3AKQA

Crystal structure of xylanase from trichoderma longibrachiatum
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
190
structure length
190
Chain Sequence
ETIQPGTGYNNGYFYSYWNDGHGGVTYTNGPGGQFSVNWSNSGNFVGGKGWQPGTKNKVINFSGSYNPNGNSYLSVYGWSRNPLIEYYIVENFGTYNPSTGATKLGEVTSDGSVYDIYRTQRVNQPSIIGTATFYQYWSVRRNHRSSGSVNTANHFNAWAQQGLTLGTMDYQIVAVEGYFSSGSASITVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords xylanase
publication title Packing Space Expansion of Protein Crystallization Screening with Synthetic Zeolite as a Heteroepitaxic Nucleant
doi rcsb
source organism Trichoderma longibrachiatum
total genus 58
structure length 190
sequence length 190
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2010-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3akqA00
2DFCA 3WP3A 1QH6A 4XQWA 1W2UA 1QH7A 1H0BA 2BW8A 2BWAA 2QZ2A 2DCZA 2VULA 1YNAA 1AXKA 4S2GA 1NLRA 3AKTA 2BVVA 3MFAA 5EJ3A 3WY6A 4S2DA 4IXLA 1F5JA 2JENA 2NQYA 3RI9A 2VGDA 1XNCA 3RI8A 2QZ3A 3MFCA 4XQ4A 3O7OA 2DCKA 5HXVA 1REFA 3VLBB 1REEA 3VZNA 3WT3A 3WR0A 1XYNA 3VHNA 1H4GA 1XYPA 3WX5A 1XXNA 2C1FA 1UU6A 3AMNA 2D98A 2B45X 4HK8A 3AKRA 3LB9A 2JICA 3AKQA 1M4WA 1H8VA 4H7MA 3AMQA 3B5LB 1PVXA 4NPRA 3AMPA 1H1AA 3VHPA 3AKPA 3AMHA 2VUJA 3M4FA 1XNBA 3VZJA 1OLQA 3ZSEA 1BK1A 1UU5A 1UU4A 2D97A 1BCXA 4XQDA 4HK9A 3WQ7A 4S2HA 1OA4A 3WQ0A 3WP6A 2B42B 3EXUA 4HKOA 1IGOA 2DCYA 3VZMA 3LGRA 3VL9A 3WXPA 1T6GC 1HV0A 1HV1A 2BWCA 2F6BA 1BVVA 1H4HA 1OA2A 3AMMA 2JEMA 2NLRA 4S2FA 2VG9A 3HD8B 1C5HA 1C5IA 1REDA 1KS5A 1XNDA 5K9YA 3WP5A 1ENXA 3VGIA 1XNKA 3VZLA 1OA3A 1OLRA 3VL8A 3VHOA 1UKRA 4HKWA 1HIXA 4XPVA 1KS4A 1TE1B 3WP4A 2Z79A 3VZOA 3MF9A 3VZKA 3B7MA 2DCJA 5K7PA 4HKLA 2DFBA 3MF6A 3AKSA 3WQ1A 1XYOA 2B46X
chains in the Genus database with same CATH superfamily
1ZBA2 1EV13 1K42A 1QJY1 3AL5A 3OGSA 4YARA 4XQWA 4WM8A 3ZYRA 1QH7A 1H2MA 2A1XA 1AXKA 4UFHA 4A6SA 2W9XA 1POV1 3KT4A 3S30A 1A6CA 2V09A 3WG3A 3WF2A 2YBPA 4YGEA 3WY6A 1JZ3A 1PNGA 1ULEA 3NJVA 4IUGA 1R1A2 1SCSA 4B1LA 2JENA 4NPMA 1KFUL 2VNRA 3KB5A 3RDIA 2XHNA 1AR91 4XYXA 4YW6A 1QJU2 2IWGB 3ZO0B 1UYZA 4FO9A 1CWPA 5EXOA 1YFWA 1DGWA 5I0TA 1ND3C 2DCKA 1W2AX 1J83A 2VC9A 2VQTA 3POFA 4JDNA 4XF4A 3GYDA 4L11A 5CB7A 3WR0A 3VDDC 4XW3A 4I09A 3X29B 1H2NA 1X82A 1GUIA 2JD4A 1UY4A 4BQXA 4AQSA 4XFGA 1PNFA 2JKXA 5ABJB 3KGZA 5CU1A 1BMV1 1HRI1 4M3CA 4BE3A 1JODA 2DVDA 1RGSA 2VUDA 5A3PA 4QQPA 1MPXA 3T1MA 1QJX3 4E27A 1EV12 2G9ZA 2R6QA 1ND2A 4HLTA 5KXDA 1LAJA 2V72A 4QDSA 5FZBA 3T0BA 4J1XA 1NCQA 1V9U3 1HKDA 4LXLA 4M3CF 2BBAA 4AR2A 5J7MA 3AXEA 4DUVA 5DQ0A 1UO9A 3PUAA 4PQ9A 3MW2A 3R4SA 1J3PA 1T2XA 1ND3B 1NZCA 1UXZA 3EBRA 4NHKA 3P5BA 4QX2A 4Y33A 1WLWA 2Q8CA 2DVGA 3GJBA 5JIUA 5JSOA 5IFTA 4JCKA 3VDDB 4OQ8A 1D0HA 2Y0IA 2D97A 2JECA 3WCRA 3GXUA 5LASA 3VBFA 1FAYA 3K51A 4R4XA 2VCBA 5CISA 1QNWA 4FSJA 2IXLA 1YIPA 1W8UA 3EHKA 5JOXA 3IBMA 4NWWA 3KD4A 5C3SA 2RR11 2VZQA 2ZGUA 1D7PM 2QQJA 5JLVA 4XUTA 3WXPA 5FYYA 4LBKA 2EALA 3BPSA 5FZGA 5K4LA 5FY5A 3DYOA 1DIWA 3PUHA 3IT8A 1RUG3 4QKDA 1S1AA 5A7NA 1Q56A 3ACLA 3AVSA 4E4SA 4F8AA 1CQ9A 4Y4YA 3O1OA 1QJX2 4MGQA 3HD8B 1DGRN 4X6QB 1LU2A 1PMHX 2TEPA 1O3TA 2Q1MA 4CTEA 4KU8A 3VGIA 1V9U2 2OYZA 2VNVA 5A6ZA 4D94A 1UY2A 1AJKA 3THPA 5A6QA 4CDQC 2OX0A 3VKNA 5F2WA 4CDWC 4J1WA 1HQNA 3G6JB 1PVC3 3SMHA 2H6BA 1MZ5A 4D3WA 1F9KA 2WLQA 4P08A 4AEJA 4BIOA 4EN0A 3MIDA 2WNVC 4A45A 4AFBA 4I01A 5HPOA 5JXHA 4DOUA 4ZS2A 4XJ9A 2VVFA 3LA7A 1QH6A 2IXKA 3DL3A 2GSYA 5GLVA 2OIIA 1YNAA 5FBZA 1NOVA 5BNPA 3V0AA 2FDJA 1CZTA 1YI7A 4Y4RA 3MFAA 4ISQA 2B4KA 3D82A 3WNLA 2XXZA 1RUG2 4B4RA 3NW4A 4IE5A 1GZWA 4KWJA 2ETEA 3POBA 4ORFA 3O0XA 1JYTA 4PF5A 1YEWA 2B9VA 2W87A 3UGGA 5JOYA 1GQGA 1VBB1 5CFDA 4YW2A 2YC2A 4N43C 2RJKA 2ZBJA 4YW7A 1BBT1 3I49A 2Z42A 2VTXA 4CDWB 5I8TA 2VBDA 2CV6A 1H8TC 2XG3A 2GNBA 2VUAA 2W46A 4NN0A 3N7KA 1FNZA 2HWD1 3AJYA 1JXNA 4JHTA 4XJUA 1YI9A 1GZCA 3H3UA 2RS33 2WNVB 3H9AA 1PVC2 5JR7B 4E4ZA 4W4ZA 3A23A 1UPSA 1UY0A 1YYNA 3WNMA 1DG6A 2VZTA 2B8MA 2PXJA 3NJXA 5A7PA 1SEFA 2WSVA 3FBMA 3WQBA 3ZVXA 1K5MC 3O5SA 1W6MB 5FZHA 3BI3A 1VBA1 5FJKA 2LRPA 1PO13 5FZKA 3HT1A 3IMNA 4IGQA 3CBNA 4FQZA 4NIIA 2XJTA 4YZ4A 5FMOS 5F5QA 3DYPA 3KV5A 4NHMA 3ZIWA 1DQ0A 2P3KA 3LSDA 4CPBA 1RUC1 1W8OA 2AH2A 2D3RA 4N43B 1VBC3 3O14A 1WW5A 2K0GA 3IIAA 3IAPA 2Y8KA 3VD4A 4BDVB 4FFIA 5L9VA 3RZHA 2VW0A 3ITQA 2RV9A 5KXEA 2G9FA 1MVQA 5DZEA 4YLZA 4C91A 2XL7A 2D5HA 3N7MA 2VOKA 1SG3A 4R52A 1HW5A 5DUUA 3RJRA 4YFZA 5JOWA 4EJRA 1FATA 3AP4A 5FY8A 3ZPOA 2XPJA 4U2AA 3IDCB 2ZHLA 4GMP1 4LKSA 2DU0A 3PLQA 4CE8A 2VO5A 1YQCA 5J96B 4V2VA 4JRLA 2RS32 3R0RA 4DPNA 1CAUA 1FT9A 1RHI1 3B94A 5CADA 2ZX2A 2JDKA 4FOYA 5FUPA 1RVF3 2X05A 3WD5A 1CAVB 1ZZCA 3ZSLA 1YXWA 3SKVA 2PQSA 3WDUA 2Y34A 4BQYA 5DAWA 1QNYA 4OHWA 2HWB1 4AL9A 4ONUA 4CVUA 1DDLA 1X33A 1PO12 3C7FA 3M70A 3PHMA 3WEZA 5K9YA 4WM7A 3UJQA 4DEVA 1YJKA 2ZOEB 4Q4V3 4QM9A 2ADEA 3PU8A 4KGQA 2UY9A 3EJKA 2WWUA 3VL8A 1YQ2A 1UKRA 1BJQA 3SC7X 5LA0A 4QX1A 1BLZA 3LD8A 2ZGOA 4LHKA 4XPVA 1DQ6A 1EUTA 4P5YA 2Z79A 5LA2A 1VBC2 3RZKA 1Q8QA 4B1MA 2BDRA 1GOHA 1RXGA 2HKXA 1SLAA 2FCUA 4W6WA 5LWBA 1JZ8A 3M3IA 1G86A 4KG8A 3WQ1A 3M3EA 1Y3TA 2L9LA 3BGAA 