3AKQA

Crystal structure of xylanase from trichoderma longibrachiatum
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
190
structure length
190
Chain Sequence
b'ETIQPGTGYNNGYFYSYWNDGHGGVTYTNGPGGQFSVNWSNSGNFVGGKGWQPGTKNKVINFSGSYNPNGNSYLSVYGWSRNPLIEYYIVENFGTYNPSTGATKLGEVTSDGSVYDIYRTQRVNQPSIIGTATFYQYWSVRRNHRSSGSVNTANHFNAWAQQGLTLGTMDYQIVAVEGYFSSGSASITVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords xylanase
publication title Packing Space Expansion of Protein Crystallization Screening with Synthetic Zeolite as a Heteroepitaxic Nucleant
doi rcsb
source organism Trichoderma longibrachiatum
molecule tags Hydrolase
total genus 58
structure length 190
sequence length 190
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2010-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3akqA00
1XNCA 3VHPA 1BVVA 3VZLA 3WXPA 1T6GC 1QH6A 2VULA 1TE1B 2VUJA 4IXLA 3VHOA 3VL9A 4S2HA 1BK1A 2D97A 3RI9A 3MFAA 3B5LB 2JICA 1UU4A 2DCZA 4S2GA 3MFCA 1F5JA 2B45X 3AMQA 3AMNA 3MF6A 2BW8A 1XYPA 3AKSA 4HK8A 4HKOA 3WQ0A 3WY6A 3AKRA 4HK9A 2DCJA 1YNAA 1OA3A 3WP6A 2C1FA 3AMPA 5HXVA 3VZJA 3VLBB 2JEMA 3WX5A 2NQYA 1OLQA 1IGOA 3WR0A 3AKQA 1KS5A 1KS4A 1HV1A 1H4HA 1XXNA 2BWAA 3EXUA 5K9YA 4HKLA 3LGRA 3B7MA 2JENA 2DCKA 3HD8B 3WQ1A 1AXKA 1BCXA 1PVXA 1HIXA 2NLRA 1REDA 1H0BA 1HV0A 1REFA 2D98A 3MF9A 2QZ2A 1OA4A 3ZSEA 1XNDA 3VHNA 3AMHA 1OLRA 3WP3A 1ENXA 3WP5A 1REEA 1XYNA 2BWCA 2VG9A 3AMMA 3VL8A 1NLRA 5EJ3A 2DFCA 4XQ4A 1XNBA 3VZOA 1C5IA 1M4WA 1XYOA 2F6BA 3O7OA 1H8VA 3WP4A 1C5HA 1W2UA 2QZ3A 3AKTA 1XNKA 2DFBA 2BVVA 3M4FA 3VGIA 1H1AA 3WQ7A 3AKPA 2B42B 2B46X 4S2DA 1H4GA 1UU6A 3VZNA 1QH7A 3RI8A 4XPVA 2VGDA 4NPRA 2DCYA 3WT3A 1OA2A 2Z79A 4S2FA 4XQWA 4HKWA 4H7MA 1UKRA 1UU5A 3LB9A 3VZMA 5K7PA 3VZKA 4XQDA
chains in the Genus database with same CATH superfamily
1XNCA 3VHPA 2EXHA 4AI2A 4BIFA 4DEQA 2AZ5A 4RD7A 1Y9GA 5HI0A 2K2SA 1YO8A 2WNVA 3KLSA 4COWA 3FZ3A 2F4PA 2JD9A 1ZM1A 2CGOA 2A6XA 4IXLA 1SDWA 5T52A 4NIIA 5K0UA 4GAZA 2D6OX 3LCPA 1GLHA 4DXSA 5LA1A 3K4AA 5JI7A 3W5MA 5FXWA 4ASKA 5T55A 3RRDA 3ZX7A 2RMU1 2NZ9A 2WNUC 4KGGA 4P00B 4W6XA 3SC7X 1VBE1 5IFTA 1OT5A 2YBKA 3T2PA 2RG4A 3Q8AA 5FY0A 2DTYA 4Y33A 5IVYA 1W6NB 1CAUA 1X9TA 2E7AA 2P37A 3QH7A 3NV1A 5FMOS 2YDEA 4WZFA 5FZKA 3UKNA 5IVFA 4HK9A 3R4UA 2FDGA 2WZR1 3DUIA 2CHHA 2JDZA 4R9CA 4JDNA 4XDQA 1GP5A 3GDBA 3ROUA 4Z2AA 1JN2P 3F95A 3WNNA 1RVF1 3LIGA 5FK7A 1MS3A 2AH2A 2HH9A 5FYSA 1DU3D 4MGTA 1W9WA 1SCSA 3JBG2 5JXHA 1PMJX 4D69A 5L36A 4QPIC 5H9RA 4QX0A 2ZGNA 3ACGA 1MQTB 1XSQA 2RS52 4DOUA 2GNBA 2A7AA 3DPRB 4LBJA 2RDSA 5M0TA 4QX7A 2NLRA 1REDA 3BB6A 4MSVA 4Y1XA 3ZPYA 4RYDA 1BMV1 4Y1ZA 2ZEWA 2ZBJA 2PHFA 2NM1A 3UGGA 4K7JA 1VRH2 4NUBA 1QXRA 1DZQA 2ZMNA 4QB2A 5I8SA 2G9ZA 5I8YA 1O3RA 1WLDA 1RUI1 1JBCA 1OPOA 1HLCA 2JDUA 4FPKA 4AFCA 3ZFGA 1BEV1 1OOPB 3T1MA 3AX4A 3E97A 2OPKA 1ZRIA 3CEWA 5FZ9A 3O7OA 3KV9A 3KZ4C 4K8RB 4RHV3 5F32A 5GJ6A 1ASJ1 4MV2A 3ZSKA 4KGQA 3J4UH 1UZYA 2HBUA 2B5HA 1MEC2 1UIKA 2XR4A 3CIHA 3RMXA 4DFSA 5BUVA 3RZMA 1AHSA 3VHRA 3FLRA 2ZACA 4BXSV 1JYWA 1ULDA 3JB4C 1C8M3 3VDDA 4PBOA 3Q8BA 4V2WA 3EO6A 2ADDA 4META 5F8PA 1T6BX 5FV3A 4FT8A 5B2GB 1RGSA 1WA6X 3ACIA 2DVAA 3I2JA 1ZZCA 1XE8A 1R1A2 1HRV1 1F31A 2E33A 2A6VA 3VZNA 4E27A 5K0UC 1GOHA 3FHQA 1W8OA 4EN8B 3T08A 1LESA 2TEPA 4QKDA 4YZ3A 3T0AA 3H8UA 1W04A 5FYZA 4COUA 3B00A 4XVHA 3V0AB 4JV4A 2GNTA 2OXBA 3SMHA 5JUVA 3RPQA 3M3CA 5J36A 5ABJB 5I8TA 4PQQA 1RUH1 2J1SA 4EN7B 1UU5A 2BZDA 2IVJA 2JD4A 5F3EA 2PHTA 3Q8CA 5IT6A 4AGRA 5GM0A 3GCXA 4BHPA 3BCWA 4MADA 2Z2SB 1Q43A 5FUNA 4A3ZA 2VNGA 1Q8OA 1I5ZA 1WLTA 4MVTA 3WOGA 1H6XA 3AP9A 1W8UA 4I01A 3QOPA 1YHFA 2G1MA 1B35A 1U12A 3AP6A 4CEWB 5JZGB 3MPBA 2Y8KA 3UL2A 4Z07A 3H7JA 2Z42A 3IMNA 1DGWX 1WCKA 3GXUA 2ZGTA 3NV2A 3WHTA 4QXCA 2PLV2 4JQTA 2RMU3 2JE8A 1JZ3A 1DYOA 2VNOA 3ZXDA 1VBE3 2BW8A 3E5UA 2VXRA 1F35A 3AKSA 3F2ZA 5AVAA 3TN91 3RS6A 2DTWA 5DAXA 1N1VA 3K4ZA 1UD1A 2IUWA 1EUUA 2WZR3 1O5LA 4XC9A 2R0FA 4IEWA 4ZONA 3I59A 4W65A 4N9HA 2RM21 2OT7A 4QGNA 4KI5M 4LNVA 2JE7A 2DVGA 2XOMA 2VH9A 1OFSA 1RVF3 4FPFA 5FTTC 2JB8A 4OHWA 4EZ4A 4MHUA 2G9GA 2WN2A 1Y7BA 3JB8A 3LA3A 1GOGA 5F3GA 1H4HA 1UY1A 2LROA 1PNFA 2EAAA 2WZEA 3O14A 4HKLA 5FZOB 2OYZA 1DGWA 4YGCA 1GNYA 2QBXA 2DCKA 2WFPA 1C3HA 4R9DA 5DQ0A 3VDDC 1YQ6A 4F3JA 4OI2A 1OKQA 3OYWA 3WW1A 3ZXLA 1GMMA 2DUPA 2ORZA 2ZHLA 1F2NA 3KT4A 4XIOA 3OEAA 2W87A 4FBFA 4I0WB 4M0NA 4UWDA 4Y5Z0 2D98A 4BA6A 1GWLA 3THDA 1TMF1 4I3GA 4LULA 4JKMA 2BFUL 3CZJA 4UFMA 2RR11 4P9JA 5FP4A 3ZYRA 1CAWA 3O5SA 3P5BA 1RUI3 1HB1A 2VQTA 1YIPA 2BWCA 2MEV2 3D8CA 1BEV3 3J7LA 2VXJA 2VOVA 4RQPC 2VOKA 3VKMA 3ZKUA 5C8CB 1BYHA 3KMHA 1UWWA 3BALA 3SH5A 2Q8DA 1ULPA 3DV8A 1AXYA 1E5HA 4ZY9A 4LBQB 2NPIA 1NY71 3USUA 5BNOC 2YU2A 2YXSA 1VBD1 3SISA 1ASJ3 1W2UA 2VOWA 4QQPA 5FZEA 1AYM1 2QZ3A 1R092 5FZAA 2PAMA 1O3TA 2P3IA 4JGZB 3QLQA 4XFBA 2R16A 4D6QA 5LBFA 5CFCA 4ES8A 1F9KA 3WF4A 2WS92 4XUOA 4LO4B 3W9AA 5JMCA 1RUNA 2Y34A 4FPGA 1CAXB 1OQEA 4CUBA 1QJZA 1HRV3 4GH4B 1B35C 2YFZA 3BN6A 3ZYHA 1GZWB 1H9WA 2C6SA 3PMEA 3VBFB 4ZZ5A 2FMDA 2HWF1 2VR4A 3FN9A 5LZ6A 2WL1A 1AR81 1LENA 1V6KA 1C1FA 3C7HA 3KD4A 1AR71 2VC9A 4IGQA 2JDHA 3GZAA 