4QGNA

Human acireductone dioxygenase with iron ion and l-methionine in active center
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
178
structure length
178
Chain Sequence
MVQAWYMDDAPGDPRQPHRPDPGRPVGLEQLRRLGVLYWKLDADKYENDPELEKIRRERNYSWMDIITICKDKLPNYEEKIKMFYEEHLHLDDEIRYILDGSGYFDVRDKEDQWIRIFMEKGDMVTLPAGIYHRFTVDEKNYTKAMRLFVGEPVWTAYNRPADHFEARGQYVKFLAQTM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase
publication title Human acireductone dioxygenase with iron ion and L-methionine in active center
rcsb
source organism Homo sapiens
total genus 43
structure length 178
sequence length 178
ec nomenclature ec 1.13.11.54: Acireductone dioxygenase (Fe(2+)-requiring).
pdb deposition date 2014-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03079 ARD ARD/ARD' family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4qgnA00
1I5ZA 1Q3EA 3NSTA 5J3UA 4WBBA 4MGKE 3ETQA 4XFIA 3NL1A 4KWLA 1SEFA 4IEYA 3L2HA 3BALA 1H1IA 1ZRRA 1RUOA 1SFNA 2E9QA 4AVBA 1Q43A 4XFBA 3ELNA 4XFGA 1RGSA 2N7GA 5FLIA 2OYZA 4X6QB 4HVQA 1O3QA 5KHHA 1ZRDA 4D7TA 4QM9A 3LWCA 4XFCA 4HZFA 4BH9A 4KU7A 2D93A 3USSA 5I8SA 4PIYA 3CJXA 3R6SA 2O1QA 3NW4A 1RL3A 3S0MA 1O3SA 3HT1A 4META 3NJZA 1EY2A 4XF4A 5I91A 4JVAA 4TLFA 1J3RA 4AQ2A 1HW5A 1CAWA 2FMYA 4IERA 5FLJA 4EWAA 4I02A 3H8UA 1YFUA 4IETA 3KMHA 3E6DA 1J58A 3RYKA 4L2NA 2D5FA 3OCPA 4I0AA 4F8AA 1ZZ9A 4MGZE 4R52A 2GC1A 4I09A 4E2SA 2XKPA 2IXJA 4XF0A 4XETA 2ETEA 4IEQA 3LZZA 4I2OA 3E6CC 1X8EA 3CLPA 2EAAA 2I45A 3KCCA 4HN1A 3SMHA 1X7NA 5CU1A 3BB6A 1J59A 2IXIA 1YWKA 2PHDA 3MPBA 4MX3A 3PVBB 2GH2A 2HKXA 3S7IA 3D0JA 4AVAA 3E5XA 3IIAA 1WA4A 3E5UA 5I0TA 4MUVA 2FQPA 2O8QA 2PQQA 2H6BA 4IEXA 5I0RA 2GC0A 3DL3A 2MPFA 4PIXA 1NYWA 5T3NA 2KXLA 2B9UA 2BNMA 4J1WA 3FZ3A 4LUMA 1ZZBA 2F4PA 5BPXA 1CAXA 1PMIA 1GQHA 3H3UA 3VHRA 1X8MA 4JV4A 5CADA 4XF9A 2QDRA 4HBNA 3QOPA 4BYYA 1FXZA 3E6BA 2CV6A 4XF3A 5C6CA 4MZUA 3SHRA 2XLAA 4Z82A 2IXHA 2WC2A 3I7DA 3KSCA 1O5UA 3ACLA 2CGPA 1ZZ8A 5KHKA 5BXXA 1O3TA 4IEPA 1H1MA 2CAVA 5E1RA 4QX5A 3FHIB 3U0ZA 3N4MA 4QXKA 4KU8A 3G7DA 3ZDSA 1V70A 3UKTA 2Z2SB 3FWEA 5KBFA 4IEUA 1QXJA 2ET7A 2XLFA 4YSFA 1OFNA 3MZHA 1DZRA 3IDBB 4I01A 5EZWA 4KWKA 2QCSB 5BY5A 5FDBA 2PHLA 3H1YA 3NVCA 4Q0VA 2B8MA 1J3PA 3RZZA 3DKWA 5JCTA 5JAXA 3RNSA 2BNNA 2Q0AA 3RDIA 1ZRCA 1OI6A 2UY8A 3OD0A 1O4TA 2IXLA 3PLQA 3UKNA 4FAHA 3IDCB 1YUDA 4FAGA 1IPKA 2Q4SA 4H7LA 4A2UA 4FT8A 1EPZA 4L11A 4E2QA 4BHPA 4LUKA 1YFYA 2PTMA 1YHFA 3O14A 1LRHA 3KGLA 3JZVA 4PJYA 4I3PA 4ZU5A 4YRDA 4JTNA 1UW8A 3GBFA 4CYDA 4XFFA 4AQ6A 3M3IA 3ES1A 2BNOA 2K9ZA 3BCWA 3HQXA 3ES4A 1ZNPA 3BPZA 4MV2A 4AXOA 5JR7B 3CF6E 2P17A 4RD7A 5FLHA 3QACA 3WW4A 1LB2A 3H7YA 4EROA 4Q0UA 1UCXA 3SCFA 2GZWA 1CGPA 2B5HA 3PNAA 1UPIA 1FI2A 1QWRA 1QY4A 4KWJA 3NKTA 5JSPA 4O9EA 5D1IA 1UD1A 4LLOA 5LRRA 3EBRA 1NZCA 3H7JA 3IBMA 1CX4A 4QGNA 4YYOA 4XFHA 5E16A 2K0GA 1YFWA 5F1RA 1PM7A 1YFXA 4XFAA 4FBFA 1VJ2A 4IEZA 3BU7A 4OLLA 3H1WA 3H3ZA 3MDPA 1LR5A 1WGPA 4B29A 1DGWA 4LULA 2OZJA 4LEJA 4EWDA 4WVZA 3LA7A 1O7FA 1J1LA 4MH0E 2UYAA 5FQ0A 5LEJA 1VP6A 3SCHA 5BUVA 4Q0PA 2Q1ZB 5KHGA 1ZZ7A 2PAKA 2VQAA 3WW2A 2BYVE 1RC6A 3TNQA 1YLLA 2VECA 5LRSA 2QNKA 4ZU4A 3DN7A 4YARA 2D5HA 3WW1A 3LOIA 4N9IA 4R8HA 2UY9A 2DCTA 1CAWB 1Y9QA 3EJKA 5EFUA 2ZKLA 1J3QA 3H9AA 1O3RA 4BIFA 4X6RB 5FPXA 2H0VA 2XL9A 2XKOA 3OTFA 1X82A 3CEWA 2EA7A 4LA3A 1WLTA 1Q5OA 5I0SA 1OD5A 1FT9A 1JUHA 3KGZA 2V09A 3FFQA 4JTOA 3SXWA 4E2GA 2Y0OA 1ZZCA 3S7EA 1NXMA 3SCGA 4D7SA 3I59A 5BV6A 1ZX5A 2QVSB 2GC3A 3RYPA 4ORFA 3I54A 4AVCA 2Z69A 2BGCA 4GULA 1CAUA 4QM8A 1CAXB 1CAVA 3U10A 3CL1A 3EQEA 2CAUA 3H1MA 4HSJA 4MGYE 5FCCA 5FPZA 3OF1A 4UBGA 1EP0A 3FE5A 2OA2A 5FQ0B 1IPJA 4MGIE 2XGXA 4HMZA 4O9GA 3TNPB 1RUNA 3D0SA 5JSRA 3C3VA 2OZ6A 4YNIA 4Q0QA 4ONUA 1XE7A 4LTAA 1I6XA 1NE6A 1ZZ6A 3UKVA 4J1XA 3ST7A 5HI0A 1TQ5A 5AVPA 5JSOA 2UYBA 4P9GA 5J7MA 2GC2A 4LA2A 5KHIA 4QGMA 4UXAA 2ATFA 3D82A 4IEOA 2IXKA 2PAMA 3HIFA 4ZU7A 1ZRFA 4KL1A 4IESA 3E5QA 1UIJA 2XLGA 3MYXA 1SQ4A 3EO6A 3U11A 1U12A 2PAEA 1NE4A 2GAUA 1ZREA 4OFGA 3RYRA 2ET1A 4EWEA 1OMIA 3M70A 4UBHA 5C8WA 3LA2A 4HN0A 5I0UA 4HLTA 4HSLA 2MHFA 5I93A 1O5LA 4IEWA 2PYTA 4PIZA 2GU9A 4WZCA 3WW3A 3E97A 3DV8A 3CO2A 4NVPA 2D40A 1QXRA 1G6NA 3FJSA 3I59B 3FX3A 2IXCA 2ZCWA 3RPQA 1GQGA 4Q29A 2HJIA 3ROUA 1L3JA 2QJVA 2VPVA 1CAUB 1DGRA 4N9HA 2MNGA 1CAVB 2XL7A 2BEOA 5K8SA 2OPKA 2EVXA 4IEVA 1ZVFA 3OGJA 1Y3TA 1RTVA 1DZTA 4Z07A 4EV0A 3GYDA 4F7ZA 2C0ZA 4QMAA 5I8YA 4HVRA 5J48A 1EYBA 2Q30A 2PA7A 4XEZA 4XF1A 5LEKA 2IC1A 4DINB 3IWZA 3H50A 5I8TA 3LAGA 1XE8A 3EHKA 3LA3A 3B02A 4K8FA 1UIKA 3HT2A 2PFWA 4I0BA 1VR3A 4HVOA 1LKNA 2XHKA 5CVRA 1XRUA 2WFPA 4QGLA 2H6CA 5KHJA 4Q0SA
chains in the Genus database with same CATH superfamily
