3AKQA

Crystal structure of xylanase from trichoderma longibrachiatum
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
190
structure length
190
Chain Sequence
ETIQPGTGYNNGYFYSYWNDGHGGVTYTNGPGGQFSVNWSNSGNFVGGKGWQPGTKNKVINFSGSYNPNGNSYLSVYGWSRNPLIEYYIVENFGTYNPSTGATKLGEVTSDGSVYDIYRTQRVNQPSIIGTATFYQYWSVRRNHRSSGSVNTANHFNAWAQQGLTLGTMDYQIVAVEGYFSSGSASITVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords xylanase
publication title Packing Space Expansion of Protein Crystallization Screening with Synthetic Zeolite as a Heteroepitaxic Nucleant
doi rcsb
source organism Trichoderma longibrachiatum
molecule tags Hydrolase
total genus 58
structure length 190
sequence length 190
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2010-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3akqA00
3AKRA 2F6BA 3AMPA 1YNAA 3ZSEA 3MFCA 4S2HA 4XPVA 3MF6A 3WY6A 3MF9A 2VG9A 3VHOA 3VL9A 2DCJA 3LGRA 1H0BA 1UU6A 1M4WA 1OLRA 2B45X 2VGDA 1H1AA 4HK8A 3WP6A 3HD8B 2BWCA 2NLRA 3WP4A 2DCKA 1XNDA 3WP5A 3VZKA 1XXNA 1OA3A 4HKLA 3VL8A 3WX5A 1C5HA 3B5LB 4S2GA 4XQ4A 3VHNA 1REEA 2JEMA 2D98A 2QZ3A 1OA2A 4HKWA 2JICA 2DFCA 1UKRA 3AKQA 1XNCA 3VGIA 2Z79A 1IGOA 4S2DA 5EJ3A 3LB9A 2VULA 1AXKA 1OLQA 1BK1A 3AMMA 3AKSA 1NLRA 1XNBA 3B7MA 2QZ2A 3M4FA 3VZJA 1OA4A 1HV0A 3WQ7A 3VZOA 1XYNA 1HV1A 2B42B 2NQYA 3EXUA 2BW8A 4NPRA 1H4HA 2B46X 1XNKA 3VZMA 1ENXA 2JENA 2DCZA 1F5JA 3VZLA 4HK9A 1HIXA 1UU5A 1T6GC 1BVVA 1KS4A 1H8VA 2VUJA 4HKOA 3WP3A 2C1FA 3VZNA 3AMHA 1REDA 3RI9A 5K9YA 2DCYA 3WQ0A 1TE1B 2DFBA 2BWAA 3MFAA 4S2FA 1QH7A 5HXVA 4H7MA 4IXLA 4XQWA 3AKPA 3VLBB 3WT3A 3VHPA 1H4GA 1PVXA 3WXPA 1C5IA 3AMNA 1REFA 1XYPA 1BCXA 1XYOA 4XQDA 2D97A 1QH6A 1UU4A 2BVVA 3AMQA 1KS5A 3RI8A 3WQ1A 1W2UA 3WR0A 3O7OA 5K7PA 3AKTA
chains in the Genus database with same CATH superfamily
2GN3A 4ISQA 2Y6JA 5BYNA 2ZGQA 3PUIA 2HEVF 3H7YA 1MEC1 5DG1A 2HWC2 5EXOA 5C5TA 4XPVA 2VXRA 5A3MA 4C0BA 4CTEA 2GAUA 1CESA 3LPGA 1AUYA 1UMHA 2ZKLA 4IEOA 3ST7A 4J1WA 3T2PA 5FWEA 4AI9A 4PJYA 3OGGA 1CAUB 1DQ2A 1QDCA 2XBO3 5LEJA 4ASLA 5DAXA 1WLTA 5T5LA 5BNOB 3W59A 2Q1ZB 3S7IA 2XQXA 4GWNA 5ANQA 4BQ2A 4FO9A 2VY0A 2E53A 4K3UA 3VHRA 4EJRA 2YPDA 3CIHA 2AGSA 5FPZA 4Q29A 5LY2A 4AQ6A 4E4DX 2JG8A 2XL9A 3NWKA 4UBHA 3DGTA 1RMU3 1UY3A 4BB3A 2R063 4QX5A 1F31A 1RUE3 2RS32 1YFWA 4X6RB 4CDWC 2Q5TA 1VMJA 4FAGA 3WF2A 4YFZA 1GMMA 1MQTB 3LB9A 1JYIA 5T55A 1XQNA 4QDRA 5HXMA 3SCHA 5T54A 1CPMA 2Q8OA 3VD9A 1EPZA 1A8DA 1RUG3 5GALA 5FAXA 2WBKA 3VBUC 2FMYA 1LAJA 1WW4A 4BZ4A 4RA0A 1W0NA 2R6QA 3APBA 1A3KA 4BDVB 2IXJA 3JD72 4JDOA 4O9GA 3B69A 3K46A 1O3SA 1W6MA 5IYYA 2JENA 1H8TA 2AR6A 3POEA 1DQ0A 4LK7A 4BH9A 4Z2WA 5FOJB 3D82A 3FFZA 1DQ4A 1UIJA 2Y34A 3AB0A 3Q8FA 4AEDA 3LCPA 3K75B 2DBNA 4LA3A 4FQ4A 1O59A 5GLTA 3ZXAC 5CB7A 2O1QA 2VOTA 1ND3C 2W94A 4FPYA 1C8M1 3ECQA 4CU9A 4OMDA 4NAMA 1GANA 5FXXA 3I3QA 3VZNA 5CBLA 3LA2A 3CLPA 1JYTA 5JXHA 1PNGA 1ENQA 4B1LA 2VOXA 4XF0A 1BXHA 1TE1B 1EAH3 2QBXA 1S0DA 3M8LA 1BMV1 5EWSA 1GWLA 4B3NA 4FTBA 4AZZA 3ZN5A 1LOFA 1CQ9A 4OQ8A 1KD7A 4Q4W1 3D4KA 1OLMA 5C6CA 4I3GA 5AVAA 3VLBB 4TZDA 2GC1A 3D0SA 1QY4A 3O1VA 3E6CC 2XKPA 4GXLA 1W3XA 1OOPB 5AVPA 4CDXC 3POBA 3I2JA 3WG3A 4D8MA 2ERFA 5IVJA 3WINE 1IPKA 1QOOA 1CAUA 1W9WA 3GZUC 3AMQA 5DDJ3 2QFEA 4Y26A 4FP3A 3RI8A 3HQXA 3JBG2 1RGSA 2GP5A 5BNOA 1XU1A 2QQIA 2V5YA 3WDWA 3RJRA 3HQRA 1IHMA 3NKTA 4QHOA 4FPCA 1FPN1 2VBDA 2DV9A 2ZS6B 3MLJA 5D8AC 4DNYA 3ZXLA 5C3RA 3HEIA 2DUOA 1YNAA 2ZHKA 3DPRC 3POJA 2C9KA 5DAVA 3TYJA 2RR13 3MIDA 5CFCB 5EIYB 5I91A 1RHI1 1W2TA 4EN9B 3I8TA 3VBFB 3H3UA 4XYXA 3SNMA 1U5XA 1WA6X 3LGRA 3ABZA 4CDWB 5LA0A 2RS51 1APNA 1WBFA 1SLLA 1YQ6A 4Q26A 3I3MA 5I0TA 1MQTA 1IQDC 4PLMA 5L73A 1XPWA 2CU5A 3B9IA 4Q4V3 2IVIB 3FN9A 2BYVE 5FBJA 3NMBA 2R042 2VE1A 1C57A 5HI0A 2BBAA 2GC3A 3AP7A 3V64A 5F3GA 4BQ1A 2WWSA 4C90A 1UYXA 4A41A 1W9YA 4CCEA 2WUHA 4MG2A 5HV0A 4YZ4A 3VHNA 1X50A 2YFZA 1W6QB 4GIQA 1VBA1 2QZ3A 4QM9A 4X8PA 4XDQA 2HWE3 4FAHA 3PHMA 1VB4A 4FI9A 2IXHA 4IL7A 4LUKA 1AJKA 5H9PA 3WHTA 1E5IA 4RFRB 1UXZA 5F5IA 1D0HA 1PM7A 1LHUA 5HCFA 1HJGA 3IMNA 1FMD2 1VPHA 1GKBA 3AMMA 3UESA 4HSJA 1Q43A 4UF0B 1ULDA 4E2QA 4MGYE 1ULCA 1LU1A 3AYDA 1DGRN 1PVC1 2HKXA 3A7QA 4ES9A 1ZA4A 1OFSA 1OUSA 5CIRA 4IW3A 3SH4A 3RJ2X 3X29B 3ZO0B 3NV2A 1GNYA 4CCDA 3OSDA 5BUVA 3ES1A 2B42B 3EMRA 4LIUA 4PF5A 5FZAA 3USUB 3MBWA 3HN1A 1FXZA 1H4HA 4K21A 5K4LA 5ACA3 2BOIA 5JI9A 2EXJA 3M7AA 4B7EA 5C70A 1R1A1 1ENXA 1JOPA 1IG3A 1NOVA 3B9CA 4MXVA 2BUKA 5FZBA 3VBHC 3J7NA 4YVWB 1HIXA 5A7SA 4TLFA 4XW3A 3HQUA 4M3CF 4RL7A 4WVMB 1SLIA 1OOPA 2IXCA 4PI2A 4CDXB 4COVA 3MYXA 5K0UB 3E97A 3ZPYA 3BTYA 1UD1A 4W6WA 4BU2A 1CZSA 3PUHA 5DPNA 3WDYA 1CAVB 3ZVXA 4P5YA 2A6WA 3MPPG 3R4UA 1BBT2 3H8XA 4GB31 2MNGA 4A6OA 4GMP1 3DPRB 3TWIA 3ZDSA 2W91A 5FZ7A 4TXWA 2W9XA 3O5SA 5DABA 5GKAC 4COWA 5AFBA 1O5UA 5GLZA 3VBFA 5A6YA 4LO5B 3DUIA 2HWB2 4Q4Y3 4CDWA 5I0DA 1M06G 3S7EA 3ZXFA 4RQPC 1KITA 5A7OA 4IE5A 1OC1A 1HQNA 1QXRA 4GJZA 1D2QA 2NN8A 2Y26A 4PQ9A 2XH6A 4CCMA 1OQEA 4FT8A 4ZXKA 2G9ZA 3UT0A 3ZIWA 2KR2A 3N9NA 4EYUA 1H9WA 2R073 4I0BA 1RUF1 4FQZA 4KL1A 2ZHMA 3N3HA 3VBRC 2IC1A 3WLUA 2MEV2 4Y20B 2NZ9A 2ZGLA 4QQHA 2B39A 