4QGNA

Human acireductone dioxygenase with iron ion and l-methionine in active center
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
178
structure length
178
Chain Sequence
MVQAWYMDDAPGDPRQPHRPDPGRPVGLEQLRRLGVLYWKLDADKYENDPELEKIRRERNYSWMDIITICKDKLPNYEEKIKMFYEEHLHLDDEIRYILDGSGYFDVRDKEDQWIRIFMEKGDMVTLPAGIYHRFTVDEKNYTKAMRLFVGEPVWTAYNRPADHFEARGQYVKFLAQTM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase
publication title Human acireductone dioxygenase with iron ion and L-methionine in active center
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 43
structure length 178
sequence length 178
ec nomenclature ec 1.13.11.54: Acireductone dioxygenase (Fe(2+)-requiring).
pdb deposition date 2014-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03079 ARD ARD/ARD' family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4qgnA00
2BYVE 4E2SA 3WW3A 4N9IA 4ZU7A 1U12A 5JCTA 4KU8A 5KHKA 1ZX5A 2O8QA 4HN0A 5HI0A 5KBFA 4YYOA 4Z82A 4YARA 4ONUA 5CU1A 2PHDA 1CAUB 4LUKA 1DGRA 2GU9A 4ZU4A 5CVRA 4D7SA 4O9GA 4BH9A 2PA7A 5FQ0A 1YUDA 2GAUA 3FFQA 2ZCWA 4IEUA 2K0GA 2B9UA 1TQ5A 2CAVA 2D93A 3RYRA 1LKNA 1LR5A 4XFIA 4QMAA 3H1WA 5BPXA 4LULA 1YFXA 2XHKA 3O14A 4JVAA 1CAXA 4HN1A 5FPZA 4XFCA 2HJIA 4XF9A 4IEQA 4IEXA 1NYWA 5FQ0B 2N7GA 2QDRA 3UKTA 2O1QA 4PIZA 1ZNPA 3DV8A 3SCHA 4EWAA 1WA4A 3NKTA 3LA7A 3S7EA 1EYBA 3ES1A 3HT1A 4X6QB 2OYZA 3GYDA 4RD7A 1QXJA 4ORFA 1WLTA 1GQHA 1QWRA 4BHPA 2IXHA 5JAXA 1CGPA 3OF1A 3IIAA 3ZDSA 1RC6A 2BGCA 3OGJA 4MUVA 3DL3A 1X8MA 2IXJA 2UY8A 3BCWA 4IEZA 1O5LA 3MZHA 3M70A 1DZRA 3CJXA 1J3QA 2UYAA 2QVSB 3KMHA 4AVBA 3OTFA 3D0SA 2IXLA 5I8YA 2PAMA 2HKXA 4AQ2A 2Q4SA 4QM8A 3U10A 3IBMA 4E2GA 5I91A 4WVZA 5KHHA 3NL1A 1O7FA 2IC1A 3QOPA 4I3PA 3LA3A 5LRSA 2BNOA 4WZCA 2OZJA 5JSRA 2P17A 4KWKA 4PJYA 3CO2A 4IERA 3SMHA 4Q0UA 2D40A 3IDBB 5E16A 3BB6A 2CAUA 3H50A 4MGZE 4META 2Q0AA 4LLOA 1ZZ8A 4TLFA 5KHGA 1J3PA 3D0JA 4HSJA 4NVPA 2F4PA 1CAWA 1PMIA 1XE8A 2ET7A 4LTAA 4MGYE 3IWZA 2E9QA 4AXOA 4D7TA 2ATFA 4R8HA 4O9EA 1Q5OA 1UPIA 3U0ZA 3TNQA 5J7MA 5BXXA 3JZVA 2Z69A 1XE7A 1RL3A 3FJSA 3I59A 2PAEA 1ZRDA 3R6SA 2GC3A 4Q0SA 4HLTA 1EP0A 5JSPA 4YRDA 5I8TA 3SXWA 2H0VA 4UBGA 1ZREA 3ACLA 2MPFA 1CAWB 3RNSA 2QJVA 4QGLA 2IXKA 1QY4A 3LOIA 4LUMA 3H7JA 1ZRFA 4MH0E 2PHLA 3RYPA 3OD0A 3HIFA 1UD1A 1ZZBA 4GULA 1J3RA 3KGLA 1VJ2A 3I59B 3FHIB 5EFUA 2V09A 5FDBA 3E5QA 1O3RA 3ROUA 3N4MA 3U11A 4Q0QA 3RYKA 2XL9A 3EBRA 1UIKA 4WBBA 5K8SA 1I6XA 2IXIA 3H1MA 1OD5A 4FAHA 4K8FA 1Q43A 1PM7A 1YFYA 1RUOA 1O5UA 3NSTA 5KHIA 1LRHA 2DCTA 5FLHA 2C0ZA 4MX3A 1CX4A 4HSLA 3H8UA 4I09A 3H9AA 3H3ZA 4BYYA 1EPZA 5I0TA 2XLFA 1ZRRA 2WC2A 2XGXA 4Z07A 4AQ6A 4DINB 3E6BA 4JV4A 4P9GA 3G7DA 2UY9A 1GQGA 3IDCB 3FE5A 2B8MA 1IPJA 1NZCA 2Q1ZB 4E2QA 1RGSA 2CV6A 3LA2A 1I5ZA 1FXZA 4UBHA 4IEOA 1WGPA 2VQAA 4XFAA 5BV6A 3RZZA 1OMIA 4EV0A 4N9HA 3E5UA 3LAGA 4YNIA 1VP6A 3EQEA 4MV2A 5J3UA 1LB2A 4IEVA 2PTMA 2ET1A 3ES4A 3FZ3A 4XFFA 4I01A 3LZZA 4XETA 4B29A 2BNNA 1O3QA 4XF0A 4JTOA 3QACA 4KU7A 3UKNA 1DZTA 1NE4A 3NJZA 1X8EA 4QXKA 3FX3A 3CL1A 4ZU5A 3USSA 4A2UA 3DKWA 1NXMA 3PVBB 2MNGA 4IEWA 2I45A 2GC1A 1YFUA 2BNMA 2H6BA 3MPBA 4HVRA 4CYDA 4PIYA 3WW4A 1X7NA 4KWJA 3H1YA 2GC2A 1H1IA 1CAVA 5FPXA 3L2HA 1DGWA 1EY2A 1J58A 4EROA 5BY5A 1ZZ6A 5I8SA 3CLPA 3KSCA 3GBFA 3H3UA 4QGNA 2OZ6A 3SHRA 4IESA 2OPKA 4X6RB 2XKPA 2VECA 4XF3A 1NE6A 3LWCA 5AVPA 3UKVA 4KL1A 1ZRCA 4QGMA 4R52A 2XLGA 1CAVB 2Q30A 3BALA 2EA7A 2D5HA 1O3TA 5LRRA 3E6DA 4J1XA 5CADA 3BU7A 5I0RA 4FBFA 2XKOA 4F7ZA 1L3JA 5BUVA 1SFNA 3ST7A 4EWDA 4FAGA 4PIXA 2ZKLA 4JTNA 3WW1A 4AVAA 2H6CA 1YHFA 3EHKA 1J59A 4HZFA 5LEJA 3M3IA 5T3NA 2EAAA 4OLLA 2PQQA 3NW4A 4IETA 3OCPA 4EWEA 4I0AA 5C6CA 4XFBA 4XF4A 1Y3TA 2UYBA 2VPVA 3HQXA 2MHFA 5J48A 4LA2A 5FLJA 1RUNA 4KWLA 1FT9A 4L11A 4Q0PA 3E6CC 5FCCA 5D1IA 4IEYA 3H7YA 1ZZ9A 2XLAA 2KXLA 4XF1A 1YFWA 4AVCA 1G6NA 4BIFA 1UCXA 1O3SA 4HMZA 3SCFA 1XRUA 3PLQA 5JR7B 4OFGA 1H1MA 3MYXA 2XL7A 4FT8A 4I02A 1JUHA 3I7DA 3DN7A 4MZUA 4Q0VA 4LEJA 5FLIA 2GZWA 4MGKE 3E97A 3TNPB 3HT2A 1CAXB 3S0MA 2PAKA 5I0UA 2WFPA 3PNAA 4MGIE 1Y9QA 2QCSB 4HBNA 2PFWA 4L2NA 3MDPA 5I93A 2CGPA 3ELNA 1X82A 2BEOA 5I0SA 1SQ4A 2QNKA 2IXCA 3E5XA 4Q29A 1SEFA 1YLLA 3FWEA 4YSFA 5EZWA 1UIJA 4LA3A 3RPQA 3WW2A 1ZZCA 1J1LA 5C8WA 4XEZA 1RTVA 3NVCA 5E1RA 2ETEA 5JSOA 2FQPA 1YWKA 2Z2SB 4QM9A 3I54A 5KHJA 3D82A 3KGZA 4QX5A 3C3VA 1O4TA 3ETQA 2OA2A 2GC0A 3BPZA 3S7IA 4H7LA 4XFHA 4HVQA 4IEPA 4UXAA 3VHRA 4HVOA 2GH2A 3EJKA 2D5FA 3KCCA 1OFNA 1V70A 1ZZ7A 3RDIA 2B5HA 3CEWA 1ZVFA 2PYTA 2Y0OA 1Q3EA 1IPKA 2EVXA 5LEKA 5F1RA 1CAUA 4F8AA 1HW5A 2FMYA 4I2OA 1OI6A 3EO6A 1VR3A 1FI2A 3B02A 4I0BA 2K9ZA 3SCGA 4J1WA 4XFGA 3CF6E 1QXRA 1UW8A
chains in the Genus database with same CATH superfamily
