4Y5TA

Structure of ftmox1 apo with metal iron
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
289
structure length
289
Chain Sequence
DSKPQLQRLAADADVDRMCRLLEEDGAFILKGLLPFDVVESFNRELDVQMAIPPPKGERLLADKYPPHFKYVPNVATTCPTFRNTVLINPVIHAICEAYFQRTGDYWLSAAFLREIESGMPAQPFHRDDATHPLMHYQPLEAPPVSLSVIFPLTEFTEENGATEVILGSHRWTEVGTPERDQAVLATMDPGDVLIVRQRVVHAGGGNRTTAGKPRRVVLAYFNSVQLTPFETYRTMPREMVESMTVLGQRMLGWRTMKPSDPNIVGINLIDDKRLENVLQLKAADSPAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Verruculogen synthase
publication title Endoperoxide formation by an alpha-ketoglutarate-dependent mononuclear non-haem iron enzyme.
pubmed doi rcsb
source organism Neosartorya fumigata
total genus 88
structure length 289
sequence length 289
chains with identical sequence B
ec nomenclature ec 1.14.11.38: Verruculogen synthase.
pdb deposition date 2015-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05721 PhyH Phytanoyl-CoA dioxygenase (PhyH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 4y5tA00
3MGUA 3NNMA 5LASA 2G19A 2RDSA 5HV4A 5C5TA 5ERLA 5L9BA 5IAXA 5LBCA 5L9VA 5DAXA 4J25A 2FCTA 4Q5OA 5LBFA 4BQWA 4BQYA 2HBTA 5HV0A 5LBBA 3HQUA 3OUHA 4XCBA 4ZONA 4XCAA 5IATA 2OPWA 4XABA 3NNLA 5EP9A 5EQUA 3KT4A 3GZEA 2RG4A 2RDQA 4ZPIA 4XAAA 4UWDA 3DKQA 4MHUA 5DAWA 4MHRA 4NHMA 3NNJA 5M0TA 4Y5SA 2V4AA 5DAVA 5DAPA 4Y5TA 4NHXA 2RDRA 5C5UA 3OBZA 2RDNA 3HQRA 2JIJA 3GJBA 4XACA 3KT1A 5LB6A 3PL0A 5LATA 2A1XA 4IW3A 4NHYA 3OUIA 3GJAA 3ITQA 5IAVA 3NNFA 2JIGA 2Y33A 3W21A 2FCVA 5LBEA 2FCUA 5L9RA 5LA9A 5EPAA 3W20A 4KBZA 5A3UA 4NAOA 4NHKA 3KT7A 5DAQA 3OUJA 2HBUA 4NHLA 2G1MA 4BQXA 4NMIA 3BVCA 4XC9A 3EMRA 4JZRA 2Y34A
chains in the Genus database with same CATH superfamily
1OPMA 3FUQA 1V00A 5D2AA 4NIGA 2DFBA 3IPVB 2V72A 3VBSB 4WVWA 3ZXJA 1WMEA 4O65A 3AKSA 4A3ZA 3KHCA 1MS4A 3VBFC 4A7YA 5CIRA 4O61A 3FL7A 2R062 3OBTA 1GOFA 1NLQA 2VOWA 1W05A 4A3XA 2BOJA 5LCWL 1HJFA 1UOJA 1RXFA 4H55A 3I3MA 4EWEA 3R4SA 4YGEA 1GWMA 3LF7A 1EV13 4G4FA 3MUY1 3OD0A 3D6EA 3N9MA 3VKFC 5J37A 1VBD2 3VBUC 3V0BA 2R0HA 1YXWA 1SHWB 2WFPA 4J1XA 1NLRA 1IKPA 5E1RA 2XQXA 4Z8BA 5A7NA 1ND3B 2OKXA 2A75A 3BB6A 3TYJA 3U4XA 4UT5A 1EV11 2IXCA 5I0TA 4LHNA 1Q43A 1UMIA 3RNSA 4Y1ZA 3AYAA 4RQPB 2D40A 4AAPA 2FDKA 1O59A 4XUPA 2VMGA 3A0NA 2VQTA 4QHOA 5GLUA 4NROA 1QGLA 3GBGA 2B39A 1O4TA 2JX9A 2R042 3S57A 4OCTA 5KHGA 1UZYA 2PELA 1H9PA 1BMV1 2ZTNA 2ZX0A 4LNVA 5JVVA 3T1MA 1GZ9A 4PJYA 2W0XA 5CZKA 4E9KA 3PJQA 2O0OA 3VHOA 3VZOA 2A6YA 4BK5A 5KXDA 2R16A 3VN4A 3HN1A 3MBWA 4OQ9A 3MF9A 4FTBA 4P9LA 3AYCA 1J58A 1PVC3 4OUEA 1R1A3 5FPVA 4LQRA 2FDJA 2E53A 2Y8KA 1OBNA 1UOFA 3AXEA 3JQXA 1DCSA 2AZ5A 2D98A 3NJXA 4QKDA 1OFNA 1CD3G 5IT6A 1O3QA 3N7JA 1QHDA 3OGVA 3TEXA 1RUNA 2YXSA 4NPRA 1HB4A 1AZDA 1R1A1 4B7EA 5JLVA 1W2TA 2VTXJ 1IS5A 3RZHA 2A3YA 3PU8A 2W94A 3QH7A 2VZPA 2QE3A 4WVMB 5FMDA 2JECA 5J98B 5A7WA 4FAGA 1W2OA 3BCWA 2PA7A 2XJPA 3H3LA 4DOUA 1CAUB 3SHRA 2YU2A 2DTYA 1XPWA 1W8UA 3RWNA 4YFWA 1W9WA 2HEYF 2PAEA 2R6QA 2WT2A 4PT6A 2D3SA 2XHKA 2ZZQA 3ABZA 3DCQA 5JXGA 3RZMA 4A44A 5CKMA 5JR2A 2VY0A 4XW3A 1UW8A 3H7JA 4P02B 5IHRA 1VB2A 2GN7A 3MO4A 4CCEA 4NOTA 1C3HA 3MW3A 3KQRA 1RUC2 1E5IA 5LEKA 4LO4B 3MLJA 3ZMNA 2ZEXA 2WAAA 4R4XA 1Z7S3 1DGLA 3B00A 4XUQA 4Y5Z0 1SQ4A 3OGRA 3PU3A 5FDBA 3FX3A 3VBOA 2IVJA 2HYXA 2TUNA 3MV11 4Q4Y2 1H9WA 1L7LA 1MS5A 5A3MA 1UKGA 4UFKA 1PGL1 4LA2A 1W6PB 2YC4A 5JMCA 3KVBA 3FZ3A 5T5OA 4AAXA 1QJZA 2ZHLA 2JG8C 5D21A 3O1PA 1NYWA 1Z7S1 2A5ZA 2UYAA 3PUSA 2JB4A 4KG0A 2JXAA 4P9WA 3SH5A 4GB32 4F83A 4B1LA 2DU1A 3B9IA 1PMIA 5BUVA 2VTFA 3J7MA 2WQ4A 2YROA 1QQP2 3FLRA 3WF4A 5A3WA 2VVDA 4ISQA 4RL7A 3POIA 4IEWA 1GWLA 1TNFA 1WWYA 2WAOA 3IDCB 4CU9A 1N1TA 2DV9A 2QQIA 5FPZA 2P5BA 1QDOA 5FCCA 3J8F3 2ZGPA 4LBLA 4QXKA 1JOPA 5KR7A 4MZUA 3FLTA 4LJHA 4QB6A 1XNTA 3NMBA 1E5HA 4P9GA 1JUIA 1YUDA 4CA9A 3LOIA 1OH3A 1XNAA 3VZKA 5A6QA 4ZZ8A 1H2LA 2ZGUA 2XBO2 3ORJA 1ZZBA 4AGRA 5D8AB 1NZCA 3P1IA 3O0WA 4IV1A 2GU9A 3USUB 2CGOA 1HXS2 1BHGA 4MGKE 4H3WA 3HNMA 3FN9A 2ZBJA 4YVWA 5FJHA 1H4HA 3OYWB 5C4WC 2HYKA 3S6PA 1G86A 5C3RA 1W8WA 4W6YA 4Y5SA 4OFGA 2F4PA 4HSLA 1JZ2A 4FT8A 5F1RA 2VVEA 1Q8OA 1J3QA 2ZHMA 3CO2A 1WBLA 1JZ8A 2VXRA 3RQ0A 2PMWB 3JD72 4LK6A 1W6NA 4QXBA 2XMLA 1P8JA 2JDAA 4JGZC 1W8FA 5C9AC 2GSYA 1R64A 2JDKA 3ZFEB 4AVSA 4LK7A 1WCQA 2B9UA 5DUXA 2W52A 5ACA3 3I2HA 2J42A 5L7OC 1DBNA 5C71A 3VUOA 2P6CA 2QJVA 4BPZA 3FHQA 3JQWA 1ZA7A 4R9DA 5FXZA 3VD9A 3WP4A 4I0WB 1UU5A 1NE4A 3VLBB 4DO0A 4AOCA 4J1WA 3WDUA 1AVBA 2CV6A 2ZACA 4YW3A 5ACA1 2DVGA 1OA2A 1CAXA 2LALA 3OJBA 1W90A 1F4HA 1QXPA 2CSGA 3ZKUA 1UY0A 4FAHA 2ZMNA 1XNKA 4Y22B 1UWWA 2JKBA 1LECA 2XWJB 1EV12 5FY5A 2XHNA 3MPBA 4YYOA 4NO4A 2PHXA 5DXDA 4COVA 1G9BA 5IFPA 2H0BA 3R4UA 4N90A 2VZ1A 4RYDA 3C7EA 4LITA 4NIHA 2JG9B 1D0HA 1V6MA 3CZJA 3S5QA 2WNUB 3POYA 1ASJ1 1VALA 4DFSA 3MDPA 4UW4A 5T5JA 3KV9A 3I49A 3VDDC 1BMV2 3EQEA 1I6XA 1GU3A 1O5UA 2GNDA 3WW2A 4HN0A 3T0BA 3MI8A 4XE9A 3VBFB 4D6SA 1YWKA 2BYVE 1W2AX 3DXUA 2CGPA 3HN3A 3ILNA 5IVYA 3JUUA 2WZR3 1BYHA 1LHWA 2TNFA 2W47A 1Z78A 3DKWA 1W99A 4D7TA 1AXKA 4IDZA 3I3DA 4TWTA 3ZX7A 4OQ8A 3BTXA 3LAGA 3LA7A 1OMIA 1C28A 4R9BA 4MGIE 3VBUB 1PVC2 2ID4A 3M1HA 4HPKB 2UWAA 1W9YA 3LB9A 3TNQA 4PI0A 1R1A2 3IIAA 3N35A 2OQ6A 1OI6A 5C3SA 1C8NA 4CCKA 2WZR1 1EUTA 3QLQA 4Q4W3 2JEMA 1K12A 5F2WA 3S30A 4N43B 3C7HA 4V2VA 1YFUA 5DN2A 3WDTA 1HJGA 4BK4A 2Q30A 2QQVA 1LAJA 3HT2A 4RGKA 1QJY1 3DPRC 2RS13 5HPOA 3VD4A 1ENSA 5H9RA 3O1VA 3TEYA 3NJYA 5IFTA 4XAAA 4AI0A 3Q8BA 3C7FA 2VL4A 1ZRIA 3CL1A 2UY8A 5LA0A 1JS9A 4LHSA 1PZ8A 4A6SA 3AX4A 3I97A 4OYUA 5FUIA 5CFCA 1S0CA 3C2UA 4YNIA 2E6VA 4CEWC 4JTOA 1X50A 4ITCA 1OUSA 2RS11 1XE7A 2Z2SB 4YW5A 3ZDSA 2WRAA 1A3KA 2YYOA 2WFF2 2Q1MA 4GD4A 3TOJA 4UOJA 1PM4A 3J9SA 5A7SA 1JZ5A 1B35C 3BYWA 3AMHA 3APBA 3ZXDA 3MZHA 1DG6A 2Q4SA 1AF9A 1RJ7A 1UY4A 4ES9A 1CWPA 3WG1A 2YZ4A 1Z7S2 2WABA 1MVQA 4WV8A 1XYOA 4CU7A 4XMAA 3D4KA 2VMHA 1AYM2 3CHXA 2EXIA 1DQ2A 3DGTA 2OZJA 5KXBA 3RGBA 4CP2A 5FPXA 4LIVA 1JYXA 1H0BA 2D5FA 4JDMA 2VCBA 5A7OA 3IDBB 3KLSA 4BM8A 3MF6A 3T2OA 1RMU2 3T0AA 5A32B 4CDXA 3A7QA 3NVCA 1HV0A 3HIFA 3ZN4A 2ZGKA 4EZHA 4KWJA 1CN1A 2ZJCA 3ALQA 2EALA 1IHMA 3PVNA 2CWSA 3B3QE 1YC61 1LR5A 2XGXA 2YUEA 2VE1A 3WUDA 5EJ3A 1W03A 3PMSA 2HEWF 2ZEYA 5FLHA 3VL8A 4YZ4A 3ME2A 1MS8A 1K5MC 4MX3A 4B3NA 2Y64A 3I3BA 3SQOA 1VPHA 5FZAA 1NOVA 4HXCA 3SH3A 2RJKA 2DBNA 5IJRA 3J8F2 4JKMA 5FZ9A 4AK3A 2HBUA 5I8SA 1RUI2 5KWRA 2YFUA 4UFMA 1AXYA 2PQSA 4QKBA 4YG3A 1E5SA 2Y6GA 1X7NA 5BXXA 5FZIA 1C1LA 1K42A 3S7IA 3MFAA 4LBQA 4JZRA 4ARXA 1T2XA 2DF7A 2JG8B 2VNRA 3KVAA 3LPGA 1W0PA 4P9YA 2ET1A 4N53A 1JUHA 3NNMA 2ADDA 2ERFA 4L8QA 3WDWA 3WLUA 4I2OA 4OI0A 3K3NA 1WGPA 5LK5A 4PQQA 4HVOA 5JUVA 1YQ2A 5ERLA 1CX4A 4MGYE 5TSWA 1ZZ6A 4ZXEA 5LBCA 4K9SA 3GZUC 3AP6A 1SPPB 4KQ7A 2VZSA 4RFT0 5K9YA 3AKPA 2QCSB 1VIWB 3S5AA 3BALA 2AUYA 2WN3A 2YGLA 4DRRA 1DQ4A 4Q8LA 4EE2A 1NY71 1R083 4QPGA 3ROUA 3NQHA 1GP4A 3ZR6A 3CKHA 4EN6B 4IE5A 1V0AA 2G9GA 4AEMA 2RR12 3OUHA 3JB8A 4IE0A 4MLOA 4OHZA 1FNYA 1MVEA 4DXRA 5CFDA 4COZA 1PGW1 4W6XA 1DZRA 1CAWA 2VD7A 5DG2A 2ARAA 1C8M3 4LLFA 3TN92 5ACA2 3VBSC 1S0IA 1WW6A 1IPJA 1R081 2GP5A 5T55A 1OA3A 4K3UA 3N4MA 1QJU1 2VPVA 1N1VA 1TE1B 1UY3A 4HOOA 2X53S 3LPFA 1UD1A 3B9CA 3G6JB 2KM2A 4YRDA 1PZ9A 5C4WB 3VL9A 4XFCA 3T4VA 3H9AA 5FPAA 3OBRA 4ZS2A 5J48A 5GZDA 1NUKA 1C8M1 4GMP3 2IZWA 4LHLA 2D44A 3ZFFC 4YG0A 3RYKA 4CPBA 2LM3A 1ENXA 2BFUS 3UYJA 1U5IA 1XE0A 2VJXA 5BNNA 4S2HA 4X6QB 1D4VB 1HRI2 1KS4A 5KC5A 5FZ1A 2YC0A 1W6OB 1NCRA 2P3KA 1OPOA 4JGZB 1VRH3 4AFBA 4RFRB 5C9AB 3ZN5A 2WINB 4M00A 2WQZC 1IPSA 2WLQA 4GMP1 5CVRA 2Q1ZB 2HH9A 3RWKX 2ZZJA 3AYEA 5FLJA 1POV3 5FRAA 2OYZA 2BEOA 3R6SA 3EJKA 5K0UA 5L7OB 1QKQA 1CGPA 3ZYFA 1PMHX 1LRHA 4CSWA 3WNMA 4XFAA 1IG0A 5C33A 1LHVA 1VRH1 2ZMKA 4XJZA 4UFHA 1REEA 4C8DA 1WLDA 2OUHA 1OOPC 1UY1A 3VBRA 5FYVA 2NMNA 2VUJA 3LA3A 1AR73 1ULEA 3WHTA 5LA1A 3DL3A 2WO7A 3SCFA 3AB0A 1POV1 2XJUA 3RZZA 5IVVA 3B93A 4HVQA 1SBDA 4BQ3A 4K20A 4HMZA 1VE0A 3OEAA 2BERA 4BQ4A 2WZR2 4DS0A 1YIPA 2FD8A 4XXPA 4BQ5A 4GWMA 2W9XA 4MUVA 1LB2A 2Q8DA 4TTGA 3POJA 1ND2C 1QJEA 4A2UA 4PDWA 4CEYA 2YPDA 5JR7B 4X8NA 4IXLA 5F6LB 3AXDA 1AR71 1UYXA 2LTNA 4I3PA 4AI3A 3BIEA 3RI9A 1DQ6A 4Q0QA 1VMJA 4Q4V3 5DAQA 4MG2A 1M4WA 5C8CA 5HBAA 3SMHA 4EQVA 2F6BA 4H7MA 2XUMA 2UWBA 4HETA 1Y4WA 2XQRA 4Q4W2 3VDDB 3ST7A 2WA4A 2RJLA 4IETA 4WZCA 1D2QA 4EYUA 3BVCA 1U5ZA 4Q26A 2ETEA 1SFPA 2ARCA 2QDRA 1HQLA 2RS12 4HG6B 1I5ZA 5JOYA 4Q4V1 4Y24A 5FZ8A 5I0RA 3CF6E 1MQTC 4NRQA 1FOD1 3AFKA 2ZGLA 3FFZA 3WNXA 4I0BA 4OI4A 4BJ0A 1YJLA 1MZFA 1N3OA 4JGYB 5FYCA 5T54A 3PLQA 3T3YA 5C5TA 1O5LA 2PHLA 2ATFA 4PLOA 2XR4A 5LRSA 3E97A 2BPA2 3N36A 3OGGA 2X5IB 4NUBA 5GLTA 1N3PA 3IMNA 4JHTA 2EIBA 3UKVA 1V6LA 3I3QA 1H8TC 2H0VA 3ZN6A 2YBKA 2DBIA 3WNOA 5HXVA 3RZKA 2ZCWA 3HQUA 3MPPG 3CLPA 3CMGA 4B7KA 1RUD3 4AR2A 1CAVA 2R1BA 