3AKQA

Crystal structure of xylanase from trichoderma longibrachiatum
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
190
structure length
190
Chain Sequence
b'ETIQPGTGYNNGYFYSYWNDGHGGVTYTNGPGGQFSVNWSNSGNFVGGKGWQPGTKNKVINFSGSYNPNGNSYLSVYGWSRNPLIEYYIVENFGTYNPSTGATKLGEVTSDGSVYDIYRTQRVNQPSIIGTATFYQYWSVRRNHRSSGSVNTANHFNAWAQQGLTLGTMDYQIVAVEGYFSSGSASITVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords xylanase
molecule tags Hydrolase
source organism Trichoderma longibrachiatum
publication title Packing Space Expansion of Protein Crystallization Screening with Synthetic Zeolite as a Heteroepitaxic Nucleant
doi rcsb
total genus 58
structure length 190
sequence length 190
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2010-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3akqA00
1UU4A 1XXNA 1C5HA 1AXKA 1H4HA 3WQ7A 3VZKA 3ZSEA 1PVXA 2DCZA 2DCYA 3B7MA 1HV1A 3HD8B 1H4GA 5EJ3A 1NLRA 4XQWA 1F5JA 3VGIA 3VHPA 3WQ0A 3WT3A 4HKOA 1XYPA 3AMQA 1UU5A 1XNCA 3WP4A 5K7PA 1BVVA 2DFBA 3B5LB 3MF6A 1W2UA 2JEMA 3AMPA 3AMHA 3AKTA 4XQDA 2DCKA 1H8VA 1UU6A 2B45X 3WY6A 1REEA 2BWCA 4S2FA 2QZ3A 4H7MA 3VHNA 1TE1B 3WP6A 2NLRA 2VG9A 4IXLA 1XYNA 1OA4A 4HKLA 1HV0A 3WX5A 2C1FA 3WP5A 2VULA 3VZJA 3AKRA 4S2HA 2B46X 3AKSA 3MFAA 2Z79A 3VZMA 1KS4A 1UKRA 1XYOA 1QH6A 2BWAA 1H0BA 3WP3A 1H1AA 2VGDA 3AMNA 1OA2A 2JENA 3MF9A 1REFA 3VZLA 3EXUA 3VZNA 3AMMA 4S2DA 3LB9A 4HKWA 3VLBB 3WXPA 4XPVA 4HK8A 1OLRA 4HK9A 1OLQA 2BVVA 1OA3A 2BW8A 1BCXA 4NPRA 2NQYA 1XNDA 5K9YA 1IGOA 3LGRA 4XQ4A 1ENXA 3MFCA 3AKQA 2VUJA 1HIXA 4S2GA 3VL9A 2DCJA 1BK1A 2D97A 2D98A 3VZOA 2DFCA 3WR0A 3M4FA 2F6BA 3RI9A 2JICA 1REDA 3O7OA 1M4WA 3WQ1A 3RI8A 2B42B 1XNBA 1KS5A 2QZ2A 3AKPA 1YNAA 1QH7A 3VL8A 1C5IA 5HXVA 3VHOA 1XNKA 1T6GC
chains in the Genus database with same CATH superfamily
1QJX2 1GU3A 4I0WB 1O3SA 4LBNA 2BBVA 1ULGA 2ERFA 1OHFA 3SLIA 3P6BA 2DCTA 2VCBA 5KHIA 4WM8A 2WZPP 3ZOIA 5FXVA 3MLJA 3PTYA 4IL7A 4NVPA 3ZMNA 4P9JA 1F5JA 2QQWA 1WLDA 2XWJB 4PCRA 3THPA 3VHPA 5JOWA 2WKKA 3UGGA 2RMU1 2VNRA 5A7WA 4YPJA 3GZAA 4F7ZA 4CRQA 4PDWB 3CL1A 1KXGA 2A3XA 1BYHA 1VAVA 2YGMA 3B5LB 1GWKA 2AC1A 1QKQA 3OGVA 3M3QA 4P9GA 5FZKA 1XBFA 5IVYA 1LR5A 2HKXA 1TME1 2FQPA 2GC0A 1UMHA 4NAMA 2D7FA 1O8SA 2CHHA 2ET7A 2WN3A 3KD4A 5FXWA 1SQ4A 3LIHA 4S2FA 4XFIA 1PMJX 1ONAA 2WFF3 4KG0A 2WFPA 3H3LA 4RYDA 5F5AA 1VE0A 4HN1A 1SMVA 4X8NA 5JLVA 5C7GA 4E4SA 4K3UA 1XOYA 1AR82 5A7SA 1JODA 1E5HA 4JC1A 4YGEA 3GF6A 3P1IA 4CDUA 1I6XA 2GZWA 4XUPA 4ZKTB 3P3NA 4QD2A 4XUQA 2JDKA 5FJHA 2GNTA 4LE4A 2RR12 1VBD2 2VD7A 3K75B 4UW4A 3MEPA 3WF0A 1GANA 4CTEA 3HQRA 2CWSA 1VBD1 1OOPA 3C7OA 4BYYA 3VBRB 4XZPA 1ENSA 5FTTC 2CV6A 1YI9A 3AP4A 4AI3A 3ZN4A 4FOVA 4HG6B 4OI2A 4XF3A 4XOGA 4R9DA 4ZXKA 1X8EA 2GU9A 1RUJ3 1ZBA3 1TVGA 3EXUA 3OG2A 4KL1A 1XE7A 1VLNA 4QQLA 1XE8A 3DYPA 3UETA 1MR5A 4A6OA 2Y0IA 2E7AA 3B02A 1DYKA 4A7YA 1HXS2 4Z2WA 5M0TA 4Y20A 4BJ0A 3USSA 4HK9A 1W8TA 3I4IA 3ZPYA 2DVBA 1OA3A 4LHKA 2CL2A 1C8NA 1J1LA 2XJVA 3DV8A 1TME2 5DUVA 3VDCA 5KC6A 4OULA 4NOTA 1X9TA 1JUHA 3WG4A 1QMJA 3JXSA 3LGRA 4YW2A 5C33A 4QKBA 2QKDA 1ENXA 2VAUA 5FOBB 1W9TA 5EYYA 5DAQA 1OD5A 3WNNA 4A4AA 3T0DA 4M3CA 3PUHA 3I3BA 4IQPA 5C4WB 2Q1FA 1AZDA 1BVP1 1ULPA 3E5XA 2JIGA 4IUGA 5H9PA 2YUEA 1RXFA 3H42B 4YG6A 1UY3A 3DKWA 3WQ1A 4KGGA 5J98B 3GBGA 1R092 4AI1A 2XBO3 1YLLA 4AVAA 2FDFA 1GYKA 4R9CA 5FZOA 2JG9A 4BH9A 1QJX1 1K5MB 3T1LA 2B8MA 1POV1 1OKQA 1PNGA 1IS5A 3KWVA 1ZZCA 4GKYA 3GGLA 2YHJA 4HSJA 1PO12 4AR2A 5IHRA 1T6GC 5EV7A 2XVKA 3LA2A 3GZTB 1VALA 4X6QB 2VE1A 2DBIA 4HFSA 3NVCA 2ZGKA 3AM2A 4FI9A 3B7MA 3HD8B 3BPSA 5LEJA 1NA1C 1ULEA 4QMAA 2P37A 2QQLA 5J1XA 5EJZB 1FMD1 2ZZQA 1R1A1 3AZVA 3I7DA 3MPPG 4CXYA 1R091 3VBFA 3HNYM 5FOJB 1JN2P 2WBKA 1O3TA 1NLSA 3WNLA 4LBQD 4FPKA 4LBQB 4WZCA 4HVQA 5I91A 1S0CA 4YZ4A 1PNFA 1PK6A 3PNAA 2PAKA 1TZOA 3O0VA 3MV11 1FI2A 5FYVA 2W08A 4JDOA 2WA3A 5K4LA 3X29B 5G04L 1ODNA 4D7TA 1OI6A 4MGKE 2YC4A 3PURA 1ASJ3 4FVVA 4W4ZA 4FSJA 3THCA 4DY3A 1G86A 4IEVA 3RYPA 1A8MA 3WDWA 4TTGA 3VHNA 1HB1A 1VBC3 1XQNA 1URXA 4MZUA 4Q4X3 4AYUA 2XJPA 4RHV3 4XUNA 1OMIA 1YQCA 3I3EA 3PHMA 1RXGA 3PUSA 2IXCA 2E7TA 4JKMA 4N9HA 3SCGA 2HWE2 2B9UA 2R6QA 4LO5B 3ETPA 1QJFA 5EP9A 3RS6A 5T5LA 1HB3A 2SBAA 3ITQA 1SBFA 3GBFA 1ZZ8A 5D2AA 3SITA 3LSEA 3BOPA 3NNJA 3IKWA 4CEYA 4Y3OA 1NXD1 2DUPA 5ANNA 1NT0A 2BWAA 3NSTA 5D21A 4V1PA 4WM7B 3KMHA 3LA3A 3NL1A 2ARCA 1OA2A 2RR11 3PVNA 4A41A 4E4ZA 1DU3D 3VBHC 5DAWA 3D8CA 2A3YA 5ACA2 4BQYA 3VBUB 4IEWA 4DO0A 1CPNA 4JGYB 2DVAA 3WXPA 2W94A 4C91A 2NM1A 3QH6A 3R4DB 3OUIA 3AYCA 1DQ5A 5G05L 1LGCA 1JH5A 5EWSA 5DAVA 1SLTA 4N43C 2W68A 4NPRA 3OBTA 4JV4A 2MEV3 5FYBA 3ZPOA 3H7YA 1DDLA 1FXZA 3SMHA 5BNOA 2WJSA 4YNIA 4XFHA 3CJXA 5ABJB 2CAUA 1WCUA 3H3UA 1JYIA 5LWBA 4DMIA 3WR0A 1BLZA 4XIOA 4DZGA 4A2UA 3N7MA 1QNYA 3PIJA 3WF4A 4JTNA 3S5AA 5FZ1A 2EXIA 2A6WA 2HWD3 2VPVA 2VTFA 4NRMA 4XCAA 4ZU4A 1C8M2 3DKQA 1DGRN 5JZGB 3M3EA 5FXXA 4Y22A 1L3JA 4LNVA 4DXSA 2L9LA 4RD7A 1YFWA 3CU7A 2YMZA 5IW0A 4FFIA 4PI2A 1AR72 3DYMA 3L2HA 4GIQA 3VDDB 3J26N 4OHYA 3AJZA 4AFBA 5C8CC 3POIA 5L7OA 1Z78A 4K1ZA 4O7XA 3USUA 2VQAA 1YFYA 3ZN5A 2ZX4A 4QPYA 4WV8A 1WBLA 1RUE1 