4QGNA

Human acireductone dioxygenase with iron ion and l-methionine in active center
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
178
structure length
178
Chain Sequence
MVQAWYMDDAPGDPRQPHRPDPGRPVGLEQLRRLGVLYWKLDADKYENDPELEKIRRERNYSWMDIITICKDKLPNYEEKIKMFYEEHLHLDDEIRYILDGSGYFDVRDKEDQWIRIFMEKGDMVTLPAGIYHRFTVDEKNYTKAMRLFVGEPVWTAYNRPADHFEARGQYVKFLAQTM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human acireductone dioxygenase with iron ion and L-methionine in active center
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase
total genus 43
structure length 178
sequence length 178
ec nomenclature ec 1.13.11.54: Acireductone dioxygenase (Fe(2+)-requiring).
pdb deposition date 2014-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03079 ARD ARD/ARD' family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4qgnA00
1ZX5A 4IEQA 5BY5A 2OZ6A 2MHFA 2K0GA 1J59A 1O3RA 5I0UA 4R52A 1RC6A 4QX5A 4YYOA 4LTAA 2BNNA 2I45A 2PHDA 2B5HA 2H0VA 2GC3A 1FXZA 2VQAA 2Q4SA 3FHIB 1WA4A 4LA2A 4XEZA 3VHRA 1LB2A 1NE6A 4XFFA 5I0SA 5J48A 2GC0A 3BPZA 4D7TA 5LEJA 1UIJA 2QNKA 3LA2A 1JUHA 3EJKA 5HI0A 2ZKLA 3RYPA 3NW4A 1DGWA 3LA7A 5FLHA 3C3VA 4AVCA 4HSLA 2D93A 1O5UA 4I2OA 2OA2A 5KHJA 4HZFA 3E5UA 2B8MA 3MPBA 1SEFA 4MV2A 4IEXA 4XFIA 1VJ2A 2MPFA 1ZVFA 3ZDSA 3N4MA 1NE4A 4LULA 1CX4A 3OF1A 1PMIA 5BXXA 2QDRA 3D0SA 3IIAA 3RYRA 2BYVE 2PQQA 3KGLA 3SMHA 3JZVA 1ZZCA 3LZZA 3MZHA 4O9EA 1NYWA 5CU1A 3HIFA 3PLQA 4WBBA 3DL3A 4ZU4A 1X8MA 4PIZA 3ACLA 4XF1A 1QXRA 4I01A 5E1RA 3UKVA 5I8YA 4UBHA 4HSJA 4LEJA 2BNMA 2H6BA 3HT2A 2Q0AA 4N9HA 1RTVA 4AQ6A 2PAMA 3D82A 1J3PA 1CAXB 3O14A 4LLOA 3SXWA 5FPXA 1EYBA 2KXLA 5LRSA 2FQPA 2XLAA 3E6BA 4JTNA 4CYDA 1EP0A 3G7DA 3FX3A 1H1MA 2UYBA 4A2UA 1WGPA 4PIXA 4XF0A 2F4PA 3SCHA 4E2SA 4UXAA 1WLTA 3DKWA 3EBRA 4OLLA 3IDBB 4XF4A 2B9UA 5BV6A 4RD7A 3ES4A 4AVBA 1YFUA 4IESA 4Q0PA 3M3IA 2IXCA 4R8HA 4XETA 2UY9A 5FQ0B 4MGZE 2QVSB 1J1LA 2O8QA 2HJIA 1ZREA 4JTOA 1J3RA 4HVRA 5BUVA 2PFWA 3WW1A 2FMYA 3RYKA 2BEOA 2XHKA 1YHFA 5KHHA 5I0RA 3I59A 1O7FA 3E97A 2Q1ZB 2PAKA 1OMIA 2XL9A 3HQXA 4MGKE 1IPKA 4KWKA 3NL1A 3OTFA 2EVXA 1ZNPA 3LOIA 2PYTA 4IEVA 5I8TA 4JV4A 1O4TA 4PJYA 4E2GA 2GZWA 3R6SA 5D1IA 1RGSA 1DZRA 3OCPA 2ETEA 2OZJA 2P17A 4Z82A 4GULA 3IBMA 4X6RB 3E6CC 2OYZA 1CAUA 4LUKA 2N7GA 3KMHA 4QGMA 5KHIA 1ZZ9A 1TQ5A 2PHLA 5C6CA 2C0ZA 1XE7A 3WW4A 4EWAA 2O1QA 4META 1CAVA 3BU7A 3RZZA 3H7YA 3FE5A 5JR7B 1EPZA 4IEZA 3EO6A 4IERA 4XFHA 1CGPA 4HN1A 4HVQA 1UD1A 4QMAA 1CAWB 4QM8A 3PNAA 4EWEA 2D5FA 1Y9QA 3NKTA 3KGZA 1H1IA 1UCXA 4I3PA 2XKOA 3ES1A 3S0MA 1RL3A 3ROUA 3LWCA 2MNGA 1ZRCA 3KSCA 1RUOA 4YSFA 4L11A 4XFAA 1EY2A 4HLTA 2PA7A 3NJZA 4IEOA 1LKNA 3H7JA 5JAXA 4MH0E 5JSPA 1IPJA 4I09A 4ZU7A 4MX3A 3DV8A 4HN0A 2D40A 4MGIE 2VPVA 2ZCWA 1RUNA 4PIYA 2DCTA 4YARA 1FI2A 3EHKA 4F8AA 4AVAA 3EQEA 1ZZ8A 3E5XA 3GBFA 1ZZ6A 2GC1A 5I8SA 4QXKA 5CADA 2EA7A 3ST7A 4XFBA 3WW3A 2Y0OA 2GU9A 1ZRRA 3IDCB 3FZ3A 4IETA 2CGPA 3TNQA 3I54A 1V70A 3BB6A 5EZWA 4F7ZA 3DN7A 5J7MA 5FPZA 5C8WA 2BNOA 3OD0A 1DZTA 4Q29A 4H7LA 3H1MA 4OFGA 1I6XA 1Q5OA 1NXMA 4IEWA 3S7IA 5EFUA 3BALA 4P9GA 3CJXA 1YLLA 3RPQA 3TNPB 4HBNA 5I93A 5KHKA 4KU8A 5E16A 3S7EA 2ET1A 1GQHA 4IEYA 3UKTA 3CLPA 2WC2A 5T3NA 1YUDA 1QWRA 1DGRA 2ATFA 4JVAA 2V09A 4UBGA 4B29A 4KL1A 4QM9A 3GYDA 3SCGA 1VR3A 2HKXA 2EAAA 4J1WA 3QACA 5FDBA 1L3JA 1YFWA 3CEWA 2D5HA 3QOPA 4YNIA 1G6NA 4I0AA 3BCWA 2K9ZA 4NVPA 1J58A 4KU7A 3U10A 4X6QB 4BYYA 1ZZ7A 2H6CA 2XLGA 2Q30A 4MGYE 4LA3A 5J3UA 5I91A 4XF3A 5CVRA 3B02A 2E9QA 3LAGA 1U12A 3H1WA 4Q0VA 1UW8A 1O3QA 4ORFA 2WFPA 1CAXA 3L2HA 3NVCA 1ZZBA 1UIKA 3MDPA 1YFYA 4ZU5A 3FWEA 5FLJA 4AQ2A 5JSOA 5K8SA 4TLFA 5KHGA 1HW5A 2OPKA 4Q0SA 4XF9A 1SQ4A 1O5LA 2VECA 2IXHA 1OFNA 2IXLA 3IWZA 4FAGA 1J3QA 3SCFA 4LUMA 3RDIA 5JCTA 3H3UA 4IEPA 3USSA 5AVPA 5FQ0A 2IXKA 4MUVA 3PVBB 4DINB 3U0ZA 5F1RA 1PM7A 2Z2SB 4HMZA 1X8EA 2UY8A 4E2QA 1XRUA 3I59B 3D0JA 3LA3A 4L2NA 1UPIA 1GQGA 3CL1A 4QGLA 2GH2A 3MYXA 2CAVA 4KWJA 5LRRA 3U11A 2ET7A 4FAHA 1FT9A 4I02A 3E5QA 1VP6A 1ZRFA 3FFQA 2BGCA 4FT8A 1O3TA 3OGJA 4MZUA 2CV6A 3M70A 1YFXA 2XLFA 1I5ZA 1CAUB 5KBFA 4O9GA 1X7NA 3H9AA 3CO2A 4D7SA 3WW2A 2GAUA 1QXJA 4XFGA 4ONUA 1QY4A 5FCCA 2XL7A 1CAVB 4N9IA 3H50A 4BHPA 3H8UA 3ELNA 2IXJA 1ZRDA 3HT1A 2IC1A 5I0TA 4KWLA 3CF6E 3RNSA 2XKPA 3UKNA 1CAWA 4WZCA 1XE8A 4WVZA 3H3ZA 5BPXA 1Q43A 5JSRA 4K8FA 1YWKA 4EV0A 4Z07A 1SFNA 4J1XA 2GC2A 2Z69A 1Q3EA 1LR5A 1NZCA 2CAUA 5FLIA 3H1YA 4BH9A 2IXIA 5LEKA 2XGXA 1X82A 3KCCA 4FBFA 2QJVA 4EROA 2QCSB 1OI6A 3NSTA 3I7DA 4Q0QA 4AXOA 1Y3TA 3SHRA 2UYAA 4EWDA 4Q0UA 4IEUA 4YRDA 2PTMA 3FJSA 4BIFA 3E6DA 1LRHA 1OD5A 4QGNA 3ETQA 4I0BA 4HVOA 1O3SA 2PAEA 4XFCA
chains in the Genus database with same CATH superfamily