1H30A 2P6HA 3DPRB 3E5QA 3MIBA 3FHIB 4Q4X3 2K0GA 4FOYA 2EAKA 5GZCA 3MHZA 4XETA 2RE9A 4XF1A 2SLIA 5ABJC 4LORA 3HOBA 3WQBA 1LENA 1W2UA 4FPHA 4JCKA 1DGWX 3SXWA 2FDFA 2YBPA 3VHNA 4N9HA 1BVVA 1QJFA 1GZTA 3GM8A 3ZYBA 4BXFA 5F9TA 1A34A 4CEWB 1W8HA 5GLZA 4Q4X1 4CXWA 2J1AA 1G8WA 5KHHA 2VCCA 2C24A 1ZVFA 4DRVA 3ZM8A 5LW9A 1BBT3 3OYWA 2RDNA 4Q0VA 4BWOA 1RUOA 4QWNA 5JZGA 3U10A 3VD7A 1PK6A 5FZ6A 4YWAA 2WO3A 5CB7A 3H3ZA 3GHMA 3N9LA 1AR63 4Q27A 3RSJA 5JPMB 4UI9L 3WQ0A 5D8AC 1COV3 3H42B 4AYUA 4UFIA 3PL0A 4QX5A 1GANA 1BBT1 5AFBA 2WZEA 3LD8A 4M3CA 2R1DA 5JCTA 5FR3A 2QQJA 5FUNA 3HNBM 4N7IA 5BV6A 5C3OA 3JB4C 4F3JA 3GCWA 1COV1 4P5YA 5BNPA 2P4EA 2WSVA 1NY72 3TEWA 2V5DA 4K21A 4Z2AA 3ZXEA 2BDRA 2Z79A 2VGDA 1D7PM 4FFGA 4JDOA 1APNA 3UGFA 1GNYA 1OF4A 3WDYA 2A71A 4D94A 4LT5A 2EVXA 3FC0A 4I01A 1CZTA 1B09A 4DY5A 2FMYA 3UNPA 1GNHA 1PGW2 1K5MB 1U12A 3NV1A 3WY6A 2QKDA 1AYN3 2F4LA 3H8UA 1LU2A 5FZOA 2ZA9A 1LODA 4QX7A 3N7LA 4I02A 1WW4A 2R073 4ET7A 1R082 2BWAA 1QXJA 4NRPA 3OY8B 4XXAA 2PLV3 1RGSA 1SBEA 5LA2A 2G1MA 4M3CE 1Y9GA 1TME2 1LOEA 2GZWA 3SCHA 3S0MA 4CP9B 4XC9A 1AYN1 3EMRA 1V6OA 4FOVA 1C8M2 4YVSA 1VAMA 2R071 1W39A 2WJSA 3WF2A 2XKPA 1CJDA 5A33B 5F37A 4QT6A 3X29B 3AZYA 1N1YA 1X8EA 2YFZA 3W5NA 2CU5A 3LKJA 1RUH3 4BOWA 4KGGA 4CUGA 5A6YA 3WT3A 1X82A 2VAUA 4CDQC 4XQDA 3U11A 5IVCA 1VAKA 5L9VA 1PO13 3AMNA 3ASIA 4XDOA 3VBFA 3WP6A 4CVUA 2OXBA 3AJZA 1W8ZA 1WW5A 2FCTA 3DYOA 3KSCA 5T50A 2B4KA 4WBBA 2NZ9A 1RVF3 3HMYA 2ZX4A 2B9VA 5FO8B 2HBTA 2YC2A 4WVZA 1RUH1 1VBE3 5T5LA 3NW4A 5LWBA 1HQNA 2WL1A 3ILRA 1VRH2 4QM9A 4IL7A 5FYUA 5J36A 1RXGA 3I2FA 5D1IA 4U2AA 1O7FA 4OLLA 2BW8A 4QX1A 4Z82A 4A42A 4H2AA 2ZGQA 5E88A 2W68A 4D7SA 1ST8A 1RVF1 2J1SA 2WYFA 1XQNA 4HKWA 5LZ6A 2O1QA 4ZU5A 2RS33 3W58A 1KJLA 1FMD3 1VBE1 3LSDA 2DVBA 5A3LA 5GZEA 3DKQA 3G7DA 4CCLA 4BIOA 5F2SA 3MIFA 4PLMA 1UXZA 4BZ4A 4UW5A 1BCXA 1GNZA 2YY1A 1AR72 4W65A 3ZFFB 4PI2A 5KHKA 2QZ2A 1OA4A 4D3WA 1W0NA 4XFHA 2RS31 4KWLA 1FMD1 4QDRA 3UKNA 2ZHKA 1VJ2A 5C5UA 4ZU7A 3AZZA 5C8WA 3NAPB 3J7HA 1YO8A 2GH8A 2UYBA 5CU1A 4CRQA 4N43C 4NPLA 5I0UA 3POSA 1FNZA 5F3IA 1AL23 2QQWA 2QDNA 3POBA 1JZ4A 3BTAA 3EO6A 2RS53 4LUKA 2DURA 3EXUA 1JYVA 2VUAA 1W28A 1XRUA 3ZOIA 4HZFA 1LOBA 4IW3A 1IPKA 1UZVA 4XJ8A 1OOPB 3I59A 2LRPA 5FXWA 3GJAA 2ZX1A 1AL21 2BFUL 5GLVA 1IQAA 1S2BA 2RS51 4GMP0 1NKGA 2P2KA 4GJZA 3WZ1A 3N9PA 4CDWA 1R093 2MNGA 3THTA 3ATGA 4L99A 2ZXQA 3OTFA 1ND2B 3AZWA 4NHKA 1XU2A 2GALA 5FWEA 2OUJA 1K5JA 1RIRA 4KG8A 4N8MA 2D93A 3H0OA 4QHBA 2GMEA 3AKTA 2WNVA 4N9IA 5K7PA 2Y38A 2ZS6B 2AACA 1POV0 1JYWA 5I0SA 4B4RA 3CQOA 2Q1FA 1R091 4IEUA 5FQ0B 5FY8A 1JMUB 2QUOA 4ATEA 4YFZA 1RYYA 2XUEA 1MS1A 2GC3A 3QCWA 1RUD2 3VKMA 4DXTA 4YLZA 4YZ5A 3VBHA 3DYMA 5FYTA 1UKRA 2GMMA 4Q0PA 1YCIA 3PUQA 4K8RB 3CU7A 1FX5A 1FT9A 1MQTB 1BKZA 3LEMA 5DABA 3OPZA 4S2DA 1EYBA 2CTVA 4JQTA 5LASA 2YDEA 3ZLIA 2PAMA 3ZFGA 3OOXA 1L7RA 3ZPYA 2C9KA 5FZBA 3T30A 4R4ZA 1OQ1A 5CAZA 3ZXGA 5EYXA 1OKOA 2L9LA 2GMPA 2VW1A 1DHKB 1U5YA 4YSFA 3RPQA 1STMA 4E4DX 1H8TB 3VZLA 3RZGA 4IEXA 1WCSA 1IOAA 1BBT2 3RJRA 4AHZA 4AE2A 1QH7A 1W6QA 2O8OA 3B69A 4FXKB 2WZ8A 5HV0A 1RINA 3I2DA 3DECA 4XZPA 1JYNA 4CCMA 1FPN3 2JDHA 3WOGA 5FBZA 4ZONA 3D82A 3KQ4B 1AR62 5IATA 3FJSA 4AFDA 4Z2WA 2ILMA 3THCA 3T0DA 1COV2 2HWE3 4JVAA 5HXMA 3NNLA 4QX3A 1V9U3 3AVRA 4PQ9A 2CAUA 2GDFA 2V4VA 5ABJB 2DCKA 2VOTA 2D97A 3U75A 4QX8A 3GALA 2MPFA 3JCIA 4IEPA 4A4AA 4YARA 5I91A 1UZWA 2DCZA 1GMMA 2XJRA 4GALA 3M7AA 4SBVA 2Q8CA 3I8TA 1FPN1 3FBMA 4LUMA 4GWJA 4RR3B 3WDXA 5DAWA 5FZ3A 4IGPA 2QQOA 1H6YA 1BK1A 1KDMA 1WZXA 3LFIA 2HWE1 3K46A 1S0FA 2EAAA 5H9QA 1V9U1 1W8NA 1LHUA 4C91A 4PIXA 1G9DA 3KV4A 4AWDA 4OVEA 4MOAA 4EZ4A 4Y4RA 4MGQA 4Q8KA 3LEGA 1JXNA 4TLGA 5FYSA 3WNLA 2WBKA 1WW7A 2D6LX 1TQ5A 4M0HA 1LOCA 3J4UH 1GZCA 1CZVA 2OQ7A 3DF0A 1YFYA 2R072 4XPVA 5CKNA 3THPA 5A6XA 2VQUA 4LXLA 3IKWA 2PLV2 4AW7A 1KGYA 3NKGA 5EYYA 5FKCA 4UBGA 5ANNA 2XKOA 5DUWA 2A1XA 3ETPA 4FPCA 3P6BA 5C9AA 4QX2A 5FP4A 3GCXA 5FKBA 1OVSA 4YW2A 5L7OA 2VNOA 4B29A 3KGLA 3E5UA 5H9SA 3ZYJB 1S0GA 4XF0A 4K1ZA 2W2IA 1JOJA 1RUH2 3NKTA 5JXIA 1DU3D 2ORXA 1J59A 1Q8PA 4KBZA 4QPWA 4U36A 4HANA 3CNAA 4Y20B 2C6SA 2B42B 2PHWA 1PO12 2HWF2 1V70A 2X8KA 2EXJA 4IEYA 5FXVA 1VRBA 5DPNA 1RVF2 1DZQA 1UOGA 2YGMA 3OBAA 4LEJA 3V0AB 3OG2A 4K6BA 4WM8C 1GKBA 1VBE2 3TB0A 1X9PA 4E2GA 1XC6A 4XVHA 1GZWA 5ISLA 4NHLA 4UBHA 5DDJ3 3RFRA 4D0QA 4C0BA 2OVUA 3VV1A 4AEJA 1IS3A 2ZHNA 1OT5A 3FFQA 4IV1C 3CZUA 3K3OA 2WWJA 1IZ3A 1VBA3 2PN5A 2XVLA 2WO2A 3B94A 4YM2A 3VZMA 3ZO0B 2V5YA 3GXUA 2VTXA 4QKNA 2WQ8A 4NWVA 4YVWC 2AH2A 2RS32 3SISA 3VDDA 1FMD2 2DDUA 1GQHA 3ETQA 2WA3A 1QNYA 5DDJ1 1ASJ3 3ZIWA 5B4NA 3TAYA 4CDQB 1Q3EA 1ACCA 3V64A 5GZGA 4W4ZA 4IGQA 2XVKA 1GLHA 5FP3A 5FY4A 5IAXA 1MZ5A 4YM1A 1O91A 1JH5A 1VBA1 4J25A 2JJ6A 2OW4A 3LDBA 3EB7A 4YW4A 5J7MA 4BQWA 2HKXA 1XNDA 4TXWA 5EXOA 1PVXA 2Y6FA 2VMCA 2CYFA 2JICA 1QNWA 2VBDA 1UX7A 1SLCA 3IB3A 3WUCA 3I3EA 2IFRA 1UMZA 3UJQA 1RUE3 3BOWA 4DIQA 1H4GA 3AVSA 2J1UA 2LUWA 1ENQA 4IEOA 3L2YA 5T3NA 2W87A 4W6WA 1GOGA 3BU7A 5EP9A 1QEXA 4Y1UA 4FBFA 1JN2P 4AFMA 1LGCA 2RDQA 2ZGOA 4P5HA 5T5PA 5IK8A 2VZUA 4RS5B 1F5FA 1S0DA 3ACHA 4IV3C 4JGYC 4LMFA 5I8YA 1RUE1 2VQAA 5FOJB 3AK0A 1NXD1 3AMMA 3D0JA 2X5IC 1QJY3 4XILA 4Y5TA 3I4IA 1R092 2EXHA 2JB8A 1NXMA 3N7MA 4CUAA 4CUCA 1ALYA 3I2JA 1NA1A 3RJ2X 5A3TA 2W1QA 4WM7C 1Y9QA 5EJ1B 1ZZ8A 2K46A 5FY7A 3AMPA 4CDUB 1JZ3A 1YHFA 3KF5A 4RSUA 5JOZA 1NCQB 5CG9A 1EPZA 3OEBA 3BTYA 4XHBA 3LSEA 4BHPA 3LGRA 3N9NA 3E6CC 1LEMA 1B35A 4D7YA 2CHHA 5SV8A 3BU0A 2VO5A 4QGNA 4I30A 2BBVA 5F39A 1KFUL 2BQPA 1ZRDA 4JC1A 1UY2A 1GV9A 4IEZA 3WSOA 4OULA 1BEV3 3M3OA 4YW6A 1JBCA 5JOXA 5JSPA 4EN0A 2J1RA 2RM23 2DCYA 2KR2A 1YEWA 2C1FA 5KXEA 4Y26A 1EP0A 1ZBA3 5C6CA 1MEC3 1V6KA 3KS7A 1XNBA 3DYPA 4RA0A 4I0AA 1PGL2 3H1YA 4NAOA 4XF4A 1DQ5A 2IUWA 4XUNA 1BEV1 4XJUA 1LGBA 1ULDA 4TN7A 2ZKLA 4IERA 4ATFA 1G9FA 3D5OA 3LQCA 2RM21 3S7EA 1J83A 2E26A 5F5AA 4HN1A 1ZBA1 3QD6A 1WBFA 5H9PA 1XB9A 1MEC1 3ON7A 1O8SA 5JOWA 1K5MA 1FPN2 1J84A 1OD3A 2VZVA 4MXWA 1RUG3 4BH9A 1QIQA 5CBLA 1DZTA 1WMDA 3N7KA 2HWE2 3OY8A 5L36A 1UMHA 1UIKA 1V9U2 3I2OA 3WNKA 1ODMA 3ACGA 4LO5B 2UY9A 5FZKA 5CA6A 1HB3A 2JE9A 2JWPA 4FO9A 3HNYM 4C1XA 4GH4A 2HWD3 4INDA 2RDSA 5J96B 4SLIA 4R9CA 1RUG1 2HWC3 2ZAHA 3O1SA 2QZ3A 1LOFC 2VMDA 1OXCA 3MUZ1 3USSA 4ASKA 4Y3OA 5LY1A 2DUQA 4YM3A 4Q5OA 1G7YA 4GJYA 1C5HA 4CCCA 2WYSA 2HWD1 1RTVA 1ONAA 1UNBA 2HWC1 4QAWA 3AFGA 3HQXA 5DG1A 5CEHA 4IEVA 3SKVA 3ELNA 3VB9A 1L3JA 1PX4A 1VMFA 4QPIA 2CDPA 1GFF2 5G05L 2VCAA 2VULA 4LKEA 5A7WB 1OLQA 1S2EA 1PZ7A 5JSRA 5EQUA 2YMZA 1O4YA 4EJRA 3UGHA 2YB7A 2OA2A 2P3JA 5JWPA 2J1EA 4LBQD 3ENRA 5A70A 4MHUA 3IPVA 4YG6A 3PJYA 3VBSA 5L73A 1DP0A 1NG0A 2E7TA 5M0TA 5IVJA 3D3AA 4QDQA 2LS6A 3T2PA 1C5IA 3RYRA 3M3CA 1QJU3 2RDRA 2VMEA 3UJOA 5GM0A 4FSJA 2E31A 2PHDA 5F3CA 4DUWA 1T6GC 3C7GA 3PMEA 1KRIA 2ET7A 2ZMLA 3OCPA 2Q8EA 2PFWA 2W3JA 3NV4A 5IK4A 1YQ5A 4HL0A 3V65A 3W59A 1BJQA 4AI8A 3CJIC 3VBOB 1SLIA 3LDKA 2P37A 3P3NA 5FZ4A 1ND3A 5FP7A 5DDJ2 3ZXKA 4YW1A 2D3PA 4R9AA 4KBBA 3Q8CA 3LIGA 3NO8A 4PIZA 4B8EA 3HWJA 1O3SA 1RUF3 4RQPA 5HCFA 1W2NA 1NT0A 1VBA2 4DEVA 4UFJA 2B8MA 1N3QA 4CCJA 3VKLA 5IK7A 3RMYA 4BISA 3C3VA 1X33A 3W21A 2WIIB 1ASJ2 3E1F1 1OOPA 5L9RA 2VZQA 3PURA 4HK8A 1UOBA 3NAPC 1JW6A 1US2A 3POEA 2B5HA 1X9TA 1RUF1 1LESA 4K7JA 4RGAA 2QQMA 2G9ZA 3NV2A 1EY2A 4CPBD 1WD4A 4WM8B 1TVGA 2XWBB 1PNFA 3POFA 4CCNA 5C7GA 2OT7A 4DMIA 1NZIA 1Q56A 4P9JA 4LULA 5FZMA 1SG3A 3K75B 3KF3A 3Q8FA 4IE4A 2IXLA 4IV1B 4X6RB 1KXGA 4GZ9A 2I2SA 1N1SA 1RUE2 2CGNA 2DU0A 4W50A 5LEJA 3EYPA 4AQ2A 2JDZA 3AP4A 3D0SA 4MO3M 1VBC3 2XPJA 5FREA 4CP0A 2ZGTA 1HRV3 4YVWB 4NPMA 2QNKA 5FTTC 4WVMA 3LA2A 3MV01 3OGJA 2VW0A 4IEQA 4XOGA 5SV5A 3V56A 3T08A 4BB3A 4DUXA 2XJSA 1CAUA 3WEZA 3UL2A 5JAXA 1OLRA 4MXVA 5HV4A 4NIDA 5FZ0A 4ZKTB 2VNGA 1RHI3 2QQLA 2KD7A 1MQTA 2AENA 1JTZX 1VBC1 3WG3A 4XFBA 3RVHA 1HRV1 1QJY2 4FTSA 1AR93 5BNNC 1F9KA 2AGSA 1F5JA 1TEIA 1FOD3 4LKSA 2IC1A 3OB8A 1IGOA 4P14A 4EN7B 2P34A 1V6NA 3U0ZA 5LBBA 1AR83 1EAH3 2J1VA 1SCSA 3TEZA 1RHI1 4QGMA 1O6UA 3HR9A 1XBFA 3IBMA 3BN6A 3NRUA 2B7YA 4XCBA 4MV2A 4XCAA 3WHUA 1SLLA 4BQ1A 5K0UC 2J22A 5C3PA 1AR91 4DZGA 1UU6A 3TWIA 3LEKA 1RITA 2N7GA 4PLNA 3C8XA 3INAA 1OKQA 3BTZA 4IV3B 4URAA 1AR81 1EAH1 1L7QA 1W6PA 2J1TA 1JZ7A 3AP7A 3VBRC 3OGSA 1UXXX 1CR7A 1VBD1 4BLIA 5FMCA 5FYBA 4AHYA 2XH6A 4MHRA 4RD7A 5ABJA 2W08A 2RM22 2Y0OA 5DAVA 2ES3A 3ZXFA 3VDBA 1ZBA2 4XTPA 1A8MA 1HV1A 3PUHA 1MEC2 3RI8A 3FUOA 4Q1PA 4LA3A 4TLFA 5FPBA 5FUPA 2VUDA 1DIWA 4WM7B 4PDWC 5A3OA 2A6ZA 4D6QA 1UYZA 2R041 2DWRA 4RHV3 5EIYB 4IQPA 3MIEA 2JIJA 2VXJA 5C70A 1DLLA 1SDDB 3QOPA 4MVTA 5C8CC 2SBAA 4L2NA 2WKKA 2WNOA 1T6BX 1S2KA 1QWRA 1W8OA 2XVGA 2BOIA 3IT8A 2A6VA 3K4DA 3MICA 5HCBA 2A7AA 3RG0A 4ARYA 1NQJA 2GAUA 4HFSA 4D6RA 1UX6A 4QPYA 1RUG2 2E32A 1QOOA 5D8AA 4AQTA 4NHYA 4RHV1 4RR3C 3USUA 