3C8XA 1AVBA 2MEV3 3D6EA 4UW5A 4WZFA 1U5XA 4LITA 5FPVA 5FZ8A 3RZGA 3F95A 3O1UA 2TUNA 2XHKA 5IK7A 3S7EA 2EICA 5GLTA 1LR5A 2DURA 1RVF2 4MGZE 4YNIA 1G8WA 4AGRA 4KGGA 1ZVFA 4JDMA 3S5QA 1HX6A 1YUDA 3NWKA 4XBLA 5FUNA 2UU8A 3UK9A 1CPMA 2HBUA 2DUQA 4K8RB 3UKVA 5HXVA 4D7YA 4IEOA 3WT3A 4D7TA 3TEWA 4H7LA 4Q4V2 3I2JA 4UW3A 1EAH1 5J98B 4DUXA 3ETPA 5FZ6A 1AR81 2GH2A 3N7JA 5IHRA 3POJA 3BPZA 2WWJA 3ILRA 4DZGA 2ZGLA 4PLNA 2FDHA 1UY1A 3CL1A 4IESA 2YFZA 1WW6A 4Y1ZA 2QDRA 4Q1RA 3RYKA 1UYYA 2QJVA 3OGRA 1NLSA 1RUI3 4ZY9A 3THDA 3LB9A 3TN91 1S0JA 1UX7A 1CGPA 4LOTA 5FRAA 4BZ4A 4NHXA 3FJSA 1WGPA 2LS6A 1ST8A 2YB7A 4CP2A 2MEV2 1H1AA 3H7JA 2HEWF 3DCQA 2AYHA 1W3XA 1NA1C 3DGTA 1E5IA 2R16A 1NCRC 3RYRA 3UJOA 4MG2A 1V6OA 4LBQA 3AYDA 5KHKA 4JQRA 2XONA 3ZYHA 1LHNA 3V65A 4ARYA 2X09A 2YDEA 3VBOC 3WSOA 2FMYA 5B4NA 4XHBA 5FP3A 4CZSA 1LOBA 2RVAA 1VE0A 4FOQA 1DYPA 4E8CA 1UU4A 5E89A 4RSUA 1V6NA 2IXIA 4Q0QA 2R063 1AX0A 3RZMA 1C8M3 5HCFA 4YRDA 2W68A 5FYHA 1MZFA 1RUF2 1HXS3 4P02B 3I7DA 3JD71 4NMIA 5FMOL 4D8MA 1HRI3 2GZWA 2PQQA 4RS5C 4HKOA 1J58A 4Q27A 5IW0A 3M1HA 4NJ4A 4CCLA 3FE5A 4Z82A 3N9PA 1VBE3 1KJLA 3GCXA 2WFPA 3KQ4B 3M3CA 3ZFFC 2D3PA 2R0HA 3IDBB 1RUI2 4LK7A 1IG3A 4OYUA 5EPAA 1GANA 2IFRA 2B39A 3I2KA 1NA1B 4WZCA 5H9QA 3W59A 5DAPA 3NV4A 4S2FA 1U5YA 1YJLA 1NCRB 4XDOA 2ZX0A 3Q9OA 1OOPC 1XBFA 1XNDA 2ARCA 2J1VA 2KA3A 4NRQA 5ANNA 1WUVA 3T08A 1W39A 2W1UA 1IKQA 3VBOB 2Q8EA 2VQAA 2WZR1 1Z78A 4XHXA 5FIXA 5T52A 5DUWA 5LRRA 1XRUA 1CPNA 2EXIA 5C3RA 2AUYA 3JB4C 3AXDA 4DY5A 2IVIB 1JZ6A 2E63A 5FYUA 4DO0A 1WLTA 1AYM1 1SBFA 5E88A 5FXZA 1DU3D 3B7MA 2DCJA 4AVCA 1VMHA 4QT6A 4GMP0 4Y26A 3A0KA 3V0BA 5I8SA 4RS5B 2R062 3ZXEA 2XVKA 1C8M2 3SLIA 1DFQA 2C9AA 2XBO1 1HB4A 3TEXA 1VPHA 1ZBE1 3USUB 1HXS2 4BQ1A 3MICA 1HRI2 2Y38A 5FPXA 4BQWA 2PA7A 2ZAAA 3ZFFB 1H1MA 1MACA 4FP2A 2A6ZA 3I2GA 1VB2A 3GHMA 1VBE2 4Y5SA 4XUPA 2W94A 2J1SA 1QOSA 4URTA 2WT1A 3NMBA 5HCHA 1OOPB 1HJFA 2OUJA 5FFOC 5DDJ1 1CJDA 2VCMA 5FP9A 3ZIXA 1IZ3A 5JI7A 5KR7A 5CKNA 3T2OA 2PAMA 4QDRA 1W03A 3U14A 3OYWA 4QQHA 4FAHA 2ZEYA 4PI2A 2MHFA 1XYNA 1MEC3 1TMF3 5T55A 3WUCA 1W3VA 2WL1A 4LBLA 4YZ2A 1LECA 3W5NA 1HB1A 4YVWC 1KD7A 4JKKA 3AP5A 2C26A 2H6CA 3AMNA 1YCIA 3B02A 1W2OA 3ACFA 4A42A 4DRVA 1RJ7A 4OHXA 2HWC3 1D2QA 5GKAC 3H8UA 1JYVA 5FZFA 4I3PA 1OF4A 2DTWA 3KV4A 5KHHA 3V56A 2BOIA 5GLZA 1PX3A 1U12A 2PHUA 1EPWA 1AXZA 4PLMA 2ILMA 2HWF1 3ZXLA 3M4FA 1W9FA 3WDVA 4JGYC 4CU8A 4HMZA 3LAGA 5FXWA 1AUYA 4JKLA 3KHCA 5H9PA 2ENRA 1FXZA 2Q0AA 2GAUA 2VZVA 2OXBA 4EYUA 5DABA 1QMJA 4HK9A 1V00A 3A22A 5FXVA 3MLKA 4XJWA 4YVWB 2X5IA 2WKKA 3NV3A 4BB3A 4NHLA 1L7QA 4CEWA 2TNFA 1MEC2 1TMF2 2KD7A 2WINB 3CNAA 4XTMA 1ZRCA 1OC1A 1IGOA 3EYPA 4YGDA 3N9NA 3R4DB 3IDEA 5EYXA 2WJSA 2YBKA 4HSJA 2JIJA 1WBFA 2ZA9A 1DBNA 5A7WB 4N53A 1X8MA 1IS4A 4N8MA 1DYKA 2ZACA 1HB2A 1UOFA 5FBJA 3PUQA 5HBAA 1UZWA 3KT7A 2JJ6A 4O9GA 1VRH1 2HWC2 4J25A 4MZUA 5C4WC 5CBLA 4E9KA 4P14A 4NWVA 2VG9A 3MW3A 4JGYB 5A1AA 5ACA1 4RR3C 2YPDA 1QIQA 3CF6E 3RQ0A 3MIFA 4DS0A 2GC3A 1OLRA 3HNYM 3IAQA 3T4VA 1W6PB 3SH4A 5K0UB 3FLRA 4OI0A 5CA6A 1L3JA 3U10A 4COZA 3LPGA 1ZNPA 4HZFA 3FHIB 3ORJA 1FPN1 4NIHA 5LW9A 1FX5A 1QDCA 3TWIA 3TNPB 2A6WA 1H9PA 4JTNA 3UYJA 2D44A 4W65A 4YM2A 5FLHA 1STMA 3N9MA 1MS0A 2BW8A 4UOJA 1H0BA 2Y60A 3T30A 4XF3A 4CP9A 1TNFA 3LOIA 1LGNA 1XNAA 5HV0A 4YGBA 2CGNA 2VZSA 5C4WB 2E51A 1YRZA 1G9AA 3FMGA 1NG0A 2PHWA 4OZXA 4BQ4A 2W52A 4GWMA 5IAXA 2XQRA 5FR3A 1OPOA 4ZPIA 4Q29A 1F2NA 1W2TA 4R9BA 3O0VA 2J1EA 4XQ4A 1EYBA 5A7QA 1R091 5IFPA 1S0IA 3Q8EA 1DQ4A 5IAVA 2GC0A 1LOFA 4UFIA 4NAOA 3AZZA 1TME1 2FBEA 1B35C 4Q26A 4XIOA 1FMD1 4AYUA 3ZYFA 1SPPB 2XOMA 4AOCA 1UMIA 2ES3A 3J4UH 4ES9A 1PMJX 2P37A 2NM1A 4LKEA 4Q0PA 2Q8DA 4BXSV 5AC93 1JUIA 3K77A 3OUIA 2JICA 1ZZ6A 1H8VA 4FT8A 4QGNA 3TRSB 3VHRA 2D6KA 2ZEXA 2ZXQA 4NPRA 4CDUC 4XCBA 2GMEA 1UAIA 3MI8A 2E31A 3TAYA 1XE8A 5K0UA 3ES4A 5JPNB 1UOGA 4XDQA 4JTOA 1ZA4A 2JDPA 2A75A 5LA1A 3JCIA 3CLPA 4OHYA 1O3SA 2EF6A 3GBFA 3I2DA 4FOWA 4KG0A 3IWZA 1RUE1 2D93A 3CJXA 4GWJA 4IE0A 4PIYA 4DQAA 1UU5A 3RGBA 1LTEA 1WD3A 1B35B 4K20A 2UWCA 1QQP1 1OA4A 1SBDA 3WQ0A 1H6XA 3HQXA 5EQUA 5FQ0A 3D0JA 1HLCA 1S0BA 4P9YA 3EXUA 3WINE 1O8PA 1COV1 1JI6A 4JGZC 4M0HA 4P9LA 5J48A 4M0NA 3O1TA 3ZMNA 3UV9A 1BZWA 2RDRA 2DV9A 4YZ5A 1W8FA 1JOBA 1LRHA 3QOPA 2MNGA 1QEXA 4HVOA 2IXJA 4IGPA 5BNNC 5LY1A 2GN7A 2GMPA 4CDUB 3S6PA 2NLRA 4XURA 3P3PA 2A70A 3SEPA 4META 3LFMA 2HYKA 5D2AA 3KF5A 1QJEA 4GWIA 4MXWB 4EWEA 2AENA 2ZX3A 4XF9A 1ENXA 2BGCA 2WQ8A 2RS51 3GZTB 4RD7A 1NE6A 3CO2A 2JIGA 2D6MA 3SCHA 4DXTA 3OF1A 1LOAA 4OI1A 1GZTA 3I54A 4FFGA 2CHHA 1T6BX 3BUCA 3GGLA 3I3QA 2YU1A 3BOPA 3C2UA 2LW8A 4ZKTB 2N7GA 3ACHA 1UF2C 1GWLA 5KC5A 2CGPA 2D43A 1PGW1 5EYYA 3FHQA 2XLAA 2Q1ZB 2WUHA 3PJYA 3WDYA 3D4KA 3FFQA 4BOWA 4LBJA 1NY72 5FZIA 4HT1T 5JZGC 3T4HB 1WCSA 3H1YA 3I59A 4MGYE 5FP4A 5BNNB 3H1MA 3NNGA 5E16A 4EN7B 2YPJA 2CTVA 1G9BA 1A8DA 3PJQA 5KHJA 1J84A 5LRSA 2OPWA 4S2GA 5A1FA 4ZU7A 4CRQA 4FPKA 3VBUA 3VD5A 1RUD3 1KGYA 4V2WA 4AF9A 5CYYA 1LJ7A 1QY4A 4OVEA 1UQXA 5CG8A 3ZFEC 4H55A 4JKMA 4OMCA 4CXWA 3A0NA 1F5FA 3IKWA 4IV3B 1XPWA 1BEV1 2WQ4A 4HPKB 3VBFC 5IVBA 4B4QA 2ZGRA 3CU7A 2QQIA 5I0DA 3VLBB 4MADA 