1DLLA 1MS0A 2NMOA 2EXHA 4XAEA 4Z82A 5L7OC 2ZZJA 1HDKA 1EV11 1W3XA 1N47A 1UZZA 1FAYA 4JHTA 1PGW2 1V6OA 2VBDA 4M0HA 4N53A 3W9AA 5DPNA 2WFF1 4JQRA 1SFYA 4XJUA 1RL3A 4NJ4A 4QXBA 1RVF2 2BU9A 5GLWA 1JZ5A 3N9QA 5CFCC 1F5FA 1W06A 4FXGB 5A7WB 2OVUA 4ISRA 1LGBA 5FUPA 4Q0PA 5D8AA 5A3PA 2OPKA 5FREA 4Z92B 2J1VA 4SLIA 1DQ0A 1DYOA 5FPZA 2XMLA 4HL0A 4MV2A 4CPBA 1AL23 1JHNA 1WWYA 3VKFC 3MYXA 4DUWA 1RB8G 2QQKA 4NPMA 1V0AA 4EJRA 5IVBA 4OYUA 5JSOA 3PUAA 5CFDA 2R32A 2C0ZA 2VZSA 2HWC2 4FBFA 5A33B 3LKJA 3B94A 1DLCA 2A73B 4IEZA 1OURA 1W9WA 2X8KA 1EP0A 1SLCA 5LBBA 1W6OB 3WW1A 1H8TB 1DF0A 1UYPA 2BP6A 4FTEA 5BNOC 3AKSA 3CIHA 3F2ZA 1EPZA 2O0OA 1PX4A 4KWUA 2FCVA 4PT6A 4D6RA 4QDQA 5IVCA 3FL7A 2J1TA 1KITA 1ULOA 3N9NA 1QGLA 4PBOA 4EYUA 4LK7A 2HYKA 2VTXJ 2EAAA 5A7NA 5L19A 2JDMA 4AEDA 4XMAA 4CDXC 1OOPB 4K21A 1T2XA 1UYZA 4GQ7A 5L9VA 2JKXA 2WO3A 4AFAA 5JWPA 3O0XA 3LWCA 3FX3A 3AMMA 3M3OA 4BCUA 3DPRA 1D4M3 3VLBB 4LMFA 3O14A 4XJ8A 3HBKA 4ASLA 1CZTA 4HK8A 5JZGC 5FZEA 5C6CA 1R1A3 1OH3A 4AOCA 1S0EA 5FY1A 3UNPA 5HV0A 3NRUA 4HANA 1DQ1A 1RHI3 4B8EA 4BLIA 2RM21 3OPTA 5JI9A 2QBXA 1QQP2 4WZFA 1CAWA 3EMRA 5GJ6A 1W04A 5F39A 5A70A 2BV4A 2AZ5A 2LW8A 2AREA 3O1PA 4IV3A 4JRLA 4OZXA 3LIGA 3CF6E 5CISA 4UFIA 4BK4A 1IQAA 3CQOA 5J37A 1NKGA 3ACGA 1JOPA 3K3NA 5A80A 5IK7A 1Q8VA 3I59B 2JG8A 1YJKA 2ID4A 1X8MA 2GMMA 3S6PA 1L7QA 5FJKA 3ZFEC 1KJLA 3JU9A 3OBRA 4XBNA 5FBJA 5BNNB 5ERLA 3RSJA 1HXS3 3TB0A 2ARBA 3GM8A 5ANQA 4CCMA 1V9U3 3ELNA 2BNMA 3ZN6A 4BXSV 3DPRC 4AQTA 3H7JA 4FPYA 1EAH1 4TWTA 4LO4B 2P3KA 3LDKA 2JG9B 5HXVA 2BQPA 3JD71 4CP2A 1MQTA 1S0GA 5JI7A 3D3AA 3BODA 4Q4Y3 4ZXEA 5I93A 1IZ3A 2IXIA 3J4UH 1LEMA 3S5QA 3CMGA 1CAUA 3BALA 4AZZA 2JKBA 3HIFA 1RUOA 1QQP3 2TNFA 1BJQA 1UZWA 4IE4A 1W39A 4KBZA 4WBBA 3ZR5A 1YQ5A 2VZ1A 1W03A 3A4UA 2WNVB 4AHYA 3VDDC 1IG0A 4QB1A 4Y1YA 4ES8A 3WLUA 1AYN3 4P00B 2OZ6A 3KS7A 2VW1A 1QJY1 3FBMA 3ROUA 1RUI3 2G9FA 5C3PA 1CQ9A 2VOVA 2CGOA 1H6YA 3WF1A 1C28A 3C2UA 3H1MA 3KHBA 4I3GA 2PQSA 4PQ9A 2FZ1A 4Q4V1 3V64A 5JMCA 4CCLA 1UIJA 3KCYA 5EXOA 2AACA 3VBRC 3DGTA 3OY8A 3BTXA 2RR13 5JR2A 2DYCA 1JYVA 2V5DA 3NNFA 2X5IC 2NPIA 4EWEA 5FYSA 3T4HB 4PIYA 5EZWA 1RUD3 4FQZA 1MVQA 1NOVA 5IWFA 1V6NA 5T50A 2VTXA 3RVHA 5A6QA 3OBZA 3TOJA 1H9PA 3R0RA 4TN7A 5IYYA 1AX2A 1W90A 4DQAA 2VOXA 1PMHX 3OB8A 4OUSA 4Y24A 1ND3B 1DQ2A 4YG3A 1XB9A 2R16A 2VZUA 3EJKA 1GBGA 3J8F2 4JZRA 2ZEZA 3H50A 4A3XA 5KHHA 5DUUA 2WQ4A 2ZGQA 2EVXA 5F32A 4NIAA 1AR93 4QT6A 5FQ0B 5CZKA 5H9RA 4C0BA 2QQIA 2ZGLA 1SZBA 3JQXA 3POBA 3ZM8A 5A6YA 1R081 2E6VA 4KI5M 2PHLA 3ILRA 2P3IA 1YYNA 2BW8A 1UOFA 4AGRA 1GKBA 5E8AA 3RQ0A 1BCXA 2IVIB 3H0OA 4UFHA 4RR3B 4CCNA 1WA6X 4HT1T 4EZHA 2DUOA 2ZGNA 3R4SA 4Q4V3 1UCXA 4HVRA 1H6XA 5FLIA 1W05A 1EV13 4OUMA 3ASIA 4MO3M 4JGZC 3MIDA 1IQDC 2AUYA 2BTVC 2RM23 4N90A 4UAPA 1YHFA 3U07A 2F6BA 2ES3A 1RUI1 1BMV1 1LCLA 4NRPA 1CONA 1VAMA 2VY0A 3IIIA 3ZXGA 4RQPB 5LEKA 4HMZA 3FHQA 1Z7S3 2WNVC 3EBRA 1DQ4A 1SLBA 1ZBE2 2GN3A 2X10A 2ZOEB 1D7PM 3AL5A 4ZHNA 2R1DA 3AXEA 5JXGA 4RGKA 1QH7A 2GSYA 2RDNA 1D4M2 4DNYA 3ZYJB 2VZQA 3JB8A 5KWRA 3RDIA 1O59A 4Y22B 4W8JA 2BFUL 2VUDA 5HCFA 4CUBA 3KZ4C 3I2KA 4N7UA 2WS91 3ATGA 2FDHA 4CDQA 4XMIA 1NLRA 4IV1B 4CDXA 4QPGC 2R1BA 3M1HA 3WQ0A 2A6VA 2EAKA 3D0JA 5FUIA 5IVFA 1VBD3 2RDSA 2YZ4A 4Q4W1 2XBO2 3VBUA 4QPGA 3IN9A 4BQ3A 2EALA 4YSFA 1RUH3 4P02B 4QX5A 3WNMA 4AFDA 3MF6A 3WOGA 1A34A 1HB4A 2OYZA 4ET7A 1ZVFA 1D0GA 3AMPA 3DYOA 2ETEA 2OX0A 1RUG2 4UOJA 3UV9A 3V65A 1UIKA 3KV6A 2WYSA 4XFAA 1T6BX 2P17A 1UU6A 1N1SA 1VMFA 1ZRIA 4CP1A 2XJUA 5AC92 1IKPA 3LA7A 3MZHA 1OQ1A 1SCSA 2VZPA 1YEWA 3AP9A 4FTBA 3K77A 2Y8KA 3JUUA 4HLTA 5IFPA 3ES1A 2PLV1 2HYXA 2YG0A 4DFSA 1ZRCA 1XNTA 4HKLA 3D5OA 1L7RA 4LBOA 1UPIA 3MGUA 4AQSA 4QB6A 1TME3 3IWZA 4QGLA 5LB6A 4UFMA 4D7SA 1N3OA 1COV1 2X05A 3WP5A 4E27A 1G8WA 1W3VA 2XWBB 5FZ6A 1UKGA 4IGOA 3E97A 5L73A 1KGYA 1W0PA 1QDCA 1Y9QA 5CBLA 3AZWA 2WSUA 1UKRA 2ADDA 2RMU3 4KU7A 3WDYA 5IAXA 3WUCA 3DCQA 5JXJA 1J1TA 3AX4A 2VGDA 4TYSA 3RG0A 2Y0OA 1JOBA 2Y6GA 5LRSA 1H2NA 2JENA 4JGZB 4HPKA 4XFGA 3OYWB 4W6XA 2ZEWA 4UW5A 2DDUA 5KC5A 3A21A 1HRI2 5JVVA 3WDVA 3VBSB 1CX1A 5JXHA 2WT2A 4BA6A 2YPJA 2W46A 2PTMA 4YZ5A 4NO4A 3NW4A 1OQEA 3CHXA 1V6LA 1AYM2 1MZFA 3DPRB 5DQ0A 4IDZA 3POJA 1XPWA 1CWPA 2EIGA 4XETA 1XNDA 3I3MA 2W5FA 3TBDA 3H8OA 3J8F3 3JB4C 1O3RA 1G6NA 1XU1A 4KWJA 5KXBA 3WDXA 2AR6A 3MBWA 3NAPC 4BZ4A 4LA3A 2QFEA 1JYXA 4YGBA 3OJBA 1ZREA 4BMBA 1CAWB 1VRH1 2D98A 3MICA 1N1VA 5LA0A 3IM0A 4ES9A 5FZHA 4NE9A 5SV5A 2XHKA 5CKNA 2R062 4RSUA 3OPWA 4GB32 3K4DA 1ST8A 5E6HA 2AGSA 1GQHA 1FNYA 1RUH2 4G3YC 1B35A 4GULA 3SHRA 4URAA 3ZX7A 1MS3A 1WCSA 1LHWA 3K3OA 5GZEA 2V5YA 4X6RB 4C8DA 4LKDA 3VBOA 2J1EA 1KDKA 4CU7A 1W9SA 4IETA 2FDKA 1QOTA 1DBNA 3PUQA 1O4YA 5BNNA 2DV9A 5B4NA 2FMYA 4OI4A 5F3IA 5KXCA 2RDQA 5FZ0A 3VHOA 4ZZ8A 2KD7A 4Z07A 4RQPC 1C3HA 3ACHA 3FBYA 2BERA 3KQRA 4NUBA 3WW3A 2XL9A 2CGNA 1LJ7A 2VL4A 3J9SA 1S2KA 3LF7A 2PHFA 4AEMA 5T55A 2WNUB 2D5HA 4XFBA 3V56A 3T2OA 4AEDB 4JAAA 1K45A 3MIFA 4YFZA 5J09A 2C6SA 3WHTA 1WLTA 4DRRA 2DUQA 2VU9A 3KF3A 4LITA 4CEYC 2CWMA 4XYXA 4CXWA 1V70A 4ZONA 1NCQC 1RUF1 1J3RA 3JD72 5H9QA 3B69A 4SBVA 3CZUA 3H1WA 4I02A 1CIWA 5I0UA 3ORJA 1CJPA 