4AVBA 2W5FA 5BNOC 4OHVA 3MLLA 4AVCA 1LJ7A 1POQA 2ZGSA 5A1LA 4LO8A 4LIUA 1WD3A 2YPJA 4A6OA 5B2GB 4JDNA 1UPIA 2HWD2 2ZX3A 3LEIA 4XURA 4YPJA 5BY5A 2BV4A 2QQUA 4JTNA 1FXZA 4UW3A 5JMOA 5A3UA 1W6MB 4DUVA 5FZCA 1K45A 1JHNA 1MS0A 3GYDA 4K40A 4B1MA 2FBEA 3Q9OA 4O9EA 2X10A 4CYDA 2W1SA 3ACIA 2CWMA 2A6WA 2W91A 5AFEA 3ZPOA 3O1TA 2ZKNA 1J3RA 2OIIA 4ASMB 3IAPA 4RN5A 1UIJA 4BLJA 3H8RA 2C9AA 1HW5A 1DQ0A 1S0BA 2FDIA 3ZFEA 1DYPA 3D8CA 1HQWA 4FPGA 2X29A 3V0AA 4YZ3A 1XSRA 3DUIA 5K4LA 5FZ7A 1C1FA 1KFXL 1DF0A 1AXZA 2YU1A 3CDZB 3AP9A 2BVBA 5E6HA 1KQRA 2CL2A 4QU1A 4XBLA 5FO9B 3THDA 1EUUA 1WCUA 4JX0A 1IG3A 2D6NA 5CFCB 2E7QA 1Q5OA 2ZGMA 4MYEA 4WZFA 2RV9A 2BNOA 4QQ2A 5L9BA 4XMIA 2WZPP 5LY2A 1IKQA 4Y33A 2ZX2A 5DAXA 1HN1A 2A3WA 4OMCA 4AVAA 5CYYA 4JQRA 3T2QA 2VM9A 1QJU2 2IWGB 1LOGA 2LROA 4Y22A 4XHXA 2W46A 5JZGC 1XYPA 3M3IA 5J3UA 2GP3A 3ZXLA 2FDGA 1CJPA 1NE6A 4O9GA 3BI3A 5A7QA 2JG9A 3HVDA 3WCRA 1QQP1 4BDVB 2WNUA 2BGPA 4CE8A 2XONA 4Y1XA 2Z5WA 3EHKA 3LZZA 3VKOA 2XJVA 2P1BA 3JXSA 3LFMA 3MIHA 1SLTA 4ZPIA 4CDXB 1RUJ3 1DFQA 3O1UA 1HN0A 3L2HA 1RUF2 4FP2A 1XJAA 2JDNA 1AHSA 4Y1YA 2ZAAA 3QBQA 4WVVA 5CKQA 5FFOC 5FPLA 5BNPC 5JXJA 1CPNA 2GC1A 1DQ1A 2NLRA 2CDOA 1XSQA 4L9BA 4ZU4A 5A3PA 3PDQA 3WX5A 4AEDC 1E5RA 5C3QA 2Q5TA 1W06A 1DGWA 2VW2A 1RUJ1 5JXHA 4M4PA 1YNAA 3F95A 2W95A 3WNNA 4NRMA 5AVAA 5FXXA 4FQ4A 4M01A 4HPKA 3VBUA 3CJIB 2V73A 3HEIA 2EIEA 1ZM1A 3K4ZA 3JD73 4NAMA 5F7UA 3CEWA 3VZNA 4CZSA 5JDBA 4XEZA 1OURA 4N43A 4LBQB 2ADEA 2V09A 3A23A 2OX0A 4RS5C 3TNPB 4QX0A 4OHWA 4N53B 4YVSC 3O0XA 1VLNA 2VH9A 5K8SA 1VBC2 3A0KA 1HRV2 4AFAA 3JD71 2JIGA 2Y60A 5KC6A 3HBKA 2DVDA 4FCAA 4QGLA 5A6ZA 4HT1T 4PCRA 2RVAA 3L9JT 4XFIA 3SC7X 4XJAA 3U1XA 3NL1A 2A70A 2D6PA 3AL6A 4HVRA 3U78A 3W20A 5IUQA 1RHI2 3LWCA 4BQ2A 4CDUC 3KCYA 1VBB3 3K48A 4QPGB 1OHFA 4XIKA 1AR92 1NCQC 1VR3A 1AX1A 1RJ8A 4Q4V2 3ZXAC 1J3PA 3VD5A 2XL9A 1FOD2 4N7UA 3ILFA 2YV8A 1BVP1 5CFDB 4LBMA 4KWKA 1AR82 1EAH2 2EIGA 3GNEA 3I2IA 1ULCA 1XNCA 5CNAA 1CAWB 4BQXA 4DY3A 4E2QA 4JV4A 2ZOEB 3ZVXA 4GKXA 1UL9A 3R4DB 4NR1A 4EV0A 1VBB1 3QACA 4BMBA 5FWJA 2GN3A 1WA4A 4AGGA 1KJRA 1ZZCA 2EIDA 2XL7A 2JDYA 1IQDC 3BOPA 3WR0A 1YI9A 3VKNA 2EICA 1UF2C 2PHFA 5DQ0A 3SCGA 1CIYA 1NX9A 2WR9A 4OZXA 1OF3A 2BWCA 1Q8VA 3LE0A 3UV9A 3NV3A 4OUMA 1QF3A 2Q0AA 4Q29A 4AVVA 1SEFA 5A32A 3CIHA 4Q2FA 2JENA 1JU3A 5CG8A 1SACA 2ENRA 4L11A 3M2MA 1MR5A 5BNNB 2DUPA 1XU1A 5AC93 3RS6A 2JDMA 1LHNA 4KNCA 1NCRB 3O1OA 4ZY9A 4D8MA 2ZPXA 1UCXA 4GWIA 1D2SA 2A3XA 2X09A 2D6KA 1KITA 2JD9A 3K77A 4QQHA 4RHV2 1G6NA 1H1AA 4KGQA 4C1WA 5K0UB 4PF5A 3MIDA 5EV7A 1WLTA 2C5DA 4Q4X2 5AC91 4XABA 2DVFA 4QHZA 1BXHA 4QDSA 4A7KA 2NQYA 3E6DA 3T4HB 1HB2A 1Z0HA 1GUIA 3KT4A 2VZ3A 3GZEA 3A21A 3VBRB 4AHXA 2WUHA 1FV3A 1PVC1 1XYNA 2JG8A 3PIGA 1J1LA 4M0NA 4UWDA 4JRAA 3FE5A 3RZJA 1H1MA 1LKNA 1ZZ9A 3IIIA 2ZEWA 4UW6A 1ENRA 3BODA 4CCDA 4CDWC 2IFWA 3ZYPA 4Y1VA 1LOAA 1ULOA 4FFIA 1NAEA 2QFEA 3F2ZA 4E2SA 4CEYB 4PDWB 2VOVA 3GBFA 4XFFA 4DNYA 2TEPA 5KHJA 1SPPA 3AZXA 5FYHA 1X36A 4XAEA 1QU0A 2AC1A 2WFF3 2WNVC 1FV2A 5FMOS 5C8CB 2G9FA 3GJBA 1F8VA 4XACA 1KEXA 3ZSEA 4CP1A 4EWAA 4TSVA 4ONUA 1Y43B 4L97A 4LTAA 4XYXA 5DZEA 1RL3A 1YQ8A 4FPEA 2RMU3 3TRSB 5E16A 4AFCA 3WW1A 3SNMA 1JYTA 4OMDA 2F17A 2WLPA 4NIIA 1KD7A 3WG4A 1Y3TA 2UURA 1H8VA 3PVEA 4QM8A 3ZSLA 3VBHC 1UPSA 5FZGA 1JI6A 1YYNA 2MEV3 4JKLA 1JYIA 2IXHA 2DYCA 4AL9A 2WFF1 4FPOB 2Z4FA 1AYM3 5BNOB 1YJKA 1XOYA 3GDBA 5IW0A 3RYPA 4J6GA 4BIFA 5B4XA 3I7DA 1JZ6A 4FFHA 5A80A 4DINB 2RMU1 2BTVC 5C4WA 1PO23 3ZFGC 1RMU3 1SMVA 4BYYA 2FCVA 2R0FA 4AI2A 2FCUA 2K9ZA 1LEDA 1SCRA 2XJTA 3AKQA 3N9QA 3WV6A 5FYIA 2MEV1 4JHZA 2X05A 1AYN2 3H8XA 1AYM1 4KU8A 1DDLA 2DCTA 1LULA 1W9FA 2YHJA 2IXKA 3E6BA 3ZN6B 3KT7A 4UFLA 4XF3A 3VBOC 1JHJA 4CXXA 1W04A 2ZGNA 5APAA 2PHUA 3KB5A 1PO21 1W6OA 1VAVA 3KM5A 1RMU1 4IGOA 4UYBA 4BXSV 4JGZA 5JPNB 5HCHA 2D3RA 1CAVB 1GR3A 1AL0G 4IE7A 2Y6JA 3LCPA 3ZDVA 2D43A 2VU9A 4IESA 5GJ6A 3TBDA 1RUI3 3IM0A 4I3GA 4WM8A 4AF9A 3MLKA 4DXSA 2R32A 4FPYA 1US3A 4O7XA 1I9RA 3O1MA 2Y34A 3K51A 3K4AA 3W9AA 1SLAA 3BGAA 4V1PA 5F32A 3T09A 4R52A 1YI7A 3BIWE 2G19A 3HD8B 1K3IA 1RUJ2 3PIJA 2VC9A 3J8F1 3DV8A 1XE8A 3M4FA 4LOTA 3WP5A 1RUI1 1YQCA 2KA3A 1I5PA 2GNMA 4L92A 4MGTA 3N3HA 4HKLA 3U07A 4HKOA 1ZZ7A 1F2NA 1WMXA 2D6MA 3NJZA 3UT0A 4URTA 5JZGB 1PK6B 4LO6B 1H2KA 1DYOA 2E51A 2WNEA 3AKRA 4MADA 2EA7A 4NVPA 4QXCA 3PVBB 5DUVA 3U14A 4CU6A 3DN7A 3KCCA 2DTWA 3WF3A 3WF1A 4Z07A 4M3CB 2RR13 4NN0A 5FK8A 2AYHA 4K8FA 3PHMA 1OQDA 1PHMA 3ZYHA 4KU7A 1QH6A 2P3IA 3AP5A 1OLMA 1DLCA 4NIAA 4AHWA 4ZZ5A 3H50A 3WQ7A 2IXJA 2NMOA 4JRLA 2WO1A 3AMQA 3TN93 3ZYIB 2I45A 2BBAA 1UU4A 3WD5A 5BNPB 3VZJA 2BGOA 5F6KA 1HIXA 1OC1A 5FZLA 4E4HA 1PM7A 2P17A 2RR11 3NNJA 4FOWA 1AX0A 4AEDB 1GICA 1HLCA 3PUAA 5G04L 1BLZA 5A1FA 1TMF3 5FBJA 4IV3A 3SITA 1U5XA 4JGYA 2GNBA 3IDAA 2LW8A 2EXKA 4H7LA 3SEEA 1LTEA 4FI9A 5ANQA 3TN91 4LOSA 2RJ2A 3ZSJA 2JD4A 5FZOB 3E5XA 3OBZA 3O14A 2GC0A 2X5IA 1OD5A 3KV6A 3MIGA 1ZREA 1CIWA 1VBB2 1AL22 3IAQA 3VHPA 4LBJA 2PQQA 1HRI3 3M70A 3O12A 5KBFA 5IVFA 1CPMA 4LBKA 1H1IA 2RS52 5F5QA 2OZ6A 1TZOA 3B5LB 5JIAA 1TMF1 1GBGA 3ES1A 4UF0B 3VDCA 5I0DA 4OHYA 1MZEA 4WM7A 5FO7B 5DZGA 5FYZA 1OLME 3RMXA 4DPNA 4COYA 2VZOA 1RC6A 1GSLA 4M4RA 5KHIA 3C7OA 4YVSB 3R0RA 3DPRA 2Z69A 1G9AA 3I54A 5CISA 1KDKA 3M3QA 3ZSMA 1HRI1 3MEPA 2AEYA 2VMFA 2GC2A 2NM1A 4NJ4A 3MW4A 2FHRA 3O0VA 4XUTA 5GZFA 2Y0IA 1BZWA 1S0JA 1W9SA 2VZRA 4S2GA 3KGZA 4FPFA 4QD2A 1LU1A 3I2GA 1UO9A 2QQKA 5LBEA 3WW4A 1YFWA 3GBWA 4UXAA 4CEWA 3IWZA 4X8PA 4HBNA 1CQ9A 4XDPA 2Y6HA 4TYSA 1W0OA 3UESA 2VCMA 1JODA 4RGGA 2VZTA 5JI9A 3MW2A 3WG2A 1N47A 4XQ4A 5BNQA 1PIV3 2A73B 1PX3A 2D5HA 4QMAA 2J7MA 5FAXA 4W8JA 3WDVA 5AC92 3FBYA 4R8HA 1REFA 1HX6A 1OH4A 5FZFA 1QOTA 2DFCA 4PBOA 1W6MA 2VBBA 2ZEZA 2B46X 4DXZA 1GQGA 5I8TA 1AX2A 2B45X 3PTYA 3WF0A 1LGNA 2WT1A 2HWB3 2WS93 4AI1A 3UETA 2VNVA 3KMHA 5FZEA 1PIV1 1F35A 4OZOA 4YGDA 2JKXA 3ZR5A 3CJXA 3WQ1A 4OUSA 2VECA 3CBNA 1UZ0A 1JU4A 1WCKA 4ZS3A 4FTEA 2Y6KA 5J09A 3ZSKA 1R1ZA 5GLWA 2FZ2A 4BU2A 2HWB1 2WS91 1G9CA 3GZAA 3V0BB 1J1TA 1VMHA 3IMMA 4MGZE 4Q4W1 4QB1A 4B4PA 2A6XA 2GH2A 4HONA 3R05A 4LKFA 4GXLA 1GOHA 1NA1C 2I74A 3JBG3 4DEQA 1W8TA 4XBQA 1O3TA 1LOFA 2R7EB 3HT1A 3KHBA 3LIHA 2O8QA 2WC2A 2E9QA 4GKYA 3FLPA 1OSGA 1UYYA 1HB1A 3GGLA 3MYXA 4AI9A 5J1XA 2CAVA 4P9XA 5FP9A 3ES4A 4E8CA 5LK7B 4C0HA 4TZDA 1AJOA 4B4QA 1PMJX 1OUXA 2OPWA 1ZNPA 2RMU2 4FXGB 2HJIA 3JBG1 3JZVA 4M3CF 1D0GA 4MH0E 1QMJA 3VD3A 3I59B 4A41A 2BGCA 4CP9A 1VP6A 2RG4A 1D4M3 3JU9A 2MEV2 1KS5A 5CFCC 4K1YA 4P9IA 2OPKA 4MGSA 2PYTA 5EFUA 4AQ6A 5FY9A 5IWFA 4CDWB 5A33A 1E57A 4FP3A 2V4AA 5I93A 1PO22 1OFSA 2RHPA 1ULFA 2GNTA 2KXLA 1FATA 3FWEA 3EBRA 1D4M1 1MZ6A 1F15A 2WNVB 4A45A 4E4ZA 2FMDA 4ZXKA 2AREA 4NWWA 3J7NA 1I1EA 4Q0UA 3OSDA 4JAAA 4COUA 3U37A 2C0ZA 2W92A 4QXHA 4GAZA 4GIQA 2IVIB 4PBPA 3UK9A 4AXOA 5JIUA 1CX1A 2BVVA 5HI0A 3KT1A 2FDHA 2WDBA 5LB6A 3OPWA 4FPLA 4DQAA 3VBHB 3J7LA 4QQPA 5LATA 2OS2A 2BZDA 4CDXC 3CJIA 4ASLA 5EJZB 1BK0A 4BA6A 1AJKA 3OUIA 1O3RA 1W3VA 2I07B 5EHDA 3BKZA 1YLLA 2XLGA 1FI2A 3ZYGA 1WCDJ 5HCAA 3ZFGB 3DXTA 2BJSA 1O8PA 4GH4C 4XTMA 5FY0A 5IVEA 2PAKA 2Y33A 3SKJE 4QB2A 4FOQA 5FLIA 5FMOL 2VG9A 3LDRA 5EPAA 5FV3A 2H6CA 1ZBE3 3KZ4C 2ZABA 3WW3A 3ZFFA 1LHOA 5GKAC 4LHKA 1W6QB 4E8DA 2XJQA 3WNPA 4ORFA 2YG0A 4FPJA 3AZVA 3NAPA 1CVNA 5EWSA 3H3UA 4BCUA 1IS6A 4YZ2A 4Z1VA 1A78A 4YZ1A 4GWNA 1A6CA 1Q8QA 1ZBE1 2BUKA 1QJX3 3ACLA 4I09A 1V6JA 4N53C 4QPIC 4Q0SA 4NMIA 3WP3A 4ES8A 2EF6A 2BU9A 3OPTA 4KH9A 3IN9A 4XF9A 4L0PA 3OF1A 1TME3 4YGBA 4XZUG 4XJWA 4KWUA 4XUOA 3SH4A 2TBVA 1W3XA 3Q8EA 1OVPA 1LNSA 4D69A 2QBXA 1V6IA 3AM2A 3KV5A 5E89A 3A4UA 4HSJA 3HPNA 5F5CA 1HKDA 1QJX1 1S0EA 1ULPA 2VVFA 1C57A 4H14A 3BUCA 2XOMA 1UYPA 4LR4A 5FY1A 4AGVA 3B02A 4QPGC 2D6OX 1TME1 5E8AA 1TMF2 5F5IA 3IDEA 2VQ0A 2NN8A 5EZWA 3T2TA 1LCLA 4XDQA 4BQYA 1ND2A 3I2KA 2DVAA 4DB5A 5A3NA 3ZIXA 5CFDC 2ARXA 2PTMA 4CTEA 5BYNA 5LRRA 3N9OA 5FMBA 1ODNA 4JKKA 3H8OA 2PXJA 3FHAA 1H6XA 4ZHNA 1ND3C 4P08A 5FQ0A 4YGCA 3POWA 3ZKYA 4E27A 3W5MA 1M06G 1HDKA 4QKFA 4AG4A 4XJ9A 4RQPC 4XQWA 1NQDA 2CNAA 1MS3A 1SFYA 3B7MA 2R063 2W1WA 4LE3A 4NHMA 3A22A 1AUYA 1F4AA 2ARBA 1W6NB 2XB6C 2WSUA 3PNAA 1NCRC 2DUOA 2WWUA 4GULA 3KD4A 1IS4A 2DCJA 4NHXA 4QQLA 1DGRN 1WLCA 3LOBA 5GALA 1SFNA 2AR6A 1VBD3 5JSOA 4F8AA 2QTWB 1GP6A 2R061 1ZRCA 1H8TA 1PIV2 3HQRA 2UU8A 4OI1A 2P3YA 1GZWB 3H1WA 1W9TA 1A8DA 5CADA 1MPXA 4LPLA 1O4ZA 4FQZA 4LBOA 2CY6A 3PVOA 2JDPA 5F8PA 3M8LA 3SLIA 2HWB2 1CONA 2WS92 1BEV2 2R043 4KMQA 2NYYA 1CZSA 4Y4YA 1CAXB 3ITQA 5IAVA 3KWVA 1U0AA 1S55A 2VOXA 5DUUA 4G9SB 3UGGA 1URXA 2K2SA 3PUIA 4QQOA 2ORZA 4RR3A 2WN2A 4NE9A 4CEYC 5BNOA 1EPWA 2AEZA 5FOBB 1TG7A 2WT0A 3WVJA 2C26A 2D7FA 1H2MA 3ECQA 1SDWA 2BP6A 4AZZA 3T1LA 1I3HA 3AYDA 3JBG2 4BMEA 1WKYA 1YFXA 1ZYBA 2VMIA 3AL5A 2JDUA 1TNRA 3WCSA 3P3PA 1QXRA 5IK5A 3P5BA 2XG3A 4PIYA 2UWCA 