1C8NA 3CQOA 3HOBA 3RPQA 5LRRA 2C0ZA 2NYYA 3CHXA 4JTOA 1PIV1 2XPJA 3ZR5A 2WFF3 4RHV1 1CVNA 3ACFA 3VD3A 4P9WA 4OUEA 1CZVA 1A6CA 4ITCA 3ZPOA 1RUOA 1I1EA 3IDCB 1N1YA 5BNPC 1C28A 5LA1A 4XZUG 1TEIA 1BEV2 4NROA 2LROA 2UYBA 3T4VA 2RG4A 4I0AA 3J26N 3OCPA 3PTRB 4HFSA 1RUH1 2RM21 4CZSA 1BJQA 2WZR3 3DL3A 4Q4X1 3WW4A 5LBEA 5B2GB 2Y33A 5H9QA 4OUSA 1NE4A 3B5LB 1HQWA 1MEC2 1VIWB 2G9GA 2LM3A 4I0WB 3K3NA 3ZSMA 5BPXA 3GBWA 3OGVA 4LO6B 4QM8A 4D69A 4IEXA 5KHGA 5LATA 2HWD1 2JIGA 4LOTA 3VGIA 3T08A 5FP3A 5A3OA 3KT1A 1CAWB 3PU3A 3AXEA 3P6BA 4YVWA 4IEWA 3WDXA 2VD7A 4CCOA 4RN5A 1QWRA 3VKMA 4WVMA 1OPOA 2LUWA 3I49A 4F3JA 2OW4A 3JCIA 4H55A 4LPLA 4CDXA 1NLRA 2PHFA 4U36A 5FY4A 2P3JA 1KFXL 4DXSA 2ZGRA 5EYYA 5K0UA 5C3PA 3POIA 2P6HA 5CNAA 3B94A 1CAVA 3IWZA 1DCSA 2AUYA 1UY4A 2K9ZA 1HV1A 1X36A 3M70A 4MXWA 4SBVA 4P9JA 2YZ4A 3ILNA 4MGQA 2Y60A 3LD8A 4OZOA 3OEBA 2OYZA 4CDQB 4NN0A 3THPA 1AR81 3DPRA 4DOUA 4FFHA 4Y33A 2WQ4A 2XG3A 1V6MA 4XFGA 3T30A 3OY8B 5FZKA 3WNNA 4OMCA 1NY72 2LS6A 4LJHA 4LK6A 1O6UA 2FMDA 2CL2A 1SACA 1O7FA 2W87A 2YGLA 1Y3TA 4PIXA 4ZONA 2Y38A 1PX3A 5A7NA 3E6BA 2QQVA 3BTZA 1FAYA 4I30A 4JDNA 4RQPB 1KDMA 1EP0A 4FPJA 1NAEA 5AC91 5ABJB 3GJBA 2GN7A 4DY3A 2JXAA 4XHXA 5LEKA 4GH4C 1OUXA 4LHLA 2A7AA 1LKNA 4XIOA 1REDA 2Y6KA 4H2AA 4RS5C 2ZGNA 3O1SA 1K3IA 1H2KA 4I2OA 2PHTA 1JOBA 3NVCA 4IERA 3LEGA 1LR5A 4UFMA 5A1AA 1LOBA 1I5ZA 3IT8A 2ZX4A 4IGQA 4PHZA 3PDQA 5GZFA 3VHPA 5IK7A 5JMOA 4AHXA 3MLLA 3BYWA 1US2A 1X82A 2ZTNA 4OZXA 1C8M2 4LEJA 4W8JA 5BNPB 1NXD1 1HLCA 2PAKA 1VRH3 1WMXA 5G04L 1JYVA 4MHUA 5J37A 2BRTA 3I2FA 2VZVA 3O7OA 2EVXA 2HWC3 2V72A 5JSRA 2ARBA 1W8WA 3N35A 4W4ZA 4EWAA 1QKQA 3ZKYA 2F6BA 3T1LA 4LBJA 2Z4FA 1PX4A 4KQ7A 5KBFA 4G4FA 2WR9A 2BU9A 1EV13 4Q4W2 1D4M1 3ZXEA 1PZ7A 1ZZBA 3CJIB 3GHNA 5C3SA 1LB2A 2I07B 3AYEA 5A7WA 2QQMA 3T0BA 1NA1C 1TMF1 5FBZA 3CMGA 5B4XA 5DZEA 3NSTA 2NP0A 4NE9A 4R9AA 5FZGA 5FXZA 1VBE1 4OI1A 2FQPA 1HXS3 1H1AA 4BXFA 4E4SA 4XJ9A 3T2TA 4EZ4A 1COV3 1N1TA 1RUI3 4BE3A 1CD3G 1NE6A 1FPN2 3S5AA 3EYPA 4JDMA 4Y4RA 4AI3A 2B7YA 3UKTA 3GZTB 1HRV3 3PL0A 2MPFA 3KGZA 4FOWA 1RIRA 2RS33 3CL1A 4D6QA 2DF7A 2WKKA 3AX4A 4UFLA 4BCUA 1RHI2 4XTPA 3LE0A 4CDQA 1K5MC 4M01A 1CR7A 4IV1B 1GZTA 2PLV3 2RS52 3PMEA 3EO6A 5D1IA 2C4XA 4YNIA 2BZDA 3UV9A 1IGOA 5FZDA 1S1AA 5C9AC 1MZ6A 4OI0A 3LDRA 4RGGA 1AVBA 1MPXA 2DWRA 3AKSA 1QEXA 4MLOA 3FHAA 4RQPA 3B7MA 2QDNA 4B4QA 4FOYA 1N3PA 3HNBM 4DO0A 2H0VA 1LTEA 2PFWA 3IAQA 4I01A 2IFWA 4Z82A 3K4DA 4CCKA 1AF9A 5T5OA 1RB8G 2GNDA 4FOQA 1GP5A 1CAXB 4AGGA 4ISRA 1RC6A 3ILRA 1VBA2 2B46X 2PQSA 4PF1A 4B7KA 5FPAA 5A1FA 4KMQA 5FYSA 5D21A 1VBD3 3VZMA 2ZBJA 1PO21 3USSA 4RYDA 4JKKA 5GZGA 2PELA 4GKXA 4JGZC 1IS4A 5EP9A 2VNVA 1KS4A 2SLIA 1KJRA 4UWDA 2R0HA 3WDTA 1PVC2 2Z42A 2I74A 5BNPA 1DLCA 1LU2A 3I59B 3WD5A 2BQPA 3LFMA 3RZHA 1LHVA 2DVDA 2P4EA 2DBIA 3C7EA 1GU3A 2QDRA 2ZHNA 1MS1A 4MX3A 4YW1A 2WNUB 2OA2A 4Y1XA 2ORXA 3FFQA 3IDEA 2ETEA 5DUXA 5FZEA 1R1A2 2RS13 4N53B 1MVEA 2A3WA 2YC4A 4HANA 4OHYA 3I4IA 3C3VA 2HJIA 2QTWB 3NO8A 1PVXA 1NA1B 1W8FA 3WXPA 2IWGB 4QMAA 1XYPA 4FP2A 5EFUA 4R8HA 3I97A 3MPBA 5HCHA 4IEYA 1HB1A 4KBZA 4K40A 4XAEA 3D8CA 5F2SA 4Q0QA 2PYTA 4LO8A 1JZ8A 4HONA 4HZFA 4U2AA 4Y1ZA 1H2LA 4GB32 3GNEA 2QQOA 3RYKA 1ULFA 4YGDA 5FZOB 2WNEA 5F3IA 3I3BA 2JG8C 3W21A 1S0EA 3TBDA 3JZVA 3KV4A 4F7ZA 2FDHA 1JU3A 1UY0A 5FZIA 3R4DB 1QJY2 4X6QB 5GLVA 1CN1A 3ZDVA 2D6MA 2YBSA 4IV1A 5LK5A 1RVF1 2BGPA 1MS3A 2HWF1 2VOKA 1S0BA 4IEPA 2VMGA 3JXSA 4DIQA 3U0ZA 1OURA 2ZPXA 2R0FA 1FYUA 3LA7A 3OD4A 2EXKA 2GP3A 4HXCA 2VW0A 3INAA 2DUPA 2R7EB 3AC0A 3MGUA 1OA3A 1WZXA 2ET7A 3KV6A 2XUMA 5FZHA 5LBCA 3SCFA 3WEZA 3ZIXA 4FTSA 1CAXA 4HPKB 4GAZA 1U5YA 2D98A 1QJU3 3B3QE 1DIWA 1HRI3 1WMDA 1UKRA 2BJSA 5FZCA 1PIV2 4RHV2 5FYVA 2WT1A 1I5PA 4META 4MO3M 1SBFA 1S2BA 1OKQA 3LDBA 4PDWB 5F7UA 1RINA 4PQQA 2ARXA 2VULA 1AXKA 1NLSA 5IK5A 3MW3A 1OLQA 5EQUA 5BNNC 2JDPA 5GM0A 1Q8OA 4Q8KA 1W8UA 2EIBA 3SISA 5JPMB 2VOVA 3RRDA 2UWBA 4M0HA 1RUH2 1QJX3 4O61A 1V9U1 2EICA 1UOJA 2IFRA 3I59A 4JTNA 4HG6B 4BQ4A 4ET7A 1NKGA 4Q4X2 3VZOA 3WCSA 3KVAA 2F17A 3BU7A 3H50A 1OPMA 1S0JA 2WNUA 1NQDA 2E31A 5JPNB 5BXXA 1LOFC 2OX0A 5IJRA 3T2OA 4NIGA 2ET1A 3V0BB 2W08A 2WS91 1FV2A 3GGLA 4J25A 4N53A 5CVRA 2WNVB 3SQOA 5F1RA 2JDMA 5T5PA 2Q8DA 3M3IA 3ATGA 1NA1A 1ZRDA 4G9SB 1WW6A 3IDAA 4R52A 2ENRA 5FO8B 3AZWA 2VUJA 1BBT3 4WZCA 4XFHA 3SC7X 4DXRA 5KC6A 5BNOC 1S0IA 3K3OA 1WLCA 4XZPA 1YQCA 3JQXA 2FD8A 1ASJ3 2QQKA 3OYWA 4N9HA 1NCRB 1NT0A 1UIKA 5FPXA 2JDHA 3AJZA 3PVBB 4YM1A 5FZOA 2NMNA 1POV3 1AR82 2HWB3 5FYTA 3TOJA 5JI7A 4ZHNA 1HQLA 2XWBB 3WG1A 2JIJA 1UWWA 3P1IA 2OVUA 3RFRA 1GR3A 2GZWA 2WL1A 2Y0OA 3IKWA 4JQTA 4UFHA 4Y24A 2VBPA 4UXAA 5J98B 4LMFA 2PHUA 3WNPA 2VCBA 4CP9B 4URAA 1XC6A 1HDKA 4K6BA 3OPTA 5FR3A 5J7MA 2BVVA 2V5DA 4XJ8A 3TN91 4TWTA 4ATFA 3RYPA 1QQP1 5FP7A 1RUJ1 3H0OA 1VB2A 1PMJX 2MEV3 3ZYHA 2WYFA 2FBEA 4QX1A 1UPSA 3SHRA 2JD9A 2XJUA 4FPEA 4AW7A 1RUNA 1UAIA 2I45A 1V6OA 3H3ZA 1XSQA 3AMPA 5KHJA 4BQ3A 1UF2C 1NCQC 3M1HA 4HPKA 5JLVA 2Z2SB 3ACGA 4NPLA 4AVTA 5CA6A 2IVJA 4BLJA 3N4MA 4EQVA 2VG9A 1ZZ6A 2J1SA 2WLPA 3LSEA 4O7XA 2OQ6A 1HN0A 1WCDJ 2D5FA 3L2HA 1GQGA 1VBB1 3ZXGA 4XVHA 3URFA 1M4WA 2JD4A 4PDWA 