1AL22 2YY1A 4ONUA 1IHMA 5FWJA 4IE5A 3PVBB 2WAOA 3T2TA 1EUTA 2RDRA 1V6IA 1YQ2A 3TRSB 1SLLA 3LE0A 4ZS3A 1LOBA 1CX4A 1R083 2UWAA 3I2OA 3JBG1 3VKOA 2ARAA 1W6NB 2BNNA 1OLMA 1RINA 3IMNA 2HH9A 3UT0A 1EPWA 1PGL2 5F37A 1RIRA 1NXMA 2ILMA 2MPFA 2O1QA 5E1RA 1AR91 2LM3A 4W65A 1W8FA 5B2GB 1WMFA 1R093 1GNZA 4PHZA 3TNQA 3THTA 3V0AB 3L9JT 2YBSA 2RHPA 1OFNA 3AXDA 3O1TA 4CDWB 1ACCA 3ZXAC 2HEVF 3Q9OA 2BGOA 3QBQA 5T52A 3K4AA 4BLJA 4OI0A 1AR73 3G7DA 2ZGRA 5I8SA 5CFDC 1QXPA 1SPPB 3C8XA 1RUF2 4F3JA 1VBB1 4MX3A 4EE2A 4IEXA 5FZOB 4B7EA 4IESA 5A3MA 3IIAA 4HKWA 2PFWA 5FMBA 5EIYB 4L97A 5BNQA 4NIDA 4COYA 1AXYA 5FCCA 2WL1A 2DU1A 5DAPA 4D69A 2RS52 4P9LA 2WA4A 1FV3A 2R7EB 1UD1A 3ZFGA 4B7KA 2OUJA 1AX0A 2VVFA 1F9KA 4HVOA 4UWDA 1IGOA 4LIUA 1WD3A 4YM2A 3UKVA 4AAPA 4RHV1 3AKQA 5BNNC 3TEZA 3JCIA 3BKZA 2RG4A 1OF4A 4LHLA 4BMEA 3Q8BA 5LK5A 4KU8A 1F35A 3A0KA 3H8UA 1BK1A 1U0AA 4R8HA 1L7LA 5GLTA 4QPWA 1HQWA 1GP4A 4OMDA 1HQNA 4QU2A 1QJEA 2VW0A 1YCIA 3UKTA 1SBEA 2WNOA 1ZM1A 3LDRA 4UFKA 3R4UA 2H0VA 1JMUB 2A75A 4GWJA 4IE6A 2HWC3 2WN2A 4OQ8A 3KT1A 1VBA1 2VXRA 3ZSMA 4I01A 3I3QA 2ZACA 1E5SA 2K2SA 3BYWA 2OS2A 3FC0A 5AVAA 5K0UC 2QNKA 5GZGA 1OFSA 5FP8A 1RVF1 4CSWA 2D93A 3AZZA 2GC2A 2WZEA 4Y26A 1HRI1 2JB4A 2Y38A 3T08A 5K8SA 3OEAA 1PGW1 1K42A 3V0BA 1DGWA 3OOXA 1LKNA 3NJVA 1S2EA 1C1LA 1WW7A 4LKSA 2G19A 1IS3A 2JDZA 1SFNA 2ZTNA 1Q56A 4MADA 4Q0QA 4XQWA 3VKNA 1JOJA 2BNOA 5DDJ1 1E5IA 5GLZA 5A32B 4QKNA 1ASJ1 4HKOA 1XYPA 2W1WA 1XNCA 2O8QA 3I2IA 5FYIA 1RUJ2 1ZBA2 1CAVB 5FV3A 3VD5A 4DIQA 1XJAA 5C5TA 4AEDC 4LO6B 1GLHA 4M3CF 4Q8LA 5FZAA 1EYBA 1S0IA 1WMDA 4WM7A 1QXJA 3A7QA 2ORXA 4LQRA 2VMEA 3B93A 3RRDA 4TXWA 3P5BA 4FPFA 3O5SA 4H7MA 4LULA 4ITCA 4GKXA 5BPXA 4UBHA 5C71A 5FPXA 1COV2 3MV01 4GJZA 4KNCA 1D4VB 2D3RA 3LQCA 3R05A 4YM1A 2FMDA 3H8XA 2Z69A 1VR3A 5HCHA 1BEV3 2G9ZA 4L2NA 2GC1A 1RHI2 2Y34A 4AHZA 1YQ8A 4DY5A 3MHZA 1WGPA 5T54A 4AVCA 3AKRA 4OHVA 4XBQA 1DGLA 1GOFA 1HN1A 5HPOA 2QJVA 2KXLA 4XACA 5AC91 1MPXA 2XBO1 1Q8OA 2HWD1 4L99A 3TEYA 3WG2A 1XYOA 1QH6A 4Y5Z0 3WHUA 3WP3A 4XXAA 3I2DA 5ABJC 3Q8FA 4DXRA 3PU8A 5FK7A 3C3VA 4XXPA 2DU0A 1IS4A 3NNGA 1OVPA 1GZWA 2ORZA 3KGLA 1H2MA 2XR4A 2WLQA 1Q8QA 2WT0A 4R9AA 4H7LA 2A6XA 2H0BA 4HZFA 1LOEA 1U5ZA 1OLRA 3GDBA 4R4ZA 4FT8A 1OLQA 3NJYA 4RFT0 1ENQA 2BPA2 3DF0A 3BIWE 3H9AA 2WS92 1EY2A 3FUQA 1O8PA 1MEC2 1VBE3 4I3PA 1PK6C 1N1TA 2WT1A 5L9RA 2QE3A 4A3ZA 1F31A 1TNFA 4CEWB 1KFUL 2HBTA 3FHAA 1X7NA 4XDQA 1D4M1 4QXHA 5TSWA 2XG3A 5A3TA 4QAWA 4K8RB 3P3PA 4PDWC 1QJU3 2HWE1 5KHGA 5H9SA 1KEXA 1UX7A 3M4FA 4R4XA 1P8JA 4IV3C 1X50A 1H2LA 3KF5A 4CPBD 4PDWA 2W1UA 4O61A 5F8PA 1RUG3 3ZYRA 4XHXA 3D82A 5C3QA 4MLOA 5LA1A 4KQ7A 4DUVA 2JDNA 2WWSA 2QZ2A 2WZR1 2YYOA 3DL3A 2JE9A 1HJFA 1GMMA 1VRBA 4L8QA 5GZFA 1YNAA 2WYFA 1BK0A 2EXKA 1S0JA 4QX2A 3WCSA 5L9BA 4LJHA 1HX6A 1OUSA 4BB3A 2IFRA 3VZKA 4CUAA 3CJIA 1UXXX 4WVZA 3LOBA 1Y3TA 2PAMA 2Y6JA 1RMU2 4LEJA 5CG9A 3VKLA 3WF3A 5EJ3A 5A33A 4E2SA 1NLQA 3UESA 1E57A 3J8F1 4MSVA 4IERA 4JGZA 4MGSA 1VP6A 2I2SA 5LY2A 1US3A 3QCWA 4RS5A 3BTZA 4MYEA 4AF9A 3AP7A 1AHSA 1K5MC 1Q8SA 2W95A 5CB7A 3TAYA 2R0HA 3GJBA 4CE8A 3HOBA 4J6GA 3OTFA 5F5CA 1ZRDA 3ECQA 1LU2A 3ZDVA 1SLIA 2DCKA 2GNDA 1JTZX 2B45X 3SISA 1REEA 2BWCA 3GZEA 4Y33A 4AI8A 5FDBA 1JZ8A 4FPJA 5FP4A 3HT1A 3ZFEA 4Q4V2 1GOHA 3I8TA 1NA1B 2VG9A 2VMIA 2B39A 2MEV2 4GMP0 1QEXA 5E88A 4Y20B 3HBZA 3O1VA 2CNAA 1SACA 2ZMKA 5JAXA 3SEEA 1UX6A 1FOD1 3VBOC 2WSVA 1HV0A 3APBA 1OUXA 4V2VA 2ZX2A 3UJQA 1VBB3 1B35B 1ND2A 2VBPA 3ZFFA 1K5JA 1SHWB 4JKKA 3ZR6A 4RHV2 3MFAA 2BOIA 3M70A 4E9KA 2LUWA 5HV4A 1JUIA 3IPVB 5AFEA 2H6BA 3NV2A 1WCQA 2HWB3 4Y1ZA 1CR7A 5C4WA 3RYRA 4YW3A 1H0BA 2OQ7A 5C9AB 3V0AA 1QJY2 3M7AA 1ZX5A 3OD4A 4LA2A 4XVHA 4QWNA 4XJZA 5JCTA 4YW7A 5FYHA 4XDPA 2JIJA 4IGQA 3PVOA 3POYA 3CLPA 3LEMA 4OI1A 4JHZA 4UT5A 5CYYA 3VZNA 2VC9A 4CYDA 1LOGA 4OLLA 3GCXA 3ZFGC 3O1MA 3GCWA 4GXLA 2JE7A 4JTOA 4NIGA 4K8FA 1EAH2 2KR2A 1ZRFA 3GJAA 5BUVA 4META 2A1XA 4YWAA 2HLEA 1DGWX 5CNAA 1LU1A 3EO6A 4KBBA 5LK7B 5K9YA 1FPN3 1X33A 2X09A 3NV3A 4QX3A 5KXDA 4K7JA 5FY8A 4AVVA 5FMDA 2Q8EA 4CP0A 1I5PA 4QHBA 3KT7A 3POFA 3ZIWA 2HWF3 2DCJA 4ARYA 1BHGA 1G9AA 5LASA 3VZOA 3CDZB 1FPN2 2BFUS 5CAZA 4I30A 2W92A 3WW4A 5IFTA 5JOXA 3H3ZA 2XJRA 3AP6A 3D4KA 2WNVA 3KHCA 1IPKA 4BIOA 1JYCA 1M4WA 1PK6B 1PVC3 2Q8CA 4CCDA 3S0MA 3VD4A 4Z8BA 3WG1A 1XNAA 2B42B 1OC1A 4N7IA 1AXZA 2TUNA 1RUNA 5DUWA 1H1MA 1C57A 4NIIA 3RZZA 2CY6A 2QQUA 2WWJA 3NMBA 1O7FA 5FYZA 4AI0A 1QJZA 2A5ZA 2WR9A 2X29A 5A7QA 3VKMA 2XLAA 1W6PA 1XNKA 2WO2A 1OPMA 3WQ7A 1JS9A 1SDWA 2PHXA 2WNEA 1MS1A 4CDQC 5C8WA 4CA9A 2I45A 2RS33 1OT5A 3HQUA 5T3NA 3ZYBA 2DVGA 4XF9A 1J84A 4RGAA 1OPOA 3QLQA 2BOJA 2LTNA 3A23A 4FPOB 2YFZA 4QGNA 1VBE1 1G7YA 1ND2C 2C24A 2D3SA 3ZFFC 2WO1A 4EN7B 4WVWA 3WP4A 1W0OA 4CCCA 1SBDA 2ZABA 3MO4A 1DP0A 3KGZA 4OCTA 1W9YA 2D6MA 1Q43A 3BI3A 1H2KA 5FP3A 2IXJA 4Q4X1 4ZU5A 1U5XA 1O5UA 5FY4A 1K3IA 5FWEA 3AMHA 2MNGA 5KHKA 2ZKLA 1NCRB 3KCCA 1PIV3 2FCUA 1ZRRA 3WY6A 4QGMA 3W59A 4LT5A 2Y6HA 4QM8A 2QQMA 4FXKB 3TN93 3DXTA 1GZTA 2IWGB 2YV8A 4E2QA 4JGYA 3GHMA 4J1XA 4UF0A 5FZCA 3CNAA 4GB31 2R041 3OGGA 4N8MA 4R52A 5FP7A 3T0BA 3IAPA 5A3WA 4QU1A 3MW2A 1VB4A 2CDOA 2VM9A 