOPA 2ADDA 1UU5A 4UW6A 1GZTA 2VD7A 2V72A 1BEV2 4MVTA 1JHNA 1MR5A 1S2BA 3T2TA 1W2TA 2HWD3 2P17A 2JJ6A 1RL3A 3AKTA 4P14A 3MIEA 4LO6B 2R6QA 1E5SA 2HWC3 2OKXA 1BMV1 1JN2P 1C8M3 2V4VA 3O1PA 3CO2A 5F37A 2FHRA 4OHVA 1NLRA 1LOGA 1V6LA 2GP5A 3E5QA 4G9SB 4H3WA 4W6WA 4DNYA 2WNVC 1ZBA2 4EN0A 1XYOA 2YZ4A 3AYEA 3B00A 3TB0A 3KQ4B 1PZ9A 2EIEA 1UL9A 1S0BA 2JE8A 4UWDA 4CCLA 4DUVA 1U5ZA 3WNPA 4Z2WA 5EPAA 1G9BA 1PZ7A 4NPMA 5IVJA 1KFUL 3I2GA 2PHLA 5FMOS 4FOWA 3T2OA 3WNLA 2GU9A 4CEYB 1ZA7A 3BTXA 3TEZA 3OB8A 2BFUL 2JEMA 1MS5A 3U37A 1H30A 1LR5A 4NIIA 1SHWB 4KI5M 3HNBM 1UY1A 4YZ3A 1TVGA 5I8YA 2ET1A 4TWTA 4TYSA 4UI9L 3I2FA 1BK0A 1JYIA 5I0UA 1VE0A 3PVEA 2DBNA 4YVWB 2OQ6A 4FOVA 4W6YA 5JUVA 1H9WA 3BUCA 3KT1A 3VBUB 3K4DA 4XF0A 3AJYA 4Q4W3 1QJU3 4OQ8A 2XHKA 2YUEA 1PGW1 2BVVA 3ZOIA 4NIHA 1HN0A 1LEMA 1IGOA 3HWJA 4YGCA 5FPAA 5DXDA 3WP3A 2JDMA 4O9EA 1S0EA 4MGYE 2YROA 4HPKA 2E33A 3POSA 5GALA 1PNGA 1UWWA 3H42B 4BIFA 2XH6A 5K0UB 4JGZA 1UYZA 1US2A 3A0KA 4GKXA 1DQ4A 3WHTA 1VPHA 2E32A 3S7EA 3SH3A 2H0VA 4CCNA 2XHNA 3I3BA 4XOGA 1J3QA 1JXNA 5FJHA 4DRRA 4EQVA 2XUMA 1LGCA 2OPWA 4XILA 5FZGA 1O5UA 3URFA 4CDQB 1TE1B 3CJIC 4EJRA 1ODMA 2YFUA 4I01A 4ZXEA 2QQKA 5FP8A 4PQQA 2RMU2 5KXBA 4UFHA 1RB8G 3AX4A 1XNBA 2NZ9A 4AFDA 2XONA 4M4PA 4GD4A 4Z8BA 2JG8C 5GZEA 3IN9A 4NE9A 5KHIA 2YGMA 2TBVA 4XDOA 4GB33 3ZSLA 4HKLA 2ZAHA 2P37A 3CQOA 1US3A 3O7OA 4M01A 5JLVA 1W99A 5IWFA 2IZWA 3ACLA 3T4HB 1AR63 2QTWB 3RSJA 4IEUA 1ZZCA 5CBLA 4DY3A 1Q8PA 1Q8VA 5CKQA 5A7WA 2W1SA 4AW7A 1F31A 4JDOA 2E31A 1ULPA 2PFWA 2W68A 4YWAA 1QF3A 1A6CA 3AM2A 1QJX3 2VZPA 5C9AA 3OPZA 5FKCA 1NY71 4ITCA 4D0QA 4PDWC 1VRH3 4COZA 3ZYIB 2WLPA 4MLOA 2P1BA 4P9YA 2AACA 1QH6A 2A70A 3ELNA 3H50A 1W2OA 1RIRA 1H8TB 4B1LA 2WNEA 1HXS3 5DDJ2 4OHYA 2Q5TA 3DYPA 3LQCA 1D4M3 2D6OX 5BNPA 5JVVA 3I59A 2VPVA 3B3QE 4FFIA 3ZN6B 3HVDA 5CFCA 4GH4A 2ZCWA 2DURA 3Q8BA 1W8UA 4FOQA 1R1A1 1JOJA 1MZEA 2FDGA 2R071 1LOAA 3DYMA 4K8RB 4XXAA 5FZ9A 4YPJA 5A33A 1Q5OA 3VD3A 1OVPA 2VUCA 2PAKA 1RUG2 5ACA3 3AXDA 1ZA4A 3ACHA 4IE7A 5EYXA 3MYXA 3GZUC 2VXRA 1KEXA 1OFSA 2BDRA 2W95A 3E6DA 3SMHA 1GP5A 1RVF1 3DKWA 3ZLIA 3ZXFA 2UU8A 3I2OA 1RJ7A 1LOBA 2C4XA 1CZTA 1GBGA 2Q0AA 1MQTB 3GYDA 4XQWA 4AQSA 2ZHNA 3TEWA 4FPFA 5IVCA 1E5HA 3VBHC 2MEV3 1RUH3 4P9GA 4E8DA 5AC91 3EO6A 1CAUA 1VBE3 5FYBA 3HNMA 4QPWA 3OD4A 4WM7A 2Y6FA 4UOJA 2VQUA 4EZ4A 2UWCA 5D8AA 1GNHA 5KBFA 2RM21 4QGNA 4YM3A 1IS4A 3LOBA 4AI9A 2CYFA 2VCAA 4HBNA 4JTNA 2DCYA 4CDWA 4E8CA 3WXPA 1GNZA 1KQRA 3VUOA 5C70A 3P1IA 4Q4X1 5J36A 3AK0A 4BIOA 3OBTA 4HFSA 1C5IA 3ZFEC 1W90A 1Q8SA 5T3NA 3TBDA 4AI8A 3WT3A 2CGOA 3EB7A 4DFSA 4BQ4A 4DUXA 5JOZA 4AI0A 4D6RA 1O3QA 2CSGA 4A6OA 4XFCA 4HK9A 3VHNA 2QQUA 4L2NA 5DABA 2EIGA 4N9IA 5A7WB 3OYWA 1JZ5A 3RG0A 5JPNB 2ID4A 2WA3A 1LU2A 1GOGA 4NR1A 5FZAA 1RUC1 2XJPA 4IGOA 5HV4A 1UZVA 2FDKA 1IPKA 3N9NA 1BK1A 1G9DA 1Z7S3 3H3ZA 4LBNA 4PI2A 1IG0A 5A3PA 2CGPA 1HDKA 2R042 4MXWA 2LALA 1QQP2 1Z78A 4EZHA 3BU7A 3I54A 4NRQA 4BQXA 4HK8A 3JBG2 2PHFA 2CAUA 2YXSA 2Y60A 2IUWA 2X53S 4OHWA 4HN1A 3EMRA 3H8UA 2K46A 5C4WC 2PHWA 2YV8A 4NWWA 2W08A 2YC4A 1M4WA 3HNYM 4RL7A 3WDUA 5CFCB 3O1SA 5KHKA 3SH4A 4COUA 2RR12 1DGRN 1UX7A 3ZXKA 1ZX5A 3ES4A 3LFMA 3V64A 3J9SA 2VGDA 1ULGA 2QVSB 3QH6A 5IHRA 2DCKA 2YU2A 4IV3B 3JZVA 1NCRA 5L7OC 4QGLA 3VDBA 1S0CA 1WWYA 3D8CA 1DLLA 1UYYA 2UY9A 4PLOA 2WDBA 2A75A 3J7NA 1S2EA 4LUKA 2ZGUA 4QD2A 2WL1A 2ZEXA 4IEWA 4XCAA 3H1WA 4OUMA 5F6KA 3WDWA 4A7YA 2W87A 2JXAA 4XFGA 5A6QA 3L9JT 3B9IA 1GV9A 4YVSA 3ZN4A 4ES8A 4I2OA 3RZLA 2VH9A 5DZEA 3HOBA 5A3LA 4YGEA 1YIPA 2JDZA 4CSWA 5A80A 1CAUB 3JCIA 4RQPC 3O0WA 1YFYA 2VZRA 1EUTA 5FP9A 5D8AB 1V6IA 3W58A 2HEYF 4FQZA 1JOBA 4Q2FA 3RYRA 1MS4A 4MUVA 5EQUA 4W65A 4ES9A 2BBVA 4YYOA 1VJ2A 1F5JA 4LBJA 2ZEWA 2Q8OA 3LAGA 3LWCA 3NO8A 1S0GA 1QOSA 4LO7A 3WCSA 5FO8B 2JG9C 4D69A 1EV13 3GM8A 5IAVA 3RI9A 1DDLA 5FQ0A 2VNOA 4BMEA 2RVAA 3AP6A 3KD4A 5IVEA 4UT5A 3M8LA 4N53B 3IPVB 