3SH3A 3O7OA 3T08A 1NLQA 2CGNA 2BYVE 2JWPA 1REDA 3AFGA 3JU9A 1I3HA 1FATA 1PIV1 2X5IA 2XBO3 3OY8A 4ZU7A 3ZYGA 5JCTA 4KU8A 1AJOA 1FOD2 1D4VB 2VQUA 3PMEA 4DPNA 5KBFA 2ZHNA 1WLDA 4J6GA 4FQZA 3J8F2 1EAH3 1CONA 1NLRA 4YARA 5FYYA 2J42A 2PHDA 2FZ1A 3BIEA 1RUE2 4FPOB 4K8RB 3ZXLA 1MZFA 2A1XA 2GU9A 3MW3A 4D7SA 4QXCA 2D6MA 1TVGA 4BH9A 3UGFA 1V00A 3JD71 1PO11 3POWA 2Q8CA 1QMJA 2P3KA 4XPVA 4NE9A 1FNYA 4AK3A 2GAUA 5IATA 5DN2A 1AR83 2VTXA 3T4VA 3VD3A 5DAWA 1F5FA 3KT4A 2B9VA 4IEUA 2W1QA 5APAA 1N3PA 3ZFGC 4C0HA 2CAVA 2FDIA 1C5HA 1FPN1 3WNMA 1U0AA 1R091 1LR5A 4XFIA 4TLGA 2HWC1 5K0UB 3ZSJA 4YZ2A 1IG3A 1OD3A 4LULA 1YFXA 1JOJA 1VAMA 1AXYA 2WQZC 5KXDA 3HOBA 2W95A 4HN1A 2A6ZA 1AXKA 5FPZA 2GP5A 4UW6A 4XF9A 3HPNA 4XBQA 3AKQA 3FHQA 2JKBA 4IEXA 4KBZA 4EE2A 4LO7A 4QX3A 2DVAA 1F35A 1Q8OA 2QQNA 5FQ0B 3OYWB 2QDRA 4DXZA 2A6XA 2E33A 2JD9A 2XJRA 5LW9A 2WO1A 4IE6A 2JECA 3EMRA 4K7JA 4EWAA 3NKTA 3LA7A 1EYBA 1VBD3 4IDZA 4QAWA 4LLFA 4ET7A 5ABJC 2H0BA 3RI9A 3HVDA 4NIGA 1UX6A 3AJZA 2G9FA 1IS4A 2XOMA 2IXHA 3AVSA 5BNNB 2CDPA 4JRLA 1ULPA 1APNA 2VCCA 3ZDSA 3IIAA 1CGPA 4MUVA 2ZEWA 4YZ5A 2BFUS 2HBTA 1J3QA 1D4M1 2LW8A 2W3JA 2FHRA 3A7QA 4YGEA 3WT3A 1BVP1 2V5YA 4QPGC 5I8YA 2PAMA 4AQ2A 3ZFEC 4Y4RA 1WW5A 1LOFA 3ZX7A 1F8VA 2OX0A 3O0XA 4CZSA 2A6WA 2RHPA 1OKOA 1D2SA 3RZJA 1NCRA 2DUQA 2QQMA 2AUYA 2R073 1MS8A 2IC1A 3NL1A 3NNMA 1WZXA 3LA3A 3LF7A 2XR4A 5EXOA 2BNOA 3T2PA 1UOJA 2VBBA 2JG8C 5JSRA 1A6CA 4KWKA 3VZJA 3VKMA 1POQA 1UQXA 2GDFA 1JZ4A 4AQSA 3WG4A 2VOXA 3PIJA 4PJYA 2PHXA 5GZCA 2D6NA 4QPWA 1D7PM 1PO23 4IERA 2XPJA 1RMU1 5A6YA 3D6EA 4Q0UA 1YI9A 1ASJ2 4AAPA 3H50A 1GOGA 5F6LB 3TEXA 4MGZE 4AGRA 2XUMA 4CCCA 5D8AC 2VUAA 3VD5A 4A7YA 1UXZA 2J7MA 5IVYA 1H2NA 1PGL2 5DQ0A 5IHRA 3WNOA 2R1DA 2WS91 4LHLA 1AR73 2RMU3 5DG2A 4P9YA 1WUVA 1XC6A 3UJOA 4NUBA 2F4PA 4QX0A 3T0AA 3ZO0B 4JRAA 1CAWA 3BGAA 1WLCA 1PMIA 1ALYA 1W3VA 2YGMA 2FZ2A 4LTAA 4MGYE 4OQ8A 3SITA 2WN3A 3OGRA 3WHUA 4K40A 1EUTA 1YCIA 4N53B 5J37A 3T0DA 1VAKA 3Q8FA 4CCLA 5GLVA 4LBNA 1UWWA 3WF0A 1OPOA 4CDWA 1LCLA 1F4AA 1AYN3 4LKDA 2C5DA 4BK4A 1QQP1 3I3QA 2Z69A 2VUDA 4QXHA 3U78A 3NAPB 1I1EA 1NCQB 2GC3A 1BBT3 5SV5A 4ASLA 1EP0A 1RIRA 1H9WA 3JXSA 5JSPA 2H0VA 2NMOA 4UBGA 4WVMB 2RS12 4SBVA 4YW1A 2MPFA 4JX0A 3SH4A 3IT8A 1LOEA 2GN7A 4QGLA 4BQ3A 4QU2A 3WQ1A 4RQPA 1OHFA 5FV3A 4CDXA 2VU9A 2JX9A 1GFF2 3H7JA 4A6SA 2RDNA 4FFIA 4OVEA 2VNOA 1PK6A 4QQHA 4QX1A 2RR13 3MV11 3OD0A 5EV7A 3HIFA 5FP9A 3SEPA 2OPWA 2WO3A 1VBB2 1OC1A 4Z2WA 2VZOA 4QX2A 1J3RA 1XBFA 4C1WA 1X9PA 3I59B 4DXSA 4CVUA 3K3OA 3DKQA 4N8MA 2VOWA 5FZCA 4UW5A 3VKLA 3USUA 1JN2P 4J25A 4Q0QA 2HEVF 3EBRA 1UIKA 5T55A 1PZ7A 4LBMA 5BNPC 1I6XA 5CISA 3D4KA 3FLPA 4K8FA 3ENRA 1UKRA 1BLZA 1KEXA 5DAXA 1PM7A 3JD72 3OPWA 5DABA 1RYYA 5G05L 3BUCA 2VZUA 3NSTA 4LQRA 5GZEA 5K9YA 4AI1A 2DCTA 4IV3C 2C0ZA 1NXD1 4L8QA 3GHMA 1I9RA 1ZBA3 1MS9A 4JQRA 4JHZA 4RHV1 4C0BA 1RUH1 1XNTA 5I0TA 2IZWA 2X10A 2ZGRA 2WLQA 3CIHA 3ZYHA 4R9DA 2ORZA 1KXGA 3CZJA 3K51A 1PZ8A 4K9SA 3WDVA 2YG0A 1T6BX 1DCSA 3G7DA 1XPWA 4E8DA 4MO3M 1W03A 2A3WA 3OPTA 2Q1ZB 2V5DA 5F5IA 3LA2A 1I5ZA 3WV6A 1MS4A 2R32A 1U5ZA 1V6NA 1WD4A 5JZGC 4NPLA 1H8TB 1K3IA 1KGYA 1TG7A 2GALA 1RUI3 4HL0A 1US2A 1GU3A 3K48A 3NRUA 4LO8A 1PGW1 4P5HA 5FFOC 4YM3A 1NG0A 1W2AX 2ZGPA 3AB0A 1CPNA 4A3XA 1LHWA 4YNIA 3ZXKA 3EQEA 1P8JA 3HBKA 4MV2A 2OKXA 3V56A 4UYBA 4BE3A 1DU3D 5J3UA 2VOKA 4IEVA 4YLZA 1B35A 2ET1A 2X53S 4QDQA 2DCKA 4JGZA 4I01A 4XFFA 2VMGA 5EP9A 3RI8A 3UETA 1VRH1 3DF0A 3KVBA 2PQSA 1S0GA 5FP3A 3GCXA 4UF0B 2MEV1 1W8OA 2HWD2 3LPFA 2DDUA 1C8M1 3AKSA 4H7MA 4XF0A 3QACA 5D2AA 3VL9A 3DCQA 2WAOA 1ZBE2 1K5MC 4GH4A 3TN92 4LBQA 2JDKA 3W9AA 1R1A1 3I3EA 5C9AA 1LESA 4Q4W1 2QQJA 1NA1C 1NXMA 3KCXA 1JYVA 1SLAA 3WF2A 3K77A 5GALA 4MSVA 4CEYA 1DDLA 5FZOB 2QQLA 4HVRA 2BTVC 4MGTA 2ZZQA 1X7NA 2CWSA 3JQWA 3K4ZA 4XURA 3VBUA 4XQDA 1HIXA 1SPPB 3LCPA 3HJRA 4AL9A 5CFCB 4Y3OA 2ZGNA 1H1IA 3VHPA 2QFEA 1BHGA 1CAVA 2RM21 5DDJ2 5FO8B 4ARYA 1SCRA 5AC93 1LJ7A 3C7EA 3ZYBA 2FCUA 3OJBA 2WWUA 2R061 2RDQA 1DGWA 3J7MA 4PBOA 2A75A 3DPRB 1ZZ6A 3POIA 5ABJB 1VBA2 3LDRA 1YQ5A 3UL2A 5I8SA 3KSCA 3S6PA 5CFDC 5A3TA 3N36A 4Q4X2 1MS5A 2OZ6A 5C3OA 1UOBA 2ZXQA 1MQTA 3VHOA 4AFDA 2WAAA 1PVC3 2VECA 5A7NA 3AJYA 1LU1A 1QDCA 1GV9A 4PDWA 5FPVA 4KL1A 2EIBA 4N43A 1QOSA 2ZEXA 3M8LA 1H2LA 3J9SA 4FCAA 2CWMA 2D5HA 3RS6A 3E6DA 5FKCA 1FOD3 5FYVA 4J1XA 4EZHA 3BU7A 4M0NA 5I0RA 1RHI2 2ZHLA 3ZN5A 3WXPA 1BMV1 1L3JA 1ONAA 1QJFA 2EIGA 2Z5WA 3J8F3 2LRPA 4QQPA 1JYNA 3ST7A 1C1FA 3IDAA 4OZOA 1C4RA 2ZKLA 4MLOA 1RUE3 5T50A 2B39A 2W92A 3ORJA 4DIQA 1W05A 2JG8B 5LBEA 5A7WB 4BMBA 1Y9MA 4AHXA 5A1FA 4TXWA 2ZGMA 3N9LA 3M3EA 1QOTA 2UWBA 4FOWA 4QKBA 1UZZA 2WO2A 1R1ZA 4BISA 4QB2A 2ES3A 3M3IA 2F17A 4LHSA 3LB9A 1NKGA 1OT5A 1MVEA 4OLLA 3ZSKA 4IETA 2W5FA 2D43A 4HPKA 3T2OA 3OCPA 3C7GA 2Z79A 5D8AB 5FYMA 2BWAA 4I0AA 4GAZA 5BYNA 3AL6A 4EYUA 2VNGA 1OLRA 1Z0HA 4XF4A 3THDA 4BK5A 3I3MA 1TMF1 1YO8A 2OS2A 2XVGA 2JDPA 3GBGA 3OGVA 1QJX1 5J48A 1RUC2 2WFF1 1WCDJ 3DXUA 3I49A 1LOFC 5FY8A 3QBQA 2XMLA 4UFKA 3BVCA 4CUCA 5LASA 2AENA 4AVVA 2Y34A 5CA6A 5JIUA 3ITQA 1HB1A 2E26A 5FCCA 5ACA1 3FN9A 4CXXA 1JS9A 2HEWF 1WLWA 3POSA 2G4IA 2A70A 1WCQA 3G6JB 3LEMA 3MEPA 3LEGA 3MIDA 2BBAA 4IL7A 5IK7A 4OHXA 4AVCA 1G6NA 4RFT0 4X8NA 4RHV2 1O3SA 5GJ6A 3VKNA 1XU2A 1W8ZA 1OVPA 1LU2A 3ZFGA 1XRUA 2WZR1 4C1XA 1DQ2A 3WCRA 3O1MA 5J96B 3M3QA 1W0OA 2NLRA 1VALA 3AXEA 4AI0A 4KMQA 3WSOA 4JHTA 3DN7A 1AX2A 3BOWA 3LKJA 5GZGA 5KC6A 5FLIA 2D6OX 5F5QA 4JKMA 4YG6A 2DBNA 4RYDA 1JH5A 2Y38A 3S0MA 2C4XA 3HD8B 4W65A 5FBJA 3WD5A 4XYXA 3UT0A 3WNNA 2ADDA 4IV1C 4XJUA 5I0UA 1H9PA 3A21A 2P3JA 4MGIE 3M3CA 4FOYA 