4UXAA 4I0BA 4OFGA 3VKFC 4DIQA 5C5TA 1AYM3 2P6CA 4RHV3 1KITA 4O7XA 1U5ZA 2D6NA 1PMIA 3H42B 3PNAA 2FCVA 3VKMA 4AE2A 1UU6A 2VZPA 1ZX5A 3LA2A 4HOOA 1HN1A 4GJYA 1S4CA 5A32B 3ZN6B 4AHWA 3WNOA 3ZDVA 4A6OA 5JZGB 5JVVA 2V5DA 4QXKA 1ULGA 4XUOA 1W04A 4FTEA 4OUEA 2GC1A 2WS91 1C3HA 5EWSA 1VR3A 1C28A 4CU7A 1KJRA 2E9QA 1AL23 5C8CC 4YG6A 2EA7A 1BYHA 4MOAA 2YFUA 4CCMA 5EIYB 1GLHA 4K6BA 4QPGB 4MH0E 3W58A 3D0SA 4K40A 1GQPA 1Z7S3 2PHRA 4NAMA 1RUD2 2GH8A 4W6YA 4DXSA 4EN8B 2ZKNA 1RYYA 2AGSA 2WZEA 1YFUA 3BU7A 4FPHA 4W50A 1GNYA 4PBOA 4Y5TA 5LY2A 2JDZA 5C6CA 5FREA 1RC6A 3JZVA 4LUKA 3GJAA 3H8RA 1SFNA 4LTAA 4R9AA 1KDKA 1RMU1 4A41A 3BU0A 5CEHA 2A5ZA 2IXCA 2VU9A 5A3TA 4WVMA 5IVJA 4XZUG 2R041 1AYM2 1WWYA 3PIGA 4RHV2 4XXPA 5H9SA 4Z1VA 3QACA 2B7YA 2CSGA 2Y6JA 1Q5OA 2ZHMA 1OF3A 1VALA 3HN3A 4E2SA 2G4IA 3AM2A 4GKXA 4K1YA 3CKHA 2RS11 3VBSC 2JG8A 3GBWA 2UWAA 1FOD1 3CJIA 5FTTC 2R1DA 5L7OC 4LBNA 1OD5A 4IV3A 5C8CB 3IDAA 5A3UA 4HN1A 3N9LA 4K8FA 4PCRA 3JU9A 4Y22B 3VBHA 3Q8FA 4O9EA 3NQHA 5DZGA 5LEJA 1AL22 1RTVA 3VBRA 3U11A 4GKYA 5BV6A 2LM3A 4FPEA 4XOGA 1URXA 4FPFA 3WG1A 4LT5A 4NIAA 4LLOA 4YPJA 5JI9A 2CAVA 1Z7S2 5C9AC 1GP4A 3WW4A 2J1UA 4JX0A 2A3WA 3PVOA 3P3NA 3PUSA 1TE1B 2QNKA 5F39A 4LJHA 5FY1A 3ZFGC 2QQLA 2QQPA 4WVWA 2ZZJA 1D4M1 1HRV1 2R7EB 4ZONA 2RMU3 1FYUA 3U75A 3DPRC 3K46A 4XE9A 5IWFA 3J7HA 3LDRA 1TEIA 4I02A 1WD4A 2RM23 2R32A 1HB3A 4QPGA 4A7ZA 4TLFA 5L7OB 2QZ2A 1ULDA 4OUSA 3A4UA 4BK5A 2Z2SB 1SFYA 1NLRA 3K2OA 1SMVA 4GJZA 1IPJA 3N3HA 4S2DA 5IK8A 3BTZA 1OI6A 3CIHA 2O0OA 1WMFA 4DMIA 5ABJA 5E6HA 2NMNA 3MUZ1 2J42A 5EJZB 3FLTA 3ZYJB 3RI8A 3HBZA 3ZKYA 2FDIA 1ULOA 4LOSA 5A3WA 5C9AB 4ARXA 4HG6B 1PGL2 2YROA 2GC2A 5F8PA 4MX3A 1OURA 3ZX7A 2GP3A 4Q4X1 1SFPA 3ZFGB 5D8AC 1X9TA 4ZU4A 4Y3OA 4CA9A 2W47A 4IEPA 5GZDA 1CJPA 3DPRB 4JQTA 1SACA 2E7QA 2JG9C 1PIV3 3O1PA 3QCWA 3RZZA 4OULA 2XGXA 3AFGA 3NVCA 5I91A 1K3IA 2C6SA 2RG4A 1ND3A 2RMU2 5A3MA 1CX4A 4QAWA 5CFCC 3TEYA 1DGRA 4QHZA 4WVVA 5TSWA 2PELA 1JMUB 1DGWX 4LIUA 3VDDA 3KCXA 2RM22 5KHIA 2QQNA 5AFBA 2D40A 4Q4W1 2QQOA 3GBGA 2WNUC 1CD3G 1UIKA 1WKYA 1OKQA 1W6NB 5ISLA 3KV6A 4K1ZA 4GIQA 3LZZA 4Y20B 3GZUC 4CDQB 2WWSA 1ULCA 5A1LA 1G9FA 1VLNA 3DKQA 4ZXKA 5C70A 4Q4Y1 2FDGA 3DECA 4RGKA 1W8TA 5FYCA 4LBMA 1BK1A 2A7AA 5IVEA 4GB33 4LQRA 1ONAA 5D8AB 3E6CC 3E5UA 4DRRA 5I0SA 5C7GA 4RL7A 3ZXFA 4V1PA 2VQUA 2W2IA 3IB3A 4FP3A 4AVVA 2A6YA 1VRBA 3ZLIA 3VZMA 4N9HA 3PU3A 1ASJ1 2FZ1A 2P2KA 4CCDA 1SLCA 2Q1FA 4EQVA 4MXVA 1HV0A 2AACA 5BYNA 3J8F3 5FPUA 4IV1C 1PIV2 3GNEA 5IATA 5AVPA 3IN9A 5GLWA 1J3QA 3USSA 1CAXB 1JU4A 4EROA 2V73A 1N3QA 1RITA 1RUH1 4XBNA 3T0DA 2WNUB 2OZJA 2JEMA 1YC61 2C0ZA 2JKBA 2VOXA 2V4VA 1OQ1A 4YVSC 1IKPA 3T09A 3H8OA 4XFHA 2XB6C 4HONA 2KR2A 4QPWA 2RE9A 1H8TB 3Q8CA 4XETA 4LO6B 3L2HA 2VMDA 3H3ZA 1JS9A 3VHOA 3ZSMA 1UX6A 2OA2A 2ATFA 3ACGA 4Z2AA 2QCSB 1JW6A 2X29A 4GQ7A 1QWRA 1Q8VA 3L9JT 1JZ4A 3T1LA 3O1MA 1W6OB 2YG0A 1LGCA 3WW3A 3KCYA 1ODMA 3PVEA 5H9RA 1YQ6A 4IE6A 4GB32 3MF6A 3LEKA 4RYDA 1K5MB 3RFRA 1WCDJ 1MVEA 2R071 4TWTA 3LOBA 4IV1B 4CUCA 2WN2A 3ELNA 1UN1A 2VULA 2VZRA 4CDQA 3OEBA 4URAA 4CDWA 4AAXA 3SH3A 1F35A 3J8F2 4CEYC 3VUOA 1W9WA 2RJLA 1G6NA 2NN8A 4IEQA 4OHVA 3AYAA 5BY5A 2XUMA 4YVSB 2YBSA 5CG9A 2WNVA 1WMXA 2VGDA 4TYSA 5JMCA 5KXBA 2I45A 4AI9A 2WZ8A 2F4LA 3IM0A 3ZXAC 1LNSA 3MPPG 1S55A 1YO8A 3HNMA 4Y1YA 5T5PA 1C8NA 2EXJA 2WAAA 5SV8A 2JWPA 3HPNA 2EIDA 5FZ9A 1Q8OA 3OCPA 3FL7A 5FYTA 1W6MA 4IDZA 4Y24A 2EAKA 5D1IA 3JBG3 5GLUA 2PLV1 3OGVA 5F9TA 5IUQA 3WCSA 2CGOA 4CCKA 1R081 1RUJ1 3T0AA 1QKQA 2HWE1 3HMYA 4Q0SA 2WDBA 2E7TA 3H1WA 1JHNA 1NLQA 1X9PA 2XVGA 3AKRA 1V6JA 4AQTA 2DDUA 2ZGSA 3AP7A 4N43A 4XEZA 5DMYA 1HN0A 2W3JA 3ETQA 1JZ2A 1UOBA 2VH9A 4ZZ5A 4CEYB 1H8TA 1DGLA 4CCJA 2AREA 3KSCA 5FOBB 5DUVA 1VAKA 4G3YC 2X8KA 4L97A 3K4DA 2YUEA 3AKPA 3ACIA 5JIAA 2XWBB 4BWOA 4AWDA 2ZGTA 5FYVA 4JDOA 1RUF3 5T5LA 3GZAA 5LB6A 1O4YA 5FPAA 3FBYA 3C7GA 4HANA 3ATGA 3B69A 3WUDA 1K5MA 3ZN4A 1AYN1 2GP5A 4P9WA 1CAVA 2A73B 1I9RA 1WA4A 2BJSA 5D21A 1QJY3 1TVGA 3ZDSA 5LK5A 1O3RA 5L36A 1H1IA 2XVLA 4I0AA 2ZMKA 2ZGNA 1AR61 1KQRA 2XJUA 3JBG2 4XFIA 3WVJA 1PGSA 3I3MA 1POV3 1AR71 2HJIA 4PLOA 4FVVA 2UWBA 1WLDA 4X8NA 4A7YA 1T6GC 4AK3A 1ENSA 1OH3A 2P34A 5FLJA 4L99A 4B7KA 1AR93 4C1WA 2VW2A 3CEWA 3GZEA 4Y1XA 5J3UA 4FAGA 2IVJA 2WFF1 4Y5Z0 5A80A 1QF3A 4Q8LA 2DVFA 4MHRA 3NAPC 3VZLA 4COWA 4UF0B 4HKWA 3W5MA 2DWRA 5CAZA 1MS1A 4W6XA 3SCFA 2GALA 1LOGA 1R1ZA 2Y64A 2XDVA 1UYXA 3M3OA 3IIIA 2JD9A 3ZYIB 3I97A 1UWWA 1YLLA 3HQRA 5F3EA 1PO21 1QJY2 2ARXA 1HQWA 3OPWA 2XKOA 1MQTC 4KWLA 2Y33A 3VD3A 4AFMA 4TSVA 3S7IA 2XJPA 5BPXA 2B5HA 1AF9A 1ZBA1 2ZEWA 5C3PA 1N47A 3AZYA 4CU9A 1LCLA 1AR92 5EP9A 4E4HA 1F5JA 4IEUA 4QGLA 2VMIA 1C1LA 1OKOA 1R1A1 1YQ8A 2VCCA 3NAPB 4R9DA 2O1QA 2VW1A 2I74A 4N9IA 2X5IC 5KXCA 1QJU1 1AHSA 3O1VA 5I0RA 4HVRA 3WHUA 1REEA 5FAXA 1OSGA 3N35A 1JYIA 3SITA 2RR13 2ZGQA 3DXTA 2YXSA 3OUHA 4PDWC 3QH6A 3UT0A 3VHNA 1LGBA 4INDA 1D4M3 4DY3A 2YC4A 1XYPA 3OY8B 3WX5A 4Z2WA 1BMV2 1TQ5A 1JYCA 1O8SA 4R8HA 2C1FA 3FLPA 4KU7A 2WO3A 2D98A 4KBZA 1GFF2 3EQEA 4OUMA 1MQTB 5F2SA 1A8MA 3M3QA 4BIFA 3K3NA 2NZ9A 3RWKX 3THCA 2R0FA 3OG2A 3ST7A 2WT2A 1X8EA 2ZZQA 4G4FA 4FPCA 1PK6C 