3M3IA 1KJLA 4BXSV 2RS11 5BNOA 5HI0A 3OYWB 2PLV3 3UGHA 4LHKA 1JU3A 3VN4A 1X50A 4CXYA 2VMDA 4EN7B 4ARYA 3RZMA 4AQ2A 4XUQA 1IS6A 5K7PA 1ASJ1 2W39A 1SG3A 1LENA 4IV1A 1NA1A 4I3GA 3MV01 3ALQA 4NUBA 2WT0A 5K4LA 1KJRA 2VBPA 2XR4A 3IMNA 4MXWB 4PF5A 4Z2AA 4AAXA 4DB5A 5JSOA 4NVPA 2P3IA 4E2GA 3R4SA 4QPIC 5A6ZA 3JD73 3ZFFA 5LCWL 3KM5A 4BYYA 2Q8CA 1T2XA 1IS5A 2Q8DA 5JXJA 1OBNA 4NAMA 4AGGA 4CDQC 4COVA 4CE8A 1EPZA 1L7QA 3E5UA 3I3EA 4FFFA 5JIAA 2VG9A 5CVRA 4BJ0A 1OA4A 1MS8A 1ENSA 1BBT1 3JU9A 1NCRB 4XJZA 1HQNA 2JDUA 4Y24A 1W3VA 4NHYA 3CEWA 3NAPC 2K0GA 5C6CA 2EA7A 3VBFC 3ST7A 3ZYJB 4G3YC 5LRRA 5I0SA 1WLDA 5BNQA 1FPN3 1STMA 4KBZA 3ZIXA 1EAH3 1PM7A 5C3SA 1J58A 1HRV2 2QKDA 2WZR3 4P9WA 1OLME 4N8MA 3ZKUA 1RUF2 4CP9B 3THCA 2ARBA 3WQ7A 1TME1 1I6XA 3PVNA 4FPEA 1LHNA 1ST8A 2XG3A 4K7JA 2XPJA 3KMHA 1W05A 3NNFA 1WA4A 4E4DX 2YBKA 1LHWA 1Y9GA 4Z82A 5D21A 4URAA 4L8QA 2HWF3 5TSWA 3ZXJA 1WD3A 5K8SA 1HW5A 4PLNA 2P3KA 2UWAA 1FI2A 2BYVE 2VZTA 3GZAA 4DZGA 1OUSA 1DLCA 2JICA 5FO9B 3GBGA 4QX8A 1AL23 5FUNA 3S6PA 4RS5A 3DV8A 3MIHA 4K40A 1V9U1 2BGCA 1LOFC 5FQ0B 1V0AA 3SCGA 1IQAA 5FAXA 2MEV1 4CVUA 5DDJ3 2FDJA 5FZCA 5BNOB 3D0JA 4MZUA 1VBE1 2ZABA 3CHXA 2OVUA 2EF6A 3K4AA 5CG8A 1OD3A 3VBSB 4AHYA 2WS93 4AEDB 1OLQA 3T0DA 1WBLA 4O7XA 3O1RA 1FOD3 4JKKA 5C8CB 3OEAA 3FJSA 3FLPA 1MQTC 3NJVA 5F5IA 2D6NA 4COYA 1PGL1 4IE5A 1LTEA 3RQ0A 1YI7A 2ET7A 1GWMA 5FUPA 3O1OA 1D2SA 1XXNA 5APAA 4E4SA 2O8QA 5JR7B 1RUD2 3CL1A 5FP4A 1RUE2 2BERA 2IXCA 2NMOA 3AMQA 4PCRA 3O1TA 4NIAA 1KS4A 1WD4A 4IE4A 1YO8A 1TZOA 3AZZA 3LFIA 4LXLA 5FLJA 1A34A 4P5YA 1VBC3 2PTMA 3WDTA 2P2KA 3VL8A 5HCBA 4QX2A 4ZKTB 1NZIA 4F3JA 2VBBA 2BPA2 4AXOA 4P9JA 1RITA 5IVYA 4NMIA 3KHCA 2PAMA 5F32A 5BYNA 1SBFA 5JOXA 1WMEA 3MDPA 4JHZA 3WG3A 4LLOA 5IJRA 2VMCA 1S55A 2VTFA 1CQ9A 1EYBA 5EIYB 2GN3A 1O59A 1J3PA 1W8FA 2DVGA 3FL7A 1K5JA 3H3LA 1QNWA 3Q8AA 2VL4A 4HLTA 1W2UA 2N7GA 2R16A 1VBB2 2QBXA 3IAQA 3PURA 4Y20B 2RG4A 2OYZA 3U78A 2JD9A 3K46A 1IS3A 2RS52 2GNBA 2Y0IA 1JYXA 2O14A 1CWPA 3NKTA 1NZCA 1XBFA 3AYCA 3LB9A 4FBFA 1BEV1 1ULOA 5FZFA 5BNNC 2R0HA 4CCEA 1HN1A 5DUUA 4YM0A 4CZSA 2IXLA 3V0AA 3NSTA 2CAVA 2H6CA 3M7AA 3CJIA 1VALA 3HT1A 3I7DA 1GLHA 2WR9A 4XFAA 4YW6A 4Q0PA 3WEZA 5HCHA 1WCKA 2C1FA 4FCAA 3RRDA 1REEA 3D0SA 4ET7A 2G9GA 5F39A 4HG6B 1O8SA 2JG8A 3KV5A 3VZNA 4BE3A 4F83A 5JSRA 1LODA 3OGVA 1WLTA 3HBZA 5GZFA 2WWJA 1U0AA 2Z69A 1JZ3A 2C26A 4COWA 2LW8A 1DZQA 3WQ1A 3UKNA 4CUAA 1PO12 3ZPYA 2XL7A 3ON7A 1W2AX 1SQ4A 2IXHA 4FFGA 4QM9A 3UT0A 2W52A 3QH7A 5FIXA 2QJVA 4B3NA 5EP9A 1K3IA 1GQGA 2O8OA 3KT4A 3AYDA 1TNRA 2QE3A 4Q1RA 5ANNA 4AVAA 2CDPA 2BTVC 4GJYA 3VV1A 4PDWA 1UOFA 4ASKA 4DMIA 4HKOA 3J4UH 4B4PA 5T5PA 4C0HA 5C71A 1KDKA 2BRTA 2BZDA 4QQHA 5FXVA 3SCFA 4JRLA 4QHZA 4WVMA 2ZXQA 5EV7A 5FPXA 4R8HA 1QJEA 3BTZA 4LBKA 2VMFA 2XKPA 3MW3A 3MW2A 3ZN5A 1RYYA 2Z5WA 1DCSA 3KB5A 2YPDA 5DAPA 4LR4A 1URXA 1RUI2 2ES3A 4UYBA 3WOGA 1PK6C 3JD71 4CDUC 5BUVA 2P6CA 2RDQA 2VJXA 2D6KA 4JTOA 4TLGA 4LO8A 2FD8A 1NAEA 4CUGA 4IXLA 1G8WA 1NE4A 2F4PA 2LRPA 2TEPA 1DQ0A 5CADA 3H7JA 3DN7A 2QQIA 3GHMA 3ZMNA 1UW8A 3ZFGB 3PUSA 3GHNA 4IE6A 4QKBA 2J1UA 2W47A 5LK5A 5T55A 1CAWA 1OKOA 2DBIA 3K75B 4PIXA 5FV3A 5E16A 1DQ1A 1PMIA 5FMCA 1AR82 3LF7A 4QB1A 3IDAA 2H6BA 3OY8B 2RMU1 2IXJA 4FO9A 4DEQA 3NW4A 2JKBA 2QUOA 2ZTNA 4GQ7A 2TNFA 2WNUC 3V0AB 3WG4A 2R1DA 2R7EB 3DPRB 3M4FA 3Q8FA 2D93A 2VOKA 5E6HA 1XNCA 3MEPA 1CX1A 2RJ2A 4I0AA 3O14A 3ILFA 3DGTA 1VBA2 4DRVA 4E9KA 3DL3A 2AEYA 3GALA 4X6RB 4XJWA 1QEXA 4Q0QA 3WDYA 2QCSB 3ZXAC 2VTXJ 3ZXDA 5FDBA 2Y6HA 3IAPA 1DGRA 5F7UA 4V1PA 3HR9A 4V2WA 3VD4A 1LB2A 1HQLA 2JIJA 1E5IA 4FPOB 3BI3A 1G9FA 2D43A 1ND3A 1U5XA 2P3YA 1OPMA 2RHPA 4NPLA 5F5CA 4AHXA 3LEMA 1C8NA 2D6MA 2JDNA 3MIGA 1XU2A 1R1ZA 4LIUA 2AUYA 5DDJ1 4MGIE 1PO23 1QH7A 4MHRA 1OSGA 3IZOA 4XEZA 3ZYPA 4AL9A 4BK4A 4CDXC 2ZEZA 1N1VA 1X8MA 3LCPA 3ORJA 4R4ZA 1UOGA 1UIJA 1D2QA 2B7YA 4FPKA 1WMFA 2FDFA 1CIWA 4LQRA 