4HBNA 2PFWA 2WA4A 3MDPA 5FYCA 3VB9A 4JC1A 2JE9A 2XXZA 3NKGA 3O0VA 1QJEA 1SQ4A 1C3HA 2QNKA 1S2EA 2C26A 3E5XA 4MXWB 3ZFFC 1Q56A 4FFFA 3CQOA 4Q4Y2 2PELA 3ZLIA 2BVBA 1UIJA 4LA3A 4V1PA 3RPQA 1TME2 1GZTA 3WW2A 4LHNA 3B93A 1LHOA 2DUOA 4XBLA 4AR2A 4JAAA 2QQPA 5BNPB 1RUJ1 1LULA 3KQ4B 1XYPA 2YXSA 1AR92 4QHZA 5FO7B 3WNPA 5JXHA 1IS5A 4BQYA 5JSOA 2FQPA 1OQ1A 4PQ9A 5EJ1B 4KGGA 4QM9A 1H1AA 3MIFA 1ST8A 4AEDC 2TEPA 1SCSA 2VO5A 2ZOEB 3ATGA 4QX5A 2CHHA 2Y6KA 2IWGB 4QPGA 3TB0A 3VBSA 3ZFEA 1PK6C 5FRAA 3S7IA 4Q8KA 1S0CA 1RUF2 1WBFA 2W39A 4H7LA 4LO4B 4G3YC 4CA9A 5D21A 3WF1A 1GOFA 5CZKA 2GH2A 2O14A 1OPMA 3J26N 1NX9A 1J84A 1ZZ7A 3ZKYA 5A33A 2JG9A 4GMP1 2JG8A 4GZ9A 2VMDA 2PYTA 3ZVXA 5L7OA 5F3EA 3QD6A 2VZRA 1IPKA 4E27A 2EVXA 4B7KA 5LEKA 3ZPYA 3A4UA 1FYUA 2CNAA 2D3RA 3IPVB 2FMYA 2RM22 4DZGA 2VZSA 1FI2A 4EQVA 1BK1A 3PUHA 3SCGA 2K9ZA 4ZS2A 4XFGA 3CF6E 1UW8A 2I74A 4RR3C 2R062 1NY71 5JVVA 3LGRA 4E2SA 1IG0A 1ENXA 1L7RA 1AVBA 1FAYA 5CIRA 2B45X 1KFUL 3IMMA 1U12A 4N7IA 5CEHA 2XH6A 2BBVA 1OOPB 2RS13 2O8QA 2YPJA 2RR12 3N7JA 2W2IA 4HN0A 4OHYA 3DXTA 2WWJA 4GWNA 4Z82A 5M0TA 4ONUA 3CBNA 3S5AA 2W68A 1W9YA 5GLWA 5LATA 1OLME 1CAUB 2ZTNA 5FREA 4HOOA 3TEZA 4NMIA 3K4DA 3TWIA 3VZLA 1GP6A 1ULEA 4ZU4A 1CESA 3PUSA 1VBB3 1FMD2 4Y20B 5CVRA 5FXWA 2SBAA 4YZ4A 2A73B 2CL2A 3O12A 2Y6JA 1O4ZA 1W2TA 2WZ8A 1CJDA 3BTAA 1HXS2 4PCRA 5FZIA 1UO9A 1YUDA 1S0EA 3LPGA 3FFQA 3T1LA 2ZCWA 2X5IB 3OY8B 2K0GA 5L36A 2B9UA 3WUCA 2WNVC 3MO4A 3POFA 2RS52 3RG0A 2D93A 4CPBA 3RYRA 1AL22 4NRMA 3M2MA 4HKLA 5BPXA 3JD73 4GB31 3O14A 4JVAA 4FO9A 1H6XA 4URTA 1KS5A 3PUIA 4JZRA 4Z2AA 2WZPP 3WZ1A 1DLCA 3HN3A 5FK7A 3H42B 3I8TA 1C28A 3K3NA 4YW4A 4NIAA 2AACA 4LBQD 1OF3A 4D94A 4XJ8A 1FPN3 2BZDA 1S0BA 2E7AA 2N7GA 1S4CA 2BRTA 1GBGA 2WT1A 3GZTB 3SQOA 4NIIA 1R64A 1AR61 1ZNPA 3DV8A 3T0BA 4FOVA 3TOJA 2JE7A 1ND2A 3S7EA 4NHLA 4KI5M 4GH4C 3ZN6A 2SLIA 2BUKA 4AQTA 4QT6A 4YW7A 1V6JA 4LNVA 5JI7A 3VZNA 4CU8A 4ORFA 4RFRB 3W5MA 1RUI2 3HQRA 3I4IA 5EJ3A 3ZMNA 1QWRA 1DGWX 4BHPA 4XDPA 1OH4A 2VBPA 3H8XA 3NJXA 4M3CF 1QNYA 1W0NA 1V9U1 1WMXA 4JCKA 1G9CA 1RC6A 2BGCA 1RVF1 2IXJA 2VE1A 4WV8A 4CDUC 2E7TA 2E6VA 2UY8A 4IV3A 4QKDA 1O5LA 4OUMA 5JR2A 1LECA 1V6KA 1DZRA 3I2FA 3CJXA 3M70A 1PGSA 2QVSB 2UYAA 4LR4A 3AYEA 3N7LA 4AVBA 5IVBA 1UYPA 1VPHA 4CP0A 2P5BA 1JZ6A 2HKXA 2P3IA 3RZKA 3U10A 4QDRA 3AP6A 5FP4A 3IBMA 4LBLA 4PI0A 3O0WA 4E2GA 4WVZA 1CIYA 1S0JA 3QOPA 4I3PA 5LRSA 1OLQA 2A6YA 5FZKA 2HWD3 3MI8A 2YBKA 5LY2A 3WDYA 4BQ1A 2JE8A 3H0OA 1LODA 3CDZB 4AGGA 1WMDA 4MGQA 1MQTC 5HBAA 4UFIA 1ZBE3 3TN93 1JU3A 3IKWA 1KD7A 1CZVA 1Z7S1 2BGOA 3CO2A 1JHNA 3HQUA 3GNEA 5JZGA 2D3SA 2DCZA 2ARXA 2D40A 2HWE2 2W91A 3IDBB 4N43C 5E16A 5K7PA 2CAUA 5FMDA 4YPJA 5C8CC 1ZYBA 1BKZA 1VBE1 3MFCA 1SZBA 4D8MA 1GUIA 3AZZA 3AFKA 3VLBB 3TEYA 1SBFA 2A6VA 5KHGA 1UZYA 5A7PA 2VOVA 1QH7A 2ZACA 5FP8A 4GKXA 1NCRB 5EQUA 2RV9A 3KLSA 2ZEZA 5E89A 3VBHC 2GMMA 3B01A 2V73A 5H9RA 4NHMA 5DDJ3 3MUY1 1XE8A 5A3NA 4YFWA 3R4DB 4LKFA 3WG1A 3OOXA 4OI0A 1MS3A 2VVFA 3X29B 5CAZA 5LK7B 4E4HA 2VJXA 1CJPA 1W8NA 4LO6B 1O59A 2VZQA 2ATFA 3AKPA 1WCUA 4R8HA 4O9EA 4AWDA 1K5MA 1VBA3 2UWCA 3GHNA 3WP3A 4FPHA 2VNVA 1UL9A 2GMEA 4DOUA 1U5YA 3AKTA 3MLKA 3MUZ1 5J7MA 1W3XA 2AREA 4Q4X3 3J4UH 1LOGA 1NA1A 2YBPA 3KB5A 3PUAA 1IS6A 2PAEA 1B09A 2XUEA 4Q0SA 3R6SA 1PHMA 4I3GA 4HLTA 4NJ4A 4AAXA 2Z4FA 5I8TA 3EYPA 1ZREA 3ACLA 1V0AA 1CAWB 3RNSA 5F5CA 4UFLA 1UY3A 5H9SA 2EXJA 2IXKA 1WCKA 1UNBA 3IAPA 1RHI3 4YW5A 2B7YA 5J98B 4FP3A 5JUVA 1F15A 1ZRFA 1C5IA 2R16A 5L9RA 3ZMOA 3RGBA 4CDWB 1IS3A 4D69A 1ZZBA 5F7UA 1F9KA 1UYXA 1UOFA 1MEC1 4LE4A 5IVFA 3WQ0A 1A78A 1VJ2A 4NHYA 3FHIB 2Y6GA 5EFUA 5FY7A 5CFDA 4JDNA 4MVTA 5FDBA 3H8RA 1GZWA 1QJY1 2E32A 3SNMA 1GWMA 5H9PA 3RYKA 2XG3A 2XL9A 4MXVA 3KV6A 4LMFA 2PMWB 1JYXA 3V0AA 1QIQA 1HV1A 1UY0A 3H1MA 3VHNA 1LEDA 4FPGA 4Z8BA 1JOPA 1AUYA 1V6LA 3B94A 4RQPB 1YFYA 5GLUA 1RUD1 4CDXB 3FUOA 1QGLA 4XCBA 1O5UA 2AH2A 4W6XA 4CEWA 1LRHA 5A3MA 1VRBA 2W87A 1XSRA 3WINE 1PK6B 1RUC3 4FPCA 1JZ8A 2VXJA 4HSLA 4ASKA 1HV0A 2WJSA 4OHZA 4I09A 4D6RA 4L92A 4BYYA 5CKMA 3O5SA 4M3CA 4S2FA 2GMPA 4JDOA 3KV9A 5FZ4A 5F37A 5K4LA 4XE9A 1R081 1ZRRA 1W9WA 2XGXA 3USUB 2Y6HA 1OUSA 3S57A 2TUNA 2WL1A 3N9PA 4JV4A 5DZEA 4YM0A 3SC7X 4COZA 4OUSA 2CU5A 1RUG1 3FE5A 3KF3A 2UURA 4RHV3 3WNLA 1GWLA 2B4KA 1NZCA 1XYOA 3AMMA 1RGSA 4FPYA 4XQ4A 1UY1A 1FXZA 4UBHA 3SKVA 2PLV2 5FYZA 4CP9A 2RDRA 4MADA 4BOWA 3GJBA 3NQHA 5A1LA 2VQAA 1HRI2 1DGLA 5IW0A 1LENA 4U2AA 1AYM1 3HBZA 5FY4A 3RZZA 3TAYA 1OMIA 3JBG2 1BVVA 1COV2 3R4UA 5IUQA 3VBSC 4AVTA 1JMUB 3OEAA 4BDVB 3KVAA 1PVXA 1A8MA 1US3A 3E5UA 3LAGA 3N9MA 4B1MA 2RS31 3IN9A 4H3WA 5FY5A 1STMA 5HPOA 3A23A 2ZGUA 2C6SA 1LB2A 2VW0A 2D98A 5CG8A 3AL5A 3FZ3A 1LTEA 3NJYA 4JKLA 4O65A 2JG9C 4C90A 4RSUA 2DFBA 5L7OC 2HWB1 3I2IA 2YC2A 4P9XA 4B4RA 2ZGLA 2YB7A 3MGUA 4BLIA 4M0HA 3MPPG 1O3QA 2BNNA 5FPLA 1QXPA 4KU7A 5FY9A 3U14A 2JDYA 5JI9A 4Q4Y3 1VBC2 3WHTA 2UU8A 1TME3 1X8EA 4QXKA 2EAKA 3FX3A 1KJRA 4XXPA 1X50A 1RJ8A 5LZ6A 1GICA 1H4HA 4A2UA 3DKWA 2YYOA 2Z42A 3D3AA 1AR93 4IGPA 4BIOA 1BJQA 2WN2A 4IEWA 3MIBA 1C8M3 2I45A 2GC1A 3RZGA 3OD4A 2BNMA 1OVSA 5IAVA 5FZ8A 3L2YA 1B35B 1HKDA 3MPBA 4JGZB 1ULGA 1WA6X 4PIYA 