1PVXA 4BPZA 5FP8A 3PIJA 5J1XA 3GF6A 4L92A 1V6MA 1NXD1 1SCRA 3OBTA 1JOJA 3AMHA 2AZ5A 4AHYA 1LKNA 5IYYA 5JXJA 4LO7A 5L9BA 4UBHA 4CP1A 4ASMB 3N4MA 1VBD1 4UFJA 1DHKB 1UPIA 2O8OA 4YWAA 4FOVA 2LUWA 2CWMA 3LDKA 4PDWB 4AFAA 1PZ7A 1U5IA 5KBFA 3MIBA 1NA1A 2RR12 1NCRA 2I07B 2CU5A 2E7AA 2ET7A 3U78A 1D4M2 4BM8A 2AEYA 5JPMB 4BLJA 3B9IA 3WNXA 4HL0A 3VBOA 1GKBA 2XQXA 4GALA 1W8WA 3RMXA 1HV1A 3OB8A 3WDWA 1PK6B 3H0OA 2ORXA 4H14A 4PQQA 3VKOA 1H2KA 5BNOC 4Q4W3 4AW7A 3P6BA 1VBB3 2K2SA 4LNVA 1F4AA 3CZJA 1XC6A 1BBT3 4YM1A 4AVTA 4RS5A 1QJX1 5SV5A 3APBA 3AC0A 1ALYA 4FFHA 1H6YA 5FZ1A 3OEAA 3I2OA 2HWD3 4OLLA 3USUA 2WRAA 3AFKA 4JVAA 1V9U1 2IC1A 1UY3A 5A7SA 2BGPA 2WSUA 4K7JA 4QPIC 3ZFFA 3MO4A 1JYXA 4HXCA 3S57A 4XZPA 4NROA 4AZZA 3RYPA 1IHMA 2EIGA 4LO5B 4Y1UA 1UMZA 4RA0A 1OOPA 4GH4C 4NUBA 4XUQA 4UFMA 1VBA3 2D5FA 1LU1A 2OPKA 3MLJA 4NIGA 3AL6A 3K3OA 4IERA 3BCWA 4DNYA 1AX2A 3ZN5A 1XU2A 2VD7A 2WAOA 3C7EA 1Q8PA 5FYBA 2C4XA 5FMDA 1IQDC 1LHVA 1RUH3 3ALQA 2W92A 3PTYA 4Q0VA 1OLME 4BQ3A 5JR2A 1RUC3 5LATA 3SEEA 3ZYPA 4JV4A 2YZ4A 2K9ZA 4Q4W2 5E1RA 1RUG1 1VBB2 1CIWA 2JDNA 1OH4A 2ZHNA 1BBT2 1N3PA 4QHBA 1SDDB 2DF7A 3VZNA 2O14A 3IPVB 2VZUA 4MVTA 1VAVA 4GMP3 2HWD2 3B01A 3JXSA 5EZWA 1XU1A 2HYXA 1FV2A 4LHSA 2J22A 1FI2A 1NE4A 1NZIA 1OLMA 1RHI3 4GH4B 5FJHA 4BQ2A 4JZRA 3VKLA 3HQUA 2XWJB 2HEVF 3M8LA 3O0WA 2XL9A 1JZ5A 4FQ4A 3OPTA 3OBAA 1PVC1 2YY1A 3KT1A 2BQPA 2JDAA 2HWB3 4HN0A 5K8SA 1VBA2 4C8DA 4KH9A 1LEMA 4QX7A 4UFLA 4RR3B 4AEDC 1WZXA 2IUWA 2P4EA 3POEA 3UGHA 1Y9MA 1EY2A 1QJFA 1VAMA 3INAA 5C33A 1AXYA 4CXYA 1RUH2 4YVWA 1GZ9A 5FV3A 5F6LB 1RUC2 2BZDA 3VZJA 4M01A 2DTYA 2JDMA 2EIEA 3VV1A 5A7WA 3T2PA 3WDXA 4N7IA 3E97A 1J1LA 1NUKA 4A3ZA 4QX3A 3DUIA 1F8VA 4QQ2A 2NYYA 1B09A 5B2GB 4MYEA 5FPLA 4AG4A 5B4XA 1ZA7A 2XH6A 4CDXC 2XJRA 1YIFA 1I5PA 3KZ4C 4YFWA 5T5JA 4XAAA 1K45A 4JGYA 4UYBA 5DG2A 3HT2A 2ZJCA 3PL0A 1RHI2 3LIHA 1V6LA 3LGRA 3FX3A 5FZAA 4RQPC 1XNTA 1WCKA 1W6PA 1ODNA 3EMRA 3JB8A 5IT6A 4SLIA 5IJRA 1OMIA 2F6BA 1GWKA 2RS31 3K4ZA 1W05A 3PURA 3MV11 4AEDB 4COVA 4D6QA 4TZDA 2Q8OA 2BOJA 1O4TA 4P5HA 5HV4A 2HWB2 5FZOB 2PTMA 2BNNA 1BK0A 2VVEA 3OBRA 1ZZ8A 1N1VA 3IPVA 3WV6A 1EAH3 2SBAA 1D2SA 1MS5A 1UZZA 1AR83 2FDFA 1PO11 2OVUA 4GD4A 4NHYA 1FNYA 1UZVA 2XKPA 3EB7A 4IEYA 1K5JA 5F5AA 3TYJA 2ZKLA 1NQJA 4WM8C 4UFKA 2GDFA 3SH5A 1IS3A 5LBFA 3BKZA 3MIGA 4JHZA 3AZXA 4QU2A 4LPLA 5FO8B 3O1RA 5C4WA 3J9SA 4CDXB 3AP9A 3TN93 2K46A 1VBC1 1GBGA 4AEMA 2ZTNA 1NAEA 1UMHA 4RR3A 5IVFA 1XYOA 5DZFA 3I3BA 3WOGA 1FV3A 4RQPB 4BQ5A 4AFCA 4CYDA 1JYWA 5T3NA 5BXXA 1D0GA 1W6QB 2EXKA 1PZ9A 2D7FA 1OVSA 2RDQA 5L19A 5A3OA 3SNMA 1XJAA 3AKTA 1KDMA 2BYVE 3H8XA 1J3RA 2WYFA 3E6BA 4KL1A 3QLQA 2G9GA 2Z4FA 4LLFA 1SPPA 2YV8A 3UGFA 2NQYA 4XVHA 3ZM8A 1RVF1 2O8QA 1OQDA 2ZABA 3D3AA 4QX0A 3FFZA 5ANQA 5JXGA 5FO9B 5L73A 2Q5TA 2VQ0A 1W99A 4SBVA 2D3SA 4HBNA 3WF3A 1AJOA 1POQA 1EAH2 1DZRA 4TN7A 5IVVA 1AR82 3JD73 3JQXA 3NSTA 4JGZB 3VB9A 5M0TA 4IE4A 1ND2C 3NKTA 5FP7A 4Q4V1 2ZGMA 1H4GA 4BA6A 5GZCA 1YHFA 2PHFA 2C9KA 2NPIA 1NCQC 2VBBA 4I3GA 5LA9A 3SXWA 4YZ1A 4F7ZA 4GULA 4D69A 3BB6A 4MGKE 4O65A 5FZOA 3TN92 3AZWA 3AJZA 4FPOB 3F2ZA 4LK6A 3T3YA 1Z0HA 1LENA 4O61A 3AKQA 4OI4A 3POWA 4KMQA 2BNMA 4LA2A 3AMQA 2OZ6A 4PI0A 3VD9A 3RPQA 4FXGB 3MZHA 1B35A 2WZR3 3URFA 4HETA 1I1EA 1F31A 3LQCA 2MEV1 3DV8A 4EN9B 1L7RA 2YGMA 4M3CB 5DG1A 3BODA 1ZRDA 4D0QA 2HBTA 2HH9A 4XF0A 5F1RA 1APNA 4AAPA 3OSDA 5KC6A 3N9QA 2VR4A 2ZHKA 4IEVA 5EHDA 4FFFA 2XBO3 3ZXKA 1ND2B 5AFEA 1EUUA 2BFUS 3AX4A 3NJYA 1ZBE3 5FZLA 4CDUA 3JD72 1F4HA 3K75B 5FWJA 1NCQB 1W8HA 2OQ6A 1TG7A 2E53A 3ENRA 1OUXA 1CZSA 4AHZA 4MXWA 1SZBA 4F83A 1V6IA 1O4ZA 3KV9A 5CIRA 5FCCA 4AI3A 4YGCA 1HDKA 2P3JA 5DXDA 2VM9A 4L9BA 3ZXDA 3ZFEB 5DDJ3 2V4AA 4C0HA 1IS5A 5AVAA 3WF1A 3R6SA 2PAKA 4XFFA 1UD1A 1OQEA 3VBFB 3C7OA 3SQOA 2TBVA 4BXFA 1RUI1 4M00A 3MBWA 1BHGA 1DZTA 4ISRA 4KNCA 3ECQA 4LA3A 5T5OA 1W0PA 1C5HA 1K12A 1REDA 1US3A 1VIWB 2BERA 2QQUA 2VJXA 2WZR2 4JGZA 4KWKA 2VMEA 4PHZA 1RUOA 1Y9QA 4EZHA 1VBD3 4YW3A 4GXLA 1UL9A 2JXAA 2ZAHA 3GALA 4M3CE 4R9CA 3N9OA 5BNNA 3HN1A 5BNPC 4QX5A 3KQRA 3RWNA 3W21A 4COYA 4M4PA 1Y43B 3BOWA 4N7UA 3H3LA 2XBO2 2CDOA 4D7SA 3MUY1 2BRTA 2BNOA 2SLIA 2JDUA 1YFYA 2W1WA 4UI9L 1ZBE2 5IK4A 1GNZA 2PHLA 3LEGA 2R061 1HQLA 3BALA 3IZOA 1C8M1 3NKGA 4HPKA 3DXUA 1CAWB 2DYCA 5CFDC 2HWF3 2YU2A 1XQNA 1HXS1 5APAA 4BJ0A 1A78A 1GWMA 4XCAA 5FK8A 5C5UA 2P3YA 1CN1A 3AYCA 1WMEA 2J7MA 1TNRA 3L2YA 2P1BA 5FO7B 3EO6A 5DDJ2 3VDAA 4KQ7A 1VBE1 1NKGA 3ZN6A 2W1QA 1QOTA 1XNCA 5A32A 4XJ8A 2CWSA 3ON7A 4KI5M 5JZGA 2KXLA 1REFA 2Y0OA 4DFSA 4AEKA 3V0AB 5BNPB 5LZ6A 1VBD2 4X8PA 3ZYGA 4BH9A 4BK4A 1KEXA 2J1AA 3S5AA 4H3WA 3VBSB 3UESA 3ZXJA 1ZRIA 5C3QA 5IK5A 3SCGA 3ZFEA 2WC2A 1GZWB 3NRUA 4CUBA 3ZYBA 3CQOA 1MS8A 4QX8A 3D8CA 1A3KA 1VRH3 4XJZA 3KGLA 3WZ1A 4A4AA 5CFDB 5KWRA 1GSLA 5T54A 2QQWA 3MPBA 1L7LA 4TLGA 5ACA3 3B00A 4GAZA 4GWNA 3B5LB 2KM2A 2WLPA 3BVCA 1V6KA 5FPBA 3B93A 2HWF2 4HVQA 3SISA 4XMIA 4MGTA 4BYYA 1W8ZA 2QUOA 4MSVA 4QM8A 3U4SA 1LULA 4IEZA 1Y9GA 4K9SA 1DF0A 1YFXA 1IOAA 1FPN3 4QKFA 3MDPA 1QXRA 4LO8A 3UKTA 4UBGA 4ET7A 3U4XA 1DYOA 2VOVA 3ILNA 1OLQA 4MGSA 5FXXA 3ZSEA 5J37A 4MV2A 1BQPA 5I0UA 5FZ0A 1ZZ9A 