3KVAA 5IK4A 3FUQA 3POJA 2ZMKA 4WVMB 1R082 1SMVA 4XVHA 3GZEA 1LKNA 1ND2B 1KFXL 2AYHA 3WW1A 4CP2A 1WCSA 5GZCA 3RMYA 1VMHA 1XNTA 1W8TA 1W04A 1H9PA 1RUG1 1G86A 1F4HA 2P3JA 4X6QB 4CPBD 1YRZA 5JZGB 1HIXA 1R1A3 1LAJA 1NCQA 1CVNA 1G7YA 1AR92 2R073 5A7NA 4X8PA 2Y6GA 1DGWA 2AR6A 2ORZA 2PHXA 4LEJA 4LNVA 1OOPC 3FX3A 2BBAA 2SBAA 2Z2SB 1FMD2 4IGPA 2VM9A 4HETA 4GKYA 1RVF3 3W59A 1GKBA 1MVQA 5A7QA 1IQDC 3M3CA 3WUDA 3PVBB 4R52A 3ZSMA 5FR3A 4LHLA 3MIDA 1RINA 2ZAAA 3J7LA 3CIHA 1OLMA 5A7SA 1GQHA 2ATFA 2YHJA 4J25A 4WM8A 1Y7BA 4AK3A 1HRI2 5FLHA 1IZ3A 4Q27A 1AHSA 3NV3A 5AC93 5HCAA 4YSFA 2J1AA 4IEVA 1HV0A 1W39A 4YZ4A 5DZGA 4ZS3A 3Q8EA 4IEQA 2ARAA 2RM23 1UQXA 5KXDA 4DQAA 3PUHA 4Q5OA 4NHKA 4XABA 3LDBA 1GYKA 2V73A 4Q4X3 2JD4A 2UYBA 1MACA 4Q8LA 1WKYA 3POWA 1C28A 1DGWX 2Q1FA 2ZS6B 5B4NA 4S2FA 2JG9A 4NO4A 3QLQA 5AFEA 4HVRA 4RR3B 3KZ4C 3N4MA 5I0DA 4XZUG 5C3QA 1ND3B 3SITA 4E4HA 1GZCA 3MGUA 2XQXA 4LK7A 4UBGA 1AXZA 4UBHA 2R041 4CEWB 4Q8KA 5I0TA 1QQP1 4JV4A 4SLIA 4XETA 5SV8A 3JBG1 1COV2 3U14A 1RUC3 1DYPA 1SPPA 1DBNA 4YGDA 2FMYA 2VO5A 2PQQA 5LY2A 3I3DA 3BTAA 4ZONA 5FK7A 3UKVA 2VBDA 1K45A 1Y4WA 4YFZA 2RR11 4AHZA 2AENA 3DXTA 4QPIA 1AR72 2PHDA 2OA2A 5DG2A 5FZOB 3VKNA 1UY3A 2WT2A 4PI0A 4W6XA 5JXGA 3H1YA 4YRDA 2DTYA 1NXMA 2BWAA 2J1SA 3R4UA 5KHJA 5C3RA 2BU9A 1RMU2 4OI4A 4FI9A 5E1RA 4XF1A 1WW6A 4YNIA 1C57A 1OPOA 2XJQA 3NNGA 4FTEA 2FCUA 1EP0A 1G6NA 2D3SA 1UAIA 3IT8A 3OOXA 1V6NA 2XJUA 5IVVA 3AFKA 5A3MA 3NAPA 2C9KA 2X5IA 4XTPA 1WCUA 2G1MA 1AYM2 2ZACA 3HQRA 3VBFA 3WNOA 3ZVXA 4Q0UA 1N1TA 3I49A 1AXYA 3BN6A 4YM2A 2RS32 4AI3A 5GJ6A 1DYKA 3H0OA 5A6XA 4WM8B 4AR2A 1UU4A 3H3UA 3FHQA 3VHRA 1WA6X 1QXRA 1VRBA 1PMJX 3I4IA 4NWVA 1F4AA 1HJFA 3KV4A 1ENXA 3T30A 5A1FA 5E88A 1MS3A 1LECA 1GOFA 4Y4YA 3GCXA 1K5MC 5GLVA 4TTGA 3C7EA 4IQPA 4OZOA 4SBVA 1XSRA 5HV0A 2WN3A 2QQJA 3PIJA 4A7ZA 3ZIWA 1OXCA 1ENRA 4NN0A 3WZ1A 1S4CA 5LY1A 1ULCA 1TNFA 2ARXA 2P6HA 4KG0A 3RZGA 1QOTA 2FQPA 2GALA 5AVAA 4C91A 1PHMA 2RS13 3TAYA 2DV9A 3WG2A 1RUOA 1S0DA 1W8NA 2I2SA 4QWNA 3USUA 4BWOA 3CJXA 4XMIA 3SH5A 1Q8OA 4RGGA 3AKSA 4LT5A 2AREA 2O0OA 3K51A 1RUI3 1I3HA 1ASJ3 2ORXA 4XW3A 5C5UA 4E4ZA 5FMDA 1Y43B 4QHOA 2KR2A 1NLQA 2GC3A 4QKDA 4XXPA 3HAGA 3POEA 2W91A 3V56A 3D6EA 2BJSA 4P00B 4D7YA 5SV5A 1W28A 5FZKA 3FFZA 4YARA 5B4XA 2VC9A 2HWE3 3C8XA 4HSLA 4WV8A 1IPSA 1FYUA 4R4XA 4BLIA 3E1F1 3B94A 5IT6A 2ZHLA 1PIV2 1S1AA 2OUHA 5FZBA 3I3MA 4WVVA 2NQYA 5JI9A 4LUMA 3J26N 1BBT3 4Y5Z0 5FPUA 3KGLA 2VMHA 4LULA 3W5NA 1QJY3 1XSQA 4ZZ8A 1ZRCA 4JKLA 1HRV1 1PO21 1MS0A 3MFAA 5IW0A 1RUF1 4CRQA 2X5IB 4AEJA 4NJ4A 1ODNA 2W94A 4AG4A 3WSOA 1LGBA 5FK8A 5E89A 3BTYA 4K6BA 2J1RA 4RD7A 3VL9A 1HX6A 5I93A 4QPGC 3BOWA 4Q26A 2KA3A 1JOPA 5JMCA 5JDBA 1TME3 4W8JA 4XBLA 4XC9A 2HWB2 5CKMA 4Y1XA 4M0NA 4XHXA 2XVGA 5LEKA 5ABJA 2W92A 4OMCA 2GNMA 2R32A 2VNGA 3ZYHA 4AVVA 3WG1A 3RZZA 4XJ8A 4CP0A 3WUCA 5L9VA 2I45A 1SLBA 3LEIA 4PBOA 2DCZA 1ZZ9A 3MHZA 4QU2A 2JB4A 5FZIA 4BCUA 5BNNA 2VW0A 5FWEA 1UU6A 1PX4A 1JI6A 1NQDA 2Z42A 2VU9A 1H0BA 3LPGA 2WNOA 1CJPA 1X7NA 2IVIB 3AVSA 5FYCA 2VZUA 3T0AA 1V9U3 4JGZB 4KWJA 1RHI2 4LO5B 1QWRA 3D82A 2B8MA 1R083 1YYNA 2R49A 3ACIA 4FAHA 1GP4A 1MS9A 4OZXA 2QDRA 1JZ7A 4HPKB 3WCRA 4YM1A 4LA2A 1MEC2 2BOJA 4PF1A 1GMMA 1AL0G 1VMJA 2G4IA 1XE0A 3T1MA 2CU5A 4JDMA 3RS6A 2WUHA 3POIA 2IXKA 5JOWA 2XBO2 1RUD1 4N43A 1CAVA 4M3CE 3WW3A 1VB2A 4RYDA 1RUE1 5CFDC 5J48A 5EYYA 1VBD2 3AP7A 5GZDA 4P02B 3R6SA 4PHZA 1UMIA 5H9QA 3O5SA 4D94A 3ETPA 5EJZB 3NL1A 3QD6A 1QXPA 3AZWA 1W06A 1H6XA 3VBOC 5FWJA 1Q3EA 3IDCB 3PTYA 4KWLA 5JMOA 2VNRA 3ILRA 5LA9A 5C3OA 4JGYC 3L2HA 4YFWA 4S2HA 1GZ9A 3FHAA 4UAPA 5FCCA 3RDIA 4AAPA 4EE2A 1JZ2A 4BU2A 3UGFA 4CU9A 5D1IA 1QIQA 2BEOA 5J37A 4QX5A 5C9AB 3I2DA 1BZWA 2GNDA 2D44A 5HPOA 1W8WA 4IE0A 2J1VA 2D7FA 3H7YA 4HVQA 5HXMA 3R05A 2LM3A 4BM8A 3TEYA 1FX5A 1L3JA 4NOTA 2A1XA 2WN2A 2FCVA 1PK6A 1W0OA 2GAUA 1PNFA 4RR3C 3X29B 3CKHA 1VBB1 3FFQA 3AXEA 