4QGNA

Human acireductone dioxygenase with iron ion and l-methionine in active center
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
178
structure length
178
Chain Sequence
MVQAWYMDDAPGDPRQPHRPDPGRPVGLEQLRRLGVLYWKLDADKYENDPELEKIRRERNYSWMDIITICKDKLPNYEEKIKMFYEEHLHLDDEIRYILDGSGYFDVRDKEDQWIRIFMEKGDMVTLPAGIYHRFTVDEKNYTKAMRLFVGEPVWTAYNRPADHFEARGQYVKFLAQTM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human acireductone dioxygenase with iron ion and L-methionine in active center
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase
total genus 43
structure length 178
sequence length 178
ec nomenclature ec 1.13.11.54: Acireductone dioxygenase (Fe(2+)-requiring).
pdb deposition date 2014-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03079 ARD ARD/ARD' family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4qgnA00
1J1LA 3CO2A 2FQPA 1J58A 3SCFA 4O9GA 2PHDA 1OD5A 3TNQA 1CAVB 2O1QA 4IEVA 1LKNA 4DINB 3TNPB 5CADA 3BB6A 3NL1A 3DV8A 4I2OA 4HN0A 1CAWA 2K9ZA 1VJ2A 4BYYA 2XLFA 4XFAA 2ET7A 5CU1A 2VECA 1PM7A 4AVAA 4LUMA 3R6SA 1O3SA 2PYTA 4KWLA 3UKTA 1CX4A 1EYBA 1UPIA 4QGLA 4ORFA 5LEKA 1OMIA 1QXJA 3GYDA 1HW5A 3B02A 3RNSA 3H7JA 4WVZA 4D7TA 3CJXA 3UKNA 5KHGA 5BV6A 3O14A 3OGJA 3RYKA 1Y9QA 4I0AA 5JAXA 3KSCA 4Z82A 3WW1A 2OA2A 3M70A 4IEYA 1ZRDA 3LA3A 2GC3A 2XHKA 2GC0A 5EFUA 4XFBA 4XFFA 3FZ3A 1OI6A 1X7NA 4Q0QA 2XLGA 4AQ6A 4XF9A 5D1IA 4YSFA 4OLLA 4PJYA 4META 3NJZA 4ONUA 3CEWA 3HT1A 4I0BA 4Q0VA 2PAMA 2BNOA 2UY8A 4XFCA 2PTMA 2OZJA 4PIYA 3GBFA 5J7MA 4Z07A 3H1MA 1CAUA 4P9GA 3EQEA 2E9QA 1RTVA 5K8SA 3HQXA 2IXKA 3NVCA 3OD0A 1ZZ8A 1UIJA 3D82A 1NE6A 5FPXA 3DN7A 3RPQA 2IXJA 3LAGA 3ST7A 4MGZE 3HT2A 1ZX5A 1YFYA 4YRDA 3KCCA 1J3RA 3L2HA 1ZRRA 4FAGA 5I8TA 3H1YA 4MZUA 1G6NA 2GC1A 4IEOA 1GQGA 3PNAA 3CLPA 4AVBA 4MH0E 5CVRA 4F7ZA 4IEWA 2N7GA 3E5QA 3LOIA 4XFHA 1I5ZA 1JUHA 2C0ZA 4QM9A 1WA4A 2B5HA 2H6CA 2D5HA 4YYOA 3SCHA 3IBMA 1FXZA 3I7DA 5F1RA 2K0GA 4IERA 3OCPA 4AVCA 4LUKA 3WW2A 4F8AA 2KXLA 4RD7A 5T3NA 5I8SA 3H1WA 4EWEA 1YFUA 3ZDSA 2GH2A 1DGWA 4HVOA 4E2GA 5LRSA 1RC6A 1NE4A 4X6QB 2HJIA 5C6CA 1YUDA 2IXHA 3D0JA 3I59B 4L11A 4I01A 4HN1A 3OF1A 2F4PA 3BCWA 4QX5A 1ZRFA 3FE5A 4XF1A 4IESA 3IIAA 3S0MA 2O8QA 3ES4A 4J1XA 5FLIA 5JSOA 2GAUA 5FLHA 4BHPA 3G7DA 1IPKA 1NZCA 5JR7B 2Q0AA 1Q3EA 4ZU4A 5KHIA 4I02A 3FFQA 4LEJA 5I91A 4QM8A 3S7EA 2BEOA 5BUVA 1VR3A 2HKXA 1RUNA 2Y0OA 4XF0A 4Q0SA 1FT9A 5JSPA 2QVSB 4PIXA 1CAWB 5KHJA 5KBFA 1X8EA 4MGYE 3ACLA 1Q43A 3KMHA 2D93A 2D40A 3SMHA 1NXMA 3SCGA 3PVBB 5I0TA 4MGKE 2QCSB 4UBHA 4MGIE 3M3IA 2CV6A 4HVRA 2EAAA 2GZWA 1ZZ9A 1CAUB 1I6XA 2GC2A 2PA7A 4N9HA 4I3PA 5FDBA 3E5UA 4JVAA 5BY5A 1CAXB 1DZTA 5LRRA 2B9UA 4JV4A 2D5FA 5I0RA 1CAXA 4NVPA 3IWZA 5FLJA 4HVQA 1SFNA 4MV2A 1NYWA 1O3TA 3ROUA 3WW4A 3H8UA 1VP6A 2ATFA 5BPXA 2OYZA 1O5LA 4AXOA 5LEJA 5JSRA 4LA2A 4EROA 3VHRA 3EBRA 2DCTA 2PQQA 4R52A 2H0VA 3RYRA 4HBNA 1O7FA 1UW8A 4IEUA 5FQ0B 4LULA 5E1RA 3ES1A 4TLFA 5I0SA 3SHRA 1QY4A 5JCTA 3BPZA 4A2UA 2ZKLA 4XF4A 3SXWA 1IPJA 3CL1A 3KGZA 1UCXA 1ZREA 2IC1A 2QNKA 4ZU7A 1O4TA 3E6DA 2IXCA 1RUOA 2XKOA 4JTOA 3LA7A 4E2SA 4Q29A 4MUVA 3LZZA 4QMAA 3ELNA 4HSJA 1QXRA 1X82A 5C8WA 4MX3A 4E2QA 2WFPA 2PHLA 4R8HA 2MHFA 2BGCA 4IEXA 3S7IA 4LTAA 4YARA 1LRHA 2VPVA 2PFWA 1ZZBA 3U0ZA 2PAEA 4IEQA 2Q30A 4I09A 4UXAA 1SQ4A 2GU9A 1YFWA 2P17A 2H6BA 1GQHA 2IXLA 5I8YA 3JZVA 3NSTA 1ZZ6A 2XKPA 3IDCB 4K8FA 1EY2A 1QWRA 4BH9A 1CGPA 3H50A 1H1IA 3BALA 3DKWA 5KHKA 1L3JA 4L2NA 3HIFA 2Q4SA 2WC2A 3NKTA 3I59A 5HI0A 1RL3A 3N4MA 2VQAA 4IETA 4QGNA 3MYXA 1ZNPA 3H7YA 3U11A 1WLTA 4QGMA 3E6CC 4HSLA 2IXIA 4JTNA 2Q1ZB 3OTFA 2BNMA 4KWJA 3MPBA 1EP0A 4EWDA 2V09A 1EPZA 5FPZA 1UIKA 2UYAA 2XL7A 2UY9A 3QOPA 1LR5A 3H3ZA 4QXKA 4FT8A 4KL1A 4HLTA 4XEZA 1ZRCA 1U12A 4LLOA 5I93A 4OFGA 5J3UA 1DZRA 2Z69A 5KHHA 4KU8A 4Q0PA 4KU7A 1TQ5A 2CGPA 4O9EA 3RZZA 1YWKA 1XRUA 3C3VA 4N9IA 1YLLA 2FMYA 4GULA 2UYBA 3E97A 4HMZA 4FBFA 4FAHA 1O5UA 3NW4A 3RDIA 4X6RB 3CF6E 4ZU5A 3KGLA 4UBGA 1ZZCA 3MDPA 3LWCA 2PAKA 2Z2SB 4WBBA 1RGSA 3FX3A 2CAUA 3E6BA 4EV0A 3H3UA 4Q0UA 1X8MA 3MZHA 2EVXA 5E16A 2OZ6A 3U10A 1V70A 3EJKA 5BXXA 3ETQA 2QDRA 4EWAA 1DGRA 2XL9A 1LB2A 5FQ0A 4BIFA 1WGPA 2XGXA 1UD1A 2CAVA 3UKVA 2ETEA 2B8MA 4LA3A 3RYPA 1ZZ7A 4HZFA 5FCCA 1CAVA 1O3RA 1H1MA 2MNGA 3LA2A 1J59A 3I54A 4CYDA 4YNIA 2EA7A 2XLAA 5EZWA 3EO6A 3BU7A 1J3QA 4B29A 3FJSA 3IDBB 3QACA 2MPFA 2OPKA 1O3QA 4AQ2A 4XF3A 1FI2A 3DL3A 4KWKA 1YHFA 1PMIA 4J1WA 3FWEA 4WZCA 4XFGA 2ET1A 5J48A 3H9AA 5I0UA 1XE8A 3USSA 1OFNA 1J3PA 4PIZA 4IEZA 2I45A 4XETA 1ZVFA 5AVPA 1XE7A 4H7LA 1Q5OA 4IEPA 3WW3A 1Y3TA 4XFIA 1YFXA 3EHKA 3E5XA 2QJVA 2ZCWA 3FHIB 3PLQA 3D0SA 4D7SA 2BNNA 1SEFA 2BYVE
chains in the Genus database with same CATH superfamily