1UOBA 1W8OA 1NAEA 4LOSA 3O1RA 1UQXA 5JIUA 2XHNA 4B1LA 1U12A 3JQWA 1W2NA 2R072 2VO5A 2BVBA 2I07B 3TN91 3ZMOA 2EA7A 2VH9A 2WFF2 3VBUC 1ULFA 2Z79A 1KS4A 1GWLA 1TMF2 2HWF2 2YROA 3HNBM 5FYUA 4OFGA 1AYM1 1H1AA 3A22A 4FPCA 4RN5A 1RUE2 2UYAA 3ACLA 4GH4C 4EZ4A 1M06G 1BBT1 1RITA 1TMF3 3FLRA 1CZVA 3L2YA 3CJIC 3ME2A 2YC2A 2UY9A 1FT9A 2RS53 5IK4A 2JDYA 1NZCA 3DEMA 3BVCA 4D7YA 2R043 5F3CA 2O8OA 4FCAA 1NY72 2OUHA 3CBNA 2PMWB 4LHSA 1V00A 1XU2A 3IT8A 4TSVA 3ZXFA 2VNOA 4CCOA 4NWWA 5LY1A 4YVWA 1YUDA 1GQGA 4LPLA 1C8M1 5DDJ3 5FPAA 2RS32 5F9TA 1NCQA 4NHKA 4URTA 3AB0A 4XQ4A 3SKVA 3T09A 2YFUA 4ATEA 3USUB 5L7OB 1O91A 2Y26A 1YXWA 4CDQB 1W8UA 2P34A 4UW3A 2P3YA 4KGQA 4IV1A 4L9BA 2A71A 2YXSA 3AYEA 3NQHA 3Q8AA 4CDXB 1OOPC 2RJKA 4AXOA 4K6BA 4AI2A 4EV0A 1PM7A 3J7HA 2C9AA 4ISQA 3O7OA 5FZBA 4QPGB 3VB9A 1CAXB 3RI8A 2BUKA 3E6DA 1Z7S2 3FFZA 3ST7A 3VBHA 5F7UA 3LDBA 3FE5A 2K9ZA 1KJRA 1ND3C 1XNBA 1SEFA 3N7JA 2PYTA 5FAXA 1UF2C 3PJQA 5D8AB 5JSPA 5LBCA 5DABA 4XILA 2O14A 1OH4A 1WW6A 2NZ9A 1YJLA 3FHIB 3PTRB 1LULA 1OF3A 2ZGTA 2OKXA 2CU5A 2XVLA 4BQWA 1HRV1 1WA4A 2E32A 2W2IA 1MS9A 4CEWC 2TBVA 4YW6A 3O1SA 1O4TA 5ACA1 1AL0G 1RYYA 4ZY9A 3B00A 5J96B 1QNWA 1W8ZA 5F3GA 4JX0A 1US2A 1CZSA 3Q8CA 2PAEA 2WDBA 1UY4A 3WNKA 3AMQA 4AK3A 2VZVA 2ZGMA 5FMCA 2Z4FA 5FY7A 1UZVA 3N9LA 4FOWA 1N3PA 3HVDA 2LROA 2AEYA 2ZGOA 3EB7A 1AR83 1OXCA 3N4MA 5HCBA 5C3RA 3S57A 1UWWA 4RS5C 1BKZA 4IV1C 1JU4A 2Y64A 3E5QA 1QU0A 3OUHA 3NNMA 4OUEA 3DXUA 2XKPA 3WZ1A 2J42A 1JXNA 2VOKA 2WQZC 5IK8A 4HPKB 1MS4A 4UW6A 4DS0A 1EUUA 5JR7B 3WP6A 4CP9B 1F15A 2VXJA 4FPGA 3TNPB 5GLVA 3VBSA 3ZVXA 4NPLA 3PJYA 4P5HA 2YBPA 5FPVA 5KBFA 2K46A 3K2OA 4L11A 3J7MA 3LZZA 4J25A 4WM8B 4YRDA 3W20A 3WNXA 5F5IA 2JJ6A 3RZKA 3C7FA 2ARXA 3GZUC 5FZGA 4MHRA 5FPBA 2YGLA 1AYN2 2VMCA 4S2HA 1PVC1 2Q5TA 3VUOA 4JDNA 3BGAA 1UAIA 3LEGA 4Y1UA 3U10A 1W6QA 4IV3B 2GAUA 3UGHA 1ND2B 3ZFFB 4YVSA 2ZCWA 5GZCA 2ZPXA 5T5PA 3NAPB 4Q1RA 2UURA 2JG8B 5BV6A 2R071 2AEZA 4M0NA 5E16A 2C4XA 1FOD2 4JKLA 5GKAC 4Q4Y2 4F83A 2E63A 2DVDA 2NYYA 3C7EA 1WW5A 2OPWA 4P9XA 3AYAA 2ZHKA 4DUXA 3LB9A 4P9WA 2RVAA 2CAVA 4EROA 5E89A 3GYDA 2R042 2IC1A 1FMD2 1A78A 1PZ9A 4Q0SA 2CDPA 1MQTB 1DZQA 2F4LA 1SG3A 4NROA 4YGDA 1SLAA 2JX9A 3BU7A 3I2JA 1RUE3 3FN9A 2N7GA 3MFCA 2D6OX 2YU1A 4IE7A 3ZO0B 2PHTA 2GNMA 2A3WA 4EN0A 1W9FA 4JCKA 4Q4X2 2YU2A 1SDDB 4S2GA 1RJ8A 3UGFA 1HW5A 1TG7A 5J7MA 4MGYE 3VBRA 4QQHA 1JBCA 3HN1A 4DINB 1QIQA 3RI9A 1NA1A 1F4HA 3HN3A 1LHNA 4OVEA 2DTYA 2Y33A 3M2MA 1F2NA 1UYYA 4Q29A 4LKFA 2E53A 4YZ3A 5JPNB 2PA7A 3ZXDA 2JD4A 1POV0 5F2WA 2GMEA 3WSOA 3KM5A 3AKPA 4M4PA 4C0HA 3NNLA 1O3QA 3TWIA 4Q1PA 1UZ0A 3DECA 4PQQA 3SH4A 3VL8A 2BGCA 2HJIA 5CEHA 4A44A 1RMU3 4AG4A 3LAGA 5DZFA 1AR63 2VQTA 4A7KA 1H4HA 1AXKA 3IPVA 3OEBA 4D8MA 1PVXA 3AFGA 1R1ZA 4N43A 4C90A 4AVBA 3D0SA 1OVSA 5EFUA 3QACA 1DQ6A 3K51A 3K46A 1KRIA 2FDJA 3LPFA 1FNZA 4Q26A 3AZYA 5BNPC 2PN5A 4XFCA 1LHUA 2VNGA 2QDRA 5JPMB 1F4AA 2JDHA 1W2TA 2Q0AA 3AFKA 4LUMA 2A70A 4QKDA 5FBZA 3B9IA 4ORFA 5K7PA 2XH6A 3PIGA 5LBFA 4DPNA 1AJOA 2DFBA 1DHKB 1O4ZA 1QXRA 1RGSA 1YFXA 3POGA 4H3WA 1WKYA 5A3OA 4LOTA 2G1MA 3IB3A 2X5IA 3GHNA 1FATA 5JMOA 1H8VA 2VVEA 2QQNA 1AR81 1SPPA 1DGRA 3ZXKA 1DZRA 4FP3A 4XTPA 4E4DX 4EWAA 2NLRA 4QQ2A 1UOGA 1QY4A 4GMP1 4KG8A 2VCAA 3B9CA 4BE3A 3RZGA 4YGCA 2VMHA 2ENRA 1IPSA 1RJ7A 2W91A 5JIAA 1J83A 1MZ5A 2JE8A 4UF0B 2CTVA 1UW8A 1GQPA 5K0UA 4XIKA 4BQ2A 1GFF2 3MPBA 3CZJA 2C1FA 3VBFB 4GWIA 2QUOA 2B46X 3MIBA 2A7AA 4JVAA 4U36A 3T0AA 4OZOA 3BUCA 2E51A 4LBQA 5I0RA 2XXZA 3SNMA 4EQVA 2PLV3 1NCRC 1ULDA 3IDAA 4HXCA 4QKFA 1UYXA 1XRUA 4QXCA 1W6PB 4HETA 2BRTA 4RQPA 1JYWA 5CVRA 3MF9A 4QPIA 2Q8OA 3VZLA 5F6LB 1VMJA 1WD4A 2VNVA 1J3QA 2OXBA 4QX1A 4RR3C 4IEYA 2BEOA 1NE4A 2RMU2 3OBAA 4S2DA 3RMXA 2RS11 5I0DA 1TNRA 3MDPA 4YVWC 1S0FA 4BISA 3S7IA 4NAOA 2VJXA 3H1YA 2VMGA 4A7ZA 2P3JA 5CKQA 1JZ4A 5F6KA 5A3NA 3BCWA 4AEJA 1Z0HA 2ZGSA 1VIWB 4O65A 5FYCA 3RNSA 3O1UA 2VUJA 5FZ9A 2V4VA 4MH0E 4QHOA 3N35A 4AGGA 4XUTA 4NIHA 3EYPA 4QDRA 1W28A 2OT7A 3GNEA 2BBAA 1GZCA 5A32A 3MUY1 3KT4A 2D6KA 2HWC1 5AC93 4I09A 3FJSA 1REDA 4UFJA 2YDEA 2IFWA 3SCHA 3UYJA 4ASKA 1GP5A 1KQRA 3UK9A 3U14A 1BBT3 1TMF1 3U0ZA 3BIEA 4QB2A 5CFCA 1AR61 1CJDA 5JUVA 2XUMA 4INDA 4IEOA 2WO7A 3VBHB 3N3HA 4FFGA 5FZDA 2XOMA 2CSGA 3VN4A 2D44A 4AEKA 2DURA 4M01A 4UYBA 4ARXA 1D2SA 1QJU2 1RTVA 2WRAA 3LEIA 5JDBA 2YPDA 1HV1A 1VBA3 3SQOA 3KV4A 4TZDA 5C4WC 4E2GA 1V9U1 3M3IA 3AC0A 2ZXQA 2ZHLA 1S1AA 1CD3G 4QQPA 1DCSA 1Y9GA 2D6LX 4NHLA 4PF5A 2GC3A 2K0GA 4XF1A 2XLFA 4FOYA 4NHMA 4OQ9A 3T2QA 3Q8EA 1NE6A 3H8RA 1NUKA 2GMPA 3ACFA 5C8CB 3PL0A 2B4KA 2OQ6A 1UNBA 1J58A 1AR71 1RUC3 2ZMNA 4P5YA 1FV2A 4DOUA 5FLJA 4NMIA 3SEPA 4DEQA 2VQ0A 2W52A 2VBBA 2ATFA 1BXHA 2ZHNA 5FO8B 3OYWA 1ULCA 1E5RA 3I2HA 1GZWB 1TE1B 4MGZE 3KVAA 4XURA 4MG2A 2B9VA 4IXLA 3URFA 4BIFA 3GALA 1RUC1 1LRHA 5AVPA 4UXAA 3OPZA 1Y4WA 2R073 5JSRA 2WC2A 2RE9A 2WZ8A 2VCMA 3WF2A 4GWNA 3N9MA 3LCPA 4GB33 2UWBA 4FAHA 3U11A 3ZYPA 2OIIA 3ZXLA 1DYPA 4CEWA 1AF9A 5BY5A 3ZYFA 2F4PA 2IZWA 2JDAA 3IMMA 4M3CE 1VBC2 5I0TA 5GZDA 1X82A 5SV8A 5KR7A 3BU0A 2FCTA 3ILFA 3NWKA 1ODMA 1TEIA 4IGPA 2VZTA 2EIBA 3VV1A 2VZRA 1GICA 2WZR3 1FOD3 1I3HA 1YC61 5FYYA 