5KR7A 5KHKA 4JGZA 1XRUA 4CUCA 2E32A 3MIHA 3TEZA 5BNNB 2RMU3 2B5HA 2J1RA 2W46A 3SMHA 5CKNA 2BWCA 3WNKA 3WP4A 1R093 2ILMA 1CONA 1MACA 1UKGA 2Y6LA 2VMFA 1Z7S1 2W3JA 1POQA 4H3WA 2GC0A 4K1YA 4AFAA 1R64A 5A33B 2XOMA 3VL8A 3WX5A 5C8CC 1ZBE1 2ZGSA 4L11A 3HPNA 1H9PA 2H0BA 5EJZB 2SBAA 4ZPIA 1O4YA 1D4M2 5FO9B 2Q8CA 5FZ1A 1BHGA 5HV4A 3LIHA 5CFDC 3V0BA 3E5UA 2BERA 2CSGA 4EWEA 2W1QA 1TMF2 2WN3A 2WNVA 2WRAA 1UZWA 2F4PA 4CSWA 4JZRA 1FV3A 1PK6C 2ZGOA 4QPYA 3FX3A 3VDBA 2DU0A 2VCAA 1VBE2 4OI4A 2ZX2A 1OOPC 3UK9A 3H7JA 3OPWA 3PNAA 3A0NA 4LITA 4Q1RA 3ZXJA 1SZBA 2IXIA 4AL9A 1SPPB 2N7GA 4BWOA 4KWKA 3ORJA 2J1EA 3FC0A 4LKEA 3HAGA 1U0AA 1VALA 3WQBA 1TVGA 4Z92B 1UYPA 4DUXA 3ETPA 4ARXA 1CJPA 3KZ4C 4TYSA 3J4UH 2L9LA 4O9EA 4Q8LA 2P6CA 2BW8A 1NCRA 4GWJA 5IWFA 4LBQD 2ZHLA 4AG4A 4INDA 4CPBA 1AR91 5CFCC 4KG0A 1ULPA 4AVAA 1GYKA 1SLBA 3VBFC 1UY1A 2WJSA 1Z78A 3ITQA 1L7QA 4NJ4A 4Z8BA 2FCVA 1IS6A 3A0KA 1PGL1 1SLTA 2HBTA 4LBNA 4ZZ5A 4LLFA 5E89A 3NJXA 5LA2A 1OVPA 1O3TA 1PM4A 4EROA 1QDOA 1J3PA 4XUNA 1RITA 1V6IA 4OHVA 1W99A 2QNKA 3GCWA 3POWA 4WM8B 2XLAA 1G86A 4GMP0 2XBO1 4M3CE 1DYPA 5D2AA 1TME3 2DFBA 1D7PM 1ULOA 2BNNA 3SLIA 3OGSA 2RJKA 1NCQB 3VDAA 1PO22 4KWLA 4QPWA 1BZWA 3J8F3 4AI0A 5JWPA 3POGA 1C8M3 3S30A 3ALQA 2AACA 4W50A 3TB0A 1C5IA 3LWCA 3IIIA 1RMU1 2YYOA 3BOWA 3KF5A 2R061 2NM1A 1RUE1 1YI9A 1UOGA 5A3PA 1GOGA 5E88A 3IB3A 4J6GA 5BNNA 1YFUA 5A32A 1AX1A 5F8PA 5A6ZA 2PHRA 1PO13 1YQ8A 1UN1A 1TQ5A 4XIKA 2EAAA 5C8CB 4HL0A 1D2SA 2VM9A 1ACCA 5E16A 4NMIA 3T2QA 3UNPA 1UX7A 2ORZA 1J1TA 2W92A 2D5HA 5T5JA 4WV8A 5CFDB 3N9QA 3GALA 3ZN4A 1OXCA 1FOD2 4HOOA 4XEZA 3I2IA 3ZM8A 4YVWC 3ZFFB 2CAUA 2DTYA 4LE4A 1PK6B 2IXLA 4OLLA 4BIFA 4P9XA 5FY0A 1HN1A 5FLIA 1EUTA 2D3RA 4OCTA 2D6KA 3BVCA 4W65A 3HNMA 1SPPA 1UOFA 4CXWA 5K0UC 2B4KA 1UNBA 1N1SA 2A5ZA 2HYXA 2O14A 5F5AA 1JYNA 5FKCA 2EIEA 4P9IA 3WG4A 1F2NA 1DQ1A 4S2GA 4XQ4A 2VZQA 2D6OX 2VCMA 3H3LA 1I9RA 3VKFC 1DDLA 3MEPA 2AYHA 2VUAA 4E8DA 2KA3A 2WO3A 1H1MA 1GQHA 4EN7B 1EAH1 2XJSA 3ZXKA 1RVF2 2GNBA 2HWF2 1RUD3 1GOHA 4HVRA 3GZAA 2EIGA 5T3NA 4AFCA 3K4ZA 3RGBA 3KCYA 5IVBA 4QHBA 2FZ1A 2JE8A 2V09A 2WZPP 3RNSA 4ORFA 2WWJA 1UCXA 4I09A 5BY5A 3C7GA 1OVSA 5HCAA 1WCUA 2YC0A 3N9PA 2GNMA 2VAUA 2ZMNA 5E6HA 5DDJ1 4GALA 4CU6A 2QJVA 2VVEA 2IUWA 4IEQA 1NCQA 2YGMA 2XVKA 1UXXX 4A44A 1W0PA 3IBMA 5FJKA 1IZ3A 4QAWA 5FRAA 1PVC3 5GZEA 3I2GA 2RR11 4A6SA 2ZZJA 1RTVA 4LKFA 3HT2A 4TN7A 1UL9A 4QB1A 1AL21 2ZAHA 1Q5OA 2QUOA 4YW3A 1AYN3 3ZYPA 1ZYBA 5CADA 3BKZA 4OFGA 4EE2A 1MZFA 1V9U2 4YLZA 5C8WA 1AR73 2BEOA 4Q4V1 3ZFGB 1RUC3 4AF9A 4PI0A 2VTXJ 4QQ2A 3PURA 5GLWA 2X10A 3MIFA 3R6SA 2FDIA 3BU0A 3HNYM 3THTA 5FTTC 4S2FA 5C8CA 2WS92 1CIYA 2CNAA 2JDNA 1SQ4A 3NJZA 3IN9A 2WYSA 3IAPA 5CFDA 3BB6A 4XC9A 1A78A 2H6CA 5FLHA 3ZFFA 2WA4A 1WKYA 2HWE1 3GXUA 2G1MA 1REFA 4RR3C 3UYJA 1BCXA 5CU1A 4YZ5A 1PK6A 3BGAA 3GZEA 4XQDA 2DUQA 5FUIA 3OTFA 4L92A 4WZFA 3MICA 2Y64A 1QH6A 1UU4A 4OVEA 5CKMA 4NUBA 3R4SA 2D6LX 3SITA 1W2UA 1JYCA 1J3QA 1GZCA 3WR0A 4URTA 2J42A 1JTZX 4JRLA 3O1UA 2GU9A 1QJY3 4JHTA 4C1XA 4AOCA 3NAPC 1RJ8A 3Q8CA 3A4UA 1QOTA 3KM5A 4CDQC 3LFIA 3RMXA 3RVHA 1O4TA 2W5FA 3CDZB 2A71A 3N9LA 3WV6A 5CFCA 1MS9A 1BKZA 5IK4A 1GICA 1DYKA 3BPZA 4BOWA 5ACA1 5ISLA 1UU6A 2D6PA 3CZJA 4JGYC 3E6DA 4OI2A 4ONUA 1P8JA 4A4AA 4FBFA 4K20A 4LIVA 3G6JB 3TNQA 1QIQA 3WDUA 3U4XA 3TN92 1UMIA 5ABJC 1FATA 1QQP2 1NQJA 1RUJ2 5DAWA 2NLRA 1GWMA 4Q1PA 5FMOS 4ZU4A 3RZMA 4UFJA 2DCKA 3IPVB 3M3CA 1G7YA 4AAPA 3WP5A 5JSOA 3VZKA 1G9DA 2HEYF 1LOAA 1VBC2 4A2UA 5FYZA 4MZUA 4HSLA 2WQZC 2R1BA 2XXZA 5JXJA 1X8EA 4B8EA 4DEVA 2AREA 2P1BA 5A70A 1W6QA 4C0HA 4XUQA 1W6OB 2AC1A 3PTYA 1VBB2 1D0GA 2XR4A 3BOPA 3AKQA 1VMFA 4B29A 2XLGA 2Y6GA 1QMJA 4P00B 2VU9A 4NIHA 4QKFA 3EBRA 1RUH3 1X9PA 5DUWA 1TZOA 3KQ4B 1XJAA 4LNVA 5C3QA 4W6XA 4UAPA 1YIFA 1XNBA 2D93A 1GLHA 2QZ2A 2WDBA 3DCQA 1DU3D 4Q4Y1 3CJXA 4UF0A 3RS6A 3GYDA 5DZGA 4DPNA 3ZXDA 1Z7S2 4XCAA 1WD3A 2ARCA 4YM0A 3V65A 1LHNA 2C24A 4BJ0A 3ZFGA 4CRQA 1ZBE2 4DXTA 2BTVC 2NMOA 4L0PA 4XF9A 1UO9A 3NV3A 4K7JA 3SXWA 3POYA 3USUA 5JDBA 3CJIC 2R071 1HJFA 3MIGA 2H6BA 3PIGA 1V00A 5L9VA 3ZYBA 1HB3A 1IQAA 1V0AA 4LKDA 4OQ9A 2EXHA 4M0NA 4L2NA 4RR3B 5J48A 3BIWE 3D0JA 3THCA 1ZVFA 4C1WA 4AVSA 1MZ5A 3PVEA 5FYIA 5IVYA 3FWEA 2W1SA 2RE9A 3HIFA 4D7TA 2JDUA 2W52A 3ILFA 4EV0A 3ASIA 2Q0AA 3P3NA 3RDIA 3CBNA 5KXCA 2VCCA 3AMHA 1QJEA 4GKYA 2GH2A 1Q3EA 5FZ0A 1G9CA 1AR92 3WUDA 4CP0A 4XTMA 3NAPB 5IAVA 4TSVA 2WZR1 2DVFA 1SHWB 4IXLA 1F8VA 3MDPA 4IV1C 1AR63 3BIEA 1NZIA 3CKHA 4AQSA 1PGL2 1CZTA 4LR4A 4JGYB 3MHZA 3NNLA 3WNMA 4XJWA 1XYOA 3D6EA 1Q8SA 4FPOB 3RYRA 1S4CA 1MS4A 3NV4A 3ZYFA 3DECA 5C71A 2YG0A 1W8OA 2B9VA 1DP0A 3SCGA 4F8AA 2D43A 1J58A 5JR2A 1ULGA 2ZXQA 2ZEYA 4QX7A 1OD5A 1Q8VA 2XBO2 3GHMA 4KG8A 5FMOL 3NNMA 3VBOC 4E9KA 4BQXA 5C33A 1Y9QA 3ACIA 4NOTA 4YW2A 4MGZE 3L2YA 4ZXEA 3MF6A 1DF0A 1AYM3 4Y20A 3VHOA 5CG9A 1W6OA 2YFUA 1W6PB 2JKBA 4Q0SA 1GWKA 1ZBA1 4D3WA 1PZ8A 4FXGB 1RMU2 3V56A 1ZRIA 1KQRA 2R062 1RUE2 1LOGA 2UY8A 3WNXA 4AGRA 2A70A 2B45X 3I54A 2DU1A 4DXZA 5FZLA 4AEJA 5A3NA 3KT7A 4Q0UA 5GZCA 4YWAA 5FXVA 5DN2A 1D4M3 3EHKA 1I3HA 5FLJA 4FFFA 1XNDA 5GLUA 1ZNPA 1PMIA 4QKNA 5A7PA 3GBGA 4QXCA 3O1PA 1K42A 