4M0NA 2VOXA 3IPVA 1SFPA 3K51A 4P14A 1J58A 2VZUA 2VQTA 3THDA 3WX5A 5FXVA 3GZUC 3WDTA 4NJ4A 1O8PA 1UMZA 5LATA 3QBQA 1DF0A 5DG2A 2GMMA 3WDXA 1A8DA 5H9RA 1LOBA 4R9CA 1YIFA 2VBBA 3VBHB 4DO0A 1LKNA 2W2IA 4WM7B 4XUOA 1LECA 3I3DA 1DIWA 2P4EA 3LD8A 5J36A 1U5YA 3B01A 3NNJA 3JU9A 4CDWA 2EXHA 3PMEA 3PURA 4LMFA 2K9ZA 1N1TA 1VJ2A 1ZBE2 3VKNA 2RJ2A 3ITQA 1PM7A 1RUJ2 3M3CA 1S4CA 4LUMA 3R6SA 4EJRA 3I3MA 3BVCA 4QPGC 4UFKA 1CVNA 1RUI2 2WUHA 5IK8A 4UF0A 3NJXA 2G19A 4L9BA 1AR73 2YUEA 1Z7S3 1UPIA 1CQ9A 1OMIA 2AR6A 5DDJ1 1QOSA 1HW5A 4N43C 3B02A 3RNSA 2OX0A 5FMBA 2OQ6A 4UW5A 4D7TA 3CJXA 2BERA 3UKNA 2DU1A 1R1ZA 2E51A 5KHGA 3O14A 3RYKA 2WR9A 4I0AA 4OI2A 1WW4A 5LA0A 1W6NA 3WY6A 2R49A 4LITA 1RMU3 4FPEA 4KI5M 1C8M2 4AG4A 1UZVA 3VBSB 2OA2A 1G9CA 3OPZA 4BE3A 4ASMB 5TSWA 2RS13 1ZRDA 2C6SA 2QQLA 3LA3A 2J1VA 2XHKA 5IFTA 2HWD3 4XUQA 2RVAA 4OUMA 2ZGLA 3Q8AA 5EFUA 1OI6A 3M3OA 1TME2 3NWKA 3O1PA 2R1DA 3MIFA 1N1YA 4Q0QA 1UXZA 1V0AA 5FZGA 3VDDB 4BWOA 4YZ3A 1LULA 5FZOA 2W5FA 1EV12 3A21A 2RS52 4META 2ERFA 3S5QA 5GLTA 3KF3A 4CCJA 2VMCA 3MO4A 4NIDA 1POV0 1QOTA 4AW7A 3CEWA 3HT1A 4Q0VA 2PAMA 2X5IB 1LESA 2LALA 2OZJA 4XACA 3ZX7A 5LA1A 5ACA3 5J7MA 5A1FA 1QQP1 2E9QA 3BODA 1OSGA 3T08A 3HQXA 1DGRN 1KD7A 2X10A 3FMGA 4N7UA 4RFT0 2DVGA 4MHUA 4QX7A 3ZFFB 3BTXA 4DZGA 1LU2A 4UT5A 4JDOA 3WF2A 5KC6A 1A78A 1ZZ8A 1JZ8A 1UIJA 3AXDA 4HONA 3D82A 4QD2A 4LBNA 5FP9A 1B35A 1WBLA 1W0PA 3LAGA 4E4SA 1A34A 1DQ5A 2BOIA 4FOYA 5FZIA 3NAPB 1YNAA 3WEZA 4ZKTB 1OA4A 1YFYA 2VCMA 5T55A 2MEV1 2R071 2Y6KA 4XABA 2JE8A 1TMF1 4ZZ5A 1UQXA 3AP4A 4BZ4A 4RSUA 2JXAA 3L2HA 4UYBA 4Y22B 2AZ5A 1AYN2 2PLV2 2ZKNA 4YM1A 5I8TA 4FCAA 5A3NA 3W9AA 4LO6B 5FV3A 1G6NA 4UWDA 1IKQA 2XUEA 2W87A 2CL2A 2RS33 1ULOA 3QCWA 3VV1A 2VULA 4WM7C 1QJEA 1AL23 2D6MA 3PNAA 3CLPA 3SC7X 4MH0E 5CVRA 1VPHA 3VDDA 4CP9B 4CVUA 1CPMA 4IUGA 4Q4W1 3AP5A 2OXBA 1UX6A 4XTMA 1XYPA 1Y7BA 3SISA 3INAA 3WXPA 3QH7A 3RZHA 2W08A 1R64A 2D5HA 4QPIC 4YYOA 1JZ4A 1FXZA 1DYKA 5F1RA 1E5RA 4AVSA 4H55A 2RM22 1YRZA 1S2KA 1WLCA 1ZBA3 1QU0A 1W04A 1UPSA 5CISA 4AVCA 4NRQA 1VBD1 1UNBA 1O59A 3QH6A 4WVVA 4AI0A 4SBVA 3ZYRA 2R32A 4KBBA 1S0JA 5LY1A 2GN3A 4CDXC 2ZOEB 1L7QA 4X6QB 3UJQA 2XBO3 3SEEA 3OGGA 4RGGA 1IG0A 2IXHA 3ACFA 2PHUA 4GMP1 1PK6A 4I01A 3T2PA 4DOUA 5KXCA 1JODA 3BOWA 1HQLA 4M01A 4YFWA 3HAGA 5KXEA 2LTNA 3C7OA 3KQ4B 4AE2A 3ORJA 4NIGA 2YGLA 5C3RA 1ZRFA 3FE5A 4W6XA 3GF6A 4IESA 3IIAA 1C8M1 2E33A 1F35A 4CEWB 3BTYA 2HEVF 1ZBE3 3AVSA 4Z1VA 1WA6X 2XOMA 2GAUA 4BLIA 5JSOA 4BHPA 1C5IA 3T1MA 3CJIA 2OVUA 4FI9A 5JR7B 4JDNA 3I97A 4RA0A 5FYMA 2D6PA 3SH5A 1S2BA 3ZXGA 5I91A 3FBMA 4QM8A 5DDJ2 1AF9A 3GNEA 4Q4W2 1Y9MA 5HCAA 2L9LA 2J1RA 5EYXA 2A6VA 1OLRA 2HKXA 2A5ZA 3RWNA 4GWMA 2GP3A 3OBRA 3AKQA 3OYWB 4JGYC 4S2GA 4LOSA 1PO13 3FN9A 4Q0SA 2GN7A 1Z7S2 2QVSB 2R043 1CAWB 1X8EA 5KR7A 1O4ZA 1WWYA 2SLIA 5DUUA 2JKBA 2RR11 3J4UH 2RG4A 1UXXX 4Q8KA 1MR5A 1POQA 5IJRA 2VOKA 4MLOA 3ECQA 4BQXA 2D40A 4EZ4A 1SDWA 1R082 2HWB3 3TBDA 5CG9A 4WM8C 5FZ8A 1BMV2 3LDKA 4QKFA 2BZDA 3MICA 3K75B 2QZ2A 5ANQA 5I0TA 3WV6A 1PMHX 5DN2A 1H8TA 3M3IA 4HVRA 4BA6A 5GKAC 3WG4A 3EB7A 1AR81 2EALA 2GZWA 2VZRA 3AYAA 3A23A 3BU0A 4RFRB 2YMZA 1PNFA 1XU1A 3SEPA 2DBIA 5FDBA 2V5YA 2DVAA 2WNEA 4DEVA 1VRBA 1I3HA 2NZ9A 1L7RA 1EV13 4Y22A 4B7KA 2MEV2 2R072 4Y33A 5GZGA 4NVPA 4CPBD 3ZSEA 1NLSA 5A6XA 4Y4YA 4QHZA 4YVSA 4ZXEA 3CKHA 3OGRA 1YI9A 2DCJA 1GZWB 2RS53 1RHI3 4QQPA 1O3TA 4P9YA 3ROUA 3T0BA 3LDRA 4W50A 2EIEA 2J7MA 2LRPA 2VL4A 2Y34A 4LK6A 5LBEA 2OYZA 4LA2A 4AEDA 4EROA 4OQ8A 2D97A 2G1MA 5EJZB 4R52A 3VHOA 1IQAA 2H0VA 3T3YA 5LBBA 4JQTA 1KGYA 4YLZA 4YGDA 3NKGA 1VRH2 3VZNA 3O1SA 2KM2A 5A80A 3I2DA 2WZ8A 4MXWB 2WJSA 1DHKB 5D8AB 4NHXA 4EN9B 1GBGA 1TZOA 1MEC1 5J09A 2NM1A 1QY4A 1V6OA 2ORZA 2C9AA 4AR2A 1BBT3 2YBKA 2RE9A 3MLKA 4LR4A 2V4AA 4IV1B 2ZKLA 2PXJA 1IPJA 3TEXA 1B09A 4LO4B 2X09A 1S0EA 2IC1A 4PI0A 3O1VA 5GM0A 1A8MA 2QKDA 2VCAA 3N9LA 5EP9A 4ATEA 5C70A 1VBD2 1H9PA 4DXZA 2YY1A 3O0VA 4RR3B 4W6YA 1SCSA 3ZXAC 1FOD1 4BMEA 1PMJX 4MX3A 4N43A 4XZUG 1PK6C 5A7PA 4E2QA 4FFFA 4BQ5A 5BNQA 5BNPB 3RZKA 2WFPA 2ZEZA 4N43B 4RGAA 4M3CA 2YC2A 1QJX3 5FR3A 4DIQA 4I0WB 5JLVA 2MHFA 4K21A 2YGMA 4YARA 3W5NA 3WOGA 3KD4A 4BISA 4A42A 1MS8A 1F15A 1UZ0A 4BQ1A 1PVC1 2PAEA 2VCBA 3W58A 2Q8DA 4D6SA 1WCUA 2UWAA 2WSUA 4UXAA 1DGLA 2GU9A 3ALQA 1YFWA 1GICA 1IQDC 1AR72 1NUKA 2CGOA 3URFA 2W1WA 5I8YA 1W28A 2DF7A 1RUD1 1ZZ6A 2O8OA 5IVBA 5IYYA 5FYHA 4BH9A 2ZBJA 2CTVA 4LHLA 4FVVA 3H50A 4QXBA 3DKWA 5KHKA 4WM7A 3VBUB 1PO12 2Q4SA 3OPWA 3VHPA 2WC2A 1C4RA 3KV4A 2XDVA 3RI9A 5HI0A 4YG3A 1AR93 1D2SA 4E27A 1QKQA 4COWA 5AC93 1K3IA 3LSDA 4QGMA 3VBFC 4BQYA 2EXJA 1DLCA 4AI3A 1TE1B 2IXIA 3O0WA 1HLCA 4E4ZA 4INDA 4E8DA 4W8JA 5FXXA 3C7FA 2BNMA 3BGAA 4LKSA 5IATA 2WT2A 3ZR5A 3ASIA 1UYPA 5FZCA 3C7GA 1LCLA 5JI7A 2WYFA 1EP0A 2Q1MA 3I2OA 4EWDA 5CKQA 4C90A 1NOVA 5DAXA 1RJ8A 1UIKA 4LXLA 3ZMOA 2BBVA 4V2VA 3GZAA 4BCUA 4BQ3A 3H8OA 2VUJA 4XJZA 1LGNA 1O91A 4EQVA 4BIOA 5C5TA 1OD3A 3KQRA 1OKOA 1LR5A 1AR63 2ZZJA 4QKNA 2Q8OA 1UKRA 4KL1A 3SKVA 3NMBA 4HLTA 2IUWA 3TN91 1PZ9A 1Y4WA 4JGYA 1BZWA 1V6NA 4LOTA 1DYPA 5I93A 3VN4A 5K7PA 4K8RB 4HANA 5LB6A 2VZPA 2V4VA 5A6ZA 3LPGA 3OSDA 1TQ5A 2CGPA 3RZZA 4D94A 1BK0A 1ULEA 1LHWA 1NQJA 4K40A 3OBAA 1EUUA 3QD6A 3ZXEA 3VKFC 5FZLA 4FAHA 4FTSA 3SNMA 2JDMA 5CFDB 1BMV1 5GLZA 3C2UA 3MLJA 2A3WA 2WWUA 5FYTA 4RR3C 4ZU5A 3KGLA 2DYCA 4Y1ZA 1KITA 5HCFA 1NKGA 4BQ4A 1G9DA 3MDPA 4QB6A 3USUB 3LWCA 3U4SA 1XC6A 4XUTA 2QQJA 5FK8A 1LGBA 1NLQA 4YVWC 2P3JA 1RHI2 5FMOS 3V65A 5FPAA 1HRI3 1UY0A 5K0UA 1IG3A 1DG6A 1LOFC 4QX3A 4DFSA 5K0UB 2D3RA 4YVWA 4KGGA 4AYUA 3ON7A 4CDXB 1AYN3 2HWC2 1HRI1 