4WVVA 4FI9A 2A3YA 2KD7A 3PJYA 4PT6A 4PHZA 1QJU2 4IV1A 1UYYA 2VBDA 2X09A 1XNCA 4AGVA 1LAJA 2W0XA 3BIWE 1RUF3 5C3SA 1YYNA 2VNRA 3WX5A 2BV4A 4JGYC 2VMFA 4GJZA 5A3WA 4CPBD 3THCA 1WBLA 3RJ2X 4ASMB 1M06G 4GH4B 3ZFFA 4IE4A 4LBQB 3HAGA 3WCSA 1ACCA 2DV9A 2JICA 1ZRIA 1EY2A 3WEZA 1J58A 5C9AB 1EV11 4ISQA 2EICA 4YFZA 2HYKA 2Q1FA 1HN1A 3IB3A 4W50A 5C70A 5IT6A 3CLPA 4Y24A 4H14A 3F2ZA 4XW3A 2RM23 4CEYB 5LBCA 3MIEA 4W4ZA 2W47A 2RJLA 2XBO1 2VUJA 4ZHNA 2HEYF 4IESA 2R7EB 2R042 2R063 3HN1A 3VBUB 2IVIB 3AVRA 5AVPA 3UKVA 4AEDA 1DG6A 1EAH1 2BDRA 2OIIA 4CCNA 4COWA 3ZIXA 2VVEA 2E63A 1CAVB 2Q30A 3BALA 1XQNA 4AE2A 1OUXA 1PIV2 2EXIA 2XKOA 2VCBA 1NAEA 2ILMA 3OBAA 4L9BA 4YWAA 5A3OA 4ARXA 5A32B 4F7ZA 2GNBA 3OBZA 5BUVA 5HV0A 4FFGA 3WY6A 4XUNA 1ND2C 2AEYA 3AMNA 4FAGA 4PIXA 3WW1A 1Y7BA 4YG0A 4C8DA 4AVAA 1G9BA 1YHFA 1TEIA 1KRIA 5JMOA 4INDA 1AR81 4XJZA 3GALA 3QLQA 1FMD3 1NOVA 2BQPA 4DEVA 1XB9A 1WD3A 1MQTB 4R9AA 1OA2A 2X05A 2ZAAA 3I3DA 2FDKA 2XVLA 1UOGA 1HXS3 4PDWB 4E8CA 4QHBA 2EAAA 2PQQA 1W9TA 3OUJA 4N43B 1PO12 2VXRA 4Y1XA 3UV9A 4RR3A 3SH5A 3O1OA 1TZOA 4DEQA 2RS53 1LHNA 2ADEA 5FZDA 5FMOL 4DXTA 2QZ2A 2UYBA 4MHUA 1AL23 1FPN2 4LA2A 4D3WA 1DFQA 5FLJA 1R092 5LA9A 5FOBB 2QBXA 2VZVA 3AK0A 2HWC2 1W6MA 2E51A 2KA3A 1ZM1A 1SACA 3RWNA 5A1AA 2VZPA 1W6QA 3ZXJA 1IQDC 3U4XA 1VBD1 5D1IA 4IEYA 2WNEA 2YHJA 3AM2A 4LITA 4CUBA 4NWWA 1N47A 1HRV1 3BU0A 3Q8BA 1ZZ9A 4TTGA 2XLAA 2KXLA 4KH9A 4HPKB 5T52A 3NNJA 4RGKA 5A6XA 4CXYA 5BNOC 4MOAA 2CTVA 4YG3A 4LBKA 3PLQA 4Q4V1 2WNVA 3ZXFA 3IDEA 3N35A 1R082 1GANA 1SDDB 4Y22A 5JR7B 1H1MA 3DGTA 4Y1ZA 4P9IA 2XL7A 4YM1A 2AZ5A 1JUHA 1POV3 1XNAA 2RDSA 2TBVA 4IE0A 3RFRA 2JKXA 3R0RA 4YGBA 4AEKA 4FTSA 1VMFA 4OI4A 5LA1A 4COUA 3MHZA 3TNPB 1UMHA 3HT2A 4S2DA 3ZPOA 5KWRA 1FV3A 2ZAHA 4Y5SA 1MVQA 1PX3A 1NLSA 4ES9A 2R071 1CWPA 4MGSA 2VMEA 4TN7A 5FP7A 4CCMA 1D4M2 2YU1A 1Y9QA 2QCSB 2DCJA 1W04A 4QX7A 4O7XA 5FWJA 1TNFA 2CGPA 4LIUA 3WP4A 5I0SA 3W5NA 1OKQA 5FBZA 3ZFGB 5KXCA 1GMMA 2IXCA 4Q29A 3LE0A 3DUIA 2E53A 4PF1A 5EZWA 3AX4A 1E5IA 3JUUA 1PO21 4R9BA 1UAIA 4P9LA 3WF3A 4BQ4A 3FBYA 1W06A 4RGAA 1J1LA 1A8DA 3BODA 2ARAA 2VZTA 2BPA2 4XABA 3T30A 1QU0A 4YW6A 2VM9A 2QQVA 2JENA 5HV4A 2XJVA 1AR71 2HWE3 2BP6A 2RMU1 1UU5A 3V64A 4CDUA 3W20A 5A7OA 4QKFA 4Q1PA 3VUOA 1RMU2 3KGZA 3SEEA 1N3QA 3ZSMA 4A7ZA 2W52A 1JHJA 2ZX1A 3BI3A 2GC0A 1M4WA 3VBOC 5AVAA 1HQWA 3AYDA 2HYXA 2L9LA 2WS92 2WT2A 5FZHA 5A32A 3ETPA 4Y5Z0 4HVOA 2D5FA 2VH9A 3FHAA 3KCCA 4LORA 3ZXEA 4ISRA 1V70A 3S30A 5FUNA 2XJQA 3RDIA 3ZDVA 4TZDA 1GP5A 3P3NA 3I2KA 1XJAA 4LK7A 5H9QA 3WG2A 2WYSA 3A22A 5C3QA 1LEMA 3BN6A 5IWFA 2JB4A 3O1SA 1BBT1 1DGRN 3B02A 1E5HA 4FSJA 1PVC2 3NV1A 2CY6A 2WINB 4QPGB 2Y6FA 5C8CA 4CEWC 3VBSB 1ODNA 1A34A 3ZFEB 1O4YA 1QQP2 5F3GA 5C7GA 2G1MA 4N9IA 3BOPA 5FZEA 2LTNA 3PDQA 2ZGOA 1ZX5A 2HH9A 4ZZ8A 5HI0A 3VBHA 1BEV1 5A33B 3N9NA 2JG9B 5GZDA 1ULCA 2ZGTA 5L7OB 4LPLA 4AFCA 3ZN4A 1HQNA 1OA4A 2FBEA 3ACGA 5LA0A 2Y64A 1CD3G 1IHMA 2YFZA 4HETA 4ITCA 2WO7A 1DBNA 4YVSC 5LB6A 5C4WC 1W6PB 5JXIA 4E4SA 1UX7A 1W99A 3DEMA 1ULDA 3RQ0A 1YQ6A 3T09A 3MF6A 4CRQA 4DXRA 5DZFA 1IKPA 3PL0A 5T5OA 3DYPA 1Z78A 3ZM8A 2P4EA 1TQ5A 2XHNA 3CJIC 1LKNA 2NM1A 3BKZA 3AYCA 1DF0A 1ZBA1 2CYFA 1W8HA 2IUWA 4QMAA 2QQKA 1WMEA 4EN8B 5LA2A 5EWSA 4COVA 2VTXJ 4QPIC 3KD4A 1KFXL 4FPKA 2HJIA 3VZOA 4A42A 3A0NA 4EN9B 5FYHA 3VZKA 2VQTA 4IEQA 5L9VA 3LDKA 1NYWA 4QB6A 3AC0A 1N1TA 4QWNA 5IAXA 4PIZA 1RUH2 1U5IA 3QH6A 4FVVA 3GGLA 4WM7A 3SCHA 3VDDA 3WDXA 1WA4A 2BERA 2D3PA 5KC5A 4X6QB 1ENRA 4WM8C 2OYZA 2VUCA 4Y4YA 4GWJA 2FDGA 1JI6A 1QXJA 1E5SA 3RSJA 1WLTA 2VW2A 1GQHA 2WNUC 2BOIA 3MV01 4D7YA 3AZYA 1VLNA 3PTYA 4SLIA 4KWUA 1HB2A 4XC9A 3KT1A 4CDQC 2PLV3 2ZZJA 4F83A 1S0DA 4D6SA 4TYSA 4E4ZA 1HRI3 2VY0A 2BGPA 3DL3A 1UZWA 1SLIA 4XJAA 5JXJA 4AI2A 2P37A 3BCWA 3JBG3 1COV3 1RXFA 3MBWA 4AG4A 2DBIA 3MZHA 4A45A 1ZA4A 3QH7A 2LALA 4ZXKA 1PGW2 2IXLA 4ZKTB 1HB4A 1ND2B 4U36A 1YC61 3K4AA 4B3NA 4A41A 2HBUA 3ZN6B 4A4AA 4RGGA 2VCAA 1DYKA 1LGCA 1VE0A 3BTYA 5A3LA 1HJGA 1OA3A 1RVF3 3K2OA 4XAEA 3NNFA 4NROA 5KHHA 1DQ1A 1YI7A 3C7HA 1MPXA 2BVVA 4WZCA 1VRH2 5C33A 1XNDA 5BNQA 5B2GB 4Y5TA 2MEV2 1VBC3 4D0QA 5CKQA 1C8M2 3ACHA 1GZ9A 1VMHA 2OXBA 4IV3B 1XOYA 1PMJX 4YGDA 4AYUA 5JOZA 3SMHA 3WOGA 4BMEA 1W28A 3BB6A 4IXLA 2DURA 1R1A2 2DVFA 2ZHKA 4OCTA 5E88A 4K1ZA 2Q0AA 2AC1A 4LLOA 1ZZ8A 4TLFA 4Q4W2 5LBFA 2WWSA 3BTZA 1J3PA 3KQRA 4XIOA 3D0JA 4HSJA 1Q8SA 1RXGA 3KS7A 4NVPA 3P3PA 5AC91 3RZMA 4BM8A 2BW8A 1QJZA 5IJRA 1Z7S3 1EUUA 1QJU3 3JCIA 4BPZA 3THPA 4QPYA 5F9TA 4IW3A 4Y1UA 3RVHA 1REFA 1POV0 2A5ZA 4LXLA 3LFMA 4P00B 5FMCA 3OGGA 4F3JA 2ET7A 3N7MA 4UAPA 1JYIA 3V65A 1G7YA 3K46A 5FO9B 5BNOB 2AGSA 2P6HA 3IWZA 4M00A 3PMSA 3VGIA 1JBCA 4AXOA 5JZGB 3AP7A 3ZYFA 4K6BA 1W6PA 2DCYA 3HEIA 5TSWA 5IVEA 1CX1A 3U0ZA 1K5JA 2FDFA 1PVC1 2VC9A 1RB8G 2NMNA 3ACIA 2FDHA 1UMZA 3TNQA 2VMCA 5BXXA 1XE7A 1JZ3A 3VBFA 3PVOA 3ZR6A 1ZRDA 3VBRA 1FOD1 4DS0A 2R043 4XVHA 3T3YA 4UFMA 5DUXA 4YRDA 3SXWA 2GNDA 3J8F1 4GXLA 3C7FA 1G86A 1LGBA 2K2SA 4IE5A 3SKJE 1MACA 3QCWA 4QQLA 5BNNC 1O8SA 3NJVA 4IQPA 3W58A 4HK8A 4CU9A 1BYHA 1RUE1 2ARBA 4TWTA 1PIV3 3LOIA 2ARCA 2AYHA 2QQOA 4QQ2A 4JGYA 3I2HA 5F2WA 1AL0G 1UMIA 3LEKA 1K5MB 1N1VA 