2BP6A 2WNUC 1YJLA 2K2SA 3VKNA 1TMF3 1REEA 1J3RA 1BMV2 1UZZA 2P3YA 4XFFA 4N53C 2DVBA 4AI8A 4ZZ8A 4XFAA 2JE9A 3AZYA 4M3CB 4CCJA 4N9IA 2R30A 4BQYA 2WA3A 3GBFA 2CGOA 3QBQA 2EIDA 5KXBA 3SKJE 1O8SA 2VZ1A 4NRQA 3T3YA 2QQJA 4DUVA 5CYYA 1CAWA 4RR3A 4FPFA 5A3WA 4GULA 1VMHA 2PQQA 3IDBB 4R9CA 4XMAA 3VZJA 3KSCA 3RG0A 2VMEA 4IEUA 4NAOA 3SH3A 4CCNA 1C1LA 3Q8AA 1WLWA 1RL3A 3SH5A 4GA9A 2Q8EA 5FY5A 4JV4A 2OS2A 3I2HA 4Y4YA 5LY1A 4R4XA 4RD7A 5CEHA 2P3KA 3KLSA 1LNSA 1VRH1 5C4WB 1TNRA 5JZGB 3LZZA 1H2MA 1XU2A 4GZ9A 1CWPA 4H7LA 3NAPA 1C4RA 2O8QA 5BV6A 1EAH2 2YXSA 4TTGA 2WO2A 4AYUA 1F5JA 4P02B 1X33A 3OY8A 1EV11 4BA6A 3KV5A 2VVDA 4DINB 4P08A 4ASKA 1VRBA 1DFQA 4JGYA 1AX2A 1JZ5A 2X05A 2E7AA 4OHWA 4YSFA 4XXPA 1GSLA 1EY2A 2PMWB 5ABJA 1LODA 3N7KA 3A21A 2RDSA 3OUHA 1T2XA 3JD73 3QD6A 5T50A 1PO23 3FL7A 1HXS1 4XBNA 2EA7A 3N9OA 5DDJ2 1JN2P 1WA4A 5J3UA 1COV1 4LBOA 1RUI1 2W0XA 4YGEA 3CU7A 3VBOB 5E1RA 3LPFA 4CP1A 1DZRA 2QQPA 3HJRA 4BMEA 5APAA 3FMGA 3HT1A 3J7HA 1HRV1 1GOFA 1YRZA 2YROA 4W6YA 3ETQA 3GM8A 3AZVA 2RR12 4PDWC 4XDPA 4YRDA 4WBBA 4JRAA 1AL22 4LBMA 4CDUC 4A42A 4ATEA 4HN0A 4PIYA 3OUJA 5FY8A 4UT5A 2ADEA 2PLV1 1SDWA 3FBYA 4L8QA 3U1XA 2CHHA 2XMLA 3DYMA 4Q4V2 1SBDA 1UZ0A 1KJLA 4Y5TA 2GDFA 3MLKA 4QU2A 4MHRA 4YZ1A 2OZ6A 4FTEA 1SLAA 2XLFA 4IV3B 1FOD3 2KXLA 1LENA 2D3PA 2RJLA 4QPGB 5DUUA 2BOJA 3ZSEA 3O0XA 2CGPA 1KXGA 4LBKA 1QHDA 2VQ0A 2D44A 2E7QA 5FKBA 1IPJA 3ZMOA 2WNVC 1UMZA 3CJIA 2ATFA 2V73A 1DHKB 1NUKA 2E6VA 3PUAA 2HWE2 3I3EA 2Q4SA 4GJYA 4Z2AA 3HR9A 2IXKA 5GZDA 1VBD1 2QE3A 2XJQA 2JB8A 3HMYA 2X8KA 3JBG3 2EF6A 4N7UA 4CCCA 4HK8A 1KGYA 1YQ5A 2WC2A 1GUIA 2BVBA 2RDQA 5FUPA 5IFTA 1QNWA 3ZFEB 4BQ5A 1JHJA 4XJUA 4E2SA 2Y0IA 3ZYGA 4PBOA 1WBLA 1QXJA 3P5BA 4BK5A 1NCRC 1C5HA 1K5JA 4BIOA 5C4WA 5FDBA 2I2SA 1N1VA 2HWF3 3HN3A 3NL1A 5FWJA 1DQ6A 3ZN6B 4UOJA 2P3IA 1JYXA 3ACLA 3O14A 1OKOA 2DVAA 2B8MA 2XHKA 5ACA2 3LQCA 3TEYA 3PIJA 2R043 2RS11 3NV1A 2PA7A 1DYOA 5SV8A 4AGVA 4M00A 4DUWA 1R081 3F95A 3DF0A 3N7LA 5BNQA 1YCIA 4JKLA 4QX2A 4YYOA 1I6XA 3WF4A 3M2MA 3ZSKA 1W04A 2P2KA 3LOIA 3ZKUA 3WF1A 2R1DA 1H6XA 1TNFA 2HBUA 3AJYA 1RUF2 1XYNA 3AYAA 3AZXA 3W9AA 1STMA 5DUVA 4KU8A 2TEPA 3NRUA 3VBOA 4V2VA 4NWVA 2CGNA 1RJ7A 2ZGTA 3AFKA 5HCBA 5B4NA 4OULA 1FMD3 3RZJA 3OOXA 3W5NA 2YC2A 3FLTA 2RDRA 5FYUA 4D6RA 1ZRCA 1IPSA 2GNTA 1BVVA 4CDUB 5IVCA 2CDPA 2P37A 2VR4A 3J9SA 3T4HB 4Q4Y2 3UJQA 5EV7A 3RZZA 2W2IA 5L7OB 4AEMA 5FZFA 2D3SA 2RV9A 4HKOA 2Y6HA 3G7DA 1S55A 4OHXA 2RM22 2E63A 4LHSA 1WW7A 5I0UA 2VMDA 1SMVA 2X29A 4AHYA 4UW6A 3TAYA 5K9YA 1W90A 4IV3A 2DYCA 4LHKA 2BWAA 1GQPA 2R072 1QH7A 3EJKA 5FZ3A 4CUBA 1KDKA 3CO2A 2HWD2 5C7GA 2D40A 3I3DA 3WT3A 1QJU1 1W2OA 3S57A 2NPIA 3PVNA 1HRI1 5F9TA 4PLOA 3K77A 2LRPA 5ERLA 3I2DA 2W39A 3MUY1 4LA2A 2CTVA 4XUTA 2CDOA 4G3YC 1KS5A 1LESA 1GBGA 4DRVA 4YFWA 4NHYA 2BFUS 4AVCA 2BGCA 2ZOEB 3AKTA 3ZFEA 4QGMA 4PBPA 3VDDC 2ZCWA 2EXIA 3I7DA 4QKBA 1QJX1 4CVUA 2GMEA 5FP4A 3OUIA 4BQWA 4XACA 5IHRA 1CPNA 4S2HA 4IEZA 2WT0A 2X09A 4IQPA 3FHQA 1W8ZA 3ZN6A 2Q1MA 2VXJA 3AP6A 1IKPA 3N9MA 3TN93 1H0BA 3AP4A 4CEYC 1O91A 2A6XA 1BK0A 3WW2A 2W47A 1X8MA 2HYKA 1SFPA 2VGDA 4F83A 5AC92 2FDJA 2J1AA 3VDCA 2ZX1A 1VBC3 2ZJCA 2YV8A 2LTNA 3LF7A 1T6BX 3BTAA 3M3OA 4WM8C 1LEMA 1ONAA 5F37A 4Z07A 3WF3A 4LT5A 2YPJA 2WIIB 4RSUA 4YW7A 3FLPA 1GNHA 4IUGA 4A3ZA 2JWPA 4GD4A 4XCBA 2XWJB 3C7OA 1VAMA 3OEAA 3Q8EA 2JDYA 1ASJ1 5JOYA 4LLOA 3WDVA 5LW9A 5FP8A 1ZBA2 3E5XA 2P34A 3H42B 2ZGPA 1FT9A 4MGKE 4FPHA 1XNCA 4XDOA 5ANNA 4DRRA 5HBAA 1POV1 4CYDA 3TEWA 5FK8A 3U14A 2LALA 4J1XA 1BEV3 3LOBA 3KVBA 4NHMA 1BK1A 3ENRA 4CDUA 1XBFA 4QXKA 5F5QA 2WWUA 3WSOA 1QXPA 3ROUA 5L7OA 4COYA 2ZACA 4MUVA 4NHLA 2PTMA 2XJTA 1HV0A 1MEC3 1D4VB 4HN1A 3UL2A 1DGLA 1JUIA 3DV8A 3FUQA 3L9JT 4WVWA 5DQ0A 4CU8A 5LBFA 5I93A 4QX0A 2AH2A 1OMIA 4Y1YA 1GFF2 1B09A 2ID4A 2WT2A 1ODNA 4NR1A 1H8TB 4JCKA 2TNFA 2ZA9A 5F3CA 1W8HA 4I3PA 3T1MA 3WOGA 2V4VA 3AYCA 3KGLA 1OQ1A 1W03A 1ENRA 3ZFFC 4BK4A 4NWWA 3BALA 2D6NA 4PCRA 4M4RA 2XJVA 2PHWA 1CJDA 2ZEXA 3E5QA 5JUVA 1W9FA 1DBNA 3R0RA 5FY7A 2TBVA 4DS0A 4XJAA 1SCRA 1XB9A 2HLEA 5CKQA 1WLDA 4QDSA 2RMU1 1E5HA 3RI9A 1VRH2 5JOWA 1FI2A 1UYZA 1X7NA 2BFUL 4FXKB 3VDDB 1R091 1ZZ7A 2VW1A 4YZ3A 5LRSA 3PU8A 1YUDA 2O8OA 4N7IA 4H7MA 3VBSB 1G6NA 3AKPA 2W68A 2VZUA 2YY1A 4ZU5A 1W3VA 1EV12 1O8PA 3RWKX 4CUGA 4AR2A 4AFDA 2JDZA 5I8TA 3NJVA 4L9BA 3RQ0A 3PJQA 4CEYB 4R9BA 2XHNA 1LCLA 5FYMA 2P5BA 4CP9A 5G05L 2D97A 2G4IA 5CG8A 4QU1A 1MS0A 5LB6A 3OD0A 5K8SA 2FZ2A 2WZEA 1HXS2 4XUOA 5FZ4A 5JCTA 1JYWA 1BLZA 1COV2 2GALA 1RUI2 1MVQA 3AKRA 4R4ZA 4XHBA 4YW4A 4Q27A 2RJ2A 5JOZA 1SBEA 3H8RA 2ZABA 3W5MA 4A45A 3UKVA 4C8DA 4YGCA 3QCWA 4QGLA 1HRV2 3CEWA 1IS5A 1ULEA 5FK7A 4QX8A 1MZEA 4XUPA 5EHDA 3OB8A 1NY71 2J1TA 1OLRA 1H30A 2X53S 4Q5OA 1R1ZA 1WW5A 3BPSA 3MIEA 1YC61 2PLV2 4AE2A 2G9FA 2QQWA 4B1MA 1MR5A 4EZHA 1JZ3A 3WG2A 1IKQA 3KCCA 2A3XA 2C9AA 2BNOA 2LW8A 3N7JA 3O1TA 5J09A 4HETA 1U5IA 5FPBA 1W39A 3OGRA 4K9SA 1UX6A 3C8XA 4NRPA 4IESA 3ZFGC 1RUG1 4Q4W3 5C5UA 1PGW1 4PIZA 5F5CA 1W0OA 1F35A 5A33A 4YW5A 1WWYA 2JEMA 4MYEA 4LE3A 4UFIA 1S2KA 4QWNA 4TLGA 4YG6A 3IZOA 1TME1 5JXGA 4KBBA 1H6YA 4QKDA 1O3RA 4N43C 4DB5A 1JHNA 1GNZA 1VBD2 3AL6A 