2CHHA 3D4KA 3SITA 1X33A 4ET7A 3MZHA 2EVXA 4TLGA 2OZ6A 4U2AA 1JZ3A 1RB8G 2P1BA 3T2OA 3J7LA 3VBHA 5FP3A 3EJKA 4UW4A 4MSVA 2AACA 3MFCA 2LS6A 1LB2A 2W68A 2QTWB 1RVF1 1MS0A 2GNMA 2XGXA 1REFA 1JXNA 3JD71 1D7PM 2WQZC 2HWF2 1BCXA 4XHXA 4YZ2A 5JVVA 1CAVA 1ODMA 3JBG2 2YG0A 3HMYA 3VLBB 1GZCA 2CY6A 1XJAA 4OVEA 2TBVA 1SLBA 5JXIA 1PGL2 2J22A 2XJTA 4QB2A 3ZYJB 3TEZA 5EJ3A 4JKMA 2D7FA 5C8WA 1HB1A 1UOJA 3B3QE 3AP7A 5JPMB 1KDMA 2R061 1RMU2 5H9PA 4B29A 3GBGA 2XJVA 3F95A 4Q4W3 1ACCA 4DB5A 2ZGRA 4FXGB 5FO8B 4XF3A 2XBO2 1W6MA 2WLPA 4OMDA 4OZXA 2BDRA 5T5JA 4KWKA 3LFMA 1RYYA 4OHZA 4D3WA 3FWEA 1EAH3 4U36A 4XFGA 1B35C 3S6PA 5J48A 2JENA 3B69A 4H14A 1J3PA 1NCQA 5EYYA 5GZEA 5D2AA 4PIZA 1RHI1 1RJ7A 1DQ6A 2C4XA 4W65A 3WF0A 4BM8A 2WN3A 4WM8B 4KQ7A 4JHZA 5AVPA 3K3NA 2ZGTA 1RUJ3 4YZ4A 4XFIA 2W91A 5JIAA 5FRAA 3UGGA 3ZXKA 2GH8A 5CKNA 3FHIB 1D4M1 4I2OA 1Q8VA 1XYOA 3OOXA 1LJ7A 3WNPA 1U5IA 1OOPB 4XAAA 5GZCA 3PIJA 1HN0A 2RDRA 3CO2A 3OBTA 1NA1A 2FHRA 2FQPA 2JB8A 3AKPA 4YM3A 1EAH1 4LBQB 4CUCA 2A71A 2WWSA 2VMIA 1AR83 3JUUA 2RV9A 4QQHA 4XBLA 4UOJA 5FY9A 3SCFA 3T1LA 2XB6C 4MG2A 2WAOA 3TNQA 4Y5Z0 3LQCA 3JXSA 1IS4A 5FZMA 2W94A 1S0BA 2E7AA 5EQUA 3TNPB 1JOBA 1GZ9A 4COVA 5CADA 1DQ0A 3DV8A 1HB4A 5CEHA 4KWUA 3POWA 3DYPA 3PTRB 4Q4V3 1RUG1 4OHVA 2VG9A 2VO5A 2Y0IA 1GLHA 4XVHA 4BYYA 2ET7A 5CU1A 2VECA 5DAVA 1ALYA 5FMCA 5FZ1A 1AX1A 3WQ1A 1XSRA 4E9KA 3SH3A 3U75A 3AFGA 2R041 4FFGA 4Z92B 2QQPA 3T0DA 4KWLA 5APAA 5A3WA 2JD9A 3B5LB 3UKTA 1CX4A 4Z2AA 1T6GC 5K0UC 3USUA 2JKXA 3VD3A 4ORFA 4GA9A 3LKJA 1QJX1 4OCTA 5G04L 3ZN4A 1CIWA 1G9FA 3WF3A 3H7JA 3AYDA 1AR61 4WVZA 1RVF3 1W03A 3WNNA 3ZIWA 2RHPA 3I2HA 3LPFA 4NROA 2WAAA 2A70A 5BV6A 1H6YA 4I3GA 1VALA 4FPKA 1Y9QA 2CWSA 2YC0A 4QU2A 4ZS3A 4LBKA 1QJY2 1URXA 4YVWB 3VBUC 4IV3B 4FP3A 2WS91 4Z82A 3WW1A 2DU0A 4GJZA 3RZLA 3JBG3 5F7UA 2VTFA 1CD3G 3MIHA 2ZACA 4XFFA 5FZ4A 5T5OA 1S0IA 1OUSA 5FO9B 2J1SA 2YHJA 2WNVC 3T0AA 1AR71 5EXOA 2ZHNA 4XF9A 5D1IA 2ZMLA 3VZOA 1JOPA 3NJZA 3K4ZA 4LORA 3HQUA 4AK3A 3W59A 4UFLA 2QDNA 2BNOA 5CBLA 3OB8A 4Q4Y1 5ACA2 4CDWB 4PIYA 4AEDC 1U5ZA 3GBFA 1RVF2 4Z07A 4P9GA 5DZFA 3O7OA 4CXWA 5ANNA 1F5JA 1RIRA 4IE4A 5CKMA 1S55A 5JOZA 1HRI2 4K7JA 3WDYA 2ZAAA 1PVC3 2Y8KA 3NVCA 4MHRA 2RS11 1YJLA 3AJZA 3DN7A 4Y5SA 1WUVA 2YROA 2IXJA 5E88A 1V9U3 2Y6JA 3RS6A 3N7KA 3MIDA 1VBA1 4DEQA 1W6MB 3NQHA 5BYNA 4Q4Y2 4AWDA 4FTBA 3IAPA 2DUQA 1DU3D 2WA3A 1R1A3 1BBT2 5JXGA 5L73A 3AMMA 4NPRA 1H8TC 1U5XA 2VH9A 1PNGA 3H1YA 4MZUA 3WG1A 3N9OA 4Y1VA 3PMSA 1NY72 5IK4A 5FKBA 1UY1A 1SG3A 4NN0A 2A6XA 4ZPIA 1GQGA 4ZY9A 1NCRC 2X53S 1SPPB 5FMDA 4WM8A 2VZ3A 4F7ZA 4HETA 3Q8FA 2VOVA 4IEWA 2N7GA 2Y6LA 4XFHA 2HBUA 3WF4A 2C0ZA 5FPVA 2HEYF 2B5HA 2HBTA 4CU7A 4LE4A 4TTGA 5F5IA 1H2NA 3VDAA 2E7QA 1SLIA 1OH3A 4IDZA 3VBRB 1UOGA 2K0GA 2DDUA 1N3PA 3AJYA 4IERA 3VD4A 1R083 1SFYA 3VD7A 2HWE3 1MVEA 3U78A 4IL7A 2WNVA 3VBHC 4XQ4A 4C91A 3WW2A 4F8AA 2KXLA 3OUHA 4H2AA 4RD7A 5AC92 3H1WA 1X9PA 2BGOA 3ZDSA 2GH2A 3AKSA 1H2LA 5SV5A 3VDCA 1DGWA 4HVOA 3WNOA 1LOFA 5ABJC 5T52A 4JC1A 2HJIA 1YUDA 4CSWA 2JB4A 3TWIA 5A3MA 4LJHA 5JZGA 1W6PA 4N53B 1E57A 4HN1A 3ZYHA 1OA2A 1C57A 1F5FA 3B94A 2KD7A 3N7MA 1VBE3 4AL9A 1H4HA 3ZKYA 2ZGSA 3KWVA 4QKBA 1TME3 3S0MA 2O8QA 2Q1FA 2YU1A 3AZVA 4ES8A 4J1XA 3MEPA 5FUNA 1AXZA 4AVTA 3G7DA 1MQTB 4WVMB 1JN2P 4Q4X3 1NZCA 3K77A 4WZFA 2ZGQA 1MACA 3AYEA 3ZPOA 1B35B 4ZU4A 1W3XA 5KHIA 1RUD2 1UX7A 3GHMA 4LEJA 3SLIA 1AZDA 4X8PA 4XJUA 4PDWA 1RUF1 3WF1A 1PO22 4ZZ8A 4NHLA 1J1TA 4NAMA 2Z79A 1HN1A 1SHWB 1VR3A 2BEOA 4P9IA 5BUVA 1RUNA 2I74A 2TUNA 1VBC2 2XQRA 2Y0OA 1Z7S1 2QBXA 4ISQA 3HQRA 2BTVC 4HK8A 1FT9A 1S0GA 2ZX1A 1OHFA 4JDMA 4O65A 4QXHA 1SACA 5FK7A 3DXTA 5KBFA 1LNSA 4CA9A 5FPUA 3NV1A 3IMMA 1D4VB 1GNZA 1MS1A 2PHFA 2ZGUA 5FZEA 1FX5A 3M4FA 3M3QA 3KB5A 3MW2A 2JIJA 3N7JA 4FOVA 5DPNA 2BWCA 1SLCA 2UURA 4FPYA 1ENXA 2D6KA 4K6BA 1AL21 3HD8B 3LIGA 4AFDA 2JDPA 1H4GA 2QQMA 5E6HA 3W21A 4E4DX 2WZR1 3JD73 2VZTA 4URTA 3ZLIA 4YWAA 2RS51 1UAIA 4AI2A 1I6XA 3NRUA 4UW6A 5J96B 4I3PA 5DUWA 4ATFA 1HJGA 3E5UA 1CX1A 3HVDA 4J25A 1E5IA 4R4ZA 5LRRA 1JHNA 4JV4A 2K46A 1CAXA 2OQ7A 1KS4A 2VNGA 4MGQA 3IWZA 3WP4A 2CU5A 1STMA 4BQWA 1SFNA 3T4HB 4MV2A 3MV11 3ME2A 4BQ2A 5HBAA 1NYWA 4EE2A 1PX3A 1PVC2 1TNRA 3NO8A 5CG8A 3DPRC 2EIDA 2ATFA 4AVVA 1PM4A 4QX1A 5FTTC 3ZN5A 4KMQA 5LEJA 3EBRA 4IE5A 3RMYA 3A22A 5L7OA 2AREA 1Q8SA 2GSYA 5F37A 2UU8A 1ULCA 2BUKA 4AI8A 4NHYA 1UW8A 2ID4A 4IEUA 4XUNA 5FQ0B 4OHWA 2ZMKA 1SZBA 2C9KA 2HWC1 3POJA 4TLFA 3RQ0A 4A3ZA 5IK5A 5EIYB 3THPA 5I0SA 1GP6A 2WWJA 3SHRA 5FOJB 1FMD3 2WINB 4X8NA 1WLWA 2WNUB 3GJAA 5JCTA 3BPZA 3GHNA 2RDSA 1UYYA 5F8PA 1AR92 3ETPA 1VMJA 4XQDA 3SXWA 4LKFA 1FV2A 3TN93 4D6RA 5B2GB 1ZREA 2YFZA 4ZU7A 5JZGB 1JZ6A 4GWIA 4LHSA 4A41A 5IVEA 3HR9A 2B45X 3BPSA 3NV4A 2VR4A 3D6EA 2VMFA 5JXHA 3LA7A 1RUH2 1VAKA 1W8ZA 2RDQA 5ABJA 1GZTA 3ZMNA 4HOOA 3CBNA 3VD5A 4HSJA 4JGZC 1XPWA 3MI8A 3L9JT 4GB32 5FP7A 5C33A 4XC9A 3S5AA 2W1SA 4DMIA 5DAPA 3TRSB 3TB0A 5CA6A 1E5HA 2P34A 4GH4C 4R8HA 4AAXA 1XBFA 1QQP2 5FBJA 1FNYA 3TYJA 3S7IA 3UL2A 2E7TA 1LRHA 2XXZA 3GJBA 4HPKA 2OKXA 4N7IA 4ASLA 4GKYA 5FKCA 1IZ3A 2BV4A 1WMDA 3ZYPA 1AR91 2DTYA 3Q8CA 4IXLA 1RXFA 2VUCA 3H0OA 1NXD1 4MXVA 4FO9A 