1UN1A

Xyloglucan endotransglycosylase native structure.
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
267
structure length
267
Chain Sequence
PVDVAFGRNYVPTWAFDHIKYFNGGNEIQLHLDKYTGTGFQSKGSYLFGHFSMQMKLVPGDSAGTVTAFYLSSQNSEHDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIYLWFDPTKEFHYYSVLWNMYMIVFLVDDVPIRVFKNCKDLGVKFPFNQPMKIYSSLWNADDWATRGGLEKTDWSKAPFIASYRSFHIDGCEASVEAKFCATQGARWWDQKEFQDLDAFQYRRLSWVRQKYTIYNYCTDRSRYPSMPPECKRDRDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords XYLOGLUCAN ENDOTRANSGLYCOSYLASE
publication title Crystal Structures of a Poplar Xyloglucan Endotransglycosylase Reveal Details of Transglycosylation Acceptor Binding
pubmed doi rcsb
source organism Populus tremula
total genus 77
structure length 267
sequence length 267
chains with identical sequence B
ec nomenclature ec 2.4.1.207: Xyloglucan:xyloglucosyl transferase.
pdb deposition date 2003-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
A PF06955 XET_C Xyloglucan endo-transglycosylase (XET) C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1un1A00
4Y1ZA 2LALA 3SH4A 4P14A 1AF9A 1G9DA 3M1HA 1QGLA 1LEMA 4R9DA 2ZHNA 3USUB 3V64A 1MS9A 2DYCA 4Q8KA 1Q8VA 4FOQA 4BQ1A 5GZGA 1OQ1A 1QOOA 3LSDA 2PHFA 2VH9A 1YYNA 3I8TA 2W39A 3WUDA 1FNZA 1F5FA 1GICA 4M01A 4PBOA 5E8AA 5GLVA 1S0JA 2FMDA 4XTPA 1H9PA 1MZ6A 2Q5TA 1G86A 4TZDA 5DZFA 3SH5A 1QOTA 5H9PA 3SLIA 4Q2FA 1SBFA 2NMNA 2JECA 3ILNA 4FPHA 4MYEA 4XE9A 1WD4A 2ZGLA 4W65A 5GLTA 3BOPA 4FPYA 3HMYA 5T52A 2AREA 4YW3A 4WZFA 2D6LX 2DUQA 2D6KA 3AJYA 4C1XA 3AK0A 4Q8LA 3SNMA 4LBKA 2PHRA 1LGNA 1UZYA 5LK5A 1LHUA 1W6OB 2DVFA 2JKBA 3PVNA 1LOFA 4GXLA 2D6OX 2C9AA 2AUYA 2GN7A 3APBA 3ZYPA 4Y1VA 2UWBA 4YGDA 1MVQA 1WW5A 4YM1A 1RITA 2D44A 2JE7A 4YM3A 3W58A 2ERFA 5EYXA 1SLCA 3CNAA 1HQLA 1WW7A 2VW0A 