1UPIA 3H1MA 4FOVA 4MV2A 1QNYA 1RYYA 1W8TA 3J8F1 4AVBA 2EALA 2VMCA 4A7KA 4L99A 3NNFA 1W6NB 3T0DA 1FPN3 3JB8A 4I02A 1JZ2A 1LECA 5FYCA 1JXNA 1XNAA 2VNGA 2RHPA 1WCKA 2ZEZA 1JS9A 4E4HA 3J7MA 1RHI3 4LOSA 4OHZA 1ZRRA 3EXUA 4YM2A 1BYHA 4QQOA 3ON7A 3O1RA 1WMFA 2RS53 4RGAA 3VDDA 5IVFA 5JXIA 1PO11 2WAOA 3KV9A 3A23A 3FBMA 4LO7A 2ZMKA 2G19A 3VBSA 1CGPA 2OQ7A 1CX4A 4GWIA 2RS12 4UW5A 3AK0A 1OT5A 2VMIA 1R082 4QB6A 1UU5A 3KB5A 4CEYA 2PHLA 4XJZA 3OF1A 2VJXA 3NJYA 3V0AB 2BDRA 4CCLA 1VBA3 5CAZA 4WM8A 4HT1T 2QKDA 3VB9A 3PUSA 3LEIA 2Y6FA 4XF1A 3B93A 4ARYA 2ES3A 1AL23 4P9YA 5A80A 1EYBA 3FZ3A 1JW6A 3WCRA 5JVVA 1Z0HA 1MS5A 4KWUA 4Q0VA 5JIAA 3EQEA 3ZYIB 5CZKA 1UY2A 3C2UA 4A7ZA 2PXJA 4Q0PA 1W2AX 3U4SA 4QHZA 5M0TA 3PVOA 4GQ7A 1LRHA 4FPLA 3FLRA 2VZSA 3MW4A 4YPJA 5A3LA 3VBUB 1RUD1 2OPWA 2VZRA 4ZS2A 1U5ZA 1OHFA 1IG0A 2A6ZA 3GCXA 4FSJA 1O4ZA 3M3QA 1PMHX 1R1A3 1LHWA 2FDGA 2R16A 4MVTA 1L7LA 2QCSB 3U75A 1VJ2A 3IMMA 5IK8A 5FYYA 2WAAA 5FMCA 1XE7A 3RZLA 1OD3A 1QJU2 1V6KA 1NG0A 1MS8A 2HH9A 4UW4A 1G9BA 1HRI2 4XF4A 5L36A 2PAMA 4N43B 3DXUA 5JOXA 4JQRA 2A1XA 4WM7C 2XGXA 2ZX3A 3KMHA 2UWAA 3CF6E 1ND3B 1W6NA 1S0GA 2VTXA 5FYHA 3WP6A 4CPBD 4GB33 1LULA 4GMP3 1JBCA 1VAKA 1AYN1 2E51A 1XXNA 3C7HA 2E7TA 2JE7A 1QJX2 2O0OA 1OI6A 1GZWB 4UYBA 1W2NA 2AEYA 1V6LA 2QQUA 1G9AA 3KT4A 1AR71 4SLIA 1O3QA 2CV6A 3W20A 3S6PA 3OPZA 1JZ6A 1RUC1 2DFCA 3PJYA 2TUNA 4LXLA 4FFGA 1ZM1A 1W06A 4LUMA 4ZS3A 2JDAA 1C1FA 2V4AA 1PNFA 4NPMA 4AEKA 4S2DA 3SEPA 4ES8A 5F6KA 1DGRA 1CX1A 1QJFA 1OF4A 4AQTA 2XVGA 4Y1UA 2IZWA 3MIBA 3H8OA 1Q8PA 1RUF3 5JR7B 3ZYRA 2BNMA 3N36A 3LA3A 5E8AA 1OA4A 3V0AA 3Q8BA 3LAGA 1WUVA 4MXWB 4N8MA 2ZX0A 3H1WA 2MHFA 2YB7A 2FCUA 4COZA 5D8AB 1V6JA 5J1XA 5FO7B 3LDKA 1PZ9A 1PIV3 2XQRA 4RHV3 4MOAA 3ZR6A 5IW0A 3BN6A 2EAKA 1ASJ2 1GV9A 1NYWA 1XNKA 1XOYA 4O65A 2RVAA 4IE4A 4QQPA 1YFYA 1WMEA 1QJY1 2CWSA 2XKOA 2ZAAA 2OKXA 4P9GA 3RZKA 2X5IC 5TSWA 5IFPA 2DURA 3VKOA 1JZ7A 3KHCA 5F6LB 1SEFA 2QVSB 4BPZA 1T6GC 2RM23 2VZOA 5FPVA 5H9RA 3WUCA 4DY5A 5FOBB 3S0MA 2VVFA 5C3OA 1JH5A 4Q4X3 4MGTA 1H8VA 4IETA 4YGBA 4BXSV 2YU1A 4C91A 4AFBA 2QQLA 3VBUA 3WP3A 3F2ZA 2C1FA 5F32A 5FPLA 5LZ6A 2GMPA 3DEMA 4OYUA 5J36A 1LGNA 3OBTA 5FZ9A 1HW5A 2DCYA 2HWD3 2XB6C 3WQ0A 1PGSA 2R32A 3MFAA 5KXDA 5HXVA 2OUHA 1JOJA 4QGNA 4AVVA 4E4ZA 1G9FA 4NVPA 3WZ1A 2ADDA 1W8NA 4QXBA 1IOAA 3AMNA 3JB4C 4JVAA 4A7YA 1OFNA 4N43A 3O1OA 2PHXA 4K8FA 3GDBA 3VKLA 4WM7B 4GWMA 4XOGA 2WFF1 2W1UA 5EYXA 1ND3A 2J1VA 1E5SA 2DCTA 1JI6A 5FUNA 1ZRFA 3WNLA 1Y9GA 3HVDA 2C26A 1UZVA 2RMU2 1AR83 1K45A 4IE0A 2ZEWA 3BCWA 1JMUB 1R092 4YVSC 3ZX7A 3OBRA 1UQXA 1GZWA 2C6SA 3I2KA 4HBNA 4FFIA 5C4WC 1E5RA 5JZGC 2BGOA 3LKJA 4H14A 1KRIA 1L3JA 5A7WB 4AI1A 4Y1VA 3J7LA 2PHDA 3MF9A 3WY6A 5IVVA 4QPIC 2FDKA 1LHOA 5A6XA 2DCJA 4RFT0 4CA9A 3VBHB 5AC93 5LK7B 2QQNA 3AL5A 1QGLA 4NRMA 2UY9A 2CAVA 5FXWA 1AX0A 2PN5A 2WN2A 1FNYA 2OPKA 3VUOA 1EUUA 3CNAA 2C5DA 5FCCA 5LASA 1OQDA 3SEEA 5DZFA 1AXYA 1O5LA 4KGGA 3VD4A 5A6QA 1A8MA 3OBZA 4LBLA 4JKMA 4LO4B 3IPVA 1VAVA 5D8AA 1ZBA3 1AL0G 3UGHA 1E57A 4UW3A 2JG9C 2Q1FA 2VC9A 1OA2A 2XONA 3PMSA 4IGPA 4IE6A 3BUCA 1OSGA 1QJZA 4KH9A 4BM8A 1TG7A 4AWDA 5JMCA 3ES4A 5DMYA 3U07A 3SKVA 3S5QA 3DKQA 3TNPB 1K12A 1YO8A 2X5IB 5DXDA 3LSDA 3IIAA 4DMIA 4COUA 5L9RA 4A3XA 1YI7A 4LULA 1Y9MA 1AR61 2XVLA 5A3TA 2JX9A 3UGGA 5FJHA 3BI3A 2ZKNA 3DKWA 3NKGA 4KGQA 2YDEA 3NNGA 2OXBA 2VUDA 2E26A 4BYYA 1Y4WA 3U78A 1RUG2 1SLCA 2CWMA 1PGW2 1OLME 1B35C 3DYPA 4KU7A 4IV3C 5DAQA 3LEKA 3KS7A 4QPGC 4CU7A 3VBRB 2YU2A 2VBBA 3EB7A 3ZSJA 1DZTA 4R9DA 2JB4A 3ZMNA 1QF3A 2WSVA 4ZKTB 1TME2 1VBE3 2E9QA 5JSPA 1JZ4A 2DCZA 2E33A 3KF3A 3WVJA 3KWVA 1H1IA 1XSRA 3VZLA 5F2WA 1ND2C 2VW2A 3J8F2 4EWDA 2J22A 5L9BA 2AZ5A 1AYM1 3OG2A 5I8YA 1XE8A 4DFSA 2WZ8A 3KQRA 4JC1A 1F9KA 4WM7A 1AXZA 5F39A 3QLQA 1IS3A 2FCTA 4JX0A 3T09A 3LEMA 2B9UA 2KD7A 3ZFEC 1XNTA 4XFCA 3O1MA 3HBKA 3HWJA 2WFPA 1ZZ9A 2JECA 5LBBA 5I0SA 3WW3A 4YVSB 3VN4A 1PO12 2HWC1 4AFMA 3RWNA 3LIGA 3ACHA 4E8CA 2AENA 4QPIB 4D0QA 4K1ZA 1YLLA 4LTAA 1H4GA 3FJSA 3JU9A 3VBHA 4CEWC 4HLTA 3Q9OA 1AHSA 2BV4A 1Q8QA 1QU0A 2XJRA 1S0CA 4FPGA 4K8RB 3UJOA 5EJ1B 3VD5A 1SCSA 1N3OA 2VH9A 3RSJA 3WHUA 2VZ3A 1DGWA 5H9SA 3GF6A 2GSYA 1YJKA 1S2EA 2BBVA 2DVGA 3WW1A 5FFOC 1YXWA 4XF3A 4E2GA 5FMDA 1W05A 3D3AA 4ZY9A 1YWKA 3QH7A 4D7YA 1DGWX 1YQ2A 1US3A 1J84A 1DZQA 2JG9B 4YG3A 5FY1A 1YIPA 3MUZ1 4YM3A 2RS31 5A3UA 2XUEA 4LHNA 4LBQB 1W6PA 1W9TA 2X5IA 1ZX5A 2W1WA 4MGSA 1VR3A 2VO5A 2WO7A 3AVSA 2WO1A 3W58A 5IAXA 1RUD2 2JKXA 4B4PA 5L7OC 1LGCA 3HD8B 2WSUA 2FDFA 3NQHA 4XFBA 3THDA 1DG6A 3BTXA 4GH4B 3T0AA 4JHZA 1SFNA 4NO4A 4AK3A 5LCWL 4KWJA 4HKLA 3AVRA 1Y7BA 4OUMA 4RS5B 1S0FA 1B35B 3VV1A 2OZJA 3VBRA 5FZ6A 3JUUA 2WLQA 5GJ6A 2YHJA 2JICA 3JD71 4MADA 4EN0A 1N47A 1POV0 5FMBA 1HB4A 2A6YA 1UOBA 1NZCA 5JIUA 2VPVA 5FIXA 4XBQA 4M3CA 1DLLA 2Z79A 5EZWA 5EJ3A 2VNRA 5KWRA 4AI2A 1ND2B 4IGOA 1GP4A 3ZOIA 3KHBA 2YMZA 3MV01 4XFIA 4MH0E 4CP2A 4CXYA 4YZ2A 2VQUA 3FUOA 1YFXA 2CY6A 5HPOA 2CYFA 1AJOA 4AAXA 3U37A 3WQ7A 1AYN2 3MZHA 3ZLIA 2Z69A 2F4LA 1JUHA 2A6VA 2NQYA 1AR72 3PUQA 2VL4A 3P3PA 3ZSLA 4KNCA 1OH3A 3NW4A 4YVSA 1RUC2 4KI5M 3FHIB 4YARA 1R083 1RVF3 5JZGA 4B4RA 1W28A 4EN8B 3RZGA 3K4AA 