4XDOA 5F6LB 1W9YA 5IVYA 1NAEA 4PBOA 4CUBA 4I09A 1YEWA 4J6GA 3UGHA 4D0QA 2W3JA 1YQCA 1W9SA 2P17A 4HKWA 5DZEA 1RUD3 1WD3A 1NCRA 1POV3 2H6BA 4Q4V2 4UFIA 3HBKA 5H9QA 3LGRA 5JWPA 1IS5A 1NCRB 1TME1 4Q4X2 4GZ9A 1FPN1 1NZIA 2I07B 1VBE1 1O6UA 4OI1A 3NSTA 1YI7A 4KGQA 5FZAA 3ZOIA 5BNOA 5KXBA 3IDCB 5E8AA 2VNRA 3ATGA 2VNVA 3BALA 2YBSA 3PUSA 1BEV2 1L3JA 4CEYB 3HIFA 1GP5A 2NN8A 2X05A 1GANA 1XNCA 5FY1A 3N4MA 1VBC3 2VQAA 4IETA 1ND2C 2ZZQA 1BQPA 4AFAA 4BK5A 4XURA 5FZBA 3S30A 4DQAA 2PHTA 1ZNPA 5A3PA 1RUH1 2W95A 3U11A 1NY71 3AX4A 1WLTA 2Y6HA 3AP9A 4EN8B 1I1EA 3E6CC 2HWE1 4JTNA 1R081 1D2QA 2Q1ZB 3OTFA 5FZ0A 5JOWA 3O0XA 3DEMA 3BI3A 2W39A 2HLEA 1RUC3 4JQRA 5FFOC 3VDBA 3WUDA 4ZHNA 3MPBA 4CTEA 2E53A 2KA3A 3I2KA 3ZSMA 3N9PA 3M1HA 2V09A 2FMDA 1FATA 2UYAA 3WQBA 1YYNA 4XJ9A 2D98A 4PHZA 4BLJA 2RS12 3H3ZA 4QXKA 1AL22 4FT8A 3AVRA 3RG0A 2ZEWA 3IZOA 3PVEA 3RMXA 1XNAA 1ZRCA 1U12A 3AZXA 3A4UA 5FAXA 4OFGA 3J7MA 4BXFA 4DRVA 1OC1A 3LEKA 3T2TA 1RUC1 1ZA4A 1W99A 2BGPA 2W52A 4HKLA 1CIYA 1H9WA 1YWKA 3C3VA 1KFXL 3ZXJA 1V9U1 2VVEA 3FC0A 1JBCA 4HMZA 3AKRA 1ZYBA 4M3CF 4AFCA 4MOAA 2B4KA 5GLWA 2NP0A 2JDHA 1AXYA 5F3CA 4QHBA 2V5DA 5CFCA 4H7MA 5L36A 2WFF1 3CF6E 3I2IA 4XW3A 5C4WB 1YO8A 2WIIB 3JQWA 4AHZA 4Y4RA 1DDLA 1O3SA 4COYA 1QNYA 3AM2A 4XDQA 5LA9A 4OUEA 1ULDA 4B1LA 2FCUA 2JG9C 3PL0A 4XOGA 1RGSA 4R9AA 4MGSA 5T5PA 2CAUA 3AK0A 3MIBA 5FZKA 4AI9A 2A73B 1GOGA 1OLME 4RQPC 5ISLA 1UZWA 2HWC3 5C8CC 2BBAA 4EV0A 2JECA 5ABJB 5IUQA 1UO9A 4Y20A 3GZEA 1GR3A 5HV0A 3MHZA 2J1UA 3RGBA 4CU6A 1X8MA 2LM3A 3T4VA 3BIWE 3KCXA 3GDBA 2VVFA 4Y3OA 5C9AA 2JJ6A 5BXXA 1WMEA 3NNFA 2WZPP 4F83A 2BVBA 4EWAA 2XG3A 2EXIA 1SPPA 1JMUB 1OLQA 4GMP0 3WCRA 4B1MA 3POYA 4BOWA 4S2DA 3UKVA 4KH9A 5DDJ3 1C1FA 2B8MA 3RYPA 3J7NA 1ZZ7A 1CWPA 2W1UA 4HZFA 2CYFA 5FCCA 4ASKA 1R092 1H1MA 4XMIA 3TOJA 2OUHA 2VXRA 2ORXA 1AYM1 1OOPA 2PHWA 1QDOA 1OUXA 4QX0A 1K5MA 3BOPA 3VUOA 3I54A 3VDDC 4CE8A 5A3LA 1RITA 1WMXA 3I2FA 4CYDA 4YNIA 1OA3A 5D8AA 3OY8A 4CRQA 2XLAA 1WCQA 4Y1UA 5IVFA 5HV4A 1WMFA 2P37A 3EO6A 2B39A 3BU7A 1N3OA 1A3KA 1J3QA 5A7NA 4K1YA 2FDJA 1PO23 2GNDA 3C7EA 4UW3A 4EN6B 3OD4A 4XDPA 1AR82 3DL3A 4K1ZA 4NIAA 3DYOA 3LEGA 2VQUA 5A7WB 4J1WA 4CCEA 5BNNA 4CDQB 4H3WA 1ULFA 3JB8A 3CHXA 1H8VA 1I5PA 2EICA 2YFUA 2ZMNA 3H9AA 4LKDA 3USSA 4DXRA 4Y26A 5FYBA 1G9BA 2WFF3 1ULPA 4FQZA 5L9BA 4IEZA 4CXXA 4D8MA 1HV0A 4C8DA 3J26N 4QPGB 3IMNA 1VBA2 3WZ1A 5EJ1B 1SMVA 1YFXA 3EHKA 3L2YA 4FPCA 3WCSA 5BNOC 2ZCWA 5BNNC 1LU1A 5CZKA 3VBSA 1POV1 1GYKA 5IVCA 1SEFA 2B9VA 1DQ1A 2BYVE 4FTEA 1J1LA 3MV01 4LK7A 4O7XA 4UFJA 3KCYA 4XCBA 3IPVB 2XBO1 1OD5A 1OKQA 2V72A 3KVAA 3ZN6B 2XJRA 2PQSA 3ZFEB 4HK9A 1CAVB 2O1QA 1JYIA 2DVDA 4QWNA 3NL1A 4PQQA 3AZZA 2Z42A 2JDAA 4HN0A 4P9JA 1CAWA 1O8SA 4JRLA 5LBFA 3U4XA 3OEBA 4K3UA 2WSVA 3ZFGC 1LGCA 4D69A 4AEKA 4XFAA 2BFUS 2WDBA 1OLMA 3CDZB 2RMU3 4AVAA 1F4AA 1W2AX 3POIA 3R4DB 1DQ2A 1C1LA 2VZVA 1HQWA 2PYTA 3J8F2 4AQTA 2IWGB 2ADDA 1NCQB 3D8CA 4IGOA 3WP6A 2DCYA 1TG7A 4URAA 2HEWF 3IM0A 4PF1A 4Y1XA 5FZHA 1EYBA 5LBCA 5IWFA 4B4RA 4QGLA 4E4HA 3H8RA 1COV1 3UNPA 3WT3A 4BPZA 3W20A 1HJFA 2E26A 2WZR2 4GWJA 3FHQA 4DRRA 4FPOB 2W92A 3K4AA 3OGJA 3U1XA 3ZXDA 2OPWA 5JAXA 4CEWA 5JR2A 2AC1A 4CEYC 3KSCA 3MW4A 1FMD1 2VXJA 3AZWA 4XBQA 3M2MA 3WDWA 5F3IA 1ND2B 1VRH3 1YQ6A 1W8UA 2AEZA 3H42B 3I2JA 3BUCA 1NX9A 4M4PA 4XQWA 4ARXA 3LE0A 2FD8A 3ILNA 2GC0A 3POSA 4G9SB 4W6WA 5FYYA 3FZ3A 3VHNA 3WD5A 1CJPA 3I2GA 4GB31 1HXS2 5F5AA 5F2WA 2XLGA 4IW3A 1F31A 3PVNA 4AGVA 4AQ6A 4DY5A 5C3OA 1AXKA 4YSFA 4OLLA 5FBZA 4PJYA 4NHMA 4QB1A 1HB3A 1HX6A 4OMCA 1IS6A 4ONUA 1RUG2 4A6SA 4S2HA 2QZ3A 3VBRA 1AYN1 1MPXA 2X5IA 2OW4A 4I0BA 3UT0A 4WVWA 4YM2A 2VGDA 2LROA 4XFCA 2PTMA 3V0BB 1WKYA 4XUPA 3H1MA 1CAUA 4P5YA 3EQEA 3P3PA 4LHNA 1ULGA 2YC4A 1QJU1 5C4WA 5IK7A 1VB4A 1CZSA 1W8HA 4AHWA 4DUWA 2XWBB 4TZDA 3VBSC 1GNHA 3OD0A 3JCIA 3ZSLA 4Y5TA 1OVPA 1M4WA 5JIUA 4KG8A 5DG1A 3ZR6A 3R4UA 1SDDB 1SBFA 1IS3A 3M7AA 4AHYA 1LEDA 1PHMA 3ZIXA 4CDQC 3KCCA 4NIIA 5GLVA 5DUVA 3ZFFC 5FY0A 1OF4A 1XSQA 5DMYA 2DTWA 1JU4A 5IW0A 4XXPA 1ND2A 3O5SA 4XTPA 4FPHA 5A6YA 1ASJ3 2JG9B 1IGOA 5IAXA 2ZHMA 5DZGA 4RS5C 4RHV1 2IVJA 2VW2A 1W3VA 3PHMA 1UZZA 1WCDJ 1W9TA 2E6VA 3E5QA 3ZFGB 1I5ZA 2D3PA 3BYWA 2VVDA 4QM9A 4CU9A 3K3OA 4CCOA 2VMGA 1VBA3 3VZKA 5HXMA 3BTZA 2H6CA 3SCHA 2HH9A 4BK4A 3NNLA 3M8LA 2HYXA 3BKZA 2WFF2 4NRMA 3RZGA 2W9XA 5F3GA 5FY7A 3ZYBA 3OCPA 3U07A 3MW3A 1WZXA 5T3NA 1MZ5A 1CZTA 3MPPG 4NWWA 4CEYA 1YFUA 1KXGA 1GNYA 5A32A 1X9TA 3NNMA 4PLOA 2JEMA 3PU8A 4E2GA 1RC6A 1NE4A 4YW6A 4COZA 5T54A 3D0JA 5JXJA 2DWRA 1ND3C 1C3HA 4L11A 3KHBA 4QX2A 1W6NB 3MLLA 1AX0A 2BW8A 1S2EA 2J1TA 1RUI1 3BCWA 3WNKA 5AVAA 3HPNA 3R0RA 2XH6A 2XVKA 1LOCA 3ES4A 3I4IA 5FLIA 1G86A 1DYOA 2DCKA 2HWD2 4XIKA 2VJXA 4XCAA 5FLHA 5F9TA 2ZX4A 3RI8A 1IPKA 5JOYA 4LO8A 1WBFA 4GWNA 5KXDA 3HEIA 2QE3A 1Q3EA 2ZJCA 4A44A 4LT5A 3SQOA 3FFQA 1ENRA 2R1BA 3FLTA 4JKKA 4NRPA 2ZAHA 3V56A 1COV2 1JI6A 4A45A 1BHGA 1XNDA 4CDUA 2V73A 1NA1B 2ZABA 3ZFEA 4AEJA 1Y9GA 5J1XA 3SH4A 1ZM1A 4W4ZA 4LIUA 4XF0A 3J8F1 4AAPA 4FSJA 4NOTA 1Q8OA 1W8WA 4AEMA 5JSPA 4PIXA 4SLIA 5KHJA 1TNFA 4M3CE 4MGYE 5L7OC 2WRAA 3ACLA 5FZ3A 3Q8EA 1V6KA 2IFWA 4LQRA 1GQPA 1R1A1 1W8OA 2D93A 