3GXUA 3G7DA 4CDUA 5BNPB 4HOOA 3I59B 3ACFA 3WDVA 1H1AA 1IOAA 2RS51 2Y0OA 3J8F2 4LKFA 4GH4B 4EROA 3E6CC 3UGGA 3N7LA 5DPNA 3AKPA 4XZPA 4AGVA 5ABJB 1DU3D 3U11A 3MPPG 3SHRA 3RJRA 5A33B 1W6NA 2V09A 2VZ3A 3BPZA 2Q1ZB 3GBFA 1YLLA 2A3XA 2A6WA 1XNKA 2VZSA 2ZX1A 3EYPA 4BQ5A 4FSJA 4XDPA 1BEV3 5FY8A 2WQZC 2WT1A 3VHOA 1NQJA 5A1AA 4XUPA 2ZGPA 2WNUA 1GUIA 2Y38A 2OZ6A 2VXJA 2ZHKA 1LRHA 2G19A 4BQ3A 2WSVA 3O1VA 5JI7A 2ZZJA 3VDDA 3OUJA 1A3KA 4GMP1 4WM7B 1OA3A 1PO11 1UYXA 1ZBA3 4P9XA 2IWGB 3OJBA 2CWMA 3WW4A 3R4DB 1D7PM 4OI2A 3EBRA 5CIRA 5JCTA 4JVAA 1S0IA 3RNSA 1PX3A 2PHRA 4CEYC 3VHPA 4CDWB 1QOOA 2RDRA 2UURA 3IM0A 1H1MA 4LHNA 4N43B 1AYN2 1CAVB 2X29A 4LKEA 1XE8A 2B9VA 3LA3A 1QNYA 4GJZA 4MGZE 2VULA 4JCKA 5GLUA 4MYEA 3F95A 3SNMA 1UY4A 1SLLA 2C0ZA 4W4ZA 4YGBA 1H1IA 1M06G 3PMEA 4XUTA 4YVWC 3ACGA 2IFRA 3USSA 4H55A 3VKLA 2XJSA 5GM0A 3VBUC 4CDXA 3E97A 2B42B 1CZVA 3BU0A 3IMMA 1CAXA 2WZ8A 1RUI1 1X8EA 5LA1A 4YZ2A 2DVBA 3AC0A 3T2QA 3CU7A 1B35A 5FXXA 3VGIA 3WX5A 5IFPA 3TN92 4KBBA 4IEZA 4LHSA 4M3CF 5AVPA 2WKKA 4ZPIA 4Q4Y2 3DECA 1W03A 3LE0A 5K0UC 1PGW2 4ATEA 1I5ZA 1S0JA 2C6SA 4CYDA 4OUSA 1QU0A 5EHDA 1VR3A 2HWE1 1UO9A 1VIWB 3E6BA 4JC1A 2XQRA 5FTTC 5L73A 1OOPA 4RFRB 4TN7A 1N47A 1AR81 5F5QA 2Q8EA 4GWMA 1JBCA 5LWBA 1O6UA 1FNZA 1UKGA 4LIVA 1QJY1 3VDCA 1NOVA 3UJQA 3WF0A 4BLJA 4NRPA 3AVRA 4GXLA 4I09A 5A3WA 1PVC2 4Y33A 1V6MA 2KXLA 1W6OA 3S5QA 1O4YA 1GOHA 2RMU3 4D8MA 1VBA1 5DUWA 3MPBA 3WLUA 1BXHA 2V5DA 3D3AA 4YZ5A 3ZSEA 4S2GA 4I02A 4YVSB 3FC0A 3N9OA 4WBBA 1CR7A 1OHFA 4O9GA 1VAKA 1POV1 2AZ5A 1W6QA 2IFWA 2R062 3KT7A 4FP2A 3VDDB 2G9FA 5FMOL 2OPKA 4DEVA 1JYNA 1KRIA 1HJGA 1W8ZA 3H1MA 2XB6C 4XFIA 3AMNA 3U4SA 1OQDA 1LOCA 2VZVA 4LTAA 2E7QA 2VVEA 4A44A 1DGLA 1LJ7A 1RUJ2 2PYTA 2XLAA 3DEMA 3POBA 1H8TC 4B8EA 1GWLA 4RHV2 3VBRA 1SZBA 2DUQA 3THTA 2WQ4A 1S0FA 5FZ7A 2ZBJA 2EAAA 2ETEA 2QQNA 1PM4A 2OIIA 3VZMA 2WO3A 4HKWA 1AJKA 5BY5A 1R081 1WW7A 1YJLA 2XJTA 4BH9A 2ZGKA 3LEGA 2F4LA 3IDEA 4EWDA 4LE3A 4CUBA 2CTVA 2J1EA 2PMWB 2BWCA 1ULEA 1R092 1W8HA 4AF9A 4IV1B 1LOEA 1D4VB 4OI0A 1NA1B 4OVEA 1B35B 1AR91 4Q4V2 4EN9B 4QX3A 1UN1A 4ASMB 1W9WA 1YHFA 2BP6A 2QQLA 2WNVA 4JKMA 1XPWA 1RUG3 3CDZB 2VCBA 4LOTA 2AEZA 3RWKX 5GLWA 3LEKA 3TWIA 3VBOA 4FPJA 4DY5A 4M4RA 1E57A 1IKQA 1HB3A 3ZFFB 5IYYA 1ZNPA 2DTWA 3O1MA 1LGNA 3W21A 2XJVA 3FLTA 5J96B 5KHGA 2OT7A 2RDSA 4ZXKA 4AGRA 1YCIA 1UMZA 3I2HA 3ECQA 5DG1A 2MHFA 1OI6A 1HRI1 2YB7A 1J1LA 5FP7A 1XQNA 1YQ6A 2BFUS 5FOBB 3WDXA 2DCTA 4K1YA 3K48A 3N9LA 3OBRA 3T1LA 1CPNA 1JYCA 3UESA 3OGSA 1W6OB 4KQ7A 3IDBB 2ENRA 1O91A 2VOWA 2Q30A 3LA2A 4A42A 1FXZA 5A3OA 4BA6A 2B39A 3NNJA 4GALA 4DPNA 4L9BA 3I8TA 2QQWA 5DAVA 1GR3A 2C9AA 2WFF2 4CU7A 3LPFA 3QBQA 1AF9A 3MUY1 5ERLA 1REFA 4DXZA 1K5MA 2Q4SA 4A4AA 4RSUA 3NMBA 5FY1A 1RC6A 4AYUA 4I0BA 1WBFA 2GH2A 4MOAA 4N9HA 2W2IA 1COV1 3LOIA 1Z0HA 3B5LB 5FFOC 4XBNA 4UF0A 3OEBA 3VBRB 4NIDA 2VMEA 2HWD2 3G6JB 4RS5B 2R043 1DIWA 1YC61 1QQP3 4AFBA 3FN9A 5LATA 1YWKA 3JBG3 2HWC2 4LKSA 5CFCC 4J1XA 2WZEA 4P9LA 1C8M2 3B93A 3BIEA 3B9CA 3PU8A 3WNKA 1QDOA 1AR71 3DCQA 5KC6A 1AVBA 1OH4A 4IV3C 2EXKA 1ZBA1 3UNPA 2CGNA 1BVVA 4M3CA 3AL6A 4ZZ5A 2ZKLA 4CP1A 2RR13 1RMU1 4R9AA 4WVWA 3RZKA 4MGKE 5FY9A 3U1XA 1KXGA 1F2NA 4K21A 1U12A 1OA2A 5A32A 2W5FA 3P3NA 3BVCA 4ATFA 1Q8QA 3EXUA 2EIBA 3F2ZA 1W6PA 1AYM1 3DYOA 1KGYA 3OPWA 4GWJA 1BYHA 1LESA 5FREA 4BQ1A 2A5ZA 2WA4A 3ZX7A 1AXKA 1DQ2A 1ZZ6A 2XDVA 3POGA 3SEEA 3PNAA 2RS31 5F3EA 1K42A 4Z92B 1VLNA 1W0NA 3C7HA 3OUIA 4X8NA 1WW5A 4R9CA 2AGSA 5D8AC 3VKFC 4TXWA 5BV6A 1XB9A 4QPGA 5KHHA 2YYOA 3TYJA 2GC2A 4QDRA 1J83A 2NPIA 2GMPA 4I3PA 5LA2A 4Q4W2 3A0NA 1AJOA 1QJU2 3M2MA 3MI8A 4D3WA 3LA7A 4PJYA 2VOVA 3OGJA 2YFZA 4KU8A 1NT0A 3APBA 4LBMA 3FE5A 3KS7A 1VAVA 4XJAA 1RJ8A 2F6BA 2XVLA 4N53C 2E26A 4P9IA 1P8JA 2QQPA 3I97A 3BKZA 3CLPA 2VZQA 4UW3A 4MO3M 2BNOA 4QX0A 3MUZ1 3WF2A 3W5MA 2CV6A 1EPWA 4CCMA 3OPTA 3T0BA 2D3PA 1QJFA 3VBHA 1W2NA 