2A7AA 1OQEA 2WKKA 1W6OA 1YIPA 3NMBA 1BMV2 1WMFA 1UD1A 1ZA7A 4HXCA 4LKSA 4GULA 4NN0A 3THTA 2DYCA 5F2SA 4ES8A 1W6NA 3KGLA 5DUUA 4X8PA 2Y8KA 3LSEA 4YW3A 1NA1B 5J09A 1BEV2 1BXHA 3NV4A 2QE3A 1YIFA 2GNTA 2O0OA 2WZEA 2W1WA 2ZX0A 4ZY9A 4CUGA 2Q5TA 1O3RA 4FPEA 4ZXEA 5A7QA 2VCMA 3ROUA 3U11A 1S2KA 1ND3C 2ZX3A 4LE3A 1PO13 3R05A 5K8SA 2JJ6A 1LNSA 1NT0A 1OD5A 1URXA 4FAHA 1MEC3 1Q43A 1DP0A 5C3RA 3B5LB 1N1YA 2GN3A 5ERLA 3GBWA 2XWBB 4UW4A 4PBPA 4Q2FA 2LM3A 3IAQA 5FLHA 2X29A 1X9TA 3FL7A 1R093 1S2BA 2VOTA 4BCUA 3I97A 3F95A 1TMF2 2HWC3 1CN1A 5DUWA 2PHFA 3H8UA 2QQIA 3J7HA 1QJX2 4XJWA 5JIAA 3WF4A 3H9AA 5A3UA 5GM0A 2WFF2 1JYWA 3H8OA 2YBSA 5FMBA 1LGNA 3T1MA 4FXKB 2WDBA 5JPNB 4S2GA 5CFDB 4XIKA 3PURA 4XZUG 4P5YA 5LBBA 1GZWB 5AFEA 2WT0A 4Z07A 5ACA2 4AQ6A 3GXUA 1XE0A 1J1TA 3E6BA 1BCXA 4B4PA 4P9GA 3V0AB 2UY9A 3N3HA 4W6WA 5CBLA 1IPJA 4N7UA 2NP0A 5FJHA 5FWEA 2CV6A 1BZWA 5B4XA 2Y26A 1I5PA 5F5AA 5JWPA 4CEWB 1R083 3V0BA 4HKWA 4XFAA 2R6QA 2XJTA 2WZR2 5BV6A 2GSYA 3GZAA 5FMOS 4EV0A 3R4SA 2X8KA 4M3CB 1G9FA 2VULA 2F4LA 3NAPC 4GALA 1NCQC 1GSLA 1UN1A 1WKYA 2PTMA 4L0PA 5FPUA 1D4M3 1H30A 4KGQA 1AYM3 4YVWC 3POBA 2LS6A 1JZ5A 2HWF1 4OYUA 1W2NA 2ZGQA 5C4WB 2YPDA 5FXVA 3WDWA 3BPSA 5I0DA 4Q5OA 4B29A 2YGLA 5BNOA 4JTOA 4CP9B 2YZ4A 3AP4A 1W8TA 3PU8A 2RS33 4DUXA 3RZLA 3VV1A 1NE4A 1CVNA 2J1AA 3NJZA 4I0WB 3POYA 4BZ4A 1ASJ1 3CL1A 4Z1VA 3ILNA 1AX0A 1VB2A 2XDVA 4Q8LA 3ZYIB 4ZU5A 2VD7A 4QHOA 1KQRA 1PGL1 1RUJ2 1N3OA 1MS0A 3WP5A 1OLMA 3JB4C 2E31A 2Y6LA 3JB8A 1YFUA 3UESA 4Z92B 2H6BA 1AJKA 1CQ9A 4FPFA 1N1SA 4DMIA 4DFSA 4EN0A 1RMU3 2OT7A 2PHRA 4CYDA 3I2OA 3ACFA 1UU4A 4UWDA 1NUKA 3WW4A 2J1VA 3T2TA 1AZDA 3AMPA 5ANQA 1KS4A 4LK6A 4KWJA 5T54A 1RITA 4XUQA 1XXNA 2VAUA 3KWVA 2WS93 1F5JA 2V4AA 5FPXA 2R1BA 4XACA 3RJRA 3L2HA 3NNGA 4BQ2A 3KHBA 4EROA 4QX8A 5BY5A 2R49A 3FLRA 1OSGA 2DFCA 3LIHA 2OUJA 1GYKA 4AHZA 5F39A 2VZ3A 4AVSA 1PM4A 2BU9A 3GBFA 3H3UA 4XMAA 5IK4A 3SHRA 3VDCA 4DUWA 2ORXA 4YZ1A 2OPKA 5F6KA 2RS11 2XKPA 3M4FA 4P9WA 4PI2A 4CE8A 3TEWA 4IV1B 4XF3A 5FYUA 1HB3A 1W2UA 3LWCA 1HJFA 4OMCA 3ZYPA 1QQP3 1ZRCA 4AHWA 4QGMA 2OQ6A 4G4FA 4LO5B 1NY72 5LRRA 3VBOA 3KV4A 3LSDA 3MW2A 4V2VA 1W9SA 3N7KA 2OQ7A 5ANNA 1H8TC 3FBMA 5FAXA 1GOHA 3ZFFB 4GJYA 3WNKA 5JOWA 1VBB1 2WNOA 4RS5A 5JOXA 3LEIA 1SFNA 4WM7C 4R4ZA 2D6KA 4Y33A 3VDDC 1FNZA 4Q26A 4B1LA 4CCDA 4EWDA 3VDAA 4PQQA 1YEWA 4JTNA 3MIHA 4IE7A 4URAA 5FZLA 2Q1MA 1GQPA 4ZS3A 1JOBA 3POEA 5EHDA 1OFSA 3ILRA 4S2HA 2Q8EA 4KBBA 4ATEA 1IQAA 1PNFA 1DIWA 5T3NA 1W2OA 4AEDB 2ZMNA 3NW4A 4P14A 3KCYA 2DUPA 4Q1RA 3WVJA 1QEXA 3HNYM 2DU1A 2EIEA 4AHYA 5CG9A 2ENRA 2XONA 1WW4A 2RJKA 4EWEA 5C3PA 4XFBA 2VPVA 1L7LA 3AZWA 3HQXA 3LQCA 3H3LA 3IZOA 2MHFA 1PX4A 4LT5A 1HLCA 5T5LA 1RUNA 5CNAA 4KWLA 4YGCA 1FT9A 5IK5A 3PU3A 1VMJA 2J1TA 2W46A 3CHXA 4GB32 2ZHMA 4B7EA 1H4GA 1JUIA 2JIGA 5IK8A 2WSUA 3PIGA 5HXVA 2RVAA 3HMYA 3UK9A 4NWVA 3H7YA 2DVGA 1XNBA 4EJRA 3O1RA 4GQ7A 2QZ3A 4YVSA 1RUH3 5C4WA 3FUQA 4KG0A 4XF1A 1JU4A 1UZ0A 1YFWA 2RE9A 4OULA 4RR3B 5CFCC 1UCXA 1AR62 3W21A 2Y0IA 2VGDA 3ME2A 1F31A 1Q8QA 3SCFA 1WWYA 1OQDA 2P2KA 4FPLA 4ATFA 3CJIA 5JDBA 1YJKA 3GDBA 1GP4A 4OFGA 4FOQA 3B9CA 4RL7A 3DPRC 1HRV3 3MYXA 1W6MB 2NYYA 3I7DA 4XTPA 3CZUA 4YM2A 5F3IA 4MZUA 1W6QB 4Q0VA 4QD2A 1TNRA 2GZWA 3E97A 3OUIA 4QPIA 2JDAA 3URFA 1V9U2 1CAXB 2ZS6B 3OBTA 5F8PA 1RVF2 4Q4V3 2PAKA 1DYPA 2WFPA 4NIHA 3PNAA 4UFJA 2HWD1 3U07A 3ZXDA 4LHKA 4OHWA 3VD4A 5I93A 2ZX4A 3KF5A 1X82A 2BEOA 5EIYB 1W8UA 1KITA 1YRZA 4WM8A 1ZBE1 2WNVB 1SEFA 1YLLA 1WW7A 3TN91 4Y22B 2YY1A 1VRH3 4PLMA 2WNUA 3RMXA 5J36A 4AFAA 1V6OA 2MEV3 1ND3B 3VBFC 5C8WA 1G9AA 2WABA 1S55A 4XEZA 3NVCA 4XCAA 3VBRC 4CDQA 1KDKA 5FZ6A 3Q8EA 2HWF2 2VG9A 5FY1A 1SBEA 3FMGA 1YWKA 2Q8DA 1Z7S2 3I2GA 4L99A 3I54A 1R1A3 4LKEA 1W39A 5KHJA 4Q4W3 4GWIA 2TNFA 3C3VA 3OBRA 1VBE2 5DDJ1 4NPMA 3ETQA 3BPZA 2K46A 2VMIA 5A6ZA 1VB4A 3PVNA 4HVQA 1UZVA 4AI9A 3EJKA 1VBA1 3B3QE 4DB5A 2DF7A 3IMNA 1ENQA 2J1EA 3C2UA 5L73A 2ZEYA 1F2NA 2B5HA 3CEWA 3WNXA 5KXEA 3ECQA 1ZVFA 2I2SA 4Q4X1 1Q3EA 5F1RA 3AZXA 4DY3A 4F8AA 2C1FA 2ZGSA 2YMZA 4CDUB 1G9DA 5LY1A 3EO6A 2G19A 5DXDA 2DVBA 5EYXA 3CKHA 1W0PA 2JXAA 2W9XA 4J1WA 3J7LA 5FY0A 1QXRA 5FZ3A 4NRQA 3ZOIA 3NV2A 4JDMA 4D6QA 2ZX2A 3J7NA 5FJKA 3WW3A 1RHI1 5L19A 4OI2A 3PUQA 1C1LA 3JQXA 5KHKA 3O1VA 3P5BA 4KQ7A 3U37A 3ZYRA 2FCVA 3HR9A 3IM0A 1S1AA 4C91A 1PMHX 4XTMA 5K0UA 1Y43B 4DNYA 4YYOA 2WYFA 4YVWB 5CU1A 3VN4A 3WQBA 3ILFA 1KJLA 3T4HB 3ZYJB 3MF9A 4XAAA 2ZGKA 4NRPA 1W8WA 2EALA 3AMQA 4LUKA 1DGRA 2DTWA 5EYYA 2WLPA 1RINA 4O9GA 3UYJA 2PA7A 4CXWA 5FQ0A 5IVVA 3OYWA 1BEV3 2FCTA 2XB6C 3EXUA 3FC0A 5C8CB 2WQ4A 1MEC2 2E7QA 3GZEA 5SV8A 5EPAA 1UYZA 4ZZ5A 3OSDA 3MLJA 1RUC1 1MZ5A 1QJY2 3VBHB 2XJPA 2R30A 3H1WA 1KDMA 2XHKA 2YDEA 5BNNA 5L9BA 4CCJA 2JDMA 1CAXA 1RUD2 2J1SA 4XFCA 5E8AA 1TMF3 4BXFA 1OBNA 1QJX3 1GWKA 5HCAA 2WFF3 3M7AA 3DYOA 2JDNA 1IKQA 3UGGA 1C8NA 1JXNA 1QKQA 1UXXX 3UKTA 1S0FA 2O1QA 3C7OA 1OF4A 4OHVA 4AI3A 4A3ZA 4AFBA 2Y60A 4V2WA 1FV2A 4HFSA 3ES1A 3HT1A 5ACA3 3GYDA 4RD7A 3AMHA 2ZMKA 2HLEA 2QDNA 4W6YA 3ZXGA 1C57A 3PVEA 4BXSV 1ND3A 3CU7A 4R9CA 1L7QA 5JAXA 1RUG2 1SBDA 2V4VA 1PNGA 4CP1A 3OF1A 1GNZA 1MZ6A 4FQ4A 3OGJA 2WZR3 1AHSA 3MW4A 1X8MA 1W9FA 