2VTXA 4RS5A 2ZHKA 1S1AA 1XQNA 3SMHA 5C71A 1WW7A 2JIGA 1REDA 2Q8EA 1NXMA 3SCGA 2NLRA 4BU2A 4OI0A 5CIRA 3AL5A 3J9SA 1JW6A 4CDQA 2BP6A 2QCSB 4UBHA 3NAPC 1R093 3MF6A 4JZRA 2YB7A 3DCQA 1DP0A 2CV6A 3MIEA 4RGKA 2A6YA 2EAAA 1GMMA 3O1RA 4NR1A 1CAUB 2ZGKA 2BOJA 2PA7A 3U14A 2YXSA 2YDEA 1UY4A 5DAQA 1W90A 2WT1A 1K45A 1R1A2 2G9ZA 1DZTA 1FPN3 4KBZA 4QXCA 2R0FA 4TN7A 2B9UA 4IV1C 2ES3A 2D5FA 4JGYB 1W2UA 4NPLA 4AGGA 5I0RA 3BN6A 1QJFA 3LOBA 3VKLA 3A0KA 2Y26A 5T50A 4HVQA 3WHUA 3KT7A 4HPKB 2EAKA 3AB0A 1BLZA 2R6QA 1UZYA 4A7KA 2I2SA 2Q8CA 3O1MA 5DQ0A 1HXS1 1CESA 4AXOA 2VD7A 4D6QA 3AYCA 3KV5A 3IDEA 2DCTA 4L8QA 1PIV1 1WLDA 2G9FA 2PQQA 5CFDA 4HG6B 1G7YA 4LNVA 1ST8A 5C9AB 1TEIA 5GLUA 3LFIA 5A3OA 5LZ6A 1JZ7A 4XILA 5FZFA 5GZDA 4CUGA 3DKQA 5FZDA 2J42A 2RR12 1FMD2 3DYMA 4CU8A 1GWLA 1CN1A 3LDBA 1VBB3 3CJIC 5L9RA 2WL1A 3KHCA 2XQXA 2AUYA 3GALA 2ZEYA 4PDWC 5F5QA 4DNYA 4A2UA 2DCZA 3CL1A 3KGZA 2FDHA 1PK6B 3POBA 3VBOC 1O4TA 3CQOA 3I3BA 1IKPA 1SLAA 3HJRA 2IXCA 4IE7A 2XKOA 1KQRA 2AYHA 2HWB1 1RUOA 4YGBA 4CUAA 2P3KA 2UWBA 1BVVA 1MS4A 3KT4A 2WO7A 4FFIA 4JTOA 3C8XA 3VBOA 1O4YA 3ZXFA 4Q29A 3UETA 4CDXA 4C0HA 1VE0A 4MUVA 3ELNA 4D7YA 5JI9A 1ODNA 1N1SA 1X82A 4N53C 1HQNA 4HFSA 2ARCA 3I8TA 1ND3A 1LOEA 1US2A 4AFBA 1PO11 2JX9A 3VZLA 2VW0A 5FUPA 1CONA 1AL0G 4V2WA 3IT8A 4KG0A 4AQSA 4LTAA 3KF5A 1FV3A 2VPVA 4OUSA 5FMOL 3EYPA 2PFWA 3PUAA 5ERLA 1ZZBA 3JB4C 4RHV2 3RJRA 4BJ0A 3H3LA 3PU3A 4Q8LA 5HXVA 3AFKA 1W0NA 4LHKA 5BNPC 1VBB1 2Q30A 1H2MA 2RMU2 2ZTNA 4NMIA 3ZM8A 2WNUA 2WT0A 3POGA 4XJWA 3JBG1 1NA1C 1W6OA 1MEC2 2HWB2 2C5DA 1QGLA 4XE9A 4B8EA 3AMQA 1GQHA 2WS93 4R4XA 2ZS6B 4QT6A 5JOXA 1RUC2 5KC5A 3PTYA 1I9RA 4RS5B 2WQ8A 1G8WA 1W8FA 3BIEA 1CGPA 5FYUA 2R042 4IV1A 2WYSA 1H1IA 5L7OB 3NJYA 3OPTA 4L2NA 2WZR3 1F9KA 5T5LA 1UMHA 5I0DA 5LCWL 2ZPXA 2Q5TA 4QGNA 5C7GA 3MYXA 4ARYA 3GM8A 2VZOA 1UY2A 1OQ1A 3OUJA 4QQ2A 3O1OA 4NE9A 2E32A 2K2SA 2X29A 1SCRA 4GKXA 4HXCA 4NIHA 3ZDVA 5A70A 4PLMA 4KWJA 2VTXJ 1NQDA 3T09A 5J98B 3N3HA 3PJQA 5HCBA 4FXKB 4JX0A 3C7HA 1UMIA 4A3XA 1W2OA 2E31A 1EPZA 5CAZA 3VZMA 3O1TA 4V1PA 1LOGA 4LO7A 3O1UA 1ZA7A 2H0BA 3LCPA 1ENSA 1GZWA 2XL7A 4YG0A 5IVVA 1AYM2 3MUZ1 3VL8A 3VB9A 2ENRA 2Y33A 2W1QA 1R091 3AMNA 4AHXA 3ZPYA 2WO3A 2HWF3 1L7LA 2NMOA 2VUAA 4XEZA 4Y24A 5G05L 3N36A 3VKOA 4DXSA 4RYDA 3WVJA 1N3QA 3D5OA 4M4RA 4DPNA 3WP3A 3PIGA 2VQ0A 2Z69A 1MZFA 2Y60A 4KU8A 2P5BA 2WBKA 1UYXA 4K9SA 1FPN2 3WNLA 4LLFA 4Q4X1 4KU7A 2WKKA 2RS32 4O9EA 1AUYA 2VY0A 3V0BA 1XRUA 4TYSA 4O61A 1YLLA 4GULA 2UYBA 5C9AC 3E97A 3GGLA 4EYUA 1UN1A 5AC91 1O5UA 4HKOA 1PZ8A 1W0OA 3NW4A 3RDIA 1W8NA 4YM0A 3I3EA 2O14A 5AFBA 2B42B 3PUHA 5FWJA 1QEXA 1JYCA 1HV1A 4QQLA 2JG8C 1DGWX 2WO2A 4UBGA 3WG2A 3ZXLA 5A33B 3K4DA 4OZOA 2PAKA 4ITCA 2Z2SB 3VD9A 4P9XA 1OFSA 2R0HA 4AI1A 4DY3A 3WUCA 3VBOB 1V6LA 1OPOA 2R063 4RN5A 2JG9A 4ES9A 1KRIA 4XPVA 3WDVA 5FOBB 3ZN6A 3W5MA 3U10A 2ADEA 2ZA9A 4Q4Y3 1ND3B 2JE9A 2XHNA 2JG8A 1UOBA 3ETQA 1KFUL 4HL0A 5FYSA 1Y43B 2XL9A 2DFCA 1PVXA 4YZ5A 2AH2A 4PF5A 5FQ0A 5A1LA 2XVGA 5FY8A 2CAVA 1BEV3 2D6NA 2F17A 2NMNA 3WP5A 4JHTA 2ETEA 3P5BA 1OQEA 2HWD1 3PVOA 5CFDC 3WR0A 1O3RA 1W05A 4FFHA 4LBQD 5EPAA 3LA2A 5FPLA 1RUJ1 1J59A 2D43A 4GIQA 5F32A 2NPIA 1KEXA 3THCA 3IIIA 2EA7A 3GZTB 1GWKA 5EHDA 3OGSA 1F4HA 1UY3A 3KVBA 3P1IA 5E89A 1IOAA 5EZWA 4DS0A 2VZSA 3KS7A 3FJSA 4OHYA 1QOOA 2MPFA 3QACA 2OPKA 5K4LA 4AQ2A 4ZXKA 4M00A 4AF9A 3IDAA 3VBFB 3KT1A 5LW9A 1PMIA 3HNYM 3ZSJA 4GAZA 4PI2A 3T2QA 2ARAA 2ET1A 1HXS3 1QXPA 3ILFA 3N9MA 5I0UA 1XE8A 2B7YA 2X8KA 2DVBA 3AXEA 2JDKA 2Y6FA 4QQOA 1RUE3 1BEV1 4UI9L 1S0CA 2XUMA 1MEC3 4LPLA 5DAWA 5FO7B 1DQ4A 1LHNA 2CDPA 4XETA 4CP1A 1ZVFA 1CR7A 2VBPA 1Q56A 3G6JB 1XE7A 2XJQA 2ZGNA 1VBE2 3R4SA 4H7LA 1TMF2 4KNCA 1Q5OA 1W6QB 1ZRIA 1LTEA 4G4FA 4PCRA 1Y3TA 2OUJA 1IHMA 1J84A 3E5XA 2QJVA 1YJKA 4Q4V1 3WW3A 3WNMA 1AJOA 3PLQA 4CP9A 5FUIA 1D0GA 2VCCA 1MQTA 4WVMA 3T30A 4WZCA 1RUE1 1OVSA 1TVGA 4COUA 2XMLA 2ILMA 2ZX3A 2RJKA 3FLPA 3KM5A 4LBJA 4CXYA 1C28A 4ZS2A 4MYEA 4TXWA 3RZMA 1BXHA 1UKGA 1W8TA 3B00A 2PHDA 4O9GA 4XHBA 1LHOA 2JDNA 4AFMA 1YQ5A 2XWJB 1RXGA 1K5JA 2PLV3 3FBYA 4IEVA 4DUVA 4DINB 1W2NA 1QJX2 1QH6A 1PX4A 3BB6A 1OOPC 1UYZA 3ACHA 1UU4A 1ZBA2 5FZOB 2GP5A 2XJUA 3VGIA 2XLFA 1RUE2 4XJ8A 2FZ2A 1QMJA 2WNVB 2JE7A 5H9SA 5C3QA 1PIV3 2JDUA 3APBA 3UJOA 1QNWA 4GMP3 5JMCA 4GH4A 4OULA 4YGCA 1ASJ2 4C1WA 4FPJA 3MIGA 2QUOA 3UESA 5L19A 4QPYA 2YV8A 3WLUA 2VOTA 5A33A 5LEKA 1QXJA 3GYDA 1JYVA 4EZHA 4Q5OA 1P8JA 1W6PB 4N53A 2UWCA 5LASA 4YPJA 3CJIB 1LOAA 4C1XA 5C8CA 1UU6A 4PDWB 3ZO0B 1HRV3 1XXNA 3ABZA 3J7HA 3MBWA 2FCVA 3O12A 1V9U2 2IFRA 1JTZX 1YQ2A 4PBPA 2WABA 2LUWA 1RUG3 3JQXA 3ACGA 3AP6A 4UAPA 1YCIA 5FIXA 1V6MA 1VIWB 2XJPA 2XJSA 3M70A 4QPWA 3AMHA 1JZ5A 2ZX0A 4IEYA 4FPLA 3B9IA 2GC3A 2YZ4A 4JKLA 5FYIA 3RFRA 4NHKA 3ZYGA 3OBZA 4ISRA 4JAAA 2B46X 4PLNA 4XFBA 4CCDA 1X7NA 2DV9A 1S0FA 3ZVXA 1K12A 3VL9A 4AEDB 3FHAA 4XZPA 3AKTA 1OF3A 4DXTA 2ZGPA 5C3PA 1CJDA 4Q27A 2RMU1 4QPIA 5A32B 1VBB2 4A6OA 3AC0A 1ZBE1 3DPRA 3V0AB 1D4M3 2NYYA 5HCHA 3NV2A 4OQ9A 5FPBA 4FP2A 2UY8A 1YQ8A 4OHXA 1J83A 4Q26A 4YW4A 1E5SA 2EXKA 5LK7B 2HWE2 2BU9A 1KDKA 1RTVA 1CPNA 5A7QA 2R062 2IXKA 5K8SA 4LE3A 1H1AA 5CFCB 3OY8B 4PT6A 1T2XA 