1Q56A 1O4TA 1Y3TA 2JDAA 1JZ6A 4UF0B 3FHIB 4MHUA 5H9PA 2ZMNA 2PHTA 2XOMA 4BXFA 3CJIB 3ABZA 4JQRA 2ZGMA 5LEJA 2E53A 3VD5A 1UXXX 4GB32 4JRAA 4TZDA 2XWBB 1CJDA 3SKVA 4HZFA 5ANQA 4QGMA 1NCRC 2JG8B 4DINB 1OMIA 1AR62 4XURA 5JPMB 4M3CB 1JUIA 3ROUA 2W1WA 1ZBE2 2YY1A 4Q1PA 1X9PA 3MF6A 4HT1T 4K1ZA 1PIV1 2W1UA 3ZFEA 4CCJA 4RGKA 3HT2A 1HB1A 3WR0A 3C2UA 4KU7A 4URTA 2WO1A 4KNCA 5KXEA 2A73B 4L11A 4XHBA 4MX3A 3N9QA 1QJX2 3GNEA 2EALA 4H14A 4BPZA 3JQWA 1V00A 4JGYA 1VRH2 2VOXA 5GKAC 3RWNA 3AL5A 4YW5A 1U5YA 2A3YA 5A3NA 1ULDA 3BB6A 1YJKA 2XLGA 3LIGA 1ENQA 4ISRA 4MH0E 5FPZA 1UZWA 1HRV3 4PDWB 1HXS2 2DCJA 1RUF3 4ZU5A 3H8OA 1J84A 1D4M2 1GP6A 2LUWA 5FZ1A 4K8FA 3ETQA 1UOJA 2HWB1 3UK9A 3V65A 4Y1ZA 3ATGA 3KCCA 3OF1A 2AC1A 3D4KA 4Y3OA 1JYTA 2UWBA 4XE9A 5C4WA 4I0WB 5G04L 2GC0A 1OH3A 1W6MA 1XJAA 2WWSA 5LK7B 3GJAA 3UYJA 1N3PA 1NG0A 2NN8A 2GDFA 3B01A 5ACA2 3C3VA 2Q1MA 4RA0A 5C8WA 5L7OA 5BNOC 3WW2A 1X82A 5FY7A 5FOJB 4QQOA 3NJZA 4Y5TA 2IXIA 3PDQA 1HB2A 3AZVA 4IEOA 1RHI1 4L0PA 4CCOA 2ZGSA 3UV9A 3VBSC 3WQ0A 5LBCA 1UNBA 2MEV2 3OUHA 4AEDC 1RUH2 1XOYA 3SXWA 4LBLA 1CAWB 1DZRA 4J1WA 4GWNA 2DU1A 3MV11 2ZZQA 4IGQA 5C8CC 4IL7A 1MEC1 2VE1A 2JX9A 1T6GC 1DFQA 2XXZA 4OFGA 1APNA 3A7QA 2HBUA 2XBO1 2LROA 3KGZA 4EYUA 4RQPA 2L9LA 5HCFA 2YMZA 1VBD1 1WW4A 4CEYA 2Y6LA 1GQPA 3WNNA 2PHUA 5T5JA 1AX0A 1RUD3 5DMYA 1VMFA 1RUE3 2ZX3A 2DWRA 2ZA9A 3ZFEB 1GZWA 2D97A 4FPGA 4JHTA 4XUNA 5IATA 2XLFA 4AVBA 3S57A 1GNYA 1MZ5A 1N3OA 2MPFA 3OCPA 4LLFA 2WAAA 1Z7S2 4NRMA 5DAQA 3SEPA 5KR7A 4JQTA 4BISA 2V5YA 5J98B 3WP6A 4YW7A 4N7UA 5D2AA 4Y4RA 3R0RA 3E5XA 3U0ZA 4GA9A 2HKXA 1AX2A 1NX9A 2DYCA 1W9TA 2LS6A 3N36A 5B2GB 1NUKA 3TNQA 3J8F1 3JXSA 1H2KA 5F3GA 3O0XA 5C5TA 1XYPA 4CCKA 3RZJA 1VBB3 4KWKA 2ZGQA 2VZ1A 4NROA 4QQLA 2XJRA 2VCMA 5C4WB 1MVEA 2WJSA 2RS53 4IEPA 4CDQA 2I07B 3HPNA 1W6MB 2C5DA 5A1LA 4A45A 1NCQB 1RXGA 1NLSA 4LORA 3Q8CA 4FQ4A 2ZMLA 2VUAA 3UL2A 5L7OB 3I3QA 3PUAA 3VB9A 1IKPA 1O8PA 5GLTA 3CZUA 3C7GA 4M00A 1GSLA 2CL2A 3CF6E 4XAAA 1DG6A 1DZTA 4QHBA 2GSYA 4XF9A 3SCHA 4XPVA 4AFCA 1WMXA 2DFCA 2WFPA 3BGAA 2RJLA 2R1BA 3H9AA 3ZM8A 4F7ZA 5FBJA 3BIWE 3KWVA 4DXSA 2DVDA 5DUVA 4P5HA 3A4UA 2XVKA 2X10A 4CXWA 5CAZA 5JXHA 3BODA 3M70A 3PTRB 1YQ2A 1AYN1 2DUOA 2VAUA 1PO13 3CBNA 4GMP3 2B45X 2WABA 1BJQA 4HANA 4RQPB 2GC1A 1R64A 3T4VA 1UZYA 3VD7A 2QZ3A 5LB6A 1OLRA 2QQMA 3IWZA 5HBAA 3ZSJA 2W46A 3C7OA 1EV12 3SQOA 2CY6A 2QDNA 2WBKA 5FZ3A 3VZOA 4CTEA 4LK6A 2DVFA 4J6GA 4MADA 4KH9A 4CCCA 4WZCA 1H8TA 1DQ5A 5FY0A 2Z4FA 3I2KA 1GZWB 2CWSA 4FPYA 5LBBA 4BHPA 2ZGRA 5J3UA 4NHLA 2JG9B 2PLV2 3KLSA 4KGQA 4BQYA 4PQ9A 4BQ2A 2JECA 1KITA 1LOFA 1WZXA 2D6LX 2XL9A 3N9PA 3PL0A 2BQPA 4LKDA 1VP6A 3PUQA 3ZN6A 4PT6A 3MZHA 2PN5A 5JR2A 3TN91 4XFHA 4Q4Y1 4N7IA 1I5PA 2TUNA 4META 5GLZA 3ZXGA 5F2WA 1NXD1 4PLMA 1SPPB 4QB2A 2FDIA 5F9TA 2B46X 1A8MA 1JHJA 1RGSA 4OQ9A 1HKDA 2ARCA 2Y26A 1OT5A 3JD72 3ZFGC 1W3XA 1F8VA 4ZS2A 2FMDA 4OHZA 3FBMA 2JE9A 2OXBA 3RFRA 2OUJA 5CU1A 3WD5A 1MQTA 3LD8A 3ZDSA 4A7KA 1OUXA 4BZ4A 4QPIB 3NNLA 2PELA 3BCWA 5T54A 2D5FA 1TMF2 4IUGA 3MICA 3H8RA 3DPRC 2B9UA 1PVC1 1AR83 1UPIA 4K3UA 3VZJA 4CU6A 2YGLA 4DIQA 1RXFA 1FPN2 3I2JA 4CA9A 3KF5A 1SCRA 3U75A 4AWDA 5J1XA 3O0VA 1WLCA 1JYWA 1EAH2 1DF0A 3NAPB 5FYIA 2WZR2 3ZYFA 3WP4A 2H0BA 3VBFB 1VBA3 1XU1A 2R061 2J1TA 1FNYA 3K3NA 4C0BA 2GH8A 3TNPB 1TG7A 1ZBE3 5J09A 2HWF2 3ZYGA 3KSCA 3ZKYA 4C90A 1POV3 4IEYA 3DKQA 1AX1A 5DAXA 1RUJ1 5FZEA 5F3CA 1HB4A 3K4ZA 2ZX0A 2RJKA 3OBZA 4RHV1 2GP3A 3FBYA 2HEVF 2A71A 1AL22 1QJZA 4H7MA 4WVZA 5HXVA 4QT6A 2JWPA 2BV4A 3A23A 4OMDA 4YW4A 2A6ZA 4ORFA 3M3EA 1ND2C 1DHKB 3KCYA 4Q29A 3PHMA 1J1TA 2EXHA 4QAWA 4UFKA 5DN2A 3AB0A 2SLIA 2W0XA 1CESA 4C1XA 5LA0A 1R091 4Y22A 2DVAA 4YZ1A 4BB3A 2JDKA 2WS92 5IVFA 3AYAA 1UY0A 5JZGC 2I74A 4Q4V1 2W1QA 2HEWF 1CONA 4IV3A 3USUB 1FOD2 2D40A 1OC1A 5K9YA 2PXJA 4E2QA 3NRUA 4EN8B 2LTNA 3ILNA 4UW4A 5EXOA 3W20A 5CISA 4YW1A 1FV3A 1KD7A 1AR93 3RYPA 