3RMYA 4WVVA 4EN9B 1N3QA 1Z7S1 3HMYA 1APNA 1CIYA 4GJYA 1GUIA 4R9BA 3NAPA 1RHI1 3VD9A 1QOSA 4QXKA 4BQXA 3DUIA 4GAZA 4XPVA 4I0AA 1GNHA 1DG6A 1C8M3 2IXHA 3D6EA 4L0PA 2RJLA 3B3QE 3JBG3 3UJOA 4XCBA 3NO8A 1WLWA 2PHUA 2BDRA 4CDUC 4KWLA 4PLMA 4COZA 5HCAA 2RS31 2WNUC 4ASMB 4B1MA 1UO9A 2W0XA 1UMIA 4B4QA 2P6HA 2DWRA 3UKNA 1H8TA 1MS8A 4GZ9A 1LOFA 2WNUA 1OLME 1UZYA 3HEIA 2LALA 1HIXA 2P4EA 4WM7C 3OGRA 4XTMA 3VL9A 5A6ZA 1GWMA 2EIEA 4CCKA 1JI6A 4UFLA 4KWKA 5DXDA 4RS5B 1WMXA 2JWPA 1NZIA 3B01A 3C7GA 2PELA 1EAH3 4LO8A 1BBT2 2XONA 3AL6A 3E5UA 4AGVA 4CUGA 2VZ3A 2VR4A 5FZ3A 3ZYHA 2ZAHA 1HRV3 4RFRB 5FZ7A 1JYNA 2UWCA 4CUCA 2FBEA 1IKQA 2HWF1 4DEVA 1C5IA 5F5QA 5A1AA 3I3DA 3TN92 2RJ2A 3ZFEB 2AH2A 4FFFA 1W6QB 2W3JA 1NX9A 2A6ZA 2GDFA 3NV1A 4MGQA 5DZEA 4IE0A 4OHWA 5FYTA 1HLCA 3ZSEA 2DCZA 3EQEA 1VBA2 1W6MB 1PX3A 2P1BA 4E4HA 1JYTA 4Y4YA 1OBNA 1G9BA 5FO7B 1VMHA 4Q2FA 3WQBA 1R1A2 1PIV1 1VRH2 2IVJA 5A6XA 1Y7BA 4HOOA 1XSRA 2QQVA 4XJ9A 2ZHMA 5FKBA 1H8TC 3RJRA 3HR9A 4B3NA 4CDWA 1VRH3 4PIXA 1PO11 2E9QA 4Y5TA 3O12A 4K1YA 4BM8A 2R063 4C1XA 5A1FA 2WAAA 1UMZA 3AP5A 2Y60A 4LE3A 4MVTA 3VDBA 3THDA 5C9AC 1O5LA 2OZJA 2E7QA 1AX1A 1JHJA 5FZFA 2RS51 3EHKA 1PO23 1S2BA 1MEC3 1VBE2 2XJSA 2VVDA 1KDMA 3WNPA 4A42A 4BDVB 3BTYA 4LO7A 2XJTA 1V6KA 4Y1XA 4AVTA 3FWEA 3SC7X 1GNYA 2XLGA 2NP0A 4CCEA 1CAUB 2DTWA 4MXWB 3RZMA 2YB7A 4L92A 4MGIE 2YBKA 3ZFGB 1VBB2 4QDSA 4ZS2A 2JDPA 1Y9MA 2Q1MA 3E1F1 1HQLA 5CA6A 1HRI3 1ZYBA 3ETQA 1LOFC 4LKEA 3M8LA 4K9SA 4K20A 4LUKA 3RGBA 5A7OA 5IAVA 3VZMA 4LIVA 3GXUA 3AJYA 4LK6A 2IUWA 2Y6FA 5J48A 2W39A 4YM0A 4IEPA 3AZXA 4FQ4A 5KXEA 1BEV1 1MVEA 4XF4A 3WNOA 4JDMA 1WW4A 1YIFA 3WVJA 4LLOA 1HXS1 4N9IA 4BHPA 4LBMA 3ALQA 4PLOA 5C70A 1K12A 4N43B 1ZNPA 2DF7A 2KA3A 4M4RA 4COVA 3KLSA 5LCWL 3HAGA 4MUVA 4COWA 1ZZ6A 5LBEA 1VPHA 3ES4A 2C26A 4FAGA 2QDNA 2ZA9A 5FZ4A 1FPN1 2ZS6B 5EJ1B 1WLCA 2B5HA 4HBNA 3JBG2 1MEC1 1LEDA 3RJ2X 5FFOC 4AAXA 5J36A 3NV4A 2C5DA 3MW4A 1Q8PA 4JRAA 5ISLA 3POSA 4NWVA 2XDVA 4LBKA 2FDIA 5FPUA 3DN7A 4FOQA 1RUF3 3PDQA 5JXIA 3POEA 4IEUA 4XUOA 3N7KA 3U78A 4D0QA 2JG8C 2X5IB 3I2FA 1D0HA 3T3YA 1QJY3 3F95A 3G6JB 2YC0A 5FZ8A 2QQPA 4OMCA 5JOZA 1JZ3A 2H6CA 1I9RA 3RPQA 3TEXA 2JICA 1F8VA 2BJSA 1YI7A 2EIDA 2ET1A 1WZXA 2P2KA 1CAVA 2P6CA 1LHVA 4P08A 4F8AA 1UY0A 2HWD2 3QOPA 5FQ0A 1RVF3 3MIGA 3WW2A 1HN0A 4D94A 4Y1VA 3IBMA 5GALA 3MUZ1 4AHXA 4N53C 4HSLA 2XB6C 1NCRA 4MXVA 3WINE 2D3PA 2XUEA 5A3UA 5A3LA 1J59A 2ZMLA 3BOWA 4CXXA 4BQ1A 2XPJA 1UU4A 1XXNA 1C5HA 4Q0UA 2DVFA 1RUD1 4IW3A 1BQPA 4FPHA 1WCKA 1ZZ7A 3NKGA 3VD3A 3WCRA 2RV9A 1LESA 1H9WA 1NQJA 3KV5A 3AYDA 4GWMA 4AW7A 1O6UA 1YRZA 2FD8A 2VMDA 3C7HA 3VGIA 1DFQA 4XJWA 4Y5SA 2MEV1 1Y43B 4JQTA 5J3UA 2Z2SB 1UOJA 2R061 3IAQA 4FTSA 1OD3A 4YLZA 2BZDA 1G9FA 3RFRA 1BZWA 1ZA4A 4Q8KA 1MACA 2PXJA 4XDOA 1NYWA 1V6MA 2JEMA 4Q5OA 1PZ7A 2GNBA 1PO21 2J1RA 4LBJA 5C8CA 5FO9B 5F3EA 1Q5OA 2GP5A 5LW9A 1LOAA 5C3SA 4ZU7A 2ZGPA 4DXZA 2QQJA 2HWB2 4KMQA 4BQ5A 5I8YA 4WVMA 1OA4A 4Q27A 2LS6A 3ZYIB 2JXAA 4YFWA 1LB2A 4XF0A 1RMU1 3WX5A 5BNPA 3I49A 4XC9A 3WUDA 4W50A 1GR3A 2D43A 3CKHA 2XQXA 2R49A 3HPNA 3ENRA 2GH2A 5CFCB 3ACIA 4H2AA 4B29A 2ADEA 5FUNA 4PLNA 4CU8A 5CKMA 5CG8A 2BYVE 2W1QA 3ZDSA 4E8CA 3VHRA 1COV3 3OD0A 2Q4SA 1WBFA 1PMIA 2WZR2 1PO22 3KVBA 3N7LA 4AFMA 2HEWF 4PI0A 3U1XA 4Z2AA 3INAA 4GALA 2RS12 1H1IA 2IXLA 1CAXA 1PGSA 1S0DA 2D5FA 1Q3EA 2WWUA 3ZSJA 4AWDA 3QH7A 5JOYA 3K4ZA 1OQDA 1FYUA 1CVNA 1RUD2 2Y6LA 1S0BA 1U5YA 3KSCA 4XEZA 1QHDA 4QX8A 4YW4A 5FZIA 5FR3A 3NJZA 5IATA 5LZ6A 3RZHA 2VOWA 1TQ5A 3HWJA 3E6CC 4GH4B 4YYOA 1B35C 3I54A 5GLUA 3W58A 4AI9A 2ZBJA 1W6OA 4CU9A 1W2AX 1WMEA 2NQYA 3CJIB 4FO9A 4AFCA 3OUJA 4MHUA 3FLTA 3FUOA 2QTWB 1PM4A 1YO8A 2QQOA 3MIHA 5IUQA 1RUG1 4AE2A 4ZZ5A 1CN1A 1AJKA 4QX7A 2D97A 3NKTA 4A45A 2CGPA 4I2OA 1PHMA 2ZX0A 1HB2A 2G4IA 3PMSA 1ZA7A 2VUAA 4EN6B 2LRPA 3HJRA 2IXKA 1POQA 2EICA 5EPAA 5DMYA 4RGGA 4NN0A 1UN1A 1STMA 3AK0A 4PJYA 3S30A 3TYJA 4W6WA 4YW1A 2JDUA 2WS93 4NR1A 4XBLA 4COUA 5KHJA 3LPGA 1S4CA 5EYXA 1G9CA 4QX0A 2ZX1A 1UL9A 1S55A 4LR4A 2UYBA 2BGPA 3IZOA 4C1WA 1R64A 4NHYA 3U37A 1OSGA 1AR92 3T4VA 4AQ6A 2W9XA 2E33A 2MHFA 3LEKA 4CP9A 5IVJA 3ON7A 1B09A 4CU6A 4DB5A 5APAA 1W99A 2V73A 1X36A 3OSDA 2DCYA 3ZKYA 2WIIB 5FK8A 1H4GA 2QVSB 1ZZ9A 3KQ4B 4QHZA 4CVUA 3TEWA 1ZBE1 2ZEYA 5FLHA 1IS6A 1OKOA 5LA2A 1I5ZA 3LOIA 1W6MA 4YG0A 2UU8A 2OA2A 2ZGUA 3ZXJA 2XJQA 4RL7A 1N1YA 4WM8C 1JZ7A 1AL21 3I59A 3K48A 5LRRA 3SCFA 3J7LA 4YZ1A 5HXMA 3SH5A 4BOWA 3R6SA 3IDEA 1JZ6A 5C9AA 1G9DA 1QQP1 3ZXEA 2ZX3A 1W2UA 4YVSB 1JZ2A 1BEV2 5LATA 5FMOL 2VZOA 4O9EA 3N9OA 3ZN6B 4M3CB 4XQDA 2JB8A 2Q30A 2EF6A 3VBOB 1LGNA 1RUJ1 1ZBA1 4LXLA 4CDWC 1IOAA 4QQOA 2WLPA 2QZ3A 4TLGA 5GM0A 4UI9L 1ASJ2 3HQXA 3ZYGA 4Q4W3 1GV9A 1V6JA 1XSQA 4CDUB 5DDJ2 2E26A 3ZSKA 2PHDA 1XYNA 2DBNA 1MZ6A 2F17A 2G9GA 2GH8A 2W87A 3CEWA 5C3OA 4RA0A 5HBAA 1NQDA 5FMOS 4D6QA 5CIRA 4KH9A 1K5MA 4BU2A 3KB5A 3JZVA 1GP6A 4UBGA 4FFHA 2ZKNA 3SH3A 2VULA 4E8DA 4D6SA 1JU3A 1LENA 5DZGA 3VZJA 5IT6A 1YIPA 4MXWA 3PMEA 4O9GA 5CADA 1W8HA 2Y6KA 3OGSA 1KFXL 4QPIC 1QWRA 1PIV2 4GA9A 1GSLA 2WQ8A 3AMNA 5HI0A 5IK5A 1AVBA 3IDBB 5DAXA 1U5IA 2GN7A 1LNSA 1RC6A 4LORA 3T30A 3U4SA 3W21A 1REFA 1SCRA 5EQUA 