2BRTA 5C5UA 2QFEA 3BTAA 1SBEA 3POEA 3E1F1 1Z0HA 1MVQA 1OH4A 2RJLA 3U37A 4P9LA 5FY4A 1NE6A 2Z4FA 5FPXA 3RWKX 2A6ZA 5A1AA 3RPQA 1GUIA 3ST7A 4MGZE 1BKZA 4NPMA 1V6JA 1ZX5A 3HT2A 4YRDA 2BQPA 1BBT1 1H6XA 1H30A 1WCSA 1OQDA 3VBFA 5AFEA 1J3RA 1AVBA 2ZGMA 1W9FA 1UWWA 1ZRRA 4LBQA 4FAGA 4NWVA 5EWSA 5CB7A 2GC1A 1XB9A 1COV3 2VNOA 3HOBA 4E8CA 3FFZA 4UFHA 4QDRA 4YW7A 1F2NA 4IEOA 3S57A 2DFBA 2NQYA 4AVBA 3SKJE 3VBRC 1JH5A 1PGW2 2YYOA 4DUXA 2YPDA 1K5MC 4YZ1A 2RS31 3KZ4C 4A4AA 3OYWA 4AGRA 1PO21 3LOIA 1RUF2 5BNPA 1GFF2 1JUHA 4L99A 4NAOA 2QQWA 1OURA 1MZ6A 3DPRB 4LKEA 1BK1A 4XJAA 1WA4A 4YFZA 4Z8BA 1PIV2 1TMF3 2VAUA 1REEA 1DCSA 2PHXA 3IBMA 1M06G 4L97A 3I7DA 4BMBA 2BFUL 2G4IA 1GOHA 3ZFEC 3CNAA 2AENA 2FBEA 2KR2A 3DECA 4LUKA 3LEMA 4CDUC 3CMGA 5I8SA 4Z2WA 3VBUA 4EWEA 4GJYA 2PLV1 5FYZA 2A75A 4RHV3 4RQPA 2CSGA 1H8TB 2GDFA 5LRSA 2IVIB 5C6CA 5FZ6A 3GCXA 5EV7A 2ZEXA 3M3EA 2VU9A 2PELA 3HN3A 2OIIA 1ASJ1 1YIPA 2TEPA 3I59B 3IKWA 2ZX2A 3OF1A 2YU2A 2F4PA 4QX5A 4OYUA 4XF1A 4LBOA 3AMPA 4CPBA 4Q2FA 2WS92 2VM9A 3WQ0A 5A6QA 2Y6GA 2OS2A 1DBNA 5FXZA 4BXSV 1ZBA1 4P5HA 2JG8B 3K2OA 5FP4A 3FL7A 5FJHA 2XPJA 2PN5A 4K20A 3OJBA 3KLSA 2Q0AA 5FZ7A 3ZFGA 2DBNA 3HBZA 3OG2A 2GMEA 4I02A 5A3TA 1LODA 4XBNA 3S7EA 5IT6A 1QHDA 3ZKUA 1HRV2 3IN9A 4B7EA 4BB3A 5K9YA 2BJSA 3MGUA 4YVSB 2J1AA 4P9WA 2VW1A 2O0OA 1CZVA 2D44A 3DF0A 1A6CA 4UFMA 4AOCA 1LENA 4CDWC 5IVJA 2CWMA 1EV11 3X29B 3RZJA 4YW1A 2FDGA 1NT0A 1UF2C 4JRAA 3ENRA 5JPNB 2WZEA 3GCWA 4BDVB 3OGVA 2VBDA 1Q43A 3UGFA 1OXCA 5GZFA 2FDKA 3KMHA 5LA2A 5LWBA 2ARXA 2ZGOA 1W9WA 2TNFA 2P6CA 2VZ1A 1LAJA 1XNKA 1WCKA 3PVBB 4GALA 1BVP1 2GMPA 4MGKE 1MQTC 1EAH2 2HYKA 4MGIE 3FUQA 4HT1T 2JDZA 4B4PA 5JUVA 2A6WA 2CGNA 4QU1A 1ZZ9A 5DABA 1ENQA 2GC2A 1D4M2 4MADA 4N9HA 4L92A 2RR13 5FZ9A 2P6HA 2BPA2 4JVAA 2VMHA 5BY5A 1CAXB 4IE0A 3WSOA 1OPMA 1QIQA 3N9QA 5ACA1 3R05A 4Q1PA 4N90A 4QX8A 2WA4A 3MFAA 2FCTA 3A7QA 1LEMA 5FLJA 1V6IA 1JU3A 1RUH3 4P00B 2R30A 1C5HA 4Y1YA 3RVHA 4XIOA 2FZ1A 4WV8A 3P3NA 1QH7A 1VBC1 4CP2A 3WW4A 1PZ7A 1RUI3 2Y64A 2F6BA 1VP6A 2EIBA 3H8UA 3IAQA 4FOQA 5BPXA 2Y38A 4CCMA 1O5LA 5IHRA 5JSRA 4QDSA 3VHRA 1VMFA 3OEAA 3LB9A 1W6OB 3RYRA 1EUTA 3PDQA 4HBNA 5CNAA 4LBLA 1O7FA 2W0XA 4XMAA 1XNTA 5A3UA 4LULA 1C8M3 5A7SA 5IFPA 5E1RA 3ES1A 4G3YC 3HNMA 5B4XA 4NUBA 1FOD3 1MS3A 1XE0A 4IGPA 4IQPA 1GP4A 2ARBA 2MEV3 2R073 3DXUA 1YXWA 3EMRA 3B7MA 4IGQA 3HWJA 4JGZA 3UK9A 5DUXA 1NLRA 2XVLA 4XF4A 3J8F3 2D3SA 4JGZB 1AYM3 3RSJA 1XU2A 1FYUA 1UCXA 2C26A 2BWAA 2HWF1 2QNKA 5C3SA 1QF3A 4NO4A 3LF7A 3JD72 3E6DA 1JYXA 5FWEA 1VRH1 3N7LA 1VMHA 2D6LX 2EIGA 4TSVA 2DURA 4AZZA 3WINE 1UU5A 1GV9A 5HPOA 3I3QA 4E2SA 3THTA 2P2KA 3CIHA 4B3NA 4YG6A 5CYYA 1QJY3 2QQIA 1V00A 3LZZA 4QMAA 2DUOA 2P3YA 2SBAA 1QXRA 4YW3A 5CFCC 1N47A 4QPGA 2W46A 4Y20B 1N1VA 2QQVA 5JZGC 3TEYA 2GNBA 3TAYA 1HDKA 2PHLA 3N35A 2JDYA 2FDFA 2BGCA 4S2FA 1US3A 1VB2A 4IEXA 1Q8QA 1G9AA 1Z78A 1LHVA 3ZYFA 1KJRA 3ILRA 2VZQA 4L0PA 1XNBA 1VAMA 2D6OX 2WLQA 3U0ZA 3VKMA 5JDBA 4IEQA 3V64A 2GNTA 2E63A 1SQ4A 3N9NA 4LIVA 1OT5A 1BYHA 4R9DA 2VUDA 5FY5A 2IXLA 3HN1A 3H8XA 3NNGA 1XYNA 3JZVA 1H2KA 3RJ2X 3UYJA 1GSLA 1K5MB 2XKPA 2A7AA 1EY2A 1QWRA 3MF9A 1DLLA 4K8FA 4P08A 4FQ4A 3POFA 1SBDA 4N8MA 5IAVA 3RRDA 2RDNA 5SV8A 3TN92 3NKTA 5A7WA 1DFQA 4B4QA 3I59A 1RL3A 2Z5WA 1W39A 4YW2A 2QQOA 1WW6A 2VMEA 1WW5A 3Q9OA 5F2SA 1W6QA 3H7YA 4GB33 1IPSA 1W2TA 4HSLA 5FYVA 3PUIA 3WDUA 4CDUB 2EF6A 2JWPA 1VBD3 2C1FA 1NG0A 3ACIA 3Q8BA 4MVTA 4MGTA 1MS9A 3K46A 3WNXA 3P6BA 5C4WC 2FDIA 4QKDA 2AGSA 1FAYA 3LEIA 4LO5B 1PGSA 4QDQA 5FPZA 2QQNA 3LIHA 3UV9A 3PUQA 5FREA 1GWMA 4CCCA 1JZ2A 1JYTA 2GALA 1Q8PA 3KV6A 2R16A 3CZJA 5JMOA 2C24A 1U0AA 2AEYA 2UY9A 2X5IC 4QPIB 3QOPA 5GJ6A 3F2ZA 3V0AA 3CZUA 2P3IA 4C0BA 1HKDA 4I30A 1VAVA 1LHUA 1JHJA 4LLOA 5GALA 3VZJA 2WO1A 5J3UA 1JUIA 1RMU1 4M3CB 3WQ7A 1DZRA 1KJLA 5KHHA 1QJU3 2WN2A 4OI4A 1QJZA 3MUY1 2WNUC 2JICA 4Q0PA 2A1XA 2G9GA 1S0DA 3B93A 4EN0A 1W06A 1QJY1 2VOWA 2CNAA 4M0HA 4N9IA 2FMYA 2OT7A 3NJVA 1WD4A 1GU3A 1DZQA 3AZYA 5J37A 4FBFA 5F5CA 2DUPA 1X50A 2BVVA 4GQ7A 2CDOA 2A3XA 3FLRA 1KS5A 1GKBA 4RQPB 1AR62 2RM21 4X6RB 3GXUA 4CEWC 1ONAA 5C8CB 2QQUA 2ZHLA 4UF0B 2XR4A 1MZEA 2YBPA 1K42A 4R9BA 3FUOA 1RUF3 5D21A 5F3EA 5LY2A 1ZZCA 1BJQA 2ZXQA 3IB3A 3K48A 2YPJA 3AL6A 4GD4A 5FXWA 4F3JA 4MO3M 4IV3C 1JYWA 1JOJA 4IV3A 1D0HA 4WBBA 1FNZA 5KWRA 1JYNA 3FX3A 3WG3A 3PJYA 4XYXA 3E6BA 1XOYA 4PQ9A 3QLQA 1FOD2 4GH4B 1QQP3 2DVFA 2W47A 1AX2A 3H3UA 4Q0UA 3TEWA 2PMWB 4QHOA 5E16A 2A3YA 1V70A 4A7ZA 1X36A 1QJU2 4FPGA 4RR3A 2QDRA 1DGRA 4YW5A 4P02B 2J1EA 1YC61 2XONA 1JS9A 1WGPA 3NV3A 4Q1RA 1UD1A 4BIFA 2WQ4A 1GOFA 4FOWA 3WHTA 1EPWA 4LA3A 5DXDA 4YGEA 3KV9A 3LSEA 1APNA 3ZSKA 4FPFA 3D3AA 2MNGA 2LW8A 4XAEA 3CU7A 2QQKA 3DUIA 3A0NA 5F6KA 5BNOB 5F39A 2F4LA 3GBWA 3HNBM 4JCKA 5FJKA 4CP0A 2VC9A 1UL9A 3EXUA 1AJKA 1QDCA 1SLLA 4A7YA 4CCLA 1F8VA 1C8NA 1H0BA 1RINA 1HRV1 4QAWA 2JD4A 5LK5A 4YVSC 1T6BX 1UOFA 4MXWA 3IDBB 1O3QA 3ZFFA 5B4NA 4ZONA 1FI2A 2IZWA 2VMDA 1MS5A 5FP8A 4RL7A 4TWTA 1YHFA 1PGW1 4GXLA 1HIXA 2R7EB 4IE6A 2VE1A 3I49A 2PHRA 1SLTA 5BNNB 5A7OA 4CCNA 5L9VA 1OFNA 3B9CA 2RM23 4CCKA 2I45A 1AHSA 2WNOA 1VLNA 5FYCA 1HB2A 3ZYIB 1NCQC 3OUIA 4EN7B 4IEPA 4CZSA 3DGTA 4XXAA 3NAPA 3D0SA 4LBMA 1PGL1 1OBNA 4D7SA 2BNNA 5M0TA 5D8AC