1CESA 2BNMA 4LBNA 2VOKA 3WINE 1Y7BA 2R49A 1QY4A 2IXIA 3URFA 3VDAA 5BPXA 2O14A 4PF1A 3RRDA 3WXPA 2PHRA 3J26N 4OI2A 4CCOA 4EN9B 5FK7A 3MGUA 4GA9A 3BPZA 4EWDA 3DEMA 1D4M2 1QDCA 2FQPA 4YM0A 5FPUA 3MFCA 2HWC2 5IVBA 3K2OA 3NJVA 1UQXA 4LKDA 3O1RA 2E63A 2MHFA 1DGRA 4G3YC 1WUVA 1ZX5A 2H6BA 2VR4A 5T52A 4META 1RUD1 1NA1B 4AVTA 2W39A 4MSVA 3GHNA 1JYCA 3GZTB 5JI7A 5LBFA 1RUC3 1UN1A 2XLFA 4Y20A 2FZ1A 2VBPA 1PGSA 4CU8A 1ZRRA 1YQ6A 1C4RA 3B01A 3M3EA 3O5SA 1B35B 3SEPA 4Q4Y3 5FP8A 1WLWA 3UKTA 2HLEA 3O7OA 1SZBA 1X8MA 1GWKA 1NLSA 1RUC1 2JE8A 2VUCA 4GQ7A 1SBFA 4Q1RA 4A7ZA 2WWSA 4IE6A 3NWKA 4QU2A 2ZGRA 4GB33 3FMGA 3H1MA 4COWA 2QVSB 1GP5A 4HLTA 2JE7A 3BPSA 4Q4Y1 5FYMA 1MACA 1QQP3 1S4CA 4FFFA 1FAYA 1FYUA 1AR61 5DAPA 3RDIA 2E33A 1OQEA 4CDQA 4EN8B 3U4SA 1SLBA 5IYYA 1PK6C 1WA6X 1WMFA 2XXZA 3NSTA 4ISRA 3ZYRA 1ZBE2 3H7YA 4GB31 2QQPA 1S1AA 5KXCA 2NP0A 4AEDA 3AC0A 3HJRA 1F31A 3GF6A 5A7PA 4E4SA 1JOBA 3NNGA 3RZLA 4OHXA 2Z42A 1UAIA 5DMYA 2Y6LA 1Y9MA 4MXWB 2XLAA 2XBO3 5DZFA 3ZMOA 1DYKA 5AVPA 3ZFEC 1HXS3 4FPKA 4AQSA 4XFGA 1QJX2 1YIFA 4EROA 3POGA 1RB8G 4LO7A 4LLOA 1QOSA 5FYYA 1VB4A 4UF0A 2W1UA 1UZZA 3ACFA 4CUBA 3NNFA 4CXYA 4GH4B 1ZA4A 4FVVA 4BE3A 1REDA 4RS5A 2Q8OA 4UAPA 4AEKA 4S2FA 2XBO1 2BRTA 5FIXA 2G4IA 3Q8AA 2R30A 2XDVA 1HXS1 2Y26A 1XXNA 4YW7A 5L19A 1GYKA 2PLV1 5LA9A 1YRZA 2PHTA 3OD4A 5F3EA 2C4XA 1H2NA 5F3GA 4P00B 2HEVF 4PHZA 4V2WA 5A1AA 3PTRB 1PNGA 1BQPA 1ZRFA 3HBZA 3QH6A 3VHRA 2YBSA 4C90A 4XBNA 4IUGA 1MS9A 4KL1A 2HWF3 4LE4A 2QQNA 4CDUA 3VGIA 4F7ZA 3IZOA 2NPIA 3OUJA 5FJKA 1NCQA 1Q8SA 2E7AA 4QPIB 2JG9C 5FZDA 3HAGA 2BNNA 1GQPA 2WNUC 4KI5M 3KCXA 1ULGA 5FZHA 4HK9A 3AJYA 4Z92B 4XIOA 1PO11 2HWF1
chains in the Genus database with same CATH topology
3MGUA 3NNMA 5LASA 2G19A 2RDSA 5HV4A 5C5TA 5ERLA 5L9BA 5IAXA 5LBCA 5L9VA 5DAXA 4J25A 2FCTA 4Q5OA 5LBFA 4BQWA 4BQYA 2HBTA 5HV0A 5LBBA 3HQUA 3OUHA 4XCBA 4ZONA 4XCAA 5IATA 2OPWA 4XABA 3NNLA 5EP9A 5EQUA 3KT4A 3GZEA 2RG4A 2RDQA 4ZPIA 4XAAA 4UWDA 3DKQA 4MHUA 5DAWA 4MHRA 4NHMA 3NNJA 5M0TA 4Y5SA 2V4AA 5DAVA 5DAPA 4Y5TA 4NHXA 2RDRA 5C5UA 3OBZA 2RDNA 3HQRA 2JIJA 3GJBA 4XACA 3KT1A 5LB6A 3PL0A 5LATA 2A1XA 4IW3A 4NHYA 3OUIA 3GJAA 3ITQA 5IAVA 3NNFA 2JIGA 2Y33A 3W21A 2FCVA 5LBEA 2FCUA 5L9RA 5LA9A 5EPAA 3W20A 4KBZA 5A3UA 4NAOA 4NHKA 3KT7A 5DAQA 3OUJA 2HBUA 4NHLA 2G1MA 4BQXA 4NMIA 3BVCA 4XC9A 3EMRA 4JZRA 2Y34A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MGU A;  3NNM A;  5LAS A;  2G19 A;  2RDS A;  5HV4 A;  5C5T A;  5ERL A;  5L9B A;  5IAX A;  5LBC A;  5L9V A;  5DAX A;  4J25 A;  2FCT A;  4Q5O A;  5LBF A;  4BQW A;  4BQY A;  2HBT A;  5HV0 A;  5LBB A;  3HQU A;  3OUH A;  4XCB A;  4ZON A;  4XCA A;  5IAT A;  2OPW A;  4XAB A;  3NNL A;  5EP9 A;  5EQU A;  3KT4 A;  3GZE A;  2RG4 A;  2RDQ A;  4ZPI A;  4XAA A;  4UWD A;  3DKQ A;  4MHU A;  5DAW A;  4MHR A;  4NHM A;  3NNJ A;  5M0T A;  4Y5S A;  2V4A A;  5DAV A;  5DAP A;  4Y5T A;  4NHX A;  2RDR A;  5C5U A;  3OBZ A;  2RDN A;  3HQR A;  2JIJ A;  3GJB A;  4XAC A;  3KT1 A;  5LB6 A;  3PL0 A;  5LAT A;  2A1X A;  4IW3 A;  4NHY A;  3OUI A;  3GJA A;  3ITQ A;  5IAV A;  3NNF A;  2JIG A;  2Y33 A;  3W21 A;  2FCV A;  5LBE A;  2FCU A;  5L9R A;  5LA9 A;  5EPA A;  3W20 A;  4KBZ A;  5A3U A;  4NAO A;  4NHK A;  3KT7 A;  5DAQ A;  3OUJ A;  2HBU A;  4NHL A;  2G1M A;  4BQX A;  4NMI A;  3BVC A;  4XC9 A;  3EMR A;  4JZR A;  2Y34 A; 
#chains in the Genus database with same CATH topology
 1OPM A;  3FUQ A;  1V00 A;  5D2A A;  4NIG A;  2DFB A;  3IPV B;  2V72 A;  3VBS B;  4WVW A;  3ZXJ A;  1WME A;  4O65 A;  3AKS A;  4A3Z A;  3KHC A;  1MS4 A;  3VBF C;  4A7Y A;  5CIR A;  4O61 A;  3FL7 A;  2R06 2;  3OBT A;  1GOF A;  1NLQ A;  2VOW A;  1W05 A;  4A3X A;  2BOJ A;  5LCW L;  1HJF A;  1UOJ A;  1RXF A;  4H55 A;  3I3M A;  4EWE A;  3R4S A;  4YGE A;  1GWM A;  3LF7 A;  1EV1 3;  4G4F A;  3MUY 1;  3OD0 A;  3D6E A;  3N9M A;  3VKF C;  5J37 A;  1VBD 2;  3VBU C;  3V0B A;  2R0H A;  1YXW A;  1SHW B;  2WFP A;  4J1X A;  1NLR A;  1IKP A;  5E1R A;  2XQX A;  4Z8B A;  5A7N A;  1ND3 B;  2OKX A;  2A75 A;  3BB6 A;  3TYJ A;  3U4X A;  4UT5 A;  1EV1 1;  2IXC A;  5I0T A;  4LHN A;  1Q43 A;  1UMI A;  3RNS A;  4Y1Z A;  3AYA A;  4RQP B;  2D40 A;  4AAP A;  2FDK A;  1O59 A;  4XUP A;  2VMG A;  3A0N A;  2VQT A;  4QHO A;  5GLU A;  4NRO A;  1QGL A;  3GBG A;  2B39 A;  1O4T A;  2JX9 A;  2R04 2;  3S57 A;  4OCT A;  5KHG A;  1UZY A;  2PEL A;  1H9P A;  1BMV 1;  2ZTN A;  2ZX0 A;  4LNV A;  5JVV A;  3T1M A;  1GZ9 A;  4PJY A;  2W0X A;  5CZK A;  4E9K A;  3PJQ A;  2O0O A;  3VHO A;  3VZO A;  2A6Y A;  4BK5 A;  5KXD A;  2R16 A;  3VN4 A;  3HN1 A;  3MBW A;  4OQ9 A;  3MF9 A;  4FTB A;  4P9L A;  3AYC A;  1J58 A;  1PVC 3;  4OUE A;  1R1A 3;  5FPV A;  4LQR A;  2FDJ A;  2E53 A;  2Y8K A;  1OBN A;  1UOF A;  3AXE A;  3JQX A;  1DCS A;  2AZ5 A;  2D98 A;  3NJX A;  4QKD A;  1OFN A;  1CD3 G;  5IT6 A;  1O3Q A;  3N7J A;  1QHD A;  3OGV A;  3TEX A;  1RUN A;  2YXS A;  4NPR A;  1HB4 A;  1AZD A;  1R1A 1;  4B7E A;  5JLV A;  1W2T A;  2VTX J;  1IS5 A;  3RZH A;  2A3Y A;  3PU8 A;  2W94 A;  3QH7 A;  2VZP A;  2QE3 A;  4WVM B;  5FMD A;  2JEC A;  5J98 B;  5A7W A;  4FAG A;  1W2O A;  3BCW A;  2PA7 A;  2XJP A;  3H3L A;  4DOU A;  1CAU B;  3SHR A;  2YU2 A;  2DTY A;  1XPW A;  1W8U A;  3RWN A;  4YFW A;  1W9W A;  2HEY F;  2PAE A;  2R6Q A;  2WT2 A;  4PT6 A;  2D3S A;  2XHK A;  2ZZQ A;  3ABZ A;  3DCQ A;  5JXG A;  3RZM A;  4A44 A;  5CKM A;  5JR2 A;  2VY0 A;  4XW3 A;  1UW8 A;  3H7J A;  4P02 B;  5IHR A;  1VB2 A;  2GN7 A;  3MO4 A;  4CCE A;  4NOT A;  1C3H A;  3MW3 A;  3KQR A;  1RUC 2;  1E5I A;  5LEK A;  4LO4 B;  3MLJ A;  3ZMN A;  2ZEX A;  2WAA A;  4R4X A;  1Z7S 3;  1DGL A;  3B00 A;  4XUQ A;  4Y5Z 0;  1SQ4 A;  3OGR A;  3PU3 A;  5FDB A;  3FX3 A;  3VBO A;  2IVJ A;  2HYX A;  2TUN A;  3MV1 1;  4Q4Y 2;  1H9W A;  1L7L A;  1MS5 A;  5A3M A;  1UKG A;  4UFK A;  1PGL 1;  4LA2 A;  1W6P B;  2YC4 A;  5JMC A;  3KVB A;  3FZ3 A;  5T5O A;  4AAX A;  1QJZ A;  2ZHL A;  2JG8 C;  5D21 A;  3O1P A;  1NYW A;  1Z7S 1;  2A5Z A;  2UYA A;  3PUS A;  2JB4 A;  4KG0 A;  2JXA A;  4P9W A;  3SH5 A;  4GB3 2;  4F83 A;  4B1L A;  2DU1 A;  3B9I A;  1PMI A;  5BUV A;  2VTF A;  3J7M A;  2WQ4 A;  2YRO A;  1QQP 2;  3FLR A;  3WF4 A;  5A3W A;  2VVD A;  4ISQ A;  4RL7 A;  3POI A;  4IEW A;  1GWL A;  1TNF A;  1WWY A;  2WAO A;  3IDC B;  4CU9 A;  1N1T A;  2DV9 A;  2QQI A;  5FPZ A;  2P5B A;  1QDO A;  5FCC A;  3J8F 3;  2ZGP A;  4LBL A;  4QXK A;  1JOP A;  5KR7 A;  4MZU A;  3FLT A;  4LJH A;  4QB6 A;  1XNT A;  3NMB A;  1E5H A;  4P9G A;  1JUI A;  1YUD A;  4CA9 A;  3LOI A;  1OH3 A;  1XNA A;  3VZK A;  5A6Q A;  4ZZ8 A;  1H2L A;  2ZGU A;  2XBO 2;  3ORJ A;  1ZZB A;  4AGR A;  5D8A B;  1NZC A;  3P1I A;  3O0W A;  4IV1 A;  2GU9 A;  3USU B;  2CGO A;  1HXS 2;  1BHG A;  4MGK E;  4H3W A;  3HNM A;  3FN9 A;  2ZBJ A;  4YVW A;  5FJH A;  1H4H A;  3OYW B;  5C4W C;  2HYK A;  3S6P A;  1G86 A;  5C3R A;  1W8W A;  4W6Y A;  4Y5S A;  4OFG A;  2F4P A;  4HSL A;  1JZ2 A;  4FT8 A;  5F1R A;  2VVE A;  1Q8O A;  1J3Q A;  2ZHM A;  3CO2 A;  1WBL A;  1JZ8 A;  2VXR A;  3RQ0 A;  2PMW B;  3JD7 2;  4LK6 A;  1W6N A;  4QXB A;  2XML A;  1P8J A;  2JDA A;  4JGZ C;  1W8F A;  5C9A C;  2GSY A;  1R64 A;  2JDK A;  3ZFE B;  4AVS A;  4LK7 A;  1WCQ A;  2B9U A;  5DUX A;  2W52 A;  5ACA 3;  3I2H A;  2J42 A;  5L7O C;  1DBN A;  5C71 A;  3VUO A;  2P6C A;  2QJV A;  4BPZ A;  3FHQ A;  3JQW A;  1ZA7 A;  4R9D A;  5FXZ A;  3VD9 A;  3WP4 A;  4I0W B;  1UU5 A;  1NE4 A;  3VLB B;  4DO0 A;  4AOC A;  4J1W A;  3WDU A;  1AVB A;  2CV6 A;  2ZAC A;  4YW3 A;  5ACA 1;  2DVG A;  1OA2 A;  1CAX A;  2LAL A;  3OJB A;  1W90 A;  1F4H A;  1QXP A;  2CSG A;  3ZKU A;  1UY0 A;  4FAH A;  2ZMN A;  1XNK A;  4Y22 B;  1UWW A;  2JKB A;  1LEC A;  2XWJ B;  1EV1 2;  5FY5 A;  2XHN A;  3MPB A;  4YYO A;  4NO4 A;  2PHX A;  5DXD A;  4COV A;  1G9B A;  5IFP A;  2H0B A;  3R4U A;  4N90 A;  2VZ1 A;  4RYD A;  3C7E A;  4LIT A;  4NIH A;  2JG9 B;  1D0H A;  1V6M A;  3CZJ A;  3S5Q A;  2WNU B;  3POY A;  1ASJ 1;  1VAL A;  4DFS A;  3MDP A;  4UW4 A;  5T5J A;  3KV9 A;  3I49 A;  3VDD C;  1BMV 2;  3EQE A;  1I6X A;  1GU3 A;  1O5U A;  2GND A;  3WW2 A;  4HN0 A;  3T0B A;  3MI8 A;  4XE9 A;  3VBF B;  4D6S A;  1YWK A;  2BYV E;  1W2A X;  3DXU A;  2CGP A;  3HN3 A;  3ILN A;  5IVY A;  3JUU A;  2WZR 3;  1BYH A;  1LHW A;  2TNF A;  2W47 A;  1Z78 A;  3DKW A;  1W99 A;  4D7T A;  1AXK A;  4IDZ A;  3I3D A;  4TWT A;  3ZX7 A;  4OQ8 A;  3BTX A;  3LAG A;  3LA7 A;  1OMI A;  1C28 A;  4R9B A;  4MGI E;  3VBU B;  1PVC 2;  2ID4 A;  3M1H A;  4HPK B;  2UWA A;  1W9Y A;  3LB9 A;  3TNQ A;  4PI0 A;  1R1A 2;  3IIA A;  3N35 A;  2OQ6 A;  1OI6 A;  5C3S A;  1C8N A;  4CCK A;  2WZR 1;  1EUT A;  3QLQ A;  4Q4W 3;  2JEM A;  1K12 A;  5F2W A;  3S30 A;  4N43 B;  3C7H A;  4V2V A;  1YFU