1ENRA 1VJ2A 2WUHA 2J7MA 2VECA 2UY8A 1KD7A 2HBUA 4J1WA 4Q4Y1 4XABA 2GALA 2VCCA 1CGPA 4CZSA 1MZEA 2W1SA 1QF3A 3BN6A 2D6PA 3OGJA 5FXZA 2W47A 1LECA 3OY8B 4GMP3 4MOAA 5D8AC 1W6NA 2BVVA 4P14A 4A6SA 3U75A 3A0NA 1XE0A 4PF1A 5FPLA 3AVSA 3AVRA 1HKDA 5FYMA 2J22A 1PVC2 4DRVA 1AYN1 2AYHA 1W8WA 2GP3A 2RS13 1MS5A 2Z42A 4DXTA 2R30A 3ILNA 4BPZA 1EV12 4H55A 2PHRA 1ND3A 3SXWA 1WCDJ 1H30A 1XC6A 4NRQA 2V4AA 2OW4A 1AYM3 4TLFA 3VBSC 1ALYA 2JD9A 3VDAA 5I8TA 2R0FA 3O0WA 5DN2A 2E31A 1W2OA 3HNMA 1CESA 2QCSB 4G9SB 4BWOA 1I1EA 3W5NA 2Z5WA 1C1FA 1FMD3 2J1AA 1W0NA 3UL2A 2FZ2A 2XKOA 4YM3A 5F2SA 5BXXA 5IVEA 4OHZA 4B4PA 1LTEA 4I0BA 2ZJCA 4RR3A 2PQQA 2A6YA 1AUYA 4XAAA 5IJRA 1PZ8A 3ZLIA 2PLV2 2J1UA 4LLFA 3KV9A 2SLIA 3MIEA 3ZKUA 1MQTC 2KM2A 3E6BA 2Q8DA 4MGTA 1PGL1 1POV3 4LHNA 1WUVA 1QJX3 4PBPA 4XE9A 5I0SA 5A7PA 5K0UB 3W5MA 5FY9A 5FZMA 4LTAA 1JW6A 3WDTA 3S7EA 4Z1VA 3WT3A 4EWDA 1FX5A 3WD5A 1A3KA 1UU5A 2I74A 5DUXA 3FLPA 1A8DA 1BVVA 1VBC1 3PVEA 1LHOA 2V72A 1HRV2 3WV6A 5IVVA 5BNOB 1IPJA 2NMNA 3MW3A 4V2WA 3ZSLA 1LAJA 5DG1A 4PIZA 3BPZA 5ABJA 3AKTA 2JECA 2XQRA 3N9PA 4P9YA 4Q4W2 2C9KA 4X8PA 5L36A 4ZPIA 2ZAAA 4AVSA 5F1RA 3WEZA 4BQ4A 3LFIA 4CCJA 4QPIB 1DZTA 4XZUG 2RM22 4D3WA 3RYKA 4BXFA 3MI8A 2WABA 5B4XA 2XVGA 2VQUA 3IDCB 1YQ6A 1GZ9A 1W8NA 2AENA 4AL9A 3NJXA 4EN8B 5JZGA 3O1OA 2X53S 3V0BB 4WVMB 3KCXA 4YVWB 1RUC2 4CEYB 5DG2A 4HONA 1IG3A 5T5OA 2WINB 1NCQB 3RWKX 4HN0A 5BYNA 5CU1A 4XHBA 2EXJA 3FFQA 4Q0VA 5BNPB 4GD4A 3HT2A 1QOOA 3LFMA 3BTAA 5EHDA 1NG0A 1NY71 3RZJA 1LOCA 2VMFA 3T2PA 4FPEA 2Q1ZB 4YARA 4YZ2A 1GOGA 1LODA 3MLLA 1RUI2 5FP9A 1DIWA 1BMV2 5LA9A 4IEQA 3VBFC 2B7YA 3LSDA 3ABZA 1RUH1 4YVSC 5FY0A 4N53B 1QDOA 2V09A 1VB2A 3RZLA 2CYFA 4W6YA 2J1SA 4QM9A 3VD7A 5FZLA 2VW2A 1UY2A 3POWA 4XFFA 5A1LA 1V9U2 2TEPA 3PU3A 4XW3A 4Y4RA 5FRAA 2D6NA 5T5JA 5FKCA 5C5UA 2HEYF 1YWKA 3J7NA 2FHRA 1X9PA 3GBWA 1YFUA 3I2GA 1R082 1QJU1 2HWE3 5FIXA 2D40A 2PHWA 2XGXA 2JG9C 2XL7A 4GH4A 4B4RA 2NN8A 4BK5A 1UY1A 3I97A 4NHXA 1UXZA 5FY5A 3SKJE 2P5BA 3M3CA 1PO13 4AQ2A 3N36A 1SFPA 2DFCA 5AFBA 5CFDB 3WDUA 1A6CA 2VOTA 1AR62 4G4FA 3T1MA 4K40A 4OHXA 4ATFA 1C4RA 3QD6A 4M00A 1J3PA 4H14A 3WG3A 3CO2A 1CPMA 3FMGA 4JGYC 3PUIA 1D2QA 2HWB1 1HJGA 3BB6A 1KS5A 2VUCA 1VAKA 2ZEXA 3FZ3A 1ZBE3 3JD73 4XJAA 3PLQA 2FDGA 3RWNA 4P9IA 5ACA3 3LD8A 4U2AA 3VDDA 3U4XA 5D1IA 3OCPA 1ZZBA 4FPLA 3OF1A 4LBLA 4YW5A 4FP2A 3MLKA 1UPSA 3ZIXA 4AHWA
chains in the Genus database with same CATH topology
1QJX2 4I0WB 1O3SA 4LBNA 2BBVA 1ULGA 2ERFA 1OHFA 3SLIA 2DCTA 5KHIA 4WM8A 2WZPP 3MLJA 3PTYA 4IL7A 4NVPA 3ZMNA 4P9JA 1F5JA 2XWJB 1WLDA 3THPA 4PCRA 3VHPA 5JOWA 2WKKA 2RMU1 2VNRA 3GZAA 4F7ZA 4CRQA 4PDWB 3CL1A 1KXGA 2A3XA 1BYHA 1VAVA 2YGMA 3B5LB 4P9GA 1QKQA 3M3QA 1LR5A 2HKXA 1TME1 2FQPA 2GC0A 2D7FA 3KD4A 2ET7A 1SQ4A 4S2FA 4XFIA 2WFF3 1ONAA 4KG0A 2WFPA 4HN1A 1SMVA 4X8NA 5JLVA 4E4SA 4K3UA 1AR82 4JC1A 4YGEA 3GF6A 4CDUA 1I6XA 2GZWA 4ZKTB 3P3NA 4QD2A 2GNTA 4LE4A 2RR12 1VBD2 4UW4A 3MEPA 1GANA 4CTEA 2CWSA 1VBD1 1OOPA 4BYYA 3VBRB 4XZPA 1ENSA 5FTTC 2CV6A 1YI9A 3AP4A 4AI3A 3ZN4A 4FOVA 4OI2A 4XF3A 4XOGA 4R9DA 4ZXKA 1X8EA 2GU9A 1RUJ3 1ZBA3 3EXUA 4KL1A 1XE7A 1VLNA 4QQLA 1XE8A 1MR5A 2Y0IA 2E7AA 3B02A 1DYKA 4A7YA 1HXS2 4Z2WA 4Y20A 3USSA 4HK9A 3I4IA 3ZPYA 2DVBA 1OA3A 4LHKA 2CL2A 1C8NA 1J1LA 2XJVA 3DV8A 1TME2 5DUVA 5KC6A 4OULA 4NOTA 1JUHA 3WG4A 1QMJA 3LGRA 4YW2A 5C33A 2QKDA 1ENXA 5FOBB 5EYYA 1OD5A 4M3CA 4IQPA 5C4WB 1AZDA 1BVP1 3E5XA 5H9PA 2YUEA 4YG6A 3DKWA 3WQ1A 4KGGA 5J98B 3GBGA 1R092 4AI1A 2XBO3 1YLLA 4AVAA 1GYKA 4R9CA 2JG9A 4BH9A 1QJX1 1K5MB 3T1LA 2B8MA 1POV1 1OKQA 1PNGA 1IS5A 1ZZCA 4GKYA 4HSJA 2YHJA 1PO12 1T6GC 5EV7A 2XVKA 3LA2A 3GZTB 1VALA 4X6QB 4HFSA 3NVCA 2ZGKA 3AM2A 3B7MA 3HD8B 5LEJA 1NA1C 1ULEA 4QMAA 2P37A 1FMD1 2ZZQA 1R1A1 3AZVA 3I7DA 3MPPG 1R091 3VBFA 5FOJB 1JN2P 1O3TA 1NLSA 4LBQD 4FPKA 4LBQB 4WZCA 4HVQA 5I91A 1S0CA 4YZ4A 1PNFA 1PK6A 3PNAA 2PAKA 3O0VA 3X29B 1FI2A 2W08A 4JDOA 2WA3A 4D7TA 1OI6A 4MGKE 1ASJ3 4FVVA 4FSJA 4DY3A 1G86A 4IEVA 3RYPA 1A8MA 3WDWA 3VHNA 1VBC3 1XQNA 1URXA 4MZUA 4Q4X3 4AYUA 2XJPA 4RHV3 1OMIA 3PHMA 2IXCA 2E7TA 3SCGA 4N9HA 2HWE2 2B9UA 2R6QA 4LO5B 3RS6A 5T5LA 2SBAA 1SBFA 3GBFA 1ZZ8A 3SITA 3LSEA 3BOPA 3IKWA 4CEYA 1NXD1 2DUPA 2BWAA 3NSTA 4V1PA 4WM7B 3KMHA 3LA3A 3NL1A 3PVNA 1OA2A 2RR11 4E4ZA 1DU3D 3VBHC 3D8CA 2A3YA 5ACA2 3VBUB 4IEWA 1CPNA 4JGYB 2DVAA 3WXPA 4C91A 2NM1A 3QH6A 3R4DB 3AYCA 1DQ5A 1LGCA 1JH5A 5EWSA 1SLTA 4N43C 2W68A 4NPRA 3OBTA 4JV4A 2MEV3 1DDLA 3H7YA 1FXZA 3SMHA 5BNOA 2WJSA 4YNIA 4XFHA 3CJXA 5ABJB 2CAUA 3H3UA 1JYIA 4DMIA 3WR0A 4XIOA 4DZGA 4A2UA 3N7MA 1QNYA 4JTNA 2EXIA 2A6WA 2HWD3 2VPVA 5JZGB 4ZU4A 1C8M2 1DGRN 3M3EA 4Y22A 1L3JA 4LNVA 4RD7A 1YFWA 3CU7A 2YMZA 1AR72 3L2HA 4GIQA 3VDDB 3J26N 4OHYA 3AJZA 4AFBA 5C8CC 5L7OA 1Z78A 4K1ZA 3USUA 2VQAA 1YFYA 3ZN5A 2ZX4A 4QPYA 4WV8A 1RUE1 1WBLA 1DLLA 1MS0A 2NMOA 2EXHA 4Z82A 5L7OC 3LOBA 2ZZJA 1HDKA 1EV11 3SCFA 1N47A 1UZZA 1FAYA 4M0HA 1PGW2 1V6OA 4N53A 3W9AA 2WFF1 4JQRA 1SFYA 4XJUA 1RL3A 1RVF2 5GLWA 5CFCC 1F5FA 4FXGB 2OVUA 4ISRA 1LGBA 4Q0PA 5D8AA 4Z92B 2OPKA 5FREA 4SLIA 1DQ0A 5FPZA 4HL0A 4MV2A 1AL23 1JHNA 3VKFC 3MYXA 1RB8G 4EJRA 5JSOA 5CFDA 2R32A 2C0ZA 