1K12A 3VKOA 1ACCA 3PLQA 4EWEA 1FMD3 1ZZBA 5IK8A 3RGBA 3KCXA 2WO2A 4C1WA 1ZM1A 2BGOA 2NM1A 4PIYA 4QDSA 1V6JA 4FXGB 5DQ0A 5IUQA 1XYNA 4XACA 1L7LA 3J7HA 3U4XA 3RMXA 4NPRA 1VBC2 2MNGA 3PU3A 1CN1A 4XF3A 3HN3A 4OYUA 2DU0A 1HRI3 1ZRRA 1ULFA 3K77A 3S30A 1UPSA 3VZLA 1L7RA 2OX0A 2VZOA 3NWKA 3THPA 1CZSA 4LITA 5FKBA 1C1LA 2VW2A 2Y33A 1MPXA 3K2OA 2RE9A 4FVVA 3IKWA 4OCTA 2WFF1 4XJUA 4O61A 2D5HA 1F15A 3ZXLA 2D3RA 1YFUA 2UYAA 2WINB 2WQ8A 4UW5A 5IK5A 4N90A 5BPXA 1UD1A 2PAEA 1JW6A 1ND3C 2Y6KA 3IPVA 4N53A 1PGSA 2EXJA 3AZYA 4XQ4A 4Y5SA 2ZPXA 4A6SA 1JH5A 1YIFA 4INDA 4AFAA 5CEHA 4CEWC 3AZXA 1SBEA 2HH9A 3UKTA 2JENA 3M1HA 5FYHA 3WNXA 4BMBA 3IIAA 3FUOA 3N7JA 3IB3A 4MV2A 1PVXA 3INAA 4XAEA 2HWD1 3WY6A 5A6YA 1XNDA 4XF4A 1GFF2 3THDA 2BW8A 3OD0A 3C7FA 5F1RA 2EICA 5L36A 1XE7A 3HQUA 1COV3 2HWC1 1SFYA 4NHMA 1C8M1 4HSJA 2X05A 5FBZA 5J7MA 5BNNB 4MG2A 5FY5A 4UFLA 5FYUA 2E51A 1FATA 4QX7A 3ME2A 5FZ8A 3WF3A 4LE4A 5KC5A 3ZO0B 3MF9A 1BMV2 4QDQA 4Y22B 4A3ZA 1H4GA 5A7PA 1AR73 2W9XA 3NV4A 1NCQC 1RUNA 4DS0A 4GAZA 2O1QA 1SDWA 3O12A 1GWKA 4YG0A 5FZLA 1RMU3 1Y9MA 4Q0SA 1LHUA 4R9DA 3VZKA 5CB7A 1LHVA 4Y1VA 4D7TA 5FPBA 4LOSA 2Y34A 5FXZA 2FCTA 3MFCA 5CZKA 4K9SA 3NKGA 2VUJA 4KMQA 5FZMA 2DDUA 4CP9A 1AYM3 1BVP1 4F8AA 3O1UA 1OURA 2VQ0A 3IBMA 3TEXA 4WM8C 2ILMA 3WVJA 3ZR6A 3CNAA 5JSPA 5LBFA 2QFEA 2VQAA 4DXRA 1A8DA 2JDHA 4HONA 4XDQA 2NLRA 3SC7X 2OQ7A 2RS33 3AMMA 1VB4A 2E63A 5C33A 3LDKA 4Q4W1 4U2AA 1NE6A 1O7FA 1OF4A 1QJU1 1GICA 2HYXA 3RI8A 1CD3G 3UETA 5T50A 5LZ6A 2ZKNA 3IIIA 4Y1UA 4IETA 4D6QA 5FZDA 3AKQA 4B1MA 3D5OA 2QQVA 1YI9A 3I2IA 4QM8A 3GF6A 1YQ5A 1YQCA 5FXWA 4DUWA 5A7OA 2WYSA 2P34A 5IAXA 1NYWA 2K9ZA 1C4RA 1PK6B 3AFGA 3NNMA 2VQTA 4CDUB 5F5AA 5L9RA 5LBEA 3ZDVA 2BUKA 2P5BA 4FPHA 3DF0A 1KDMA 1XC6A 2ADEA 1LULA 4CUCA 1W9YA 2YPJA 3VBSA 3S0MA 3QOPA 3NQHA 4GMP0 1FT9A 4AEDA 1F35A 1W6NB 2V4AA 5EZWA 2GZWA 5IK7A 5C8CA 4IDZA 5F3IA 1UY2A 3MBWA 4GB31 3MW4A 1I9RA 3KHBA 3FWEA 2D98A 5IFTA 3TRSB 4LBOA 4KG8A 2JKXA 3J7MA 2WNUB 3N7KA 1AR61 4MGTA 5FP3A 4UXAA 5I8TA 2C24A 1ZBE1 2A6YA 1JUHA 2HYKA 2HLEA 3N3HA 4XJ9A 2J22A 3ZXEA 5JAXA 1LU1A 3MLJA 4A2UA 1ALYA 1IPJA 2EXIA 5I91A 4R9BA 1V6KA 3M3QA 2X09A 1C1FA 1TMF3 2VTXA 4CXXA 2YBPA 5A3UA 1QJX1 1WMDA 5DAWA 3MIFA 1PIV3 4BQWA 1VRH1 3WF4A 2X5IC 1O3TA 1ONAA 2VVDA 2IC1A 2Z79A 4WZFA 4JDNA 2WO7A 4AVTA 5H9RA 1YNAA 4XUOA 5G05L 5FRAA 1XRUA 2EAKA 3JB4C 4P08A 5EFUA 1NY72 1HXS1 3U07A 1WUVA 2HJIA 1PO22 1V70A 1D4M1 1LNSA 2VUDA 3PIGA 4HMZA 1YQ8A 4YLZA 3DUIA 1OFNA 2GNTA 4XFBA 5FYMA 4A41A 2CHHA 1UOBA 3QCWA 4UFJA 4QXBA 4AE2A 4CDXB 3ZPOA 4Y20A 5KXCA 1OQEA 2HWB3 1CAXB 4MSVA 3SKJE 4E27A 3S5AA 1ZRDA 1UIKA 2VOTA 3AMHA 5FY4A 5ACA1 4YW3A 4YG3A 1PZ8A 5FYVA 4AVCA 1JYVA 1DP0A 3FMGA 2Y6JA 1R1A2 4H2AA 4HXCA 4Q0VA 3FZ3A 2R072 1QGLA 3KQRA 4QQPA 3HEIA 1EY2A 1SLAA 1J3RA 1N1SA 4QQ2A 1FMD1 4JGZC 5EJ1B 5FZ4A 2ZGLA 5A70A 4EV0A 2XGXA 4BDVB 3U10A 1RUH1 4LJHA 1RVF2 3NJXA 4B4RA 1I1EA 2XKOA 2XUEA 1OOPB 1X9TA 4QKFA 1RHI3 1POV0 1IG3A 1C5HA 3GCWA 1SDDB 1B09A 5AC92 4AFMA 1X36A 3CMGA 4JZRA 2JIGA 4AEMA 1UCXA 1VAMA 2X8KA 3LKJA 2VVFA 1MEC3 1SFNA 4OHXA 4RGAA 5BXXA 2G9ZA 2RM22 2R30A 4QB6A 2KM2A 4EWAA 3EJKA 2JB8A 1ZZ7A 1O3RA 2XBO3 1BCXA 1MZFA 1GANA 2HBTA 3GGLA 4Q4X2 3A21A 4UFMA 1SEFA 1VBD3 5DUXA 3PUIA 4PBPA 3OGRA 2ZX2A 3PJYA 4M0HA 3OG2A 5DZFA 1W6QB 3POFA 4LA3A 4DOUA 3ASIA 3LSDA 5EJ3A 3SLIA 4KWUA 5ISLA 5C9AC 1WCQA 1N3QA 2BOIA 3KF3A 1ZRFA 1SBDA 2WAOA 5JOYA 1Z7S1 1F5FA 3SISA 5KWRA 3OBAA 2VY0A 1QKQA 1H6YA 4DXTA 5JXIA 3LSEA 3GJBA 3MIBA 2ERFA 1N1YA 1RUC2 2NP0A 1MZ6A 5L9BA 1D0GA 4IW3A 5BNPC 5CNAA 1LEDA 4B4QA 2P4EA 4QXCA 3ZYBA 1O5LA 1YXWA 3HD8B 2DFBA 4QPYA 1CGPA 4GH4C 3MLLA 4OLLA 5F2SA 3WF1A 4K20A 2JDPA 3BPSA 1UYPA 4IESA 2RDNA 5ABJC 2CNAA 2DUPA 3AMPA 3B7MA 1YFXA 3WP5A 3AJZA 3ZFGA 1OKQA 2PQSA 3NV2A 1POQA 2F17A 3J8F3 4RFT0 4CCDA 1SLCA 2BNNA 2BVBA 1S2KA 4AHWA 3JQXA 3OY8A 4XYXA 1A78A 3JB8A 4XIOA