3NSTA 5J3UA 3OBRA 4NJ4A 3U1XA 1F5JA 3ETQA 1W8ZA 2JX9A 1YCIA 3NWKA 1LEDA 1H1IA 2VNGA 3O0WA 4Q26A 3VD3A 3USUB 4MXWB 2DWRA 4PLOA 1N3QA 3ELNA 5IWFA 4XFGA 4OUEA 3VL9A 2N7GA 2OYZA 2R073 3MW3A 4X6QB 5A7WA 1ZRDA 1KDKA 2YB7A 1W8WA 2VZUA 3WX5A 2EICA 3LWCA 4XFCA 1XJAA 1DQ2A 1MACA 1RVF1 1SLIA 1NT0A 3GHMA 3ZYPA 4P00B 3HNYM 1F9KA 1O8PA 3VKFC 4CXYA 5A33A 3O5SA 3NW4A 1RL3A 1AYN3 1O3SA 1FX5A 2V4AA 3O1PA 3AC0A 1BHGA 2ZZJA 4JVAA 1HB2A 2Z42A 4UI9L 4TLFA 3MF9A 1PO11 5F2WA 4LOSA 4IXLA 5B4NA 3U4XA 1JHNA 1F15A 1S55A 2WNEA 2YC2A 4N7IA 3OYWB 1JODA 4V2WA 4CPBA 3H8UA 4ASMB 1PK6C 3E6DA 4D3WA 1PGL1 3RYKA 1ST8A 3OGSA 4F8AA 4YVSC 1PX4A 2ZBJA 3M7AA 1ZZ9A 3KT4A 3WNKA 4IE5A 4YFWA 2FBEA 1JZ3A 2WYSA 2BJSA 1POV1 2R042 3R0RA 1O4YA 4XF0A 4XETA 3OUJA 3PURA 5C9AB 2ETEA 3WNNA 2VMHA 1AYM2 1LHNA 3LZZA 4IEQA 4JDMA 4I2OA 1C1LA 1X8EA 2B9VA 2VH9A 4PBPA 4AHYA 1SFYA 2A6ZA 3B5LB 3KCCA 4NE9A 1CZVA 3OY8A 3SH3A 1C3HA 1UKRA 2VE1A 1OHFA 3BGAA 5L73A 1YWKA 2PHDA 1AXKA 4MOAA 1LOFC 2DUOA 4ES8A 1W2TA 1TMF1 3N9QA 5FY8A 3LQCA 2RS52 1RJ7A 3H8RA 5FUIA 1CZSA 3D0JA 3T0AA 1S1AA 3ZIWA 4AVAA 3E5XA 1WA4A 2DFCA 4CXXA 2O8QA 1XOYA 2VUCA 1ULGA 5D21A 1AR92 4JRAA 2XJVA 1H8TA 2ZHKA 2WZR1 4JX0A 3FMGA 4XMIA 5DZGA 1R1A1 1GV9A 1MEC1 4W4ZA 3I2IA 2KXLA 3IMNA 2BNMA 4J1WA 4LUMA 4XZUG 4YM1A 1IPSA 2F4PA 5FPBA 2XBO2 5G05L 1PMIA 1RMU2 1H2KA 1SDWA 2E7QA 3A22A 1AR71 2ZMKA 3THTA 4Q4Y1 3VZOA 4CEWA 3H3UA 3VHRA 4XQDA 3K75B 5FZIA 3I2DA 5IVFA 3M8LA 2OW4A 3H8XA 3O1SA 5FPUA 4HBNA 1WBFA 5A3PA 5ISLA 2W08A 2A71A 2VMDA 1NCQB 1OVSA 3MV11 5FZAA 2CV6A 4XF3A 1VBC3 1W3XA 1MQTC 4BLIA 3LGRA 2JG8C 4PDWA 4CU8A 3VDDB 3ACHA 3MW2A 3R4DB 1G9AA 2HWC2 2GNDA 2VNRA 3KQ4B 4CDWC 1W9SA 4FFFA 3KSCA 2E63A 2ZGKA 4YW1A 4QB6A 1W8OA 4LIVA 3DPRA 1U5IA 1Y4WA 2ES3A 4CU6A 1AX0A 3V64A 3ZN6B 3C7FA 2CGPA 1JHJA 3BOWA 2ARAA 4Z2WA 2VUDA 2E31A 2IFRA 2ZEXA 1ZBE2 2JECA 4GH4B 4TSVA 4IEPA 3WDUA 4H2AA 1H1MA 3ETPA 2XJRA 1TE1B 3HWJA 5E1RA 4QX5A 3AZWA 1R1ZA 2A6VA 4LHNA 3G7DA 4P9XA 1VAVA 3KT7A 4GIQA 3GZTB 2W39A 4RQPB 2Y0IA 1V70A 1LNSA 2Z2SB 1UL9A 3J8F3 2G1MA 5K4LA 3FWEA 1HJFA 1OKOA 4HPKA 4Q4W1 2Y60A 5IATA 2XLFA 1N1VA 1MS1A 2A6YA 4Y1XA 4BQWA 5DZEA 4DXRA 4IL7A 2R041 5JZGB 2HWE3 3N9LA 2QCSB 3INAA 4OUMA 5BY5A 1AYM1 4FPCA 4NMIA 3AMNA 4MGSA 1H8VA 4NHYA 2J22A 3S57A 5JCTA 4YM0A 5JAXA 1NCRA 2Q0AA 1WBLA 1PNFA 3OJBA 3GJAA 1URXA 2ZGRA 4DUWA 3W9AA 5IK5A 1UZ0A 1UYYA 3ATGA 2WA4A 1RXGA 1KD7A 2IXLA 2RDQA 2B42B 2V4VA 2RS51 3G6JB 4HK9A 5FY0A 2LRPA 1YUDA 5FY5A 1J83A 2Q4SA 5IK4A 5GKAC 1S0IA 4M4RA 1GSLA 4L11A 4Y22B 1W8FA 3LEMA 1AVBA 2D6OX 2PHTA 2JKBA 1AX1A 5DAQA 1NX9A 3VBUB 2P5BA 3VBFB 1LCLA 3O14A 3KGLA 4W65A 4A6OA 4LR4A 3KVAA 3Q8EA 5A1FA 4CU9A 1GWMA 4AAXA 5A3WA 4I3PA 3BI3A 2EIDA 3IMMA 1JZ7A 1YIFA 2PQSA 4AEMA 2WQ8A 3LPGA 1UX6A 3DYOA 4CYDA 1W99A 1GNHA 1RMU1 3VDAA 1NUKA 3M3IA 4ATEA 2VOTA 4AVTA 1QJZA 4Q2FA 4Y33A 4Y1UA 2WT0A 5DDJ3 2WS92 4XVHA 1GWLA 1ZNPA 1VBD2 2WUHA 1DQ0A 1VBB2 3TYJA 3GZUC 5JR7B 2ZGTA 4AXOA 1SBFA 2TNFA 4QX0A 3MI8A 2RG4A 1WMXA 2VGDA 3H7YA 4Q0UA 4QB2A 2PHUA 2KM2A 3EYPA 5L9BA 4K9SA 3FN9A 4LK6A 4QKNA 3PNAA 3GZAA 4RGGA 1UPIA 5FBZA 3O0VA 4DEQA 4BOWA 3WNOA 3GBWA 1FMD1 4A44A 1LOGA 3SQOA 3NKTA 1H4HA 2QZ3A 5D1IA 2OQ7A 4FTBA 1D2SA 2AENA 4AVVA 1HRI1 2WJSA 4QX7A 1CX4A 4QB1A 3LIGA 1ZBE1 2KD7A 1SPPA 2Y6JA 5FWEA 5C3SA 5F39A 4NO4A 4X8NA 2VZPA 2K0GA 1PK6A 1AL21 2E53A 3I2HA 3K4DA 1BKZA 4CCEA 2VVDA 1GOHA 3AMPA 4KBZA 3IT8A 2ARXA 4YVSA 1VJ2A 4CDXC 1OPMA 3BU7A 3D4KA 4NAMA 3H1WA 3RMYA 3O1UA 5JI7A 4XILA 4QQPA 4IV3B 4BXFA 1F31A 3MLKA 2GNTA 5LA1A 1N3OA 1NAEA 1RUC1 4TLGA 4XIKA 1XXNA 2ENRA 4Y5TA 3RS6A 3ASIA 3CU7A 2F17A 3N9MA 4LEJA 4M0NA 3WDVA 1CR7A 4BISA 5FAXA 1PO13 1ENSA 5LEJA 3N36A 1GLHA 1NXD1 4COVA 3SCHA 2ZGOA 1DQ5A 3WINE 4LK7A 2PHXA 5FZGA 4Y20B 1DQ1A 1US3A 1BMV2 3TEYA 4Q4V3 1RC6A 1CN1A 1YLLA 1WW7A 5A70A 1CX1A 3P5BA 1A3KA 1SDDB 1VAMA 2XDVA 4CCKA 2YFUA 1QNYA 5LY2A 5J36A 1DDLA 1BBT1 1T6GC 3DN7A 4YZ5A 5A3TA 3WW1A 4NUBA 4AHWA 4Y1YA 3LOIA 3HPNA 2NPIA 4XUOA 4AAPA 2UY9A 4AI8A 1Y9QA 5JXIA 3M1HA 4YPJA 3EJKA 1IKQA 1GKBA 2WT1A 1DYOA 4P9IA 5EFUA 2P3JA 4QPGB 5EP9A 3ZFEB 4P02B 3PIJA 3M2MA 5CNAA 3T30A 4AI0A 1DQ4A 2VBDA 4OULA 4ASKA 2PMWB 4NHLA 3BKZA 2WQ4A 2WS91 4C1WA 3V0AB 3ZN5A 1VBD1 2AC1A 4FOQA 1H9WA 1VBB1 1MQTA 3D8CA 3UV9A 1LODA 1QXPA 2JG8A 5F6LB 1SLLA 5F5IA 5GM0A 2CTVA 1APNA 3OTFA 4PBOA 5FREA 3CEWA 4CDWA 3R05A 2W9XA 1C4RA 2WZR3 2AH2A 3P6BA 1PZ7A 1JYCA 1S2BA 2GMEA 3FUQA 1R1A3 1MEC3 5JVVA 4URTA 3TN91 4PI2A 3PJQA 3ZFFB 3L2YA 2XH6A 1OD5A 2ZMNA 1JUHA 3KGZA 4LHKA 3SEEA 3D3AA 3NV1A 4FOWA 1BEV1 1AR73 3ZKUA 4Q4Y3 4EN0A 5IK8A 1QJFA 3WG4A 2WNVB 3MICA 4BK5A 5CKQA 1BVVA 5C4WB 1WCSA 1MPXA 2CGNA 1AR61 4XJ8A 3RI8A 2JDMA 1YYNA 1ZX5A 2WR9A 4P5YA 4FPKA 5FZ1A 3RYPA 1QGLA 1QKQA 1KGYA 4JGZC 1QOSA 1VBE2 1S0DA 4QDRA 2JDYA 2FCVA 2BGCA 2P4EA 4A41A 2VAUA 2AR6A 1D7PM 4JGYC 4L99A 2VOVA 2YGLA 4XYXA 2HWF2 3BTXA 5FO9B 5GZEA 1HJGA 4AW7A 3B93A 4G3YC 2G9GA 3H1MA 4RR3B 5EXOA 5FPZA 1PO22 5JIAA 1MS0A 5A3OA 4C90A 2DTYA 2ZPXA 3FE5A 5FK8A 2O8OA 1ALYA 5IUQA 3POBA 4CZSA 2QTWB 4AK3A 2FMDA 4QKFA 5FZBA 3CDZB 1W9TA 2XGXA 2C1FA 5E6HA 4GJZA 1FNYA 5FV3A 1W2OA 3C3VA 4GWNA 3ZX7A 4DPNA 3BOPA 4QX8A 4YNIA 4LQRA 2UWBA 1BMV1 3ORJA 2YBPA 2AGSA 5HXMA 5CFDC 3AL6A 3ZXDA 2ZKNA 1I6XA 5IVCA 1ULCA 1LTEA 1DP0A 1P8JA 3N35A 2XQXA 1X9TA 4W6YA 4C91A 2ZOEB 2Y6FA 2R043 5HI0A 1W6MB 3RWNA 2YGMA 4JAAA 3WP4A 1AYM3 2J1EA 4DXTA 1HX6A 2R32A 2V5DA 3N3HA 2JIJA 4AI9A 3TEWA 4SBVA 1OOPC 2FDKA 3Q8CA 5LATA 1ACCA 2A3XA 4QGMA 5FMOL 3MV01 3KLSA 4IEOA 3SH4A 1J1TA 2QQLA 4GAZA 5HV0A 5CKMA 2VG9A 2ZZQA 5BNNB 1V6NA 1XYPA 3GCXA 4ET7A 2GDFA 2XG3A 1PVXA 2RS53 4IESA 1XE0A 