4XQWA 5FWEA 3WDUA 3AZYA 5DZEA 3LAGA 3MBWA 2X5IA 1US2A 3LB9A 4M4PA 5GLVA 4M01A 5C3OA 5DUUA 2YY1A 3HNMA 1DYPA 3HN1A 2DCTA 1W2TA 1DZTA 5DAVA 1UPIA 1MS8A 1WMFA 2GN7A 1QDOA 2VPVA 4Q4X1 3HWJA 1V9U1 1DHKB 3OCPA 5E6HA 2CGPA 5HBAA 2XUEA 2AR6A 3WUDA 3IWZA 2VULA 3Q8FA 2VUJA 3VHOA 3UK9A 3U07A 1AZDA 2A1XA 5FR3A 2TBVA 1IKQA 4XABA 5FZ3A 2XDVA 5B4NA 1ZNPA 1V00A 2DWRA 1EPZA 1ZZ8A 2XMLA 3OUHA 4N8MA 4FTBA 5JPNB 1RHI2 1RUG1 2Y38A 1NAEA 2D40A 2B45X 5IW0A 5JMOA 4HETA 4XIKA 3OBAA 3LOIA 3SH4A 1NCQA 4GIQA 4EQVA 1H1IA 3PVBB 2WO7A 3LDRA 4GALA 4GKXA 1EAH2 1S0GA 2Y6LA 2W94A 1I1EA 1E5IA 4Q4W1 1E57A 1YNAA 1OA3A 2BOJA 4QXKA 4SBVA 3IPVA 5CKMA 3TN93 3PJQA 1FPN2 1Q8QA 3AMPA 5HXVA 3RYPA 2A6WA 4R52A 3BOWA 3LFIA 4MX3A 3ZVXA 3ZXKA 4X8NA 1JHNA 2RM23 2WNUB 3OUJA 1WBFA 5IAVA 3AKQA 3M1HA 1Y4WA 3P1IA 1E5SA 5JIUA 2VZ1A 3I54A 4FFGA 1COV1 1TME1 2OUHA 3H50A 1V6LA 4EZHA 1LHVA 2PXJA 2ZEXA 3JQXA 2WRAA 3ZPOA 1O4ZA 1RIRA 2JJ6A 5EQUA 4E2SA 1CGPA 5CFCC 1GV9A 4LUKA 1WMEA 1WW7A 2XQRA 1ZA4A 3WV6A 2UWCA 1MS1A 2UWBA 1W2AX 4KWJA 2BERA 4P9YA 4OLLA 5AVPA 5FYVA 1MPXA 1YUDA 2DF7A 2BV4A 4M0HA 4XFIA 5DMYA 3BVCA 1JZ5A 4P5YA 1TMF3 1O5UA 5FCCA 1W0PA 2XVKA 3NJXA 4GMP1 2RR13 1XYNA 5GZFA 1W6NA 4YFWA 3WSOA 4C0HA 1NLRA 3MV01 4KMQA 5IWFA 5DDJ1 2A71A 2B39A 2GU9A 4H7LA 1IG0A 1WLWA 5T5PA 5D1IA 4YZ5A 3I49A 3MGUA 4QD2A 2X5IC 1GOFA 1UCXA 3OJBA 5HPOA 4J1XA 1VBA1 1VBD3 3IMMA 4LQRA 1AYM3 4FFFA 3J8F2 2UURA 3T4HB 4M3CB 2HWC2 2VAUA 3P3PA 2XJUA 3S7EA 1MQTA 1JYCA 2CAVA 1H4GA 1UU6A 2UY9A 4MO3M 3AYCA 3DPRA 3RWNA 3SLIA 4D6RA 4KH9A 3SITA 2QDNA 1WMDA 4Y24A 3H1YA 4CCDA 1CONA 5A3NA 2Q8EA 4FXKB 4LHNA 5FRAA 3GJAA 2WO1A 2RJLA 2HWF3 2Y6FA 4FPHA 4N7UA 1AR83 1NCQC 1ZZBA 2P2KA 2VZ3A 4XOGA 2KA3A 2QE3A 4HSLA 5A1AA 1UKRA 5DPNA 1AR73 5BV6A 1OOPA 5IVBA 1Q56A 1QMJA 2K0GA 5CVRA 1CZSA 2VJXA 5K7PA 4ZS2A 4JKLA 1D2QA 1UNBA 5SV5A 1HB4A 2E7QA 3WNOA 4QX5A 2VMDA 1T6GC 4XBQA 1DG6A 2W47A 3NJZA 4HVOA 4Q4X3 1PMHX 1V9U3 1UYPA 4XJ8A 1APNA 3VD7A 3POGA 1QOOA 2GH8A 3CLPA 3N4MA 2JX9A 5E89A 1CR7A 4QKBA 5I0TA 2XGXA 3E1F1 3ASIA 4QWNA 2J7MA 1YXWA 1W0OA 3M7AA 3PUIA 2YG0A 3MLLA 4IV1C 1RUG3 1I9RA 1Z7S1 2I45A 2WFF1 2HKXA 1DLLA 4IEVA 2VNRA 1L7QA 5EHDA 1UMHA 1VAVA 3NNFA 4MXVA 1ZRCA 2WT1A 3I2FA 4AHZA 4XF3A 2KD7A 4O7XA 4OUMA 4DY3A 5T5JA 3KSCA 2GNMA 3V0AA 4Q4V2 1W2NA 3SCHA 4Q4W3 3ACFA 2CDOA 3WP6A 1AR62 1CWPA 3URFA 1DGLA 1QXPA 5ABJA 2EIEA 4BXFA 3AB0A 1VALA 1W9SA 3JUUA 3KQRA 4QHBA 4QKNA 3WX5A 1O3QA 1OURA 2P1BA 3N35A 4LHSA 1J83A 1S2EA 2VUDA 3DXTA 2ZX1A 4UFLA 3ZXEA 5G04L 3MUZ1 2CNAA 4YM3A 1OH3A 2XL7A 5JOWA 1AXZA 1RMU2 1F8VA 2VQUA 2XLGA 3SNMA 5FXXA 1A34A 1COV3 3RZZA 1YQCA 1TME3 3KB5A 2JENA 5LK5A 1DQ2A 1WUVA 2PN5A 3FL7A 3O0VA 4OI1A 3T4VA 2CL2A 4KBZA 4FPEA 4Q1PA 3RQ0A 3LPGA 1BCXA 1PVXA 2FBEA 5IK7A 1C57A 3THTA 5HCFA 2VZSA 1DZRA 1MQTC 4JCKA 4CEWA 5JZGA 4YFZA 5FYIA 5LEJA 4Q4Y2 3POYA 5FP8A 3PLQA 4XAAA 1DQ4A 4LBMA 4M3CF 3JD72 1IS3A 4BK4A 4EROA 3AMHA 4JVAA 1UOJA 1OQ1A 1YJKA 2BUKA 2D3PA 5C7GA 1REEA 2X53S 3D5OA 2WQ4A 2JE9A 2XVLA 2IVIB 4GMP3 4HT1T 4UT5A 2QQPA 4G9SB 2I74A 2TUNA 4NR1A 4AEKA 2XPJA 4FTSA 1C5IA 1QJU1 4TYSA 4UFIA 2WR9A 5DDJ3 4D8MA 1OOPC 2XBO1 1GWMA 3OGJA 2JECA 1PZ7A 1U5XA 3MIBA 4N43C 1UYXA 3IBMA 4PJYA 4XHBA 4YGBA 5J98B 1NLQA 2QNKA 3ST7A 3ZM8A 4AI3A 1VBA3 5FXVA 1O7FA 3WQ7A 1HRI3 5CG8A 3DECA 1LCLA 5D8AC 3W21A 5FMCA 3BPSA 4RQPB 3TOJA 1ZVFA 1CQ9A 4XZPA 5FZOA 3ZYGA 1S0CA 4J25A 2R0HA 1UZZA 2FCUA 2HWE1 1K5MC 2R1DA 4XF1A 3GCWA 5BNOB 1PZ8A 1XJAA 1BBT1 2D93A 5KXCA 2WWUA 4QDQA 1QQP1 2X8KA 4I30A 3WT3A 3OEBA 1WCQA 1FOD2 3LA7A 1AR91 4NO4A 1Y3TA 1POQA 2Z79A 3EBRA 4QQOA 5LRRA 2VCMA 3SKVA 4FAGA 3J7HA 3ILNA 2DBNA 5IYYA 2ZPXA 4DNYA 4AE2A 3GALA 3HJRA 5C5UA 1VE0A 2A6ZA 1QDCA 1NXD1 1RUE1 3MEPA 5FZ4A 4C91A 4A41A 5C8CA 4Q26A 5FY5A 4K20A 4XQDA 2QQKA 4WZCA 5E8AA 1NE4A 4IE6A 1UX7A 4LBQA 4LKDA 1UMIA 2GH2A 1H1MA 2RJ2A 2J1TA 4WVWA 3R4SA 5FY1A 1ODNA 2P17A 3IIAA 3VBFA 4CP0A 1EP0A 2WSVA 1W05A 1SACA 5A3UA 5A6ZA 4JGZA 1UY2A 1KDMA 1ZBA1 5FY8A 1HX6A 5LBEA 1ZZ9A 1US3A 1XNTA 5B4XA 4XCAA 5LCWL 3BODA 1O4TA 1D4VB 3FHIB 4LHKA 4ZHNA 1CAXA 1AUYA 2ZEZA 5C33A 3S57A 4GH4A 3MDPA 4KWLA 2A6YA 2WAOA 4CEWC 4FVVA 5JZGC 1Z7S3 2WFF3 1GZWA 2D6KA 1ZX5A 1W3XA 2W1SA 1VJ2A 2IFRA 5J09A 3VBRB 2QQLA 1W28A 4HXCA 4P9LA 2EA7A 3AL6A 4R9AA 1PX3A 5C3SA 5FUIA 3HT2A 1P8JA 1PIV1 3VZJA 5FLHA 3T3YA 2WAAA 2ZTNA 4AQTA 4HANA 5FLIA 1GZTA 2AENA 1RC6A 2WZPP 3ZN4A 3JCIA 1AJKA 3UGFA 1S1AA 2BBVA 4OYUA 1XXNA 2BDRA 3WCRA 5JDBA 4ATFA 3T2QA 3B7MA 4YVSC 5T50A 3OGGA 4NHXA 4NOTA 2GAUA 3KQ4B 5DUWA 2ZHNA 1WCSA 2W52A 4JDOA 3FX3A 3RSJA 1H0BA 3PJYA 2GC3A 5F5CA 4E4SA 3ZN6B 2IC1A 1B09A 1TG7A 4AZZA 4YLZA 3SXWA 3UNPA 1W39A 3ACLA 1HQNA 4IEQA 5ACA2 2XJPA 4BQXA 4L11A 1OMIA 2ZGQA 2EXKA 3PDQA 4QMAA 5FLJA 4Q27A 4NIAA 3ZDVA 3OTFA 4DQAA 4G3YC 2B8MA 5LBCA 3VZOA 4CVUA 1WCDJ 1EV11 2D43A 3HR9A 4CDXB 3ZMOA 1JOJA 1S4CA 5JSOA 3I2OA 1QJU3 3R0RA 4YGEA 2XBO3 3O1UA 5FUPA 2EIGA 3VGIA 2WNUA 2PYTA 2VE1A 1G8WA 5AC91 3RVHA 5JVVA 1LODA 1WKYA 4QGMA 2BEOA 5DUXA 1HXS1 3VBFC 3MW4A 4XE9A 5EYXA 4XFHA 3N7LA 1ULOA 3PHMA 4O65A 3OBRA 4RA0A 4YG0A 4BPZA 2J42A 2VMIA 1NZCA 1R082 1RUF2 5CKQA 5APAA 3RI8A 5CFDC 3HOBA 2HWE3 3WG4A 5CKNA 4XPVA 3ZO0B 4LKSA 