chains in the Genus database with same CATH topology
4M0NA 2VOXA 3IPVA 3K51A 4P14A 3WX5A 1J58A 3GZUC 3WDTA 1UMZA 3QBQA 1DF0A 5DG2A 2GMMA 3WDXA 1A8DA 5H9RA 1LOBA 4R9CA 1YIFA 3VBHB 1LKNA 4WM7B 1LECA 1DIWA 5J36A 1U5YA 3B01A 3JU9A 4CDWA 2EXHA 3PMEA 2K9ZA 1N1TA 1VJ2A 1ZBE2 3VKNA 1PM7A 1RUJ2 3M3CA 4LUMA 3R6SA 4EJRA 4QPGC 1CVNA 1RUI2 5IK8A 4L9BA 1AR73 2YUEA 1Z7S3 1UPIA 1CQ9A 1OMIA 2AR6A 5DDJ1 1QOSA 1HW5A 4N43C 3B02A 3RNSA 4UW5A 4D7TA 3CJXA 3UKNA 2DU1A 1R1ZA 2E51A 5KHGA 3O14A 3RYKA 4I0AA 4OI2A 1WW4A 1W6NA 3WY6A 2R49A 1RMU3 4FPEA 1C8M2 4AG4A 3VBSB 2OA2A 1G9CA 3OPZA 4BE3A 4ASMB 5TSWA 2RS13 1ZRDA 3LA3A 2XHKA 2HWD3 4OUMA 2ZGLA 5EFUA 1OI6A 3M3OA 1TME2 3NWKA 2R1DA 3MIFA 1N1YA 4Q0QA 3VDDB 4BWOA 4YZ3A 1LULA 1EV12 2RS52 4META 2ERFA 5GLTA 1POV0 1QOTA 4AW7A 3CEWA 3HT1A 4Q0VA 2PAMA 2X5IB 1LESA 2LALA 2OZJA 3ZX7A 5ACA3 5J7MA 1QQP1 2E9QA 3BODA 1OSGA 3HQXA 1DGRN 1KD7A 3FMGA 4N7UA 4RFT0 2DVGA 3ZFFB 4DZGA 1LU2A 4JDOA 5KC6A 1A78A 1ZZ8A 1UIJA 3AXDA 3D82A 4QD2A 4LBNA 1B35A 1WBLA 1W0PA 3LAGA 4E4SA 1DQ5A 4FOYA 3NAPB 1YNAA 4ZKTB 1OA4A 1YFYA 5T55A 2MEV1 2R071 1TMF1 3AP4A 4BZ4A 4RSUA 2JXAA 3L2HA 4Y22B 2AZ5A 1AYN2 2PLV2 2ZKNA 4YM1A 5I8TA 4FCAA 3W9AA 4LO6B 1G6NA 1IKQA 2CL2A 2RS33 3QCWA 3VV1A 2VULA 4WM7C 1AL23 2D6MA 3PNAA 3CLPA 4MH0E 5CVRA 3VDDA 1CPMA 4Q4W1 3AP5A 1UX6A 4XTMA 1XYPA 1Y7BA 3SISA 3INAA 3WXPA 3QH7A 2W08A 2D5HA 4QPIC 4YYOA 1FXZA 1DYKA 5F1RA 4AVSA 4H55A 2RM22 1YRZA 1S2KA 1WLCA 1ZBA3 1QU0A 1UPSA 4AVCA 1VBD1 4WVVA 3QH6A 4AI0A 4SBVA 3ZYRA 2R32A 4KBBA 1S0JA 2GN3A 4CDXC 2ZOEB 4X6QB 3UJQA 2XBO3 3OGGA 4RGGA 2IXHA 2PHUA 4GMP1 1PK6A 4I01A 4DOUA 5KXCA 3BOWA 4M01A 1HQLA 4YFWA 3HAGA 5KXEA 2LTNA 4AE2A 2YGLA 1ZRFA 3FE5A 4W6XA 3GF6A 4IESA 3IIAA 1C8M1 4CEWB 2HEVF 1ZBE3 4Z1VA 5JSOA 4BLIA 2GAUA 4BHPA 1C5IA 3T1MA 3CJIA 2OVUA 5JR7B 4JDNA 4RA0A 2D6PA 3SH5A 1S2BA 3ZXGA 5I91A 3FBMA 4QM8A 5DDJ2 1AF9A 3GNEA 4Q4W2 5HCAA 5EYXA 2A6VA 1OLRA 2HKXA 2A5ZA 3RWNA 4GWMA 3OBRA 3AKQA 3OYWB 4JGYC 4S2GA 1PO13 4Q0SA 2GN7A 1Z7S2 2QVSB 2R043 1CAWB 1X8EA 1O4ZA 2SLIA 5DUUA 2JKBA 2RR11 3J4UH 4Q8KA 1MR5A 2VOKA 4MLOA 3ECQA 2D40A 1SDWA 1R082 2HWB3 3TBDA 5CG9A 4WM8C 1BMV2 3MICA 2QZ2A 5I0TA 3WV6A 1H8TA 3M3IA 4HVRA 4BA6A 5GKAC 3WG4A 1AR81 2EALA 2GZWA 3AYAA 2YMZA 1PNFA 1XU1A 5FDBA 2V5YA 2DVAA 2WNEA 1I3HA 2NZ9A 1EV13 4Y22A 4B7KA 2MEV2 2R072 5GZGA 4NVPA 3ZSEA 1NLSA 4Y4YA 4YVSA 1YI9A 2DCJA 1GZWB 2RS53 1RHI3 4QQPA 1O3TA 4P9YA 3ROUA 2OYZA 4AEDA 4LA2A 4EROA 2D97A 4R52A 3VHOA 1IQAA 2H0VA 4YLZA 4YGDA 3NKGA 1VRH2 3VZNA 2KM2A 3I2DA 4MXWB 2WJSA 1DHKB 5D8AB 4EN9B 1GBGA 1MEC1 5J09A 2NM1A 1QY4A 1V6OA 2C9AA 1BBT3 2RE9A 3MLKA 4LR4A 4IV1B 2ZKLA 1IPJA 1B09A 4LO4B 1S0EA 2IC1A 5GM0A 1A8MA 2QKDA 4ATEA 1VBD2 1H9PA 4DXZA 2YY1A 3O0VA 4RR3B 4W6YA 1SCSA 3ZXAC 1FOD1 4BMEA 5C8WA 4MX3A 4N43A 5BNPB 1PK6C 4E2QA 5BNQA 2WFPA 4RGAA 4N43B 4M3CA 1QJX3 4I0WB 5JLVA 2MHFA 4K21A 2YGMA 4YARA 3WOGA 3KD4A 1MS8A 4BQ1A 1PVC1 2PAEA 3W58A 2UWAA 2WSUA 4UXAA 1DGLA 2GU9A 3ALQA 1YFWA 1GICA 1AR72 2CGOA 3URFA 5I8YA 2DF7A 1RUD1 1ZZ6A 2O8OA 4BH9A 2ZBJA 2CTVA 4LHLA 4FVVA 3H50A 3DKWA 5KHKA 4WM7A 3VBUB 1PO12 2Q4SA 3VHPA 2WC2A 1C4RA 3RI9A 5HI0A 4YG3A 1AR93 1D2SA 4E27A 1QKQA 4COWA 5AC93 3LSDA 4QGMA 3VBFC 2EXJA 4AI3A 4E4ZA 1TE1B 2IXIA 3O0WA 1HLCA 4INDA 2BNMA 2WT2A 3ASIA 1LCLA 5JI7A 1EP0A 2Q1MA 4EWDA 4C90A 2BBVA 1NOVA 1RJ8A 1UIKA 3ZMOA 3GZAA 4BCUA 2VUJA 4XJZA 1LGNA 1O91A 4BIOA 3KQRA 1LR5A 1AR63 2ZZJA 2Q8OA 1UKRA 4KL1A 4HLTA 3TN91 1PZ9A 4JGYA 1BZWA 1V6NA 1DYPA 5I93A 3VN4A 5K7PA 4HANA 1TQ5A 2CGPA 3RZZA 4D94A 1ULEA 1LHWA 1NQJA 4K40A 3ZXEA 3QD6A 3VKFC 4FAHA 4FTSA 3SNMA 5CFDB 1BMV1 5GLZA 3C2UA 3MLJA 2A3WA 4RR3C 4ZU5A 3KGLA 2DYCA 4Y1ZA 1KITA 5HCFA 1G9DA 3MDPA 3USUB 3LWCA 1LGBA 4YVWC 5FMOS 2P3JA 1RHI2 3V65A 1HRI3 5K0UA 1DG6A 1LOFC 4DFSA 5K0UB 2D3RA 4YVWA 4KGGA 4AYUA 4CDXB 1AYN3 2HWC2 1HRI1 3D4KA 3SITA 1X33A 3MZHA 2EVXA 4U2AA 2OZ6A 1RB8G 3VBHA 3EJKA 4UW4A 4MSVA 3MFCA 1LB2A 2W68A 1RVF1 1MS0A 2GNMA 2XGXA 1REFA 1JXNA 3JD71 2WQZC 2HWF2 1BCXA 4XHXA 4YZ2A 5JVVA 1CAVA 3JBG2 3VLBB 3HMYA 1GZCA 2CY6A 4OVEA 2TBVA 1SLBA 1PGL2 2XJTA 3ZYJB 5EJ3A 2D7FA 3B3QE 3AP7A 5JPMB 1KDMA 2R061 1RMU2 5H9PA 4B29A 3GBGA 2XJVA 4Q4W3 4DB5A 2ZGRA 4FXGB 5FO8B 4XF3A 2XBO2 1W6MA 2WLPA 4OZXA 5T5JA 4KWKA 4OHZA 4D3WA 3FWEA 1EAH3 4U36A 4XFGA 1B35C 3S6PA 5J48A 2JENA 3B69A 4H14A 1J3PA 1NCQA 5EYYA 5GZEA 4PIZA 1RHI1 1RJ7A 1DQ6A 4W65A 4BM8A 4WM8B 4KQ7A 5AVPA 2ZGTA 1RUJ3 4YZ4A 4XFIA 5JIAA 5FRAA 3ZXKA 2GH8A 3FHIB 1D4M1 1Q8VA 1XYOA 1LJ7A 1U5IA 1OOPB 5GZCA 3OBTA 3CO2A 4YM3A 1NA1A 2FHRA 2FQPA 3AKPA 1EAH1 4LBQB 2A71A 2WWSA 2VMIA 1AR83 3JUUA 4QQHA 3SCFA 4XBLA 3T1LA 4AFAA 2XB6C 3TNQA 4Y5Z0 1IS4A 1S0BA 2E7AA 3TNPB 4COVA 5CADA 1GZ9A 1DQ0A 3DV8A 3POWA 4Q4V3 1RUG1 4OHVA 2VG9A 4BYYA 2Y0IA 1GLHA 2ET7A 5CU1A 2VECA 1ALYA 1AX1A 3WQ1A 4E9KA 3SH3A 4Z92B 3AFGA 2R041 2QQPA 4KWLA 3B5LB 3UKTA 1CX4A 1T6GC 5K0UC 3USUA 4ORFA 4GA9A 3LKJA 1QJX1 3ZN4A 1CIWA 1G9FA 3H7JA 3AYDA 1AR61 4WVZA 1RVF3 3ZIWA 2RHPA 2A70A 5BV6A 4I3GA 1VALA 4FPKA 1Y9QA 2CWSA 2YC0A 4QU2A 4LBKA 1QJY2 1URXA 4YVWB 3VBUC 4IV3B 4FP3A 2WS91 4Z82A 3WW1A 2DU0A 