4NIHA 1UIJA 1KJLA 2IVJA 2W1QA 4KG8A 1PX3A 1JU3A 1BQPA 1ND2A 3MUY1 4JC1A 1NE4A 5DZFA 2OQ6A 3VBSB 1E57A 2GP5A 1VB2A 3CJIC 3PUIA 2XUMA 1AR93 3WHUA 1Y9MA 4FXGB 4EWEA 5F37A 2R6QA 4XJWA 5A7NA 5FOJB 2QFEA 4LLFA 4HSLA 3V0BB 1KS4A 1MS9A 5I93A 1O5LA 5JXHA 5FY1A 1PZ8A 4RL7A 2GU9A 2XBO3 4WZCA 3O7OA 3VZLA 2WWJA 3E97A 1N3PA 1RMU3 3CO2A 5F5CA 1LU1A 2FDJA 5IAXA 2KR2A 2PHRA 2AZ5A 3AKSA 2D40A 3WV6A 2X5IB 1AYN1 2W46A 3TEXA 4YG0A 4OYUA 3NAPA 3WP3A 1ULFA 2ZCWA 4CDXA 3RPQA 3VUOA 4MGQA 3ABZA 4NHMA 4AZZA 4LITA 4BXSV 1RJ8A 2RJKA 2HJIA 4WVMA 1FPN2 4J6GA 4LORA 1VBE1 4AFDA 2HWC3 1DGRA 1PVC2 1STMA 3NNMA 1WMEA 2XL7A 1A8DA 5K8SA 4YG6A 5K0UB 3K77A 4L0PA 5FZOA 4R4ZA 1W6QB 1TME1 1ZBE3 2HH9A 4EV0A 4F7ZA 3WCRA 4DUVA 2JDUA 3PUSA 1EYBA 4XAEA 2RE9A 5LEKA 1R082 1F35A 2QQPA 3VGIA 4MYEA 1OUXA 2G19A 2BU9A 1LHWA 2IUWA 1ND3C 3LA3A 2VCCA 3B02A 1UIKA 3AVRA 4NN0A 5EHDA 4COWA 2BTVC 1NOVA 1QJY2 2CDPA 3BN6A 4D6QA 3AX4A 3OBZA 4FFGA 2XHKA 1W6NA 2WFPA 1NLRA 1Q3EA 4R4XA 1O6UA 2ZHNA 4B3NA 5LWBA 3ON7A 1SFPA 4LBMA 4MGKE 3C8XA 3ZXFA 1WA6X 1XB9A 3VZJA 3Q9OA 3R4SA 3RSJA 2VOKA 2XHNA 3H0OA 4WM7C 1SEFA 4AEKA 1GZ9A 3BALA 1UAIA 3HD8B 1S0JA 5CYYA 1RITA 2A3WA 1G9DA 3B3QE 1Q43A 4XTMA 2JIGA 4XFBA 1RGSA 2UWCA 2X8KA 4IE4A 5FO7B 4D7TA 2JDHA 3UESA 4FPOB 4HZFA 1UYXA 4BH9A 4KU7A 2HEYF 2OT7A 4MHRA 2D93A 4B4QA 2ORZA 3AB0A 5I8SA 2ZX2A 4PIYA 1MZ5A 3IIIA 2JICA 2ZEZA 1SBDA 4YVWB 5FXVA 4RS5A 4B1MA 5JOXA 1V6KA 3S0MA 4META 1A78A 3K2OA 3URFA 1EY2A 2F4LA 4XF4A 1YQ6A 3I49A 1KDMA 1CJPA 1UF2C 4AQ2A 1GNZA 1CAWA 2FMYA 4H7MA 4IERA 5H9RA 4EWAA 2EXIA 3UNPA 1JMUB 4GD4A 1W8UA 2UU8A 2EIEA 4CA9A 1CPNA 1J58A 3T4VA 2QQNA 1GZTA 2D5FA 3OCPA 4HXCA 4FFHA 4E4HA 5JR2A 4MGZE 3LDKA 4R52A 3ZR6A 5JDBA 2WS93 3KHCA 4I09A 4OZOA 1VBD3 5IVVA 1N47A 1K5MC 1OD3A 1OLMA 1DGWX 1UY3A 1VBB3 2IWGB 2IXJA 2VMFA 4M0HA 4OI1A 1JYWA 4JGZA 4NRPA 1CZTA 4HKOA 3CLPA 4JGYA 3RRDA 2JD4A 5E89A 2I45A 1LOAA 1XNTA 1FPN1 5CU1A 5GJ6A 1NG0A 3AYAA 5FO8B 2WABA 4MX3A 1WCKA 1PVC1 4BQYA 5DAXA 3LDBA 4KI5M 3J8F1 5LA0A 3KQRA 4PDWC 2GH2A 1POV0 1FAYA 2HKXA 4CVUA 3O1VA 1RUE2 3HN1A 4AGRA 3IIAA 1LHUA 1W8HA 3E5UA 3THPA 5L7OC 3O1TA 4RSUA 3C7EA 2ZGLA 5DABA 3VBOB 2HWE1 4GWJA 1M06G 3WNLA 1EAH2 3VN4A 1YEWA 5EJZB 4MGTA 3MIHA 3WQ7A 2VVFA 4FXKB 4IGPA 2GC0A 5BNOB 1R081 3DL3A 2Z5WA 4LBNA 2MPFA 5T3NA 1F5FA 1NYWA 2JG9A 3TB0A 3ZFGB 1C8NA 1UOGA 4U36A 5FZDA 5FUNA 2W52A 5IAVA 5IVJA 1CAXA 1MR5A 2OX0A 3GALA 4M4PA 4UW5A 4XOGA 5CADA 2ID4A 2QDRA 3N7MA 1C1FA 1OH3A 3QOPA 4BYYA 3ZO0B 5C3PA 3DUIA 3E1F1 1AR82 1NQDA 3AYEA 1B35B 4IE7A 3JQXA 3MUZ1 5DAVA 3UGFA 4MZUA 5C6CA 3PVEA 2H0BA 5HCFA 1GU3A 3WT3A 5A7WB 4BIOA 3VBHB 5FZLA 1R64A 4UF0B 2XJUA 3JD72 3GJBA 4UYBA 2J1AA 3ZSMA 1Z7S2 2R49A 1GWKA 3I7DA 5FPLA 2KA3A 3C7GA 4A7YA 5DUWA 5IFTA 1O5UA 1NCRC 1V6JA 1JOBA 4M3CA 1RINA 4FPYA 4CE8A 4R9DA 3ME2A 5FZ0A 3B01A 4UAPA 5FP4A 2DF7A 3HQRA 2E51A 5KXBA 3EMRA 2BQPA 4QXBA 2V72A 5I0DA 3M3QA 3PDQA 3KV6A 3MIFA 3J26N 4LBKA 4B8EA 4KU8A 2VUJA 3WNXA 2Q8DA 4NOTA 4AHXA 1CWPA 3I3QA 5DG1A 2DVDA 1JS9A 2CGOA 4FPLA 5KBFA 1QXJA 4D69A 2DFBA 4QPIB 5F3EA 4CEYC 4DQAA 2FDHA 1W04A 5C71A 1DG6A 3WY6A 4LBQB 1CQ9A 3AJZA 2PHLA 3H1YA 1J3PA 3WNPA 4OHVA 4YZ4A 3AMHA 2C6SA 5FP8A 4R9CA 4AFCA 4GH4C 3RDIA 4CP1A 1ZRCA 4ZKTB 5JMCA 1EUUA 1DFQA 1QU0A 1NLQA 2UY8A 4KG0A 1H9PA 5A1LA 1HRV2 1U0AA 1H30A 1A6CA 2L9LA 1AX2A 2PN5A 1NA1B 2JDPA 2VNOA 2WSUA 3D5OA 4G4FA 4GMP0 1GQPA 1OF4A 3WDYA 1RUE1 4H7LA 2VTXA 4PCRA 1Q8QA 1EPZA 2RR12 5FY4A 4LMFA 3TBDA 4BHPA 3I3BA 1X50A 4IV1B 1DZQA 1VBA2 2OUJA 3GCWA 3WP6A 1YFYA 4K8RB 1EAH1 1YHFA 4E4DX 1H8TB 1ND3A 1OBNA 2ZGNA 1TZOA 4LO8A 1QEXA 1VBE3 4K40A 4LO7A 2ZGMA 4ZU5A 4DEVA 3W5NA 4YRDA 4JTNA 2HWF3 3H8OA 4JDOA 3S5QA 4Q4V1 3HVDA 5C33A 3KCYA 1IS6A 3RZGA 4BE3A 2BNOA 3QH6A 2K9ZA 1PGW2 3BCWA 4WM7A 1PO23 4CEWB 2YUEA 1RUG2 3MPPG 2BFUL 3QH7A 1TME3 3BPZA 4AFAA 4HETA 3CF6E 3MEPA 1N1YA 3OD4A 4RD7A 5FLHA 5FZ8A 5KWRA 1AR81 1LB2A 4EROA 3KM5A 5FZ4A 1UCXA 5AVAA 4INDA 4CDUA 2GZWA 2BBAA 1CGPA 5IFPA 4QU1A 3MIGA 2ERFA 3QLQA 3JD71 5GLUA 2P3IA 4XUPA 5IW0A 3SH5A 4E8CA 4EE2A 1Z7S1 3DCQA 1QWRA 4HL0A 4MXVA 4JZRA 1QY4A 2D3PA 2BGOA 4KWJA 3FL7A 3DPRB 3RVHA 4AEDB 2XXZA 5JSPA 2VW0A 3DECA 1UD1A 4LLOA 4XCBA 4XQ4A 1H1AA 5A3MA 5HV4A 1KEXA 4DFSA 4JQRA 5IHRA 1BJQA 2D6PA 3IBMA 2X05A 1QOTA 4CUBA 4YYOA 1ASJ2 5E16A 4FFIA 1YFWA 5F1RA 4YGEA 1T6BX 3I8TA 4LOTA 3FBYA 3USUA 2D3SA 2W87A 4AFBA 2A3YA 4FBFA 3KV5A 4LJHA 1JN2P 1MVQA 2JE9A 4IEZA 3N7JA 2J1UA 5LA2A 5EJ3A 5B4XA 3ZLIA 2NLRA 1K5MA 3HAGA 4HPKB 1A34A 4UT5A 3MDPA 3AVSA 1C5IA 4KQ7A 4YGDA 4XJZA 5D8AB 2D6NA 4NROA 4RHV2 3WDTA 1W6PB 1UY1A 2AYHA 4LBOA 4D7YA 5AFEA 4B29A 5CAZA 4CP0A 3D6EA 4KBBA 2FZ2A 5FMDA 5HBAA 4ZZ5A 3BTYA 1GBGA 1WD3A 3DXUA 3S6PA 3LOBA 4WVZA 5FKBA 3WUCA 1HDKA 1GNYA 2UYAA 1RYYA 1MS4A 2IVIB 1W90A 2QQIA 5DUXA 5C3RA 1GUIA 1YC61 3AKPA 4XCAA 4DOUA 2YHJA 1FNZA 1EUTA 1FV2A 1ZZ7A 4MSVA 4E9KA 3BUCA 4YGCA 5FBJA 2R30A 1HRV1 5L7OA 3LE0A 2DVAA 4YW4A 3AM2A 5FKCA 1SLTA 1UZVA 1JW6A 3LD8A 1VMFA 1PHMA 2LTNA 3PIGA 3K46A 2RR11 4LXLA 4UFKA 5F32A 3M3EA 4ZU4A 5FY9A 2WSVA 3ZSLA 1Q8SA 2JEMA 4PQQA 4BK4A 4BU2A 3OGGA 1VBA1 4B1LA 1OQDA 3WVJA 1TNRA 5C9AA 2WWSA 1L7LA 1UU5A 1FPN3 3PHMA 2DUQA 3SKVA 2ZEYA 2ZKLA 