1YQ8A 2A71A 3B9IA 2V72A 4IEZA 4XZPA 2D7FA 3LD8A 3PHMA 1AYM2 3MIGA 2UWAA 3KMHA 3OTFA 1QNWA 3D0SA 4FPJA 4OI1A 4WM7B 2GP3A 2VQ0A 3VDDB 5FYBA 4BLJA 2WR9A 1J83A 2Q4SA 1DHKB 4O61A 4QM8A 3TYJA 2BWCA 2RS32 2WA3A 2J1UA 1VIWB 4Q4Y1 2D44A 2Q8OA 5I91A 1OOPC 2D6LX 1TME1 1O7FA 3C8XA 4NAOA 2OZJA 3APBA 3VD7A 2HWB2 1H8VA 3GF6A 2P17A 2YFUA 3NV3A 1D0GA 3U4SA 4XJ9A 4DO0A 4K1YA 1AR91 4CP2A 1BQPA 4UT5A 4P9JA 1DQ4A 3AKRA 1YJLA 1D2QA 1SG3A 1LOCA 2EIDA 4N53A 2DU0A 5GLZA 3ON7A 1AXZA 4CSWA 3CNAA 2PN5A 3ABZA 4META 1RUJ3 5GZFA 1DZQA 3ZIWA 4AI8A 3ZR5A 1RUF1 2X5IC 3AYAA 4UI9L 4UOJA 1WCSA 1XYNA 3GJAA 1IPSA 1IOAA 1NCQA 1W90A 3NAPA 4RS5C 4BU2A 5KR7A 1HDKA 3D8CA 1GKBA 4BB3A 1SDWA 3U1XA 4BQ5A 1AYN1 4WVMA 4XHBA 1ODMA 3KV5A 4YVWA 2IVJA 2OW4A 3I3BA 3D5OA 2YC0A 3WQ7A 1ULFA 2FDJA 4H55A 4N90A 2PHTA 4AZZA 5IVCA 4XMIA 1UF2C 4JQTA 4BWOA 1PZ9A 2E9QA 3ZSEA 3W59A 5LWBA 4D7TA 4NIDA 5FOJB 1CZSA 1Q5OA 1UPIA 4QDSA 3MLLA 5GLTA 1EV12 4GMP3 4DY5A 1REEA 3JZVA 4FP2A 1RL3A 3FJSA 1K45A 3I59A 4KG8A 5FZ0A 4XHXA 3OB8A 2RR11 2XBO2 5J1XA 3VZMA 3HNMA 2G9ZA 1UY2A 2QUOA 2VTFA 2FD8A 5T5JA 2JD4A 5FR3A 2C9AA 4TSVA 1DQ5A 2QJVA 2ID4A 1GNHA 2ERFA 1EAH2 4FXGB 4CU7A 1QY4A 1H2KA 3NNLA 4LUMA 4AW7A 2O8OA 2ZA9A 1FMD1 1SMVA 4MH0E 2PHLA 3RYPA 2AR6A 3INAA 2JB8A 3P6BA 4HONA 3WG3A 2R0FA 3POGA 3VL8A 4E4DX 1HXS1 4IGOA 2ZPXA 1SLTA 2GNMA 4H2AA 4LOTA 1UPSA 3VBFB 5IFTA 2RS51 3KM5A 3VBRB 1AR82 2V09A 1IZ3A 2VVDA 3E5QA 3KHCA 4LBJA 2F6BA 3N4MA 1AL21 4WBBA 1JZ2A 1T2XA 3UNPA 2IXIA 3U75A 1JZ7A 3T2QA 3LDBA 1SLCA 3OUHA 1MR5A 3LOBA 2NPIA 4DQAA 1RUOA 3VKFC 4JGYB 5KHIA 1YQCA 1UU6A 2BFUL 2WQ8A 3N9OA 1NZIA 4MX3A 1CX4A 1H8TA 1W6OB 5DPNA 4AOCA 3O1UA 4GB33 1W6NB 3H3ZA 1EPZA 3KT7A 4WZFA 4Y1YA 2XLFA 2JDZA 2WC2A 3MICA 4DUVA 1NCRC 3S5QA 1VBD2 1NQDA 1QOOA 1RUI1 2CGOA 2J1RA 4HK9A 4XILA 4ZPIA 4DINB 1E5RA 1GQGA 2ZMLA 3IDCB 1HRV2 4AF9A 1GR3A 5IYYA 2B8MA 1AR63 1POV1 1YNAA 4UF0A 1LHVA 2J22A 3RMYA 4E2QA 1NQJA 4HKOA 3WDUA 5HCHA 2AEZA 4IEOA 2A3XA 1WGPA 2ZABA 5F32A 2VL4A 5AFBA 4Q4V2 4UFHA 5IVJA 4R4XA 1WW6A 3VDBA 2RG4A 4N9HA 5HCFA 4AFMA 1H6YA 2W94A 3WDTA 1V9U3 5KXBA 2JIJA 1VP6A 1XU1A 2NQYA 2ZJCA 3AZVA 5FZFA 4BA6A 2WSVA 2CSGA 1V6MA 3ES4A 4XBNA 5FZOA 5FZBA 3RWKX 3LZZA 2R072 3P1IA 4K21A 4XETA 3VD9A 1D0HA 1V6IA 1SPPA 4M4RA 4XDOA 4CCOA 4CUAA 2C9KA 5CFCA 2YV8A 2LUWA 2XQRA 4XUPA 3Q8AA 1QF3A 3E1F1 3UKNA 4MHRA 1OURA 2D6PA 5FK8A 3V0BB 1DZTA 2VMHA 2HWE1 2R0HA 4Y26A 4YZ3A 4FFHA 4COYA 1Q8PA 5C5UA 5LCWL 4CDWC 3IIIA 5C71A 1PO22 5FPAA 5ABJA 3DPRA 5DUVA 3USSA 4PF5A 5JMCA 4EN7B 2HWF3 4P02B 3PVBB 2MNGA 4CCEA 2I07B 2QQUA 4NOTA 1CR7A 5FZAA 2EF6A 2BOJA 4A6OA 2IFRA 5K0UC 5DAQA 2Y33A 5HXMA 5GKAC 1AR72 2RMU2 3Q9OA 5HCBA 1ASJ3 1VBE3 1TE1B 3OG2A 4PLNA 4K20A 1A3KA 2QTWB 2W08A 3H1YA 2GC2A 2PHUA 2QKDA 3LIGA 4RQPC 4XXAA 4CDXC 3UGHA 1OXCA 5FZGA 5T5PA 1MS1A 2PXJA 4L97A 2JDHA 1HQLA 2YC4A 3FFZA 4QKNA 4LOSA 3GCWA 5C5TA 4EN6B 3MFAA 4HT1T 3TRSB 1T6GC 5A6QA 1JYCA 3B69A 1DQ0A 2WUHA 4LBOA 5EJZB 3DECA 1SLBA 1AYN2 3HWJA 5A70A 5A7WA 2VW1A 4QGNA 4M01A 5FXXA 3ALQA 1H2MA 2XVKA 2DWRA 1X33A 4X6RB 1UKGA 1BBT2 4XOGA 3WR0A 3AP5A 4RA0A 4LIVA 1NE6A 2B42B 4I30A 3O1TA 3N9QA 4R52A 3RRDA 2XLGA 3Q8CA 1JW6A 2EA7A 3B00A 4WVWA 5FZMA 1O3TA 4G9SB 5D8AA 5FYSA 1E57A 1G8WA 1SFPA 1Y9GA 5CADA 4FBFA 5DAVA 5DG1A 4BQXA 4Y1VA 3KZ4C 1O91A 2H6CA 2OVUA 3I2DA 4LJHA 3RZHA 3EHKA 1VAVA 2B46X 1J59A 3M3OA 4JKKA 4DRVA 5CKNA 1K12A 4HZFA 2DTYA 1XNKA 3CMGA 1GLHA 5LEJA 4NPRA 5FUIA 3OPZA 4OMDA 3PTRB 5DAPA 5FZ7A 1F4HA 4GD4A 3OGSA 5IFPA 3K75B 3VBOB 3I2JA 4W8JA 5C6CA 1QJY3 2XQXA 1Y3TA 2ZBJA 2P1BA 4RS5B 2EXKA 5B4NA 3ASIA 3SISA 5CYYA 2EXHA 1LHUA 1O6UA 1CPMA 1MZEA 2NZ9A 1ZBA2 4GMP0 4XUTA 2C24A 4B8EA 4BJ0A 4HG6B 4NAMA 4NR1A 1RUD3 4L11A 2PHWA 4Q0PA 1ENSA 1DLLA 3E6CC 4A44A 4AEJA 4E9KA 1B35C 5A3PA 4JGZC 1YXWA 3BTXA 3WP6A 4IUGA 2WRAA 2OUHA 3DYMA 4GIQA 1IGOA 5F3CA 3WUDA 5LK5A 4IGQA 4ZONA 4BIFA 3L9JT 2KM2A 4OZXA 4CTEA 2PLV1 1FX5A 4HMZA 1HRI1 3LFIA 1SLLA 4N53C 4P08A 3SLIA 1Q8VA 4MXWA 5DMYA 2P3YA 1YQ2A 3JBG1 1COV1 4CU6A 5C9AC 3O1PA 1K42A 1RUG3 4FT8A 2YROA 4I02A 1UY4A 2XJSA 3VKOA 4HANA 4XDQA 3BYWA 5FKBA 2IFWA 5A7SA 2G9GA 1SFYA 3EB7A 4LEJA 5BNPA 1AF9A 4MGKE 4QU1A 4CEYC 4MG2A 1RJ7A 4QB1A 4GKYA 2VZ1A 3NO8A 4XUOA 4YVSB 5FPBA 1GZCA 4RN5A 3VBUC 2VR4A 4BQWA 1LOAA 4AEMA 4GWMA 4NO4A 4L2NA 1QDOA 4MYEA 1JODA 1HX6A 5FYIA 5FZ9A 3ELNA 3ZXAC 5ISLA 1VBC1 3HNBM 4KNCA 4NHXA 4PLOA 1SHWB 1CIWA 3A0KA 4QXBA 5FZ1A 3FWEA 3CJIB 3ZSLA 4YSFA 2P6CA 3ZKUA 5DZGA 4FTBA 4NHKA 2LROA 2JEMA 3TBDA 2D97A 1ZZCA 1EPWA 2HWB3 3FLTA 2WBKA 3NWKA 5FTTC 1OH3A 1W8FA 2DVDA 4M3CE 1RTVA 5E1RA 4A7KA 4QPIB 2ETEA 3GM8A 1DQ6A 1CZTA 5JOYA 4GA9A 1U5XA 4FTEA 3IPVA 3POJA 4OUEA 5E6HA 2Z2SB 4EZ4A 2YU2A 5A80A 1AX1A 1QJU1 3AP9A 3GZUC 4PDWC 3D82A 2XWJB 3M1HA 4XQWA 2XJUA 3PJQA 2BJSA 2FMDA 1O4TA 2OA2A 4YW2A 4DRRA 4UW3A 4WM8B 1X36A 1JTZX 3AXDA 4XFHA 2YUEA 4M4PA 5JLVA 2WIIB 4Q27A 2ZKNA 4IEPA 4UXAA 1OOPA 4K3UA 3VHRA 5AC92 1O8PA 2WNUB 2JDUA 5G04L 1Y4WA 4CCKA 1GNYA 1OFNA 2NN8A 5JXGA 1JYTA 1H0BA 3WLUA 4CDQB 2W1SA 2W1UA 3UJQA 5FUPA 4B4QA 2Y0OA 1QH6A 1LOBA 2GH8A 4QQOA 3OEBA 4OQ9A 1CAUA 1DYOA 5FIXA 1XSQA 2KR2A 1HW5A 2RJ2A 4I2OA 1S0IA 1OI6A 2P34A 1ULOA 1VR3A 2R041 3B7MA 4Y20A 5FYTA 2QQWA 5CB7A 4I0BA 1EV13 1HN0A 2CDOA 5FXZA 1BK0A 5JPMB 1QHDA