1POV1 1BBT3 2OUJA 1HW5A 3NV4A 4QU2A 3UJOA 3RZGA 1X36A 1QQP3 3ZFEC 4XYXA 3U11A 4Q8KA 1GSLA 1AR93 3N9NA 3QBQA 2BBAA 4FXGB 2QJVA 2W92A 1QOSA 5FFOC 5FMOL 1OLME 3MLJA 2P6HA 4BIOA 4F83A 1ULGA 4IE4A 1VRBA 1ZBE1 2DVDA 1RUE3 2UY8A 3AYAA 3T1LA 1AYN1 3S7IA 5I0DA 3OGRA 3O1VA 4Y20B 4LBQD 3ETQA 1LNSA 5IVEA 1VBE2 3PNAA 5AFEA 3HQXA 1VBB1 5FYUA 2ZEYA 3N7KA 1SLAA 1J3RA 5T54A 1MVQA 4GZ9A 4NIHA 1ZBA3 4YW1A 3WW4A 3TB0A 4TWTA 5I0UA 3WF0A 2HWD2 2ZKNA 4AVTA 2WZR2 3WF2A 2PAKA 2O1QA 2P3YA 3B02A 4RFT0 1HQWA 3W59A 2V72A 3V65A 3ZYFA 2XL9A 2A70A 2GC0A 3CBNA 3POWA 1LOAA 4W4ZA 1N1TA 4HK8A 3IT8A 2XJQA 3AYEA 3WW3A 2WBKA 4GWMA 2KR2A 2Y6HA 3CNAA 3UKTA 3AP7A 2VD7A 3VLBB 3OUIA 1PIV3 1H9PA 3FJSA 4D7SA 3POFA 2W39A 4IV1B 2PHRA 4AW7A 1N3PA 1UKGA 1QJX2 3L2HA 4IEXA 4LA3A 4Y1UA 4C0BA 1BMV2 3S5QA 3IB3A 2QQUA 4ZU4A 1LU1A 2JDKA 2Q1FA 4CYDA 4ZXKA 4CCKA 3T2TA 2TNFA 3B9CA 3K3OA 5DAPA 2WSUA 1SBDA 4NRQA 1IQAA 3O12A 2VNVA 4XBLA 1BEV2 3LDBA 4PT6A 4CUAA 4TZDA 3FMGA 2VTXJ 3IDEA 1BLZA 4OFGA 1DBNA 3KHBA 4OI4A 3H1WA 2EF6A 2D6NA 5DG1A 4JHTA 4Y4RA 3WP5A 2RJKA 4OMCA 1SDDB 1ULEA 2V73A 5ANQA 2A3WA 5LWBA 3POSA 2YUEA 4ZXEA 1Z0HA 2UU8A 4U36A 1YEWA 5A6XA 4DPNA 1GZCA 4L0PA 2QQNA 1V70A 3H8RA 1EV13 2DUQA 4FFHA 1QF3A 2X09A 1XNKA 2FCTA 1V6JA 2XQXA 4UBHA 5K8SA 1HRV2 1EYBA 1S0BA 2A75A 3LSDA 5I0RA 2DU0A 2PHXA 3K3NA 3POEA 4RN5A 4LIUA 4X6RB 3N9MA 5AC93 2BOIA 1DQ1A 3E6DA 4XUQA 3I7DA 4S2DA 2HWB1 3DGTA 4XTMA 1NOVA 1HXS3 1UOBA 4YW6A 4YW5A 1VBC1 3VDBA 3PVEA 5HXMA 1S0FA 3GF6A 1MZ6A 1PGW2 2ZAAA 2WABA 1UL9A 5HV4A 4LK7A 4CCOA 4TTGA 2WLQA 4B29A 4N43B 3RGBA 4NVPA 2BTVC 4HFSA 4YW3A 5FZ6A 1POV3 2Q4SA 2YYOA 4K8FA 1SLBA 3D82A 1DQ5A 2AACA 4LBOA 1UOFA 3AFKA 2RDNA 3I2IA 5D8AB 5EFUA 3R05A 4HKWA 4K40A 4NRPA 2D7FA 1VIWB 1RTVA 5ISLA 4XTPA 4ASMB 1RJ7A 3PVNA 4A3XA 1MS4A 2R062 4AR2A 1K5MB 3OOXA 1D2SA 4P02B 3W58A 3U10A 1ZBE3 5F2SA 3SKJE 4BOWA 5I93A 3LA2A 1FI2A 2LM3A 2BGCA 1LEDA 3I3QA 1AYN3 1OSGA 3KCYA 3VBSB 5KWRA 2XH6A 1G9DA 1G86A 1LOEA 3KF5A 3KV6A 2PHDA 3M3QA 3ZOIA 2ZHKA 3DEMA 3VL9A 4A6OA 1WW5A 1JOPA 1WWYA 4DIQA 5FZ0A 3T09A 2WA4A 2ZGMA 4NE9A 1UYYA 1UU4A 1VBB3 5H9PA 1NZIA 4NAMA 4RQPA 3MW2A 1WW4A 3AMQA 3B9IA 1UXXX 3JU9A 4AQ2A 3H9AA 2ETEA 1AL21 4IEOA 2VU9A 2IXCA 3ECQA 2V4VA 3JBG1 4GA9A 4P9XA 4PBPA 3LEIA 4RS5C 5BNOA 3GM8A 4IEUA 2RM22 1Y43B 2HYKA 1KEXA 2E7TA 4FOWA 5DUVA 1XBFA 1JYXA 5GZCA 2VVFA 1I3HA 2E32A 2C1FA 1YFXA 4L99A 5FKBA 1ZRDA 1IGOA 1IPSA 2A3YA 2FDJA 2QTWB 4J1WA 4KNCA 2K9ZA 1QEXA 4LR4A 4DY5A 3E6BA 5K9YA 3VKFC 3QCWA 2Q30A 1XU2A 2VOTA 1J3QA 1NE6A 1TMF2 1CZTA 1OD5A 4MGYE 4AFBA 5DAWA 4LUMA 1CAVB 2RR12 1NX9A 4X8PA 4AVAA 1REFA 1W03A 4QM8A 3J7NA 3H3ZA 5BNPC 4XURA 2DDUA 3R6SA 1SBEA 2BU9A 4QPGB 4YM2A 3ZSEA 2H6CA 1XNDA 4JZRA 3WDYA 1OF4A 4EN0A 1DYKA 4LJHA 1RJ8A 1VBD2 4X6QB 3AMMA 4YVSB 4AG4A 5C4WC 1LGCA 2IXJA 1R1A1 2AREA 3SCGA 2D3RA 2QQIA 5LATA 2C9KA 3IDAA 3VBRA 5JR2A 4BQ3A 1RL3A 3PVOA 1JU3A 4B4QA 2VW2A 2FDIA 5HCHA 3NKGA 3INAA 4CDQB 4IEZA 4YM1A 4CEYB 1UZWA 3M4FA 2CYFA 4LE4A 2D6LX 1ENSA 2ES3A 4MGIE 3DL3A 4NAOA 1Z78A 1OKOA 4FPYA 1SMVA 4BMBA 3KV4A 4FAHA 2HWF2 4CCJA 4GJYA 2HWB3 1AR82 4B1MA 3ZIWA 1CIYA 3O0WA 1VBC3 4XFCA 1FNZA 1W3VA 5DXDA 3TRSB 3WDXA 2ZX3A 3MLKA 4L97A 3ZYIB 2NMOA 3DCQA 4IESA 2QDRA 2VZOA 1OA2A 3HBKA 4EWEA 3ZN6A 1YCIA 3FBMA 3ZYJB 1LOGA 2WKKA 1YQ5A 4M4RA 3BI3A 3WINE 1H2LA 4QT6A 4Q4X2 2WYSA 1V9U2 2VMCA 3VD3A 3C7FA 5J37A 5A32B 1XPWA 4K3UA 1J3PA 1ND3B 2PLV1 4HZFA 4PI0A 5CFDB 5JXGA 1HDKA 3O1MA 1AX2A 4IGPA 4CDXA 4QQLA 3UT0A 3CJXA 3RZLA 3I3DA 4OULA 2VZRA 1RUG2 4PF1A 3BYWA 3ZFEB 2VMHA 3ZIXA 2LALA 1FNYA 1J84A 2P34A 1DF0A 4P9IA 1UY3A 4J6GA 4PQ9A 5IJRA 1F4HA 2LW8A 5GLUA 3ZR5A 4DXZA 5C3RA 5TSWA 1PGL2 4COYA 2YMZA 1UOGA 3B93A 3S5AA 1DDLA 5EZWA 5FBJA 1JHJA 2WC2A 2GN3A 1KGYA 3TEXA 1ZZ7A 2Y26A 4RFRB 2CU5A 4XACA 5F9TA 1W90A 1TEIA 4EN6B 5FOJB 1AL23 3IDCB 3JBG3 1SLTA 4AHXA 1NCRB 4HKOA 1TNFA 1RUC1 3AKRA 1RUH3 2P6CA 3BU7A 5FYYA 1JZ8A 5LB6A 3ZXJA 1GKBA 4JGYB 4YW7A 4DUXA 1O59A 3WG2A 2YBPA 4EJRA 2E63A 3KGLA 1COV2 2JEMA 4NHMA 1TME2 1AVBA 1XOYA 4H3WA 1NQJA 2MNGA 3SEEA 3VBRC 3MW3A 1UIJA 4Z1VA 1H8TC 1W6QB 1KFXL 2EAKA 4ZZ8A 3NAPC 2KXLA 4WBBA 4BLJA 4FOQA 1JUHA 4Y20A 2UYAA 3L9JT 1JXNA 5EP9A 3WQ1A 1UYZA 4FP2A 1HIXA 3WNKA 3ELNA 4HONA 4IE7A 3VN4A 1IPJA 2OW4A 3LFMA 1RXFA 1RUD1 3CKHA 2GP3A 4GQ7A 3H8XA 2GZWA 4I0BA 5FP9A 2HBTA 4AAPA 3AZZA 2XXZA 2NYYA 1JOBA 4B4PA 2JG8C 2WS91 4CXYA 1OVPA 1N3OA 5FZBA 1VBA2 4B1LA 1W8WA 1HRI2 1R1A3 2AEZA 4QX8A 3K2OA 2XKPA 3U1XA 4NIGA 2RS31 4K1YA 3VD4A 1JW6A 1VR3A 1YFWA 3CL1A 4CP2A 3O1SA 4F8AA 5KXEA 1QJY1 4IV1A 1C28A 4CDXC 4JDMA 2B42B 3G7DA 3CU7A 5IVJA 2VZPA 4XUTA 1D4M1 2ZXQA 4CDWC 4I3PA 3RG0A 4AFMA 4HVQA 3O1OA 3KT7A 4FPCA 1UF2C 3KWVA 4XF4A 3PMSA 4BZ4A 5LRSA 5C9AB 3H7YA 4XJZA 2ILMA 4WVMB 4CP1A 3R4DB 4EYUA 4ZKTB 2F4LA 1W9YA 2YV8A 1W9FA 1GNZA 2LTNA 2FD8A 3ES4A 4YWAA 4A7YA 3VZKA 2YPJA 5JSPA 2AYHA 5GZGA 1SFYA 3FE5A 3BKZA 2PLV3 3HVDA 3VZLA 3VBOC 4DXTA 5KBFA 2VW0A 3ON7A 4XFFA 4E4HA 1PMIA 4ORFA 1Z7S2 2WFF2 1FPN1 4YPJA 2EXJA 1LECA 4NIDA 1ULCA 1W99A 1A8DA 2RV9A 5FOBB 3E5QA 1K45A 2J1UA 4I02A 1F4AA 5FO7B 1N1YA 4BQ5A 4E4DX 1S0EA 3FHAA 2HYXA 4A42A 4JTNA 4D0QA 2JIGA 1C1LA 4BM8A 2R041 3HQUA 