A;  5DN2 A;  3WDT A;  1HJG A;  4BK4 A;  2Q30 A;  2QQV A;  1LAJ A;  3HT2 A;  4RGK A;  1QJY 1;  3DPR C;  2RS1 3;  5HPO A;  3VD4 A;  1ENS A;  5H9R A;  3O1V A;  3TEY A;  3NJY A;  5IFT A;  4XAA A;  4AI0 A;  3Q8B A;  3C7F A;  2VL4 A;  1ZRI A;  3CL1 A;  2UY8 A;  5LA0 A;  1JS9 A;  4LHS A;  1PZ8 A;  4A6S A;  3AX4 A;  3I97 A;  4OYU A;  5FUI A;  5CFC A;  1S0C A;  3C2U A;  4YNI A;  2E6V A;  4CEW C;  4JTO A;  1X50 A;  4ITC A;  1OUS A;  2RS1 1;  1XE7 A;  2Z2S B;  4YW5 A;  3ZDS A;  2WRA A;  1A3K A;  2YYO A;  2WFF 2;  2Q1M A;  4GD4 A;  3TOJ A;  4UOJ A;  1PM4 A;  3J9S A;  5A7S A;  1JZ5 A;  1B35 C;  3BYW A;  3AMH A;  3APB A;  3ZXD A;  3MZH A;  1DG6 A;  2Q4S A;  1AF9 A;  1RJ7 A;  1UY4 A;  4ES9 A;  1CWP A;  3WG1 A;  2YZ4 A;  1Z7S 2;  2WAB A;  1MVQ A;  4WV8 A;  1XYO A;  4CU7 A;  4XMA A;  3D4K A;  2VMH A;  1AYM 2;  3CHX A;  2EXI A;  1DQ2 A;  3DGT A;  2OZJ A;  5KXB A;  3RGB A;  4CP2 A;  5FPX A;  4LIV A;  1JYX A;  1H0B A;  2D5F A;  4JDM A;  2VCB A;  5A7O A;  3IDB B;  3KLS A;  4BM8 A;  3MF6 A;  3T2O A;  1RMU 2;  3T0A A;  5A32 B;  4CDX A;  3A7Q A;  3NVC A;  1HV0 A;  3HIF A;  3ZN4 A;  2ZGK A;  4EZH A;  4KWJ A;  1CN1 A;  2ZJC A;  3ALQ A;  2EAL A;  1IHM A;  3PVN A;  2CWS A;  3B3Q E;  1YC6 1;  1LR5 A;  2XGX A;  2YUE A;  2VE1 A;  3WUD A;  5EJ3 A;  1W03 A;  3PMS A;  2HEW F;  2ZEY A;  5FLH A;  3VL8 A;  4YZ4 A;  3ME2 A;  1MS8 A;  1K5M C;  4MX3 A;  4B3N A;  2Y64 A;  3I3B A;  3SQO A;  1VPH A;  5FZA A;  1NOV A;  4HXC A;  3SH3 A;  2RJK A;  2DBN A;  5IJR A;  3J8F 2;  4JKM A;  5FZ9 A;  4AK3 A;  2HBU A;  5I8S A;  1RUI 2;  5KWR A;  2YFU A;  4UFM A;  1AXY A;  2PQS A;  4QKB A;  4YG3 A;  1E5S A;  2Y6G A;  1X7N A;  5BXX A;  5FZI A;  1C1L A;  1K42 A;  3S7I A;  3MFA A;  4LBQ A;  4JZR A;  4ARX A;  1T2X A;  2DF7 A;  2JG8 B;  2VNR A;  3KVA A;  3LPG A;  1W0P A;  4P9Y A;  2ET1 A;  4N53 A;  1JUH A;  3NNM A;  2ADD A;  2ERF A;  4L8Q A;  3WDW A;  3WLU A;  4I2O A;  4OI0 A;  3K3N A;  1WGP A;  5LK5 A;  4PQQ A;  4HVO A;  5JUV A;  1YQ2 A;  5ERL A;  1CX4 A;  4MGY E;  5TSW A;  1ZZ6 A;  4ZXE A;  5LBC A;  4K9S A;  3GZU C;  3AP6 A;  1SPP B;  4KQ7 A;  2VZS A;  4RFT 0;  5K9Y A;  3AKP A;  2QCS B;  1VIW B;  3S5A A;  3BAL A;  2AUY A;  2WN3 A;  2YGL A;  4DRR A;  1DQ4 A;  4Q8L A;  4EE2 A;  1NY7 1;  1R08 3;  4QPG A;  3ROU A;  3NQH A;  1GP4 A;  3ZR6 A;  3CKH A;  4EN6 B;  4IE5 A;  1V0A A;  2G9G A;  4AEM A;  2RR1 2;  3OUH A;  3JB8 A;  4IE0 A;  4MLO A;  4OHZ A;  1FNY A;  1MVE A;  4DXR A;  5CFD A;  4COZ A;  1PGW 1;  4W6X A;  1DZR A;  1CAW A;  2VD7 A;  5DG2 A;  2ARA A;  1C8M 3;  4LLF A;  3TN9 2;  5ACA 2;  3VBS C;  1S0I A;  1WW6 A;  1IPJ A;  1R08 1;  2GP5 A;  5T55 A;  1OA3 A;  4K3U A;  3N4M A;  1QJU 1;  2VPV A;  1N1V A;  1TE1 B;  1UY3 A;  4HOO A;  2X53 S;  3LPF A;  1UD1 A;  3B9C A;  3G6J B;  2KM2 A;  4YRD A;  1PZ9 A;  5C4W B;  3VL9 A;  4XFC A;  3T4V A;  3H9A A;  5FPA A;  3OBR A;  4ZS2 A;  5J48 A;  5GZD A;  1NUK A;  1C8M 1;  4GMP 3;  2IZW A;  4LHL A;  2D44 A;  3ZFF C;  4YG0 A;  3RYK A;  4CPB A;  2LM3 A;  1ENX A;  2BFU S;  3UYJ A;  1U5I A;  1XE0 A;  2VJX A;  5BNN A;  4S2H A;  4X6Q B;  1D4V B;  1HRI 2;  1KS4 A;  5KC5 A;  5FZ1 A;  2YC0 A;  1W6O B;  1NCR A;  2P3K A;  1OPO A;  4JGZ B;  1VRH 3;  4AFB A;  4RFR B;  5C9A B;  3ZN5 A;  2WIN B;  4M00 A;  2WQZ C;  1IPS A;  2WLQ A;  4GMP 1;  5CVR A;  2Q1Z B;  2HH9 A;  3RWK X;  2ZZJ A;  3AYE A;  5FLJ A;  1POV 3;  5FRA A;  2OYZ A;  2BEO A;  3R6S A;  3EJK A;  5K0U A;  5L7O B;  1QKQ A;  1CGP A;  3ZYF A;  1PMH X;  1LRH A;  4CSW A;  3WNM A;  4XFA A;  1IG0 A;  5C33 A;  1LHV A;  1VRH 1;  2ZMK A;  4XJZ A;  4UFH A;  1REE A;  4C8D A;  1WLD A;  2OUH A;  1OOP C;  1UY1 A;  3VBR A;  5FYV A;  2NMN A;  2VUJ A;  3LA3 A;  1AR7 3;  1ULE A;  3WHT A;  5LA1 A;  3DL3 A;  2WO7 A;  3SCF A;  3AB0 A;  1POV 1;  2XJU A;  3RZZ A;  5IVV A;  3B93 A;  4HVQ A;  1SBD A;  4BQ3 A;  4K20 A;  4HMZ A;  1VE0 A;  3OEA A;  2BER A;  4BQ4 A;  2WZR 2;  4DS0 A;  1YIP A;  2FD8 A;  4XXP A;  4BQ5 A;  4GWM A;  2W9X A;  4MUV A;  1LB2 A;  2Q8D A;  4TTG A;  3POJ A;  1ND2 C;  1QJE A;  4A2U A;  4PDW A;  4CEY A;  2YPD A;  5JR7 B;  4X8N A;  4IXL A;  5F6L B;  3AXD A;  1AR7 1;  1UYX A;  2LTN A;  4I3P A;  4AI3 A;  3BIE A;  3RI9 A;  1DQ6 A;  4Q0Q A;  1VMJ A;  4Q4V 3;  5DAQ A;  4MG2 A;  1M4W A;  5C8C A;  5HBA A;  3SMH A;  4EQV A;  2F6B A;  4H7M A;  2XUM A;  2UWB A;  4HET A;  1Y4W A;  2XQR A;  4Q4W 2;  3VDD B;  3ST7 A;  2WA4 A;  2RJL A;  4IET A;  4WZC A;  1D2Q A;  4EYU A;  3BVC A;  1U5Z A;  4Q26 A;  2ETE A;  1SFP A;  2ARC A;  2QDR A;  1HQL A;  2RS1 2;  4HG6 B;  1I5Z A;  5JOY A;  4Q4V 1;  4Y24 A;  5FZ8 A;  5I0R A;  3CF6 E;  1MQT C;  4NRQ A;  1FOD 1;  3AFK A;  2ZGL A;  3FFZ A;  3WNX A;  4I0B A;  4OI4 A;  4BJ0 A;  1YJL A;  1MZF A;  1N3O A;  4JGY B;  5FYC A;  5T54 A;  3PLQ A;  3T3Y A;  5C5T A;  1O5L A;  2PHL A;  2ATF A;  4PLO A;  2XR4 A;  5LRS A;  3E97 A;  2BPA 2;  3N36 A;  3OGG A;  2X5I B;  4NUB A;  5GLT A;  1N3P A;  3IMN A;  4JHT A;  2EIB A;  3UKV A;  1V6L A;  3I3Q A;  1H8T C;  2H0V A;  3ZN6 A;  2YBK A;  2DBI A;  3WNO A;  5HXV A;  3RZK A;  2ZCW A;  3HQU A;  3MPP G;  3CLP A;  3CMG A;  4B7K A;  1RUD 3;  4AR2 A;  1CAV A;  2R1B A;  1H30 A;  2P6H A;  3DPR B;  3E5Q A;  3MIB A;  3FHI B;  4Q4X 3;  2K0G A;  4FOY A;  2EAK A;  5GZC A;  3MHZ A;  4XET A;  2RE9 A;  4XF1 A;  2SLI A;  5ABJ C;  4LOR A;  3HOB A;  3WQB A;  1LEN A;  1W2U A;  4FPH A;  4JCK A;  1DGW X;  3SXW A;  2FDF A;  2YBP A;  3VHN A;  4N9H A;  1BVV A;  1QJF A;  1GZT A;  3GM8 A;  3ZYB A;  4BXF A;  5F9T A;  1A34 A;  4CEW B;  1W8H A;  5GLZ A;  4Q4X 1;  4CXW A;  2J1A A;  1G8W A;  5KHH A;  2VCC A;  2C24 A;  1ZVF A;  4DRV A;  3ZM8 A;  5LW9 A;  1BBT 3;  3OYW A;  2RDN A;  4Q0V A;  4BWO A;  1RUO A;  4QWN A;  5JZG A;  3U10 A;  3VD7 A;  1PK6 A;  5FZ6 A;  4YWA A;  2WO3 A;  5CB7 A;  3H3Z A;  3GHM A;  3N9L A;  1AR6 3;  4Q27 A;  3RSJ A;  5JPM B;  4UI9 L;  3WQ0 A;  5D8A C;  1COV 3;  3H42 B;  4AYU A;  4UFI A;  3PL0 A;  4QX5 A;  1GAN A;  1BBT 1;  5AFB A;  2WZE A;  3LD8 A;  4M3C A;  2R1D A;  5JCT A;  5FR3 A;  2QQJ A;  5FUN A;  3HNB M;  4N7I A;  5BV6 A;  5C3O A;  3JB4 C;  4F3J A;  3GCW A;  1COV 1;  4P5Y A;  5BNP A;  2P4E A;  2WSV A;  1NY7 2;  3TEW A;  2V5D A;  4K21 A;  4Z2A A;  3ZXE A;  2BDR A;  2Z79 A;  2VGD A;  1D7P M;  4FFG A;  4JDO A;  1APN A;  3UGF A;  1GNY A;  1OF4 A;  3WDY A;  2A71 A;  4D94 A;  4LT5 A;  2EVX A;  3FC0 A;  4I01 A;  1CZT A;  1B09 A;  4DY5 A;  2FMY A;  3UNP A;  1GNH A;  1PGW 2;  1K5M B;  1U12 A;  3NV1 A;  3WY6 A;  2QKD A;  1AYN 3;  2F4L A;  3H8U A;  1LU2 A;  5FZO A;  2ZA9 A;  1LOD A;  4QX7 A;  3N7L A;  4I02 A;  1WW4 A;  2R07 3;  4ET7 A;  1R08 2;  2BWA A;  1QXJ A;  4NRP A;  3OY8 B;  4XXA A;  2PLV 3;  1RGS A;  1SBE A;  5LA2 A;  2G1M A;  4M3C E;  1Y9G A;  1TME 2;  1LOE A;  2GZW A;  3SCH A;  3S0M A;  4CP9 B;  4XC9 A;  1AYN 1;  3EMR A;  1V6O A;  4FOV A;  1C8M 2;  4YVS A;  1VAM A;  2R07 1;  1W39 A;  2WJS A;  3WF2 A;  2XKP A;  1CJD A;  5A33 B;  5F37 A;  4QT6 A;  3X29 B;  3AZY A;  1N1Y A;  1X8E A;  2YFZ A;  3W5N A;  2CU5 A;  3LKJ A;  1RUH 3;  4BOW A;  4KGG A;  4CUG A;  5A6Y A;  3WT3 A;  1X82 A;  2VAU A;  4CDQ C;  4XQD A;  3U11 A;  5IVC A;  1VAK A;  5L9V A;  1PO1 3;  3AMN A;  3ASI A;  4XDO A;  3VBF A;  3WP6 A;  4CVU A;  2OXB A;  3AJZ A;  1W8Z A;  1WW5 A;  2FCT A;  3DYO A;  3KSC A;  5T50 A;  2B4K A;  4WBB A;  2NZ9 A;  1RVF 3;  3HMY A;  2ZX4 A;  2B9V A;  5FO8 B;  2HBT A;  2YC2 A;  4WVZ A;  1RUH 1;  1VBE 3;  5T5L A;  3NW4 A;  5LWB A;  1HQN A;  2WL1 A;  3ILR A;  1VRH 2;  4QM9 A;  4IL7 A;  5FYU A;  5J36 A;  1RXG A;  3I2F A;  5D1I A;  4U2A A;  1O7F A;  4OLL A;  2BW8 A;  4QX1 A;  4Z82 A;  4A42 A;  4H2A A;  2ZGQ A;  5E88 A;  2W68 A;  4D7S A;  1ST8 A;  1RVF 1;  2J1S A;  2WYF A;  1XQN A;  4HKW A;  5LZ6 A;  2O1Q A;  4ZU5 A;  2RS3 3;  3W58 A;  1KJL A;  1FMD 3;  1VBE 1;  3LSD A;  2DVB A;  5A3L A;  5GZE A;  3DKQ A;  3G7D A;  4CCL A;  4BIO A;  5F2S A;  3MIF A;  4PLM A;  1UXZ A;  4BZ4 A;  4UW5 A;  1BCX A;  1GNZ A;  2YY1 A;  1AR7 2;  4W65 A;  3ZFF B;  4PI2 A;  5KHK A;  2QZ2 A;  1OA4 A;  4D3W A;  1W0N A;  4XFH A;  2RS3 1;  4KWL A;  1FMD 1;  4QDR A;  3UKN A;  2ZHK A;  1VJ2 A;  5C5U A;  4ZU7 A;  3AZZ A;  5C8W A;  3NAP B;  3J7H A;  1YO8 A;  2GH8 A;  2UYB A;  5CU1 A;  4CRQ A;  4N43 C;  4NPL A;  5I0U A;  3POS A;  1FNZ A;  5F3I A;  1AL2 3;  2QQW A;  2QDN A;  3POB A;  1JZ4 A;  3BTA A;  3EO6 A;  2RS5 3;  4LUK A;  2DUR A;  3EXU A;  1JYV A;  2VUA A;  1W28 A;  1XRU A;  3ZOI A;  4HZF A;  1LOB A;  4IW3 A;  1IPK A;  1UZV A;  4XJ8 A;  1OOP B;  3I59 A;  2LRP A;  5FXW A;  3GJA A;  2ZX1 A;  1AL2 1;  2BFU L;  5GLV A;  1IQA A;  1S2B A;  2RS5 1;  4GMP 0;  1NKG A;  2P2K A;  4GJZ A;  3WZ1 A;  3N9P A;  4CDW A;  1R09 3;  2MNG A;  3THT A;  3ATG