2K0GA 2YBPA 2Y8KA 1FOD1 3GJAA 1WCQA 3MI8A 4IDZA 1H2NA 4FPKA 2A73B 4QPIA 5EPAA 3AFGA 2XJPA 2OT7A 5F3EA 3NNJA 4BMBA 4CEWB 4D7SA 4PLNA 1ALYA 2XDVA 2AEZA 1UYYA 2WQ8A 2OUJA 4QT6A 4Y22B 5T52A 3O12A 2VUCA 4FCAA 4V1PA 1OBNA 2ARAA 3B02A 4NHKA 4XAAA 3K48A 3AXDA 5FYBA 5KHHA 3OYWB 2J1UA 4EN6B 1VP6A 3JBG1 3M3EA 5FY9A 3UETA 1Q56A 5IATA 1NLQA 5J96B 2VTFA 4N90A 4Y5SA 4HMZA 5FP9A 2PAEA 2VECA 3AP9A 1LOEA 3CZUA 2VMHA 5DAPA 3TRSB 4X8NA 5FV3A 1U12A 3WF0A 4IEVA 3D5OA 2JG9A 1K5MB 2ZGUA 1NXMA 1UZYA 3H9AA 2Z5WA 3OBAA 4Y5Z0 4CE8A 1YHFA 4LBQA 2P17A 4LQRA 1V9U3 5C9AB 1A34A 4RGKA 1ZZ8A 5FQ0B 3RMYA 2J7MA 4HVOA 1YEWA 3AP5A 1HB2A 1V70A 1QOSA 4LKSA 2D7FA 2R041 1VLNA 3C7FA 3ME2A 1KEXA 5LA9A 3WQ1A 5LWBA 1ODMA 3MW2A 3OJBA 1NX9A 5FREA 4DZGA 3B01A 4GH4A 4AHZA 5K7PA 2WS93 4PT6A 4WVZA 2HEWF 4NIDA 1LGBA 4RS5A 4XMIA 1RXFA 4DEQA 2DDUA 1B35A 5A7QA 4ASMB 3FE5A 1H8TC 4XILA 1SDDB 1RXGA 3MFCA 1LJ7A 4QPGA 4NIAA 3POSA 3TEXA 2GH8A 3VL9A 4ZU7A 4AEDC 1PHMA 5CISA 3A22A 4JGZB 3WNOA 4Y3OA 1JU4A 4MGIE 2ZMLA 4FVVA 3VD7A 1ND2A 4XE9A 3BODA 1FMD1 2WFF2 1J59A 3R05A 3KCXA 3N7MA 4QX3A 3JQWA 1OH4A 1W9SA 2UYAA 3U11A 3PLQA 1ZREA 4DQAA 4XETA 1F4HA 2ZZQA 5SV5A 2RDNA 1F15A 2A3YA 2VZTA 2YBKA 4P9LA 4HVQA 4D94A 2ZGMA 2BPA2 2XL7A 1HKDA 1GP6A 2WZR2 1SFYA 2JDKA 2VOWA 2A75A 4HKWA 3VBSC 4AQ2A 5I0RA 2W95A 3QACA 5IUQA 4NIIA 4Z1VA 5L19A 4XURA 1WD4A 3U10A 1L7RA 4XXAA 5FZMA 4BHPA 3E1F1 5FPUA 1QQP3 1RUJ3 1G8WA 1HX6A 2YUEA 4CEWA 1J1LA 2DTWA 4QDQA 5JAXA 1DQ5A 3ELNA 4IE7A 2VQTA 1JODA 3M4FA 4Y22A 3ZYJB 1AZDA 3MV11 4NHXA 2KM2A 4D6SA 4P14A 3K2OA 4P5HA 1Y43B 4QXHA 2UURA 4V2WA 4AXOA 5A1LA 1LEDA 3O0VA 2VQAA 4LORA 4AHWA 1SG3A 1EPWA 1BBT1 1V6NA 4JAAA 4NPRA 1VBB3 2JG8B 2UU8A 5DG2A 3AM2A 3DN7A 2GMMA 3KD4A 4QD2A 4XABA 2VNOA 1K5MA 5FZ8A 1BQPA 4BISA 1MQTC 1URXA 3I2OA 4HK9A 2FHRA 3UKNA 4E27A 2HWB1 3QH6A 3H1YA 1GZ9A 1AR62 3HBZA 5C9AA 1UW8A 2WINB 5FQ0A 1Z7S3 2K46A 3UGFA 3OGJA 4XBLA 1ZZCA 4UBGA 1ZBE3 2WABA 3O0WA 4WVVA 4UI9L 2JJ6A 3K51A 4YG0A 1VBC1 4MSVA 1VE0A 3DXTA 1LOCA 4BLIA 1F5FA 2OIIA 5I8SA 4QQLA 1W6MB 1FNZA 1C3HA 1X9TA 2MEV1 4CXXA 5KHIA 1FX5A 1XE0A 2GC2A 2UWCA 4Q2FA 1N3QA 4XQWA 3QOPA 2R49A 4AEDB 3B00A 5KC5A 1KFUL 1AYM2 3DYOA 2VZPA 2Q30A 3IM0A 3AZZA 4YW6A 5AFEA 3POFA 5A32B 4UFKA 4L97A 1ST8A 1OF3A 1J83A 3H8UA 1BEV1 1ENSA 1WGPA 4CUAA 1YYNA 1AR93 3MO4A 1BVP1 5KXEA 1F4AA 2ZGKA 1WCSA 2WNOA 4QB2A 5IVEA 4M4PA 1CIWA 5IT6A 1ZA7A
chains in the Genus database with same CATH topology
2GN3A 4ISQA 5BYNA 2ZGQA 2HEVF 3H7YA 1MEC1 5DG1A 2HWC2 5EXOA 4XPVA 2VXRA 5A3MA 4C0BA 4CTEA 2GAUA 1CESA 1AUYA 2ZKLA 4IEOA 3ST7A 4J1WA 4PJYA 3OGGA 1CAUB 1DQ2A 1QDCA 2XBO3 5LEJA 4ASLA 1WLTA 5T5LA 5BNOB 3W59A 2Q1ZB 3S7IA 4GWNA 4FO9A 2VY0A 2E53A 4K3UA 3VHRA 4EJRA 2AGSA 5FPZA 4Q29A 4AQ6A 4E4DX 2JG8A 2XL9A 3NWKA 4UBHA 3DGTA 1RMU3 2R063 4QX5A 1F31A 1RUE3 2RS32 1YFWA 4X6RB 4CDWC 2Q5TA 4FAGA 4YFZA 1MQTB 3LB9A 1JYIA 5T55A 1XQNA 3SCHA 5T54A 1CPMA 2Q8OA 1EPZA 1A8DA 1RUG3 5GALA 5FAXA 3VBUC 2FMYA 1WW4A 4BZ4A 4RA0A 2R6QA 3APBA 1A3KA 2IXJA 3JD72 4JDOA 4O9GA 3B69A 1O3SA 1W6MA 2JENA 1H8TA 2AR6A 4Z2WA 1DQ0A 5FOJB 4BH9A 3D82A 3FFZA 1DQ4A 1UIJA 3AB0A 4AEDA 3LCPA 4LA3A 4FQ4A 5GLTA 3ZXAC 5CB7A 2O1QA 1ND3C 4FPYA 1C8M1 3ECQA 1GANA 3VZNA 5CBLA 3LA2A 3CLPA 1PNGA 1ENQA 2VOXA 4XF0A 1BXHA 1TE1B 1EAH3 1S0DA 3M8LA 1BMV1 5EWSA 4B3NA 4FTBA 3ZN5A 1LOFA 1CQ9A 1KD7A 4Q4W1 3D4KA 5C6CA 4I3GA 5AVAA 3VLBB 4TZDA 2GC1A 3D0SA 1QY4A 3E6CC 2XKPA 4GXLA 1OOPB 5AVPA 4CDXC 3WG3A 2ERFA 3WINE 1IPKA 1QOOA 1CAUA 3GZUC 3AMQA 5DDJ3 2QFEA 4Y26A 4FP3A 3RI8A 3HQXA 3JBG2 1RGSA 5BNOA 1XU1A 2V5YA 3WDWA 3RJRA 1IHMA 3NKTA 5D8AC 4FPCA 1FPN1 5JCTA 2DV9A 2ZS6B 3MLJA 4DNYA 3ZXLA 2DUOA 1YNAA 2ZHKA 3DPRC 3TYJA 2RR13 3MIDA 5CFCB 5I91A 1RHI1 4EN9B 3I8TA 3VBFB 3H3UA 4XYXA 3SNMA 1U5XA 3LGRA 4CDWB 2RS51 1APNA 1WBFA 1SLLA 4Q26A 5I0TA 1MQTA 4PLMA 5L73A 3B9IA 4Q4V3 2BYVE 2R042 5HI0A 1C57A 3V64A 2GC3A 3AP7A 4BQ1A 2WWSA 4C90A 4YZ4A 3VHNA 1X50A 4GIQA 1W6QB 4X8PA 1VBA1 2QZ3A 4QM9A 4XDQA 4FAHA 2HWE3 3PHMA 1VB4A 4IL7A 2IXHA 4LUKA 5H9PA 1AJKA 3WHTA 1D0HA 1PM7A 1LHUA 5HCFA 3IMNA 1FMD2 1GKBA 3AMMA 4HSJA 1Q43A 1ULDA 4E2QA 4MGYE 1ULCA 1LU1A 3AYDA 1DGRN 1PVC1 2HKXA 4ES9A 1ZA4A 1OFSA 5CIRA 3SH4A 3RJ2X 3X29B 3ZO0B 3NV2A 3ES1A 2B42B 4PF5A 3USUB 3HN1A 1FXZA 1H4HA 4K21A 5ACA3 5JI9A 2EXJA 3M7AA 4B7EA 1R1A1 1ENXA 1NOVA 3B9CA 4MXVA 2BUKA 3VBHC 4YVWB 1HIXA 4TLFA 4XW3A 4M3CF 4RL7A 4WVMB 1SLIA 1OOPA 2IXCA 4CDXB 4COVA 3MYXA 5K0UB 3E97A 3ZPYA 1UD1A 4W6WA 3ZVXA 3WDYA 1CAVB 2A6WA 3MPPG 3R4UA 1BBT2 4GB31 2MNGA 4GMP1 3DPRB 3TWIA 3ZDSA 4COWA 3O5SA 5GKAC 5AFBA 1O5UA 5GLZA 3VBFA 4LO5B 3DUIA 2HWB2 4Q4Y3 4CDWA 1M06G 3S7EA 3ZXFA 4RQPC 1KITA 1QXRA 1HQNA 1D2QA 2NN8A 2Y26A 4PQ9A 2XH6A 1OQEA 4FT8A 4ZXKA 3ZIWA 1H9WA 2R073 4I0BA 1RUF1 4FQZA 4KL1A 2ZHMA 3N3HA 3VBRC 2IC1A 3WLUA 2MEV2 4Y20B 2NZ9A 2ZGLA 4QQHA 2B39A 1C8NA 3RPQA 5LRRA 2C0ZA 2NYYA 4JTOA 1PIV1 2XPJA 2WFF3 4RHV1 1CVNA 4P9WA 1A6CA 4ITCA 1RUOA 1I1EA 3IDCB 1N1YA 5BNPC 1C28A 1TEIA 1BEV2 2UYBA 4I0AA 3J26N 3OCPA 4HFSA 4CZSA 1RUH1 2RM21 1BJQA 2WZR3 3DL3A 4Q4X1 3WW4A 5B2GB 5H9QA 4OUSA 1NE4A 3B5LB 1HQWA 1MEC2 1VIWB 2G9GA 2LM3A 4I0WB 5BPXA 3GBWA 4LO6B 4QM8A 4D69A 4IEXA 