2C4XA 4JC1A 1LGNA 4DUWA 4AHYA 4BWOA 4N43A 3QD6A 5E16A 4W6WA 1CESA 1XRUA 1RUC3 4FTEA 1Y9QA 2CDPA 5FPUA 4CU6A 2AGSA 3VV1A 5CBLA 4XW3A 5D8AA 2C24A 5I0SA 4YSFA 4RGKA 3HPNA 4KBBA 4BQYA 3WR0A 4QGLA 1K5MA 1RUJ1 4RS5B 4Y5TA 3BIEA 3K46A 4LK6A 4LOTA 3OBZA 2I2SA 1CPMA 1JU4A 2EALA 3LPFA 3VBSA 3WNXA 1SBFA 2FDHA 2Z4FA 1G7YA 1XE0A 1UN1A 2R7EB 5IK5A 4AHWA 2XLFA 4UW6A 1DIWA 3WG1A 2ZGRA 1QXJA 2ZX4A 4CTEA 2CTVA 4B8EA 1UPSA 1S0JA 3ZXFA 1VB2A 2EXIA 5CG9A 3WNMA 1RUD3 1QJU2 4BQWA 5A70A 1GQPA 3X29B 3ZYBA 3AC0A 2W2IA 2HWC1 3UGHA 3GYDA 4GB31 1IZ3A 2WS93 4XQ4A 3USSA 1O3SA 5A3TA 5LW9A 3GBGA 2W5FA 4RGAA 4AEMA 4MHRA 1H8VA 3NNGA 1IS5A 1UO9A 2WYFA 1JYVA 5BNPB 1LKNA 5L9VA 1FV3A 3MV11 2X05A 2RS33 3V0BB 4WVVA 1RXGA 5H9QA 2HWE2 1GQGA 5CYYA 3UJQA 4CA9A 2Q1MA 2XJRA 1QJY3 4BB3A 2R071 1R64A 3BGAA 1BBT2 4L9BA 5A1LA 2FZ1A 2G4IA 5C4WB 2X29A 1SQ4A 2DURA 1QQP2 3HIFA 2FMYA 3OY8B 4WV8A 5FWJA 2GNDA 4E4ZA 2SBAA 1D4M3 3FBYA 4XJWA 4OQ8A 2YROA 5FP3A 1PVC2 1CAVA 1L7RA 3LF7A 3UKVA 3E6CC 1XC6A 1S55A 4O9GA 3N9LA 2W95A 1QY4A 4W6YA 4QPGA 2JIJA 5LY2A 3THCA 1JTZX 4ISQA 5AFBA 4XAEA 1IOAA 1PO11 4KG8A 2ZJCA 4IEPA 4YVSA 4CU8A 3ZYPA 4RSUA 1CX1A 4LXLA 4NPMA 2ZHMA 1S0IA 5GKAC 1ZBA2 4A7KA 2Y6KA 3WXPA 5DAQA 3MIGA 1OUSA 3DKQA 4CDQA 2XWJB 3NJYA 4MG2A 4CEYA 4HBNA 5J7MA 1JS9A 1OQDA 1TE1B 5FO9B 1GNHA 1JZ4A 5FY7A 1AR61 4HMZA 3MI8A 5A6QA 1IQDC 2PHWA 5DABA 4KU7A 1FPN3 4XETA 4LHLA 1A8MA 2OA2A 3VBSC 2GSYA 1LU2A 1FMD1 4XZUG 2W68A 4RR3C 4DEVA 1HKDA 1URXA 2DUOA 3V56A 4NRMA 1NQDA 1J1TA 1PIV2 5L7OC 4TLGA 3AYDA 1YYNA 4QQHA 3OPWA 1RMU1 3OF1A 3WQ0A 5CAZA 2R043 3POIA 4MUVA 4YG3A 4UW4A 2DCJA 5BYNA 2EIBA 5K4LA 2ARCA 1J1LA 3CHXA 2QQWA 4H14A 4P9WA 1JYTA 3D0SA 3WDVA 1XNAA 3KCXA 4QDSA 4N7IA 1QIQA 5IAXA 2VQ0A 4Q4Y1 3OBTA 2OZJA 2WT0A 3AVSA 4LEJA 4PDWB 4QB1A 4AWDA 5A32A 2H0BA 1KQRA 1WD3A 1ND3A 1S0DA 4MGSA 5GZDA 5CFDA 3RJRA 4A4AA 2Y60A 1VMFA 4GKYA 1PGSA 1RUJ3 1JODA 2BWAA 1QWRA 2QFEA 3EXUA 4CCNA 3NWKA 3HNBM 2K46A 2OVUA 4BH9A 3ZFEA 4ASLA 1Q3EA 5JPMB 3ALQA 5GLZA 1D0GA 4Z82A 5GZEA 2ZMKA 3DYMA 4EN9B 1H2MA 1O91A 2WN3A 1EY2A 4XUPA 4C1WA 5CA6A 2BNMA 2WQ8A 5FYTA 1H8TB 1SFNA 2YC4A 2W1QA 2GC2A 3BTAA 3NAPB 3T30A 1OLRA 1E5RA 1PK6B 1HB3A 5FPXA 3APBA 1U5ZA 3OB8A 2VUAA 3FFQA 5JCTA 2E6VA 1NCRA 4G4FA 2Q5TA 2HWC3 4QPGC 5EJ3A 2RVAA 3HAGA 2Y6GA 3D0JA 5AC92 4GB33 4OUEA 1W2OA 3VD9A 4JGYA 3AL5A 5BNNC 1HXS2 3W5NA 1H30A 2XONA 4H2AA 3B01A 1FOD1 2OIIA 4N53C 5LA2A 2FCVA 4CU7A 1W6QA 3NNLA 1RB8G 3C7OA 2IWGB 2JG8B 3C8XA 5F39A 2R073 4CDQC 5EIYB 4CEYC 1UQXA 4RHV2 4LORA 5CEHA 3NQHA 4AEDC 2W46A 1ENQA 2PHLA 4LOSA 1SG3A 4QX1A 3WHUA 3ZFFB 5CU1A 1PHMA 1LOCA 1STMA 1WBLA 3PIJA 4QHOA 4UF0B 5A6YA 3BU0A 3IDBB 1W6MB 4CE8A 2XVGA 1KRIA 2ERFA 3JXSA 1C8M2 5F1RA 1RITA 5KHIA 2PA7A 1DCSA 5A33B 5IFPA 3SEPA 5A7QA 4WM8C 1W0NA 1DGRN 3AVRA 4QX3A 2JKXA 1AYN2 2CWSA 3ETPA 2CV6A 2PELA 2YB7A 3HNYM 4NHYA 2HEVF 4AVSA 2VTFA 4LLOA 2VZQA 1PO13 3AZXA 3FC0A 4CDWB 2ZX0A 3NV3A 1GICA 5C3QA 5T3NA 5FO8B 5FP7A 3DF0A 3CJIB 3DKWA 3NNMA 1R1ZA 1X8EA 3IN9A 4E9KA 5J1XA 4FPJA 4IW3A 3DN7A 1N3QA 1ND3C 4NHLA 4UW5A 2O8OA 4NROA 4V2VA 1XQNA 4WM7B 1K3IA 3MFAA 1UXZA 2WO2A 3VBUB 1AR63 2JICA 4QM9A 3B69A 2ZGUA 3MHZA 4JTOA 1C4RA 2C9AA 2HEWF 3N9QA 1Y9MA 3AMNA 1GU3A 5A3OA 1FMD3 3SCFA 5JOYA 3VKOA 1QKQA 4XXPA 4K9SA 3TEWA 1MZEA 2V4AA 4LITA 4RGGA 4CCLA 4NWVA 1GP4A 5FMBA 4QXHA 4Q29A 3VBOB 2WINB 1RMU3 4AQSA 2P3JA 3D6EA 3GHNA 4DRVA 2DV9A 2BNOA 4LTAA 4XJAA 1WW6A 1EUTA 5C9AA 1CN1A 5F37A 5KXBA 1NCRC 4WVMA 2YGMA 2NQYA 3GGLA 1V6MA 2VBDA 2RMU2 5LASA 4HOOA 3FLTA 2ZGPA 5C3PA 1H2NA 4GWIA 4Q4Y3 3K48A 4JGYC 1KS5A 1KS4A 1TZOA 5ACA1 3KHCA 1NA1B 2R49A 4OHXA 5C8WA 1RINA 3WG3A 3A4UA 2YFUA 4Q0UA 4AI8A 1NKGA 1L3JA 3CMGA 1N47A 3VBHB 5J3UA 2CGNA 2A5ZA 5LY1A 1OHFA 2AEYA 3EJKA 1ND2B 4FOVA 4AYUA 2OX0A 4Z8BA 4FP3A 4P14A 3RNSA 4O61A 1RVF2 1YI9A 3M3IA 1DQ6A 4AI0A 2BP6A 4HN0A 3TNQA 4AI1A 4B4RA 3VHNA 1KFUL 1BVP1 1QNWA 1W9TA 1ENXA 3N36A 2BVBA 3AP5A 3IAQA 5JR7B 1IPKA 1W8ZA 3ILFA 2VG9A 4CCMA 4YZ2A 3K77A 1H6YA 5F3CA 4LLFA 3VDCA 4DUVA 4PLOA 1R081 1DP0A 1PO21 1OH4A 1RUF1 2O0OA 4OZXA 3FWEA 2VCAA 2F17A 4BJ0A 4XILA 2ATFA 1FT9A 1UY4A 2HWB2 2IFWA 2JWPA 2NMNA 4GWNA 4L2NA 3CF6E 5EJ1B 1MVEA 4LE3A 2JG9C 3S6PA 4V1PA 3GBFA 1FOD3 4XMIA 1LHUA 1RUI2 2FQPA 2IXLA 1K12A 4OQ9A 4RS5A 4JRLA 1G6NA 4I0AA 2Y64A 1BZWA 3PURA 4Q0VA 4XJ9A 2L9LA 2Z69A 4F7ZA 4CPBA 3WF1A 4BCUA 3PU8A 4NMIA 5FPVA 3AXDA 3ZMNA 4YGDA 3TEZA 2WLPA 1OBNA 3ENRA 1ASJ2 3M70A 3NMBA 5FYBA 2DYCA 3KVBA 3HQRA 2VGDA 2X10A 3VB9A 4NPRA 1W6PB 1KJRA 2RS11 1G9FA 2VMEA 3AFGA 2C26A 3PU3A 5D21A 5FZCA 2VZUA 5F3IA 3S0MA 5F6KA 4PLMA 3O1TA 4AI9A 2HWD1 5F5IA 3LIHA 2ADEA 2UWAA 4W8JA 5C9AC 1V6OA 2YZ4A 2LUWA 4PIYA 4QX2A 3CQOA 4DINB 5BNPA 1BQPA 2PTMA 4CSWA 3JZVA 3CDZB 1KD7A 5CISA 1ACCA 1MZFA 3BUCA 5FZGA 5LBBA 3V0BA 3KVAA 2J1EA 1T2XA 1AL22 4E8DA 5C5TA 1GQHA 1AL0G 1RUH2 4BDVB 4XDPA 1NXMA 2DBIA 3AJZA 5C4WA 3VKLA 4AVVA 3MFCA 2WNEA 4LKEA 1A78A 2YU1A 3OY8A 4ET7A 3IZOA 2E26A 1QJX1 4P08A 4AVCA 1XYPA 3GBWA 3IIIA 4D94A 4FPOB 1U0AA 2BJSA 2Q0AA 5A7WB 4IGOA 1LHNA 4LT5A 4IV3C 3UESA 1XSRA 3M2MA 5FDBA 2IZWA 4BK5A 1KITA 1PM4A 1G9AA 1FAYA 5FK8A 2D44A 3E5XA 3T2OA 4UFHA 5LA9A 4RR3B 2D3SA 4BISA 1CZVA 