4WV8A 1W6QA 3OGGA 4AWDA 3OPZA 1BKZA 3VKLA 3BTAA 2JE9A 2A71A 3ZPYA 1HLCA 1W6OA 4KBBA 1SACA 1N47A 4YFWA 3UK9A 4JRAA 4Y22A 1IKQA 2YY1A 2PHTA 1G9FA 1MACA 3WDVA 4RA0A 5JLVA 5KXBA 1APNA 1UPSA 1V6JA 1GANA 1GV9A 4XMAA 1CONA 1ENRA 1D0HA 5GALA 3ENRA 3ZYRA 5F9TA 1ZM1A 1IKPA 4LBQD 4UW5A 1PZ8A 2XG3A 1Q8OA 1Z0HA 1MS4A 4YW4A 3N7LA 2A75A 3VKMA 3BODA 1MR5A 4K20A 4FPLA 5DUUA 3O0XA 4AGVA 5JOXA 3MW3A 1FYUA 3FLTA 2GDFA 4GKYA 1F9KA 2ZBJA 1DQ6A 4M3CB 4FOVA 2GNTA 2R1DA 5DG2A 1DGLA 1G9BA 1FV3A 1DFQA 1LULA 2EXKA 4SLIA 4XZPA 1AX0A 3MEPA 2JJ6A 4JCKA 4Y1UA 3ZSJA 2D6MA 4AGGA 1WBLA 3R05A 4FPEA 4AYUA 2A5ZA 3NV4A 3AYEA 2ZGTA 3NV2A 4TYSA 4NOTA 1ENSA 1N3QA 4M3CA 4BM8A 4YG0A 2WQZC 1O4YA 2ZHLA 3RSJA 3MW4A 3WLUA 2A6XA 5AVAA 4R9AA 1N3OA 1RIRA 2YMZA 3OJBA 4GWNA 2SBAA 3N3HA 3WHTA 4L8QA 1DZQA 1W6PA 1AJOA 1CPMA 1LTEA 2PHXA 3AZWA 4CTEA 4CRQA 1SLAA 3AXEA 2WNEA 2D43A 1W6MA 3B9CA 3NWKA 1N1SA 2DWRA 4YGEA 1C1FA 2AGSA 2E7QA 1EPWA 4XIOA 1W0PA 2AH2A 3C2UA 3PVEA 2EF6A 2GMMA 3OY8B 2R16A 1SCRA 4K1YA 2W08A 1BZWA 3PMEA 3T2TA 1GBGA 3RG0A 2A6ZA 1KJLA 2EAKA 2UU8A 1JW6A 1A3KA 5IK8A 1LU2A 1S0IA 2OUJA 1IS6A 4LBOA 2GNDA 2ZKNA 1W6NB 2W68A 4R9BA 3OY8A 4XMIA 3WG1A 3AP5A 1MS8A 5T5LA 1CPNA 2NP0A 2P3IA 3M3QA 1S1AA 5T5PA 2DVBA 3WDTA 4ATEA 3N7KA 1NXD1 2PHWA 3ZXJA 3RMYA 3D4KA 3R4UA 1D2SA 1S0FA 3M2MA 2CYFA 1N1TA 1URXA 1W6NA 3V0AB 1C1LA 2GNMA 4XXAA 4XYXA 2TEPA 1LGBA 2C5DA 4DS0A 1NLSA 4NO4A 1QU0A 1V6KA 4Y20A 4BOWA 2EIGA 2ZGNA 1WCSA 1QMJA 3WDXA 1LECA 2OVUA 3NV1A 2CY6A 5IK5A 1S0DA 1LU1A 4ITCA 1LHWA 1HDKA 3AJZA 5GZDA 4FPJA 1LEDA 3V0AA 1DQ1A 2SLIA 2ZGMA 2GALA 3AP9A 2A3XA 1SLBA 4Q27A 3USUA 2DTYA 4C1WA 5CA6A 1VAVA 2D6PA 4XDQA 3ASIA 5JOZA 1VIWB 3KQRA 3VUOA 5GLZA 3WUCA 5T5OA 2WJSA 2A6YA 3WHUA 3AXDA 1X50A 2P3JA 4P9WA 1S0BA 2DVDA 1BQPA 4AVVA 3ILRA 5T5JA 3L2YA 1VALA 4XJ8A 4XJ9A 5KXDA 