5IAVA 3B94A 5GZGA 1F35A 3AP5A 4XXPA 2OZ6A 3UJOA 3VBOB 1U5YA 1XC6A 5M0TA 5FXVA 2K0GA 3OGSA 5B4XA 1MQTC 3WQ0A 3T1LA 1W6MB 1O3RA 1JZ5A 1US2A 4JX0A 4LTAA 1AX0A 2WQZC 1B35B 2B5HA 1QJEA 1FXZA 5H9PA 4QPIC 3WQ7A 3FHIB 1RUG3 2L9LA 3VHRA 1LB2A 4AGGA 3AK0A 3GBGA 4XFFA 4HKOA 2GC0A 4BQ5A 2DV9A 3BPZA 2RDQA 4YW7A 1H2MA 5CFDB 4KWUA 1UIJA 2QNKA 1QMJA 3ZFGC 2JG9A 3GZTB 4TLGA 4LHSA 5I0DA 5L9RA 4KBZA 1OPOA 1DGWA 2XJSA 4AK3A 1POV0 1V0AA 3VZNA 5JR2A 3QCWA 4FTBA 2VTXJ 3WNLA 4AAPA 1Y7BA 3VZLA 3OB8A 1O5UA 3UV9A 5JDBA 2P4EA 3WF2A 2OA2A 5KHJA 1MZ6A 3SEEA 4AI2A 3IM0A 1R081 4IV3C 5DPNA 4UFJA 1ZVFA 1OF3A 3CJIB 4BMBA 5HCFA 5IVCA 1Q56A 4BE3A 3VBSA 1NE4A 3AP6A 4YPJA 4LULA 2HWB2 2Q8CA 2WNUC 4P9LA 5K0UB 4MGTA 4HONA 4D6QA 3U75A 4RYDA 3AKQA 3N9LA 1PMIA 3BI3A 5GLZA 2QDRA 2DCJA 2J1AA 1LNSA 2BYVE 3FN9A 4Y1ZA 3GCWA 1PGSA 2VMEA 5CFCC 3JZVA 3NV4A 5F6LB 2W5FA 5K9YA 5CU1A 4P00B 1AF9A 1VB2A 3LQCA 1HB1A 3WNKA 3PMEA 4LKFA 4Q4V2 1KXGA 4SBVA 1RUC1 3I3BA 1EV13 1SPPA 5F2SA 1QXRA 2JWPA 3I2GA 5E1RA 2EXIA 4XVHA 4Y24A 1AVBA 3EXUA 1GZ9A 3ZFEB 2WWUA 5F8PA 2VZUA 3ZOIA 1FMD2 2PAMA 5DUUA 1QGLA 3D82A 2AH2A 3ZYJB 5HV4A 1BJQA 1J3PA 5D2AA 3SXWA 5FPXA 5TSWA 1N3OA 2ADEA 2WS92 5LRSA 2BW8A 2FQPA 2PHTA 3E6BA 5DN2A 4CYDA 1EP0A 1N1SA 3G7DA 4DUXA 1H1MA 1RUF1 2ENRA 2UYBA 1HB4A 2X8KA 4FPGA 4MVTA 1XE0A 2AEYA 1ODMA 4XF0A 2F4PA 5FPAA 3VBFA 1JH5A 3RZLA 1JOJA 2QQOA 4YGBA 2VQTA 4CUAA 5F3GA 1WD3A 4WVMB 4AAXA 2HYXA 3ZFGA 4RD7A 2JG9C 3OGGA 5IFTA 3R4DB 3ES4A 1YFUA 4ZXKA 4CXXA 4CXYA 1RUJ1 2VL4A 2J22A 1HJFA 4Y4YA 1NA1C 4E27A 4IESA 1JZ3A 4GWJA 2AGSA 3M3IA 1H8VA 4R8HA 3BN6A 2A73B 2UY9A 4MGZE 1ND2A 1MS0A 2QVSB 3AMQA 5C9AB 3BIEA 4WM7A 2IFRA 2VUAA 3NAPB 4LBMA 5E88A 3GBWA 4BQ4A 4XJ8A 4JTOA 2VG9A 3AKSA 1D7PM 2FMYA 4XUTA 3RYKA 2HWC1 2XHKA 1SFYA 1UOGA 2XDVA 4AEMA 2E33A 2JD9A 1UL9A 2V73A 2P3YA 3E97A 2PHWA 2QFEA 4NROA 2VMGA 2KM2A 3MIHA 5T5JA 4XAAA 4A44A 4B8EA 2PAKA 4JGZB 4LJHA 4X8PA 3WDTA 4PDWB 1WD4A 1PNFA 1GP5A 1IG3A 3NL1A 4DFSA 1OH3A 1QJU3 1X50A 1ZNPA 1RYYA 2R6QA 4JV4A 4RQPC 5SV5A 1O4TA 4PJYA 1JMUB 4N53B 3R6SA 3THTA 1WUVA 3HBZA 5C33A 1PX4A 5JZGC 1DYKA 1DZRA 4AGVA 2E31A 4EN8B 2SBAA 2CGOA 4CEYB 2WYFA 2H0BA 5CA6A 1W8TA 4Q1RA 4GMP0 4X6RB 3E6CC 1E5IA 1QJX3 3I2FA 4HXCA 4CUCA 5GLWA 4WZFA 5FZFA 4LUKA 4DQAA 2DU1A 1MS4A 1B09A 5KHIA 3RVHA 1ZZ9A 3CZJA 1CIYA 4AI8A 1XSQA 3V65A 3WP4A 5JUVA 3OJBA 1XNAA 4AFDA 2CU5A 5FZOA 3MIFA 5CKMA 4FTSA 3WDUA 4EWAA 1Y4WA 5CKNA 1VE0A 3VDAA 2ZS6B 1WBFA 1CAVA 3BU7A 4META 3U4XA 3FE5A 4QPIB 5JR7B 1EPZA 1ENRA 1WW5A 2J1UA 3AZXA 3WG2A 4ES9A 4MO3M 2D3PA 4M01A 4IERA 3MBWA 3IAQA 4XFHA 2WWSA 5FXXA 1JZ8A 4RS5B 4WVWA 2C6SA 2QQUA 1V9U3 2WABA 5FYZA 4D3WA 3D6EA 2GP5A 5FZ7A 5IYYA 3VBHA 3WF1A 4OULA 5FY8A 3URFA 4Q4V1 1GP4A 4CDXC 3PNAA 3ASIA 1NA1A 5FO7B 2ARBA 2D5FA 2W47A 1LULA 2BGPA 3NKTA 4JRAA 2Y6KA 1HKDA 4HT1T 2TEPA 4Y5TA 2AYHA 2RS51 1GYKA 2DF7A 3I97A 5H9RA 1MVEA 4CTEA 2QQVA 5GJ6A 1XBFA 2RS12 5KC6A 1LJ7A 3ZYFA 1QDCA 1SBFA 3OBTA 3H8OA 3W58A 4AFBA 1RUOA 1S1AA 2Z5WA 1S2BA 2DCZA 5FYUA 2OKXA 1REEA 4HLTA 5L73A 3ZXKA 4MHRA 4RR3B 4IEOA 5FZ4A 5A33A 2WNUB 1YIPA 2DFBA 5C70A 5JSPA 3IAPA 3IPVB 3ZSJA 4XHXA 2JG8B 4CCDA 1H2LA 3MGUA 4HN0A 2VPVA 1LOFC 2ZCWA 3J7HA 2WRAA 5KXCA 1RUNA 1V6NA 1LHVA 3O7OA 3BKZA 2WIIB 3VZKA 3T09A 4NUBA 2ZJCA 4YARA 3EHKA 4LKDA 4F8AA 4B4QA 5CB7A 2WFF2 3JD72 1QQP1 1D4M2 2YXSA 3FUOA 5I8SA 1AR62 1HIXA 3T2OA 2ZGRA 1UQXA 5LWBA 4RGGA 2CSGA 4QD2A 3VBOA 4XFBA 1ULCA 2Y6FA 4OI2A 4WVVA 1MS3A 2Y0OA 2ZEWA 3BTXA 1FNYA 5DAPA 1F4HA 3CJIC 3FZ3A 3MFCA 3POYA 1KJLA 2VZ3A 4IETA 3QLQA 4S2HA 4YW1A 5CKQA 2GDFA 3RZMA 2QQKA 1B35A 3I2KA 4SLIA 5FR3A 5K0UC 1BKZA 2FCVA 3AZZA 4Y26A 1JHJA 2GNBA 1WZXA 3L2YA 1HRV2 1OVPA 3GZEA 5C8WA 2CWSA 1NQDA 2ADDA 1ULOA 3ZSKA 2XWBB 1SG3A 3N9PA 4U36A 1DZTA 3ZIXA 4KMQA 4YWAA 5DZEA 2VZOA 3Q8AA 4YVWC 1UO9A 2JG9B 5LK5A 1CN1A 3PTRB 3IIIA 3BALA 5EFUA 2VC9A 4K9SA 2OT7A 1C28A 4M3CF 5KXBA 5FZ6A 4MXVA 5F5QA 4HBNA 4KH9A 1PIV3 3VV1A 1HRI3 5IWFA 1R093 4JZRA 1OA3A 3T2QA 1XNCA 5JOZA 1QF3A 3CLPA 1ASJ3 2WFF1 1COV1 3AZVA 1YUDA 2OW4A 2ATFA 3T08A 4EN7B 3B69A 1LGCA 4B29A 4KL1A 1UZZA 3GYDA 5FAXA 3OOXA 2R0HA 2TNFA 3T30A 4PQQA 3GZUC 2W3JA 1JODA 3VBSB 1PVXA 3LDBA 4OVEA 3QACA 4W65A 4JGZC 1F2NA 4OUMA 4CU6A 1YFWA 3OUIA 1ZBA3 2VNOA 4GIQA 2ARCA 3BCWA 2JB4A 2K9ZA 3WD5A 2G4IA 1LOFA 3OPWA 1AX2A 1AL22 2RS33 1PO13 1OA4A 2P34A 2F6BA 2ZZJA 3KF3A 2JDHA 4FPKA 3USUA 1YQ6A 1EV11 1OSGA 2Q30A 4FFHA 2WWJA 4XIKA 1ULPA 2VO5A 5APAA 5J3UA 3LF7A 3HN3A 4J6GA 5A7WA 1LGBA 4V2VA 3FHQA 1JU4A 1O4YA 4PBOA 1WCUA 2JEMA 2VNGA 2YC4A 1S55A 3D8CA 1U12A 3LAGA 2RS13 1F8VA 2XJVA 1ZBE2 3ZXAC 2VR4A 1YRZA 4FOVA 5ANQA 1JZ4A 3VD7A 2A75A 2WNVC 4D94A 4BZ4A 3VD9A 3L2HA 3UGHA 4XE9A 5L7OC 5EYXA 3D4KA 3M3CA 5K8SA 3U07A 3W20A 1H4GA 4MLOA 1QOTA 3J8F3 3JB8A 3FLTA 1GR3A 4JHTA 3LDRA 4D6RA 4RN5A 3JB4C 2ZAHA 5JPMB 4PLOA 5C3SA 2P3JA 2IXHA 2ZA9A 3VBUB 3KQ4B 2C1FA 1Z7S1 2PXJA 4N53C 2BU9A 2ORZA 4WVMA 3DECA 2OX0A 4LO4B 3ZFGB 4FAGA 2A6VA 1XXNA 2ZGKA 1WKYA 3EB7A 2XOMA 1NAEA 3NJVA 3AP4A 4HPKA 2ZX4A 3H3UA 4LUMA 3THDA 4IEPA 4DRRA 4MADA 5GZDA 2GH8A 3SKJE 4B1LA 4QX8A 1HRI2 5FJHA 3B9IA 5FQ0A 1ND2B 3HNYM 4XACA 1J1TA 3JCIA 4ZS2A 4WM7B 4ARYA 3KM5A 4Q4Y1 4DINB 2JX9A 1AJOA 2E26A 3NAPA 4JDOA 3U0ZA 5K7PA 4XABA 1X8EA 1UX6A 3HAGA 1RUF3 3AYAA 1DLCA 1K3IA 4FFGA 1QJX2 1GLHA 4E2QA 1UYYA 2JDYA 3NQHA 4M00A 2QQMA 3LA3A 4JGZA 4Y5SA 3WZ1A 1LOCA 3NMBA 3BTAA 1UPIA 4PDWA 1H2NA 5AC92 4QB1A 1LECA 1S4CA 2RVAA 5B2GB 4N8MA 3APBA 4EE2A 3T2PA 4Y1UA 5LRRA 2ET7A 2YPDA 4FAHA 4XBQA 2YHJA 2X5IC 2ZMKA 4S2FA 4IUGA 5J36A 2YG0A 3U14A 3NNJA 3ZXFA 1DLLA 4FO9A 4IXLA 2XB6C 2XPJA 4AI9A 4CEYA 2OUJA 1LTEA 