4GMP0 4QHZA 4INDA 2E53A 4CDUB 1GANA 4HSJA 3NO8A 4U2AA 3AJYA 3NJVA 4PLNA 4DRRA 1VLNA 3ACHA 4M3CE 5L7OB 3MZHA 2ZA9A 5ACA3 4AFAA 4DXRA 4QPYA 2OZ6A 1YQ8A 3TN92 3NNJA 4Y4YA 2KM2A 2VM9A 3QH6A 3WEZA 2GDFA 4LO8A 2VECA 5J48A 3A22A 1AXKA 1AJOA 1VMJA 1GYKA 2BGPA 2OQ6A 4OI0A 4UW3A 1YFYA 5FXZA 5L9RA 5A80A 2RS51 3J9SA 4AFDA 5A1FA 5F7UA 2WNVC 1N1SA 1Q8VA 2XG3A 3LEMA 4PF5A 3VDAA 1G9CA 1K42A 3VKNA 1MR5A 3THPA 3AK0A 4AGGA 3H3UA 4YYOA 3RDIA 4OHVA 1PNGA 3A0NA 3LZZA 3PTYA 4M00A 4OCTA 1VRH1 4OZOA 3KCCA 4MXWB 3D4KA 3ABZA 4E2GA 2E51A 2WZ8A 5C6CA 1ZREA 5G05L 1D0HA 1NLSA 1PGW1 5DG2A 1JZ7A 2XKOA 1NYWA 1R083 1PO23 1RUF3 3H1MA 3AKTA 4E2QA 3M3EA 3VD5A 4PDWA 5HCAA 1X50A 1GUIA 2Q8CA 3PUQA 4NJ4A 1FX5A 1MEC1 1UMZA 3PL0A 5BXXA 3FUOA 4Y22B 3S30A 1YC61 2R061 5JWPA 4XXAA 1QH7A 4CPBD 1IHMA 1NY72 2N7GA 4O9EA 3WDTA 1QJFA 3EYPA 5BNNB 3ZXGA 5FMDA 5DZGA 4D6SA 1AYM2 2CSGA 1W6OB 2DCYA 5JAXA 4GXLA 4AQ6A 4EV0A 4N53B 2RS13 1ULFA 3N7JA 1GWKA 2GP5A 1H8TA 5KC6A 1V6IA 5LA0A 3NAPA 2O8QA 1HB2A 1CPNA 1PK6A 4HPKB 1W06A 3WVJA 4DMIA 5JIAA 3BPZA 3LDKA 2VBPA 4TN7A 2CWMA 4AEDB 1WD4A 1V0AA 4TLFA 2HWD3 4HN1A 3PUAA 4SLIA 2D5HA 3A23A 4JX0A 3ZFGC 4EWAA 3ATGA 1M06G 1YLLA 3OPZA 3EQEA 2HLEA 2FHRA 1OUXA 4WM8B 5A3WA 1AR72 3T0DA 2D97A 2QQVA 3NSTA 5A7NA 3JQWA 4MOAA 3ZN5A 2ENRA 4PI2A 2G9FA 3U14A 2JB4A 2JG8A 3ILRA 1RUC2 4S2GA 2RDRA 4EWDA 1AF9A 1F5JA 3O1RA 4LO5B 5JXJA 2JDPA 5T5OA 2R32A 4P9GA 4YG6A 3ZFFA 1ZRFA 1ST8A 1LAJA 1BKZA 3ES1A 3GZEA 4UF0A 1QJX3 2VTXA 4AGVA 2VOXA 1W6MA 5T5LA 2P3KA 3BTYA 1UW8A 2QKDA 1TNRA 5A7PA 3POBA 1WGPA 4Z92B 3RZKA 3ME2A 1RYYA 5A33A 3H42B 2W9XA 4URTA 2VO5A 3LD8A 2GMPA 3NW4A 1DFQA 4OHZA 4COVA 3AZWA 1DLCA 3IKWA 3I2HA 5H9SA 1OLQA 1YI7A 5D2AA 3I3EA 4CDWA 5EPAA 5FZDA 4XHXA 4MGQA 2P5BA 1F15A 1JI6A 4UI9L 4BQ4A 1X33A 3Q8EA 3CJIA 1GP6A 2WO3A 2EIDA 3GZTB 5FPZA 5IATA 3H8OA 4PDWC 4Q4W2 5EJZB 1SPPB 1RUD2 1TVGA 5FQ0B 3NL1A 2VCBA 5JXIA 4YRDA 1S2BA 4AL9A 4ARXA 1QNYA 1LULA 2A3XA 4WM7A 3LE0A 4ATEA 3VBUA 2QZ2A 2WA3A 5JOXA 2QQOA 1D7PM 2ARXA 5FZHA 4DO0A 2RS53 1HQLA 4QU1A 3WLUA 4BQ2A 1J59A 4Y26A 4MZUA 1X9PA 1LRHA 4PIZA 1OFNA 3CZUA 1CJPA 2XJSA 3HT1A 3ITQA 3KF3A 2RS32 2UYBA 2IXHA 2O14A 5FYMA 3T0BA 1HN1A 4XMAA 1X7NA 4A45A 4FI9A 3VBOA 4P5HA 2VUCA 1QJY2 2GMEA 1VRH3 1XYOA 3DYPA 3WP4A 4C90A 2BGOA 3OPTA 1PK6C 3LSEA 4GJZA 1BHGA 4BLIA 4XFAA 4UFKA 3SQOA 2WWJA 3ZR6A 2MEV1 4FCAA 2V09A 5FYHA 2GC1A 1D4M2 4Z2WA 4LA2A 3DXUA 3QACA 2JDMA 2GALA 1FYUA 2V5YA 1JYIA 3D3AA 2ZGOA 5EYYA 3W20A 4ARYA 1NA1A 4LPLA 1R091 2R1BA 1ODMA 1TQ5A 4Y3OA 1FV2A 4XCBA 1MEC3 1SFPA 2XWBB 3G6JB 2Q1ZB 5DDJ2 5FKCA 2YPDA 4W50A 2BFUS 2VZVA 4WVZA 1CX4A 4NHKA 2NP0A 3I2GA 2Y33A 5GALA 2R063 3VBHA 4ES9A 4Q0QA 2ZABA 2ARBA 1LTEA 1IKPA 2VL4A 2VZTA 4YVWB 1ND2A 1X8MA 2BYVE 2BRTA 4CP9B 5KHKA 2ARAA 2J22A 3K75B 1RUOA 2ET1A 2JG9B 3J26N 4CUGA 3HBZA 3ZFFC 3H0OA 2QVSB 1WLCA 4JRAA 5FY9A 2D6PA 2FDFA 4Q0PA 1PGL1 3WQBA 1QU0A 4IE5A 1YIFA 4Q0SA 1MACA 4LO6B 3HN3A 3P3NA 5DZFA 4FO9A 3U37A 1ZZ6A 2ZZQA 1VP6A 4XBNA 2ET7A 5KC5A 3BOPA 1GBGA 2SLIA 2ZZJA 5DN2A 1OVSA 2WQZC 5LK7B 1LB2A 1KXGA 2VVEA 1VB4A 2XHNA 2D6MA 3KGZA 2GMMA 5F5QA 1VMHA 2WDBA 5FPLA 1LJ7A 3CJIC 2R042 3WCSA 4DB5A 4E8CA 5IVVA 1H2KA 4R9BA 4TXWA 2I07B 4XF9A 3WD5A 3AP4A 1SLCA 3GNEA 5KHGA 2E31A 4WM7C 2IXIA 3ZXAC 1SEFA 3TAYA 3VBUC 3RYRA 4QB6A 1DGRA 2WUHA 3M8LA 4IQPA 1RHI1 5BPXA 1W6PA 4KL1A 2W1WA 3OGSA 2BQPA 4FFIA 5BNQA 1ENRA 3NKTA 4B7EA 1BXHA 1KJLA 2AC1A 4JHZA 1RUJ2 4Q5OA 4QPIB 4UBGA 1YJLA 3B3QE 1EAH1 4XJUA 2PFWA 1PM7A 1LR5A 3C7GA 4HG6B 1WMXA 4COZA 4H55A 3AXEA 2ZGSA 4R4ZA 2WJSA 2OPWA 5E88A 3OG2A 3UV9A 4QXBA 5EV7A 1JZ6A 5A7SA 4XFGA 1YFUA 4AEJA 2ZOEB 3OSDA 4AAXA 1W8TA 3HEIA 3I4IA 4IV3B 4OVEA 3HD8B 4I09A 1HRI1 2PHUA 4OUSA 2JDNA 1Q5OA 2HEYF 2JDAA 5SV8A 1NA1C 4Q2FA 4ZU5A 5LEKA 5JI9A 1OA4A 1W8HA 1HJFA 1PZ9A 2YBSA 4GB32 4KG0A 2E9QA 1IS6A 4N90A 3VBHC 3WP3A 1ND2C 1LHWA 4IETA 1A3KA 2Y0IA 4IEYA 4Y1VA 3ZDSA 2W3JA 3ZKYA 1IS4A 5F5AA 5E1RA 5FAXA 2WWSA 1BJQA 4AK3A 5A7WA 3RWKX 4BU2A 4UOJA 3MYXA 1POV0 1M4WA 2EICA 2F6BA 2XJTA 5FZ1A 2R072 3TYJA 4QPWA 2WNVB 4AXOA 3LEGA 3A21A 5CB7A 5KR7A 2MEV3 2FZ2A 4RR3A 1H1AA 4CCEA 4DS0A 3KV5A 5K0UB 4CZSA 4CDUA 2PAEA 4C1XA 2OQ7A 5L7OA 4KQ7A 4NPLA 4CXXA 2LRPA 1R093 3ZSLA 3RZHA 2MHFA 3J8F1 1MS5A 1CAUB 2XBO2 3EHKA 5IK4A 1GFF2 3AM2A 4LKFA 2EVXA 3MIEA 1PO12 1Q8PA 2ZCWA 3N3HA 1UAIA 4FOYA 4IE0A 4ISRA 4UFJA 5HCBA 3TWIA 1LOBA 3LQCA 1KDKA 4EE2A 3WNPA 1VAKA 3O0XA 4H7MA 2BNNA 3U0ZA 1V6NA 1K5JA 1FXZA 2JDYA 1LOFA 3LOBA 4MXWA 4LO7A 4UAPA 1DQ0A 1VAMA 5A7OA 5C71A 1CVNA 1I5PA 2P4EA 1BVVA 3KS7A 3WZ1A 5FZ7A 2C0ZA 4TSVA 2W1UA 5FREA 5GLWA 2ZKLA 1AR92 1FMD2 4QQ2A 4KU8A 1L7LA 1UX6A 2YGLA 4Y1YA 2VCCA 2OKXA 1MZ5A 4S2HA 3RI9A 1SLLA 2PQQA 3BIWE 3B5LB 3I2DA 4HVRA 2CAUA 3V64A 2D5FA 3I8TA 1RUE2 1BK0A 1AX0A 1SCRA 4Y22A 3MUY1 4LIVA 3FFZA 1O8PA 2VMGA 3ZFGB 1HN0A 2RDQA 4AF9A 1ONAA 4HLTA 5BNNA 1JYNA 2XLAA 1Q8SA 1G9BA 4CUCA 2QQMA 1XE7A 3RZJA 3BTXA 1W6OA 3ZLIA 4RL7A 4Y5SA 2R30A 1RHI3 3DPRC 4ITCA 4N53A 3RMYA 4AVBA 5IVCA 5IHRA 5KXDA 1UZVA 2H6BA 2B9UA 4QAWA 4AOCA 3MIHA 5ANNA 3TBDA 4B7KA 2WT2A 1AX1A 4HPKA 2PMWB 3A0KA 1EAH3 3LKJA 2C5DA 4AEDA 4Q4V1 1QGLA 5FIXA 1O8SA 3VDDB 2AUYA 4URAA 3KM5A 4Q1RA 