chains in the Genus database with same CATH topology
3SH3A 3O7OA 2CGNA 2BYVE 3AFGA 1REDA 3JU9A 1I3HA 1FATA 1PIV1 2X5IA 2XBO3 3OY8A 4ZU7A 3ZYGA 5JCTA 4KU8A 1AJOA 1FOD2 1D4VB 3PMEA 4DPNA 5KBFA 2ZHNA 1WLDA 4J6GA 4FQZA 3J8F2 1EAH3 1CONA 1NLRA 4YARA 2PHDA 2FZ1A 1RUE2 4FPOB 3ZXLA 1MZFA 2GU9A 3MW3A 4D7SA 2D6MA 4BH9A 1V00A 3JD71 1PO11 3POWA 1QMJA 2P3KA 4XPVA 4AK3A 1FNYA 2GAUA 1AR83 1F5FA 3KT4A 4IEUA 3ZFGC 1N3PA 4C0HA 2CAVA 1C5HA 1FPN1 1U0AA 1R091 1LR5A 4XFIA 2HWC1 5K0UB 3ZSJA 4YZ2A 4LULA 1YFXA 1JOJA 1VAMA 1AXYA 2WQZC 5KXDA 4HN1A 2A6ZA 1AXKA 5FPZA 4UW6A 4XF9A 4XBQA 3AKQA 2JKBA 4IEXA 4LO7A 2DVAA 1Q8OA 4DXZA 5FQ0B 3OYWB 2QDRA 2A6XA 2XJRA 2JECA 4K7JA 4EWAA 3NKTA 3LA7A 1EYBA 1VBD3 4LLFA 5ABJC 2H0BA 3RI9A 1UX6A 3AJZA 2G9FA 1IS4A 2IXHA 5BNNB 4JRLA 1APNA 1CGPA 3ZDSA 3IIAA 4MUVA 4YZ5A 2BFUS 1J3QA 1D4M1 4YGEA 2FHRA 3WT3A 1BVP1 2V5YA 4QPGC 5I8YA 2PAMA 4AQ2A 3ZFEC 1WW5A 1LOFA 3ZX7A 1F8VA 3O0XA 4CZSA 2A6WA 2RHPA 1D2SA 1NCRA 2R073 2DUQA 2AUYA 3NL1A 1MS8A 2IC1A 5EXOA 3LA3A 2BNOA 2JG8C 5JSRA 1A6CA 4KWKA 3VZJA 3VKMA 2GDFA 4AQSA 3WG4A 2VOXA 4PJYA 2PHXA 5GZCA 2D6NA 1PO23 4IERA 2XPJA 1RMU1 3D6EA 4Q0UA 1YI9A 1ASJ2 3H50A 5F6LB 4MGZE 4AGRA 2XUMA 5D8AC 2VUAA 4A7YA 1H2NA 1PGL2 2R1DA 2WS91 4LHLA 1AR73 2RMU3 5DG2A 4P9YA 1WUVA 3UJOA 3ZO0B 2F4PA 4JRAA 1CAWA 1WLCA 1PMIA 1ALYA 2YGMA 2FZ2A 4LTAA 4MGYE 3SITA 3WHUA 4K40A 1YCIA 5J37A 4N53B 1VAKA 5GLVA 4LBNA 1OPOA 4CDWA 1LCLA 1AYN3 2C5DA 1QQP1 2Z69A 1I1EA 3NAPB 1NCQB 2GC3A 1BBT3 5SV5A 4ASLA 1EP0A 1RIRA 1H9WA 5JSPA 2H0VA 2NMOA 4UBGA 4WVMB 2RS12 4SBVA 4YW1A 2MPFA 3SH4A 3IT8A 1LOEA 2GN7A 4QGLA 4QU2A 3WQ1A 4RQPA 1OHFA 4CDXA 2VU9A 2JX9A 1GFF2 3H7JA 4OVEA 2VNOA 1PK6A 4QQHA 2RR13 5EV7A 3OD0A 3HIFA 1VBB2 4Z2WA 1J3RA 4C1WA 3I59B 2VOWA 4UW5A 3VKLA 3USUA 1JN2P 4Q0QA 2HEVF 3EBRA 1UIKA 5T55A 1PZ7A 4LBMA 5BNPC 1I6XA 3D4KA 3FLPA 4K8FA 3ENRA 1UKRA 3ZXDA 1PM7A 3JD72 3NSTA 5GZEA 5K9YA 4AI1A 2DCTA 4IV3C 2C0ZA 1NXD1 4L8QA 3GHMA 1I9RA 1ZBA3 1MS9A 4JQRA 4RHV1 4C0BA 1RUH1 5I0TA 2IZWA 2ZGRA 2WLQA 4R9DA 1KXGA 3K51A 4K9SA 1PZ8A 3WDVA 3G7DA 2A3WA 2Q1ZB 3LA2A 1I5ZA 3WV6A 1MS4A 2R32A 1U5ZA 1V6NA 1WD4A 5JZGC 1H8TB 2GALA 1RUI3 4HL0A 3K48A 4LO8A 1PGW1 4P5HA 5FFOC 4YM3A 1NG0A 2ZGPA 3AB0A 1CPNA 4A3XA 1LHWA 4YNIA 3ZXKA 3EQEA 4MV2A 3V56A 4BE3A 1DU3D 5J3UA 2VOKA 4IEVA 4YLZA 1B35A 2ET1A 2X53S 2DCKA 4JGZA 4I01A 4XFFA 2VMGA 3RI8A 1VRH1 3DF0A 1S0GA 2MEV1 2HWD2 1C8M1 3AKSA 4H7MA 4XF0A 3QACA 3VL9A 1ZBE2 1K5MC 4GH4A 3TN92 4LBQA 3W9AA 1R1A1 5C9AA 1LESA 4Q4W1 1NA1C 1NXMA 3KCXA 1SLAA 5GALA 4MSVA 4CEYA 1DDLA 4HVRA 2BTVC 2ZZQA 1X7NA 2CWSA 3JQWA 3VBUA 4XQDA 1HIXA 3LCPA 5CFCB 2ZGNA 1H1IA 3VHPA 2QFEA 5DDJ2 1CAVA 2RM21 5FO8B 1SCRA 5AC93 1LJ7A 3OJBA 2R061 1DGWA 4PBOA 2A75A 3DPRB 1ZZ6A 5ABJB 1VBA2 3UL2A 5I8SA 3KSCA 3S6PA 5CFDC 3N36A 4Q4X2 1MS5A 2OZ6A 1MQTA 3VHOA 4AFDA 1PVC3 2VECA 3AJYA 1LU1A 1QDCA 1GV9A 4PDWA 4KL1A 4N43A 1QOSA 3M8LA 1H2LA 3J9SA 4FCAA 2CWMA 2D5HA 3RS6A 3E6DA 1FOD3 4J1XA 3BU7A 4M0NA 5I0RA 1RHI2 2ZHLA 3ZN5A 3WXPA 1BMV1 1L3JA 1ONAA 2EIGA 3J8F3 2Z5WA 4QQPA 3ST7A 1C1FA 1C4RA 2ZKLA 4MLOA 1RUE3 5T50A 2B39A 2JG8B 4BMBA 4AHXA 2ZGMA 4FOWA 3M3EA 1QOTA 2UWBA 1UZZA 1R1ZA 2ES3A 3M3IA 3LB9A 1MVEA 4OLLA 3ZSKA 4IETA 4HPKA 2D43A 3OCPA 2Z79A 5D8AB 2BWAA 4I0AA 5BYNA 2VNGA 1OLRA 1Z0HA 4XF4A 1TMF1 1YO8A 2XVGA 3GBGA 1QJX1 5J48A 1RUC2 2WFF1 1WCDJ 1LOFC 3QBQA 2AENA 4AVVA 5CA6A 5JIUA 5ACA1 5FCCA 2HEWF 1WLWA 3POSA 2G4IA 2A70A 3G6JB 3MEPA 3MIDA 4IL7A 5IK7A 4OHXA 4AVCA 1G6NA 4RFT0 4X8NA 4RHV2 1O3SA 5GJ6A 3VKNA 1XU2A 1LU2A 3ZFGA 1XRUA 2WZR1 1DQ2A 3WCRA 5J96B 3M3QA 1W0OA 2NLRA 1VALA 3AXEA 4AI0A 3DN7A 1AX2A 3BOWA 3LKJA 5GZGA 5KC6A 5FLIA 2D6OX 5F5QA 4YG6A 1JH5A 2Y38A 3S0MA 3HD8B 4W65A 3WD5A 4XYXA 4IV1C 4XJUA 5I0UA 1H9PA 2P3JA 4MGIE 3M3CA 4FOYA 4HBNA 2PFWA 2WA4A 3MDPA 4JC1A 2JE9A 3NKGA 3O0VA 1SQ4A 1C3HA 2QNKA 3E5XA 4MXWB 3ZFFC 1Q56A 4Q4Y2 2PELA 2BVBA 1UIJA 4LA3A 4V1PA 3RPQA 1TME2 3WW2A 4LHNA 3B93A 1LHOA 2DUOA 4XBLA 2QQPA 4JAAA 5BNPB 1RUJ1 1LULA 1XYPA 2YXSA 1AR92 5FO7B 1IS5A 5JSOA 2FQPA 1OQ1A 4PQ9A 4KGGA 4QM9A 1H1AA 3MIFA 4AEDC 2TEPA 1SCSA 2ZOEB 3ATGA 4QX5A 3TB0A 4ATFA 4QPGA 2IWGB 3VBSA 3ZFEA 1PK6C 5FRAA 3S7IA 4Q8KA 1S0CA 1RUF2 1WBFA 2W39A 4H7LA 4LO4B 4G3YC 2GH2A 1OPMA 3J26N 1ZZ7A 5A33A 2JG9A 4GMP1 2JG8A 3ZVXA 2PYTA 5L7OA 3QD6A 1IPKA 4E27A 2EVXA 4B7KA 5LEKA 3ZPYA 3A4UA 1FYUA 2CNAA 2D3RA 3IPVB 2FMYA 2RM22 4DZGA 1FI2A 1BK1A 3SCGA 2K9ZA 4XFGA 3CF6E 1UW8A 2I74A 4RR3C 2R062 1NY71 5JVVA 3LGRA 4E2SA 5CIRA 1ENXA 1AVBA 1FAYA 2B45X 1KFUL 1U12A 4N7IA 2XH6A 2BBVA 1OOPB 2RS13 2O8QA 2YPJA 2RR12 3N7JA 4HN0A 4OHYA 4GWNA 4Z82A 4ONUA 2W68A 5GLWA 1CAUB 2ZTNA 5FREA 3TWIA 3VZLA 1ULEA 4ZU4A 1CESA 1VBB3 1FMD2 4Y20B 5CVRA 2SBAA 4YZ4A 2A73B 2CL2A 3O12A 1O4ZA 1CJDA 3BTAA 1HXS2 4PCRA 1YUDA 1S0EA 3FFQA 3T1LA 2ZCWA 2X5IB 3OY8B 2K0GA 5L36A 2B9UA 3WUCA 2WNVC 2RS52 3RG0A 2D93A 3RYRA 1AL22 3M2MA 4HKLA 5BPXA 3JD73 4GB31 3O14A 4JVAA 4FO9A 4URTA 1KS5A 2WZPP 3WZ1A 3I8TA 1C28A 4YW4A 4LBQD 4D94A 4XJ8A 1FPN3 1S0BA 2E7AA 2N7GA 1GBGA 2WT1A 3GZTB 1AR61 1ZNPA 3DV8A 4FOVA 3TOJA 2JE7A 1ND2A 3S7EA 4NHLA 4GH4C 3ZN6A 