1PVC3 2OIIA 3ACIA 2GN7A 3F2ZA 4XTPA 2PHFA 3B9IA 1XSQA 2WO7A 4CCCA 1ZYBA 1RB8G 1JI6A 4NHXA 3H9AA 2ZHMA 1RUG1 4QHOA 3WDXA 5GZFA 1C8M2 3T3YA 3O1MA 5FPXA 2XL9A 3LEIA 5F5AA 3IM0A 2XKOA 3OBTA 2BFUS 2DVBA 1UXXX 4Q27A 4O7XA 2GALA 1R083 1YIPA 4LA3A 4I0WB 2DCKA 3KF3A 4PT6A 4TYSA 4I30A 4S2HA 1JYNA 3ZXKA 1QJY3 1JXNA 2B4KA 4E2GA 2R062 3EXUA 4V1PA 2ZHLA 4Y5SA 1ZZCA 4QDSA 4AI3A 4QPGC 4EQVA 3S7EA 1BYHA 3PMSA 3SCGA 2EIGA 1G86A 1ODMA 1ASJ1 3I59A 3PLQA 5BV6A 1PK6B 3ENRA 1OA2A 1YQ2A 2GC3A 4BQ3A 1AR91 1NCQA 1QQP2 5C5TA 4ISRA 4MO3M 1D0HA 1JTZX 3MO4A 3Q8FA 4ORFA 4YVSB 1JU4A 2GH8A 3MIDA 2ARCA 2W1UA 2WN2A 4CEYA 3RJ2X 2Z69A 3VDDA 4GULA 2BRTA 3ZPOA 1CAUA 3HBKA 5F3CA 3I2JA 1CAVA 1GFF2 2XBO1 2Y34A 5FR3A 5LY1A 2TEPA 2MEV2 4RHV1 3WP5A 1GP6A 1RUJ2 2CAUA 3HOBA 4HSJA 1YQCA 4KGGA 3S5AA 4JRLA 3VKLA 1GP5A 2WFF2 4P5HA 2C24A 4GH4A 2OA2A 3OGVA 2FHRA 2GN3A 1GZWB 1ND2C 3OUIA 4LKSA 4TZDA 1YQ8A 3TNPB 4K21A 3FFZA 4GA9A 2FCUA 4Q0QA 3BIWE 5EYYA 2HWC1 5DN2A 4NWWA 4AGGA 4C0BA 1OT5A 4BA6A 4Z1VA 4FTSA 1POQA 2BVVA 2PLV2 4LTAA 4NRQA 4URAA 2HBUA 2GP3A 4AOCA 5JMOA 4OQ8A 2HEWF 1ZZ6A 3UKVA 2AEZA 1Q8VA 2ZJCA 4QHZA 5IK7A 3UETA 3CKHA 5BNPC 4W50A 5JZGA 5FJKA 4P9GA 2VTXJ 5KHIA 2ZAHA 1IG0A 3NV3A 1HB3A 4GB32 2ATFA 4UXAA 5FYVA 2IXKA 3NAPC 1IQAA 2WNUC 3GHNA 3KB5A 3HIFA 4K20A 5EWSA 4JKKA 1YXWA 5KR7A 4YWAA 1ZRFA 2XUEA 3FHQA 4IE0A 3UYJA 1LULA 3WD5A 2BPA2 4LO5B 2W5FA 3NNLA 1L7RA 1PIV2 1RUE3 2XLGA 5LASA 3B7MA 3MYXA 4QXHA 2VY0A 1C8M1 3ZSKA 2GAUA 1C57A 1MQTB 3TOJA 4OFGA 2JG8B 4AG4A 4A45A 4ZHNA 1EAH3 4CDWB 3RYRA 4NPRA 3VBFA 2P2KA 3KWVA 4COYA 2P34A 3FLPA 4A3ZA 5I0UA 2VMCA 1QDCA 1S0CA 2YPJA 3C7HA 4FI9A 4HLTA 1OLME 4OHXA 3WG3A 4XACA 5CEHA 4IEWA 2PYTA 1N1SA 1WMDA 5CKNA 1UKGA 2R16A 1SACA 4D94A 3AFKA 4CP2A 2R061 3L9JT 5FY7A 2JE7A 2VZVA 2BERA 3T1LA 1G6NA 1S0BA 2VZQA 3ALQA 3FJSA 3FX3A 3JBG2 2IXCA 1KRIA 1UZZA 2XPJA 1AR83 3GF6A 1HV1A 2P3YA 4N8MA 5L9VA 1OXCA 1SCSA 1QQP1 3WHTA 1KFXL 4Q29A 2Y6GA 3GNEA 4LBJA 3ROUA 3HBZA 4UW3A 3VBSC 4B7EA 3JD73 3ZYGA 3AYDA 1Z7S3 5IVEA 4CP9A 3BPSA 1LU2A 2BEOA 2BV4A 5EIYB 1R092 2QDNA 3K48A 5CZKA 2MEV1 1RUJ1 4XDPA 2DVGA 3VZNA 2P37A 4Z07A 4ASLA 2WFF1 2XVLA 4P9LA 4QMAA 5I8YA 4M3CF 1Y43B 2B7YA 3S30A 4HVRA 4PQ9A 2Q30A 4RS5C 2PA7A 4XEZA 2VMGA 3DYPA 4DUXA 4QU2A 1OFSA 3LAGA 3V56A 2RJ2A 4Z8BA 4XDQA 4GKXA 1NQJA 1NZIA 3BYWA 1E5SA 2PLV1 4YM3A 4I0BA 1VR3A 4HVOA 2E33A 1UQXA 3VB9A 1COV2 2H6CA 2Y33A 1I5ZA 5CFCB 3SC7X 4YZ2A 1SG3A 2TUNA 4XXPA 3THCA 1D2QA 2WQZC 1QJEA 3NL1A 2Q1FA 4XFIA 5JIUA 3IPVB 4GZ9A 2OUHA 3L2HA 1W2UA 3RG0A 4DRVA 4HKLA 3AP6A 5LA9A 1RUOA 1C28A 1SFNA 4HANA 4XZPA 3PJYA 3MLJA 4GB31 3SNMA 1DLLA 2QQOA 4N43C 4ZY9A 2D6KA 5J96B 2RS32 5EPAA 3MGUA 5KHHA 3T4HB 3POSA 4BQ2A 4QM9A 4Y20A 1HRV3 3T08A 2LS6A 1LOCA 2QQMA 4Z92B 1WLCA 5J09A 5T5PA 4ZPIA 3WQ0A 2DCJA 3USSA 1HQWA 2P3KA 4JQTA 1BCXA 3HNBM 5T50A 1N1TA 2RR13 3R6SA 1W06A 5A1AA 2JE8A 3LSDA 1LGBA 1XYNA 3HT1A 3NJZA 2A75A 2WBKA 2YY1A 2DBNA 3VHNA 1VBA3 5KXEA 4NIIA 2J7MA 3WG1A 1J3RA 3AL5A 3ACGA 4CSWA 3ITQA 3AZZA 4AQTA 3R4UA 5FLJA 4HKWA 2QZ2A 5ABJC 5AFBA 4I02A 2JDKA 5HCAA 3NRUA 1BK0A 4IETA 1BK1A 4AHZA 4QPGA 4L2NA 5FJHA 3CZJA 1OLQA 2BDRA 2EALA 2JG9C 3J4UH 4Y24A 1B09A 2XMLA 3MW4A 1OPOA 4NIAA 1RUG3 1ULEA 2BVBA 4UFLA 5T5LA 3X29B 2VO5A 2A7AA 3JBG1 4CDXB 4YLZA 5FZ9A 1VRBA 2UWAA 4RGAA 4R9AA 1BLZA 2ZMLA 3GM8A 3E6CC 5FTTC 5FYIA 2ZX3A 4D6RA 5B2GB 4HN1A 4F3JA 4AFMA 1D4M2 4RFRB 4CDQC 1UYZA 1J59A 2Y38A 2VZSA 2IXIA 4HFSA 1AF9A 2R1BA 4DZGA 4HT1T 3IDAA 3T2PA 1I5PA 1Q8OA 3PVBB 4NHKA 3BIEA 5DPNA 5A6XA 2ORXA 5FZOB 1UY0A 2VD7A 2HWB2 1LECA 5I0TA 3THDA 4BCUA 2Y6KA 5HXVA 5CA6A 4XPVA 1ASJ3 4E8DA 1G7YA 4XJ9A 1UOJA 3NQHA 2YV8A 1VIWB 3SLIA 3ZIXA 4NPLA 5CIRA 4IEXA 1W03A 3ZXJA 2A5ZA 2I74A 2D97A 2WAOA 5FYBA 4PIXA 3UL2A 4CCOA 1QF3A 2QQUA 5FRAA 5HPOA 3EB7A 2B9UA 3K4ZA 3FZ3A 2Q5TA 2NYYA 3LKJA 5GLWA 4N53B 3ZYIB 1WZXA 5DG2A 1V00A 3ACFA 2G9ZA 1W6NB 1GQHA 3AMQA 3K3NA 4RHV3 4WM8C 5BNPA 5C70A 1COV1 2E7AA 1VB4A 3FUOA 4H55A 4RR3A 3MF6A 1X8MA 4JV4A 2WNOA 4XF9A 4RGKA 1VAKA 1FXZA 2WNUA 4FPJA 1IS5A 3JQWA 3VZMA 2CWMA 4EZ4A 5A3UA 4FCAA 2RM22 3FHAA 2YPDA 2ZGSA 1F8VA 1ENRA 1CVNA 3J7MA 3SHRA 1DGLA 2J1SA 5DMYA 2W1WA 3T2TA 4BDVB 2RS31 1OURA 3VD5A 2JDZA 2WC2A 1QMJA 2RVAA 5T55A 4AI1A 1OC1A 2HWF1 4KH9A 3T09A 4UW6A 3WDWA 4LE4A 1DCSA 3GXUA 3KVBA 1LOBA 5FP3A 5L19A 2K46A 4P14A 4FO9A 3I3MA 1MS3A 1PO21 3JB8A 3ZMOA 5C7GA 5FXXA 1W2AX 1H2LA 1ZZ8A 3N9PA 4AYUA 5JOYA 5BXXA 5KHKA 5JOZA 1W6MA 3RZMA 2C9KA 1VMJA 4GQ7A 1O3TA 3WQ1A 3RZLA 2CAVA 2JWPA 3I2GA 2BWCA 1EV12 5LK5A 3FHIB 5C8CC 3H42B 4QDQA 3N4MA 5F9TA 1RUH2 3HMYA 4QWNA 5BNNA 5F3IA 2BOJA 1B35C 1JOPA 5GLZA 3UKTA 2QQWA 4OZXA 2B45X 2R0HA 2Y8KA 2BOIA 4IEUA 3W21A 2WO2A 5EJ1B 4BPZA 1YQ5A 2ET7A 1QJX2 4DS0A 4GALA 3MZHA 1C8M3 1OLRA 3IDBB 1REDA 5FP9A 3VBSA 4FVVA 3OPTA 3I2FA 1YO8A 1RUI2 2JDAA 3NVCA 4JGYB 2B8MA 2GMMA 2B46X 4PF1A 1W0PA 3DKWA 4Q0VA 3RZZA 4DO0A 3CHXA 5A32B 2YROA 4BWOA 2BNNA 1ZA4A 3BODA 4HOOA 3VV1A 1OI6A 3V0BA 3K4AA 3OD0A 4GXLA 1KFUL 3ZR5A 2HEVF 2VZ3A 3UKNA 4CDUC 3GGLA 4FAHA 4FSJA 4FP3A 2R063 4FAGA 4FOYA 4FT8A 3O1RA 4M00A 1DU3D 2HWB1 2NMOA 2Q8CA 3LEKA 2XWBB 4LUKA 3OB8A 2VMEA 3POWA 4ARXA 1YJKA 3K3OA 4QPIC 3O12A 