2LROA 3Q8AA 3E5QA 5FZ4A 3UL2A 3ZXGA 1JUHA 4XQDA 5EFUA 5C8CA 4S2HA 1MZEA 1CAWA 3LSEA 4FCAA 4QD2A 4Y22A 2C5DA 3LDBA 1XSQA 5A6YA 2YYOA 3LA3A 3W20A 1XB9A 2VNGA 4AFDA 2XJQA 4LUMA 1E57A 4Q5OA 3UETA 3FN9A 2JE9A 4WM7C 4QHOA 1O59A 1MEC1 1TMF1 2HLEA 2RJ2A 4ASLA 3RS6A 4HSLA 3T2TA 4NR1A 1WLCA 2BWCA 2DCTA 4AVBA 1VRH2 1S0GA 4L8QA 4AQ2A 4LO4B 1US2A 2BFUL 1UIJA 4XFAA 4AVSA 1ZYBA 4QPYA 1O91A 3WG2A 1R093 5ACA2 4FTSA 4Z92B 4B8EA 5DAQA 1VP6A 2HWC1 4DINB 2DVAA 3OD0A 1S0DA 1KS5A 3U0ZA 2ZS6B 1NXMA 1TME3 3VBSA 1OA3A 3MW4A 4OMDA 1FMD3 1CAUB 4E8DA 4OZOA 5FYSA 5JOZA 4DXZA 4PT6A 1YQ5A 2YGLA 4QGMA 5L7OA 2QVSB 2JG9B 1KS4A 1FPN2 3MV01 2VOTA 5FMCA 4E2GA 3HAGA 5DAXA 2YHJA 2X53S 1DLCA 2ARBA 2ZCWA 2D6OX 5K7PA 1XE7A 2JDYA 3WNPA 5CFCB 2VAUA 1W0OA 2DFBA 3BIWE 1WW7A 3VD7A 2VVDA 4GA9A 3AKSA 4WM7B 2CYFA 2PAEA 3BYWA 1ZRRA 1JU3A 3LF7A 5FZ3A 3WP3A 1JYNA 5C9AA 2BPA2 5JWPA 4AGGA 2BWAA 3DF0A 5A6XA 3WW1A 3MGUA 2VL4A 2ZMLA 3PTRB 3U37A 3RG0A 5A70A 3P1IA 2BVVA 3FC0A 3E5XA 3ZFGA 1GR3A 4K21A 1BVP1 2NMOA 1SLBA 1POV0 2VNOA 5FLIA 1RUE3 1N3OA 3DPRA 3RI9A 2CAUA 2VCAA 2Y6LA 5FYZA 3ZMOA 2B9UA 2JX9A 2XJVA 4RN5A 1R092 3ZPYA 3MFCA 4QB6A 1N1TA 1QQP3 3POSA 2IZWA 4F3JA 4LHLA 2PHXA 4M4RA 5CVRA 3Q8BA 1COV3 1TME2 1Y4WA 1FMD2 2GMMA 3AK0A 1DQ2A 4NO4A 5G05L 3KWVA 4NIDA 1O6UA 4YG0A 1W6NA 3OUJA 4H2AA 4Y20A 1MS9A 2Z5WA 5FY0A 2WR9A 2Y6GA 1WW4A 4LBOA 3KS7A 2A6XA 3S0MA 1N1YA 1SDWA 4DEQA 3HOBA 4LR4A 2F17A 1JN2P 1ZM1A 2RS53 4CSWA 2MPFA 5D8AA 3AMPA 2CL2A 1SBEA 1LOCA 1BXHA 1H2LA 4YG3A 3NNMA 2JG9A 3ABZA 3LWCA 3MLLA 5F3IA 5JSPA 1NX9A 3KF3A 4FPGA 1RB8G 2BTVC 2ZMNA 4AVAA 1CIYA 2CNAA 2VZOA 4XFBA 1RUE2 5CFCA 1GOFA 5IVCA 3I4IA 5FK7A 4OQ9A 2QQMA 4YW1A 3RVHA 5FYMA 5CKQA 5DN2A 4BMBA 1CAXA 1DZQA 2P6HA 1QQP2 2FHRA 3B9CA 3NNLA 5DAVA 5GZFA 3MIHA 2W39A 3WQ7A 1MS4A 3N7LA 5LBCA 3LEIA 2WNUA 3G7DA 4I30A 4ASKA 3BTAA 4BHPA 1COV2 1U0AA 4D6RA 1S2BA 4LHNA 4LBQB 2ORZA 1CX1A 2DCYA 4YM0A 1OVPA 4ZS3A 1WCUA 4JC1A 2ZPXA 4IGOA 4CCOA 1MZ6A 4FXKB 4XC9A 1IPSA 2W08A 2XLGA 2FMDA 2ZGKA 4X6RB 5F3GA 1IQAA 2D6LX 2QQVA 2Y26A 3ASIA 1BEV3 1W6OA 3OTFA 4P9IA 5AC91 1OFNA 2G19A 1EP0A 3NO8A 4NOTA 5C8WA 1H9WA 1DQ5A 4MUVA 3WG4A 4W8JA 3WHTA 2RS52 4ATFA 4EN6B 3M2MA 3E6DA 1UZ0A 4AI1A 1VJ2A 3QD6A 4LIVA 1SLIA 1XNKA 1LB2A 4AQ6A 5C71A 1C1FA 1SHWB 3DN7A 2Y6KA 4C0BA 2FZ2A 4IV1A 5G04L 1SLTA 1EPZA 3LE0A 4UT5A 3PVBB 5ERLA 3M7AA 2R30A 2VUCA 5JMOA 3WP4A 3VZOA 4D6SA 1ZZ7A 2JB4A 2Y6HA 1PGW2 5JAXA 1QXJA 4C90A 2WS93 4YVSA 3R4UA 1LODA 4YM3A 1A34A 1PX4A 2UYAA 2EVXA 3I2FA 2WA3A 3H7YA 4ZXEA 3KVBA 2B46X 3PMEA 4RGAA 4WVZA 3VDBA 3WNKA 1UKGA 1NY71 4QB1A 1XE0A 2UY8A 3LPFA 4J6GA 2HEYF 2VY0A 5FY7A 2VMHA 3A21A 2BVBA 3JQWA 1OT5A 2A3YA 5EJ1B 2LALA 4UAPA 5FKCA 4C1XA 3V0BB 3BIEA 1RMU3 1BEV2 4CCCA 4EWDA 2WNEA 5LCWL 2GN3A 2JE7A 1QHDA 4QU1A 4B3NA 3ZSKA 2VECA 2DVBA 4L0PA 5J36A 3VN4A 5A33B 4EWAA 1QOOA 1GQHA 1YWKA 2VZ3A 1J59A 5LEKA 2R043 2YC0A 3RNSA 4CCNA 4IL7A 3SHRA 5L9RA 3I3EA 3H50A 4CUAA 4CEYA 3TNQA 4XACA 2RS13 4PIZA 1G9CA 2BUKA 5HCAA 1Q43A 1UOJA 2VE1A 3DKWA 2E6VA 3ROUA 1E5SA 5A7OA 3ZR5A 5F3CA 1FOD3 2I2SA 3TEZA 2X10A 3HNBM 3ZKUA 5T50A 2WO7A 1O5LA 2QTWB 2WS92 3BN6A 2F4PA 3DEMA 4QQLA 2AC1A 4XMAA 2FCTA 1BKZA 3HWJA 4FBFA 3LKJA 1M4WA 4R4ZA 4H7MA 1W2NA 1V0AA 3OYWB 5E8AA 2P5BA 3RZJA 1W9YA 1DLLA 3LCPA 2P3IA 4QXHA 5JCTA 3J7MA 3W9AA 4CEWC 1QDOA 2VUJA 2WIIB 3WLUA 3ZR6A 1ACCA 4DXRA 4L2NA 4YSFA 2QFEA 1J1TA 2R49A 1NQDA 2EXHA 1RUNA 3KVAA 1RMU2 1RUD1 1HRV3 1ENQA 2ZX1A 4N53C 4Z07A 5F32A 3U07A 1IS6A 4G9SB 2WABA 2FD8A 4RFT0 2G1MA 5F37A 1PZ8A 2R042 1QXPA 3GDBA 4Q1PA 1AZDA 4A44A 1JBCA 3RZLA 2VMFA 2IXHA 1ULFA 1CESA 1G9DA 2B42B 3KHBA 2WT0A 2RS12 2WBKA 4XDPA 1CZVA 3NV2A 2PFWA 4RHV1 2V5YA 1ZRFA 1FOD2 1F15A 1LHWA 1EV11 3RMYA 4UF0A 2ZEZA 5BNQA 1Y7BA 4NVPA 4UWDA 4NRMA 2DU1A 4XUNA 4FTBA 4PF1A 5A33A 1XSRA 3FWEA 5F6KA 5I8YA 5JXIA 1W28A 2WNOA 4XFCA 4BISA 2X5IB 3OGGA 4CEWB 4IE7A 4P00B 4BCUA 1RJ8A 3RSJA 2DUPA 5FYIA 4QDQA 2ARAA 1D4VB 3HR9A 4HFSA 1OD3A 4Q4X3 1AL21 4Q0UA 4BMEA 4ES8A 2OUHA 1UZYA 4WV8A 2D6PA 1N1SA 2WA4A 4N53B 5DPNA 3NJZA 4FPLA 5F7UA 1JOPA 4MO3M 4P9GA 5CZKA 4XBQA 3U1XA 2ADDA 4B7EA 4CPBD 1Z7S1 3KLSA 1HRV2 1CVNA 1LHUA 1VMJA 3ILFA 2CDPA 1GU3A 3I2HA 2QQKA 2UYBA 1LOEA 1WA6X 1GNHA 4LKFA 4QWNA 1X36A 2OKXA 1MR5A 3FUOA 3NAPA 4CU6A 2ZX4A 1GYKA 1PM7A 2DFCA 2WO1A 2VTFA 1E5RA 4LMFA 1R64A 1W9SA 2EAAA 3MYXA 3SKJE 3ZOIA 1W2UA 2A3XA 2J1RA 1LOFC 1LESA 4NRPA 1ULPA 4MHUA 4Q4Y3 4COUA 4QXCA 4XAEA 5C3OA 4AHXA 4FI9A 3OY8A 3LFIA 2A71A 4KBBA 5FDBA 4TTGA 4DUWA 2XUEA 5FZ7A 1MQTA 4FPYA 1KXGA 4LE3A 1GMMA 3WNNA 4CCEA 3O7OA 2PHDA 5HXMA 1ZREA 5A3NA 1PHMA 4Q4X2 2UURA 2W1SA 4IETA 2CY6A 3PVNA 4I0WB 5FZMA 2YMZA 4CP9B 2VZ1A 4AI8A 1GV9A 4IQPA 1PGL1 4JAAA 4B29A 1ASJ3 2GNDA 4XF1A 1Q8SA 3R05A 4N90A 3MHZA 5K0UC 4XABA 1O7FA 2RDNA 2JB8A 3V64A 2QE3A 5BNOB 2B45X 1LEDA 1JTZX 2OW4A 3K48A 1DQ1A 3MEPA 4HK8A 5FZCA 1E5HA 1JHJA 2W5FA 1S0FA 1X50A 2XR4A 3D5OA 2RMU1 4RGGA 3WDTA 3HEIA 1OHFA 4PDWA 2IFWA 4LORA 4A2UA 5LK7B 4KWUA 4GZ9A 3GCWA 4IEWA 3VHPA 2RM21 1C57A 3PUIA 2QDNA 4QPIB 4Q4Y2 2QBXA 5FY4A 2ET1A 1XNBA 1I6XA 5FOJB 2BEOA 2VBPA 3NL1A 3CZUA 4P9JA 2XMLA 3HVDA 1PK6A 4Q8KA 3J7LA 2R073 2W91A 1OBNA 4IW3A 4QKNA 