A;  4L99 A;  2ZXQ A;  3OTF A;  1ND2 B;  3AZW A;  4NHK A;  1XU2 A;  2GAL A;  5FWE A;  2OUJ A;  1K5J A;  1RIR A;  4KG8 A;  4N8M A;  2D93 A;  3H0O A;  4QHB A;  2GME A;  3AKT A;  2WNV A;  4N9I A;  5K7P A;  2Y38 A;  2ZS6 B;  2AAC A;  1POV 0;  1JYW A;  5I0S A;  4B4R A;  3CQO A;  2Q1F A;  1R09 1;  4IEU A;  5FQ0 B;  5FY8 A;  1JMU B;  2QUO A;  4ATE A;  4YFZ A;  1RYY A;  2XUE A;  1MS1 A;  2GC3 A;  3QCW A;  1RUD 2;  3VKM A;  4DXT A;  4YLZ A;  4YZ5 A;  3VBH A;  3DYM A;  5FYT A;  1UKR A;  2GMM A;  4Q0P A;  1YCI A;  3PUQ A;  4K8R B;  3CU7 A;  1FX5 A;  1FT9 A;  1MQT B;  1BKZ A;  3LEM A;  5DAB A;  3OPZ A;  4S2D A;  1EYB A;  2CTV A;  4JQT A;  5LAS A;  2YDE A;  3ZLI A;  2PAM A;  3ZFG A;  3OOX A;  1L7R A;  3ZPY A;  2C9K A;  5FZB A;  3T30 A;  4R4Z A;  1OQ1 A;  5CAZ A;  3ZXG A;  5EYX A;  1OKO A;  2L9L A;  2GMP A;  2VW1 A;  1DHK B;  1U5Y A;  4YSF A;  3RPQ A;  1STM A;  4E4D X;  1H8T B;  3VZL A;  3RZG A;  4IEX A;  1WCS A;  1IOA A;  1BBT 2;  3RJR A;  4AHZ A;  4AE2 A;  1QH7 A;  1W6Q A;  2O8O A;  3B69 A;  4FXK B;  2WZ8 A;  5HV0 A;  1RIN A;  3I2D A;  3DEC A;  4XZP A;  1JYN A;  4CCM A;  1FPN 3;  2JDH A;  3WOG A;  5FBZ A;  4ZON A;  3D82 A;  3KQ4 B;  1AR6 2;  5IAT A;  3FJS A;  4AFD A;  4Z2W A;  2ILM A;  3THC A;  3T0D A;  1COV 2;  2HWE 3;  4JVA A;  5HXM A;  3NNL A;  4QX3 A;  1V9U 3;  3AVR A;  4PQ9 A;  2CAU A;  2GDF A;  2V4V A;  5ABJ B;  2DCK A;  2VOT A;  2D97 A;  3U75 A;  4QX8 A;  3GAL A;  2MPF A;  3JCI A;  4IEP A;  4A4A A;  4YAR A;  5I91 A;  1UZW A;  2DCZ A;  1GMM A;  2XJR A;  4GAL A;  3M7A A;  4SBV A;  2Q8C A;  3I8T A;  1FPN 1;  3FBM A;  4LUM A;  4GWJ A;  4RR3 B;  3WDX A;  5DAW A;  5FZ3 A;  4IGP A;  2QQO A;  1H6Y A;  1BK1 A;  1KDM A;  1WZX A;  3LFI A;  2HWE 1;  3K46 A;  1S0F A;  2EAA A;  5H9Q A;  1V9U 1;  1W8N A;  1LHU A;  4C91 A;  4PIX A;  1G9D A;  3KV4 A;  4AWD A;  4OVE A;  4MOA A;  4EZ4 A;  4Y4R A;  4MGQ A;  4Q8K A;  3LEG A;  1JXN A;  4TLG A;  5FYS A;  3WNL A;  2WBK A;  1WW7 A;  2D6L X;  1TQ5 A;  4M0H A;  1LOC A;  3J4U H;  1GZC A;  1CZV A;  2OQ7 A;  3DF0 A;  1YFY A;  2R07 2;  4XPV A;  5CKN A;  3THP A;  5A6X A;  2VQU A;  4LXL A;  3IKW A;  2PLV 2;  4AW7 A;  1KGY A;  3NKG A;  5EYY A;  5FKC A;  4UBG A;  5ANN A;  2XKO A;  5DUW A;  2A1X A;  3ETP A;  4FPC A;  3P6B A;  5C9A A;  4QX2 A;  5FP4 A;  3GCX A;  5FKB A;  1OVS A;  4YW2 A;  5L7O A;  2VNO A;  4B29 A;  3KGL A;  3E5U A;  5H9S A;  3ZYJ B;  1S0G A;  4XF0 A;  4K1Z A;  2W2I A;  1JOJ A;  1RUH 2;  3NKT A;  5JXI A;  1DU3 D;  2ORX A;  1J59 A;  1Q8P A;  4KBZ A;  4QPW A;  4U36 A;  4HAN A;  3CNA A;  4Y20 B;  2C6S A;  2B42 B;  2PHW A;  1PO1 2;  2HWF 2;  1V70 A;  2X8K A;  2EXJ A;  4IEY A;  5FXV A;  1VRB A;  5DPN A;  1RVF 2;  1DZQ A;  1UOG A;  2YGM A;  3OBA A;  4LEJ A;  3V0A B;  3OG2 A;  4K6B A;  4WM8 C;  1GKB A;  1VBE 2;  3TB0 A;  1X9P A;  4E2G A;  1XC6 A;  4XVH A;  1GZW A;  5ISL A;  4NHL A;  4UBH A;  5DDJ 3;  3RFR A;  4D0Q A;  4C0B A;  2OVU A;  3VV1 A;  4AEJ A;  1IS3 A;  2ZHN A;  1OT5 A;  3FFQ A;  4IV1 C;  3CZU A;  3K3O A;  2WWJ A;  1IZ3 A;  1VBA 3;  2PN5 A;  2XVL A;  2WO2 A;  3B94 A;  4YM2 A;  3VZM A;  3ZO0 B;  2V5Y A;  3GXU A;  2VTX A;  4QKN A;  2WQ8 A;  4NWV A;  4YVW C;  2AH2 A;  2RS3 2;  3SIS A;  3VDD A;  1FMD 2;  2DDU A;  1GQH A;  3ETQ A;  2WA3 A;  1QNY A;  5DDJ 1;  1ASJ 3;  3ZIW A;  5B4N A;  3TAY A;  4CDQ B;  1Q3E A;  1ACC A;  3V64 A;  5GZG A;  4W4Z A;  4IGQ A;  2XVK A;  1GLH A;  5FP3 A;  5FY4 A;  5IAX A;  1MZ5 A;  4YM1 A;  1O91 A;  1JH5 A;  1VBA 1;  4J25 A;  2JJ6 A;  2OW4 A;  3LDB A;  3EB7 A;  4YW4 A;  5J7M A;  4BQW A;  2HKX A;  1XND A;  4TXW A;  5EXO A;  1PVX A;  2Y6F A;  2VMC A;  2CYF A;  2JIC A;  1QNW A;  2VBD A;  1UX7 A;  1SLC A;  3IB3 A;  3WUC A;  3I3E A;  2IFR A;  1UMZ A;  3UJQ A;  1RUE 3;  3BOW A;  4DIQ A;  1H4G A;  3AVS A;  2J1U A;  2LUW A;  1ENQ A;  4IEO A;  3L2Y A;  5T3N A;  2W87 A;  4W6W A;  1GOG A;  3BU7 A;  5EP9 A;  1QEX A;  4Y1U A;  4FBF A;  1JN2 P;  4AFM A;  1LGC A;  2RDQ A;  2ZGO A;  4P5H A;  5T5P A;  5IK8 A;  2VZU A;  4RS5 B;  1F5F A;  1S0D A;  3ACH A;  4IV3 C;  4JGY C;  4LMF A;  5I8Y A;  1RUE 1;  2VQA A;  5FOJ B;  3AK0 A;  1NXD 1;  3AMM A;  3D0J A;  2X5I C;  1QJY 3;  4XIL A;  4Y5T A;  3I4I A;  1R09 2;  2EXH A;  2JB8 A;  1NXM A;  3N7M A;  4CUA A;  4CUC A;  1ALY A;  3I2J A;  1NA1 A;  3RJ2 X;  5A3T A;  2W1Q A;  4WM7 C;  1Y9Q A;  5EJ1 B;  1ZZ8 A;  2K46 A;  5FY7 A;  3AMP A;  4CDU B;  1JZ3 A;  1YHF A;  3KF5 A;  4RSU A;  5JOZ A;  1NCQ B;  5CG9 A;  1EPZ A;  3OEB A;  3BTY A;  4XHB A;  3LSE A;  4BHP A;  3LGR A;  3N9N A;  3E6C C;  1LEM A;  1B35 A;  4D7Y A;  2CHH A;  5SV8 A;  3BU0 A;  2VO5 A;  4QGN A;  4I30 A;  2BBV A;  5F39 A;  1KFU L;  2BQP A;  1ZRD A;  4JC1 A;  1UY2 A;  1GV9 A;  4IEZ A;  3WSO A;  4OUL A;  1BEV 3;  3M3O A;  4YW6 A;  1JBC A;  5JOX A;  5JSP A;  4EN0 A;  2J1R A;  2RM2 3;  2DCY A;  2KR2 A;  1YEW A;  2C1F A;  5KXE A;  4Y26 A;  1EP0 A;  1ZBA 3;  5C6C A;  1MEC 3;  1V6K A;  3KS7 A;  1XNB A;  3DYP A;  4RA0 A;  4I0A A;  1PGL 2;  3H1Y A;  4NAO A;  4XF4 A;  1DQ5 A;  2IUW A;  4XUN A;  1BEV 1;  4XJU A;  1LGB A;  1ULD A;  4TN7 A;  2ZKL A;  4IER A;  4ATF A;  1G9F A;  3D5O A;  3LQC A;  2RM2 1;  3S7E A;  1J83 A;  2E26 A;  5F5A A;  4HN1 A;  1ZBA 1;  3QD6 A;  1WBF A;  5H9P A;  1XB9 A;  1MEC 1;  3ON7 A;  1O8S A;  5JOW A;  1K5M A;  1FPN 2;  1J84 A;  1OD3 A;  2VZV A;  4MXW A;  1RUG 3;  4BH9 A;  1QIQ A;  5CBL A;  1DZT A;  1WMD A;  3N7K A;  2HWE 2;  3OY8 A;  5L36 A;  1UMH A;  1UIK A;  1V9U 2;  3I2O A;  3WNK A;  1ODM A;  3ACG A;  4LO5 B;  2UY9 A;  5FZK A;  5CA6 A;  1HB3 A;  2JE9 A;  2JWP A;  4FO9 A;  3HNY M;  4C1X A;  4GH4 A;  2HWD 3;  4IND A;  2RDS A;  5J96 B;  4SLI A;  4R9C A;  1RUG 1;  2HWC 3;  2ZAH A;  3O1S A;  2QZ3 A;  1LOF C;  2VMD A;  1OXC A;  3MUZ 1;  3USS A;  4ASK A;  4Y3O A;  5LY1 A;  2DUQ A;  4YM3 A;  4Q5O A;  1G7Y A;  4GJY A;  1C5H A;  4CCC A;  2WYS A;  2HWD 1;  1RTV A;  1ONA A;  1UNB A;  2HWC 1;  4QAW A;  3AFG A;  3HQX A;  5DG1 A;  5CEH A;  4IEV A;  3SKV A;  3ELN A;  3VB9 A;  1L3J A;  1PX4 A;  1VMF A;  4QPI A;  2CDP A;  1GFF 2;  5G05 L;  2VCA A;  2VUL A;  4LKE A;  5A7W B;  1OLQ A;  1S2E A;  1PZ7 A;  5JSR A;  5EQU A;  2YMZ A;  1O4Y A;  4EJR A;  3UGH A;  2YB7 A;  2OA2 A;  2P3J A;  5JWP A;  2J1E A;  4LBQ D;  3ENR A;  5A70 A;  4MHU A;  3IPV A;  4YG6 A;  3PJY A;  3VBS A;  5L73 A;  1DP0 A;  1NG0 A;  2E7T A;  5M0T A;  5IVJ A;  3D3A A;  4QDQ A;  2LS6 A;  3T2P A;  1C5I A;  3RYR A;  3M3C A;  1QJU 3;  2RDR A;  2VME A;  3UJO A;  5GM0 A;  4FSJ A;  2E31 A;  2PHD A;  5F3C A;  4DUW A;  1T6G C;  3C7G A;  3PME A;  1KRI A;  2ET7 A;  2ZML A;  3OCP A;  2Q8E A;  2PFW A;  2W3J A;  3NV4 A;  5IK4 A;  1YQ5 A;  4HL0 A;  3V65 A;  3W59 A;  1BJQ A;  4AI8 A;  3CJI C;  3VBO B;  1SLI A;  3LDK A;  2P37 A;  3P3N A;  5FZ4 A;  1ND3 A;  5FP7 A;  5DDJ 2;  3ZXK A;  4YW1 A;  2D3P A;  4R9A A;  4KBB A;  3Q8C A;  3LIG A;  3NO8 A;  4PIZ A;  4B8E A;  3HWJ A;  1O3S A;  1RUF 3;  4RQP A;  5HCF A;  1W2N A;  1NT0 A;  1VBA 2;  4DEV A;  4UFJ A;  2B8M A;  1N3Q A;  4CCJ A;  3VKL A;  5IK7 A;  3RMY A;  4BIS A;  3C3V A;  1X33 A;  3W21 A;  2WII B;  1ASJ 2;  3E1F 1;  1OOP A;  5L9R A;  2VZQ A;  3PUR A;  4HK8 A;  1UOB A;  3NAP C;  1JW6 A;  1US2 A;  3POE A;  2B5H A;  1X9T A;  1RUF 1;  1LES A;  4K7J A;  4RGA A;  2QQM A;  2G9Z A;  3NV2 A;  1EY2 A;  4CPB D;  1WD4 A;  4WM8 B;  1TVG A;  2XWB B;  1PNF A;  3POF A;  4CCN A;  5C7G A;  2OT7 A;  4DMI A;  1NZI A;  1Q56 A;  4P9J A;  4LUL A;  5FZM A;  1SG3 A;  3K75 B;  3KF3 A;  3Q8F A;  4IE4 A;  2IXL A;  4IV1 B;  4X6R B;  1KXG A;  4GZ9 A;  2I2S A;  1N1S A;  1RUE 2;  2CGN A;  2DU0 A;  4W50 A;  5LEJ A;  3EYP A;  4AQ2 A;  2JDZ A;  3AP4 A;  3D0S A;  4MO3 M;  1VBC 3;  2XPJ A;  5FRE A;  4CP0 A;  2ZGT A;  1HRV 3;  4YVW B;  4NPM A;  2QNK A;  5FTT C;  4WVM A;  3LA2 A;  3MV0 1;  3OGJ A;  2VW0 A;  4IEQ A;  4XOG A;  5SV5 A;  3V56 A;  3T08 A;  4BB3 A;  4DUX A;  2XJS A;  1CAU A;  3WEZ A;  3UL2 A;  5JAX A;  1OLR A;  4MXV A;  5HV4 A;  4NID A;  5FZ0 A;  4ZKT B;  2VNG A;  1RHI 3;  2QQL A;  2KD7 A;  1MQT A;  2AEN A;  1JTZ X;  1VBC 1;  3WG3 A;  4XFB A;  3RVH A;  1HRV 1;  1QJY 2;  4FTS A;  1AR9 3;  5BNN C;  1F9K A;  2AGS A;  1F5J A;  1TEI A;  1FOD 3;  4LKS A;  2IC1 A;  3OB8 A;  1IGO A;  4P14 A;  4EN7 B;  2P34 A;  1V6N A;  3U0Z A;  5LBB A;  1AR8 3;  1EAH 3;  2J1V A;  1SCS A;  3TEZ A;  1RHI 1;  4QGM A;  1O6U A;  3HR9 A;  1XBF A;  3IBM A;  3BN6 A;  3NRU A;  2B7Y A;  4XCB A;  4MV2 A;  4XCA A;  3WHU A;  1SLL A;  4BQ1 A;  5K0U C;  2J22 A;  5C3P A;  1AR9 1;  4DZG A;  1UU6 A;  3TWI A;  3LEK A;  1RIT A;  2N7G A;  4PLN A;  3C8X A;  3INA A;  1OKQ A;  3BTZ A;  4IV3 B;  4URA A;  1AR8 1;  1EAH 1;  1L7Q A;  1W6P A;  2J1T A;  1JZ7 A;  3AP7 A;  3VBR C;  3OGS A;  1UXX X;  