1QQP3 1LRHA 1LHVA 5CFDB 4EN6B 4AL9A 1OVPA 5FXWA 4EZHA 5A7OA 4PHZA 4PJYA 1UWWA 5A7PA 3H3LA 3GBFA 1E5IA 1JZ4A 1W6OB 2Q1MA 2VZ1A 4ZXEA 4XFFA 2A6WA 1H0BA 2MEV3 3VBRB 1RUJ3 4Y26A 3ES4A 5CISA 1OOPB 5K0UA 4L97A 4S2FA 1W8NA 1KITA 1UY4A 1HIXA 1JBCA 1FOD2 2WIIB 1BVP1 2WFF3 1V6OA 2Y64A 2ZX4A 1NA1C 4N43A 5ACA2 1Z0HA 1PGSA 2X29A 3CQOA 2W47A 3LB9A 1AXZA 4RA0A 3SCFA 3J7LA 4CCDA 5JWPA 1JYXA 4A7ZA 2B5HA 3PUQA 2VJXA 3ZYHA 4LHSA 1BXHA 2NMNA 4K1ZA 5FPVA 2PLV3 3ZXGA 2RDRA 3CJIB 4NWVA 2XOMA 5FMBA 5T54A 3JCIA 4BQ5A 1LEMA 2BZDA 3LEGA 5J37A 1KQRA 1J84A 3KS7A 5LRRA 1TG7A 3H7JA 4B7KA 2V73A 3JUUA 1VPHA 3KZ4C 4QGNA 4BB3A 2ADEA 2LALA 4XFHA 5ABJA 4XJUA 1U5YA 2YDEA 3PVNA 1EV11 5T5OA 1QOOA 4GB33 1CPMA 5IVBA 1CD3G 4YW2A 2ZTNA 4CUGA 5F5QA 4Q8KA 5LBFA 1RUH1 1WW4A 5C9AC 2CSGA 2VC9A 3MIEA 2DYCA 2DCYA 2W94A 4OLLA 1DIWA 2DUPA 1FYUA 4AQSA 3IZOA 1RVF2 1QJY1 2EXJA 2YBKA 4OHZA 1LR5A 1PIV3 4UFHA 5ERLA 1QIQA 1QJX1 4X8PA 2ZEWA 3AP7A 2X10A 3HN3A 4LULA 4BMBA 3P3PA 3IAPA 4CDQA 4AEDC 4EWDA 1RUI1 1F4AA 4F83A 5LBBA 1VMHA 4P08A 5FQ0A 1OKQA 2VVEA 2NN8A 1MVEA 2Y6LA 5HCBA 1JZ8A 5DXDA 5APAA 4Q0PA 5K7PA 2Q1ZB 5KHGA 2PAKA 1X9PA 1S0GA 2VQAA 4BZ4A 1WWYA 1WW6A 2XJTA 2D44A 3TNQA 4Y1ZA 2QKDA 5A33B 4JDNA 1W3VA 5FYYA 2XKPA 5A3NA 1QDOA 4FPEA 4YARA 3JBG3 3AJYA 1YI9A 1G9CA 1S0FA 1CESA 1LESA 1ND3B 1UZWA 4KMQA 2Z4FA 4XXAA 2DCTA 3WEZA 2W0XA 3PU3A 5LBCA 2TBVA 1OSGA 1V9U2 4WM8A 5FOBB 5F8PA 5A7QA 5FZCA 1H2MA 1NCQC 1QHDA 5LB6A 3RI9A 5FXZA 1TMF2 2D3RA 4NIDA 1R093 3TRSB 1G9BA 3VDBA 5DAPA 3WF4A 2VZOA 1W8TA 4XABA 1I3HA 2VU9A 3VDDC 1O3RA 2CY6A 4L92A 3KT1A 4X6RB 1FOD1 4C8DA 2ZA9A 3ZPYA 3VBOA 1JZ6A 4AVSA 5ACA1 2SBAA 1UY2A 1X82A 2DU1A 2XVKA 1RHI2 2QQJA 4FQ4A 2BP6A 2EA7A 3VL8A 4OCTA 3OY8B 2LROA 4CUCA 1WLTA 4AF9A 1Q5OA 3ZFGA 3AK0A 1HXS2 3ILNA 4JHZA 3AP5A 2YC0A 3WCSA 2V09A 1FT9A 4ATFA 1TNFA 3BU0A 4JTOA 2OXBA 3N7KA 3SXWA 1COV3 3FLRA 4IGQA 2ILMA 4RQPC 4B4PA 3RZJA 1NXMA 4JHTA 5C8CA 2ARBA 2CYFA 5GLTA 3VKMA 5LBEA 2VQTA 2FZ1A 5FZKA 5GALA 4QAWA 4BQXA 3T0DA 5EQUA 2D6LX 2A1XA 2Y6HA 1GP4A 1B35A 4ARYA 4DB5A 5IVYA 4CTEA 3LF7A 3AKRA 1ZBA2 1LJ7A 2I2SA 3I54A 5JZGC 5KC5A 2RS33 3DF0A 4LPLA 3VBHA 4UOJA 4UF0A 1K5MB 3CMGA 4JCKA 1XPWA 2JXAA 2WZEA 5L36A 4Q4Y2 1OF3A 3UK9A 4B4RA 4MGYE 2NQYA 5FCCA 4P9YA 3OF1A 2OKXA 1JUIA 1EP0A 3CNAA 3WQBA 4Q4X2 2ZX1A 3DGTA 3Q8AA 2RS12 3FC0A 3AXDA 4DXZA 1UO9A 4O9GA 4HMZA 2VNVA 5D2AA 4PDWB 3D0SA 4TXWA 2OZ6A 3JXSA 2ZS6B 1PM4A 5T5JA 4ONUA 3M4FA 3VBUC 3VBFC 5JUVA 5L7OB 1UMHA 3DYMA 2W92A 2WYFA 4YG3A 2VUAA 1NE6A 4Q4W2 4ZS3A 2FD8A 2B39A 4XAAA 3VHPA 4QPIA 2YXSA 3PU8A 4NR1A 3BTZA 1LGNA 3I3EA 1TQ5A 4DIQA 4OHWA 5T52A 5JSOA 2G4IA 4LBQA 2UYBA 4LHLA 2WWUA 2GC2A 5J7MA 1Q56A 5FZ6A 4XUQA 4CCJA 1D4M3 4XBLA 3KV4A 4MXWA 1V9U1 4YW5A 5FUPA 3LDRA 3J9SA 1HQNA 2PAMA 2VM9A 1WMFA 1WD4A 4A42A 5TSWA 4ZU7A 1BZWA 1KS5A 5FK7A 1DBNA 1S0EA 4XIOA 1X33A 2P1BA 1NA1A 2BBVA 1RUD2 2D43A 1SQ4A 4K3UA 2HWB3 2YBSA 4EYUA 1ZREA 2ADDA 5IYYA 1Q8PA 2GNBA 4OVEA 4IV1A 2W1SA 2ET1A 1RHI1 2PXJA 1OMIA 3AYCA 1ONAA 5FP7A 1K5JA 3QBQA 4UBHA 5C8WA 4BM8A 1NCRB 3LA2A 4AEJA 1DHKB 3VD7A 4UW4A 1LGCA 1EPWA 1LAJA 2E7TA 2BW8A 2D6MA 2MHFA 2XQRA 4ZONA 2WL1A 1HXS1 3OYWA 3ZXEA 4IUGA 5DAWA 4YGBA 2EF6A 2A6XA 1DF0A 2HBTA 3M3OA 3T2OA 3DV8A 1H6XA 2X09A 4A7KA 3POGA 4D8MA 2VW2A 4NVPA 4NAOA 5FZ7A 1NLSA 1QXRA 3WZ1A 3I59B 4IV3C 2AUYA 2RM23 1GQGA 3AMMA 2P6CA 4BQ1A 4MG2A 4TN7A 3SEPA 4CEYB 1ZBA1 1D4VB 3U4SA 3BTAA 3TEZA 1K12A 2VPVA 1CAUB 4N9HA 2HWD2 3V65A 2E6VA 1CAVB 2MNGA 5SV5A 3AXEA 1FMD2 1MS8A 4UFIA 1GANA 4QX3A 4AEDA 2OPKA 2EVXA 4COZA 3PVOA 1PGW1 1XNAA 4OUSA 3RMXA 3OGJA 1IHMA 1Y3TA 1RTVA 3AKQA 3HEIA 5F2SA 1D0GA 1OUSA 1HRI2 2VOWA 4AGVA 1ZM1A 3GYDA 2C0ZA 4Q4X1 5KXDA 5IJRA 4QHBA 1EV13 1AL22 2RS11 2HLEA 3BVCA 4XF1A 2IC1A 4Y1VA 3OOXA 4W6WA 4DNYA 1RUH3 1HKDA 1VALA 3A0NA 3OBAA 2W3JA 3RQ0A 3NJXA 1XE8A 2WLQA 4IE6A 3VKNA 1FV3A 5I8TA 1NY72 3EHKA 4K8FA 4Z2AA 3HT2A 2PFWA 2K2SA 1UOBA 2XJSA 3F95A 3NNJA 1LKNA 1RUC2 1QJX3 5D8AA 5AC92 1PNGA 3APBA 1UU4A 1WW5A 1W6PA 3ZFEC 5KHJA 1QJU2 4GMP1 4WBBA 1SPPB 5F3GA 4EN9B 1T2XA 3A0KA 1DGRN 4KWLA 1RUI3 4QQOA 4IEYA 4XDOA 2GSYA 1UXZA 1ZRRA 2E9QA 2WKKA 3UJQA 2YU1A 2AEYA 4AVBA 2C4XA 5FYMA 3KCXA 5FLIA 2WINB 4D0QA 3OUHA 1Y9GA 4HVQA 1O3QA 4A4AA 4GKYA 1IKPA 4TWTA 4PI0A 4RFT0 5G04L 4DY3A 4FPHA 4RN5A 2FDFA 1RUD1 1TVGA 3CJXA 4DY5A 2O1QA 3ZN6A 4QKBA 3ZFFC 1BBT2 1RXFA 1O4ZA 5LW9A 1C5HA 5I91A 5JXGA 4FPGA 1HW5A 4WZFA 5CG9A 1GZCA 2WNVC 4PLNA 5CFCC 1SLBA 4H14A 5EV7A 5C4WC 1W2NA 2VBPA 2GMPA 2QQVA 2W91A 1VRH2 1YFUA 3IAQA 2R0FA 4Q5OA 3KMHA 4RQPA 3SITA 4CCLA 1YI7A 5A6ZA 1SLAA 2YZ4A 4QQ2A 3OEAA 4I0AA 4EN7B 1XSRA 2BWAA 3UGHA 4K6BA 2DBIA 1E5RA 2GC1A 2JD9A 1JYIA 4E2SA 1FOD3 1IQDC 5GZCA 3MFCA 5ACA3 4S2GA 4Y5Z0 4YW7A 5C3QA 4OI2A 4RR3C 2EAAA 3SMHA 5GZGA 4FOVA 4QXCA 1X7NA 1YJLA 5CB7A 4IW3A 4Q8LA 3BB6A 4LIUA 4KGQA 4ITCA 3U75A 4CP9B 3TN92 4C1XA 3MPBA 2HWD1 3N9OA 2P6HA 1BEV2 3S7IA 2ZGPA 4MUVA 2FQPA 4CUAA 4Y22A 2PQQA 1AR62 3AZXA 1OA4A 2A73B 4N90A 2H6BA 3LFIA 4XC9A 2YU2A 3VBUA 5I0RA 2J1TA 1ZA7A 3QD6A 3B9CA 1CIWA 2J1VA 2WT2A 4P9JA 1HQLA 5FFOC 1I9RA 1JYTA 1W9YA 1NY71 2DCZA 2C26A 1ZZBA 1RVF3 3J7NA 5FYTA 1S4CA 2AACA 1IS3A 5BPXA 5AC91 3VKOA 5BNNC 2RDNA 