4Y1XA 3ZXFA 4YZ2A 1U0AA 2NM1A 5GLUA 1HQWA 3TAYA 4FVVA 4XHXA 5CAZA 5IK4A 3HR9A 3FFZA 2DU1A 1J1TA 3N7MA 3ATGA 1BXHA 3WV6A 1KDMA 4DQAA 2A3WA 2VW2A 1LOGA 3B69A 5F5QA 4YZ1A 3ZXLA 1ULDA 2P37A 2ARBA 5CNAA 3DGTA 1ZA4A 2A7AA 5H9SA 5KXCA 1DHKB 2EALA 1AXYA 3T1LA 4YLZA 3N35A 1JUIA 2ZABA 4WVWA 3OBRA 1V00A 2NN8A 4Q1RA 1VLNA 2GNBA 1GKBA 3ZXKA 3WOGA 2V73A 3JU9A 4P9XA 2ES3A 4FPOB 1V6IA 2W52A 2VY0A 2HYKA 2E53A 2ZAAA 1G8WA 2EXIA 2ZGUA 1IOAA 2ZMNA 5GZEA 3M3OA 4XXPA 3WCSA 3FLPA 4ISQA 3B00A 1ULGA 2P34A 2ZACA 1CIWA 1BYHA 2G4IA 3W59A 1H30A 1MS5A 2JD4A 1HKDA 4XBQA 5DZGA 5HCFA 4BLJA 3WNXA 1GNZA 4LBMA 3N36A 3OYWB 4LBQB 4XJUA 4XOGA 3WVJA 3AX4A 1AXZA 4FQZA 4HANA 4P9YA 5T50A 2UWAA 4XJWA 3UJOA 2D6NA 5DZEA 1F31A 1R1ZA 4XILA 1CVNA 3SITA 4XJAA 1WLWA 3H0OA 3JUUA 2A6WA 4HL0A 4Q26A 3V65A 2PHUA 4DPNA 1ULCA 2E6VA 1YIFA 2VU9A 1KDKA 1ONAA 2DUPA 3B01A 2WLQA 3IM0A 3R4SA 3N7JA 4YGBA 2AENA 3RRDA 1N1VA 1JOJA 2KM2A 5E89A 1DLLA 2WT1A 3INAA 1FV2A 2NZ9A 2WT2A 4Q1PA 4XHBA 1G9CA 1V6NA 1WLDA 1N3PA 3A4UA 1UMZA 2GMPA 4ZKTB 1DYKA 3ZSKA 1GZWB 1TEIA 2ZGOA 3O5SA 2R49A 5EWSA 1A78A 4ATFA 1LJ7A 3IN9A 1QF3A 2CTVA 3MW2A 1CN1A 2R0HA 1SLIA 3IPVB 2I2SA 1SBEA 1BJQA 4YM0A 2EXJA 4GALA 1LOCA 5EXOA 4YW5A 5KXEA 1GZWA 1OKQA 2WSVA 5DUVA 2D3RA 5H9RA 2V5YA 3WDYA 1GLHA 1AXKA 3VKFC 2A6VA 5JDBA 5HCAA 1ENQA 5IUQA 2DVGA 4LBJA 3IPVA 4PBPA 1GZ9A 3AZYA 2DUOA 4YG3A 5GZFA 5L73A 1LENA 3NV3A 4R9CA 3RMXA 4Y20B 1Z78A 5GLWA 3FBYA 4DRVA 3WZ1A 1AX1A 4WVVA 1G7YA 2E51A 3GNEA 1KQRA 3D6EA 4UW3A 2D7FA 2ZGPA 3POYA 1W0OA 3B3QE 4FPCA 4FOYA 3RS6A 3T1MA 1DQ4A 2UURA 4FP3A 2ZGRA 2ZZJA 4YZ3A 3GALA 3FUOA 4YGCA 3WCRA 4BMBA 3AP6A 1WUVA 1FAYA 4M3CF 1SLLA 2D3PA 1FX5A 4GWMA 4DRRA 2CWMA 4H55A 4YZ4A 1FATA 4IQPA 1S0EA 3AYAA 2CWSA 3IKWA 1GNHA 1YI7A 2P3KA 3LSEA 1LESA 4XBLA 1V6OA 1GYKA 2GMEA 3QLQA 1CQ9A 4PF5A 1AZDA 3AZZA 