4TXWA 3OJBA 5IVYA 1S0CA 3CHXA 2RDSA 2WQZC 3OGJA 3UNPA 5GZGA 1OPMA 1ASJ2 4QQOA 1QU0A 1H30A 3AP6A 2VPVA 2P17A 3CMGA 3ME2A 2Z69A 3NNJA 3RRDA 3CDZB 4Q2FA 1O5UA 5FWEA 3RJ2X 4AI0A 4CXXA 1V70A 4LEJA 1G7YA 3THTA 3PDQA 5FPZA 1JH5A 5LBBA 1BVVA 4XJAA 3I3DA 3FZ3A 5GALA 1PIV1 2J1TA 3FUQA 3JUUA 4UW4A 4DB5A 5FQ0B 2VXJA 5BUVA 2A6VA 4UW6A 1CONA 4XXAA 3POYA 4CUGA 3OBZA 4BU2A 1TZOA 5JSRA 4Z8BA 3QBQA 5FKBA 3WP5A 4NE9A 3C3VA 3IMMA 1VB4A 2PLV3 1X7NA 4LBQD 1R083 1JZ7A 1RUJ3 3KMHA 4YW5A 1RL3A 3POGA 2JDHA 1S0EA 3E1F1 5HCBA 2HWE3 2PYTA 2WN3A 1HJGA 2VMCA 2ZGPA 4NPLA 5BNOA 5JUVA 2JE8A 1UCXA 4JRAA 3MF9A 2Y6FA 3VZKA 4K3UA 3VBUC 5FZDA 1W9TA 2BGOA 2AR6A 3OD4A 2R072 4YZ3A 1RINA 4IEXA 4CP0A 3O12A 4GB31 1RIRA 2ERFA 3ES1A 4MLOA 5FMBA 1O3QA 1SLLA 3VDCA 5LBEA 4YW4A 2R1BA 2OT7A 2ID4A 2XJSA 3K4AA 1UYPA 4QPIA 4AI2A 3LEMA 3NNFA 2DCZA 2NP0A 5I93A 3TOJA 1I3HA 5DUXA 4OHZA 5EJ3A 4B4PA 5FUIA 1UNBA 4ZZ8A 2W0XA 4IXLA 2C24A 3J8F1 2PHTA 1AYN3 4FPJA 4GH4A 3O1SA 1M06G 2DUOA 4YYOA 1QGLA 3UKNA 3NV1A 3C7HA 3TBDA 4XIKA 1WCQA 2QZ3A 1W06A 3I59B 4QKBA 4LE4A 1GICA 1AR63 2BP6A 4LKDA 2PLV2 1P8JA 1AR73 1OUSA 1R082 2PN5A 3HIFA 1DP0A 1RUJ2 3VBUB 4ZHNA 4AXOA 2HWE2 3J26N 1UW8A 2BBVA 1XXNA 2AEZA 5CKMA 3WW2A 1WMDA 3FHAA 1GP5A 3POIA 4PIXA 2GNMA 2E33A 5JDBA 4I2OA 2DBNA 4Y1VA 2GNTA 1OFSA 2WFF3 3WF0A 3MIEA 4E2QA 1W90A 2BV4A 2BU9A 3DYMA 2FQPA 4BLIA 3HJRA 4LULA 3OOXA 2VXRA 1NYWA 3I8TA 4WM8B 5AC92 2E32A 5FZEA 1ENRA 4OI2A 1IG0A 2WYSA 3QH7A 4ITCA 1AYN2 1WBLA 1CR7A 1S2KA 3J7NA 1RXFA 2JG8C 2W95A 4A7KA 2VOWA 3CJIC 1PO23 1KFXL 4AEDA 4IV3C 3AYEA 1BCXA 5HI0A 5F5IA 1ZZBA 5A3LA 3I2IA 1AR62 2FDKA 3BTXA 2Q4SA 4MGIE 2OQ7A 3VBHC 2VMGA 1ZBA3 1AR72 4QMAA 5GM0A 3WP6A 2QKDA 3PMSA 3BTYA 1XOYA 3GHNA 1GP6A 1SQ4A 3VBRC 1AX1A 3JBG1 1IPKA 5CNAA 3VL9A 3TB0A 4QXBA 3AZVA 4AGVA 5FY9A 1MS3A 1H4HA 1R1A3 1W8NA 1DCSA 2WZPP 4PJYA 2RHPA 3T2QA 1QJZA 1OA2A 3KCCA 4QB2A 2Q30A 3AMMA 1AL0G 1LHOA 5F5CA 2WO2A 2WFF2 2LTNA 2XLFA 1QJU3 1GOGA 4WVMB 4XILA 4CDXA 1NT0A 3OPZA 1OXCA 5KHGA 2VTXJ 4A3XA 2DBIA 2H0VA 5GJ6A 1C5IA 1VMFA 2PMWB 4EE2A 4EV0A 3N36A 2OS2A 5J09A 1PM4A 4ATEA 3AVRA 4RQPA 5EV7A 1Q3EA 1I5ZA 2JG8B 4QPGC 5GZEA 1HIXA 4XTPA 3CJIB 3HBKA 4P9XA 4E4DX 1W6QA 1UXXX 3AB0A 4OCTA 4EZ4A 3KM5A 4RFRB 3LIGA 1RUF1 3VBHB 3GM8A 4WBBA 1PO22 1S2EA 3ZSJA 4HKLA 1C4RA 1W0NA 2H0BA 5ABJC 4ZU5A 1KRIA 4U36A 2EIBA 3VBRB 2GU9A 3A7QA 4PBPA 2E26A 3B3QE 3WF4A
chains in the Genus database with same CATH topology
1ZBA2 1EV13 1QJY1 4YARA 4XQWA 4WM8A 3ZYRA 1QH7A 1H2MA 1AXKA 1POV1 3KT4A 3S30A 1A6CA 2V09A 3WG3A 4YGEA 3WY6A 1PNGA 1ULEA 1R1A2 1SCSA 2JENA 1KFUL 2VNRA 3KB5A 3RDIA 1AR91 4XYXA 1QJU2 2IWGB 3ZO0B 4FO9A 5EXOA 1YFWA 1DGWA 5I0TA 1ND3C 2DCKA 4JDNA 4XF4A 3GYDA 4L11A 3WR0A 3VDDC 4XW3A 4I09A 3X29B 1H2NA 1X82A 2JD4A 4AQSA 4XFGA 1PNFA 5ABJB 3KGZA 5CU1A 1BMV1 1HRI1 4M3CA 4BE3A 2DVDA 1RGSA 4QQPA 3T1MA 1QJX3 4E27A 1EV12 2R6QA 1ND2A 4HLTA 5KXDA 4J1XA 1NCQA 1V9U3 1HKDA 4M3CF 5J7MA 3AXEA 4PQ9A 3MW2A 3R4SA 1J3PA 1ND3B 1NZCA 4NHKA 3EBRA 1WLWA 2DVGA 5JIUA 5JSOA 4JCKA 3VDDB 1D0HA 2Y0IA 2D97A 2JECA 3WCRA 3VBFA 1FAYA 3K51A 4R4XA 1QNWA 4FSJA 2IXLA 1YIPA 3EHKA 5JOXA 3IBMA 4NWWA 3KD4A 2RR11 2ZGUA 5JLVA 3WXPA 4LBKA 2EALA 1DIWA 3IT8A 1RUG3 1S1AA 1Q56A 3ACLA 4E4SA 4F8AA 1CQ9A 4Y4YA 1QJX2 3HD8B 1DGRN 4X6QB 1LU2A 1O3TA 2TEPA 2Q1MA 4CTEA 4KU8A 3VGIA 1V9U2 2OYZA 4D94A 1AJKA 3THPA 4CDQC 3VKNA 4CDWC 4J1WA 1HQNA 3G6JB 1PVC3 3SMHA 2H6BA 1MZ5A 4D3WA 1F9KA 2WLQA 4AEJA 4BIOA 4EN0A 3MIDA 2WNVC 4AFBA 4I01A 4DOUA 4XJ9A 2VVFA 3LA7A 1QH6A 2IXKA 3DL3A 2GSYA 5GLVA 2OIIA 1YNAA 5FBZA 1NOVA 5BNPA 3V0AA 1YI7A 3MFAA 4ISQA 3D82A 1RUG2 4B4RA 3NW4A 1GZWA 4KWJA 2ETEA 4ORFA 3O0XA 4PF5A 5JOYA 1GQGA 1VBB1 5CFDA 4YW2A 4N43C 2RJKA 2ZBJA 1BBT1 2Z42A 4CDWB 5I8TA 2CV6A 1H8TC 2XG3A 2GNBA 2VUAA 4NN0A 3N7KA 1FNZA 2HWD1 3AJYA 1JXNA 4XJUA 1YI9A 1GZCA 3H3UA 2RS33 2WNVB 3H9AA 1PVC2 5JR7B 4E4ZA 1UPSA 1YYNA 1DG6A 2B8MA 1SEFA 2WSVA 3FBMA 3ZVXA 1K5MC 3O5SA 1W6MB 1VBA1 1PO13 3HT1A 3IMNA 4FQZA 2XJTA 4YZ4A 5FMOS 5F5QA 4NHMA 3ZIWA 1DQ0A 2P3KA 3LSDA 1RUC1 2AH2A 2D3RA 4N43B 1VBC3 3O14A 1WW5A 2K0GA 3IIAA 2VW0A 5KXEA 2G9FA 1MVQA 5DZEA 4YLZA 4C91A 2XL7A 2D5HA 3N7MA 2VOKA 4R52A 5DUUA 1HW5A 3RJRA 4YFZA 5JOWA 4EJRA 1FATA 3AP4A 2XPJA 4U2AA 3IDCB 2ZHLA 4GMP1 2DU0A 3PLQA 5J96B 4JRLA 2RS32 3R0RA 4DPNA 1CAUA 1FT9A 1RHI1 3B94A 5CADA 2ZX2A 4FOYA 1RVF3 3WD5A 1CAVB 1ZZCA 3ZSLA 1YXWA 3WDUA 1QNYA 4OHWA 2HWB1 1DDLA 4ONUA 1X33A 1PO12 3M70A 3PHMA 5K9YA 4WM7A 3UJQA 1YJKA 2ZOEB 4Q4V3 4QM9A 4KGQA 2UY9A 3EJKA 3VL8A 1UKRA 1BJQA 4LHKA 2ZGOA 4XPVA 1DQ6A 2Z79A 1VBC2 1Q8QA 2HKXA 1SLAA 4W6WA 3M3IA 1G86A 4KG8A 3WQ1A 3M3EA 1Y3TA 1AVBA 2MEV3 3D6EA 4UW5A 4WZFA 1U5XA 2TUNA 2XHKA 5IK7A 3S7EA 5GLTA 1LR5A 2DURA 1RVF2 4MGZE 4YNIA 1G8WA 4AGRA 4KGGA 1ZVFA 4JDMA 1HX6A 1YUDA 3NWKA 4XBLA 2UU8A 3UK9A 1CPMA 2DUQA 3UKVA 5HXVA 4D7YA 4IEOA 3WT3A 4D7TA 4H7LA 4Q4V2 4UW3A 1EAH1 5J98B 1AR81 2GH2A 3N7JA 3BPZA 3ILRA 4DZGA 2ZGLA 4PLNA 3CL1A 4IESA 1WW6A 4Y1ZA 2QDRA 4Q1RA 3RYKA 2QJVA 1NLSA 1RUI3 3LB9A 3TN91 1S0JA 1CGPA 5FRAA 4BZ4A 3FJSA 1WGPA 4CP2A 2MEV2 1H1AA 3H7JA 2HEWF 2AYHA 1NA1C 3DGTA 3RYRA 2R16A 1NCRC 3UJOA 1V6OA 4LBQA 3AYDA 5KHKA 4JQRA 