2SLIA 2BUKA 4AQTA 4QT6A 1V6JA 4LNVA 5JI7A 3VZNA 4ORFA 1RUI2 3I4IA 5EJ3A 3ZMNA 1QWRA 1DGWX 4BHPA 4M3CF 1QNYA 1V9U1 4JCKA 1G9CA 1RC6A 2BGCA 1RVF1 2IXJA 4WV8A 4CDUC 2E7TA 2E6VA 2UY8A 4IV3A 1O5LA 4OUMA 1LECA 1V6KA 1DZRA 3M70A 3CJXA 4LR4A 2UYAA 1PGSA 2QVSB 4AVBA 3AYEA 3N7LA 4CP0A 2HKXA 2P3IA 3U10A 3AP6A 3IBMA 4LBLA 3O0WA 4E2GA 4WVZA 1S0JA 3QOPA 4I3PA 5LRSA 1OLQA 2A6YA 2HWD3 3MI8A 3WDYA 4BQ1A 3H0OA 1LODA 4AGGA 1WMDA 1MQTC 5HBAA 1ZBE3 3TN93 3IKWA 1KD7A 3CO2A 1Z7S1 1JHNA 5JZGA 3GNEA 2D3SA 2DCZA 2ARXA 2D40A 2HWE2 3IDBB 4N43C 5K7PA 5E16A 2CAUA 5C8CC 1ZYBA 1BKZA 1VBE1 3MFCA 3AZZA 3VLBB 3AFKA 1SBFA 2A6VA 5KHGA 1UZYA 2VOVA 1QH7A 2ZACA 4GKXA 1NCRB 3KLSA 3VBHC 5E89A 2GMMA 3B01A 2V73A 5H9RA 4NHMA 5DDJ3 1XE8A 4YFWA 3R4DB 3WG1A 4OI0A 1MS3A 2VVFA 3X29B 5CAZA 5LK7B 1CJPA 4LO6B 2ATFA 3AKPA 4R8HA 4O9EA 4AWDA 1K5MA 1VBA3 2UWCA 3GHNA 3WP3A 4FPHA 4DOUA 1UL9A 2GMEA 1U5YA 3AKTA 3MLKA 5J7MA 2AREA 4Q4X3 3J4UH 1LOGA 1NA1A 3KB5A 1IS6A 2PAEA 1B09A 3R6SA 4Q0SA 1PHMA 4I3GA 4HLTA 5I8TA 1ZREA 3ACLA 3RNSA 1CAWB 5H9SA 2EXJA 2IXKA 1WCKA 1RHI3 4YW5A 2B7YA 5J98B 4FP3A 1ZRFA 1C5IA 2R16A 3ZMOA 4CDWB 1IS3A 4D69A 1ZZBA 1F9KA 4LE4A 1MEC1 3WQ0A 1A78A 1VJ2A 3FHIB 5EFUA 5CFDA 4JDNA 4MVTA 5FDBA 1GZWA 1QJY1 3SNMA 5H9PA 3RYKA 2XG3A 2XL9A 4MXVA 3V0AA 1HV1A 3H1MA 3VHNA 1LEDA 4FPGA 4Z8BA 1AUYA 1V6LA 3B94A 4RQPB 1YFYA 5GLUA 1RUD1 4CDXB 3FUOA 1QGLA 1O5UA 2AH2A 4W6XA 4CEWA 1LRHA 5A3MA 3WINE 1PK6B 1RUC3 4FPCA 4HSLA 1HV0A 2WJSA 4OHZA 4I09A 4L92A 4BYYA 3O5SA 4M3CA 4S2FA 2GMPA 4JDOA 4XE9A 1R081 1ZRRA 2XGXA 3USUB 2TUNA 2WL1A 4JV4A 5DZEA 4YM0A 4COZA 4OUSA 3FE5A 1RUG1 4RHV3 2UURA 1NZCA 1XYOA 3AMMA 1RGSA 4FPYA 4XQ4A 1FXZA 4UBHA 2PLV2 4BOWA 2VQAA 1HRI2 1DGLA 1LENA 4U2AA 1AYM1 3HBZA 3RZZA 3TAYA 1OMIA 3JBG2 1BVVA 1COV2 3R4UA 5IUQA 3VBSC 4AVTA 1PVXA 1A8MA 3E5UA 3LAGA 2RS31 3IN9A 4H3WA 2ZGUA 1LB2A 2VW0A 2D98A 5CG8A 3FZ3A 1LTEA 4C90A 2JG9C 4RSUA 2DFBA 5L7OC 2HWB1 4B4RA 4P9XA 2ZGLA 4BLIA 3MGUA 4M0HA 3MPPG 1O3QA 2BNNA 1QXPA 4KU7A 5JI9A 4Q4Y3 1VBC2 3WHTA 2UU8A 1TME3 1X8EA 4QXKA 2EAKA 3FX3A 1KJRA 4XXPA 1X50A 1RJ8A 1GICA 1H4HA 4A2UA 3DKWA 2YYOA 2Z42A 4BIOA 1AR93 1BJQA 4IEWA 3MIBA 1C8M3 2I45A 2GC1A 3OD4A 2BNMA 3L2YA 1B35B 1HKDA 3MPBA 4JGZB 1ULGA 4WVVA 4PIYA 2A3YA 3PJYA 1QJU2 4IV1A 1XNCA 4AGVA 2W0XA 3BIWE 1RUF3 1YYNA 2VNRA 3WX5A 4JGYC 1M06G 1WBLA 3RJ2X 4ASMB 4GH4B 3ZFFA 4LBQB 3HAGA 3WCSA 2DV9A 2JICA 5C9AB 1EY2A 1J58A 1EV11 4ISQA 4YFZA 2HYKA 5IT6A 3CLPA 4Y24A 4H14A 4XW3A 2RM23 4CEYB 3MIEA 2XBO1 2RJLA 2VUJA 2HEYF 4IESA 2R042 2R063 3HN1A 3VBUB 5AVPA 4AEDA 3UKVA 1DG6A 1EAH1 4COWA 2OIIA 3ZIXA 2VVEA 2E63A 1CAVB 2Q30A 3BALA 1XQNA 4AE2A 1PIV2 2EXIA 2XKOA 4L9BA 2ILMA 4F7ZA 5A32B 2GNBA 5BUVA 3WY6A 1ND2C 3AMNA 4FAGA 4PIXA 3WW1A 1Y7BA 4YG0A 1G9BA 4AVAA 1KRIA 1YHFA 1TEIA 4INDA 1AR81 4XJZA 3GALA 3QLQA 1FMD3 1NOVA 2BQPA 1WD3A 1MQTB 4R9AA 1OA2A 2ZAAA 2XVLA 4PDWB 1HXS3 4QHBA 2EAAA 2PQQA 4N43B 1PO12 2VXRA 4Y1XA 3UV9A 4RR3A 3SH5A 2RS53 1LHNA 5FMOL 2QZ2A 2UYBA 1AL23 1FPN2 4LA2A 4D3WA 1DFQA 5FLJA 1R092 5FOBB 3AK0A 2HWC2 1W6MA 2E51A 2KA3A 1ZM1A 1SACA 3RWNA 3ZXJA 1W6QA 3U4XA 1VBD1 5D1IA 4IEYA 2WNEA 2YHJA 3AM2A 4NWWA 1N47A 1HRV1 1ZZ9A 2XLAA 2KXLA 4KH9A 4HPKB 5T52A 5BNOC 2CTVA 4YG3A 4LBKA 3PLQA 4Q4V1 2WNVA 3ZXFA 3IDEA 3N35A 1R082 1GANA 4Y22A 5JR7B 1H1MA 3DGTA 4Y1ZA 4P9IA 2XL7A 4YM1A 2AZ5A 1JUHA 1POV3 2TBVA 3R0RA 4YGBA 4AEKA 4FTSA 4OI4A 4COUA 3TNPB 3HT2A 4S2DA 5KWRA 1FV3A 2ZAHA 4ES9A 1MVQA 1NLSA 2R071 1D4M2 1Y9QA 2QCSB 2DCJA 1TNFA 2CGPA 3WP4A 5I0SA 1OKQA 5FBZA 3ZFGB 5KXCA 2IXCA 4Q29A 3DUIA 2E53A 5EZWA 3AX4A 3JUUA 1PO21 4R9BA 1UAIA 4P9LA 3FBYA 4RGAA 1J1LA 1A8DA 3BODA 2BPA2 1QU0A 2JENA 2XJVA 1AR71 2HWE3 2RMU1 1UU5A 3V64A 4CDUA 4Q1PA 3VUOA 1RMU2 3KGZA 1N3QA 3ZSMA 4A7ZA 2W52A 2ZX1A 2GC0A 1M4WA 3VBOC 5AVAA 1HQWA 3AYDA 2WS92 5A32A 2WT2A 4Y5Z0 4HVOA 2D5FA 2VH9A 3KCCA 3ZXEA 4ISRA 1V70A 3S30A 3RDIA 2XJQA 4TZDA 3P3NA 3WG2A 5H9QA 1LEMA 1BBT1 1DGRN 3B02A 4FSJA 1PVC2 3NV1A 2CY6A 2WINB 4QPGB 5C8CA 4CEWC 3VBSB 3ZFEB 1O4YA 1QQP2 4N9IA 3BOPA 2LTNA 2ZGOA 1ZX5A 5HI0A 3VBHA 1BEV1 5A33B 2JG9B 5GZDA 1ULCA 2ZGTA 5L7OB 4AFCA 3ZN4A 1HQNA 1OA4A 2FBEA 4ITCA 1CD3G 1IHMA 4HETA 1DBNA 4YVSC 5C4WC 1W6PB 4E4SA 1ULDA 3RQ0A 3MF6A 4CRQA 5DZFA 1IKPA 5T5OA 1Z78A 1TQ5A 3CJIC 1LKNA 2NM1A 3AYCA 1DF0A 1ZBA1 2CYFA 4QMAA 1WMEA 4EN8B 5EWSA 4COVA 4QPIC 3KD4A 1KFXL 4FPKA 2HJIA 3VZOA 3A0NA 4EN9B 3VZKA 4IEQA 1NYWA 1N1TA 4PIZA 1RUH2 1U5IA 3QH6A 4FVVA 4WM7A 3VDDA 3SCHA 3WDXA 1WA4A 2D3PA 5KC5A 4X6QB 1ENRA 4WM8C 2OYZA 4Y4YA 1QXJA 3RSJA 1WLTA 2VW2A 1GQHA 2WNUC 4D7YA 3AZYA 1VLNA 3PTYA 4SLIA 3KT1A 4CDQC 2PLV3 2ZZJA 4F83A 1S0DA 4TYSA 4E4ZA 1HRI3 2VY0A 3DL3A 1SLIA 4XJAA 4AI2A 2P37A 3BCWA 3JBG3 1COV3 4AG4A 3MZHA 1ZA4A 3QH7A 2LALA 4ZXKA 1PGW2 2IXLA 4ZKTB 1ND2B 4U36A 4B3NA 3ZN6B 4RGGA 1DYKA 1LGCA 5A3LA 1OA3A 1RVF3 5KHHA 1DQ1A 1YI7A 2BVVA 4WZCA 1VRH2 5C33A 1XNDA 5BNQA 5B2GB 2MEV2 1VBC3 1C8M2 1GZ9A 4IV3B 4YGDA 4AYUA 5JOZA 3SMHA 3WOGA 4BMEA 3BB6A 4IXLA 2DURA 1R1A2 2DVFA 2ZHKA 5E88A 4K1ZA 2Q0AA 4LLOA 1ZZ8A 4TLFA 4Q4W2 2WWSA 1J3PA 3KQRA 4XIOA 3D0JA 4HSJA 1Q8SA 3KS7A 4NVPA 3P3PA 5AC91 4BM8A 2BW8A 1QJZA 1Z7S3 1QJU3 3JCIA 4BPZA 5F9TA 3THPA 4QPYA