1OPMA 2BGCA 2CGNA 2Y0IA 2AR6A 1APNA 1TMF3 2JENA 3OGJA 1BBT2 2JECA 4XCAA 3R4UA 5FYYA 4N90A 1YFXA 4DNYA 5CYYA 3LSDA 2WFF3 2Y26A 1GOHA 5KBFA 3KT7A 3LFIA 4QQLA 4LXLA 2D3SA 2EIEA 1H8TC 3P6BA 1VMFA 2ZZQA 4FPOB 2W87A 3ON7A 2WO7A 3WDWA 1AX1A 4QXCA 5LB6A 1NUKA 5FPBA 1QXJA 4XFGA 4LQRA 2XBO1 2FCTA 5FZMA 1F9KA 4BQ2A 4HKLA 3LKJA 4HK9A 2DUQA 2R042 5ACA3 3AMMA 1CAVB 5CAZA 2GMPA 4DMIA 3VD5A 1UYXA 3IDAA 1CJPA 2FZ2A 2IC1A 3S5QA 4RS5A 1VBB1 2NPIA 1BVP1 3HWJA 4CUGA 4XCBA 1LU2A 3AKTA 4QQOA 2YB7A 3H3ZA 1OLQA 1HN1A 3IMMA 5BPXA 4Q8KA 2GP3A 3GGLA 2EALA 3EYPA 2RDNA 3AVRA 4K8FA 3VL8A 1U5XA 4J1XA 4AE2A 1GBGA 1T2XA 3PIGA 1QIQA 1LR5A 2CAUA 3RRDA 1IS4A 1DQ1A 3AB0A 1UY3A 2C4XA 4BIOA 2B45X 3BVCA 4B4RA 4WM8B 4AHYA 1AR82 1MZ5A 3POIA 2E7AA 4M3CE 3VZMA 5CISA 1UY4A 1YO8A 1U5ZA 2RE9A 3LDKA 1UKRA 4RR3A 3WF3A 1VPHA 2YC2A 5DQ0A 3KCCA 4FBFA 1IZ3A 4MG2A 4EROA 5FMDA 2QCSB 1TME1 5IK4A 4AXOA 1FOD3 1RMU3 1Y3TA 3SHRA 4Q1PA 5ANNA 4EWDA 3GNEA 4NRQA 4Q0UA 1RUJ3 5FTTC 5A3PA 1L7LA 3BODA 1W39A 2J42A 4IGOA 4BQWA 1A78A 5A3LA 2HWE1 1LRHA 4DB5A 5C5TA 5JXHA 3BYWA 2UWBA 4QX1A 1QHDA 4BLJA 3VDBA 1GANA 4WV8A 3LSEA 3PUHA 4OHWA 1LENA 3G6JB 5HV0A 2VUDA 1T6BX 2G9ZA 1ENXA 3DPRC 4P02B 1J59A 1H6YA 4R52A 1IQAA 1O8SA 1V6MA 2D97A 4GQ7A 3DKQA 1R1A3 2D98A 1SBEA 2W52A 2R49A 3IT8A 2I45A 2ZGSA 2PHDA 4RFT0 3W5NA 2GC3A 3B5LB 2VQAA 3RSJA 3K3NA 1WA4A 4IL7A 2XR4A 2DURA 1LEMA 2RM21 1MACA 1JYCA 1AUYA 5LBBA 4I3GA 4PI2A 2D3RA 2FZ1A 3LA2A 3C7FA 2BZDA 3QD6A 3CKHA 3EJKA 5HI0A 3RYPA 1Q8SA 3NW4A 2ZX0A 5BNOA 5F7UA 4FPFA 1H0BA 4PT6A 4QX2A 5JOWA 5L9BA 1GUIA 4HSLA 2D93A 1UY2A 2D7FA 3DYOA 5FZ9A 3MPBA 4EJRA 1SEFA 3KB5A 3VZJA 1CESA 1V6KA 2RG4A 1UKGA 2MPFA 2A5ZA 3POJA 1WMFA 1DYPA 1W9YA 5IVFA 3ZDSA 2OS2A 4TTGA 3N4MA 4GAZA 2YFZA 4XMAA 4OUSA 1CX4A 1UXZA 4YW5A 3OF1A 2YDEA 3POBA 2V5YA 5LBEA 4NHXA 4CDQB 1HV0A 3D0SA 4PLNA 4XURA 1STMA 4OZOA 2NP0A 2V4AA 3KVAA 1W99A 3K46A 3SMHA 3HPNA 5D8AA 3LZZA 2ZHMA 4DY5A 1K5MA 3T2TA 3MZHA 4O9EA 1FMD3 3HIFA 1XQNA 5FWEA 3USUB 4DIQA 5C9AC 3E1F1 1X9PA 4CCLA 3W9AA 3J8F1 3S5AA 4BDVB 1JW6A 3DL3A 3J9SA 5A6QA 1GNHA 1W8UA 5A7WB 4GXLA 5EPAA 2LM3A 2YFUA 3JBG1 3P1IA 1G9FA 1MR5A 2RJKA 4LEJA 2RR11 3VKNA 1SHWB 4AHZA 2LW8A 3QBQA 4NIHA 3O1TA 4NIGA 1G8WA 1EPWA 5A7PA 1CAXB 4LLOA 5A1AA 5EJ3A 3ZYHA 2HWF1 1AR91 3ZKUA 2KXLA 2ZACA 4JTNA 1MZFA 3V0AB 1ZA7A 4AI3A 1DQ2A 3K75B 3BGAA 2EXKA 4LKEA 4PIXA 4XOGA 3U1XA 3ABZA 2LRPA 3SCHA 1E5HA 1LGNA 1PO11 1RIRA 1RITA 2VOTA 3C8XA 4UXAA 4XDOA 2D6MA 3TOJA 3WG3A 2JB8A 3MLLA 3VBUA 3W5MA 2FDKA 1YI7A 1QU0A 1WLWA 3POWA 4XF4A 4CUBA 5BNPB 3ZN4A 4RGAA 4E2SA 1RUH1 3IN9A 2WNEA 1ZBA1 2ZTNA 1RINA 2WO1A 3PU3A 4HPKB 4F83A 1QJY3 3A21A 1N1VA 4Q27A 1W0PA 2X53S 4RHV3 1NLQA 1PGW1 2ZHLA 2OVUA 2OPWA 3CBNA 5FQ0B 4OHZA 4DUVA 1G9AA 3T0DA 1J1LA 1W90A 2DFCA 4RL7A 1S0BA 2HJIA 1CR7A 1OOPB 2RR12 5BUVA 2VBPA 2Y6GA 1K42A 3N7LA 4UFHA 2PHUA 1O7FA 1WWYA 3T0AA 2EIGA 5FYIA 1AXKA 1UU4A 1OMIA 1XYPA 3MW4A 4NIAA 2FHRA 2P1BA 2RS11 4JKLA 4KWKA 3SC7X 4CDXB 5DZGA 3IKWA 3P3PA 2X09A 4XPVA 4QPWA 1Z78A 3LOIA 3JBG3 2PYTA 3F2ZA 4QKDA 3I8TA 3WSOA 4G4FA 1HXS3 2GNMA 1FAYA 1O91A 1O8PA 5D1IA 3M2MA 3OCPA 2QTWB 2WN3A 2OZJA 4JKKA 2IZWA 1LHNA 1QNYA 4Q4W1 2XUMA 1OF4A 2CL2A 4YW3A 4KNCA 2DVBA 1CZVA 1UMZA 5G05L 1RUF2 4NO4A 2N7GA 3KMHA 4QGMA 1W8ZA 4LNVA 2R063 3CDZB 1KDKA 4C0HA 1PMHX 3VL9A 5F3IA 4IGPA 2WLQA 1GWKA 2BJSA 2HWC3 2PMWB 2NMNA 3MIGA 4EN0A 1S0DA 2PHLA 4BLIA 3NWKA 2D43A 1JXNA 2I74A 3M8LA 1HB2A 5LK7B 3WW4A 3THPA 3ZFFC 5LA9A 1KJRA 4KGGA 4CXWA 3SKVA 3H7YA 1XNKA 5FZ0A 4URAA 3Q8BA 4DY3A 3VDDC 1ZBE1 1CGPA 1A8MA 2JICA 5FZBA 2VCMA 2ZX2A 3DF0A 4ARXA 1W28A 1MZEA 1UD1A 3TN91 4BPZA 1GMMA 3I2DA 4COYA 4QM8A 2QE3A 2RS53 3MW2A 3KHCA 1LHUA 3LGRA 3AMHA 4Q4X2 3KGZA 4L92A 3N7MA 1C8M2 2VMDA 2XQXA 4I3PA 2XQRA 4BM8A 5CFDC 2I2SA 4Y1VA 3S0MA 4COUA 1PVC1 2R30A 4D7YA 2MNGA 4NHMA 5EXOA 4YVSC 1W3VA 2LROA 3I3QA 4YSFA 3UNPA 4IE4A 4WM8A 4Y22A 3AM2A 5DUWA 1B35C 1VBA3 1NLRA 2PA7A 2LUWA 4LBKA 1KITA 3I3EA 3H7JA 1TME3 1H9PA 1MS9A 2A3XA 1PGL1 3ZSMA 4MH0E 3B01A 1LAJA 4DEQA 2R043 2RS32 3AXEA 4C91A 1IPJA 4ZU7A 1GKBA 4L97A 1TVGA 4MX3A 4YZ3A 4YW6A 2D40A 5A32B 3NJYA 4AQSA 1R64A 2LS6A 5JIUA 5DAQA 5FRAA 2R073 3O1VA 4UW3A 1ZBA2 4IE5A 4W6WA 2R1BA 3ZXJA 5DXDA 4DUWA 5FOBB 2Q5TA 1Z0HA 3LEMA 5IVBA 1FI2A 4C8DA 1X36A 4FPYA 3KT4A 5K4LA 2W94A 1FPN3 4P5YA 3AZYA 3OSDA 3WF0A 1JI6A 1Q8QA 1SDWA 2WZR2 2WUHA 5GLUA 1TMF2 1VRH1 2EA7A 2JDUA 4XTMA 5JIAA 1D2QA 1S2EA 3ST7A 3WW3A 1JU3A 3JD73 5IHRA 3AKPA 1A8DA 3M3QA 2GU9A 1GOGA 4YM1A 1HV1A 5E6HA 1R092 5F3CA 4LBQB 4FVVA 1QQP2 4BK4A 1IS6A 5FYTA 2WZPP 3TNQA 1CD3G 1JHNA 3MEPA 3BB6A 5IFPA 2DTWA 1DHKB 1EAH2 3ZFFA 1NT0A 3V0BA 3S57A 3RWNA 2VMIA 2WDBA 4CDWB 1W8WA 2VJXA 5FPZA 5FK8A 4Q26A 1OKOA 4Y20B 1RHI2 3HMYA 3TRSB 4Q29A 3N3HA 2HWD3 4E9KA 1JS9A 2E32A 5E89A 4LBOA 1Q5OA 1NXMA 1CQ9A 1GZWB 4OHYA 4P9XA 5T54A 1TNRA 1MPXA 1D2SA 4OQ8A 1ENSA 5BNOB 2ZX1A 3AP9A 1QQP3 5FP9A 2WNVB 5A7SA 5I93A 1T6GC 4KU8A 2VQUA 5E16A 1D4VB 3WXPA 2MEV2 1G9DA 1GQHA 4IEYA 1GNYA 4OI4A 2DVGA 4E4HA 1IGOA 2WC2A 2BTVC 3VKFC 3ZMOA 3MV11 4JVAA 4UOJA 3SH3A 1D4M3 1WW7A 1LOEA 1ND3C 4JDNA 1V6LA 4QXHA 2Q8EA 3VBFC 3SCGA 5FY5A 2BUKA 4OHXA 2HKXA 1L7RA 1F31A 1PX3A 1UXXX 