1LHNA 3V65A 2YDEA 3VBOC 2FMYA 4XHBA 4CZSA 1LOBA 4FOQA 1DYPA 1UU4A 5E89A 4RSUA 1V6NA 2IXIA 4Q0QA 2R063 1AX0A 1C8M3 5HCFA 4YRDA 2W68A 1MZFA 1RUF2 1HXS3 3I7DA 3JD71 5FMOL 1HRI3 2GZWA 2PQQA 4RS5C 4HKOA 1J58A 4Q27A 3M1HA 3FE5A 4Z82A 1VBE3 1KJLA 2WFPA 3M3CA 3ZFFC 2D3PA 2R0HA 3IDBB 1RUI2 1GANA 2IFRA 2B39A 3W59A 1NA1B 4WZCA 5H9QA 4FTEA 3NV4A 4S2FA 1U5YA 1YJLA 1NCRB 2ZX0A 3Q9OA 1OOPC 1XNDA 2KA3A 1WUVA 1W39A 1IKQA 3VBOB 2VQAA 2WZR1 1Z78A 4XHXA 5T52A 5DUWA 5LRRA 1XRUA 1CPNA 2EXIA 2AUYA 3JB4C 3AXDA 4DY5A 2E63A 1WLTA 1AYM1 1SBFA 5E88A 1DU3D 3B7MA 2DCJA 4AVCA 4QT6A 4GMP0 4Y26A 3A0KA 3V0BA 5I8SA 4RS5B 2R062 3ZXEA 2XVKA 1C8M2 3SLIA 1DFQA 2C9AA 2XBO1 1ZBE1 3USUB 1HXS2 4BQ1A 3MICA 1HRI2 2Y38A 5FPXA 2PA7A 2ZAAA 3ZFFB 1H1MA 1MACA 4FP2A 2A6ZA 1VB2A 3GHMA 1VBE2 1QOSA 4URTA 2WT1A 1OOPB 2OUJA 5FFOC 5DDJ1 1CJDA 3ZIXA 1IZ3A 5JI7A 2PAMA 3OYWA 4QQHA 4FAHA 2MHFA 1XYNA 1MEC3 1TMF3 5T55A 3WUCA 2WL1A 4LBLA 4YZ2A 1LECA 4YVWC 1KD7A 3AP5A 2H6CA 3AMNA 1YCIA 3B02A 4DRVA 1RJ7A 4OHXA 2HWC3 1D2QA 5GKAC 3H8UA 4I3PA 2DTWA 5KHHA 3V56A 5GLZA 1U12A 2PHUA 1EPWA 1AXZA 4PLMA 2ILMA 2HWF1 3ZXLA 3M4FA 3WDVA 4JGYC 4HMZA 3LAGA 1AUYA 5H9PA 2ENRA 1FXZA 2Q0AA 2GAUA 1QMJA 4HK9A 1V00A 3MLKA 4XJWA 4YVWB 2X5IA 2WKKA 3NV3A 4CEWA 4NHLA 2TNFA 1MEC2 1TMF2 3CNAA 2WINB 1ZRCA 4XTMA 1IGOA 4YGDA 3R4DB 3IDEA 5EYXA 2WJSA 4HSJA 1WBFA 2ZA9A 1DBNA 4N53A 1X8MA 1IS4A 1DYKA 2ZACA 5HBAA 3KT7A 2JJ6A 4O9GA 1VRH1 2HWC2 5CBLA 4MZUA 5C4WC 4E9KA 4P14A 4NWVA 2VG9A 3MW3A 4JGYB 5ACA1 4RR3C 3CF6E 3RQ0A 3MIFA 4DS0A 2GC3A 1OLRA 1W6PB 3SH4A 5K0UB 3FLRA 4OI0A 5CA6A 1L3JA 3U10A 4COZA 1ZNPA 4HZFA 3FHIB 1FPN1 1FX5A 1QDCA 3TWIA 3TNPB 2A6WA 1H9PA 4JTNA 2D44A 4W65A 4YM2A 5FLHA 1MS0A 2BW8A 1H0BA 4XF3A 1TNFA 3LOIA 1LGNA 4YGBA 2CGNA 5C4WB 2E51A 1YRZA 1G9AA 3FMGA 1NG0A 2PHWA 4OZXA 2W52A 4GWMA 1OPOA 4Q29A 1F2NA 4R9BA 3O0VA 4XQ4A 1EYBA 1R091 1S0IA 1DQ4A 2GC0A 1LOFA 3AZZA 1TME1 2FBEA 1B35C 4Q26A 4XIOA 1FMD1 4AYUA 2ES3A 3J4UH 4ES9A 2P37A 2NM1A 4Q0PA 5AC93 1JUIA 2JICA 1ZZ6A 1H8VA 4FT8A 4QGNA 3TRSB 3VHRA 2D6KA 4NPRA 4CDUC 2GMEA 1UAIA 3MI8A 3TAYA 1XE8A 5K0UA 3ES4A 5JPNB 4XDQA 4JTOA 1ZA4A 2A75A 3JCIA 3CLPA 4OHYA 1O3SA 2EF6A 3GBFA 3I2DA 4FOWA 4KG0A 3IWZA 1RUE1 2D93A 3CJXA 4PIYA 4DQAA 1UU5A 1LTEA 1WD3A 1B35B 4K20A 2UWCA 1QQP1 1OA4A 1SBDA 3WQ0A 3HQXA 5FQ0A 3D0JA 1HLCA 1S0BA 4P9YA 3EXUA 3WINE 1COV1 4JGZC 4M0HA 4P9LA 5J48A 4M0NA 3ZMNA 3UV9A 1BZWA 2DV9A 4YZ5A 1LRHA 3QOPA 2MNGA 4HVOA 5BNNC 2IXJA 2GN7A 2GMPA 4CDUB 3S6PA 2NLRA 3P3PA 2A70A 4META 2HYKA 4EWEA 4MXWB 2AENA 2ZX3A 4XF9A 1ENXA 2BGCA 4RD7A 2RS51 3GZTB 1NE6A 3CO2A 2D6MA 3SCHA 3OF1A 1LOAA 4OI1A 3I54A 3BOPA 3C2UA 4ZKTB 2N7GA 1UF2C 5KC5A 2CGPA 2D43A 1PGW1 5EYYA 2XLAA 2Q1ZB 3PJYA 3WDYA 3D4KA 3FFQA 4BOWA 4LBJA 1NY72 4HT1T 5JZGC 1WCSA 3H1YA 3I59A 4MGYE 5BNNB 3H1MA 5E16A 1G9BA 4EN7B 2YPJA 2CTVA 1A8DA 3PJQA 5KHJA 5LRSA 4S2GA 4ZU7A 4CRQA 4FPKA 3VBUA 1RUD3 4AF9A 1LJ7A 1QY4A 4OVEA 5CG8A 3ZFEC 4H55A 3A0NA 1F5FA 3IKWA 4IV3B 2WQ4A 1BEV1 4HPKB 3VBFC 4B4QA 2ZGRA 3CU7A 3VLBB 4UXAA 4I0BA 4OFGA 3VKFC 1AYM3 4RHV3 1KITA 1U5ZA 2D6NA 1PMIA 3PNAA 3VKMA 4AE2A 1UU6A 1ZX5A 3LA2A 3ZN6B 5A32B 4AHWA 5JZGB 5JVVA 4QXKA 1ULGA 2GC1A 2WS91 1C3HA 5EWSA 1VR3A 1C28A 1KJRA 2E9QA 1AL23 5C8CC 4YG6A 2EA7A 1BYHA 1GLHA 4K6BA 4QPGB 4MH0E 3W58A 3D0SA 4K40A 1Z7S3 2PHRA 4W6YA 1RUD2 2GH8A 4EN8B 2ZKNA 2AGSA 5CG9A 1YFUA 3BU7A 4FPHA 4PBOA 2JDZA 5C6CA 5FREA 1RC6A 3JZVA 4LUKA 1SFNA 4LTAA 4R9AA 1KDKA 1RMU1 2A5ZA 2IXCA 2VU9A 4WVMA 2R041 1AYM2 4XXPA 4RHV2 5H9SA 4Z1VA 3QACA 2B7YA 2ZHMA 1Q5OA 1VALA 4E2SA 2G4IA 3AM2A 4GKXA 4K1YA 2RS11 3VBSC 2JG8A 3GBWA 2UWAA 1FOD1 3CJIA 5FTTC 2R1DA 5L7OC 4LBNA 1OD5A 4IV3A 5C8CB 4HN1A 4K8FA 4PCRA 3JU9A 4Y22B 3VBHA 4O9EA 5DZGA 5LEJA 1AL22 1RTVA 3VBRA 3U11A 4GKYA 5BV6A 2LM3A 4FPEA 4XOGA 1URXA 4FPFA 3WG1A 4LT5A 4LLOA 5JI9A 2CAVA 1Z7S2 5C9AC 3WW4A 2A3WA 3PVOA 3P3NA 1TE1B 2QNKA 3ZFGC 2QQPA 4WVWA 2ZZJA 1D4M1 1HRV1 2RMU3 1FYUA 3DPRC 4XE9A 1TEIA 4I02A 1WD4A 2RM23 2R32A 4QPGA 4A7ZA 4TLFA 5L7OB 2QZ2A 1ULDA 4OUSA 3A4UA 2Z2SB 1SFYA 1NLRA 1SMVA 1IPJA 3N3HA 4S2DA 5IK8A 1OI6A 2O0OA 1WMFA 4DMIA 5ABJA 2NMNA 3FLTA 3ZYJB 3RI8A 3HBZA 5C9AB 1PGL2 2YROA 2GC2A 4MX3A 3ZX7A 4Q4X1 3ZFGB 5D8AC 4ZU4A 4IEPA 5GZDA 1CJPA 3DPRB 1SACA 2E7QA 2JG9C 1PIV3 3QCWA 3RZZA 4OULA 2XGXA 3AFGA 3NVCA 5I91A 1ND3A 2RMU2 5A3MA 1CX4A 5CFCC 1DGRA 4WVVA 5TSWA 2PELA 3VDDA 1DGWX 5KHIA 3KCXA 2RM22 5AFBA 2D40A 4Q4W1 3GBGA 2WNUC 1CD3G 1UIKA 1OKQA 1W6NB 4K1ZA 4GIQA 3LZZA 4Y20B 3GZUC 4CDQB 2WWSA 1ULCA 1G9FA 1VLNA 4ZXKA 4Q4Y1 4LBMA 1BK1A 2A7AA 4GB33 1ONAA 5D8AB 3E6CC 3E5UA 4DRRA 5I0SA 4RL7A 3ZXFA 4V1PA 4AVVA 4FP3A 2A6YA 3VZMA 4N9HA 1ASJ1 2FZ1A 2P2KA 5BYNA 1SLCA 4MXVA 1HV0A 3J8F3 4IV1C 1PIV2 3GNEA 5AVPA 3IN9A 5GLWA 1J3QA 3USSA 1CAXB 4EROA 2V73A 1N3QA 1RITA 1RUH1 4XBNA 2WNUB 2OZJA 2JEMA 2C0ZA 2JKBA 2VOXA 1OQ1A 4YVSC 1IKPA 4XFHA 2XB6C 2RE9A 1H8TB 4XETA 4LO6B 3L2HA 3H3ZA 3VHOA 3ZSMA 1UX6A 2OA2A 2ATFA 2QCSB 1JW6A 2X29A 4GQ7A 1QWRA 1Q8VA 3L9JT 3T1LA 1W6OB 1LGCA 3WW3A 3KCYA 3PVEA 5H9RA 4GB32 3MF6A 1K5MB 1WCDJ 1MVEA 2R071 4TWTA 3LOBA 4IV1B 3ELNA 1UN1A 2VULA 4CDQA 4CDWA 3SH3A 4CEYC 3J8F2 3VUOA 2RJLA 1G6NA 2NN8A 4IEQA 