1HV1A 5CNAA 2VW1A 3MPPG 5CZKA 3LGRA 4BMEA 3OGVA 1F5FA 1ALYA 2LS6A 2B4KA 3I3BA 4LMFA 1YWKA 5FZIA 4CDUC 4WM8A 4YW2A 2H0VA 2JKBA 3OD0A 1EPWA 1A6CA 2ORXA 4PIXA 5ERLA 5HV0A 4OHYA 5FZLA 4R8HA 3OD4A 3POJA 3C2UA 2JXAA 3NRUA 3MICA 1OD3A 1MS9A 4L8QA 3VL8A 5FY4A 5CADA 3P6BA 5EWSA 3B94A 1O4YA 1XNBA 3JD71 4BYYA 1NG0A 1YQ2A 4FQZA 1PVC1 1C5HA 4D3WA 4YM0A 1LOFC 2DFBA 3I97A 4HL0A 1OLMA 3RYKA 1I6XA 3UYJA 1B35B 2Y0OA 3AKPA 2W08A 5ABJC 5JOZA 1OI6A 3WUCA 3FUQA 3PTRB 3WW2A 4MYEA 3K4DA 3DYOA 4JAAA 4LBKA 4N9IA 4GD4A 4K6BA 1U5YA 1SPPA 2VMFA 1EV12 3GZUC 5FQ0A 2ZAHA 5JSRA 3C7EA 1LHOA 2BPA2 3TEYA 2W91A 3J8F3 5A3LA 1QHDA 4K21A 2A73B 2NN8A 2ZGKA 1VPHA 4S2FA 4YW4A 4LBLA 3I59B 1ZA7A 3U4XA 2XUMA 4C8DA 1FATA 4IDZA 1J58A 1GZ9A 2J1AA 2ZS6B 4B3NA 3VUOA 3I3MA 3MIFA 1CD3G 1CIWA 1QOTA 3MO4A 1JUIA 2R6QA 5CIRA 5A3MA 3EB7A 4GWJA 2YHJA 4ZPIA 2ZMLA 5FJKA 2QCSB 5L19A 3GJBA 2YC0A 3AZVA 5KHHA 1QH6A 4MH0E 4PHZA 3OYWB 3PIGA 4JQRA 4NWWA 1W8FA 2VQAA 5EXOA 4FSJA 2QUOA 4XF0A 5A3PA 1BK1A 1SZBA 4Q8LA 1OF3A 1XB9A 4IUGA 2G19A 2DCZA 3HMYA 5C70A 1UY0A 4YNIA 3WDWA 4A7ZA 3N7MA 1PX4A 1O6UA 1ZBE2 4A2UA 4UXAA 3NVCA 2VY0A 5FJHA 4A44A 2RE9A 1CAWB 2DU1A 3MF6A 2HJIA 4FPLA 1QJEA 4BQ1A 4YVWA 3WY6A 5IUQA 4CP9A 2Z5WA 2QQJA 3I2KA 1SHWB 3N9OA 3SHRA 3USUB 2JG9A 2V5DA 2ZX2A 1VBB2 4MGKE 4OMDA 4XEZA 3Q9OA 4MGZE 2VVDA 1OXCA 3N9PA 1UZ0A 4LBNA 3BTZA 2XJVA 4XDOA 5F2WA 1XU1A 3WNLA 2YC2A 5CFCB 1NUKA 4KWUA 4Q4V3 4ONUA 2PQSA 3KT1A 4IL7A 5F6LB 1JZ2A 1ZYBA 3CO2A 3LEKA 5C8CC 3FLPA 4QKFA 3UETA 3TNPB 3LWCA 1OPMA 2DVFA 2ID4A 1GR3A 1HV0A 3PUSA 3RFRA 4D7YA 3PUHA 4L92A 3MF9A 1U5IA 3H3LA 2RHPA 2ZGLA 3WF3A 2MPFA 1WA4A 4ZU7A 1S2KA 4JGZC 3J7MA 5JLVA 4MLOA 1PO22 5FZFA 2J1RA 1LGBA 2B7YA 2B9VA 2X5IB 1SLIA 5BY5A 4RHV1 4GULA 2DFCA 1HJGA 4D7TA 4YZ1A 1YRZA 3C3VA 4GH4C 1X82A 1WZXA 3MIDA 5L73A 3RJ2X 3JD73 5FPBA 5FZ8A 4XUNA 5J96B 1WCUA 2WNOA 4QPIA 1IG3A 1OC1A 2J1VA 4R4XA 4BE3A 4CU9A 1PVC3 4PCRA 3U78A 1JMUB 1C8M1 1ZRRA 2BVVA 4A6SA 5KHJA 3SH3A 5I91A 2DVBA 2VBBA 2OS2A 4YZ4A 2XHKA 2B46X 4QDRA 1NT0A 1W8NA 2WIIB 3IAPA 4JKKA 4CCCA 2RS12 3ZSMA 4I2OA 5GLTA 5IK8A 4IV3A 2CY6A 4YARA 2XB6C 5FPAA 1NCQB 3L2YA 3U75A 4CRQA 1LEMA 4NN0A 2FDKA 3K51A 1CJDA 3M3OA 4M3CA 2Q8OA 2IXKA 2Y6JA 3IPVB 5FZMA 1JH5A 4IERA 1C8NA 5FYCA 4FQ4A 5L9BA 3O1PA 3A7QA 4KWKA 3GHMA 4DZGA 5FBZA 3U4SA 4YVWC 3ZSJA 2W0XA 4CXWA 3VZMA 1VBC2 3IM0A 3ORJA 4K1ZA 4UYBA 1MS0A 3EMRA 4ZS3A
chains in the Genus database with same CATH topology
1XNCA 3VHPA 2EXHA 4AI2A 4BIFA 2AZ5A 4RD7A 5HI0A 2K2SA 1YO8A 2WNVA 3KLSA 4COWA 3FZ3A 2F4PA 4IXLA 1ZM1A 2CGOA 2A6XA 5T52A 1SDWA 5K0UA 2D6OX 3LCPA 1GLHA 5JI7A 5T55A 3RRDA 3ZX7A 2RMU1 2NZ9A 2WNUC 4KGGA 4W6XA 1VBE1 2DTYA 1W6NB 1CAUA 2E7AA 2P37A 3QH7A 3NV1A 5FMOS 2YDEA 4WZFA 3UKNA 4HK9A 3R4UA 2WZR1 3DUIA 2JDZA 4R9CA 4JDNA 4XDQA 3ROUA 1JN2P 4E9KA 1RVF1 1MS3A 2AH2A 1DU3D 1SCSA 3JBG2 5L36A 4D69A 4QPIC 5H9RA 2ZGNA 1MQTB 2RS52 4DOUA 2GNBA 2A7AA 3DPRB 4LBJA 2NLRA 1REDA 3BB6A 4MSVA 4Y1XA 3ZPYA 1BMV1 4Y1ZA 2ZBJA 2PHFA 2NM1A 4K7JA 1VRH2 1QXRA 1DZQA 2ZMNA 5I8SA 1O3RA 5I8YA 1WLDA 1RUI1 1JBCA 1OPOA 1HLCA 4FPKA 4AFCA 3ZFGA 1BEV1 1OOPB 3T1MA 3AX4A 3E97A 2OPKA 3CEWA 3O7OA 3KZ4C 4RHV3 5GJ6A 1ASJ1 4MV2A 3ZSKA 4KGQA 3J4UH 1UZYA 2B5HA 1MEC2 1UIKA 4DFSA 5BUVA 3RMXA 1AHSA 3VHRA 3FLRA 2ZACA 1ULDA 3JB4C 1C8M3 3VDDA 4PBOA 3EO6A 4META 4FT8A 5B2GB 1RGSA 2DVAA 1ZZCA 1XE8A 1R1A2 1HRV1 1F31A 3VZNA 2A6VA 4E27A 5K0UC 4EN8B 1LESA 2TEPA 4YZ3A 3H8UA 4COUA 3B00A 3V0AB 4JV4A 2GNTA 3SMHA 3RPQA 3M3CA 5J36A 5ABJB 5I8TA 1RUH1 4EN7B 1UU5A 2JD4A 2PHTA 5IT6A 4AGRA 5GM0A 4BHPA 3BCWA 2Z2SB 1Q43A 2VNGA 1Q8OA 1I5ZA 1WLTA 4MVTA 3WOGA 3AP9A 4I01A 3QOPA 1YHFA 4CEWB 1B35A 1U12A 3AP6A 5JZGB 3MPBA 3UL2A 4Z07A 3H7JA 2Z42A 3IMNA 1DGWX 1WCKA 3NV2A 2ZGTA 3WHTA 2PLV2 2RMU3 2VNOA 3ZXDA 1VBE3 2BW8A 3E5UA 2VXRA 3AKSA 5AVAA 3TN91 3RS6A 2DTWA 1N1VA 1UD1A 2WZR3 1O5LA 2R0FA 4IEWA 3I59A 4W65A 4N9HA 2RM21 4QGNA 4LNVA 2JE7A 2DVGA 2VH9A 1OFSA 1RVF3 4FPFA 5FTTC 4OHWA 2G9GA 1Y7BA 3JB8A 3LA3A 1H4HA 3O14A 1PNFA 2EAAA 4HKLA 2OYZA 1DGWA 4YGCA 2DCKA 2WFPA 1C3HA 4R9DA 3VDDC 4F3JA 4OI2A 1OKQA 3OYWA 3WW1A 3ZXLA 2DUPA 3KT4A 2ZHLA 1F2NA 4XIOA 4FBFA 4I0WB 4M0NA 4Y5Z0 2D98A 4BA6A 1TMF1 4I3GA 4LULA 2BFUL 2RR11 4P9JA 3ZYRA 1CAWA 3O5SA 1RUI3 1YIPA 2BWCA 2MEV2 3D8CA 1BEV3 4RQPC 2VOVA 2VOKA 3VKMA 5C8CB 1BYHA 3KMHA 3SH5A 3BALA 3DV8A 1AXYA 3USUA 5BNOC 4LBQB 2NPIA 1NY71 2YXSA 1VBD1 3SISA 1ASJ3 1W2UA 2VOWA 4QQPA 3VBFB 1AYM1 2QZ3A 1R092 2PAMA 1O3TA 2P3IA 4JGZB 3QLQA 4XFBA 2R16A 5CFCA 4ES8A 1F9KA 2WS92 4LO4B 3W9AA 5JMCA 1RUNA 4FPGA 1CAXB 1OQEA 1QJZA 1HRV3 4GH4B 1B35C 1GZWB 1H9WA 3PMEA 2FMDA 2HWF1 2WL1A 1AR81 1LENA 1V6KA 1C1FA 3KD4A 1AR71 3WDUA 4XQWA 3GZAA 3AZYA 5DZEA 3LAGA 5GLVA 2X5IA 3LB9A 4M01A 5DUUA 2YY1A 3HN1A 1DYPA 2DCTA 1DZTA 1UPIA 1MS8A 1WMFA 2GN7A 1QDOA 2VPVA 4Q4X1 3HWJA 1V9U1 1DHKB 3OCPA 2CGPA 5HBAA 3WUDA 2AR6A 3IWZA 2VULA 2VUJA 3VHOA 3UK9A 3U07A 1AZDA 2TBVA 1IKQA 1ZNPA 1V00A 2DWRA 1EPZA 1ZZ8A 4FTBA 5JPNB 1RHI2 1RUG1 2Y38A 2D40A 2B45X 4HETA 4XIKA 3LOIA 3SH4A 1NCQA 4GIQA 1H1IA 3PVBB 4GALA 4GKXA 1EAH2 1S0GA 1I1EA 4Q4W1 4QXKA 1E57A 1YNAA 1OA3A 4SBVA 3TN93 3IPVA 3PJQA 1FPN2 1Q8QA 3AMPA 5HXVA 