1QJU1 5F6KA 2E32A 2LW8A 3WXPA 5JOWA 2OVUA 5FYSA 1CONA 3OSDA 5J1XA 3E6BA 3SISA 1JZ5A 1LOFA 1GZWA 2RMU2 2CL2A 2WAAA 1GICA 2CDOA 2JDNA 2O14A 1WUVA 2VQUA 2XLAA 3POEA 4MLOA 4Z82A 3UT0A 1F2NA 2IXHA 4AWDA 1WKYA 2WO1A 1MZ6A 5FMCA 2CWSA 4D6SA 2YC4A 3U14A 5ANNA 1SZBA 3ACLA 4L9BA 3NV4A 4XJAA 1AJKA 4DRRA 1POV3 1RUF2 4E4SA 1S2EA 2ZACA 5LZ6A 1UNBA 2VR4A 3K51A 4N53C 3ZSJA 3TAYA 1ULPA 3WOGA 2QQKA 3U0ZA 2QE3A 2X5IC 4QXKA 4XHBA 4AE2A 3JB4C 1V9U3 1H4GA 5GZDA 3W59A 1W39A 3ZDSA 1SBEA 2VULA 4BLJA 1VRH1 3HR9A 3W20A 1TMF3 3CBNA 4NPMA 4OMCA 4IV3A 3GBGA 4WV8A 4XURA 1KXGA 1WCUA 1UN1A 1ZRIA 2PELA 1REFA 2I07B 1ENQA 1IG3A 1OFNA 4YSFA 1DZRA 2J42A 2YYOA 4YZ3A 3VHOA 4I01A 2XB6C 5EZWA 4KWKA 4YW6A 1ULDA 2WRAA 3W58A 5K9YA 4UFMA 5FDBA 1TEIA 1RHI3 5K0UC 1VE0A 4WVVA 2QUOA 4M3CE 3ZOIA 3NKGA 3RNSA 1IZ3A 1F4HA 1GYKA 1HXS3 1UZYA 2R072 3IDEA 3LFMA 5EYXA 1JH5A 1O4TA 1OQ1A 4W8JA 3HQUA 3ECQA 4PF5A 3T0BA 4DXSA 1HV0A 4GJYA 3IDCB 3A21A 1PIV1 1IPKA 1U5XA 1ND2B 4A2UA 3PTRB 4FP2A 1SHWB 3WUDA 2OS2A 4J25A 4XW3A 1SCRA 3N9NA 4E2QA 1HB1A 1AYN2 1JOJA 1RIRA 3ZVXA 4QT6A 5M0TA 3OPWA 2JJ6A 2PTMA 4O65A 1K42A 4JKLA 5FIXA 5LCWL 2X53S 1DYKA 2D98A 1ZBA3 3ILFA 3JZVA 5JPMB 5FZHA 1M4WA 2F6BA 3KD4A 4BQ4A 1OH4A 2V5YA 1IS4A 1UW8A 3ZFEA 4R9BA 4COUA 5BNPB 3I2KA 4ISQA 3ZKYA 4AQ6A 2XJPA 3ES1A 2JKXA 3NJYA 3HQXA 1PMJX 1PMHX 3ZYJB 1JZ2A 2XR4A 4QD2A 4MV2A 5FZEA 3V0AA 1TME2 1YRZA 1W05A 2WNUB 3NAPB 2QBXA 3ZMNA 2P17A 4FQZA 4Q4X3 3AZVA 3QACA 2O0OA 3MBWA 1MZFA 4K7JA 3WW4A 1AHSA 1O59A 2RJLA 1LENA 2RS13 4Q1PA 1UOFA 3N7LA 4WVMB 2RMU1 4YVWC 1AUYA 2J1RA 2NP0A 1WCQA 3KHBA 1HB4A 4C0HA 1FI2A 2VW1A 2WLPA 4KNCA 3TWIA 3POJA 1LOEA 3PTYA 5FPAA 3ZFFA 1R091 4Q4W3 3C7OA 5FWJA 5F7UA 4XMAA 1I1EA 2VTFA 4O9EA 2C5DA 4WVWA 4MVTA 4CRQA 1RUF1 3HNMA 2WNVA 3EBRA 1NZCA 4GMP3 3I4IA 5CFCA 5C4WA 3OG2A 2AREA 4XHXA 5BNQA 4ZZ8A 1AZDA 1UPSA 3VBRC 4E27A 2VQ0A 3IPVA 4HK8A 2FDIA 4ES9A 4QX1A 5HCHA 2VMIA 1PM7A 2EAKA 3Q8BA 1V0AA 1YFXA 3GZEA 1A8MA 4IGOA 4XFAA 2ZABA 5A6QA 3NNFA 5E88A 3A4UA 3ZSEA 5L9RA 1XBFA 3H3ZA 1WCDJ 4GWIA 4QKDA 1WLDA 2XJQA 3AKTA 2RV9A 1RUD3 5H9SA 2DURA 3NO8A 3ZDVA 1WGPA 1DGWA 2XWJB 2ZX0A 3WF2A 4V2VA 3DEMA 4SLIA 2OZJA 1X36A 4A3XA 3LA7A 1O7FA 1J1LA 4MH0E 1VBC2 1VP6A 4I3GA 5BUVA 3OGRA 3VBOC 2W68A 3UJOA 1US2A 5KXCA 2R071 4CXWA 3WW2A 4DMIA 2BYVE 2W2IA 2WA3A 3POIA 1CJDA 3JU9A 1W0NA 2VECA 5BNOC 5CBLA 3WSOA 1IOAA 3ILRA 2VZRA 3ZFGC 5JPNB 2QNKA 4FPFA 4RS5B 5LRSA 3AZYA 3FLTA 5E8AA 4LBLA 2VZTA 3LPFA 5FYCA 1JYVA 4K1YA 3IB3A 2D5HA 3J7HA 2EXKA 4LKEA 2VXRA 3P1IA 4U2AA 4N9IA 4R8HA 3WLUA 4N7UA 3A7QA 5BYNA 3AFGA 1CAWB 5JXJA 5FYUA 3O0XA 1UMIA 4M01A 3O1OA 1FATA 2R7EB 4RYDA 1K3IA 2CU5A 1V6IA 4GWMA 2ZXQA 2HWD3 1G9FA 4YM2A 4P9WA 4NRMA 2NM1A 1FMD3 3PUAA 4IQPA 5C3OA 3J8F2 4NIGA 2YMZA 3CZUA 4UWDA 1J3QA 3IN9A 3OPZA 4KWUA 3AP4A 2Q8OA 2E26A 3VBHC 4BIFA 3M3CA 1HRI3 1UX7A 2YG0A 1AL0G 1S2KA 5H9QA 3I2OA 3OEBA 4JGZB 4N43B 1U5ZA 2H0VA 2HWE2 3PL0A 1VLNA 2RHPA 1XNBA 3LIHA 1AL23 4MADA 3RZKA 4MHUA 3RWKX 1D4M1 4S2DA 4XBQA 5I0SA 3FBMA 2VCMA 5GLVA 2Y26A 3T2QA 4AR2A 3POFA 1WLWA 2EXHA 3FFQA 1RUC3 4N53A 5DUUA 4ZS2A 3T1MA 5AC93 5A80A 4QX2A 2Y0OA 3I3DA 1QJU3 2WZPP 1SLCA 2X5IA 4D7SA 4G9SB 5ABJB 1GOFA 3MIBA 3U07A 4CCNA 1NKGA 2W95A 3ZXLA 1MS5A 1HLCA 1XNCA 3IKWA 1UMZA 2QVSB 1W28A 4HONA 4BMEA 4CCMA 2FCTA 1SMVA 2JG9B 2SLIA 5A6YA 2XONA 3KF5A 3QCWA 3NV2A 1O8SA 3NJVA 4AVCA 3RJRA 3SKJE 5FMOS 4EJRA 4QM8A 1CAXB 4OQ9A 4E4ZA 3U10A 1DLCA 1GOGA 3CL1A 3EQEA 1XU2A 3MHZA 1K45A 1MZEA 2D7FA 3WNMA 2ZGQA 5DDJ2 4UBGA 3PUHA 1BBT3 3VZKA 4XQWA 4CDQB 2VXJA 3LCPA 5J98B 1W6QA 3NNGA 3MFAA 1KJRA 3A23A 2RM21 5FQ0B 3WR0A 3GDBA 3WG2A 1VBC1 1IPJA 2BGPA 1YNAA 4MGIE 5IT6A 2UURA 1RUNA 1GR3A 5JSRA 3U37A 4JKMA 1VRH3 4IV1C 1XNKA 4ZXKA 1H8TC 2CNAA 5CG8A 1XE7A 4CPBD 3POYA 4M3CB 5JLVA 1AJOA 1ODNA 1UU6A 2C9AA 2YFZA 4OI4A 2IZWA 1DYPA 4XUTA 3NMBA 4BJ0A 2IFWA 4J1XA 5A7SA 2HYKA 2Z79A 3ST7A 4QPWA 4OHYA 1ULOA 3ZXAC 4LKDA 3ZM8A 3VD4A 5AVPA 2LM3A 2DDUA 3WF1A 4LO6B 1XYOA 4CEWC 4LA2A 3U78A 3UGGA 1W9WA 1CIYA 2DTWA 5DQ0A 4WM8B 3B69A 4LBQD 2EIBA 5A32A 3D82A 3MLLA 3TN93 4IDZA 1DQ6A 3ZN4A 4KL1A 4LE3A 1BEV3 1H2NA 1G8WA 3E5QA 1OA3A 5H9PA 3EO6A 4LKFA 2VCAA 5FYZA 4LT5A 2FDGA 3U11A 1E5HA 1U12A 2PAEA 3B00A 4L8QA 4XUNA 4YVWA 1AR63 4QQLA 5C5UA 5JI9A 1LHOA 2CHHA 3DPRC 4YFZA 1AXYA 2NZ9A 4W6XA 4PLMA 1PO12 2G9FA 3M70A 3C2UA 5SV8A 2BUKA 5CFDA 4HN0A 2OPWA 2WN3A 2ZGUA 1V6LA 2WDBA 1PGL2 4PIZA 4Q4V2 3WW3A 4TTGA 4EN8B 1W6OA 3P3NA 1XNDA 3RZHA 1HN1A 3VBRA 2DV9A 3CIHA 1QNWA 1V6MA 2XVGA 2VL4A 5C8CB 3ZYRA 1OOPA 2HYXA 3PMEA 1REEA 1O91A 3AP9A 1QH7A 2JB4A 1QH6A 5D8AC 3LSEA 3WF3A 1IGOA 1HN0A 1XU1A 3KV9A 3WF0A 2RMU3 2VOXA 5KC6A 5FZFA 2WO3A 2GNMA 4A6SA 1ENXA 3DXTA 1L3JA 2VBBA 2QJVA 3I97A 1W0OA 4Y3OA 4YW3A 4OMDA 2JB8A 2Q8EA 3ZYBA 4QPYA 1GMMA 5FZMA 1Y7BA 3W5MA 4O61A 2RDSA 3CJIA 4WM7B 4IEVA 2ZAAA 4LO4B 1ZVFA 1W9FA 4AI2A 5ANQA 1RUF3 4LNVA 4Q1RA 5DDJ1 3RFRA 3B94A 1DZTA 1Z78A 5A3LA 3VLBB 3VDCA 4FTEA 1XQNA 4QQHA 5FYHA 3DKQA 4H3WA 1OQEA 1PZ9A 1XC6A 2LUWA 2VCBA 4UFJA 5J48A 2PHWA 4CDUB 4XBNA 2WZR2 1H6YA 4DINB 3HJRA 5LK7B 1UYPA 3IWZA 2WZ8A 4HG6B 5BNOA 3H50A 4OI0A 4XE9A 1R1A2 5DUVA 1MEC2 4YZ1A 2JENA 5FZ3A 2DU0A 3VD9A 4Y4YA 3ZYFA 4CU7A 3RGBA 4Y4RA 1AR72 1L7QA 1XRUA 2A70A 4QGLA 2DVFA 5CVRA 2R1DA 4Q0SA