3JBG3 1CD3G 3MIHA 2ZACA 4XFFA 5T5OA 1S0IA 5FO9B 2YHJA 2WNVC 1AR71 5EXOA 2ZHNA 4XF9A 5D1IA 2ZMLA 3VZOA 3NJZA 4AK3A 3W59A 2QDNA 2BNOA 5CBLA 5ACA2 4Q4Y1 4CDWB 4PIYA 4AEDC 1U5ZA 3GBFA 1RVF2 4Z07A 4P9GA 5DZFA 3O7OA 1F5JA 1RIRA 1S55A 5JOZA 1HRI2 4K7JA 3WDYA 2ZAAA 1PVC3 3NVCA 2RS11 1YJLA 3AJZA 3DN7A 1WUVA 2YROA 2IXJA 5E88A 1V9U3 3RS6A 3N7KA 3MIDA 1VBA1 1W6MB 5BYNA 4Q4Y2 4AWDA 4FTBA 2DUQA 1DU3D 2WA3A 1R1A3 1BBT2 5L73A 3AMMA 4NPRA 1H8TC 1U5XA 2VH9A 1PNGA 3H1YA 4MZUA 3WG1A 4Y1VA 3PMSA 1NY72 5IK4A 4NN0A 2A6XA 1GQGA 1NCRC 2X53S 4WM8A 4F7ZA 4HETA 2VOVA 4IEWA 2N7GA 4XFHA 2C0ZA 2HEYF 2B5HA 4LE4A 1H2NA 2E7QA 1SLIA 3VBRB 2K0GA 4IERA 1N3PA 3AJYA 1R083 1SFYA 2HWE3 1MVEA 4C91A 4IL7A 2WNVA 3VBHC 4XQ4A 3WW2A 4F8AA 2KXLA 4RD7A 5AC92 3H1WA 3ZDSA 2GH2A 3AKSA 1H2LA 5SV5A 1DGWA 4HVOA 5ABJC 1LOFA 5T52A 4JC1A 2HJIA 1YUDA 3TWIA 5A3MA 5JZGA 1W6PA 4N53B 1E57A 4HN1A 1OA2A 1C57A 1F5FA 3B94A 3N7MA 1VBE3 1H4HA 2ZGSA 1TME3 3S0MA 2O8QA 4ES8A 3AZVA 4J1XA 3MEPA 1AXZA 4AVTA 3G7DA 1MQTB 4WVMB 1JN2P 4Q4X3 1NZCA 4WZFA 2ZGQA 1MACA 3AYEA 5KHIA 1B35B 4ZU4A 1RUD2 3GHMA 4LEJA 3SLIA 1AZDA 4X8PA 4XJUA 4PDWA 1RUF1 1PO22 4NHLA 1J1TA 2Z79A 2BEOA 4P9IA 1VR3A 5BUVA 1RUNA 2I74A 2TUNA 1VBC2 2Y0OA 1Z7S1 4ISQA 2BTVC 4HK8A 1FT9A 1S0GA 2ZX1A 1OHFA 4JDMA 1SACA 5KBFA 3NV1A 1D4VB 1GNZA 1MS1A 2PHFA 2ZGUA 1FX5A 3M4FA 3M3QA 3KB5A 3MW2A 3N7JA 4FOVA 2BWCA 1SLCA 2UURA 4FPYA 1ENXA 2D6KA 4K6BA 1AL21 3HD8B 4AFDA 1H4GA 4E4DX 2WZR1 3JD73 4URTA 2RS51 1UAIA 4AI2A 1I6XA 4UW6A 5J96B 4I3PA 5DUWA 4ATFA 3E5UA 4R4ZA 5LRRA 1JHNA 4JV4A 1CAXA 1KS4A 2VNGA 3IWZA 3WP4A 1SFNA 4MV2A 3ME2A 5HBAA 1NYWA 5CG8A 1TNRA 1PVC2 3NO8A 3DPRC 2ATFA 4AVVA 5FTTC 3ZN5A 5LEJA 3EBRA 3RMYA 5L7OA 2AREA 1Q8SA 2GSYA 2UU8A 1ULCA 2BUKA 4AI8A 1UW8A 4IEUA 5FQ0B 4OHWA 2ZMKA 2HWC1 4TLFA 3RQ0A 5IK5A 3THPA 5I0SA 5FOJB 3SHRA 1FMD3 2WINB 4X8NA 1WLWA 2WNUB 5JCTA 3BPZA 3GHNA 1AR92 4XQDA 3SXWA 1FV2A 3TN93 5B2GB 1ZREA 4ZU7A 5JZGB 3HR9A 2B45X 3NV4A 3D6EA 3LA7A 1RUH2 1VAKA 5ABJA 3ZMNA 4HSJA 4JGZC 3MI8A 3L9JT 4GB32 5C33A 4DMIA 3TRSB 3TB0A 5CA6A 2P34A 4GH4C 4R8HA 1QQP2 1FNYA 3TYJA 3S7IA 3UL2A 2E7TA 1LRHA 4HPKA 4ASLA 4N7IA 4GKYA 1IZ3A 3ZYPA 1WMDA 1AR91 2DTYA 4IXLA 4MXVA 3H0OA 1NXD1 4FO9A 5F6LB 4PBOA 4I09A 4J6GA 4HKWA 2P17A 5DZEA 1RUD3 1WD3A 1NCRA 1POV3 2H6BA 4Q4V2 5H9QA 5JWPA 3LGRA 1IS5A 1NCRB 1TME1 4Q4X2 1FPN1 1VBE1 2I07B 4OI1A 3NSTA 1YI7A 4KGQA 5BNOA 5KXBA 3IDCB 5E8AA 2VNRA 3ATGA 3BALA 1BEV2 1L3JA 4CEYB 3HIFA 2NN8A 1GANA 1XNCA 3N4MA 1VBC3 2VQAA 4IETA 1ND2C 2ZZQA 1BQPA 3S30A 4DQAA 2PHTA 1ZNPA 1RUH1 3U11A 1NY71 3AX4A 1WLTA 3AP9A 4EN8B 1I1EA 3E6CC 2HWE1 4JTNA 1R081 1D2QA 2Q1ZB 3OTFA 5JOWA 3O0XA 2W39A 1RUC3 4JQRA 5FFOC 3WUDA 3MPBA 4CTEA 2E53A 2KA3A 3ZSMA 3M1HA 2V09A 2FMDA 1FATA 2UYAA 1YYNA 4XJ9A 2D98A 4BLJA 2RS12 3H3ZA 4QXKA 1AL22 4FT8A 3RG0A 3RMXA 3PVEA 1ZRCA 1U12A 3AZXA 3A4UA 5FAXA 4OFGA 4DRVA 3T2TA 1RUC1 1ZA4A 2W52A 4HKLA 1H9WA 1YWKA 3C3VA 1KFXL 3ZXJA 1V9U1 2VVEA 3FC0A 1JBCA 4HMZA 3AKRA 1ZYBA 4M3CF 4AFCA 5GLWA 2NP0A 1AXYA 4QHBA 5CFCA 4H7MA 5L36A 2WFF1 3CF6E 4XW3A 5C4WB 1YO8A 2WIIB 3JQWA 4AHZA 1DDLA 4COYA 1QNYA 3AM2A 4XDQA 1ULDA 2JG9C 4XOGA 1RGSA 4R9AA 5T5PA 2CAUA 3AK0A 3MIBA 2A73B 4RQPC 2HWC3 5C8CC 4EV0A 2JECA 5ABJB 5IUQA 4Y20A 1GR3A 1X8MA 2LM3A 3BIWE 3KCXA 2VVFA 5C9AA 2JJ6A 5BXXA 1WMEA 2WZPP 4F83A 2BVBA 4EWAA 2XG3A 2EXIA 3WCRA 1OLQA 4GMP0 3POYA 4BOWA 4S2DA 3UKVA 4KH9A 5DDJ3 1C1FA 2B8MA 3RYPA 1ZZ7A 4HZFA 2CYFA 5FCCA 1R092 1H1MA 4XMIA 3TOJA 2OUHA 2VXRA 1AYM1 1OOPA 2PHWA 1QDOA 1K5MA 3BOPA 3VUOA 3I54A 3VDDC 5A3LA 1RITA 4CYDA 4YNIA 1OA3A 5D8AA 3OY8A 4CRQA 2XLAA 4Y1UA 1WMFA 2P37A 3EO6A 2B39A 3BU7A 1N3OA 1A3KA 1J3QA 4K1YA 1PO23 2GNDA 4UW3A 4EN6B 3OD4A 1AR82 3DL3A 4K1ZA 5BNNA 4J1WA 4CDQB 4H3WA 1ULFA 3JB8A 1H8VA 2ZMNA 3H9AA 3USSA 1G9BA 4Y26A 2WFF3 4FQZA 4IEZA 1HV0A 3J26N 4QPGB 3IMNA 1VBA2 3WZ1A 1SMVA 1YFXA 3EHKA 3L2YA 4FPCA 3WCSA 5BNOC 2ZCWA 5BNNC 1LU1A 3VBSA 1POV1 1GYKA 1SEFA 1DQ1A 2BYVE 1J1LA 3KCYA 3IPVB 2XBO1 1OD5A 1OKQA 3ZN6B 2XJRA 3ZFEB 4HK9A 1CAVB 2O1QA 1JYIA 2DVDA 3NL1A 4I2OA 3AZZA 2Z42A 3U4XA 4HN0A 4P9JA 1CAWA 4JRLA 4K3UA 2WSVA 3ZFGC 1LGCA 4D69A 4AEKA 4XFAA 2BFUS 2RMU3 4AVAA 4AQTA 1O3SA 3R4DB 1DQ2A 1C1LA 1HQWA 2PYTA 3J8F2 2IWGB 3D8CA 1NCQB 3WP6A 2DCYA 2HEWF 3IM0A 4Y1XA 1EYBA 4B4RA 4QGLA 1COV1 3WT3A 4BPZA 2WZR2 4DRRA 4FPOB 3OGJA 3ZXDA 5JAXA 4CEWA 4CEYC 3KSCA 3MW4A 1FMD1 3AZWA 4XBQA 3M2MA 3WDWA 1ND2B 1VRH3 4XQWA 3ILNA 2GC0A 3POSA 4G9SB 4W6WA 3VHNA 3FZ3A 3WD5A 1CJPA 4GB31 1HXS2 4DY5A 4AGVA 2XLGA 1F31A 3PVNA 4AQ6A 1AXKA 4YSFA 4OLLA 5FBZA 4PJYA 4NHMA 1HX6A 1IS6A 4ONUA 1RUG2 4S2HA 2QZ3A 3VBRA 1AYN1 2X5IA 2OW4A 4I0BA 4WVWA 4YM2A 2VGDA 4XFCA 2PTMA 3V0BB 3H1MA 1CAUA 3EQEA 3P3PA 4LHNA 1ULGA 1QJU1 5C4WA 5IK7A 1VB4A 4AHWA 2XWBB 4TZDA 3VBSC 1GNHA 3OD0A 3JCIA 3ZSLA 1M4WA 5JIUA 4KG8A 5DG1A 3R4UA 1SBFA 1IS3A 3M7AA 4AHYA 1LEDA 1PHMA 3ZIXA 4CDQC 3KCCA 5GLVA 5DUVA 3ZFFC 2DTWA 4XXPA 1ND2A 3O5SA 4XTPA 4FPHA 1ASJ3 2JG9B 1IGOA 2ZHMA 5DZGA 4RS5C 4RHV1 2VW2A 3PHMA 1UZZA 1WCDJ 2E6VA 3E5QA 3ZFGB 1I5ZA 2D3PA 2VVDA 4QM9A 2VMGA 1VBA3 3VZKA 2H6CA 3SCHA 3M8LA 2WFF2 3OCPA 3U07A 3MW3A 5T3NA 1MZ5A 3MPPG 4NWWA 4CEYA 1YFUA 1KXGA 5A32A 4PLOA