1CR7 A;  1VBD 1;  4BLI A;  5FMC A;  5FYB A;  4AHY A;  2XH6 A;  4MHR A;  4RD7 A;  5ABJ A;  2W08 A;  2RM2 2;  2Y0O A;  5DAV A;  2ES3 A;  3ZXF A;  3VDB A;  1ZBA 2;  4XTP A;  1A8M A;  1HV1 A;  3PUH A;  1MEC 2;  3RI8 A;  3FUO A;  4Q1P A;  4LA3 A;  4TLF A;  5FPB A;  5FUP A;  2VUD A;  1DIW A;  4WM7 B;  4PDW C;  5A3O A;  2A6Z A;  4D6Q A;  1UYZ A;  2R04 1;  2DWR A;  4RHV 3;  5EIY B;  4IQP A;  3MIE A;  2JIJ A;  2VXJ A;  5C70 A;  1DLL A;  1SDD B;  3QOP A;  4MVT A;  5C8C C;  2SBA A;  4L2N A;  2WKK A;  2WNO A;  1T6B X;  1S2K A;  1QWR A;  1W8O A;  2XVG A;  2BOI A;  3IT8 A;  2A6V A;  3K4D A;  3MIC A;  5HCB A;  2A7A A;  3RG0 A;  4ARY A;  1NQJ A;  2GAU A;  4HFS A;  4D6R A;  1UX6 A;  4QPY A;  1RUG 2;  2E32 A;  1QOO A;  5D8A A;  4AQT A;  4NHY A;  4RHV 1;  4RR3 C;  3USU A;  4AVB A;  2W5F A;  5BNO C;  4OHV A;  3MLL A;  4AVC A;  1LJ7 A;  1POQ A;  2ZGS A;  5A1L A;  4LO8 A;  4LIU A;  1WD3 A;  2YPJ A;  4A6O A;  5B2G B;  4JDN A;  1UPI A;  2HWD 2;  2ZX3 A;  3LEI A;  4XUR A;  4YPJ A;  5BY5 A;  2BV4 A;  2QQU A;  4JTN A;  1FXZ A;  4UW3 A;  5JMO A;  5A3U A;  1W6M B;  4DUV A;  5FZC A;  1K45 A;  1JHN A;  1MS0 A;  3GYD A;  4K40 A;  4B1M A;  2FBE A;  3Q9O A;  4O9E A;  2X10 A;  4CYD A;  2W1S A;  3ACI A;  2CWM A;  2A6W A;  2W91 A;  5AFE A;  3ZPO A;  3O1T A;  2ZKN A;  1J3R A;  2OII A;  4ASM B;  3IAP A;  4RN5 A;  1UIJ A;  4BLJ A;  3H8R A;  2C9A A;  1HW5 A;  1DQ0 A;  1S0B A;  2FDI A;  3ZFE A;  1DYP A;  3D8C A;  1HQW A;  4FPG A;  2X29 A;  3V0A A;  4YZ3 A;  1XSR A;  3DUI A;  5K4L A;  5FZ7 A;  1C1F A;  1KFX L;  1DF0 A;  1AXZ A;  2YU1 A;  3CDZ B;  3AP9 A;  2BVB A;  5E6H A;  1KQR A;  2CL2 A;  4QU1 A;  4XBL A;  5FO9 B;  3THD A;  1EUU A;  1WCU A;  4JX0 A;  1IG3 A;  2D6N A;  5CFC B;  2E7Q A;  1Q5O A;  2ZGM A;  4MYE A;  4WZF A;  2RV9 A;  2BNO A;  4QQ2 A;  5L9B A;  4XMI A;  2WZP P;  5LY2 A;  1IKQ A;  4Y33 A;  2ZX2 A;  5DAX A;  1HN1 A;  2A3W A;  4OMC A;  4AVA A;  5CYY A;  4JQR A;  3T2Q A;  2VM9 A;  1QJU 2;  2IWG B;  1LOG A;  2LRO A;  4Y22 A;  4XHX A;  2W46 A;  5JZG C;  1XYP A;  3M3I A;  5J3U A;  2GP3 A;  3ZXL A;  2FDG A;  1CJP A;  1NE6 A;  4O9G A;  3BI3 A;  5A7Q A;  2JG9 A;  3HVD A;  3WCR A;  1QQP 1;  4BDV B;  2WNU A;  2BGP A;  4CE8 A;  2XON A;  4Y1X A;  2Z5W A;  3EHK A;  3LZZ A;  3VKO A;  2XJV A;  2P1B A;  3JXS A;  3LFM A;  3MIH A;  1SLT A;  4ZPI A;  4CDX B;  1RUJ 3;  1DFQ A;  3O1U A;  1HN0 A;  3L2H A;  1RUF 2;  4FP2 A;  1XJA A;  2JDN A;  1AHS A;  4Y1Y A;  2ZAA A;  3QBQ A;  4WVV A;  5CKQ A;  5FFO C;  5FPL A;  5BNP C;  5JXJ A;  1CPN A;  2GC1 A;  1DQ1 A;  2NLR A;  2CDO A;  1XSQ A;  4L9B A;  4ZU4 A;  5A3P A;  3PDQ A;  3WX5 A;  4AED C;  1E5R A;  5C3Q A;  2Q5T A;  1W06 A;  1DGW A;  2VW2 A;  1RUJ 1;  5JXH A;  4M4P A;  1YNA A;  3F95 A;  2W95 A;  3WNN A;  4NRM A;  5AVA A;  5FXX A;  4FQ4 A;  4M01 A;  4HPK A;  3VBU A;  3CJI B;  2V73 A;  3HEI A;  2EIE A;  1ZM1 A;  3K4Z A;  3JD7 3;  4NAM A;  5F7U A;  3CEW A;  3VZN A;  4CZS A;  5JDB A;  4XEZ A;  1OUR A;  4N43 A;  4LBQ B;  2ADE A;  2V09 A;  3A23 A;  2OX0 A;  4RS5 C;  3TNP B;  4QX0 A;  4OHW A;  4N53 B;  4YVS C;  3O0X A;  1VLN A;  2VH9 A;  5K8S A;  1VBC 2;  3A0K A;  1HRV 2;  4AFA A;  3JD7 1;  2JIG A;  2Y60 A;  5KC6 A;  3HBK A;  2DVD A;  4FCA A;  4QGL A;  5A6Z A;  4HT1 T;  4PCR A;  2RVA A;  3L9J T;  4XFI A;  3SC7 X;  4XJA A;  3U1X A;  3NL1 A;  2A70 A;  2D6P A;  3AL6 A;  4HVR A;  3U78 A;  3W20 A;  5IUQ A;  1RHI 2;  3LWC A;  4BQ2 A;  4CDU C;  3KCY A;  1VBB 3;  3K48 A;  4QPG B;  1OHF A;  4XIK A;  1AR9 2;  1NCQ C;  1VR3 A;  1AX1 A;  1RJ8 A;  4Q4V 2;  3ZXA C;  1J3P A;  3VD5 A;  2XL9 A;  1FOD 2;  4N7U A;  3ILF A;  2YV8 A;  1BVP 1;  5CFD B;  4LBM A;  4KWK A;  1AR8 2;  1EAH 2;  2EIG A;  3GNE A;  3I2I A;  1ULC A;  1XNC A;  5CNA A;  1CAW B;  4BQX A;  4DY3 A;  4E2Q A;  4JV4 A;  2ZOE B;  3ZVX A;  4GKX A;  1UL9 A;  3R4D B;  4NR1 A;  4EV0 A;  1VBB 1;  3QAC A;  4BMB A;  5FWJ A;  2GN3 A;  1WA4 A;  4AGG A;  1KJR A;  1ZZC A;  2EID A;  2XL7 A;  2JDY A;  1IQD C;  3BOP A;  3WR0 A;  1YI9 A;  3VKN A;  2EIC A;  1UF2 C;  2PHF A;  5DQ0 A;  3SCG A;  1CIY A;  1NX9 A;  2WR9 A;  4OZX A;  1OF3 A;  2BWC A;  1Q8V A;  3LE0 A;  3UV9 A;  3NV3 A;  4OUM A;  1QF3 A;  2Q0A A;  4Q29 A;  4AVV A;  1SEF A;  5A32 A;  3CIH A;  4Q2F A;  2JEN A;  1JU3 A;  5CG8 A;  1SAC A;  2ENR A;  4L11 A;  3M2M A;  1MR5 A;  5BNN B;  2DUP A;  1XU1 A;  5AC9 3;  3RS6 A;  2JDM A;  1LHN A;  4KNC A;  1NCR B;  3O1O A;  4ZY9 A;  4D8M A;  2ZPX A;  1UCX A;  4GWI A;  1D2S A;  2A3X A;  2X09 A;  2D6K A;  1KIT A;  2JD9 A;  3K77 A;  4QQH A;  4RHV 2;  1G6N A;  1H1A A;  4KGQ A;  4C1W A;  5K0U B;  4PF5 A;  3MID A;  5EV7 A;  1WLT A;  2C5D A;  4Q4X 2;  5AC9 1;  4XAB A;  2DVF A;  4QHZ A;  1BXH A;  4QDS A;  4A7K A;  2NQY A;  3E6D A;  3T4H B;  1HB2 A;  1Z0H A;  1GUI A;  3KT4 A;  2VZ3 A;  3GZE A;  3A21 A;  3VBR B;  4AHX A;  2WUH A;  1FV3 A;  1PVC 1;  1XYN A;  2JG8 A;  3PIG A;  1J1L A;  4M0N A;  4UWD A;  4JRA A;  3FE5 A;  3RZJ A;  1H1M A;  1LKN A;  1ZZ9 A;  3III A;  2ZEW A;  4UW6 A;  1ENR A;  3BOD A;  4CCD A;  4CDW C;  2IFW A;  3ZYP A;  4Y1V A;  1LOA A;  1ULO A;  4FFI A;  1NAE A;  2QFE A;  3F2Z A;  4E2S A;  4CEY B;  4PDW B;  2VOV A;  3GBF A;  4XFF A;  4DNY A;  2TEP A;  5KHJ A;  1SPP A;  3AZX A;  5FYH A;  1X36 A;  4XAE A;  1QU0 A;  2AC1 A;  2WFF 3;  2WNV C;  1FV2 A;  5FMO S;  5C8C B;  2G9F A;  3GJB A;  1F8V A;  4XAC A;  1KEX A;  3ZSE A;  4CP1 A;  4EWA A;  4TSV A;  4ONU A;  1Y43 B;  4L97 A;  4LTA A;  4XYX A;  5DZE A;  1RL3 A;  1YQ8 A;  4FPE A;  2RMU 3;  3TRS B;  5E16 A;  4AFC A;  3WW1 A;  3SNM A;  1JYT A;  4OMD A;  2F17 A;  2WLP A;  4NII A;  1KD7 A;  3WG4 A;  1Y3T A;  2UUR A;  1H8V A;  3PVE A;  4QM8 A;  3ZSL A;  3VBH C;  1UPS A;  5FZG A;  1JI6 A;  1YYN A;  2MEV 3;  4JKL A;  1JYI A;  2IXH A;  2DYC A;  4AL9 A;  2WFF 1;  4FPO B;  2Z4F A;  1AYM 3;  5BNO B;  1YJK A;  1XOY A;  3GDB A;  5IW0 A;  3RYP A;  4J6G A;  4BIF A;  5B4X A;  3I7D A;  1JZ6 A;  4FFH A;  5A80 A;  4DIN B;  2RMU 1;  2BTV C;  5C4W A;  1PO2 3;  3ZFG C;  1RMU 3;  1SMV A;  4BYY A;  2FCV A;  2R0F A;  4AI2 A;  2FCU A;  2K9Z A;  1LED A;  1SCR A;  2XJT A;  3AKQ A;  3N9Q A;  3WV6 A;  5FYI A;  2MEV 1;  4JHZ A;  2X05 A;  1AYN 2;  3H8X A;  1AYM 1;  4KU8 A;  1DDL A;  2DCT A;  1LUL A;  1W9F A;  2YHJ A;  2IXK A;  3E6B A;  3ZN6 B;  3KT7 A;  4UFL A;  4XF3 A;  3VBO C;  1JHJ A;  4CXX A;  1W04 A;  2ZGN A;  5APA A;  2PHU A;  3KB5 A;  1PO2 1;  1W6O A;  1VAV A;  3KM5 A;  1RMU 1;  4IGO A;  4UYB A;  4BXS V;  4JGZ A;  5JPN B;  5HCH A;  2D3R A;  1CAV B;  1GR3 A;  1AL0 G;  4IE7 A;  2Y6J A;  3LCP A;  3ZDV A;  2D43 A;  2VU9 A;  4IES A;  5GJ6 A;  3TBD A;  1RUI 3;  3IM0 A;  4I3G A;  4WM8 A;  4AF9 A;  3MLK A;  4DXS A;  2R32 A;  4FPY A;  1US3 A;  4O7X A;  1I9R A;  3O1M A;  2Y34 A;  3K51 A;  3K4A A;  3W9A A;  1SLA A;  3BGA A;  4V1P A;  5F32 A;  3T09 A;  4R52 A;  1YI7 A;  3BIW E;  2G19 A;  3HD8 B;  1K3I A;  1RUJ 2;  3PIJ A;  2VC9 A;  3J8F 1;  3DV8 A;  1XE8 A;  3M4F A;  4LOT A;  3WP5 A;  1RUI 1;  1YQC A;  2KA3 A;  1I5P A;  2GNM A;  4L92 A;  4MGT A;  3N3H A;  4HKL A;  3U07 A;  4HKO A;  1ZZ7 A;  1F2N A;  1WMX A;  2D6M A;  3NJZ A;  3UT0 A;  4URT A;  5JZG B;  1PK6 B;  4LO6 B;  1H2K A;  1DYO A;  2E51 A;  2WNE A;  3AKR A;  4MAD A;  2EA7 A;  4NVP A;  4QXC A;  3PVB B;  5DUV A;  3U14 A;  4CU6 A;  3DN7 A;  3KCC A;  2DTW A;  3WF3 A;  3WF1 A;  4Z07 A;  4M3C B;  2RR1 3;  4NN0 A;  5FK8 A;  2AYH A;  4K8F A;  3PHM A;  1OQD A;  1PHM A;  3ZYH A;  4KU7 A;  1QH6 A;  2P3I A;  3AP5 A;  1OLM A;  1DLC A;  4NIA A;  4AHW A;  4ZZ5 A;  3H50 A;  3WQ7 A;  2IXJ A;  2NMO A;  4JRL A;  2WO1 A;  3AMQ A;  3TN9 3;  3ZYI B;  2I45 A;  2BBA A;  1UU4 A;  3WD5 A;  5BNP B;  3VZJ A;  2BGO A;  5F6K A;  1HIX A;  1OC1 A;  5FZL A;  4E4H A;  1PM7 A;  2P17 A;  2RR1 1;  3NNJ A;  4FOW A;  1AX0 A;  4AED B;  1GIC A;  1HLC A;  3PUA A;  5G04 L;  1BLZ A;  5A1F A;  1TMF 3;  5FBJ A;  4IV3 A;  3SIT A;  1U5X A;  4JGY A;  2GNB A;  3IDA A;  2LW8 A;  2EXK A;  4H7L A;  3SEE A;  1LTE A;  4FI9 A;  5ANQ A;  3TN9 1;  4LOS A;  2RJ2 A;  3ZSJ A;  2JD4 A;  5FZO B;  3E5X A;  3OBZ A;  3O14 A;  2GC0 A;  2X5I A;  1OD5 A;  3KV6 A;  3MIG A;  1ZRE A;  1CIW A;  1VBB 2;  1AL2 2;  3IAQ A;  3VHP A;  4LBJ A;  2PQQ A;  1HRI 3;  3M70 A;  3O12 A;  5KBF A;  5IVF A;  1CPM A;  4LBK A;  1H1I A;  2RS5 2;  5F5Q A;  2OZ6 A;  1TZO A;  3B5L B;  5JIA A;  1TMF 1;  1GBG A;  3ES1 A;  4UF0 B;  3VDC A;  5I0D A;  4OHY A;  1MZE A;  4WM7 A;  5FO7 B;  5DZG A;  5FYZ A;  1OLM E;  3RMX A;  4DPN A;  4COY A;  2VZO A;  1RC6 A;  1GSL A;  4M4R A;  5KHI A;  3C7O A;  4YVS B;  3R0R A;  3DPR A;  2Z69 A;  1G9A A;  3I54 A;  5CIS A;  1KDK A;  3M3Q A;  3ZSM A;  1HRI 1;  3MEP A;  2AEY A;  2VMF A;  2GC2 A;  2NM1 A;  4NJ4 A;  3MW4 A;  2FHR