chains in the Genus database with same CATH topology
3NSTA 5J3UA 3OBRA 1F5JA 3ETQA 2JX9A 1YCIA 3NWKA 1LEDA 1H1IA 2VNGA 3O0WA 4Q26A 3USUB 4MXWB 2DWRA 4PLOA 1N3QA 3ELNA 4XFGA 3VL9A 2N7GA 2OYZA 2R073 3MW3A 4X6QB 1ZRDA 1KDKA 3WX5A 3LWCA 4XFCA 1DQ2A 1MACA 1RVF1 1SLIA 3GHMA 3ZYPA 1F9KA 3VKFC 5A33A 3O5SA 3NW4A 1RL3A 1AYN3 1O3SA 1FX5A 2ZZJA 4JVAA 2Z42A 4TLFA 3MF9A 1PO11 4IXLA 3U4XA 1JHNA 1S55A 2WNEA 4N7IA 3OYWB 3H8UA 4ASMB 1PK6C 3E6DA 4D3WA 1PGL1 3RYKA 4F8AA 4YVSC 2ZBJA 3M7AA 1ZZ9A 3KT4A 4YFWA 2FBEA 1POV1 2R042 3R0RA 1O4YA 4XF0A 4XETA 5C9AB 2ETEA 2VMHA 1AYM2 1LHNA 3LZZA 4IEQA 4JDMA 4I2OA 1C1LA 1X8EA 2VH9A 4PBPA 4AHYA 1SFYA 2A6ZA 3B5LB 3KCCA 3OY8A 3SH3A 1C3HA 1UKRA 5L73A 1OHFA 1YWKA 2PHDA 1AXKA 1LOFC 2DUOA 4ES8A 1TMF1 2RS52 1RJ7A 3D0JA 1S1AA 3ZIWA 4AVAA 3E5XA 1WA4A 2DFCA 2O8QA 1ULGA 1AR92 4JRAA 2XJVA 1H8TA 2ZHKA 2WZR1 3FMGA 4XMIA 5DZGA 1R1A1 1GV9A 1MEC1 2KXLA 3IMNA 2BNMA 4J1WA 4LUMA 4YM1A 2F4PA 2XBO2 1PMIA 1RMU2 1H2KA 1SDWA 2E7QA 1AR71 2ZMKA 3THTA 4Q4Y1 3VZOA 4CEWA 3H3UA 3VHRA 4XQDA 3I2DA 3M8LA 2OW4A 4HBNA 1WBFA 2W08A 2A71A 1NCQB 2CV6A 4XF3A 1VBC3 1MQTC 4BLIA 3LGRA 2JG8C 4PDWA 3VDDB 3R4DB 3MW2A 1G9AA 2HWC2 2GNDA 2VNRA 4CDWC 3KSCA 2E63A 2ZGKA 4YW1A 3DPRA 1U5IA 2ES3A 1AX0A 3V64A 3ZN6B 2CGPA 3BOWA 4Z2WA 4GH4B 2IFRA 4TSVA 3WDUA 1ZBE2 2JECA 4IEPA 1H1MA 2XJRA 1TE1B 3HWJA 5E1RA 4QX5A 3AZWA 1R1ZA 2A6VA 4LHNA 3G7DA 4P9XA 1VAVA 3KT7A 4GIQA 3GZTB 2W39A 4RQPB 2Y0IA 1V70A 2Z2SB 1UL9A 3J8F3 3FWEA 4HPKA 4Q4W1 2XLFA 1N1VA 1MS1A 2A6YA 4Y1XA 5DZEA 4IL7A 2R041 5JZGB 2HWE3 2QCSB 3INAA 4OUMA 5BY5A 1AYM1 4FPCA 3AMNA 1H8VA 5JCTA 4YM0A 5JAXA 1NCRA 2Q0AA 1WBLA 1PNFA 3OJBA 1URXA 2ZGRA 5IK5A 3W9AA 3ATGA 2WA4A 2IXLA 1KD7A 2B42B 3G6JB 2RS51 4HK9A 5IK4A 1YUDA 2Q4SA 5GKAC 1S0IA 1GSLA 4L11A 4Y22B 1AVBA 2D6OX 2PHTA 2JKBA 1AX1A 3VBFB 3VBUB 1LCLA 3O14A 3KGLA 4W65A 4LR4A 4I3PA 1YIFA 4AEMA 1UX6A 4CYDA 1GNHA 1RMU1 4ATEA 3M3IA 4AVTA 1QJZA 4Q2FA 4Y1UA 2WT0A 5DDJ3 2WS92 1ZNPA 1VBD2 1DQ0A 1VBB2 3TYJA 3GZUC 5JR7B 2ZGTA 4AXOA 1SBFA 2TNFA 3MI8A 2VGDA 3H7YA 4Q0UA 2PHUA 2KM2A 4K9SA 3PNAA 3GZAA 4RGGA 1UPIA 5FBZA 3O0VA 4BOWA 3GBWA 1FMD1 1LOGA 3NKTA 1H4HA 2QZ3A 5D1IA 4FTBA 1D2SA 2AENA 4AVVA 1HRI1 2WJSA 1CX4A 1ZBE1 4NO4A 4X8NA 2K0GA 1PK6A 1AL21 2E53A 1BKZA 2VVDA 3AMPA 3IT8A 2ARXA 4YVSA 1VJ2A 4CDXC 1OPMA 3BU7A 3D4KA 3RMYA 3H1WA 5JI7A 4XILA 4QQPA 4IV3B 1F31A 3MLKA 2GNTA 1N3OA 4XIKA 1RUC1 1XXNA 2ENRA 3RS6A 3ASIA 3CU7A 4LEJA 4M0NA 3WDVA 1CR7A 5FAXA 1PO13 1ENSA 5LEJA 3N36A 1GLHA 1NXD1 4COVA 3SCHA 2ZGOA 1DQ5A 3WINE 2PHXA 4Y20B 1DQ1A 1BMV2 4Q4V3 1RC6A 1CN1A 1YLLA 1WW7A 1A3KA 1VAMA 1QNYA 5J36A 1DDLA 1BBT1 1T6GC 3DN7A 4YZ5A 3WW1A 4AHWA 4Y1YA 3LOIA 2NPIA 2UY9A 4AI8A 1Y9QA 3M1HA 3EJKA 1IKQA 1GKBA 2WT1A 4P9IA 5EFUA 2P3JA 4QPGB 3ZFEB 3M2MA 5CNAA 4AI0A 1DQ4A 4OULA 4NHLA 2WQ4A 2WS91 4C1WA 3V0AB 3ZN5A 1VBD1 4FOQA 1H9WA 1VBB1 1MQTA 3D8CA 3UV9A 1LODA 1QXPA 2JG8A 5F6LB 1SLLA 5GM0A 2CTVA 1APNA 3OTFA 4PBOA 5FREA 3CEWA 4CDWA 3R05A 1C4RA 2WZR3 2AH2A 1PZ7A 1JYCA 1S2BA 2GMEA 3FUQA 1R1A3 1MEC3 5JVVA 4URTA 3TN91 3PJQA 3ZFFB 3L2YA 2XH6A 1OD5A 2ZMNA 1JUHA 3KGZA 4LHKA 3VZLA 3NV1A 4FOWA 1BEV1 1AR73 4Q4Y3 4EN0A 5IK8A 3WG4A 2WNVB 3MICA 1BVVA 5C4WB 1WCSA 2CGNA 1AR61 4XJ8A 3RI8A 1YYNA 1ZX5A 4FPKA 3RYPA 1QGLA 1QKQA 4JGZC 1QOSA 1VBE2 1S0DA 2BGCA 2AR6A 4JGYC 4L99A 4XYXA 2VOVA 2YGLA 2HWF2 5FO9B 5GZEA 4AW7A 3B93A 4G3YC 2G9GA 3H1MA 4RR3B 5EXOA 5FPZA 1PO22 5JIAA 1MS0A 4C90A 2DTYA 2ZPXA 3FE5A 2O8OA 1ALYA 5IUQA 4CZSA 4AK3A 2FMDA 2XGXA 2C1FA 1FNYA 3C3VA 4GWNA 3ZX7A 4DPNA 3BOPA 4YNIA 2UWBA 1BMV1 2AGSA 5CFDC 3ZXDA 2ZKNA 1I6XA 1ULCA 1LTEA 3N35A 4W6YA 4C91A 2ZOEB 2R043 5HI0A 1W6MB 3RWNA 2YGMA 4JAAA 3WP4A 1AYM3 1HX6A 2R32A 3N3HA 4SBVA 1OOPC 2A3XA 5FMOL 4QGMA 3KLSA 4IEOA 3SH4A 1J1TA 5BNNB 2VG9A 2ZZQA 1V6NA 1XYPA 2GDFA 2XG3A 1PVXA 2RS53 4IESA 1UIJA 1KJLA 4KG8A 1ND2A 1BQPA 4JC1A 1NE4A 5DZFA 3VBSB 1E57A 3CJIC 1VB2A 2XUMA 1AR93 3WHUA 4FXGB 4EWEA 2R6QA 4XJWA 5FOJB 2QFEA 4LLFA 4HSLA 3V0BB 1KS4A 1MS9A 5I93A 1O5LA 1PZ8A 4RL7A 2GU9A 2XBO3 4WZCA 3O7OA 3E97A 1N3PA 1RMU3 3CO2A 1LU1A 3WV6A 2PHRA 2AZ5A 3AKSA 2D40A 2X5IB 1AYN1 4YG0A 3NAPA 3WP3A 1ULFA 2ZCWA 4CDXA 3RPQA 3VUOA 4NHMA 1RJ8A 2RJKA 2HJIA 4WVMA 1FPN2 4J6GA 1VBE1 4AFDA 2HWC3 1DGRA 1PVC2 1WMEA 2XL7A 1A8DA 5K8SA 4YG6A 5K0UB 4R4ZA 1W6QB 1TME1 1ZBE3 4EV0A 4F7ZA 3WCRA 1EYBA 2RE9A 5LEKA 1R082 2QQPA 3VGIA 4MYEA 1LHWA 1ND3C 3LA3A 3B02A 4NN0A 1UIKA 4COWA 2BTVC 1NOVA 1QJY2 3AX4A 2XHKA 2WFPA 1W6NA 1NLRA 1Q3EA 4R4XA 2ZHNA 4B3NA 4MGKE 4LBMA 3ZXFA 3VZJA 3Q9OA 3R4SA 3RSJA 2VOKA 3H0OA 4WM7C 1SEFA 4AEKA 1GZ9A 3BALA 1UAIA 3HD8B 1S0JA 1RITA 2A3WA 1G9DA 3B3QE 1Q43A 4XTMA 4XFBA 1RGSA 2UWCA 2X8KA 5FO7B 4D7TA 4FPOB 4HZFA 4BH9A 4KU7A 2HEYF 2D93A 4B4QA 3AB0A 5I8SA 2ZX2A 4PIYA 1MZ5A 2JICA 4YVWB 1SBDA 5JOXA 4RS5A 1V6KA 3S0MA 4META 1A78A 3URFA 1EY2A 4XF4A 1KDMA 1CJPA 1UF2C 4AQ2A 1GNZA 1CAWA 2FMYA 4H7MA 4IERA 5H9RA 4EWAA 2EXIA 2UU8A 1CPNA 1J58A 2D5FA 3OCPA 4MGZE 4R52A 5JDBA 2WS93 4I09A 1VBD3 1N47A 1K5MC 1VBB3 2IXJA 1DGWX 2IWGB 2XKPA 4M0HA 4OI1A 3WD5A 4JGZA 4HKOA 3CLPA 4JGYA 3RRDA 2JD4A 5E89A 