4FBFA 2HWC2 5A33B 3LKJA 3B94A 2A73B 4IEZA 2X8KA 1EP0A 1SLCA 1W6OB 3WW1A 1H8TB 1DF0A 5BNOC 3AKSA 1EPZA 2O0OA 1KITA 1QGLA 4PBOA 2HYKA 5L19A 2EAAA 4AEDA 4CDXC 4XMAA 1OOPB 4K21A 4GQ7A 4AFAA 5JWPA 3O0XA 3LWCA 3FX3A 3AMMA 3M3OA 4BCUA 3DPRA 1D4M3 3VLBB 3O14A 4XJ8A 4ASLA 4HK8A 5JZGC 5C6CA 1R1A3 1S0EA 4HANA 1DQ1A 1RHI3 4B8EA 4BLIA 2RM21 5JI9A 1QQP2 4WZFA 1CAWA 5GJ6A 2AZ5A 2AREA 4IV3A 4JRLA 4OZXA 3CF6E 5J37A 1IQAA 5IK7A 1Q8VA 3I59B 2JG8A 1YJKA 1X8MA 2GMMA 3S6PA 3ZFEC 1KJLA 3JU9A 3OBRA 4XBNA 5BNNB 3RSJA 1HXS3 3TB0A 2ARBA 1V9U3 3ELNA 2BNMA 3ZN6A 3DPRC 4AQTA 3H7JA 4FPYA 1EAH1 4TWTA 4LO4B 2P3KA 5HXVA 2JG9B 2BQPA 3JD71 4CP2A 1MQTA 1S0GA 5JI7A 4Q4Y3 3BODA 5I93A 1IZ3A 2IXIA 3J4UH 1LEMA 1CAUA 3BALA 2JKBA 3HIFA 1RUOA 1QQP3 2TNFA 1BJQA 1W39A 4WBBA 3A4UA 2WNVB 4AHYA 3VDDC 4Y1YA 4ES8A 3WLUA 1AYN3 2OZ6A 3KS7A 2VW1A 1QJY1 3FBMA 3ROUA 1RUI3 2G9FA 1CQ9A 2VOVA 2CGOA 1C28A 3C2UA 3H1MA 4I3GA 4PQ9A 2FZ1A 4Q4V1 3V64A 5JMCA 1UIJA 3KCYA 5EXOA 3VBRC 3DGTA 3OY8A 2RR13 2DYCA 2X5IC 2NPIA 4EWEA 4PIYA 5EZWA 1RUD3 4FQZA 1MVQA 1NOVA 5T50A 1V6NA 3TOJA 1H9PA 3R0RA 1AX2A 4DQAA 2VOXA 4Y24A 4OUSA 1ND3B 1DQ2A 4YG3A 3J8F2 2R16A 4A3XA 3EJKA 1GBGA 3H50A 5KHHA 5DUUA 2WQ4A 2ZGQA 2EVXA 1AR93 4QT6A 5FQ0B 5H9RA 4C0BA 2ZGLA 3JQXA 1R081 2E6VA 2PHLA 3ILRA 1YYNA 2BW8A 2P3IA 4AGRA 1GKBA 5E8AA 3RQ0A 1BCXA 3H0OA 4RR3B 4HT1T 2DUOA 2ZGNA 3R4SA 4Q4V3 1UCXA 4HVRA 5FLIA 1EV13 4OUMA 3ASIA 4JGZC 3MIDA 2AUYA 2BTVC 2RM23 4N90A 3U07A 1YHFA 2F6BA 2ES3A 1RUI1 1BMV1 1LCLA 1CONA 1VAMA 2VY0A 3ZXGA 4RQPB 5LEKA 4HMZA 1Z7S3 2WNVC 3EBRA 1DQ4A 1SLBA 1ZBE2 2GN3A 2ZOEB 2R1DA 3AXEA 1QH7A 2GSYA 1D4M2 4DNYA 3ZYJB 5KWRA 3JB8A 3RDIA 4Y22B 5HCFA 2BFUL 3KZ4C 4N7UA 2WS91 3ATGA 4CDQA 4XMIA 1NLRA 4IV1B 4CDXA 4QPGC 2R1BA 3M1HA 3WQ0A 2A6VA 2EAKA 3D0JA 1VBD3 2YZ4A 4Q4W1 3VBUA 2XBO2 4QPGA 3IN9A 4YSFA 2EALA 1RUH3 4QX5A 4AFDA 3MF6A 3WOGA 2OYZA 1ZVFA 1D0GA 3AMPA 2ETEA 1RUG2 3UV9A 3V65A 1UIKA 4XFAA 2P17A 1UU6A 1N1SA 4CP1A 2XJUA 5AC92 1IKPA 3LA7A 3MZHA 1OQ1A 1SCSA 3AP9A 4FTBA 3JUUA 4HLTA 3ES1A 2PLV1 1ZRCA 4DFSA 4HKLA 3D5OA 4LBOA 1UPIA 3MGUA 4AQSA 1TME3 3IWZA 4QGLA 4D7SA 1N3OA 1COV1 3WP5A 4E27A 1G8WA 2XWBB 1UKGA 3E97A 5L73A 1W0PA 1Y9QA 1QDCA 5CBLA 3AZWA 2WSUA 1UKRA 2RMU3 4KU7A 3WDYA 3WUCA 1J1TA 3AX4A 2VGDA 4TYSA 3RG0A 2Y0OA 5LRSA 1H2NA 2JENA 4JGZB 4HPKA 4XFGA 3OYWB 4W6XA 4UW5A 5KC5A 1HRI2 5JVVA 3WDVA 3VBSB 2WT2A 4BA6A 2YPJA 2PTMA 4YZ5A 4NO4A 3NW4A 1OQEA 1V6LA 1AYM2 1MZFA 3DPRB 2EIGA 4XETA 1XNDA 3TBDA 1O3RA 3J8F3 3JB4C 1G6NA 1XU1A 4KWJA 5KXBA 3WDXA 2AR6A 3NAPC 4LA3A 2QFEA 4YGBA 3OJBA 1ZREA 4BMBA 1CAWB 1VRH1 2D98A 3MICA 1N1VA 3IM0A 4ES9A 5SV5A 2XHKA 2R062 4RSUA 4GB32 3SHRA 2AGSA 1GQHA 1FNYA 1RUH2 4G3YC 1B35A 4GULA 3ZX7A 1MS3A 1WCSA 1LHWA 5GZEA 2V5YA 4X6RB 3VBOA 1KDKA 4IETA 1QOTA 1DBNA 5BNNA 1O4YA 2DV9A 2FMYA 4OI4A 5KXCA 3VHOA 4Z07A 4RQPC 1C3HA 3FBYA 3KQRA 3WW3A 2XL9A 2CGNA 1LJ7A 3J9SA 1S2KA 2PHFA 4AEMA 5T55A 2WNUB 2D5HA 4XFBA 3V56A 4AEDB 4JAAA 3MIFA 4YFZA 5J09A 3WHTA 1WLTA 4DRRA 2DUQA 2VU9A 4CEYC 2CWMA 4XYXA 1V70A 1NCQC 1RUF1 1J3RA 3JD72 5H9QA 3B69A 4SBVA 3H1WA 4I02A 1CIWA 5I0UA 1CJPA 1AL22 2YY1A 4ONUA 1IHMA 3PVBB 3T2TA 1V6IA 3TRSB 1SLLA 1LOBA 1CX4A 1R083 2UWAA 3JBG1 3VKOA 1W6NB 2BNNA 1RINA 3IMNA 1EPWA 1PGL2 1RIRA 1NXMA 2ILMA 2MPFA 2O1QA 5E1RA 1AR91 2LM3A 4W65A 5B2GB 1WMFA 1R093 1GNZA 3TNQA 3THTA 3V0AB 3L9JT 2RHPA 1OFNA 3AXDA 4CDWB 3ZXAC 2HEVF 3Q9OA 3QBQA 5T52A 4BLJA 4OI0A 1AR73 3G7DA 2ZGRA 5I8SA 5CFDC 1QXPA 1RUF2 4F3JA 1VBB1 4MX3A 4IEXA 4B7EA 4IESA 5A3MA 3IIAA 4HKWA 2PFWA 4L97A 5BNQA 4COYA 1AXYA 5FCCA 2WL1A 2DU1A 4D69A 2RS52 4P9LA 2WA4A 1FV3A 1UD1A 3ZFGA 4B7KA 2OUJA 1AX0A 2VVFA 1F9KA 4HVOA 4YM2A 1IGOA 3UKVA 1WD3A 4RHV1 3AKQA 5BNNC 3JCIA 4LHLA 4BMEA 5LK5A 4KU8A 3A0KA 3H8UA 1BK1A 1U0AA 4R8HA 5GLTA 1HQWA 1HQNA 4QU2A 2VW0A 3UKTA 1YCIA 1SBEA 1ZM1A 3R4UA 2H0VA 2A75A 2HWC3 3KT1A 1VBA1 2VXRA 3ZSMA 4I01A 2ZACA 5K0UC 2K2SA 5AVAA 3FC0A 2QNKA 5GZGA 1OFSA 1RVF1 2D93A 3AZZA 2GC2A 4Y26A 1HRI1 2Y38A 5K8SA 1PGW1 3V0BA 1DGWA 1LKNA 1C1LA 1WW7A 4XQWA 1IS3A 2JDZA 1SFNA 2ZTNA 1Q56A 4Q0QA 3VKNA 1JOJA 2BNOA 5DDJ1 5GLZA 5A32B 1ASJ1 4HKOA 1XYPA 1XNCA 2O8QA 1RUJ2 1ZBA2 1CAVB 4AEDC 4LO6B 1GLHA 4M3CF 4Q8LA 1EYBA 1S0IA 1WMDA 4WM7A 1QXJA 3B93A 3RRDA 4FPFA 3O5SA 4H7MA 4LULA 4ITCA 4GKXA 5BPXA 4UBHA 5FPXA 1COV2 4KNCA 1D4VB 2D3RA 3R05A 4YM1A 2FMDA 2Z69A 1VR3A 1BEV3 4L2NA 2GC1A 1RHI2 4AHZA 4DY5A 1WGPA 5T54A 4AVCA 3AKRA 4OHVA 4XBQA 1DGLA 2QJVA 2KXLA 5AC91 2XBO1 1Q8OA 2HWD1 4L99A 3WG2A 1XYOA 1QH6A 4Y5Z0 3WHUA 3WP3A 4XXAA 3I2DA 5ABJC 3C3VA 4XXPA 2DU0A 1IS4A 1GZWA 3KGLA 1H2MA 2WLQA 1Q8QA 2WT0A 4R9AA 4H7LA 2A6XA 2H0BA 4HZFA 1LOEA 1U5ZA 1OLRA 4R4ZA 4FT8A 1OLQA 4RFT0 1ENQA 2BPA2 3DF0A 3BIWE 3H9AA 2WS92 1EY2A 3FUQA 4I3PA 1MEC2 1VBE3 4BZ4A 1PK6C 1N1TA 2WT1A 2QE3A 1F31A 1TNFA 4CEWB 1KFUL 4XDQA 1X7NA 5TSWA 1D4M1 2XG3A 3P3PA 4PDWC 1QJU3 2HWE1 5KHGA 5H9SA 4R4XA 3M4FA 4IV3C 1X50A 1H2LA 4PDWA 3ZYRA 1RUG3 4XHXA 3D82A 4MLOA 4KQ7A 2WWSA 2QZ2A 2WZR1 2YYOA 3DL3A 2JE9A 5GZFA 4L8QA 1YNAA 2EXKA 1S0JA 3WCSA 1HX6A 2IFRA 3VZKA 3CJIA 4WVZA 1Y3TA 2PAMA 4LEJA 1RMU2 5CG9A 3VKLA 5EJ3A 5A33A 4E2SA 1E57A 3J8F1 4MSVA 4IERA 4JGZA 1VP6A 