1GZCA 3AMNA 2JE7A 5FDBA 5LY2A 4YNIA 4AWDA 3QOPA 1DZQA 2PHFA 3DGTA 4I0AA 3ZSLA 3AMPA 3VKOA 2FDJA 2RMU2 2VQ0A 4FFIA 3X29B 4CDQA 1QJX1 1J58A 2E53A 4NVPA 5L36A 3T4HB 4R4XA 1URXA 4CP9A 1TG7A 3MPPG 5D8AB 1K5MB 1OXCA 1ASJ2 3ETPA 4N7UA 1H6XA 1XNTA 2XLGA 3MIDA 5AC91 1W0OA 1VBA2 4LA3A 1MQTB 1UPSA 3ZXEA 2DVFA 4EN9B 2DUPA 5I91A 1QJU1 3GHNA 1BMV1 3CQOA 1FX5A 5IK5A 1G9CA 2WL1A 5IVYA 2X10A 3NAPC 1M06G 4Q0VA 4HOOA 2HWD2 1BMV2 3OPZA 4QB6A 2HBTA 3WUDA 1CAXA 5GLVA 3VBRB 1UIKA 1QH6A 3MDPA 2CDPA 2Q1MA 4Q4X3 4ZU5A 3FWEA 2JDPA 4E4DX 3V0AA 3ATGA 5FLJA 4AQ2A 1UNBA 5KHGA 4LPLA 2RMU3 5FY9A 1JTZX 3BTYA 3ZYPA 2BVBA 1WW6A 2OPKA 4L9BA 5FZLA 3IDEA 4UW5A 4Y3OA 2HWF2 3WX5A 1ONAA 3N9NA 2VECA 2WKKA 3NNFA 5FUPA 3RWKX 2XVLA 5BNPA 3D5OA 1DQ4A 1POQA 1YXWA 1QJY1 3AYEA 4ZONA 5GLTA 1AR63 3SCFA 4ASMB 4RHV1 1VBC2 1C8M1 1VLNA 3VKMA 3NJXA 1BK1A 2ZHNA 4HL0A 2G1MA 1SLLA 2MEV3 1CZSA 3OD4A 4IE7A 2C26A 1AR61 2VZVA 2ZHKA 4XUQA 2IXKA 3WY6A 4D69A 3JD71 4DXSA 3PVBB 3P3NA 1HLCA 1OOPA 3RFRA 2R32A 1NG0A 4RHV2 5A3TA 5F1RA 5GM0A 4DS0A 1UZWA 4QDQA 4HMZA 2A70A 4LO6B 3A23A 4YGDA 5EWSA 1XJAA 3TEYA 3PDQA 2XVKA 2WBKA 2R7EB 1BLZA 1JYXA 5KXDA 2XHNA 1GQGA 1UF2C 2ID4A 2LTNA 3CL1A 4QGLA 3VBHC 1O3TA 4CDXA 3D3AA 1REDA 4KWJA 4IV1C 2EIDA 3HOBA 3U11A 3JBG2 2WO2A 4LMFA 1CX1A 3AYCA 2BQPA 3B9CA 3ZXGA 3RQ0A 3ZM8A 2WS93 1VP6A 4A6OA 2V4VA 1SLIA 4XILA 3FFQA 2AUYA 4FT8A 2VMHA 5EYYA 4W50A 5JXJA 2JG8C 4MZUA 2CV6A 4XAEA 5F39A 5CG8A 2XLFA 5FYSA 3GCXA 1I5ZA 1CAUB 1C1LA 1RUI1 4LO7A 3WHTA 4CDUA 4AI1A 2UURA 3FUQA 4QB2A 4FXKB 3AL6A 2VZSA 3I2OA 2HEWF 2OXBA 5LA0A 1COV2 4D7SA 3WW2A 1VALA 3WP6A 4Z8BA 3UESA 4QXBA 1DIWA 4AVVA 2AREA 5A80A 3CU7A 4PF5A 2QQPA 5HCHA 2PLV2 3T3YA 1YQ8A 1HRV1 2ZOEB 1NKGA 3KCYA 1PZ7A 1QY4A 4YM3A 5FCCA 1NQJA 2PHRA 1KRIA 3NRUA 2NMOA 1OC1A 2A6WA 2J1VA 2B42B 1V6IA 2KD7A 2MEV1 1JN2P 2Y38A 3GF6A 3H8UA 4GD4A 4BHPA 4G9SB 3ALQA 2W95A 1PZ9A 4KWLA 3RNSA 4FTEA 2XKPA 1R1A1 4Y4RA 1AR92 2R062 1DDLA 4N43A 1PZ8A 1XE8A 3SITA 4LR4A 3BPSA 2W1UA 3LPGA 2JIGA 3O12A 1YCIA 3T4VA 2J7MA 4AFCA 3H8RA 5JSRA 4DOUA 3VD3A 2TBVA 2EXHA 4Z07A 5FYBA 4XIOA 2W0XA 4NHKA 3T1MA 3ZPOA 5LA2A 1MEC1 2HH9A 3DCQA 1GV9A 4Q4X1 3H1YA 1WCQA 1OHFA 4UT5A 3ACIA 5J1XA 4YFZA 4Y22B 4CZSA 3FFZA 1W9FA 2ZX3A 2XGXA 4YVWA 4BQ1A 1C4RA 5C3PA 2WT0A 4OUEA 2YBKA 1R082 4A6SA 1ODNA 4Q0QA 5A32A 5A6XA 2UYAA 4O65A 4XZPA 4INDA 2X05A 2P6HA 3KCXA 2JDNA 3O0VA 4BISA 1ZM1A 1UMIA 2E7TA 4DPNA 5A6ZA 2QQNA 3FJSA 3PHMA 4Q2FA 4YG0A 3M1HA 4XQ4A 5A6YA 5JMOA 1JYWA 1SLBA 2XWJB 4QX7A 1AYN3 3RS6A 2GN7A 2R1DA 5ABJC 3N9OA 3AJYA 3RI9A 3ZXLA 3RZJA 2BFUL 1H9WA 2WSUA 1UOFA 4A3XA 1GOFA 1RXGA 1VAKA 4IEQA 5F6KA 4NIDA 4BQXA 2VOKA 1SCRA 5FPUA 2YU1A 3C7GA 1CWPA 2XJTA 1H4HA 5I0UA 3HQRA 2WQ8A 5FPLA 1W03A 1RC6A 1OQ1A 4LBQA 1RUC2 3RJ2X 4Q4W2 1VRH2 3AP7A 3VBRC 4ZS3A 2A1XA 3A7QA 5L9VA 3PMSA 2XMLA 4OZXA 3ZFFB 3V0BB 3MICA 2XBO2 4OI0A 4CDWA 5IATA 1FOD1 1BXHA 1RMU1 2NQYA 2P3KA 4IDZA 4AEKA 1PGL2 4LIUA 5DDJ2 4JGYA 1WMXA 1XPWA 4UWDA 1NE6A 4Y20A 5L7OB 5J48A 2E63A 5D8AC 5DG2A 3A0KA 3J7LA 3JU9A 4JHZA 2XBO3 4V2WA 3KHBA 3MW3A 1XNBA 1JUHA 1CIWA 3ZX7A 1GZWA 4F3JA 1LODA 2ZKLA 2AZ5A 5IUQA 5IVEA 5J96B 1F4AA 2JIJA 4V1PA 4FI9A 3SEPA 2VAUA 3U37A 2WNVA 5FP7A 2BPA2 3C3VA 1OQEA 4PI0A 4AVCA 5FUNA 4NRMA 1POV3 4I2OA 1BYHA 1J83A 1BQPA 4YM0A 4HZFA 3WR0A 3E5UA 4P9WA 2B8MA 3C7OA 5FREA 5FZDA 4QAWA 3HQUA 3M4FA 1ZA4A 5ERLA 4A7ZA 4MV2A 1TE1B 4XFIA 3VN4A 3MF6A 1S0JA 3GM8A 5ACA1 3OBZA 1AYN2 1DP0A 4DXRA 3WP3A 1W6QA 3DUIA 3VZOA 2DCKA 4CPBA 1D0GA 1MS1A 2VZTA 3ACFA 3GXUA 1E5RA 4BQYA 2ORXA 3GZAA 4Z1VA 5FV3A 4XQWA 2VZPA 3RYRA 1VBB3 4MXWA 5ACA2 4CP9B 1ZZCA 1TMF1 1NYWA 2JDAA 4JQTA 5AVAA 4TSVA 5JXGA 3OYWA 1MQTA 3OBAA 2NYYA 4XF1A 3UKVA 1C3HA 2OQ7A 4TN7A 1UN1A 1EUUA 5I8YA 3ILNA 4D0QA 4DXZA 1FNZA 5LW9A 2BNMA 3S30A 4N9HA 3HT2A 4XJAA 3GJBA 3WUCA 4I0WB 3WNOA 4HG6B 3SQOA 1UU6A 1QOSA 3W21A 3F95A 4XBNA 3WNPA 3VBRA 1GICA 3M7AA 1HQLA 1VIWB 1DGLA 4NN0A 4BWOA 2XLAA 1JBCA 5FK7A 3FX3A 2P37A 3VLBB 3BOPA 5GALA 3W59A 4R9AA 1K12A 1VBE1 3LFMA 5JPNB 1VAVA 4LK7A 4A2UA 1WGPA 1WCKA 2PHXA 1S0EA 4CDWC 4BOWA 2HWB3 1OT5A 1RUC3 3FL7A 5HBAA 3Q9OA 4JGYC 2Z42A 1WLTA 5IT6A 2WINB 3AKRA 5F3EA 3ZDVA 3EBRA 1QH7A 5FYMA 2VH9A 4OLLA 3IDBB 1NCRB 3O0WA 5FYCA 5BV6A 3WQ1A 1DFQA 2AEZA 1YQ2A 4AVBA 4M3CA 4K40A 2Y60A 4RFRB 3JQWA 3LCPA 2CYFA 1HQWA 2BBVA 1E5SA 1SDDB 1H1AA 1Z7S2 5CFCB 1GQPA 4QX0A 2F4LA 3R0RA 3TWIA 5E8AA 3VBSC 1VBC1 3HBKA 2IUWA 2CY6A 1ZREA 4NMIA 2ZEXA 2W1WA 5ISLA 1J3RA 3WW1A 1QJFA 1AHSA 1VBC3 1YHFA 4GWIA 5I0RA 2B39A 3KZ4C 3OBRA 4GB31 4EN6B 1S0CA 3H3LA 3P5BA 4FP2A 5DDJ3 3POEA 3VB9A 3MFAA 1Y43B 3HQXA 4AHWA 1KEXA 4ES8A 1IPKA 2ARAA 3A22A 1RVF2 2JD4A 4Q4W3 5EJ1B 4NPMA 2GZWA 2P2KA 4E8DA 5C71A 2VD7A 4Y1XA 2ETEA 4CRQA 1H2KA 2ZEZA 3LEIA 4TXWA 3DXTA 5HXVA 1RXFA 4JKMA 4NWWA 4GULA 4UI9L 1VBD1 3IBMA 4QPYA 1RVF1 2CNAA 1RB8G 1RJ8A 1ZBE3 1CAUA 5C8CC 5BYNA 4CDUB 3PU8A 4GMP3 1W9SA 3I2JA 4RR3C 2W39A 3B3QE 3ZO0B 4IE0A 1BZWA 5JWPA 5CIRA 3N36A 1LOAA 2QKDA 5C6CA 2C0ZA 2A71A 5DUVA 1DGRN 1FOD2 1RMU2 1AJKA 2NLRA 2O1QA 2VMFA 1CJDA 3WG1A 1PO22 2YPJA 2ZGMA 3QH6A 5LBCA 4AEJA 4FPLA 5BNNB 2PQSA 4AL9A 3KF5A 2Q1FA 1COV3 3J7NA 3TAYA 4A41A 4AEDA 4CSWA 4YW2A 4OHVA 4Q4Y2 