5KHGA 2HWD1 3VGIA 3KT1A 1CAWB 4YVWA 3AXEA 4IEWA 3WDXA 1QWRA 3VKMA 4WVMA 1OPOA 2LUWA 4F3JA 2OW4A 3JCIA 4H55A 4CDXA 1NLRA 2PHFA 4U36A 2P3JA 1KFXL 2ZGRA 5EYYA 5K0UA 5CNAA 3B94A 1CAVA 3IWZA 4SBVA 2AUYA 2K9ZA 3M70A 1HV1A 1X36A 4MXWA 4P9JA 2YZ4A 3ILNA 2OYZA 4CDQB 4NN0A 3THPA 1AR81 3DPRA 4DOUA 2WQ4A 2XG3A 1V6MA 4XFGA 3OY8B 1NY72 2FMDA 2CL2A 1SACA 1O7FA 2YGLA 4PIXA 1Y3TA 2Y38A 3E6BA 1FAYA 4I30A 4JDNA 4RQPB 1KDMA 1EP0A 4FPJA 5AC91 5ABJB 2GN7A 4DY3A 2JXAA 4XHXA 5LEKA 4GH4C 4LHLA 2A7AA 1LKNA 4XIOA 1REDA 4RS5C 2ZGNA 1H2KA 4I2OA 2PHTA 3NVCA 4IERA 1LR5A 1LOBA 1I5ZA 3IT8A 2ZX4A 5GZFA 3VHPA 5IK7A 4AHXA 3MLLA 1X82A 2ZTNA 4OZXA 1C8M2 4LEJA 5BNPB 1NXD1 1HLCA 2PAKA 1VRH3 5J37A 3O7OA 2EVXA 2HWC3 5JSRA 2ARBA 3N35A 4EWAA 1QKQA 2F6BA 3T1LA 4LBJA 4KQ7A 5KBFA 4G4FA 1EV13 4Q4W2 1D4M1 3ZXEA 1PZ7A 1ZZBA 3CJIB 3GHNA 1LB2A 2I07B 3AYEA 1NA1C 1TMF1 5FBZA 5DZEA 3NSTA 2NP0A 4R9AA 1VBE1 4OI1A 2FQPA 1HXS3 1H1AA 4E4SA 4XJ9A 3T2TA 1COV3 1N1TA 1RUI3 4BE3A 1CD3G 1NE6A 1FPN2 4JDMA 4AI3A 2B7YA 3UKTA 3GZTB 1HRV3 2MPFA 3KGZA 4FOWA 1RIRA 2RS33 3CL1A 2DF7A 2WKKA 3AX4A 4BCUA 1RHI2 4XTPA 4CDQA 1K5MC 4M01A 1CR7A 4IV1B 2RS52 2PLV3 5D1IA 3PMEA 3EO6A 3UV9A 4YNIA 1IGOA 1S1AA 5C9AC 1MZ6A 4OI0A 4RGGA 1AVBA 2DWRA 3AKSA 4MLOA 4RQPA 3B7MA 2QDNA 4B4QA 4FOYA 1N3PA 2H0VA 1LTEA 2PFWA 4I01A 4Z82A 2IFWA 1AF9A 5T5OA 1RB8G 2GNDA 4FOQA 1CAXB 4AGGA 4ISRA 1RC6A 3ILRA 1VBA2 2B46X 4B7KA 3VZMA 1VBD3 2ZBJA 1PO21 3USSA 5GZGA 2PELA 4GKXA 4JGZC 1IS4A 1KS4A 2SLIA 1KJRA 2R0HA 3WDTA 1PVC2 2Z42A 2I74A 5BNPA 3I59B 1LU2A 3WD5A 2BQPA 1LHVA 2DVDA 2QDRA 2ZHNA 1MS1A 4MX3A 4YW1A 2WNUB 2OA2A 4Y1XA 3FFQA 3IDEA 2ETEA 5DUXA 1R1A2 2RS13 4N53B 1MVEA 2A3WA 4HANA 4OHYA 3I4IA 3C3VA 2HJIA 3NO8A 1PVXA 1NA1B 3WXPA 2IWGB 4QMAA 1XYPA 4FP2A 5EFUA 4R8HA 3MPBA 4IEYA 4K40A 3D8CA 4Q0QA 2PYTA 4LO8A 4HZFA 4U2AA 4Y1ZA 1H2LA 4GB32 3GNEA 3RYKA 1ULFA 4YGDA 2WNEA 2JG8C 1S0EA 3TBDA 3JZVA 4F7ZA 3R4DB 1QJY2 4X6QB 5GLVA 1CN1A 2D6MA 4IV1A 5LK5A 1RVF1 2HWF1 1MS3A 2VOKA 1S0BA 4IEPA 2VMGA 3U0ZA 2ZPXA 2R0FA 1FYUA 3LA7A 3OD4A 2EXKA 2VW0A 3INAA 2DUPA 3MGUA 3ZSMA 1OA3A 2ET7A 3SCFA 4FTSA 2XUMA 3ZIXA 1CAXA 4HPKB 1U5YA 2D98A 1QJU3 3B3QE 1DIWA 1HRI3 1WMDA 1UKRA 1PIV2 4RHV2 2WT1A 4META 1SBFA 1S2BA 1OKQA 4PDWB 1RINA 2ARXA 2VULA 1AXKA 1NLSA 5IK5A 3MW3A 1OLQA 5BNNC 5GM0A 1Q8OA 4Q8KA 3SISA 5JPMB 2VOVA 3RRDA 2UWBA 4M0HA 1RUH2 1QJX3 1V9U1 2IFRA 4JTNA 3I59A 4Q4X2 3VZOA 3WCSA 3BU7A 3H50A 1OPMA 1S0JA 2WNUA 1NQDA 5JPNB 5BXXA 1LOFC 2ET1A 3V0BB 2W08A 2WS91 1FV2A 4N53A 5F1RA 5CVRA 2WNVB 5T5PA 3M3IA 3ATGA 1NA1A 1ZRDA 4G9SB 1WW6A 4R52A 2ENRA 5FO8B 3AZWA 2VUJA 1BBT3 4WZCA 4XFHA 5KC6A 5BNOC 1S0IA 1WLCA 4XZPA 3JQXA 1ASJ3 3OYWA 4N9HA 1NCRB 1UIKA 5FPXA 4YM1A 3AJZA 3PVBB 2NMNA 1POV3 1AR82 2HWB3 3TOJA 5JI7A 1HQLA 2XWBB 3WG1A 2OVUA 1GR3A 2GZWA 2WL1A 2Y0OA 3IKWA 4Y24A 4UXAA 5J98B 2PHUA 1HDKA 4K6BA 5J7MA 2BVVA 4XJ8A 3TN91 4TWTA 4ATFA 3RYPA 1QQP1 1RUJ1 3H0OA 1VB2A 2MEV3 2FBEA 1UPSA 3SHRA 2XJUA 4FPEA 4AW7A 1RUNA 1UAIA 2I45A 1V6OA 3H3ZA 5KHJA 3AMPA 1UF2C 1NCQC 3M1HA 4HPKA 5JLVA 2Z2SB 4AVTA 5CA6A 3N4MA 4BLJA 2VG9A 1ZZ6A 2WLPA 3LSEA 1WCDJ 2D5FA 3L2HA 3ZXGA 1GQGA 1VBB1 3URFA 1M4WA 2JD4A 4PDWA 5KHKA 4JGZA 1XRUA 3MIHA 5BNNB 2RMU3 2B5HA 3SMHA 2BWCA 3WP4A 1R093 2ILMA 1CONA 1MACA 1UKGA 1Z7S1 4K1YA 4H3WA 2GC0A 4AFAA 5A33B 3VL8A 3WX5A 5C8CC 1ZBE1 2ZGSA 4L11A 5FO9B 1H9PA 2H0BA 2SBAA 1O4YA 1D4M2 5CFDC 3V0BA 3E5UA 4EWEA 1TMF2 2WNVA 2F4PA 1FV3A 1PK6C 2ZGOA 4QPYA 3FX3A 2DU0A 4OI4A 1VBE2 2ZX2A 1OOPC 3UK9A 3H7JA 4Q1RA 3PNAA 3A0NA 3ZXJA 4BWOA 2IXIA 2N7GA 4KWKA 3FC0A 3HAGA 1U0AA 1VALA 4Z92B 1CJPA 3KZ4C 4TYSA 3J4UH 4O9EA 4Q8LA 2BW8A 1NCRA 4LBQD 2ZHLA 4AG4A 4INDA 1AR91 5CFCC 4KG0A 4AVAA 1GYKA 1SLBA 3VBFC 2WJSA 1Z78A 4Z8BA 3A0KA 1IS6A 1PGL1 1SLTA 4LBNA 4LLFA 5E89A 1O3TA 4EROA 1QDOA 1J3PA 1RITA 1V6IA 4OHVA 2QNKA 4WM8B 3POWA 2XLAA 1G86A 4GMP0 2XBO1 4M3CE 1DYPA 1TME3 2DFBA 2BNNA 3SLIA 2RJKA 1NCQB 1PO22 4KWLA 1BZWA 3J8F3 4AI0A 5JWPA 1C8M3 3S30A 3ALQA 3TB0A 1C5IA 3LWCA 1RMU1 2YYOA 3BOWA 2R061 2NM1A 1RUE1 1YI9A 5E88A 4J6GA 5BNNA 1YFUA 5A32A 1AX1A 2PHRA 1PO13 1UN1A 1TQ5A 4XIKA 2EAAA 5C8CB 4HL0A 1D2SA 5E16A 1J1TA 2D5HA 5T5JA 4WV8A 5CFDB 3GALA 3ZN4A 1FOD2 4XEZA 4YVWC 3ZFFB 2CAUA 2DTYA 4LE4A 1PK6B 2IXLA 4OLLA 4BIFA 4P9XA 5FLIA 2D3RA 2D6KA 4W65A 5K0UC 1N1SA 2A5ZA 4P9IA 3WG4A 1F2NA 1DQ1A 4S2GA 4XQ4A 2D6OX 1I9RA 3VKFC 1DDLA 3MEPA 2AYHA 2VUAA 2KA3A 1H1MA 1GQHA 4EN7B 1EAH1 2XJSA 3ZXKA 1RVF2 2GNBA 2HWF2 1RUD3 4HVRA 3GZAA 2EIGA 5T3NA 4AFCA 3KCYA 4QHBA 2FZ1A 2V09A 2WZPP 3RNSA 4ORFA 1UCXA 4I09A 5BY5A 5HCAA 2YC0A 2GNMA 2ZMNA 5DDJ1 4GALA 2QJVA 2VVEA 4IEQA 1NCQA 2YGMA 2XVKA 1W0PA 3IBMA 1IZ3A 5FRAA 1PVC3 5GZEA 2RR11 2ZZJA 1RTVA 3HT2A 1UL9A 1AL21 2ZAHA 1Q5OA 2QUOA 4YW3A 1AYN3 3ZYPA 1ZYBA 5CADA 4OFGA 1MZFA 1V9U2 4YLZA 5C8WA 1AR73 2BEOA 4Q4V1 3ZFGB 1RUC3 4AF9A 4QQ2A 5GLWA 3MIFA 3R6SA 3THTA 5FTTC 4S2FA 5C8CA 2WS92 2CNAA 1SQ4A 3NJZA 3IN9A 5CFDA 3BB6A 1A78A 2H6CA 5FLHA 3ZFFA 2WA4A 4RR3C 2HWE1 1REFA 1BCXA 5CU1A 4YZ5A 1PK6A 4XQDA 2DUQA 3OTFA 4L92A 4WZFA 3MICA 1QH6A 1UU4A 4OVEA 3R4SA 2D6LX 3SITA 1W2UA 1JYCA 1J3QA 1GZCA 3WR0A 4URTA 1JTZX 4JRLA 2GU9A 1QJY3 4C1XA 3NAPC 1RJ8A 