A;  3O0V A;  4XUT A;  5GZF A;  2Y0I A;  1BZW A;  1S0J A;  1W9S A;  2VZR A;  4S2G A;  3KGZ A;  4FPF A;  4QD2 A;  1LU1 A;  3I2G A;  1UO9 A;  2QQK A;  5LBE A;  3WW4 A;  1YFW A;  3GBW A;  4UXA A;  4CEW A;  3IWZ A;  4X8P A;  4HBN A;  1CQ9 A;  4XDP A;  2Y6H A;  4TYS A;  1W0O A;  3UES A;  2VCM A;  1JOD A;  4RGG A;  2VZT A;  5JI9 A;  3MW2 A;  3WG2 A;  1N47 A;  4XQ4 A;  5BNQ A;  1PIV 3;  2A73 B;  1PX3 A;  2D5H A;  4QMA A;  2J7M A;  5FAX A;  4W8J A;  3WDV A;  5AC9 2;  3FBY A;  4R8H A;  1REF A;  1HX6 A;  1OH4 A;  5FZF A;  1QOT A;  2DFC A;  4PBO A;  1W6M A;  2VBB A;  2ZEZ A;  2B46 X;  4DXZ A;  1GQG A;  5I8T A;  1AX2 A;  2B45 X;  3PTY A;  3WF0 A;  1LGN A;  2WT1 A;  2HWB 3;  2WS9 3;  4AI1 A;  3UET A;  2VNV A;  3KMH A;  5FZE A;  1PIV 1;  1F35 A;  4OZO A;  4YGD A;  2JKX A;  3ZR5 A;  3CJX A;  3WQ1 A;  4OUS A;  2VEC A;  3CBN A;  1UZ0 A;  1JU4 A;  1WCK A;  4ZS3 A;  4FTE A;  2Y6K A;  5J09 A;  3ZSK A;  1R1Z A;  5GLW A;  2FZ2 A;  4BU2 A;  2HWB 1;  2WS9 1;  1G9C A;  3GZA A;  3V0B B;  1J1T A;  1VMH A;  3IMM A;  4MGZ E;  4Q4W 1;  4QB1 A;  4B4P A;  2A6X A;  2GH2 A;  4HON A;  3R05 A;  4LKF A;  4GXL A;  1GOH A;  1NA1 C;  2I74 A;  3JBG 3;  4DEQ A;  1W8T A;  4XBQ A;  1O3T A;  1LOF A;  2R7E B;  3HT1 A;  3KHB A;  3LIH A;  2O8Q A;  2WC2 A;  2E9Q A;  4GKY A;  3FLP A;  1OSG A;  1UYY A;  1HB1 A;  3GGL A;  3MYX A;  4AI9 A;  5J1X A;  2CAV A;  4P9X A;  5FP9 A;  3ES4 A;  4E8C A;  5LK7 B;  4C0H A;  4TZD A;  1AJO A;  4B4Q A;  1PMJ X;  1OUX A;  2OPW A;  1ZNP A;  2RMU 2;  4FXG B;  2HJI A;  3JBG 1;  3JZV A;  4M3C F;  1D0G A;  4MH0 E;  1QMJ A;  3VD3 A;  3I59 B;  4A41 A;  2BGC A;  4CP9 A;  1VP6 A;  2RG4 A;  1D4M 3;  3JU9 A;  2MEV 2;  1KS5 A;  5CFC C;  4K1Y A;  4P9I A;  2OPK A;  4MGS A;  2PYT A;  5EFU A;  4AQ6 A;  5FY9 A;  5IWF A;  4CDW B;  5A33 A;  1E57 A;  4FP3 A;  2V4A A;  5I93 A;  1PO2 2;  1OFS A;  2RHP A;  1ULF A;  2GNT A;  2KXL A;  1FAT A;  3FWE A;  3EBR A;  1D4M 1;  1MZ6 A;  1F15 A;  2WNV B;  4A45 A;  4E4Z A;  2FMD A;  4ZXK A;  2ARE A;  4NWW A;  3J7N A;  1I1E A;  4Q0U A;  3OSD A;  4JAA A;  4COU A;  3U37 A;  2C0Z A;  2W92 A;  4QXH A;  4GAZ A;  4GIQ A;  2IVI B;  4PBP A;  3UK9 A;  4AXO A;  5JIU A;  1CX1 A;  2BVV A;  5HI0 A;  3KT1 A;  2FDH A;  2WDB A;  5LB6 A;  3OPW A;  4FPL A;  4DQA A;  3VBH B;  3J7L A;  4QQP A;  5LAT A;  2OS2 A;  2BZD A;  4CDX C;  3CJI A;  4ASL A;  5EJZ B;  1BK0 A;  4BA6 A;  1AJK A;  3OUI A;  1O3R A;  1W3V A;  2I07 B;  5EHD A;  3BKZ A;  1YLL A;  2XLG A;  1FI2 A;  3ZYG A;  1WCD J;  5HCA A;  3ZFG B;  3DXT A;  2BJS A;  1O8P A;  4GH4 C;  4XTM A;  5FY0 A;  5IVE A;  2PAK A;  2Y33 A;  3SKJ E;  4QB2 A;  4FOQ A;  5FLI A;  5FMO L;  2VG9 A;  3LDR A;  5EPA A;  5FV3 A;  2H6C A;  1ZBE 3;  3KZ4 C;  2ZAB A;  3WW3 A;  3ZFF A;  1LHO A;  5GKA C;  4LHK A;  1W6Q B;  4E8D A;  2XJQ A;  3WNP A;  4ORF A;  2YG0 A;  4FPJ A;  3AZV A;  3NAP A;  1CVN A;  5EWS A;  3H3U A;  4BCU A;  1IS6 A;  4YZ2 A;  4Z1V A;  1A78 A;  4YZ1 A;  4GWN A;  1A6C A;  1Q8Q A;  1ZBE 1;  2BUK A;  1QJX 3;  3ACL A;  4I09 A;  1V6J A;  4N53 C;  4QPI C;  4Q0S A;  4NMI A;  3WP3 A;  4ES8 A;  2EF6 A;  2BU9 A;  3OPT A;  4KH9 A;  3IN9 A;  4XF9 A;  4L0P A;  3OF1 A;  1TME 3;  4YGB A;  4XZU G;  4XJW A;  4KWU A;  4XUO A;  3SH4 A;  2TBV A;  1W3X A;  3Q8E A;  1OVP A;  1LNS A;  4D69 A;  2QBX A;  1V6I A;  3AM2 A;  3KV5 A;  5E89 A;  3A4U A;  4HSJ A;  3HPN A;  5F5C A;  1HKD A;  1QJX 1;  1S0E A;  1ULP A;  2VVF A;  1C57 A;  4H14 A;  3BUC A;  2XOM A;  1UYP A;  4LR4 A;  5FY1 A;  4AGV A;  3B02 A;  4QPG C;  2D6O X;  1TME 1;  5E8A A;  1TMF 2;  5F5I A;  3IDE A;  2VQ0 A;  2NN8 A;  5EZW A;  3T2T A;  1LCL A;  4XDQ A;  4BQY A;  1ND2 A;  3I2K A;  2DVA A;  4DB5 A;  5A3N A;  3ZIX A;  5CFD C;  2ARX A;  2PTM A;  4CTE A;  5BYN A;  5LRR A;  3N9O A;  5FMB A;  1ODN A;  4JKK A;  3H8O A;  2PXJ A;  3FHA A;  1H6X A;  4ZHN A;  1ND3 C;  4P08 A;  5FQ0 A;  4YGC A;  3POW A;  3ZKY A;  4E27 A;  3W5M A;  1M06 G;  1HDK A;  4QKF A;  4AG4 A;  4XJ9 A;  4RQP C;  4XQW A;  1NQD A;  2CNA A;  1MS3 A;  1SFY A;  3B7M A;  2R06 3;  2W1W A;  4LE3 A;  4NHM A;  3A22 A;  1AUY A;  1F4A A;  2ARB A;  1W6N B;  2XB6 C;  2WSU A;  3PNA A;  1NCR C;  2DUO A;  2WWU A;  4GUL A;  3KD4 A;  1IS4 A;  2DCJ A;  4NHX A;  4QQL A;  1DGR N;  1WLC A;  3LOB A;  5GAL A;  1SFN A;  2AR6 A;  1VBD 3;  5JSO A;  4F8A A;  2QTW B;  1GP6 A;  2R06 1;  1ZRC A;  1H8T A;  1PIV 2;  3HQR A;  2UU8 A;  4OI1 A;  2P3Y A;  1GZW B;  3H1W A;  1W9T A;  1A8D A;  5CAD A;  1MPX A;  4LPL A;  1O4Z A;  4FQZ A;  4LBO A;  2CY6 A;  3PVO A;  2JDP A;  5F8P A;  3M8L A;  3SLI A;  2HWB 2;  1CON A;  2WS9 2;  1BEV 2;  2R04 3;  4KMQ A;  2NYY A;  1CZS A;  4Y4Y A;  1CAX B;  3ITQ A;  5IAV A;  3KWV A;  1U0A A;  1S55 A;  2VOX A;  5DUU A;  4G9S B;  3UGG A;  1URX A;  2K2S A;  3PUI A;  4QQO A;  2ORZ A;  4RR3 A;  2WN2 A;  4NE9 A;  4CEY C;  5BNO A;  1EPW A;  2AEZ A;  5FOB B;  1TG7 A;  2WT0 A;  3WVJ A;  2C26 A;  2D7F A;  1H2M A;  3ECQ A;  1SDW A;  2BP6 A;  4AZZ A;  3T1L A;  1I3H A;  3AYD A;  3JBG 2;  4BME A;  1WKY A;  1YFX A;  1ZYB A;  2VMI A;  3AL5 A;  2JDU A;  1TNR A;  3WCS A;  3P3P A;  1QXR A;  5IK5 A;  3P5B A;  2XG3 A;  4PIY A;  2UWC A;  1CES A;  2BNM A;  4LBN A;  2VOK A;  3WIN E;  1Y7B A;  2R49 A;  1QY4 A;  2IXI A;  3URF A;  3VDA A;  5BPX A;  2O14 A;  4PF1 A;  3RRD A;  3WXP A;  2PHR A;  3J26 N;  4OI2 A;  4CCO A;  4EN9 B;  5FK7 A;  3MGU A;  4GA9 A;  3BPZ A;  4EWD A;  3DEM A;  1D4M 2;  1QDC A;  2FQP A;  4YM0 A;  5FPU A;  3MFC A;  2HWC 2;  5IVB A;  3K2O A;  3NJV A;  1UQX A;  4LKD A;  3O1R A;  2E63 A;  2MHF A;  1DGR A;  4G3Y C;  1WUV A;  1ZX5 A;  2H6B A;  2VR4 A;  5T52 A;  4MET A;  1RUD 1;  1NA1 B;  4AVT A;  2W39 A;  4MSV A;  3GHN A;  1JYC A;  3GZT B;  5JI7 A;  5LBF A;  1RUC 3;  1UN1 A;  2XLF A;  4Y20 A;  2FZ1 A;  2VBP A;  1PGS A;  4CU8 A;  1ZRR A;  1YQ6 A;  1C4R A;  3B01 A;  3M3E A;  3O5S A;  1B35 B;  3SEP A;  4Q4Y 3;  5FP8 A;  1WLW A;  3UKT A;  2HLE A;  3O7O A;  1SZB A;  1X8M A;  1GWK A;  1NLS A;  1RUC 1;  2JE8 A;  2VUC A;  4GQ7 A;  1SBF A;  4Q1R A;  4A7Z A;  2WWS A;  4IE6 A;  3NWK A;  4QU2 A;  2ZGR A;  4GB3 3;  3FMG A;  3H1M A;  4COW A;  2QVS B;  1GP5 A;  4HLT A;  2JE7 A;  3BPS A;  4Q4Y 1;  5FYM A;  1MAC A;  1QQP 3;  1S4C A;  4FFF A;  1FAY A;  1FYU A;  1AR6 1;  5DAP A;  3RDI A;  2E33 A;  1OQE A;  4CDQ A;  4EN8 B;  3U4S A;  1SLB A;  5IYY A;  1PK6 C;  1WA6 X;  1WMF A;  2XXZ A;  3NST A;  4ISR A;  3ZYR A;  1ZBE 2;  3H7Y A;  4GB3 1;  2QQP A;  1S1A A;  5KXC A;  2NP0 A;  4AED A;  3AC0 A;  3HJR A;  1F31 A;  3GF6 A;  5A7P A;  4E4S A;  1JOB A;  3NNG A;  3RZL A;  4OHX A;  2Z42 A;  1UAI A;  5DMY A;  2Y6L A;  1Y9M A;  4MXW B;  2XLA A;  2XBO 3;  5DZF A;  3ZMO A;  1DYK A;  5AVP A;  3ZFE C;  1HXS 3;  4FPK A;  4AQS A;  4XFG A;  1QJX 2;  1YIF A;  4ERO A;  3POG A;  1RB8 G;  4LO7 A;  4LLO A;  1QOS A;  5FYY A;  1VB4 A;  4UF0 A;  2W1U A;  1UZZ A;  3ACF A;  4CUB A;  3NNF A;  4CXY A;  4GH4 B;  1ZA4 A;  4FVV A;  4BE3 A;  1RED A;  4RS5 A;  2Q8O A;  4UAP A;  4AEK A;  4S2F A;  2XBO 1;  2BRT A;  5FIX A;  2G4I A;  3Q8A A;  2R30 A;  2XDV A;  1HXS 1;  2Y26 A;  1XXN A;  4YW7 A;  5L19 A;  1GYK A;  2PLV 1;  5LA9 A;  1YRZ A;  2PHT A;  3OD4 A;  5F3E A;  2C4X A;  1H2N A;  5F3G A;  4P00 B;  2HEV F;  4PHZ A;  4V2W A;  5A1A A;  3PTR B;  1PNG A;  1BQP A;  1ZRF A;  3HBZ A;  3QH6 A;  3VHR A;  2YBS A;  4C90 A;  4XBN A;  4IUG A;  1MS9 A;  4KL1 A;  2HWF 3;  4LE4 A;  2QQN A;  4CDU A;  3VGI A;  4F7Z A;  3IZO A;  2NPI A;  3OUJ A;  5FJK A;  1NCQ A;  1Q8S A;  2E7A A;  4QPI B;  2JG9 C;  5FZD A;  3HAG A;  2BNN A;  1GQP A;  2WNU C;  4KI5 M;  3KCX A;  1ULG A;  5FZH A;  4HK9 A;  3AJY A;  4Z92 B;  4XIO A;  1PO1 1;  2HWF 1; 
#chains in the Genus database with same CATH homology
 3MGU A;  3NNM A;  5LAS A;  2G19 A;  2RDS A;  5HV4 A;  5C5T A;  5ERL A;  5L9B A;  5IAX A;  5LBC A;  5L9V A;  5DAX A;  4J25 A;  2FCT A;  4Q5O A;  5LBF A;  4BQW A;  4BQY A;  2HBT A;  5HV0 A;  5LBB A;  3HQU A;  3OUH A;  4XCB A;  4ZON A;  4XCA A;  5IAT A;  2OPW A;  4XAB A;  3NNL A;  5EP9 A;  5EQU A;  3KT4 A;  3GZE A;  2RG4 A;  2RDQ A;  4ZPI A;  4XAA A;  4UWD A;  3DKQ A;  4MHU A;  5DAW A;  4MHR A;  4NHM A;  3NNJ A;  5M0T A;  4Y5S A;  2V4A A;  5DAV A;  5DAP A;  4Y5T A;  4NHX A;  2RDR A;  5C5U A;  3OBZ A;  2RDN A;  3HQR A;  2JIJ A;  3GJB A;  4XAC A;  3KT1 A;  5LB6 A;  3PL0 A;  5LAT A;  2A1X A;  4IW3 A;  4NHY A;  3OUI A;  3GJA A;  3ITQ A;  5IAV A;  3NNF A;  2JIG A;  2Y33 A;  3W21 A;  2FCV A;  5LBE A;  2FCU A;  5L9R A;  5LA9 A;  5EPA A;  3W20 A;  4KBZ A;  5A3U A;  4NAO A;  4NHK A;  3KT7 A;  5DAQ A;  3OUJ A;  2HBU A;  4NHL A;  2G1M A;  4BQX A;  4NMI A;  3BVC A;  4XC9 A;  3EMR A;  4JZR A;  2Y34 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...