4QMAA 4N43B 1W9TA 2DVAA 3OGVA 1JUIA 2UU8A 4EWEA 3K4ZA 3KD4A 1Y9QA 3TBDA 2QUOA 5DUXA 4R9CA 2FDHA 3VD4A 1UCXA 5T5PA 3O5SA 2FD8A 2XKOA 1TZOA 1RUE2 2A3WA 2DBIA 2NM1A 2RHPA 4YZ1A 1YEWA 1V6OA 3LD8A 3LWCA 1AR93 1CZTA 1MS5A 2Q8DA 4Z92B 1LHOA 1MEC3 4XFAA 1UX7A 4LBQD 3ZXDA 2X5IB 3WDVA 1AR71 3DYPA 1UWWA 3AX4A 1UAIA 4YVWB 3Q8FA 1LKNA 2D6PA 4IW3A 1LU1A 1X33A 3ZSEA 3AFGA 3LE0A 2YGMA 4I09A 5FZ8A 4MGIE 1OURA 3KVBA 4PIYA 2QZ2A 3TN93 4NOTA 4NIIA 4QPGA 3C7EA 3FHAA 1AYN1 4UFMA 3SISA 4MGSA 3ACGA 3CIHA 5FP8A 4FPCA 4YM2A 2E7QA 1UYPA 4XQDA 2HBUA 3EQEA 3IB3A 3S6PA 2WSVA 1ZZ8A 1ND3B 2VTXA 5LZ6A 1ZZ6A 2GC1A 2HYKA 5C4WC 3KQRA 3H8XA 4UF0A 1DU3D 3PUIA 2CDOA 3K2OA 1IS5A 5F2WA 3WNNA 1YIFA 1KFXL 4BMEA 4A3ZA 3B93A 1AR73 2J1SA 5F5AA 1YQCA 5KC5A 2CGPA 2FMDA 3I54A 2RDSA 1V70A 3FLRA 3HNBM 2GNDA 1K5MC 4GALA 4ASLA 2R061 4Q8LA 3DN7A 4Y33A 3J26N 4CPBD 4MGQA 2Z4FA 3U78A 5J7MA 4P9YA 1SFPA 1W3XA 4ISQA 1G9BA 1RUD3 1JYNA 4P14A 3RZHA 4JGYB 3OD0A 5L7OA 2WS91 4L0PA 4R4ZA 4L8QA 4H7LA 4S2DA 3PVOA 1SZBA 3GDBA 4AEDC 1NCRC 3LPFA 1IHMA 4IEWA 3S7IA 1W05A 2QQWA 4FFFA 2W2IA 4P9GA 1X9TA 4NHLA 2DUOA 1SLAA 5KHKA 3NV1A 2A6XA 4GA9A 2GMMA 5JI7A 4OQ9A 1C5IA 1RUE3 1SCSA 4PLMA 4QWNA 3UKTA 3ZR6A 4PQ9A 2BWCA 2RV9A 1I3HA 4YFWA 1DGRA 2IFWA 3TB0A 2V09A 4UBGA 2UWAA 3WF4A 4ATEA 3O1MA 1KQRA 4URTA 3OEAA 1I1EA 3MF9A 1NXD1 4PBPA 3POFA 1HXS1 1UY1A 2HEVF 3NKGA 3GHMA 2V5DA 4C0BA 2JE8A 2EAAA 3WQBA 1W8NA 4J1WA 1W6QB 4B7EA 5FMBA 2J1TA 2ZBJA 5DMYA 1L3JA 1JYVA 1A6CA 3CEWA 1G6NA 1REFA 3VHOA 4ZY9A 3N7KA 3DYMA 1AL0G 1S0GA 3PJYA 4QKBA 4KU7A 2GALA 2JE9A 2XJPA 3NNMA 4MXWB 2R16A 4W4ZA 3U10A 2RM22 3ZN5A 1VMHA 5C5UA 5KR7A 4AFMA 2VVFA 4QPGC 1VBD2 2PELA 4BYYA 1CONA 2A3YA 1XB9A 3POSA 4HKWA 3VBOC 2W92A 2B7YA 3OYWB 2XXZA 2BOIA 3AC0A 2LALA 4LHKA 4OYUA 3VHNA 1P8JA 2R041 4Z2WA 3HEIA 3INAA 3KS7A 1PK6B 5C4WA 3RGBA 3M3EA 4K21A 1ULDA 4XF3A 2E9QA 3H1WA 4CVUA 1HB3A 1OOPC 1SLTA 1W0NA 5FY0A 4CEYC 1UW8A 2DWRA 2W91A 4K1YA 5DZFA 5IAXA 4ORFA 1WMDA 4U2AA 1VBD3 2WFPA 2ZGLA 4IV3B 1RUD2 1F15A 3K4DA 2B4KA 3WOGA 2C9AA 1YFYA 5LASA 5LY1A 3O1SA 1DQ5A 4B7KA 3TEZA 2YUEA 1HW5A 2DTYA 4W6XA 1D0HA 1HXS2 4EZ4A 4Q4Y3 4XF9A 2WAAA 1SQ4A 3PTYA 1O5LA 4H2AA 1PHMA 1EAH1 2BV4A 1NCQB 1OFNA 2IXLA 1RUG1 4MOAA 4NAOA 2XJUA 1NCRA 3IWZA 2DCYA 4NRPA 3PVEA 1J3QA 2HWE2 2JKXA 4XXAA 4M3CB 3RDIA 2WQ4A 2RR13 3K77A 3ZYRA 2ZGTA 4FQ4A 3WHUA 4YZ2A 5IK7A 4RS5C 5CFCA 5AVPA 1O6UA 4FSJA 2VZQA 3ZKYA 4QHOA 2VZ1A 5AFBA 5F9TA 3UL2A 2ZEYA 2WNOA 4FP3A 1PM7A 2WT2A 2Z2SB 5CG9A 2BOJA 4NE9A 4K8RB 5FZGA 3VDDA 2KA3A 2VUCA 1XRUA 1YJKA 3I59B 4AR2A 5F32A 3IMNA 2VZRA 1V00A 4ZHNA 3ZYIB 3UYJA 2VMCA 4L2NA 1KDMA 5FKCA 2CAVA 3IZOA 4FPHA 3K51A 5DAVA 2BGOA 3KLSA 1BVVA 1KGYA 1LOBA 1WA6X 5DAXA 3RZKA 2ZGUA 4UYBA 4LK6A 1FT9A 4N7IA 3E5QA 4AF9A 1FPN1 4MYEA 2XH6A 4N43C 3PURA 2E6VA 5H9QA 1O59A 1RJ7A 1W2TA 4UFLA 4XTPA 1IKQA 3GALA 3OUJA 2EF6A 3M70A 4YVSA 1UY0A 4FCAA 4FOWA 1FPN2 4O9GA 4K6BA 3FC0A 2YMZA 4XC9A 1JYIA 1ULFA 3TEWA 3PL0A 1AXZA 2XJQA 1PIV1 3H9AA 3PIJA 1UOBA 1RUH3 4A45A 5FZ1A 2VU9A 4P5HA 1XYOA 5EP9A 2WA4A 2HEYF 4QQHA 2OUHA 4ONUA 1QJY2 4WM7C 5FMOS 3PUAA 5FZAA 4BCUA 3N35A 4N9IA 4NPLA 1DYOA 5BNNA 3ZPYA 1XU1A 3ELNA 3C7HA 2BFUS 1ZRDA 4BB3A 4AOCA 5A3UA 5I0TA 2D6KA 2EIBA 1UZVA 2WLPA 3CF6E 1AL21 3ZIWA 4AEDB 2WN2A 4AFAA 1PNGA 4ASKA 3ILFA 2ZPXA 4OCTA 1OD3A 2VBBA 4O61A 4DRVA 5ABJA 3I2IA 4LOSA 1OLRA 1S0FA 4HANA 4RQPA 1GU3A 3WVJA 4Z2AA 4GH4C 1YWKA 4EV0A 1SFNA 2Y64A 4AW7A 4CCMA 5T55A 4UW6A 2GC2A 4PDWC 2A7AA 4LO8A 1GFF2 5FLIA 4CU9A 1NOVA 1CPNA 4BH9A 1RVF3 5LA1A 4LITA 1XOYA 4BQ3A 2CWMA 2X5IA 4JQRA 1NX9A 1OKQA 5LEKA 1MS8A 1IQDC 1VRBA 3AFKA 4NR1A 2QJVA 5IW0A 2OIIA 2VY0A 3MLKA 1W2OA 1OI6A 2C24A 3MIEA 3NSTA 2BBAA 2JDZA 1RUG2 2VCAA 3DEMA 1LESA 2QZ3A 2PN5A 4UFKA 5HCBA 3RI8A 2J1RA 4CCNA 2ARXA 1FMD1 3VHPA 4E8CA 3BTZA 3KV4A 2FDIA 4IEUA 4QPGB 4YRDA 5F5CA 3ZN6B 1AXYA 4BIFA 4GKXA 2EXJA 3O1OA 5FKBA 5C7GA 3NV3A 4HVOA 1S0IA 1YJLA 1QKQA 5FYHA 1VB4A 4CU7A 1ND3A 4XFCA 1O3SA 3WP5A 1PK6C 2W08A 1ZX5A 5BY5A 4UAPA 4UF0B 4PCRA 3HNMA 3JUUA 3PUQA 4B3NA 2MHFA 4AGRA 2VXRA 1Y9MA 3SH4A 1DCSA 4QX5A 4YYOA 2W1SA 3KV9A 4GZ9A 2BNNA 1OFSA 2VGDA 3NNLA 2NN8A 2H0VA 3OEBA 4FXGB 4NAMA 2EAKA 2Q4SA 2TUNA 4JRLA 1PVC3 1ZYBA 4LA2A 4XEZA 5FXZA 5BNNC 5BNQA 1ST8A 4XDPA 4LT5A 2BWAA 3MO4A 5I0SA 1OLMA 2G9FA 1L7QA 4D7TA 5LEJA 1AR83 1EUTA 1V9U1 2IVIB 4QDRA 4W8JA 1R1A2 1OH4A 3WDYA 4ATFA 1C1FA 5HCAA 3LA7A 5FLHA 4Q4V3 4GH4A 3B00A 5T52A 2VVEA 2ERFA 1YI9A 2Q8OA 4CEWB 4P9JA 1U5IA 1YC61 5AFEA 4L99A 4LBJA 5H9SA 3SNMA 3WG4A 2FBEA 1SMVA 2VOXA 1VBB2 1LHWA 1MVQA 4IEXA 4ZKTB 2VNRA 1VJ2A 3LEGA 3MUZ1 2PLV1 1UMHA 4C1WA 5FO9B 1GZTA 1IPSA 5BNPC 2CTVA 4QQ2A 1FATA 2CHHA 1W2AX 4QKFA 5CZKA 2P3IA 4YG6A 3DPRB 1VBA1 1AYM1 5BXXA 2FDGA 1WBLA 4D6SA 3IIAA 1A34A 2PQQA 3UETA 3KGLA 5EV7A 1F5JA 2QQLA 3LB9A 3LIGA 2G9GA 4FOYA 2YC0A 4XJWA 5EHDA 5IVJA 4KG0A 4FPJA 2D6NA 2IWGB 4LKSA 4XZUG 1DQ0A 2YROA 3PLQA 4IQPA 4WBBA 1OBNA 2WA3A 4ZU4A 1X8MA 4PIZA 3VDCA 3ACLA 2JDMA 3WLUA 4I01A 2XONA 4COVA 4ISRA 5F5IA 1PK6A 5FZEA 1OQDA 4UBHA 5C4WB 4I30A 4BA6A 5F37A 4HSJA 4A4AA 2DU0A 3I4IA 2H6BA 2Q0AA 1RTVA 2B9VA 4H3WA 4AQ6A 2VTFA 1BBT3 2YZ4A 4Y1YA 1JOBA 5FZIA 1K45A 3O14A 4IV3A 4XJZA 