chains in the Genus database with same CATH topology
3OTFA 3BALA 3N35A 2WNVB 5I0RA 4ZU7A 4ONUA 3DPRA 1H4HA 3V0BA 1CPMA 1TEIA 4AVSA 3VBOB 3MLKA 2VMIA 1C3HA 4A3XA 1RTVA 4EN6B 3RPQA 4WM7C 2B5HA 1QY4A 3RJ2X 4HVOA 3EQEA 4CDWC 4LBQA 4N43C 3OGGA 4FTBA 4Z07A 4GULA 4FPCA 4XFFA 2GMEA 1EV11 2NYYA 3Q9OA 4IERA 2ZGOA 4META 3WP5A 1AYN3 3AKRA 3HMYA 1IHMA 1ZZ8A 2GMMA 2UY8A 2VMGA 4S2DA 1G9CA 1UZZA 5I8SA 2PLV1 2BNMA 3P3PA 1AUYA 1OD5A 1JTZX 4FP3A 4OULA 4IEXA 2GN7A 3N7MA 1K5MB 1F9KA 3JUUA 4AEKA 2VW1A 2K2SA 2ZHMA 3S7IA 3LGRA 1QHDA 2RS12 4E2SA 1ND2A 1O3SA 2E7TA 1YUDA 4HN0A 1UF2C 5FO7B 4FT8A 4YG6A 5JWPA 4XTMA 4Z1VA 1ASJ2 2XWJB 5JZGA 3FLRA 3VKMA 3TN93 4AI2A 2FZ1A 1CX4A 4HL0A 4LO4B 2DF7A 4Y1YA 4Q4Y3 1QMJA 2YDEA 3B02A 1SCSA 1TQ5A 3ZSKA 1H2MA 4Y26A 5T5LA 3ES1A 3WV6A 4B29A 2A3WA 1H8VA 1O4ZA 1TMF1 2HWE2 5CFDA 4LBQD 4B7KA 2R0FA 2ZOEB 3HN1A 3PJQA 2ZX4A 2WLQA 2E9QA 1BBT2 1FPN1 3EHKA 5A32B 1QJY2 4FAGA 1PVC3 1EAH1 4KGGA 3V0BB 2WZR1 1W6PB 4YVSC 3POYA 2YC0A 4ZU4A 4XMAA 3B69A 3VDDC 1UX6A 2ZGNA 1SLTA 2A7AA 2WSUA 3AP5A 2QNKA 4I30A 2HWF1 2NMNA 1TME2 3PMSA 1LCLA 2R063 4L92A 2OW4A 4TSVA 1QDCA 3ZMOA 4LBQB 4QPGB 4OI1A 1ZREA 2WZPP 4RR3A 4ISQA 4L97A 1SLIA 1FV2A 1HV1A 1AL21 4AI1A 5H9SA 4CEWA 3M3OA 3HIFA 1H2NA 3VLBB 1RUJ3 3PVOA 1LHOA 2EVXA 4XQDA 4RHV3 4ASLA 1V6OA 3HQXA 3L2YA 1YFWA 1REDA 4JAAA 1ZVFA 4FTSA 1V9U2 3ZYRA 4L99A 5F6LB 4IV1C 3AP9A 2WS91 4AQ6A 1NA1C 2AH2A 1B35C 2FBEA 4BOWA 4D7SA 2E7AA 5CG9A 1VBE2 1FOD1 5AFBA 4FXKB 4H7LA 1X33A 4QMAA 1H2LA 1QXJA 1DQ6A 1BKZA 4QXKA 2ZJCA 1R093 1Y9QA 3VBHB 1U5IA 1AZDA 3ZFFC 5JIUA 1G9AA 4Q4V3 2QZ2A 1BQPA 1OQ1A 2D6PA 3RYKA 1WLWA 4KL1A 5EWSA 1HQWA 3AP4A 4MXVA 1PGL2 3TOJA 1J59A 5L19A 4PIZA 3QACA 2PA7A 1VBC1 5GZGA 1MS1A 5CFDB 4FPLA 5E8AA 4TLFA 1HLCA 3LZZA 2A6XA 2A6VA 5T5OA 3GBWA 4YVWA 4G4FA 4FOYA 4YW2A 3ENRA 2WIIB 4JGYB 3VBUA 1FAYA 1UKRA 3GZTB 5FLIA 2ZGTA 4XIKA 5T52A 4B7EA 1SACA 1Q43A 1W0PA 2FZ2A 1WGPA 4U36A 3WHUA 2WC2A 3NV1A 2VECA 1WCDJ 2WFF3 4GIQA 2OZJA 5K0UA 3NVCA 5LRSA 1KS5A 3WINE 1D0HA 2E6VA 4XBQA 5CA6A 3UJOA 2JE7A 1ZYBA 3VBRC 4RS5C 4AQTA 3BOPA 1UU5A 4UW6A 1BEV2 4MVTA 1JHNA 1MR5A 1S2BA 3T2TA 2HWD3 2P17A 2JJ6A 1RL3A 3AKTA 4P14A 3MIEA 4LO6B 2R6QA 2HWC3 1BMV1 1JN2P 1C8M3 3CO2A 2FHRA 4OHVA 1NLRA 1LOGA 1V6LA 4G9SB 3E5QA 4W6WA 4H3WA 4DNYA 2WNVC 1ZBA2 4EN0A 1XYOA 2YZ4A 3AYEA 3B00A 3TB0A 1PZ9A 1UL9A 1S0BA 1U5ZA 4Z2WA 1G9BA 1PZ7A 1KFUL 2PHLA 5FMOS 4FOWA 2GU9A 4CEYB 2BFUL 2JEMA 1MS5A 1H30A 1LR5A 4YZ3A 5I8YA 2ET1A 4TWTA 4TYSA 1JYIA 5I0UA 4YVWB 3PVEA 4FOVA 4W6YA 1H9WA 3KT1A 3VBUB 4XF0A 3AJYA 4Q4W3 1QJU3 2XHKA 2YUEA 1PGW1 2BVVA 1LEMA 1IGOA 3HWJA 4YGCA 3WP3A 5DXDA 4O9EA 1S0EA 4MGYE 2YROA 4HPKA 3POSA 5GALA 1PNGA 5K0UB 4BIFA 2XH6A 4JGZA 3WHTA 3A0KA 4GKXA 1DQ4A 3S7EA 3SH3A 2H0VA 4XOGA 1J3QA 1JXNA 4DRRA 2XUMA 1LGCA 4XILA 1O5UA 3URFA 4CDQB 1TE1B 3CJIC 4EJRA 4I01A 5KXBA 2RMU2 1RB8G 3AX4A 1XNBA 2NZ9A 4AFDA 4Z8BA 2JG8C 5GZEA 3IN9A 5KHIA 2YGMA 2TBVA 4GB33 3ZSLA 4HKLA 2ZAHA 2P37A 3O7OA 5JLVA 4M01A 2IZWA 3ACLA 1AR63 3RSJA 4IEUA 1ZZCA 5CBLA 4DY3A 1Q8PA 1Q8VA 4AW7A 1F31A 4JDOA 2PFWA 2W68A 1QF3A 1A6CA 3AM2A 1QJX3 5C9AA 3OPZA 1NY71 4ITCA 4PDWC 1VRH3 4COZA 3ZYIB 2WLPA 4MLOA 4P9YA 1QH6A 2A70A 3ELNA 3H50A 1RIRA 1H8TB 2WNEA 1HXS3 5DDJ2 4OHYA 2Q5TA 1D4M3 2D6OX 5BNPA 5JVVA 3I59A 2VPVA 3B3QE 3ZN6B 5CFCA 4GH4A 2ZCWA 2DURA 4FOQA 1R1A1 1JOJA 1MZEA 2R071 1LOAA 4XXAA 5A33A 1Q5OA 2PAKA 1RUG2 5ACA3 3AXDA 1ZA4A 5EYXA 3MYXA 3GZUC 2VXRA 1OFSA 3SMHA 3E6DA 3ZXFA 1RVF1 3DKWA 2UU8A 1RJ7A 1LOBA 1GBGA 2Q0AA 1MQTB 3GYDA 4XQWA 4AQSA 2ZHNA 4FPFA 3VBHC 2MEV3 1RUH3 4P9GA 5AC91 3EO6A 1CAUA 1VBE3 3OD4A 4WM7A 2UWCA 5D8AA 1GNHA 5KBFA 2RM21 4QGNA 4YM3A 1IS4A 3LOBA 2CYFA 4HBNA 4JTNA 2DCYA 4CDWA 3WXPA 1GNZA 1KQRA 3VUOA 4Q4X1 5J36A 3AK0A 4BIOA 3OBTA 4HFSA 1C5IA 3ZFEC 4AI8A 1Q8SA 5T3NA 3TBDA 4DFSA 3WT3A 2CGOA 5JOZA 4AI0A 1O3QA 4XFCA 4HK9A 3VHNA 4L2NA 2EIGA 4N9IA 3OYWA 3RG0A 5JPNB 2WA3A 1LU2A 4NR1A 1RUC1 