2I45A 1LOAA 1FPN1 5CU1A 5GJ6A 1NG0A 3AYAA 5FO8B 4MX3A 1WCKA 1PVC1 3J8F1 3KQRA 4PDWC 2GH2A 1POV0 1FAYA 2HKXA 1RUE2 3HN1A 4AGRA 3IIAA 1LHUA 3E5UA 3THPA 5L7OC 4RSUA 3VBOB 2ZGLA 2HWE1 1M06G 1EAH2 3VN4A 3MIHA 3WQ7A 2VVFA 4FXKB 2GC0A 5BNOB 1R081 3DL3A 2Z5WA 4LBNA 2MPFA 5T3NA 1F5FA 1NYWA 2JG9A 3TB0A 3ZFGB 1C8NA 4U36A 2W52A 1CAXA 1MR5A 3GALA 4UW5A 4XOGA 5CADA 2QDRA 3N7MA 1C1FA 3QOPA 4BYYA 3ZO0B 3DUIA 1AR82 1NQDA 3AYEA 1B35B 3JQXA 5C6CA 4MZUA 3PVEA 2H0BA 5HCFA 3WT3A 4BIOA 3VBHB 3ZSMA 2XJUA 3JD72 1Z7S2 2R49A 3I7DA 2KA3A 4A7YA 5DUWA 1O5UA 1NCRC 1V6JA 4M3CA 1RINA 4FPYA 4R9DA 3ME2A 3B01A 2DF7A 2E51A 5KXBA 2BQPA 3M3QA 3MIFA 4LBKA 3J26N 4B8EA 4KU8A 2VUJA 3WNXA 4NOTA 4AHXA 5DG1A 2DVDA 2CGOA 4FPLA 5KBFA 1QXJA 4D69A 2DFBA 4QPIB 4CEYC 4DQAA 1DG6A 3WY6A 4LBQB 1CQ9A 3AJZA 2PHLA 3H1YA 1J3PA 4OHVA 4YZ4A 3AMHA 4R9CA 4AFCA 4GH4C 3RDIA 4CP1A 1ZRCA 4ZKTB 5JMCA 2UY8A 1DFQA 1QU0A 4KG0A 1H9PA 1HRV2 1U0AA 1H30A 1A6CA 2PN5A 1AX2A 2VNOA 1NA1B 2WSUA 3D5OA 3PLQA 4G4FA 4GMP0 3WDYA 1RUE1 4H7LA 4PCRA 1Q8QA 1EPZA 2RR12 3TBDA 4BHPA 1X50A 4IV1B 1DZQA 1VBA2 2OUJA 3WP6A 1YFYA 1EAH1 1YHFA 4E4DX 1H8TB 1ND3A 2ZGNA 4LO8A 1VBE3 4K40A 4LO7A 2ZGMA 4ZU5A 4YRDA 4JTNA 2HWF3 4JDOA 4Q4V1 5C33A 3KCYA 1IS6A 4BE3A 2BNOA 3QH6A 2K9ZA 1PGW2 3BCWA 4WM7A 1PO23 4CEWB 2YUEA 1RUG2 3MPPG 2BFUL 3QH7A 1TME3 3BPZA 4AFAA 4HETA 3CF6E 3MEPA 1N1YA 3OD4A 4RD7A 5FLHA 5KWRA 1AR81 1LB2A 4EROA 3KM5A 1UCXA 5AVAA 4CDUA 2GZWA 1CGPA 3MIGA 2ERFA 3QLQA 3JD71 5GLUA 2P3IA 3SH5A 1Z7S1 4MXVA 1QWRA 4HL0A 1QY4A 2D3PA 4KWJA 3DPRB 4AEDB 5JSPA 2VW0A 1UD1A 4LLOA 4XQ4A 5A3MA 1H1AA 4DFSA 4JQRA 1BJQA 2D6PA 3IBMA 1QOTA 4YYOA 1ASJ2 5E16A 1YFWA 5F1RA 4YGEA 3I8TA 3FBYA 3USUA 2D3SA 4AFBA 2A3YA 4FBFA 1JN2P 1MVQA 2JE9A 4IEZA 3N7JA 5EJ3A 2NLRA 1K5MA 3HAGA 4HPKB 3MDPA 4KQ7A 1C5IA 4YGDA 5D8AB 4XJZA 2D6NA 4RHV2 3WDTA 1W6PB 4LBOA 2AYHA 4D7YA 5AFEA 4B29A 5CAZA 4CP0A 3D6EA 4KBBA 2FZ2A 5HBAA 1GBGA 1WD3A 3S6PA 3LOBA 4WVZA 3WUCA 1HDKA 2UYAA 1MS4A 5DUXA 3AKPA 4DOUA 2YHJA 1FNZA 1FV2A 1ZZ7A 4MSVA 4E9KA 4YGCA 2R30A 1HRV1 5L7OA 2DVAA 4YW4A 3AM2A 1SLTA 1JW6A 1PHMA 2LTNA 2RR11 3ZSLA 3M3EA 4ZU4A 2WSVA 1Q8SA 2JEMA 3OGGA 1VBA1 5C9AA 1OQDA 3WVJA 1TNRA 2WWSA 1UU5A 1FPN3 3PHMA 2DUQA 2ZKLA 1PVC3 2OIIA 4XTPA 2GN7A 2PHFA 3B9IA 1ZYBA 1RB8G 3H9AA 2ZHMA 1RUG1 3WDXA 5GZFA 1C8M2 5FPXA 2XL9A 3IM0A 2XKOA 3OBTA 2BFUS 2DVBA 4Q27A 2GALA 1R083 1YIPA 4LA3A 4I0WB 2DCKA 4TYSA 4I30A 4S2HA 3ZXKA 1QJY3 1JXNA 4E2GA 2R062 3EXUA 4V1PA 2ZHLA 1ZZCA 4AI3A 4QPGC 3S7EA 1BYHA 3PMSA 3SCGA 2EIGA 1G86A 1ASJ1 3I59A 5BV6A 1PK6B 3ENRA 1OA2A 2GC3A 1AR91 1NCQA 1QQP2 4ISRA 1D0HA 1JTZX 4ORFA 4YVSB 3MIDA 2GH8A 4CEYA 3RJ2X 2Z69A 3VDDA 4GULA 1CAUA 1CAVA 1GFF2 2XBO1 2TEPA 2MEV2 4RHV1 3WP5A 1RUJ2 2CAUA 4HSJA 4KGGA 4JRLA 3VKLA 2WFF2 4P5HA 4GH4A 2OA2A 2FHRA 2GN3A 1GZWB 1ND2C 4TZDA 3TNPB 4K21A 3FFZA 4GA9A 4Q0QA 3BIWE 5EYYA 2HWC1 4AGGA 4NWWA 4C0BA 4Z1VA 4BA6A 4FTSA 2BVVA 2PLV2 4LTAA 2HEWF 1ZZ6A 3UKVA 1Q8VA 2ZJCA 5IK7A 5BNPC 5JZGA 4P9GA 5KHIA 2ZAHA 3NV3A 4GB32 4UXAA 2ATFA 2IXKA 3NAPC 1IQAA 2WNUC 3GHNA 3KB5A 3HIFA 4K20A 5EWSA 1YXWA 1ZRFA 1LULA 2BPA2 4LO5B 1PIV2 1RUE3 2XLGA 3B7MA 3MYXA 2VY0A 1C8M1 3ZSKA 2GAUA 1C57A 1MQTB 3TOJA 4OFGA 2JG8B 4AG4A 1EAH3 4CDWB 3RYRA 4NPRA 3VBFA 2P2KA 4COYA 2P34A 3FLPA 5I0UA 4HLTA 1QDCA 1S0CA 2YPJA 4OHXA 3WG3A 4IEWA 2PYTA 1N1SA 1WMDA 1UKGA 2R16A 1SACA 4D94A 3AFKA 4CP2A 2R061 3L9JT 2JE7A 3T1LA 1G6NA 1S0BA 3ALQA 3FJSA 3FX3A 3JBG2 2IXCA 1KRIA 1UZZA 2XPJA 1AR83 3GF6A 1HV1A 1SCSA 1QQP1 3WHTA 1KFXL 4Q29A 3GNEA 4LBJA 3ROUA 3HBZA 4UW3A 3VBSC 4B7EA 3JD73 3ZYGA 3AYDA 1Z7S3 1LU2A 2BEOA 1R092 2QDNA 3K48A 2MEV1 1RUJ1 2DVGA 3VZNA 2P37A 4Z07A 4ASLA 2WFF1 2XVLA 4P9LA 4QMAA 5I8YA 4M3CF 1Y43B 2B7YA 3S30A 4HVRA 4PQ9A 2Q30A 4RS5C 2PA7A 4XEZA 2VMGA 4QU2A 1OFSA 3LAGA 3V56A 4Z8BA 4XDQA 4GKXA 1NQJA 2PLV1 4YM3A 4I0BA 1VR3A 4HVOA 1COV2 2H6CA 1I5ZA 5CFCB 4YZ2A 2TUNA 4XXPA 1D2QA 2WQZC 4XFIA 3NL1A 5JIUA 3IPVB 2OUHA 3L2HA 1W2UA 3RG0A 4DRVA 4HKLA 3AP6A 1RUOA 1C28A 1SFNA 4HANA 4XZPA 3PJYA 3MLJA 4GB31 3SNMA 1DLLA 4N43C 5J96B 2D6KA 2RS32 3MGUA 5KHHA 3POSA 4QM9A 4Y20A 1HRV3 1LOCA 4Z92B 1WLCA 5J09A 5T5PA 3WQ0A 2DCJA 3USSA 1HQWA 2P3KA 1BCXA 5T50A 1N1TA 2RR13 3R6SA 3LSDA 1LGBA 1XYNA 3HT1A 3NJZA 2A75A 2YY1A 3VHNA 1VBA3 5KXEA 3WG1A 1J3RA 3AZZA 4AQTA 3R4UA 5FLJA 4HKWA 2QZ2A 5ABJC 5AFBA 4I02A 5HCAA 4AHZA 4IETA 1BK1A 4QPGA 4L2NA 1OLQA 2EALA 4Y24A 2JG9C 3J4UH 1B09A 3MW4A 1OPOA 1RUG3 1ULEA 2BVBA 5T5LA 3X29B 2A7AA 3JBG1 4CDXB 4YLZA 4RGAA 2UWAA 4R9AA 2ZMLA 3E6CC 5FTTC 2ZX3A 5B2GB 4HN1A 4F3JA 4AFMA 1D4M2 4CDQC 1J59A 2Y38A 2IXIA 4HFSA 1AF9A 2R1BA 4DZGA 4HT1T 1Q8OA 3PVBB 4NHKA 2HWB2 1LECA 5I0TA 4BCUA 5CA6A 5HXVA 4XPVA 1ASJ3 1G7YA 4XJ9A 2YV8A 1VIWB 3SLIA 3ZIXA 5CIRA 4IEXA 3ZXJA 2A5ZA 2I74A 2D97A 4PIXA 3UL2A 1QF3A 5FRAA 2B9UA 3FZ3A 2Q5TA 2NYYA 3LKJA 5GLWA 4N53B 3ZYIB 5DG2A 1V00A 4WM8C 3AMQA 1W6NB 1GQHA 5BNPA 4RHV3 1COV1 2E7AA 1VB4A 3FUOA 4H55A 4RR3A 3MF6A 1X8MA 4JV4A 4XF9A 1VAKA 1FXZA 2WNUA 4FPJA 1IS5A 3JQWA 3VZMA 2CWMA 4FCAA 2RM22 2ZGSA 1ENRA 1CVNA 3SHRA 1DGLA 3T2TA 2RS31 2JDZA 2WC2A 1QMJA 5T55A 4AI1A 2HWF1 4KH9A 4UW6A 3WDWA 4LE4A 1LOBA 5L19A 4P14A 4FO9A 1MS3A 1PO21 3JB8A