5A7QA 1SLCA 3U4SA 1EYBA 1N3PA 4LBLA 1NY72 2ZKNA 1Q8OA 5T5LA 1N1YA 1W8OA 1W6NB 1HJGA 3HR9A 1WW4A 3RG0A 3ZYBA 4EYUA 4NHYA 1CPMA 4XYXA 5BNOC 4XW3A 3DKWA 1NCQA 5AC93 2XJRA 2B9UA 2QBXA 4NWVA 2O8OA 2ZGOA 5DDJ1 2JKBA 4D8MA 3AXDA 2GMEA 4CCCA 5C3OA 1IKPA 1G86A 5FY7A 1FV3A 4JDMA 2VULA 5A1LA 3PUSA 1QDOA 4K7JA 4Q0PA 2WZR1 5C8CA 2IXCA 4XETA 4QQPA 1OLME 3WNMA 2WJSA 4UFIA 2O8QA 2VXJA 1IOAA 4XUPA 2YU2A 2UWCA 1RUJ2 4AG4A 4YGCA 3UT0A 4HVRA 2PFWA 2KR2A 3OPTA 4NJ4A 2RMU1 2B46X 2BEOA 2C9KA 4TWTA 5KHHA 1R083 3VDDB 3WNXA 1OA2A 1HRI1 3I59A 3MI8A 3OY8A 4QHZA 1PO21 4XJ9A 5LCWL 4TZDA 2Q1ZB 1JZ2A 1XU2A 1ASJ1 1J84A 1PVC2 2BERA 2DVDA 2XL9A 4MGKE 4BXSV 2ZMNA 2Y33A 2VBDA 4RSUA 3OTFA 5JVVA 1W6OB 2EVXA 4IEVA 1DGWX 5I8TA 1VRH3 1AR81 1UZ0A 2DBNA 4E2GA 4MHUA 2ZGQA 1RGSA 4GWMA 3O1UA 4GJYA 5SV8A 1GP6A 2P17A 2YYOA 4Z82A 4B1MA 5C3QA 5JLVA 2VUJA 2RS31 4FOQA 4XBLA 4XUOA 2QQIA 1R1ZA 2A6ZA 2WYSA 4LIVA 1DG6A 4QKNA 1GSLA 4FPEA 4YVSB 2ZAAA 2OYZA 1ND2C 2W46A 1TNFA 4BJ0A 4CCEA 2VE1A 3FLPA 5A3OA 2ZGNA 1TQ5A 2BRTA 2SLIA 3RMXA 2RJLA 4CP0A 2ZABA 3HD8B 3AVSA 5FZHA 3WINE 1XE7A 2XUEA 4BXFA 2VVDA 1KD7A 4DEVA 2RM23 2HWE3 3WDXA 3RZZA 4AQTA 4IEZA 1I9RA 1WLCA 3EO6A 1PGW2 1R091 3ZVXA 4K3UA 1NCQC 3MV01 2O14A 2Z79A 3POGA 2VNVA 3VGIA 4ET7A 4HN1A 3OGRA 1WCDJ 5JZGA 4M4PA 2O0OA 1QJZA 1DQ6A 4HVQA 1ULEA 4KG8A 1CAWB 4XDQA 4ZZ8A 3MIBA 4IGQA 3CMGA 1E57A 5ABJB 3FBMA 4RQPB 2HWB1 2G19A 2YY1A 4QDSA 1ENQA 1H1IA 4PHZA 1RHI1 4LO5B 5EJZB 3BIWE 4Q5OA 5IK8A 3ES1A 1RL3A 1H8TB 4MSVA 3ROUA 4KGQA 5A3MA 5FOJB 4M0HA 3DXUA 4XHBA 1ZRCA 3KSCA 4M0NA 3ILRA 4IV1B 2IVJA 4L11A 4LE4A 1EY2A 1W2NA 1VMJA 2R0FA 1JYTA 4HETA 5HPOA 1VBE2 3NJZA 5FXWA 1NZIA 1GWMA 4GKYA 5JAXA 3K3OA 4A42A 1W04A 4A7KA 1XSRA 1AL23 3DV8A 2HLEA 2PLV3 2WT1A 3ZMNA 4C90A 4Y5Z0 4YGEA 5FWJA 3Q8CA 3M3OA 2DCTA 1N47A 4YZ4A 1DBNA 3NV2A 3ZN6A 1W6PB 2OQ6A 4QHBA 3N7JA 1RUH2 3WV6A 4K20A 1US3A 3MLJA 4AVAA 1QNWA 1IS3A 3WCRA 3ZR5A 1AYM2 2WZEA 2Y34A 3E5XA 3AJZA 3GBFA 1W9WA 1PMJX 4QXKA 2QQJA 3BU0A 3CZUA 2WZ8A 2VCBA 5A3WA 3JXSA 1ALYA 1W6MA 1NY71 1ZRRA 3FBYA 3IDCB 1K5JA 3BOWA 4IE6A 1C5HA 3UK9A 1XYNA 3I3MA 3ORJA 4LHNA 1O4ZA 4KQ7A 3UGFA 5FZCA 2XVGA 3I3DA 3TN92 1BEV2 1BK0A 1HX6A 2D6LX 1POV1 3Q8EA 5EZWA 4F7ZA 4P08A 5HXMA 2NZ9A 1UYZA 4QU2A 1UU5A 2EICA 2P6CA 2BNOA 4YZ5A 1SBDA 4CU8A 1C57A 1RHI3 2JDKA 2DYCA 2Y6LA 3HVDA 4JC1A 4XMIA 5A3NA 3H1MA 1SACA 1HRV3 5FIXA 4OFGA 5A7OA 5CFDA 1I6XA 2GSYA 2BDRA 4H7MA 3AL5A 1LCLA 1JOPA 1AZDA 1MEC2 3CJXA 4ZXEA 2VM9A 1YLLA 5CEHA 5IJRA 5FP3A 3RPQA 5EQUA 5LBFA 3TNPB 5JOXA 1KFUL 1AR72 3K4AA 3R4SA 3R05A 4GH4B 4LORA 3S7EA 2ET1A 1HDKA 2VCCA 4WM8C 4AI0A 1WMEA 4CEWA 3K48A 4LHLA 2VOVA 3O1RA 5T3NA 1W06A 1QWRA 3ECQA 1W8FA 4GB32 1XNDA 2BP6A 3KWVA 4O7XA 4QM9A 1F5FA 2YGLA 2D6OX 2DDUA 3CJIA 4FQZA 1VR3A 5FMOL 1DF0A 1FYUA 2AENA 2HWF3 5K0UA 2D5HA 3N9QA 2JJ6A 3DPRA 4DO0A 3J8F2 1LEDA 5DAWA 1RUI3 1QEXA 4LBNA 4GB33 3T0BA 3ENRA 4X6QB 4AHXA 4S2GA 5J37A 2WO3A 3VKLA 4DZGA 1ZZ7A 2H6CA 3N9MA 4CCKA 1BHGA 5G04L 4MGYE 3WCSA 1VBE3 4QX3A 5DABA 3OUHA 4AZZA 1QOOA 1SPPB 1OUXA 3ITQA 2X29A 2FCUA 3UGGA 5CVRA 3B02A 2Y6HA 3H0OA 5FMCA 4QT6A 3ZFEA 4X8NA 5J09A 1O3QA 1C8M3 3JQXA 5JOYA 1PO12 3PVNA 3LOBA 3J7MA 1ZZBA 2GN3A 3NVCA 3WEZA 4LLFA 4NPRA 3I49A 4RA0A 5JSOA 1RUI2 1UOJA 4TLFA 1EAH3 4B4PA 3O1PA 1BEV3 4C1XA 4Q0SA 1W6NA 4E4ZA 3RJRA 2JXAA 1V9U2 5CNAA 1ZRIA 2F17A 3KT1A 3VBFB 5JXIA 1VAMA 4R9DA 1G7YA 3ZLIA 2W68A 4YG3A 4G3YC 2VW2A 5C3RA 2A6YA 2WR9A 2BVVA 5KXEA 1OUSA 2GNTA 1PO23 1BCXA 5JCTA 2WZR3 3USSA 1AYM3 1W2UA 2R071 2RJ2A 2W1QA 5C8CB 1TEIA 1PIV2 5T50A 4MUVA 2HWC2 4CEWC 5C9AA 5FFOC 5J98B 5DG1A 3MUY1 1QXPA 4PF1A 4EQVA 2R072 5FO8B 2K2SA 1FV2A 4DXTA 1YYNA 2ZGPA 3PJQA 4YW4A 1WCSA 2UY8A 4A7YA 3RMYA 4QU1A 4CDQC 3A4UA 3OY8B 2AACA 4JAAA 3I2HA 1BEV1 2Y8KA 3D0JA 1TME2 3KV5A 5FJKA 5FZKA 2VW0A 4COWA 1Q8VA 4GMP1 2J1EA 1GNZA 2GH2A 5GKAC 2YV8A 3MYXA 2K46A 2VW1A 1UZYA 4GWNA 4XUNA 4HFSA 1S2KA 1BBT1 3LIHA 3LEKA 1W6OA 1Y9GA 1QJU2 2QDNA 4CCOA 2YBPA 4H55A 4JCKA 3TEXA 5D21A 4N53A 3WT3A 2P5BA 3NO8A 4I02A 1JZ6A 3C2UA 2XG3A 4RGKA 3RZGA 3V64A 4AVSA 1ZRFA 3SLIA 3BUCA 1N1TA 2HWD1 3O0XA 4W6YA 5GZEA 5KWRA 3V56A 3KV6A 2WAOA 2Y6JA 3VBUC 2RS52 4BK5A 3CHXA 5JI9A 1ULGA 2W9XA 1C8NA 3FMGA 2D44A 4CA9A 1ACCA 3ZYGA 1U0AA 3ZFEC 5FP4A 1X7NA 4CCJA 3OG2A 3CO2A 2GAUA 2I07B 1M4WA 4CP2A 4HK8A 4H14A 3B7MA 1Z7S3 5FZOB 1LOGA 4P9IA 4OI1A 5A70A 2ZMLA 2ES3A 3QH7A 4ZPIA 1JZ7A 5FBZA 1RUD1 2XL7A 3NNGA 4AYUA 2ILMA 3ACHA 4TYSA 5IVVA 2YBSA 4QPIA 5L19A 3H50A 1H30A 4EZHA 3VUOA 2IXJA 3HT1A 4LOTA 2ZXQA 2E51A 3GJAA 4COZA 4KBBA 5LATA 4R9BA 5JZGB 3UKNA 3VBHB 5FBJA 4CP1A 1CAWA 1NLSA 4WZCA 1N3QA 4ZZ5A 1YQ5A 4K1ZA 4WVZA 1D4M1 1CVNA 1NA1B 1HQNA 5T5OA 3ME2A 1Q8PA 1YNAA 1Q43A 3J4UH 4GJZA 4KI5M 4UW4A 5A1FA 1PM4A 5FYVA 3SH5A 1KS4A 4J25A 1V6JA 4ITCA 2FDFA 1H8TA 5EIYB 1OVSA 2AC1A 2Z69A 1Q3EA 4OMDA 1NZCA 4M4RA 4LE3A 1WLDA 4OMCA 1IG0A 3UJQA 2IXIA 4IV1A 2C5DA 1EV12 1RUE1 5CADA 4YLZA 3L9JT 1GWLA 1X82A 5A33B 5FY4A 2WNUA 3H42B 5CBLA 1A3KA 2VOWA 5FZ3A 4CE8A 3IPVA 1W8HA 2V72A 3I7DA 5GZFA 2JG8A 5GZCA 3THCA 4BU2A 3CNAA 4AVTA 4XJUA 4E4SA 2RDRA 1KS5A 3AZWA 4CDUC 3A0NA 5A7NA 1W6PA 2PTMA 5B4NA 5FY1A 5FPVA 3HJRA 3E6DA 1OD5A 4QGNA 3MHZA 3TYJA 5JMCA 1HN0A 3EMRA 3ETQA 5FUIA 1I5PA 4I0BA 3HN1A 3AYDA 2PAEA