2I2SA 3QCWA 4RS5A 4MYEA 4AF9A 3AP7A 1AHSA 1K5MC 1Q8SA 5CB7A 3TAYA 2R0HA 4J6GA 3OTFA 1ZRDA 3ECQA 1LU2A 1SLIA 2DCKA 2GNDA 1JTZX 2B45X 3SISA 1REEA 2BWCA 5FDBA 4AI8A 4FPJA 3HT1A 3ZFEA 4Q4V2 3I8TA 1NA1B 2VG9A 2VMIA 2B39A 2MEV2 4GMP0 5E88A 4Y20B 3HBZA 2CNAA 1SACA 2ZMKA 5JAXA 1UX6A 1FOD1 3VBOC 2WSVA 1HV0A 3APBA 2ZX2A 3UJQA 1VBB3 1B35B 1ND2A 3ZFFA 4RHV2 3MFAA 3M70A 4E9KA 2LUWA 1JUIA 3IPVB 5AFEA 2H6BA 3NV2A 2HWB3 4Y1ZA 1CR7A 5C4WA 3RYRA 4YW3A 1H0BA 5C9AB 3V0AA 1QJY2 3M7AA 1ZX5A 3OD4A 4LA2A 4XJZA 5JCTA 3PVOA 3POYA 3CLPA 4OI1A 3VZNA 4CYDA 1LOGA 4OLLA 3ZFGC 4GXLA 2JE7A 4JTOA 4K8FA 1EAH2 1ZRFA 5BUVA 4META 1DGWX 5CNAA 1LU1A 3EO6A 4KBBA 5LK7B 5K9YA 1FPN3 1X33A 3NV3A 5KXDA 4K7JA 4AVVA 4CP0A 4QHBA 3KT7A 3ZIWA 2HWF3 2DCJA 1G9AA 3VZOA 1FPN2 2BFUS 5CAZA 4I30A 3WW4A 5JOXA 3H3ZA 2XJRA 3AP6A 3D4KA 2WNVA 1O3QA 1IPKA 4BIOA 1JYCA 1M4WA 1PK6B 1PVC3 3S0MA 4Z8BA 3WG1A 2B42B 4N7IA 1AXZA 2TUNA 1RUNA 5DUWA 1H1MA 1C57A 3RZZA 2CY6A 1O7FA 4AI0A 1QJZA 2A5ZA 2X29A 3VKMA 2XLAA 1W6PA 1XNKA 1OPMA 3WQ7A 2PHXA 1SDWA 2WNEA 4CDQC 1MS1A 5C8WA 2I45A 2RS33 5T3NA 2DVGA 4XF9A 4RGAA 1OPOA 3QLQA 2LTNA 4FPOB 4QGNA 1VBE1 1G7YA 1ND2C 2D3SA 3ZFFC 4EN7B 4WVWA 3WP4A 1W0OA 1SBDA 2ZABA 3KGZA 2D6MA 1Q43A 1H2KA 2IXJA 4Q4X1 4ZU5A 1U5XA 1O5UA 4AQ2A 5KHKA 3AMHA 2MNGA 2ZKLA 1NCRB 3KCCA 1PIV3 1ZRRA 3WY6A 4QGMA 3W59A 4LT5A 4QM8A 4FXKB 3TN93 2IWGB 2YV8A 4E2QA 4JGYA 3GHMA 4J1XA 3CNAA 4GB31 2R041 3OGGA 4R52A 3MW2A 1VB4A 5JIUA 1U12A 3JQWA 2R072 2BVBA 2I07B 3TN91 3ZMOA 2EA7A 2VH9A 2WFF2 3VBUC 1ULFA 2Z79A 1KS4A 2HWF2 1TMF2 2YROA 4OFGA 1AYM1 1H1AA 4FPCA 1RUE2 2UYAA 3ACLA 4GH4C 1M06G 1BBT1 1RITA 1TMF3 3FLRA 3L2YA 3CJIC 3ME2A 2UY9A 1FT9A 2RS53 5IK4A 1NZCA 4D7YA 2R043 2O8OA 4FCAA 1NY72 2OUHA 4TSVA 3ZXFA 1V00A 1XU2A 3IT8A 2VNOA 4NWWA 4YVWA 1YUDA 1GQGA 5DDJ3 1C8M1 2RS32 5F9TA 1NCQA 4NHKA 4URTA 3AB0A 4XQ4A 4ATEA 5L7OB 3USUB 1O91A 2Y26A 1YXWA 4CDQB 2P34A 4UW3A 4KGQA 4IV1A 4L9BA 2A71A 2YXSA 3AYEA 4CDXB 1OOPC 2RJKA 4AXOA 4K6BA 4AI2A 4EV0A 1PM7A 2C9AA 4ISQA 3O7OA 4QPGB 1CAXB 3RI8A 2BUKA 3E6DA 1Z7S2 3FFZA 3ST7A 3VBHA 3FE5A 1KJRA 1XNBA 1ND3C 2K9ZA 1SEFA 3N7JA 2PYTA 5FAXA 1UF2C 3PJQA 5D8AB 5JSPA 4XILA 1WW6A 2NZ9A 1YJLA 3FHIB 1LULA 2ZGTA 2XVLA 1HRV1 1WA4A 1MS9A 4CEWC 2TBVA 1O4TA 5ACA1 1AL0G 3B00A 5J96B 1QNWA 2PAEA 3AMQA 4AK3A 2ZGMA 4FOWA 1N3PA 2ZGOA 1AR83 3N4MA 5HCBA 4RS5C 1BKZA 4IV1C 3E5QA 1QU0A 2XKPA 3WZ1A 2WQZC 1JXNA 2VOKA 5IK8A 4HPKB 1MS4A 4UW6A 4DS0A 5JR7B 3WP6A 4FPGA 3TNPB 5GLVA 3VBSA 3ZVXA 3PJYA 4P5HA 5KBFA 4L11A 4YRDA 3LZZA 4WM8B 3WNXA 2JJ6A 2ARXA 3GZUC 2YGLA 1AYN2 4S2HA 1PVC1 2Q5TA 3VUOA 4JDNA 1UAIA 4Y1UA 3U10A 1W6QA 4IV3B 2GAUA 1ND2B 3ZFFB 4YVSA 2ZCWA 5GZCA 2ZPXA 5T5PA 3NAPB 4Q1RA 2UURA 2JG8B 5BV6A 2R071 4M0NA 5E16A 1FOD2 5GKAC 4Q4Y2 4F83A 2E63A 2DVDA 2NYYA 4P9XA 1WW5A 3AYAA 2ZHKA 3LB9A 4P9WA 2CAVA 4EROA 5E89A 3GYDA 2R042 2IC1A 1FMD2 1A78A 1PZ9A 4Q0SA 1MQTB 1DZQA 4YGDA 1SLAA 2JX9A 3BU7A 1RUE3 2N7GA 3MFCA 2D6OX 3ZO0B 2PHTA 2GNMA 2A3WA 4EN0A 4JCKA 4Q4X2 4S2GA 1RJ8A 1HW5A 5J7MA 4MGYE 3VBRA 4QQHA 1JBCA 3HN1A 4DINB 3RI9A 1NA1A 1LHNA 4OVEA 2DTYA 3M2MA 1F2NA 4Q29A 2E53A 4YZ3A 5JPNB 2PA7A 3ZXDA 2JD4A 1POV0 2GMEA 3KM5A 3AKPA 4C0HA 3TWIA 4Q1PA 3VL8A 3SH4A 2BGCA 2HJIA 1RMU3 4AG4A 3LAGA 5DZFA 1AR63 4A7KA 1H4HA 1AXKA 3IPVA 1PVXA 3AFGA 1R1ZA 4N43A 4C90A 4AVBA 3D0SA 5EFUA 3QACA 1DQ6A 3K51A 1KRIA 1FNZA 4Q26A 3AZYA 5BNPC 2PN5A 4XFCA 1LHUA 2VNGA 2QDRA 5JPMB 4LUMA 3AFKA 2Q0AA 2A70A 5FBZA 3B9IA 4ORFA 5K7PA 2XH6A 4DPNA 1AJOA 2DFBA 1DHKB 1O4ZA 1QXRA 1RGSA 1YFXA 4H3WA 2X5IA 3GHNA 1FATA 1H8VA 2VVEA 1AR81 1DGRA 3ZXKA 1DZRA 4FP3A 4XTPA 4E4DX 4EWAA 2NLRA 4QQ2A 1QY4A 4GMP1 4KG8A 4BE3A 3B9CA 4YGCA 2VMHA 2ENRA 1RJ7A 5JIAA 1MZ5A 2CTVA 1UW8A 5K0UA 4XIKA 1GFF2 3MPBA 2C1FA 3VBFB 2QUOA 2B46X 3MIBA 2A7AA 4JVAA 4U36A 2E51A 4LBQA 5I0RA 3SNMA 2PLV3 1NCRC 1ULDA 1XRUA 1W6PB 4HETA 4RQPA 5CVRA 3MF9A 4QPIA 2Q8OA 3VZLA 5F6LB 1WD4A 1J3QA 4RR3C 4IEYA 2BEOA 1NE4A 2RMU2 4S2DA 3RMXA 2RS11 1TNRA 3MDPA 4YVWC 1S0FA 3S7IA 3H1YA 2VMGA 4A7ZA 2P3JA 5F6KA 3BCWA 4AEJA 1Z0HA 2ZGSA 1VIWB 3RNSA 2VUJA 4MH0E 3N35A 4AGGA 3GNEA 1GZCA 5A32A 5AC93 3KT4A 2D6KA 2HWC1 4I09A 3FJSA 1REDA 2YDEA 2IFWA 3SCHA 1KQRA 3UK9A 1BBT3 1TMF1 3U0ZA 5CFCA 1AR61 1CJDA 2XUMA 4INDA 4IEOA 3VBHB 3N3HA 4AEKA 3VN4A 2D44A 2DURA 4M01A 1D2SA 1QJU2 1RTVA 5JDBA 1HV1A 1VBA3 4TZDA 5C4WC 4E2GA 1V9U1 3M3IA 2ZHLA 1S1AA 1CD3G 4QQPA 2D6LX 4NHLA 4PF5A 2GC3A 2K0GA 4XF1A 2XLFA 4FOYA 4NHMA 1NE6A 2GMPA 5C8CB 1J58A 1AR71 1RUC3 2ZMNA 1FV2A 4DOUA 5FLJA 2VQ0A 2W52A 2ATFA 1BXHA 2ZHNA 5FO8B 3OYWA 1ULCA 1GZWB 1TE1B 4MGZE 4IXLA 3URFA 4BIFA 3GALA 1RUC1 1LRHA 5AVPA 4UXAA 3OPZA 2R073 5JSRA 2WC2A 2RE9A 4GWNA 3LCPA 4GB33 2UWBA 4FAHA 3U11A 3ZYPA 2OIIA 3ZXLA 1DYPA 4CEWA 1AF9A 5BY5A 2F4PA 2IZWA 5I0TA 4M3CE 5SV8A 1VBC2 4BOWA 5GZDA 1X82A 3ILFA 3NWKA 1TEIA 3VV1A 1GICA 2WZR3 1FOD3 1I3HA 3RMYA 4WVVA 4EN9B 1N3QA 1Z7S1 3HMYA 1APNA 4R9BA 3NAPA 1RHI1 1QOSA 4QXKA 3DUIA 4XPVA 4I0AA 1GNHA 1DG6A 1C8M3 2IXHA 3D6EA 2RJLA 3B3QE 3JBG3 3UJOA 3NO8A 1WLWA 2PHUA 4CDUC 4KWLA 4PLMA 4COZA 5HCAA 2RS31 2WNUC 4ASMB 2W0XA 4B4QA 2DWRA 3UKNA 1H8TA 1MS8A 1LOFA 2WNUA 1UZYA 2LALA 1HIXA 4WM7C 4XTMA 3VL9A