4OHVA 3AYAA 5BY5A 2XUMA 4YVSB 2WNVA 2VGDA 4TYSA 5JMCA 5KXBA 2I45A 3IM0A 3ZXAC 3MPPG 1S55A 1YO8A 4Y1YA 5T5PA 1C8NA 2EXJA 5SV8A 1Q8OA 3OCPA 1W6MA 4Y24A 2EAKA 5D1IA 3JBG3 5GLUA 2PLV1 5F9TA 5IUQA 3WCSA 2CGOA 1R081 1RUJ1 1QKQA 2HWE1 3HMYA 4Q0SA 3H1WA 2E7TA 1JHNA 2XVGA 3AKRA 1V6JA 4AQTA 2ZGSA 3AP7A 4N43A 4XEZA 3ETQA 2VH9A 4CEYB 1H8TA 1DGLA 2AREA 3KSCA 5FOBB 5DUVA 1VAKA 4G3YC 2X8KA 4L97A 2YUEA 3AKPA 5JIAA 2XWBB 4BWOA 4AWDA 2ZGTA 4JDOA 1RUF3 5T5LA 3GZAA 1O4YA 3FBYA 4HANA 3ATGA 3B69A 3WUDA 1K5MA 3ZN4A 1AYN1 4P9WA 1CAVA 2A73B 1I9RA 1WA4A 1QJY3 3ZDSA 5LK5A 1O3RA 5L36A 1H1IA 2XVLA 4I0AA 2ZMKA 2ZGNA 1AR61 1KQRA 2XJUA 3JBG2 4XFIA 3WVJA 1PGSA 1POV3 1AR71 2HJIA 4PLOA 4FVVA 2UWBA 1WLDA 4X8NA 4A7YA 1T6GC 4AK3A 1ENSA 2P34A 5FLJA 4L99A 4B7KA 1AR93 4C1WA 2VW2A 3CEWA 4Y1XA 5J3UA 4FAGA 2WFF1 4Y5Z0 1QF3A 4Q8LA 2DVFA 3NAPC 3VZLA 4COWA 4HKWA 2DWRA 5CAZA 1MS1A 4W6XA 3SCFA 2GALA 1LOGA 1R1ZA 3M3OA 3ZYIB 1YLLA 1PO21 1QJY2 2ARXA 1HQWA 2XKOA 1MQTC 4KWLA 4AFMA 4TSVA 3S7IA 2XJPA 5BPXA 2B5HA 1AF9A 1ZBA1 1N47A 3AZYA 1LCLA 1AR92 1F5JA 4IEUA 4QGLA 2VMIA 1C1LA 1R1A1 3NAPB 4R9DA 2O1QA 2VW1A 2I74A 4N9IA 2X5IC 5KXCA 1QJU1 1AHSA 5I0RA 4HVRA 3WHUA 1REEA 5FAXA 1OSGA 3N35A 1JYIA 3SITA 2RR13 2ZGQA 2YXSA 4PDWC 3QH6A 3VHNA 1LGBA 4INDA 1D4M3 4DY3A 1XYPA 3OY8B 3WX5A 4Z2WA 1BMV2 1TQ5A 1JYCA 4R8HA 2C1FA 3FLPA 4KU7A 2D98A 1GFF2 3EQEA 4OUMA 1MQTB 1A8MA 3M3QA 4BIFA 2NZ9A 2R0FA 3ST7A 2WT2A 1X8EA 2ZZQA 4G4FA 4FPCA 1PK6C 1PVXA 4BPZA 3GF6A 4L92A 1V6MA 1NXD1 1SCRA 3OBTA 1JOJA 3AMHA 2AZ5A 4AHYA 1LKNA 4LO7A 4UBHA 4CP1A 4ASMB 3N4MA 1VBD1 1DHKB 1UPIA 2O8OA 4FOVA 2LUWA 2CWMA 4PDWB 4AFAA 1PZ7A 1U5IA 5KBFA 3MIBA 1NA1A 2RR12 1NCRA 2I07B 2E7AA 2ET7A 1D4M2 4BM8A 4BLJA 3B9IA 3WNXA 4HL0A 3VBOA 1GKBA 4GALA 3RMXA 1HV1A 3WDWA 1PK6B 3H0OA 4H14A 3VKOA 5BNOC 1H2KA 4Q4W3 4AW7A 1VBB3 2K2SA 4LNVA 1BBT3 4YM1A 4AVTA 4RS5A 1QJX1 5SV5A 3APBA 1ALYA 2HWD3 4OLLA 3USUA 3AFKA 4JVAA 1V9U1 2IC1A 4K7JA 2WSUA 4QPIC 3ZFFA 4XZPA 3RYPA 1IHMA 2EIGA 4LO5B 4Y1UA 1UMZA 4RA0A 1OOPA 4GH4C 1VBA3 2D5FA 1LU1A 2OPKA 3MLJA 4IERA 3BCWA 4DNYA 1AX2A 3ZN5A 1XU2A 1Q8PA 1LHVA 1RUH3 3ALQA 3PTYA 4Q0VA 1RUC3 3ZYPA 4JV4A 2YZ4A 2K9ZA 4Q4W2 5E1RA 1RUG1 1VBB2 1CIWA 2ZHNA 1BBT2 1N3PA 4QHBA 2DF7A 3VZNA 3IPVB 4MVTA 1VAVA 4GMP3 2HWD2 3B01A 5EZWA 1XU1A 1FV2A 1FI2A 1NE4A 1RHI3 4GH4B 3VKLA 2XWJB 2HEVF 3M8LA 3O0WA 2XL9A 4FQ4A 1PVC1 2YY1A 3KT1A 2BQPA 2HWB3 4HN0A 5K8SA 1VBA2 4KH9A 1LEMA 4RR3B 4AEDC 1EY2A 3INAA 1VAMA 5C33A 1AXYA 1RUH2 4YVWA 1GZ9A 5F6LB 1RUC2 3VZJA 4M01A 2DTYA 3VV1A 3WDXA 4N7IA 3E97A 1J1LA 3DUIA 1F8VA 4QQ2A 2NYYA 1B09A 5B2GB 4MYEA 4AG4A 2XH6A 4CDXC 2XJRA 1YIFA 4YFWA 3KZ4C 5T5JA 4JGYA 5DG2A 3HT2A 2ZJCA 1RHI2 1V6LA 3LGRA 3FX3A 4RQPC 1WCKA 1W6PA 3JB8A 5IT6A 4SLIA 1OMIA 2F6BA 4TZDA 2RS31 4AEDB 4COVA 2Q8OA 1O4TA 4P5HA 2HWB2 2PTMA 2BNNA 2VVEA 3OBRA 1ZZ8A 1N1VA 3IPVA 3WV6A 1EAH3 2SBAA 1D2SA 1MS5A 1UZZA 1AR83 1PO11 2OVUA 1FNYA 4IEYA 2XKPA 3TYJA 2ZKLA 1NQJA 4WM8C 2GDFA 3SH5A 1IS3A 3MIGA 3AZXA 4QU2A 5FO8B 5C4WA 3J9SA 4CDXB 3AP9A 3TN93 1VBC1 1GBGA 4AEMA 2ZTNA 4RR3A 1XYOA 5DZFA 3WOGA 1FV3A 4RQPB 4AFCA 4CYDA 5T3NA 5BXXA 1D0GA 1W6QB 2EXKA 1PZ9A 2D7FA 5L19A 3SNMA 3AKTA 1KDMA 2BYVE 1J3RA 4KL1A 3E6BA 3QLQA 2G9GA 4LLFA 2YV8A 2NQYA 1RVF1 2O8QA 1OQDA 2ZABA 3FFZA 5FO9B 5L73A 2Q5TA 2VQ0A 4SBVA 2D3SA 4HBNA 1AJOA 1EAH2 1DZRA 1AR82 3JD73 3JQXA 3NSTA 4JGZB 1ND2C 3NKTA 4Q4V1 2ZGMA 1H4GA 4BA6A 5GZCA 1YHFA 2PHFA 2NPIA 1NCQC 4I3GA 4YZ1A 3SXWA 4F7ZA 4GULA 4D69A 3BB6A 4MGKE 3TN92 3AZWA 3AJZA 4FPOB 1Z0HA 1LENA 3AKQA 4OI4A 3POWA 2BNMA 4LA2A 3AMQA 2OZ6A 3RPQA 4FXGB 3MZHA 1B35A 2WZR3 3URFA 4HETA 1I1EA 1F31A 2MEV1 3DV8A 4EN9B 2YGMA 4M3CB 5DG1A 3BODA 1ZRDA 4XF0A 5F1RA 1APNA 5KC6A 4IEVA 2ZHKA 2XBO3 3ZXKA 1ND2B 5AFEA 2BFUS 3AX4A 1ZBE3 4CDUA 3JD72 1NCQB 2E53A 3ENRA 4AHZA 4MXWA 4F83A 1V6IA 1O4ZA 5FCCA 5CIRA 4AI3A 4YGCA 1HDKA 2P3JA 5DXDA 4L9BA 3ZXDA 3ZFEB 5DDJ3 4C0HA 1IS5A 5AVAA 3R6SA 2PAKA 4XFFA 1UD1A 1OQEA 3VBFB 2TBVA 1RUI1 4M00A 1DZTA 4ISRA 4KNCA 3ECQA 4LA3A 5T5OA 1W0PA 1C5HA 1REDA 4JGZA 1VIWB 4KWKA 2WZR2 1RUOA 1Y9QA 1VBD3 4YW3A 4GXLA 1UL9A 2JXAA 2ZAHA 3GALA 4M3CE 4R9CA 5BNNA 3HN1A 5BNPC 4QX5A 3KQRA 3RWNA 4COYA 1Y43B 3BOWA 4N7UA 2XBO2 4D7SA 2SLIA 2BNOA 5IK4A 1YFYA 1ZBE2 1GNZA 2PHLA 2R061 1HQLA 3BALA 3NKGA 1C8M1 4HPKA 1CAWB 2DYCA 5CFDC 2HWF3 1XQNA 1HXS1 1A78A 1CN1A 3AYCA 1WMEA 1TNRA 3L2YA 5FO7B 3EO6A 5DDJ2 4KQ7A 1VBE1 3ZN6A 5A32A 1QOTA 1XNCA 4XJ8A 2CWSA 5JZGA 2KXLA 1REFA 2Y0OA 4DFSA 4AEKA 3V0AB 5BNPB 1VBD2 4X8PA 3ZYGA 4BH9A 4H3WA 3VBSB 3ZXJA 5IK5A 3SCGA 3ZFEA 2WC2A 1GZWB 1MS8A 3D8CA 1A3KA 1VRH3 4XJZA 3KGLA 3WZ1A 5CFDB 5KWRA 1GSLA 5T54A 3MPBA 5ACA3 3B00A 4GWNA 3B5LB 2KM2A 2WLPA 1V6KA 3B93A 2HWF2 4HVQA 3SISA 4XMIA 4BYYA 2QUOA 4MSVA 4QM8A 1LULA 4IEZA 4K9SA 1DF0A 1YFXA 1IOAA 1FPN3 3UKTA 3MDPA 1QXRA 4LO8A 4UBGA 3U4XA 2VOVA 3ILNA 1OLQA 3ZSEA 5J37A 4MV2A 1BQPA 5I0UA 1ZZ9A 3ZXGA 3UL2A 3E5QA 5C8CA 5JPMB 1JUHA 4XQDA 5EFUA 4S2HA 1MZEA 1CAWA 3LSEA 4FCAA 4QD2A 4Y22A 2C5DA 2YYOA 3LA3A 2VNGA 4AFDA 2XJQA 4LUMA 1E57A 2JE9A 4WM7C 4ASLA 1MEC1 1TMF1 3RS6A 4HSLA 3T2TA 4NR1A 1WLCA 2BWCA 2DCTA 4AVBA 1VRH2 1S0GA 4L8QA 4AQ2A 4LO4B 2BFUL 1UIJA