4LBLA 1PZ7A 1YXWA 2R1BA 1MS1A 2CNAA 4I30A 3WG4A 1O4ZA 3AYDA 1UAIA 4FP2A 1LHNA 1S0GA 1LOFC 1WW6A 1LODA 1JBCA 1RINA 3DUIA 3WDWA 3U4XA 1WD3A 5JOWA 1UN1A 2AYHA 1VAMA 1IS4A 1LCLA 3LCPA 3ZXEA 1G9AA 4DFSA 2DTWA 5GJ6A 3WG2A 3OBTA 1I1EA 1I3HA 4XBNA 1UKGA 3ZVXA 3TB0A 2DU0A 3M3EA 2ARXA 3SISA 4YFZA 1UX6A 1W6QB 1WW4A 4Z8BA 3O12A 3Q9OA 4UW6A 1YO8A 1QNYA 2ZA9A 3ZSLA 5IT6A 4Y22B 1WLCA 2B7YA 2H0BA 5DXDA 4M3CE 1Q56A 3A0NA 2PELA 1SBDA 2JDZA 1YRZA 1DIWA 1Q8PA 1QDCA 4FPFA 4XTMA 4YM2A 3VKOA 1JHNA 1LOEA 5T55A 2WSUA 1DQ0A 3UJQA 4D69A 4K21A 2NYYA 1Q8QA 3BIWE 4OZXA 5GM0A 2OW4A 2WKKA 1KITA 1LHVA 5JOYA 3AZVA 4PQ9A 2ZHMA 3POSA 4GA9A 1SLTA 4U36A 4AVTA 2FHRA 4YG6A 4U2AA 3RQ0A 3WG3A 1DQ5A 4ISRA 1DYPA 1N1YA 1MVEA 3AZXA 3HN1A 1FNYA 4XJZA 5CB7A 1XQNA 3UL2A 4AGRA 1LGCA 3ILFA 4BMEA 2OUHA 5DG1A 2CL2A 3SH3A 3MPPG 2ZGSA 1CR7A 3POWA 4CZSA 3FUQA 1DQ2A 2DVAA 3VKNA 1QOSA 3OYWA 3D5OA 3AYCA 4K1ZA 4LBQA 3AFKA 1IS5A 2EXHA 1QKQA 1V6MA 4AVSA 4FPGA 2XB6C 2ZGQA 1MZ5A 4FPKA 2R0FA 3FLRA 4Y1YA 5JVVA 1UZZA 2WT0A 4YW1A 3PJQA 2YROA 4PCRA 4ZXKA 5H9QA 1C4RA 1W6PB 1LOAA 2NMOA 3AP7A 4FOWA 1JXNA 1KJRA 1AJKA 3PVOA 1JYCA 2YZ4A 1V6LA 1W6MB 1AX2A 3KM5A 4GKXA 1MS3A 1QNWA 3ZSMA 2AR6A 1C57A 2ZMLA 4UW4A 1GZCA 1ULFA 1AVBA 2BQPA 5DUXA 1B09A 5EYYA 5JMCA 1Y7BA 2D3SA 2Z42A 4FQ4A 4YW2A 3VV1A 4BPZA 4F83A 1CJPA 1LOBA 1QDOA 1SFYA 5CBLA 2DURA 4RL7A 1Q8SA 2P2KA 2VXRA 1IS3A 2VW1A 4XIKA 1LHOA 2YXSA 5HCBA 3QCWA 4ASMB 1OFSA 2A3YA 2GN3A 4YZ5A 2ENRA 5BYNA 1JYIA 5IK7A 3AP4A 2DV9A 4Y24A 3M3CA 4LBNA 5GZCA 3A0KA 4JC1A 1ULEA 1GSLA 1WBFA 3V0BB 2ZGKA 1JN2P 5T54A 2RHPA 5FRAA 4Y26A 1MS0A 4M00A 5E88A 5SV8A 3IMNA 2VUAA 4BLIA 2ZHKA 2UWCA 5DUWA 3O0VA 1SCSA 3I4IA 5FREA 2LTNA 1A8DA 1UL9A 1KRIA 3V0BA 2A70A 2ZMKA 1S0CA 2E7TA 1CESA 1DBNA 3O0WA 1H9WA 1PZ9A 2YV8A 3WDUA
chains in the Genus database with same CATH superfamily