3RYPA 2A6WA 4R52A 3BOWA 4MX3A 3ZVXA 3ZXKA 4X8NA 1JHNA 2RM23 2WNUB 1WBFA 3AKQA 3M1HA 5JIUA 3I54A 1COV1 1TME1 2OUHA 3H50A 1V6LA 1LHVA 3JQXA 1O4ZA 1RIRA 2JJ6A 4E2SA 1CGPA 5CFCC 1GV9A 4LUKA 1WMEA 1WW7A 1ZA4A 3WV6A 2UWCA 1MS1A 2UWBA 4KWJA 4P9YA 5AVPA 4OLLA 1YUDA 2DF7A 4M0HA 4XFIA 1TMF3 1O5UA 5FCCA 1W0PA 2XVKA 4GMP1 5GZFA 2RR13 1XYNA 1W6NA 4YFWA 4C0HA 1NLRA 5DDJ1 2A71A 2B39A 2GU9A 4H7LA 1WLWA 5T5PA 5D1IA 4YZ5A 3MGUA 4QD2A 2X5IC 1UCXA 3OJBA 4J1XA 1VBA1 1VBD3 1AYM3 3J8F2 2UURA 4M3CB 2HWC2 3P3PA 2XJUA 3S7EA 1MQTA 1JYCA 2CAVA 1H4GA 1UU6A 2UY9A 3AYCA 3DPRA 3RWNA 3SLIA 4KH9A 3SITA 2QDNA 1WMDA 4Y24A 3H1YA 1CONA 4FXKB 4LHNA 5FRAA 2RJLA 2HWF3 4FPHA 4N7UA 1AR83 1NCQC 1ZZBA 2P2KA 4XOGA 2KA3A 2QE3A 4HSLA 1UKRA 5BV6A 1AR73 1OOPA 1Q56A 1QMJA 2K0GA 5CVRA 5K7PA 1D2QA 5SV5A 2E7QA 4QX5A 4XBQA 1T6GC 1DG6A 3NJZA 4HVOA 4Q4X3 1V9U3 4XJ8A 1APNA 1QOOA 2GH8A 3CLPA 3N4MA 2JX9A 5E89A 1CR7A 5I0TA 2XGXA 3ASIA 1YXWA 1W0OA 3M7AA 3MLLA 4IV1C 1RUG3 2WFF1 1I9RA 1Z7S1 2I45A 2HKXA 1DLLA 4IEVA 2VNRA 1ZRCA 1VAVA 4MXVA 2WT1A 4AHZA 4XF3A 4OUMA 4DY3A 5T5JA 3KSCA 2GNMA 3V0AA 4Q4V2 3SCHA 4Q4W3 3WP6A 1AR62 3URFA 1DGLA 1QXPA 5ABJA 3AB0A 1VALA 3JUUA 3KQRA 4QHBA 1O3QA 3WX5A 3N35A 2ZX1A 3ZXEA 2CNAA 4YM3A 1F8VA 2XL7A 5JOWA 1AXZA 1RMU2 2XLGA 3SNMA 1COV3 3RZZA 3KB5A 1TME3 5LK5A 2JENA 4YZ1A 1DQ2A 1WUVA 2PN5A 3O0VA 4OI1A 2CL2A 3RQ0A 4FPEA 4Q1PA 1BCXA 1PVXA 2FBEA 5IK7A 1C57A 3THTA 5HCFA 4CEWA 1DZRA 1MQTC 4JCKA 5JZGA 4YFZA 5LEJA 4Q4Y2 3POYA 3PLQA 1DQ4A 4LBMA 4M3CF 3JD72 1IS3A 4EROA 3AMHA 4JVAA 1YJKA 1OQ1A 2BUKA 2D3PA 1REEA 2X53S 3D5OA 2WQ4A 2JE9A 2XVLA 4GMP3 4HT1T 2QQPA 4G9SB 2I74A 2TUNA 4NR1A 4AEKA 2XPJA 4FTSA 1C5IA 1QJU1 4TYSA 5DDJ3 1OOPC 2XBO1 3OGJA 2JECA 1PZ7A 1U5XA 3MIBA 4N43C 3IBMA 4PJYA 4XHBA 4YGBA 5J98B 3ST7A 2QNKA 4AI3A 1VBA3 1O7FA 3WQ7A 1HRI3 5CG8A 1LCLA 5D8AC 4RQPB 3TOJA 1ZVFA 1CQ9A 4XZPA 3ZYGA 1S0CA 2R0HA 1UZZA 2HWE1 4XF1A 1K5MC 2R1DA 5BNOB 1PZ8A 1BBT1 2D93A 5KXCA 1QQP1 2X8KA 4I30A 3WT3A 3LA7A 1FOD2 4NO4A 1AR91 1Y3TA 2Z79A 3EBRA 4QQOA 5LRRA 4FAGA 3ILNA 2ZPXA 4DNYA 4AE2A 3GALA 2A6ZA 1QDCA 1NXD1 1RUE1 3MEPA 4C91A 5C8CA 4Q26A 4K20A 4XQDA 4WZCA 5E8AA 1NE4A 4LBQA 2GH2A 1H1MA 4WVWA 3R4SA 3VBFA 2P17A 3IIAA 4CP0A 1EP0A 2WSVA 1SACA 4JGZA 1ZBA1 1KDMA 1HX6A 1ZZ9A 3BODA 1O4TA 1D4VB 3FHIB 4LHKA 1CAXA 1AUYA 5C33A 4GH4A 3MDPA 4KWLA 2A6YA 4CEWC 4FVVA 5JZGC 1Z7S3 2WFF3 1GZWA 2D6KA 1ZX5A 1VJ2A 2IFRA 5J09A 3VBRB 4P9LA 2EA7A 4R9AA 3HT2A 1PIV1 3VZJA 5FLHA 2ZTNA 4AQTA 4HANA 5FLIA 2AENA 1RC6A 2WZPP 3ZN4A 3JCIA 1AJKA 1S1AA 2BBVA 1XXNA 3WCRA 5JDBA 4ATFA 3B7MA 4YVSC 5T50A 3OGGA 4NOTA 2GAUA 5DUWA 2ZHNA 1WCSA 2W52A 4JDOA 3FX3A 3RSJA 1H0BA 3PJYA 2GC3A 4E4SA 3ZN6B 2IC1A 1B09A 4YLZA 3SXWA 1W39A 3ACLA 1HQNA 4IEQA 5ACA2 2XJPA 4L11A 1OMIA 2ZGQA 2EXKA 4QMAA 5FLJA 4Q27A 3OTFA 4DQAA 4G3YC 2B8MA 3VZOA 1WCDJ 1EV11 2D43A 3HR9A 4CDXB 3ZMOA 1JOJA 5JSOA 1QJU3 3R0RA 4YGEA 2XBO3 2EIGA 3VGIA 2WNUA 2PYTA 1G8WA 5AC91 5JVVA 1LODA 4QGMA 2BEOA 5DUXA 1HXS1 3VBFC 3MW4A 4XE9A 5EYXA 4XFHA 3N7LA 4BPZA 3PHMA 4YG0A 3OBRA 4RA0A 2VMIA 1NZCA 1R082 1RUF2 5CFDC 3RI8A 2HWE3 3WG4A 4XPVA 3ZO0B 1POV1 1BBT3 2OUJA 1HW5A 3NV4A 4QU2A 3UJOA 1X36A 1QQP3 3ZFEC 4XYXA 3U11A 4Q8KA 1GSLA 1AR93 3QBQA 4FXGB 2QJVA 1QOSA 5FFOC 5FMOL 3MLJA 4BIOA 4F83A 1ULGA 1ZBE1 2DVDA 1RUE3 2UY8A 3AYAA 3T1LA 1AYN1 3S7IA 4Y20B 4LBQD 3ETQA 1VBE2 3PNAA 5AFEA 3HQXA 1VBB1 3N7KA 1SLAA 1J3RA 5T54A 1MVQA 1ZBA3 4YW1A 3WW4A 3TB0A 4TWTA 5I0UA 2HWD2 2ZKNA 4AVTA 2WZR2 2PAKA 2O1QA 3B02A 4RFT0 1HQWA 3W59A 3V65A 2XL9A 2A70A 2GC0A 3POWA 1LOAA 1N1TA 4HK8A 3IT8A 2XJQA 3AYEA 3WW3A 4GWMA 3CNAA 3UKTA 3AP7A 3VLBB 1PIV3 1H9PA 3FJSA 4D7SA 2W39A 4IV1B 2PHRA 4AW7A 1N3PA 1UKGA 1QJX2 3L2HA 4IEXA 4LA3A 4Y1UA 4C0BA 1BMV2 4ZU4A 1LU1A 4CYDA 4ZXKA 3T2TA 2TNFA 3B9CA 2WSUA 1SBDA 1IQAA 3O12A 4XBLA 1BEV2 4TZDA 3FMGA 3IDEA 4OFGA 1DBNA 4OI4A 3H1WA 2EF6A 2D6NA 5DG1A 3WP5A 2RJKA 1ULEA 2V73A 2A3WA 3POSA 2YUEA 1Z0HA 2UU8A 4U36A 4DPNA 1GZCA 1V70A 1EV13 2DUQA 1QF3A 1XNKA 4UBHA 1V6JA 5K8SA 1HRV2 1EYBA 1S0BA 2A75A 3LSDA 5I0RA 2DU0A 2PHXA 4X6RB 5AC93 1DQ1A 3E6DA 3I7DA 4S2DA 2HWB1 3DGTA 4XTMA 1NOVA 1HXS3 4YW5A 1VBC1 3PVEA 1S0FA 3GF6A 1MZ6A 1PGW2 2ZAAA 1UL9A 2WLQA 4B29A 4N43B 4NVPA 2BTVC 4HFSA 4YW3A 1POV3 2Q4SA 2YYOA 4K8FA 1SLBA 3D82A 1DQ5A 4LBOA 3AFKA 5D8AB 5EFUA 3R05A 4HKWA 4K40A 2D7FA 1VIWB 1RTVA 4XTPA 4ASMB 1RJ7A 3PVNA 4A3XA 1MS4A 2R062 1K5MB 1D2SA 3W58A 3U10A 1ZBE3 4BOWA 5I93A 3LA2A 1FI2A 2LM3A 2BGCA 1LEDA 3KCYA 1AYN3 1OSGA 3VBSB 5KWRA 2XH6A 1G9DA 1G86A 1LOEA 3M3QA 2PHDA 2ZHKA 3VL9A 1WW5A 2WA4A 2ZGMA 1VBB3 1UU4A 5H9PA 4RQPA 3MW2A 1WW4A 3AMQA 3B9IA 3JU9A 4AQ2A 3H9AA 2ETEA 1AL21 4IEOA 2VU9A 2IXCA 3ECQA 3JBG1 4GA9A 4P9XA 4PBPA 4RS5C 5BNOA 4IEUA 2RM22 1Y43B 2HYKA 2E7TA 4FOWA 5DUVA 5GZCA 2VVFA 1I3HA 2C1FA 1YFXA 4L99A 1ZRDA 1IGOA 2A3YA 4J1WA 4KNCA 2K9ZA 4LR4A 4DY5A 3E6BA 5K9YA 3VKFC 3QCWA 2Q30A 1XU2A 1J3QA 1NE6A 1TMF2 1OD5A 4MGYE 4AFBA 4LUMA 1CAVB 2RR12 4X8PA 4AVAA 1REFA 4QM8A 5BNPC 3H3ZA 3R6SA 1SBEA 4QPGB 4YM2A 3ZSEA 2H6CA 1XNDA 3WDYA 4EN0A 1DYKA 1RJ8A 1VBD2 4X6QB 3AMMA 4YVSB 4AG4A 5C4WC 1LGCA 2IXJA 1R1A1 2AREA 3SCGA 2D3RA 3VBRA 1RL3A 3PVOA 4B4QA 2VW2A 3NKGA 