3A4UA 1QOTA 3KM5A 4CDQC 3RMXA 1O4TA 2A71A 3WV6A 5CFCA 1MS9A 1BKZA 5IK4A 1GICA 1DYKA 3BPZA 4BOWA 5ACA1 1UU6A 2D6PA 4JGYC 3E6DA 4OI2A 4ONUA 4FBFA 4K20A 3G6JB 3TNQA 3WDUA 3U4XA 3TN92 5ABJC 1FATA 1QQP2 1NQJA 1RUJ2 2NLRA 4Q1PA 5FMOS 4ZU4A 2DCKA 3IPVB 3M3CA 1G7YA 5JSOA 3WP5A 1G9DA 3VZKA 2HEYF 1LOAA 1VBC2 4A2UA 4MZUA 4HSLA 2WQZC 2R1BA 1X8EA 4B8EA 2AREA 1W6QA 4C0HA 1W6OB 3PTYA 1VBB2 1D0GA 3BOPA 4B29A 3AKQA 2XLGA 1QMJA 2VU9A 3EBRA 1RUH3 5DUWA 4LNVA 4W6XA 1YIFA 1XNBA 2D93A 1GLHA 2QZ2A 4Q4Y1 3RS6A 1DU3D 3CJXA 3GYDA 5DZGA 4DPNA 3ZXDA 1Z7S2 4YM0A 1WD3A 3V65A 1LHNA 3ZFGA 4CRQA 1ZBE2 2BTVC 2NMOA 4XF9A 3NV3A 4K7JA 3SXWA 3POYA 3USUA 5JDBA 3CJIC 2R071 3MIGA 2H6BA 1V00A 1IQAA 2EXHA 4M0NA 4L2NA 4RR3B 5J48A 3BIWE 3D0JA 1ZVFA 4C1WA 4AVSA 1MZ5A 3PVEA 3FWEA 2RE9A 3HIFA 4D7TA 2W52A 3ILFA 4EV0A 3ASIA 2Q0AA 3P3NA 3RDIA 5KXCA 3AMHA 4GKYA 2GH2A 1Q3EA 1G9CA 1AR92 3WUDA 4CP0A 4XTMA 3NAPB 4TSVA 2WZR1 2DVFA 4IXLA 1F8VA 3MDPA 4IV1C 1AR63 4AQSA 1PGL2 4LR4A 4JGYB 4XJWA 1XYOA 3D6EA 1Q8SA 4FPOB 3RYRA 1MS4A 3NV4A 3SCGA 4F8AA 1J58A 2D43A 1ULGA 1OD5A 1Q8VA 2XBO2 3GHMA 4KG8A 5FMOL 3VBOC 4E9KA 5C33A 1Y9QA 4NOTA 4YW2A 4MGZE 3L2YA 3MF6A 1DF0A 1AYM3 4Y20A 3VHOA 5CG9A 1W6OA 1W6PB 2JKBA 4Q0SA 4D3WA 1ZBA1 1PZ8A 4FXGB 1RMU2 3V56A 1KQRA 2R062 1RUE2 1LOGA 2UY8A 3WNXA 4AGRA 2A70A 2B45X 3I54A 2DU1A 4DXZA 4AEJA 3KT7A 4Q0UA 5GZCA 1D4M3 3EHKA 1I3HA 5FLJA 1XNDA 5GLUA 1ZNPA 1PMIA 3GBGA 2WNUC 1YJLA 2K2SA 3VKNA 1TMF3 1REEA 1J3RA 1BMV2 1UZZA 4XFFA 4N53C 2DVBA 4AI8A 4XFAA 2JE9A 3AZYA 4M3CB 4N9IA 2R30A 2WA3A 3GBFA 2CGOA 3QBQA 5KXBA 1CAWA 4RR3A 4FPFA 4GULA 2PQQA 3IDBB 4R9CA 4XMAA 3VZJA 3KSCA 3RG0A 4IEUA 3SH3A 1C1LA 1WLWA 1RL3A 3SH5A 4GA9A 4JV4A 4Y4YA 4R4XA 4RD7A 2P3KA 3KLSA 1VRH1 5C4WB 1TNRA 5JZGB 3LZZA 1H2MA 1XU2A 4H7LA 3NAPA 1C4RA 2O8QA 5BV6A 1EAH2 2YXSA 4AYUA 1F5JA 1X33A 3OY8A 1EV11 4BA6A 2VVDA 4DINB 1DFQA 4JGYA 1AX2A 2E7AA 4OHWA 4YSFA 4XXPA 1GSLA 1EY2A 5ABJA 1LODA 3N7KA 5T50A 3QD6A 3JD73 1PO23 1HXS1 4XBNA 2EA7A 5DDJ2 1JN2P 1WA4A 5J3UA 1COV1 4LBOA 1RUI1 2W0XA 4YGEA 3CU7A 3VBOB 5E1RA 4CP1A 1DZRA 2QQPA 4BMEA 3FMGA 3HT1A 1HRV1 1YRZA 2YROA 4W6YA 3ETQA 3AZVA 2RR12 4PDWC 4YRDA 4WBBA 4JRAA 1AL22 4LBMA 4CDUC 4ATEA 4HN0A 4PIYA 2PLV1 3FBYA 1SDWA 4L8QA 4Q4V2 1SBDA 1KJLA 2GDFA 3MLKA 4QU2A 4YZ1A 2OZ6A 4FTEA 1SLAA 2XLFA 4IV3B 1FOD3 2KXLA 1LENA 2D3PA 2RJLA 4QPGB 5DUUA 3ZSEA 2CGPA 3O0XA 1KXGA 4LBKA 1QHDA 2VQ0A 2D44A 2E7QA 1IPJA 3ZMOA 2WNVC 1UMZA 3CJIA 2ATFA 2V73A 1DHKB 2E6VA 2HWE2 2Q4SA 3HR9A 2IXKA 5GZDA 1VBD1 2QE3A 2XJQA 3HMYA 2X8KA 3JBG3 2EF6A 4N7UA 4HK8A 2WC2A 2BVBA 1QNWA 3ZFEB 4XJUA 4E2SA 2Y0IA 3ZYGA 4PBOA 1WBLA 1QXJA 1NCRC 1C5HA 4BIOA 5C4WA 5FDBA 2I2SA 1N1VA 2HWF3 3NL1A 1DQ6A 3ZN6B 2P3IA 3ACLA 3O14A 2DVAA 2XHKA 2B8MA 5ACA2 2R043 2RS11 3NV1A 2PA7A 5SV8A 4AGVA 4M00A 1R081 3DF0A 3N7LA 5BNQA 1YCIA 4YYOA 1I6XA 3M2MA 3ZSKA 2P2KA 3LOIA 2R1DA 1TNFA 3AJYA 3AYAA 1RUF2 1XYNA 3AZXA 3W9AA 5DUVA 4KU8A 2TEPA 3VBOA 4NWVA 2CGNA 1RJ7A 2ZGTA 3AFKA 5HCBA 4OULA 1FMD3 3FLTA 1ZRCA 2GNTA 1BVVA 4CDUB 2P37A 3J9SA 4Q4Y2 3UJQA 5EV7A 3RZZA 5L7OB 4AEMA 2D3SA 4HKOA 3G7DA 1S55A 4OHXA 2RM22 2E63A 1WW7A 5I0UA 1SMVA 2X29A 4AHYA 4UW6A 3TAYA 5K9YA 4IV3A 2DYCA 4LHKA 2BWAA 2R072 1QH7A 3EJKA 1KDKA 3CO2A 2HWD2 2D40A 3WT3A 1QJU1 2NPIA 3PVNA 1HRI1 5F9TA 4PLOA 3I2DA 2W39A 4LA2A 2CTVA 4G3YC 1KS5A 1LESA 1GBGA 4DRVA 4YFWA 2BFUS 4AVCA 2BGCA 2ZOEB 3AKTA 3ZFEA 4QGMA 4PBPA 3VDDC 2ZCWA 2EXIA 3I7DA 1QJX1 2GMEA 1CPNA 4S2HA 4IEZA 2WT0A 4IQPA 3ZN6A 2Q1MA 3AP6A 1IKPA 3TN93 1H0BA 3AP4A 4CEYC 1O91A 2A6XA 3WW2A 1X8MA 2HYKA 2VGDA 4F83A 5AC92 2ZX1A 1VBC3 2ZJCA 2YV8A 2LTNA 3M3OA 3BTAA 4WM8C 1LEMA 1ONAA 4LT5A 4Z07A 2YPJA 2WIIB 4RSUA 3FLPA 1GNHA 2XWJB 1VAMA 1ASJ1 5JOYA 4LLOA 3WDVA 1ZBA2 3E5XA 2P34A 2ZGPA 1FT9A 4MGKE 4FPHA 1XNCA 4DRRA 5HBAA 1POV1 4CYDA 2LALA 4J1XA 1BEV3 3LOBA 4NHMA 1BK1A 3ENRA 4CDUA 4QXKA 5F5QA 1QXPA 3ROUA 5L7OA 4COYA 2ZACA 4MUVA 4NHLA 2PTMA 2XJTA 1HV0A 1MEC3 1D4VB 4HN1A 3UL2A 1DGLA 1JUIA 3DV8A 3FUQA 3L9JT 4WVWA 5I93A 2AH2A 1OMIA 4Y1YA 1GFF2 1B09A 4NR1A 2WT2A 1H8TB 4JCKA 2TNFA 2ZA9A 4I3PA 3T1MA 3WOGA 3AYCA 3KGLA 1OQ1A 1ENRA 3ZFFC 4NWWA 3BALA 2D6NA 4PCRA 2XJVA 2PHWA 1CJDA 3E5QA 1DBNA 3R0RA 2TBVA 4DS0A 4XJAA 1SCRA 1WLDA 2RMU1 3RI9A 1VRH2 5JOWA 1FI2A 1X7NA 2BFUL 4FXKB 3VDDB 1R091 1ZZ7A 2VW1A 4YZ3A 5LRSA 1YUDA 2O8OA 4N7IA 4H7MA 3VBSB 1G6NA 3AKPA 2W68A 2YY1A 4ZU5A 1EV12 5I8TA 4AFDA 2JDZA 4L9BA 3RQ0A 3PJQA 4CEYB 4R9BA 1LCLA 2D97A 2G4IA 5CG8A 1MS0A 3OD0A 5K8SA 2FZ2A 1HXS2 1COV2 2GALA 1RUI2 1MVQA 3AKRA 4R4ZA 4XHBA 4YW4A 4Q27A 5JOZA 1SBEA 2ZABA 3UKVA 4YGCA 3QCWA 4QGLA 1HRV2 3CEWA 1IS5A 1ULEA 1MZEA 1NY71 1OLRA 1H30A 2X53S 5BUVA 1R1ZA 1WW5A 3MIEA 2PLV2 4AE2A 2G9FA 1MR5A 3WG2A 1IKQA 3KCCA 2A3XA 2C9AA 2BNOA 3N7JA 5J09A 4HETA 1U5IA 1W39A 4K9SA 1UX6A 3ZFGC 4IESA 1RUG1 4Q4W3 1PGW1 4PIZA 1W0OA 5A33A 4YW5A 2JEMA 4MYEA 4LE3A 1S2KA 4YG6A 1TME1 4KBBA 1O3RA 4N43C 4DB5A 1JHNA 1GNZA 1VBD2 3H1MA 1UPIA 4FOVA 4MV2A 1QNYA 3J8F1 4AVBA 2EALA 4A7KA 4L99A 1W6NB 1FPN3 3JB8A 4I02A 1LECA 1JXNA 2VNGA 2RHPA 1WCKA 1RHI3 4OHZA 1ZRRA 3EXUA 4YM2A 1BYHA 4QQOA 1WMFA 2RS53 4RGAA 3VDDA 1PO11 4LO7A 3FBMA 2ZMKA 3VBSA 1CGPA 1CX4A 2RS12