5I0DA 4V1PA 4XF1A 1OA3A 4KG0A 1AF9A 4H7LA 2Q8DA 3S5QA 3QH7A 5LY1A 2IFRA 2IFWA 1K5JA 2JG8C 3KV4A 4OMDA 4R9DA 5HPOA 4CU8A 3USUB 3V64A 1VR3A 4CDWB 2DYCA 3CO2A 3KT7A 4BQ1A 1OQ1A 1NZCA 3NSTA 3LSDA 2PHFA 2VH9A 4IDZA 1ZRIA 2W0XA 1D4M2 2QCSB 2R061 2XJPA 4M01A 4AZZA 1GQGA 4B8EA 2Q5TA 4J1WA 1G86A 3I59B 1S2BA 5F3EA 4TZDA 4QU1A 3AMPA 3NJYA 5DABA 4E8CA 2UY9A 3GBFA 3MUZ1 3B7MA 2GC2A 4DUXA 1EY2A 4QB2A 1VMFA 4MYEA 3VBOA 1ZYBA 2X05A 4FPYA 4ES9A 3HMYA 3NAPC 3OF1A 4XFIA 3ZMOA 1YQ8A 4PLNA 3IBMA 4Q8LA 4LO6B 1QJFA 1RUF1 1BK1A 1LGNA 1UZYA 4ZHNA 1VJ2A 4MOAA 1LHUA 4X6RB 2DVFA 5K7PA 4MH0E 1MQTC 2HEVF 4Y1VA 2XVGA 3ST7A 1K12A 3AB0A 4JZRA 5JZGA 2VGDA 1RITA 3WF0A 2MEV2 4LK7A 1NAEA 1YI9A 4BE3A 2ERFA 2BW8A 1SLCA 2QFEA 1W8WA 4MXWB 5JR7B 3KHBA 1W6QA 4BA6A 3OPZA 1A6CA 4B4QA 1BKZA 3UKVA 3BTAA 2JE9A 5EJ1B 2OX0A 1HLCA 1W6OA 2QQKA 3MIGA 4YFWA 2HWD1 2UYBA 2YY1A 4B1LA 4SBVA 2H6CA 2V4VA 3IIAA 5FZOB 2BDRA 4IV1A 5JLVA 2OQ7A 2WABA 1UPSA 4LHKA 1GV9A 4QX0A 1R1A3 1XYNA 4QX7A 4UXAA 5IFPA 2V09A 1Z7S1 1ZM1A 3IDEA 4LBQD 5A33B 4M4RA 3CJIB 4W6XA 1Z0HA 2YBKA 1O3TA 3BODA 3VBHB 1COV1 3THCA 3NNFA 1O6UA 4E2GA 5JOXA 1CZVA 3MW3A 2GDFA 4JDNA 4GKYA 3TWIA 3VD5A 2VMGA 4GIQA 1POQA 4JTOA 2VG9A 4QX8A 4QPGC 5A32A 1ZBA1 1OF4A 1DFQA 4SLIA 4Y1UA 3RFRA 1GR3A 3RPQA 3MEPA 2JJ6A 4AGGA 3HIFA 4EZ4A 4UF0A 5CEHA 4CP9B 4MGKE 5FZ8A 1MZFA 3NV4A 2D93A 4AG4A 3AYEA 3NV2A 5IVJA 4TYSA 1LAJA 4NOTA 2CAVA 5BNPB 1E5SA 4M3CA 2WFF2 2WQZC 3FHAA 4YG0A 2ATFA 3ZDVA 4LKDA 5A1AA 3UGGA 2P5BA 1ND3C 4Q4X2 3LDRA 1JYNA 2YMZA 3HQUA 3LDBA 2HH9A 4QGNA 3CEWA 1SZBA 2O1QA 3ZFEC 1AJOA 4CTEA 4CRQA 4EN6B 3AXEA 5DAWA 1QWRA 5A3OA 4LR4A 1W6MA 1YLLA 3B9CA 1SFNA 1ST8A 3NWKA 4RHV2 2DWRA 5ANNA 2VJXA 1QQP1 2X8KA 1VMJA 2IXLA 2AGSA 1NT0A 4XIOA 5FV3A 3ZX7A 1DG6A 1OOPC 5CKMA 2JXAA 2ZEWA 1YUDA 1XNBA 1PO22 3JB8A 