3INAA 4CDQB 4IEZA 4YM1A 4CEYB 3M4FA 2CYFA 4LE4A 2D6LX 1ENSA 2ES3A 4MGIE 3DL3A 1Z78A 4FPYA 4BMBA 1SMVA 4FAHA 2HWF2 2HWB3 1AR82 3ZIWA 3O0WA 1VBC3 4XFCA 1FNZA 5DXDA 3TRSB 3WDXA 2ZX3A 3MLKA 4L97A 3ZYIB 2NMOA 4IESA 2QDRA 1OA2A 4EWEA 3ZN6A 1YCIA 3FBMA 3ZYJB 1LOGA 2WKKA 3WINE 1H2LA 4QT6A 4Q4X2 1V9U2 5J37A 5A32B 4K3UA 1J3PA 1ND3B 2PLV1 4HZFA 5CFDB 1HDKA 1AX2A 4CDXA 4QQLA 3CJXA 4OULA 1RUG2 3ZIXA 3ZFEB 2VMHA 2LALA 1FNYA 2P34A 1DF0A 4P9IA 4J6GA 4PQ9A 5GLUA 4DXZA 1PGL2 5TSWA 4COYA 2YMZA 3B93A 1DDLA 5EZWA 2WC2A 2GN3A 1ZZ7A 2Y26A 5F9TA 1TEIA 4EN6B 5FOJB 1AL23 3IDCB 3JBG3 1SLTA 4AHXA 1NCRB 4HKOA 1TNFA 1RUC1 3AKRA 1RUH3 3BU7A 3ZXJA 1GKBA 4JGYB 3WG2A 4EJRA 2E63A 3KGLA 1COV2 2JEMA 4NHMA 1TME2 1AVBA 4H3WA 1NQJA 2MNGA 3VBRC 3MW3A 1UIJA 4Z1VA 1H8TC 1W6QB 1KFXL 2EAKA 3NAPC 2KXLA 4WBBA 4BLJA 4FOQA 1JUHA 4Y20A 2UYAA 3L9JT 1JXNA 3WQ1A 4FP2A 1HIXA 3ELNA 3VN4A 1IPJA 2OW4A 1RUD1 4GQ7A 2GZWA 4I0BA 3AZZA 2NYYA 4B4PA 2JG8C 2WS91 1N3OA 1VBA2 1HRI2 1R1A3 2XKPA 2RS31 4K1YA 1JW6A 1VR3A 1YFWA 3CL1A 4CP2A 4F8AA 5KXEA 1QJY1 4IV1A 1C28A 4CDXC 4JDMA 2B42B 3G7DA 3CU7A 1D4M1 4CDWC 4I3PA 3RG0A 4AFMA 4HVQA 3KT7A 4FPCA 1UF2C 4XF4A 3PMSA 4BZ4A 5LRSA 5C9AB 3H7YA 4XJZA 2ILMA 4WVMB 4CP1A 3R4DB 4ZKTB 2YV8A 1GNZA 2LTNA 3ES4A 4A7YA 3VZKA 2YPJA 5JSPA 2AYHA 5GZGA 1SFYA 3FE5A 2PLV3 3VZLA 3VBOC 5KBFA 2VW0A 4XFFA 1PMIA 4ORFA 1Z7S2 2WFF2 1FPN1 2EXJA 1LECA 1ULCA 1A8DA 5FOBB 3E5QA 4I02A 5FO7B 1N1YA 4E4DX 1S0EA 4JTNA 1C1LA 4BM8A 2R041 4JC1A 1LGNA 4AHYA 4BWOA 4N43A 3QD6A 5E16A 4W6WA 1CESA 1XRUA 1RUC3 4FTEA 1Y9QA 2AGSA 3VV1A 5CBLA 4XW3A 5D8AA 5I0SA 4YSFA 4KBBA 3WR0A 4QGLA 1K5MA 1RUJ1 4RS5B 2I2SA 1CPMA 2EALA 3VBSA 3WNXA 1SBFA 1G7YA 1UN1A 5IK5A 4AHWA 2XLFA 4UW6A 1DIWA 3WG1A 2ZGRA 1QXJA 2ZX4A 4CTEA 2CTVA 4B8EA 1UPSA 1S0JA 3ZXFA 1VB2A 2EXIA 5CG9A 1RUD3 1QJU2 3X29B 2HWC1 3GYDA 4GB31 1IZ3A 2WS93 4XQ4A 3USSA 1O3SA 3GBGA 4RGAA 4AEMA 1H8VA 1IS5A 5BNPB 1LKNA 1FV3A 2RS33 3V0BB 4WVVA 5H9QA 2HWE2 1GQGA 3UJQA 2Q1MA 2XJRA 1QJY3 2R071 4L9BA 1BBT2 2FZ1A 2G4IA 5C4WB 2X29A 1SQ4A 2DURA 1QQP2 3HIFA 2FMYA 3OY8B 4WV8A 2GNDA 4E4ZA 2SBAA 1D4M3 3FBYA 4XJWA 2YROA 1PVC2 1CAVA 3UKVA 3E6CC 1S55A 4O9GA 1QY4A 4W6YA 4QPGA 1JTZX 4ISQA 5AFBA 1IOAA 1PO11 4KG8A 2ZJCA 4IEPA 4YVSA 3ZYPA 4RSUA 2ZHMA 1S0IA 5GKAC 1ZBA2 4A7KA 3WXPA 3MIGA 4CDQA 2XWJB 4CEYA 4HBNA 5J7MA 1OQDA 1TE1B 5FO9B 1GNHA 1AR61 4HMZA 3MI8A 2PHWA 4KU7A 1FPN3 4XETA 4LHLA 1A8MA 2OA2A 3VBSC 2GSYA 1LU2A 1FMD1 2W68A 4RR3C 1HKDA 1URXA 2DUOA 3V56A 1NQDA 1J1TA 1PIV2 5L7OC 3AYDA 1YYNA 4QQHA 1RMU1 3OF1A 3WQ0A 5CAZA 2R043 4MUVA 4YG3A 4UW4A 2DCJA 5BYNA 1J1LA 4H14A 4P9WA 3D0SA 3WDVA 3KCXA 4N7IA 2VQ0A 4Q4Y1 3OBTA 2OZJA 2WT0A 4PDWB 4LEJA 4AWDA 5A32A 2H0BA 1KQRA 1WD3A 1ND3A 1S0DA 5GZDA 5CFDA 3RJRA 4GKYA 1PGSA 1RUJ3 2BWAA 2QFEA 1QWRA 3EXUA 3NWKA 2OVUA 4BH9A 3ZFEA 4ASLA 1Q3EA 3ALQA 5GLZA 1D0GA 4Z82A 5GZEA 2ZMKA 4EN9B 1H2MA 1O91A 4C1WA 1EY2A 5CA6A 2BNMA 1H8TB 1SFNA 2GC2A 3BTAA 3NAPB 1OLRA 1PK6B 5FPXA 3APBA 1U5ZA 2VUAA 3FFQA 5JCTA 2E6VA 1NCRA 4G4FA 2Q5TA 2HWC3 4QPGC 5EJ3A 3HAGA 3D0JA 5AC92 4GB33 4JGYA 5BNNC 1HXS2 1H30A 3B01A 1FOD1 2OIIA 4N53C 1W6QA 1RB8G 2IWGB 2JG8B 4CDQC 2R073 4CEYC 4RHV2 4AEDC 1ENQA 2PHLA 3WHUA 3ZFFB 5CU1A 1PHMA 1LOCA 1WBLA 3IDBB 1W6MB 1KRIA 2XVGA 2ERFA 5F1RA 1C8M2 5KHIA 1RITA 2PA7A 5A33B 4WM8C 1DGRN 1AYN2 2CWSA 2CV6A 2PELA 2HEVF 4AVSA 4LLOA 3FC0A 1PO13 3AZXA 4CDWB 2ZX0A 3NV3A 1GICA 5T3NA 5FO8B 3DF0A 3CJIB 3DKWA 1R1ZA 1X8EA 3IN9A 4FPJA 3DN7A 1N3QA 1ND3C 4NHLA 4UW5A 2O8OA 1XQNA 4WM7B 3MFAA 3VBUB 1AR63 2JICA 4QM9A 3B69A 2ZGUA 4JTOA 1C4RA 2C9AA 2HEWF 3AMNA 1FMD3 3SCFA 5JOYA 3VKOA 1QKQA 4XXPA 4K9SA 1MZEA 4RGGA 4NWVA 4Q29A 3VBOB 2WINB 1RMU3 4AQSA 2P3JA 3D6EA 3GHNA 4DRVA 2DV9A 2BNOA 4LTAA 4XJAA 1WW6A 5C9AA 1CN1A 5KXBA 1NCRC 4WVMA 2YGMA 2NQYA 1V6MA 2RMU2 3FLTA 2ZGPA 1H2NA 4Q4Y3 3K48A 4JGYC 1KS5A 1KS4A 5ACA1 1NA1B 2R49A 4OHXA 5C8WA 1RINA 3WG3A 3A4UA 4Q0UA 4AI8A 1L3JA 1N47A 3VBHB 5J3UA 2CGNA 2A5ZA 1OHFA 3EJKA 1ND2B 4FOVA 4AYUA 4Z8BA 4FP3A 4P14A 3RNSA 1RVF2 1YI9A 3M3IA 1DQ6A 4AI0A 4HN0A 3TNQA 4AI1A 4B4RA 3VHNA 1KFUL 1BVP1 1QNWA 1ENXA 3N36A 2BVBA 3AP5A 5JR7B 1IPKA 3ILFA 2VG9A 4YZ2A 4LLFA 4PLOA 1R081 1PO21 1RUF1 4OZXA 2O0OA 3FWEA 4XILA 2ATFA 1FT9A 2IFWA 2HWB2 4GWNA 2NMNA 4L2NA 3CF6E 1MVEA 4LE3A 2JG9C 3S6PA 4V1PA 3GBFA 1FOD3 4XMIA 1LHUA 1RUI2 2FQPA 2IXLA 4RS5A 4JRLA 1G6NA 4I0AA 1BZWA 4Q0VA 4XJ9A 2Z69A 4F7ZA 4BCUA 3ZMNA 3AXDA 4YGDA 2WLPA 3ENRA 1ASJ2 3M70A 2DYCA 2VGDA 4NPRA 1W6PB 1KJRA 2RS11 1G9FA 3AFGA 3S0MA 5F6KA 4PLMA 2HWD1 2UWAA 5C9AC 1V6OA 2YZ4A 2LUWA 4PIYA 4DINB 5BNPA 1BQPA 2PTMA 3JZVA 1KD7A 1MZFA 3V0BA 1AL22 1GQHA 1AL0G 1RUH2 1NXMA 3AJZA 5C4WA 3VKLA 4AVVA 3MFCA 2WNEA 1A78A 3OY8A 1QJX1 4AVCA 1XYPA 3GBWA 4D94A 4FPOB 1U0AA 2Q0AA 1LHNA 4LT5A 4IV3C 3M2MA 5FDBA 2IZWA 1KITA 1G9AA 1FAYA 2D44A 3E5XA 4RR3B 2D3SA 4GMP0 4INDA 2E53A 4CDUB 1GANA 4HSJA 3NO8A 4U2AA 3AJYA 4PLNA 4DRRA 1VLNA 5L7OB 4M3CE 3MZHA 2ZA9A 5ACA3 4AFAA 4QPYA 2OZ6A 3TN92 4Y4YA 2KM2A 5J48A 3QH6A 2GDFA 4LO8A 2VECA 1AXKA 1AJOA 1GYKA 4OI0A 4UW3A 1YFYA 2RS51 3J9SA 4AFDA 2WNVC 1N1SA 1Q8VA 2XG3A 4PF5A 1G9CA 3VKNA 1MR5A 3THPA 3AK0A 4AGGA 3H3UA 4YYOA 3RDIA 4OHVA 1PNGA