2XJPA 1IPKA 1BK1A 1G9DA 1Z7S3 3H3ZA 4LBNA 2CGPA 1HDKA 2R042 4MXWA 2LALA 1QQP2 1Z78A 3BU7A 3I54A 4HK8A 3JBG2 2PHFA 2CAUA 2YXSA 2X53S 4OHWA 4HN1A 3H8UA 5C4WC 2PHWA 2YV8A 4NWWA 2W08A 4RL7A 1M4WA 3WDUA 5CFCB 5KHKA 3SH4A 4COUA 2RR12 1DGRN 3ZXKA 1ZX5A 3ES4A 3V64A 3J9SA 2VGDA 1ULGA 2QVSB 3QH6A 2DCKA 4IV3B 3JZVA 1NCRA 5L7OC 4QGLA 1S0CA 3D8CA 1DLLA 2UY9A 4PLOA 2A75A 4LUKA 2ZGUA 4QD2A 2WL1A 4IEWA 3H1WA 4OUMA 5F6KA 3WDWA 4A7YA 2JXAA 4XFGA 3L9JT 3B9IA 1GV9A 4YVSA 3ZN4A 4ES8A 4I2OA 2VH9A 5DZEA 5A3LA 4YGEA 1YIPA 2JDZA 1CAUB 3JCIA 4RQPC 3O0WA 1YFYA 5D8AB 1V6IA 3W58A 2HEYF 4FQZA 4ES9A 4Q2FA 3RYRA 1MS4A 4MUVA 2BBVA 4W65A 4YYOA 1VJ2A 1F5JA 4LBJA 2Q8OA 3LAGA 3LWCA 3NO8A 1S0GA 1QOSA 4LO7A 3WCSA 5FO8B 2JG9C 4D69A 1EV13 3RI9A 1DDLA 5FQ0A 2VNOA 4BMEA 3AP6A 3KD4A 3M8LA 4N53B 3IPVB 3M3IA 1KJLA 5BNOA 2RS11 3OYWB 2PLV3 4LHKA 3VN4A 1X50A 4EN7B 4AQ2A 5K7PA 1IS6A 1ASJ1 2W39A 1LENA 4IV1A 1NA1A 4I3GA 3ALQA 2WT0A 1KJRA 3IMNA 4MXWB 4PF5A 4DB5A 5JSOA 4NVPA 2P3IA 4E2GA 3R4SA 4QPIC 3JD73 3ZFFA 3KM5A 4BYYA 1IS5A 4AGGA 4CDQC 4COVA 1EPZA 3E5UA 5JIAA 2VG9A 5CVRA 1OA4A 1MS8A 1ENSA 1BBT1 3JU9A 1NCRB 4XJZA 1HQNA 4Y24A 3CEWA 3NAPC 2K0GA 5C6CA 2EA7A 3VBFC 3ST7A 3ZYJB 4G3YC 5LRRA 5I0SA 1WLDA 5BNQA 1FPN3 3ZIXA 1EAH3 1PM7A 1J58A 1HRV2 2QKDA 2WZR3 4P9WA 1RUF2 2ARBA 3WQ7A 1TME1 1I6XA 3PVNA 4FPEA 1LHNA 2XG3A 4K7JA 2XPJA 3KMHA 4E4DX 1WA4A 1LHWA 4Z82A 4L8QA 2HWF3 5TSWA 3ZXJA 1WD3A 5K8SA 1HW5A 4PLNA 2P3KA 2UWAA 1FI2A 2BYVE 3GZAA 2JICA 5FO9B 3GBGA 1AL23 3S6PA 4RS5A 3DV8A 3MIHA 4K40A 1V9U1 2BGCA 1LOFC 5FQ0B 3SCGA 1IQAA 5FAXA 2MEV1 5DDJ3 5BNOB 3D0JA 4MZUA 1VBE1 2ZABA 2OVUA 2EF6A 5CG8A 3VBSB 4AHYA 2WS93 4AEDB 1OLQA 1WBLA 1FOD3 5C8CB 3FJSA 3FLPA 1MQTC 4COYA 2D6NA 1PGL1 3RQ0A 1LTEA 1YI7A 2ET7A 1D2SA 1XXNA 4E4SA 2O8QA 5JR7B 1RUD2 3CL1A 1RUE2 2IXCA 2NMOA 3AMQA 4PCRA 1KS4A 1WD4A 1YO8A 5FLJA 3AZZA 1VBC3 2PTMA 3WDTA 2P2KA 3VL8A 5HCBA 4ZKTB 4F3JA 2BPA2 4AXOA 4P9JA 1RITA 2PAMA 5BYNA 1SBFA 5JOXA 1WMEA 3MDPA 3WG3A 4LLOA 1S55A 1CQ9A 1EYBA 2GN3A 1J3PA 2DVGA 1QNWA 4HLTA 1W2UA 2R16A 2N7GA 1VBB2 4Y20B 2OYZA 1IS3A 2RS52 2GNBA 2Y0IA 3NKTA 1NZCA 3AYCA 3LB9A 4FBFA 1BEV1 5BNNC 2R0HA 5DUUA 4YM0A 4CZSA 2IXLA 3V0AA 3NSTA 2CAVA 2H6CA 3M7AA 3CJIA 1VALA 3HT1A 3I7DA 1GLHA 4XFAA 4Q0PA 1WCKA 2C1FA 4FCAA 3RRDA 1REEA 3D0SA 2G9GA 4BE3A 2JG8A 3VZNA 4F83A 5JSRA 1LODA 1WLTA 3HBZA 5GZFA 1U0AA 2Z69A 4COWA 1DZQA 3WQ1A 3UKNA 1PO12 3ZPYA 2XL7A 4QM9A 1SQ4A 2IXHA 2W52A 3QH7A 2QJVA 4B3NA 1GQGA 2O8OA 3KT4A 3AYDA 1TNRA 2QE3A 4Q1RA 4AVAA 2BTVC 3VV1A 4PDWA 4DMIA 4HKOA 3J4UH 4B4PA 5T5PA 4C0HA 1KDKA 4QQHA 3SCFA 4JRLA 4WVMA 5EV7A 5FPXA 4R8HA 4LBKA 2XKPA 3MW3A 3MW2A 3ZN5A 2Z5WA 3KB5A 4LR4A 1URXA 1RUI2 2ES3A 3WOGA 1PK6C 3JD71 4CDUC 5BUVA 2D6KA 4JTOA 4LO8A 4IXLA 1G8WA 1NE4A 2F4PA 2TEPA 1DQ0A 5CADA 3H7JA 3DN7A 3GHMA 3ZMNA 1UW8A 3ZFGB 3GHNA 5LK5A 5T55A 1CAWA 4PIXA 5E16A 1DQ1A 1PMIA 1AR82 2H6BA 3OY8B 2RMU1 2IXJA 4FO9A 3NW4A 2JKBA 2QUOA 2ZTNA 4GQ7A 2TNFA 2WNUC 3V0AB 3WG4A 2R1DA 3DPRB 3M4FA 2D93A 2VOKA 1XNCA 3MEPA 4I0AA 3O14A 3ILFA 3DGTA 1VBA2 4DRVA 4E9KA 3DL3A 3GALA 3WDYA 4X6RB 4XJWA 4Q0QA 3ZXAC 2QCSB 3ZXDA 5FDBA 1DGRA 4V1PA 3HR9A 1LB2A 1HQLA 4FPOB 1G9FA 2D43A 1ND3A 1U5XA 1OPMA 2RHPA 4AHXA 1C8NA 2D6MA 3MIGA 1XU2A 1R1ZA 2AUYA 5DDJ1 4MGIE 1PO23 1QH7A 4XEZA 1OSGA 3ZYPA 4CDXC 1N1VA 1X8MA 3LCPA 4R4ZA 1UIJA 1D2QA 2B7YA 4FPKA 1WMFA 1CIWA 5IK4A 3FUQA 2ZMKA 4WVMB 1R082 1SMVA 1LKNA 1ND2B 1KFXL 2AYHA 3WW1A 4CP2A 1WCSA 5GZCA 3RMYA 1G86A 1H9PA 1RUG1 2P3JA 4X6QB 1YRZA 5JZGB 1HIXA 1R1A3 1NCQA 1CVNA 1G7YA 1AR92 2R073 4X8PA 1DGWA 2AR6A 2PHXA 4LEJA 4LNVA 1OOPC 3FX3A 2SBAA 2Z2SB 1FMD2 4HETA 4GKYA 1RVF3 3W59A 1GKBA 1MVQA 3M3CA 3WUDA 3PVBB 4R52A 3ZSMA 4LHLA 3MIDA 1RINA 2ZAAA 1GQHA 2ATFA 2YHJA 4WM8A 1Y7BA 4AK3A 1HRI2 5FLHA 1IZ3A 4Q27A 1AHSA 3NV3A 5AC93 5HCAA 4YSFA 4IEVA 5DZGA 1HV0A 1W39A 4YZ4A 5J37A 4IEQA 2RM23 5KXDA 4DQAA 4NHKA 1GYKA 2V73A 4Q4X3