chains in the Genus database with same CATH topology
3B94A 5GZGA 3AP5A 4XXPA 2OZ6A 3UJOA 3VBOB 1U5YA 2K0GA 3WQ0A 1MQTC 3T1LA 1W6MB 1O3RA 4LTAA 1AX0A 2WQZC 1B35B 2B5HA 1FXZA 5H9PA 4QPIC 3WQ7A 3FHIB 1RUG3 3VHRA 1LB2A 4AGGA 3AK0A 3GBGA 4XFFA 4HKOA 2GC0A 2DV9A 3BPZA 1H2MA 5CFDB 1UIJA 2QNKA 1QMJA 3ZFGC 2JG9A 3GZTB 1OPOA 1DGWA 2XJSA 4AK3A 1POV0 3VZNA 4FTBA 3QCWA 1Y7BA 3VZLA 1O5UA 3UV9A 5JDBA 2OA2A 5KHJA 1MZ6A 4AI2A 3IM0A 1R081 4IV3C 1ZVFA 3CJIB 4BMBA 5HCFA 1Q56A 4BE3A 3VBSA 1NE4A 3AP6A 4LULA 2HWB2 2WNUC 4P9LA 5K0UB 3AKQA 1PMIA 5GLZA 2QDRA 2DCJA 2BYVE 4Y1ZA 1PGSA 5CFCC 3JZVA 3NV4A 5F6LB 5K9YA 5CU1A 1AF9A 1VB2A 3PMEA 4Q4V2 4SBVA 1KXGA 1RUC1 1EV13 1QXRA 5E1RA 2EXIA 4Y24A 1AVBA 3EXUA 1GZ9A 3ZFEB 1FMD2 2PAMA 5DUUA 1QGLA 3D82A 2AH2A 3ZYJB 1BJQA 1J3PA 3SXWA 5FPXA 5TSWA 1N3OA 2WS92 5LRSA 2BW8A 2FQPA 2PHTA 3E6BA 4CYDA 1EP0A 1N1SA 3G7DA 1H1MA 1RUF1 2ENRA 2UYBA 2X8KA 4FPGA 4MVTA 4XF0A 2F4PA 3VBFA 1JH5A 1JOJA 4YGBA 1WD3A 4WVMB 3ZFGA 4RD7A 2JG9C 3OGGA 3R4DB 3ES4A 1YFUA 4ZXKA 1RUJ1 4E27A 4Y4YA 1NA1C 4IESA 2AGSA 3M3IA 1H8VA 4R8HA 2A73B 2UY9A 4MGZE 1ND2A 1MS0A 2QVSB 3AMQA 5C9AB 4WM7A 2IFRA 2VUAA 3NAPB 4LBMA 5E88A 3GBWA 4XJ8A 4JTOA 2VG9A 3AKSA 2FMYA 3RYKA 2HWC1 2XHKA 1SFYA 4AEMA 2V73A 1UL9A 5T5JA 3E97A 2PHWA 2QFEA 2VMGA 2KM2A 3MIHA 4B8EA 2PAKA 4JGZB 4X8PA 3WDTA 4PDWB 1WD4A 1PNFA 4DFSA 3NL1A 1QJU3 1X50A 1ZNPA 2R6QA 5SV5A 4JV4A 4RQPC 1O4TA 4PJYA 4N53B 3R6SA 3THTA 1WUVA 3HBZA 5C33A 5JZGC 1DYKA 1DZRA 4AGVA 4EN8B 2SBAA 2CGOA 4CEYB 2H0BA 5CA6A 4Q1RA 4GMP0 4X6RB 3E6CC 1QJX3 5GLWA 4WZFA 4LUKA 4DQAA 2DU1A 1MS4A 1B09A 5KHIA 1ZZ9A 4AI8A 3V65A 3WP4A 3OJBA 4AFDA 3MIFA 4FTSA 3WDUA 4EWAA 2ZS6B 1WBFA 1CAVA 3BU7A 4META 3U4XA 3FE5A 4QPIB 5JR7B 1EPZA 1ENRA 1WW5A 3AZXA 3WG2A 2D3PA 4M01A 4IERA 4XFHA 2WWSA 4RS5B 4WVWA 1V9U3 4D3WA 3D6EA 3VBHA 4OULA 3URFA 4Q4V1 4CDXC 3PNAA 3ASIA 1NA1A 5FO7B 2ARBA 2D5FA 1LULA 3NKTA 4JRAA 1HKDA 4HT1T 2TEPA 5H9RA 2AYHA 2RS51 1GYKA 2DF7A 4CTEA 1MVEA 5GJ6A 2RS12 5KC6A 1LJ7A 1QDCA 1SBFA 3OBTA 3W58A 4AFBA 1RUOA 1S1AA 2Z5WA 1S2BA 2DCZA 1REEA 4HLTA 5L73A 3ZXKA 4RR3B 4IEOA 5A33A 2WNUB 1YIPA 2DFBA 5JSPA 3IPVB 3ZSJA 4XHXA 2JG8B 1H2LA 3MGUA 4HN0A 2VPVA 1LOFC 2ZCWA 1RUNA 5KXCA 1V6NA 1LHVA 3O7OA 2WIIB 3VZKA 2ZJCA 4YARA 3EHKA 4F8AA 4B4QA 5CB7A 2WFF2 3JD72 1QQP1 1D4M2 2YXSA 3FUOA 5I8SA 1AR62 1HIXA 2ZGRA 4RGGA 4QD2A 3VBOA 4XFBA 1ULCA 4OI2A 4WVVA 2Y0OA 1MS3A 1FNYA 3CJIC 3FZ3A 3POYA 3MFCA 4IETA 1KJLA 3QLQA 4S2HA 4YW1A 2GDFA 1B35A 4SLIA 5K0UC 1BKZA 3AZZA 4Y26A 2GNBA 3L2YA 1HRV2 5C8WA 2CWSA 1NQDA 3ZSKA 2XWBB 4U36A 1DZTA 3ZIXA 5DZEA 4YVWC 2JG9B 5LK5A 1CN1A 5EFUA 3BALA 4K9SA 1C28A 4M3CF 5KXBA 4MXVA 5F5QA 4HBNA 4KH9A 1PIV3 3VV1A 1HRI3 1R093 1OA3A 1XNCA 5JOZA 1QF3A 3CLPA 1ASJ3 2WFF1 1COV1 3AZVA 1YUDA 2OW4A 2ATFA 4EN7B 3B69A 1LGCA 4B29A 4KL1A 1UZZA 3GYDA 5FAXA 2R0HA 2TNFA 3GZUC 3VBSB 1PVXA 4OVEA 3QACA 4W65A 4JGZC 1F2NA 4OUMA 1YFWA 1ZBA3 2VNOA 4GIQA 3BCWA 2K9ZA 3WD5A 2G4IA 1LOFA 1AX2A 1AL22 2RS33 1PO13 1OA4A 2ZZJA 2F6BA 2P34A 4FPKA 3USUA 1EV11 1OSGA 2Q30A 4XIKA 5J3UA 4J6GA 1LGBA 1O4YA 4PBOA 2JEMA 2VNGA 3D8CA 1S55A 1U12A 3LAGA 2RS13 1F8VA 2XJVA 1ZBE2 3ZXAC 1YRZA 4FOVA 2A75A 2WNVC 4D94A 4BZ4A 3L2HA 4XE9A 5L7OC 5EYXA 3D4KA 3M3CA 5K8SA 3U07A 1H4GA 4MLOA 1QOTA 3J8F3 3JB8A 3FLTA 1GR3A 3JB4C 2ZAHA 5JPMB 4PLOA 2P3JA 2IXHA 2ZA9A 3VBUB 2C1FA 1Z7S1 4N53C 4WVMA 4LO4B 3ZFGB 4FAGA 2A6VA 1XXNA 2ZGKA 4LUMA 3AP4A 4HPKA 2ZX4A 3H3UA 4DRRA 4IEPA 5GZDA 2GH8A 1HRI2 5FQ0A 3B9IA 1ND2B 1J1TA 3JCIA 4DINB 4WM7B 3KM5A 4Q4Y1 3U0ZA 2JX9A 1AJOA 3NAPA 4JDOA 5K7PA 1X8EA 1UX6A 3HAGA 1RUF3 3AYAA 4E2QA 1QJX2 1GLHA 4M00A 3WZ1A 3LA3A 4JGZA 1LOCA 3BTAA 1UPIA 4PDWA 1H2NA 5AC92 1LECA 5B2GB 3APBA 4Y1UA 5LRRA 2ET7A 4FAHA 5J36A 4XBQA 2YHJA 2X5IC 2ZMKA 4S2FA 3ZXFA 1DLLA 4FO9A 4IXLA 2XB6C 2XPJA 4CEYA 2OUJA 1LTEA 1OPMA 2BGCA 2CGNA 2Y0IA 2AR6A 1APNA 1TMF3 2JENA 3OGJA 1BBT2 2JECA 3R4UA 4DNYA 4N90A 1YFXA 3LSDA 2WFF3 2Y26A 5KBFA 3KT7A 4QQLA 2D3SA 1H8TC 2ZZQA 4FPOB 3WDWA 1AX1A 1QXJA 4XFGA 2XBO1 1F9KA 4HKLA 3LKJA 4HK9A 2DUQA 2R042 5ACA3 3AMMA 1CAVB 5CAZA 2GMPA 4DMIA 1CJPA 2FZ2A 2IC1A 4RS5A 1VBB1 2NPIA 1BVP1 3HWJA 1LU2A 3AKTA 4QQOA 3H3ZA 1OLQA 5BPXA 4Q8KA 2EALA 4K8FA 3VL8A 1U5XA 4J1XA 4AE2A 1GBGA 1LR5A 2CAUA 3RRDA 1IS4A 1DQ1A 3AB0A 4BIOA 2B45X 4B4RA 4WM8B 4AHYA 1AR82 1MZ5A 4M3CE 2E7AA 3VZMA 2RE9A 1YO8A 1U5ZA 4RR3A 1UKRA 3KCCA 4FBFA 1IZ3A 4EROA 2QCSB 1TME1 5IK4A 4AXOA 1FOD3 1RMU3 1Y3TA 3SHRA 4Q1PA 4EWDA 3GNEA 4Q0UA 1RUJ3 5FTTC 3BODA 1W39A 1A78A 5A3LA 2HWE1 1LRHA 4DB5A 2UWBA 1QHDA 4BLJA 1GANA 4WV8A 3LSEA 4OHWA 1LENA 3G6JB 1ENXA 3DPRC 1J59A 4R52A 1IQAA 2D97A 1V6MA 4GQ7A 1R1A3 2D98A 1SBEA 2W52A 2R49A 3IT8A 2I45A 2ZGSA 2PHDA 4RFT0 2GC3A 3B5LB 2VQAA 3RSJA 1WA4A 4IL7A 2DURA 1LEMA 2RM21 1MACA 1JYCA 1AUYA 4I3GA 2D3RA 2FZ1A 3LA2A 3QD6A 3EJKA 5HI0A 3RYPA 1Q8SA 3NW4A 2ZX0A 5BNOA 4FPFA 1H0BA 5JOWA 4HSLA 2D93A 2D7FA 3MPBA 4EJRA 1SEFA 3KB5A 3VZJA 1CESA 1V6KA 1UKGA 2MPFA 2A5ZA 1WMFA 1DYPA 3ZDSA 3N4MA 4XMAA 4OUSA 1CX4A 4YW5A 3OF1A 2YDEA 2V5YA 4CDQB 1HV0A 3D0SA 4PLNA 2NP0A 3SMHA 4DY5A 5D8AA 3LZZA 2ZHMA 3MZHA 1K5MA 3T2TA 4O9EA 1FMD3 3HIFA 1XQNA 3USUB 5C9AC 3W9AA 3J8F1 1JW6A 3DL3A 3J9SA 1GNHA 4GXLA 2LM3A 3JBG1 1G9FA 1MR5A 2RJKA 4LEJA 2RR11 3VKNA 4AHZA 3QBQA 1G8WA 1EPWA 1CAXB 4LLOA 5EJ3A 2HWF1 1AR91 2KXLA 2ZACA 4JTNA 1MZFA 3V0AB 4AI3A 1DQ2A 2EXKA 4PIXA 4XOGA 3SCHA 1LGNA 1PO11 1RIRA 1RITA 4UXAA 4E2SA 3TOJA 2D6MA 3WG3A 3MLLA 3VBUA 1YI7A 1QU0A 1WLWA 3POWA 4XF4A 5BNPB 3ZN4A 4RGAA 1RUH1 3IN9A 2WNEA 1ZBA1 2ZTNA 1RINA 4HPKB 4F83A 1QJY3 1N1VA 4Q27A 1W0PA 2X53S 4RHV3 1PGW1 2ZHLA 2OVUA 5FQ0B 4OHZA 1G9AA 1J1LA 2DFCA 4RL7A 1S0BA 2HJIA 1CR7A 1OOPB 2RR12 5BUVA 3N7LA 2PHUA 1O7FA 2EIGA 1AXKA 1UU4A 1OMIA 1XYPA 3MW4A 2FHRA 2RS11 4KWKA 4CDXB 5DZGA 3IKWA 3P3PA 4XPVA 1Z78A 3LOIA 3JBG3 2PYTA 3I8TA 4G4FA 1HXS3 2GNMA 1FAYA 1O91A 5D1IA 3M2MA 3OCPA 2OZJA 2IZWA 1LHNA 1QNYA 4Q4W1 2XUMA 2CL2A 4YW3A 4KNCA 1UMZA 2DVBA 1RUF2 4NO4A 2N7GA 3KMHA 4QGMA 4LNVA 2R063 1KDKA 4C0HA 3VL9A 2WLQA 2HWC3 2NMNA 3MIGA 4EN0A 1S0DA 2PHLA 4BLIA 3NWKA 2D43A 1JXNA 2I74A 3M8LA 5LK7B 3WW4A 3THPA 3ZFFC 1KJRA 4KGGA 3H7YA 1XNKA 4DY3A 3VDDC 1ZBE1 1CGPA 1A8MA 2JICA 2ZX2A 3DF0A 1MZEA 1UD1A 3TN91 4BPZA 3I2DA 4COYA 4QM8A 2QE3A 2RS53 3MW2A 1LHUA 3LGRA 3AMHA 4Q4X2 3KGZA 4L92A 3N7MA 1C8M2 4I3PA 4BM8A 5CFDC 2I2SA 4Y1VA 3S0MA 4COUA 1PVC1 2R30A 4D7YA 2MNGA 4NHMA 5EXOA 4YVSC 4YSFA 4Y22A 4WM8A 3AM2A 5DUWA 1B35C 1VBA3 1NLRA 2PA7A 2LUWA 4LBKA 1KITA 3H7JA 1TME3 1H9PA 1MS9A 2A3XA 1PGL1 3ZSMA 4MH0E 3B01A 2R043 2RS32 3AXEA 4C91A 1IPJA 4ZU7A 1GKBA 4L97A 4MX3A 4YZ3A 4AQSA 2D40A 5A32B 5JIUA 5FRAA 2R073 4UW3A 1ZBA2 4W6WA 2R1BA 3ZXJA 5DXDA 5FOBB 2Q5TA 1Z0HA 1FI2A 1X36A 4FPYA 3KT4A 1FPN3 3AZYA 1Q8QA 1SDWA 2WZR2 5GLUA 1TMF2 1VRH1 2EA7A 4XTMA 5JIAA 3ST7A 1D2QA 3WW3A 5CADA 3JD73 3AKPA 1A8DA 3M3QA 2GU9A 4YM1A 1HV1A 1R092 4LBQB 4FVVA 1QQP2 1IS6A 2WZPP 3TNQA 1CD3G 1JHNA 3MEPA 3BB6A 2DTWA 1DHKB 1EAH2 3ZFFA 3V0BA 3RWNA 2VMIA 4CDWB 5FPZA 4Q26A 4Y20B 1RHI2 3HMYA 3TRSB 4Q29A 3N3HA 2HWD3 4E9KA 5E89A 4LBOA 1Q5OA 1NXMA 1CQ9A 1GZWB 4OHYA 4P9XA 5T54A 1TNRA 1D2SA 1ENSA 5BNOB 2ZX1A 3AP9A 1QQP3 2WNVB 5I93A 1T6GC 4KU8A 5E16A 1D4VB 3WXPA 2MEV2 1G9DA 1GQHA 4IEYA 4OI4A 2DVGA 1IGOA 2WC2A 2BTVC 3VKFC 3ZMOA 4JVAA 3SH3A 1D4M3 1WW7A 1LOEA 1ND3C 4JDNA 1V6LA 3VBFC 3SCGA 2BUKA 4OHXA 2HKXA 1F31A 1GZCA 3AMNA 2JE7A 5FDBA 4YNIA 4AWDA 3QOPA 1DZQA 2PHFA 3DGTA 4I0AA 3ZSLA 3AMPA 3VKOA 2RMU2 2VQ0A 3X29B 4CDQA 1QJX1 1J58A 2E53A 4NVPA 5L36A 4R4XA 1URXA 3MPPG 5D8AB 1K5MB 1ASJ2 4N7UA 2XLGA 3MIDA 5AC91 1W0OA 1VBA2 4LA3A 1MQTB 1UPSA 3ZXEA 2DVFA 4EN9B 2DUPA 5I91A 1QJU1 3GHNA 1BMV1 1FX5A 5IK5A 1G9CA 2WL1A 3NAPC 1M06G 4Q0VA 2HWD2 1BMV2 3OPZA 3WUDA 1CAXA 5GLVA 3VBRB 1UIKA 1QH6A 3MDPA 4Q4X3 2Q1MA 4ZU5A 3FWEA 4E4DX 3V0AA 3ATGA 5FLJA 4AQ2A 5KHGA 2RMU3 1JTZX 3ZYPA 2BVBA 1WW6A 2OPKA 4L9BA 3IDEA 4UW5A 2HWF2 3WX5A 1ONAA 2VECA 2WKKA 2XVLA 5BNPA 3D5OA 1DQ4A 1YXWA 1QJY1 3AYEA 5GLTA 1AR63 3SCFA 4ASMB 4RHV1 1VBC2 1C8M1 1VLNA 3VKMA 1BK1A 2ZHNA 4HL0A 1SLLA 2MEV3 3OD4A 3WY6A 2ZHKA 1AR61 4D69A 2IXKA 3JD71 3PVBB 3P3NA 1HLCA 1OOPA 2R32A 1NG0A 4RHV2 5F1RA 5GM0A 4DS0A 4HMZA 2A70A 4LO6B 4YGDA 5EWSA 2XVKA 5KXDA 1GQGA 1UF2C 2LTNA 3CL1A 4QGLA 3VBHC 4CDXA 1REDA 4KWJA 4IV1C 3U11A 3JBG2 3AYCA 2BQPA 3B9CA 3ZXGA 3RQ0A 2WS93 1VP6A 4XILA 1SLIA 3FFQA 2AUYA 4FT8A 2VMHA 5EYYA 5CG8A 1O3TA 2JG8C 4MZUA 2CV6A 2XLFA 1I5ZA 1CAUB 1C1LA 1RUI1 4LO7A 3WHTA 4CDUA 4AI1A 2UURA 3FUQA 4FXKB 2HEWF 1COV2 4D7SA 3WW2A 1VALA 3WP6A 4Z8BA 1DIWA 4AVVA 2AREA 3CU7A 4PF5A 2QQPA 2PLV2 2ZOEB 1HRV1 3KCYA 1PZ7A 1QY4A 4YM3A 5FCCA 1NQJA 2PHRA 1KRIA 2NMOA 2A6WA 2B42B 1V6IA 2Y38A 2MEV1 1JN2P 3H8UA 3GF6A 4BHPA 4G9SB 3ALQA 1PZ9A 4KWLA 3RNSA 4FTEA 2XKPA 1R1A1 1AR92 2R062 1DDLA 4N43A 1PZ8A 1XE8A 3SITA 4LR4A 4AFCA 3O12A 1YCIA 5JSRA 4DOUA 2TBVA 2EXHA 4Z07A 4XIOA 2W0XA 4NHKA 3T1MA 1MEC1 1GV9A 4Q4X1 3H1YA 1OHFA 4YFZA 4Y22B 4CZSA 3FFZA 2ZX3A 2XGXA 4YVWA 4BQ1A 1C4RA 2WT0A 1R082 4Q0QA 5A32A 2UYAA 4XZPA 4INDA 4DPNA 3KCXA 3O0VA 1ZM1A 2E7TA 3FJSA 4Q2FA 3PHMA 4YG0A 3M1HA 4XQ4A 1SLBA 2XWJB 1AYN3 3RS6A 2GN7A 2R1DA 5ABJC 3AJYA 3RI9A 3ZXLA 2BFUL 1H9WA 2WSUA 4A3XA 1VAKA 4IEQA 5F6KA 2VOKA 1SCRA 2XJTA 1H4HA 5I0UA 1RC6A 1OQ1A 4LBQA 1RUC2 3RJ2X 4Q4W2 1VRH2 3AP7A 3VBRC 3PMSA 4OZXA 3ZFFB 3V0BB 3MICA 2XBO2 4OI0A 4CDWA 1FOD1 1BXHA 1RMU1 2NQYA 2P3KA 4AEKA 1PGL2 5DDJ2 4JGYA 4Y20A 5L7OB 1NE6A 5J48A 2E63A 5D8AC 5DG2A 3A0KA 3JU9A 2XBO3 3MW3A 1XNBA 1JUHA 1CIWA 3ZX7A 1GZWA 4F3JA 1LODA 2ZKLA 2AZ5A 5IUQA 5J96B 4V1PA 2WNVA 2BPA2 3C3VA 1OQEA 4AVCA 1POV3 4I2OA 1BYHA 1BQPA 4YM0A 4HZFA 3WR0A 3E5UA 4P9WA 2B8MA 5FREA 4A7ZA 3M4FA 1ZA4A 4MV2A 1TE1B 4XFIA 3VN4A 3MF6A 1S0JA 5ACA1 1AYN2 3WP3A 1W6QA 3DUIA 3VZOA 2DCKA 1D0GA 1MS1A 4Z1VA 3GZAA 4XQWA 3RYRA 1VBB3 4MXWA 5ACA2 1ZZCA 1TMF1 1NYWA 5AVAA 4TSVA 3OYWA 1MQTA 2NYYA 4XF1A 3UKVA 1C3HA 1UN1A 5I8YA 3ILNA 4DXZA 1FNZA 2BNMA 3S30A 4N9HA 3HT2A 4XJAA 3WUCA 4I0WB 1UU6A 1QOSA 4XBNA 3VBRA 1GICA 3M7AA 1HQLA 1VIWB 1DGLA 4NN0A 4BWOA 2XLAA 1JBCA 3FX3A 2P37A 3VLBB 3BOPA 5GALA 3W59A 4R9AA 1VBE1 5JPNB 1VAVA 4A2UA 4CDWC 1WGPA 1WCKA 2PHXA 1S0EA 4BOWA 2HWB3 1RUC3 5HBAA 3Q9OA 4JGYC 2Z42A 1WLTA 5IT6A 2WINB 3AKRA 3EBRA 1QH7A 2VH9A 4OLLA 3IDBB 1NCRB 3O0WA 5BV6A 3WQ1A 1DFQA 4AVBA 4M3CA 4K40A 3JQWA 3LCPA 2CYFA