3ZYBA 3RJRA 1HRV2 1VBD1 4N43C 3C7EA 5F8PA 1GBGA 2VOXA 3GBWA 1KJLA 2PFWA 1EYBA 3GBGA 5A6YA 3WW2A 2UU8A 1JW6A 1FOD2 2W87A 4X6QB 5BPXA 2Y6GA 4E2SA 4X8NA 3G7DA 1H6YA 4XFHA 2CDOA 2FBEA 2ZKNA 4MGSA 4R9BA 1VAKA 3LFMA 3E5XA 2ARCA 3JBG2 3JD73 4AI9A 1H8TC 4GULA 5T5LA 1EV12 1ND2C 2P3IA 3M3QA 1H8TB 4ATEA 1JZ7A 3Q8CA 1AL21 2PHWA 4NAMA 4Y33A 3ZXJA 3RMYA 4L9BA 3D4KA 4WM7A 3E6CC 2XBO3 3C7HA 3M2MA 5FZ3A 2GZWA 1CZTA 1URXA 3MLJA 3ZYHA 3LA2A 2WFPA 3FMGA 2TEPA 2LM3A 2NLRA 5FUIA 5C3OA 1OLRA 5ABJB 5HXVA 1NLSA 1YJKA 5A3WA 4ES8A 4Y20A 3KT4A 5F2WA 2ZGNA 3LB9A 4J6GA 1H2NA 1WCSA 4L99A 4UFMA 5CKQA 2WFF1 1LNSA 5FP8A 1GP5A 1D4M3 5AVPA 2JENA 1S0DA 3DL3A 1JOBA 4JAAA 1LHWA 4B1MA 4QDRA 4Z82A 2A3XA 3OSDA 4Q27A 1JYXA 1VAVA 5CIRA 2D6PA 3NNLA 4AL9A 2XJSA 5CG9A 2DCZA 1AR81 4GAZA 4NR1A 2WNVC 5I0UA 5GLZA 3E6BA 2WJSA 2A6YA 1UYZA 4RHV1 4P9WA 4RN5A 2IXIA 1S0BA 2Z2SB 3MUY1 1XE0A 4AVVA 5DDJ3 5T5JA 3L2YA 1H4HA 1OD3A 1H4GA 4Y1XA 3E5QA 1L7RA 2L9LA 4AEDB 2IVIB 1GWMA 1U0AA 2GP3A 2NM1A 5C8WA 5IK4A 4FVVA 3HR9A 1AR61 5E16A 1V9U1 2V72A 1TNFA 1VMHA 3DXUA 3IT8A 3BKZA 3ATGA 4JX0A 1BXHA 1FOD1 3WV6A 4OFGA 1ZBE2 4IE4A 3SC7X 4B4PA 3ZXLA 2I74A 2P37A 1SHWB 5ACA2 4DB5A 5J3UA 1UXZA 1DHKB 1AXYA 4J25A 3O1UA 3OEAA 5JAXA 1VBE2 1FMD1 1V00A 2NN8A 3OBRA 2GNBA 2P1BA 4QMAA 1GKBA 3J7LA 4BDVB 2B8MA 5FZDA 3WNMA 2V73A 2XWJB 3VBRA 1RMU1 1F35A 1V6IA 4AQSA 1IPJA 3I3QA 3O7OA 5C70A 2ZAAA 2HWE2 2ZMNA 3U11A 5KWRA 3M3OA 2YB7A 1UY0A 3FLPA 4ISQA 2WO3A 4ASLA 3W59A 1BYHA 3X29B 4TTGA 1CWPA 4XAEA 1NQJA 5A1LA 1MS5A 1S55A 4JKKA 1NYWA 3PTYA 3PL0A 3PNAA 1REEA 2W46A 5JSOA 4DZGA 4YWAA 1AXZA 4JGZB 4YVSB 5D8AA 5JR2A 5KHKA 2BVBA 1UIJA 4XJWA 3S7IA 5F6KA 4PF1A 1F31A 1TMF1 3SITA 3T0AA 4XJAA 1WLWA 4G9SB 4HL0A 3J8F2 3G6JB 2RJLA 1W8OA 2E6VA 3UV9A 4CEWA 4Q0UA 1YIFA 2DUPA 4Q4X3 3B5LB 3WSOA 1VRBA 5FKCA 2ZKLA 2RR12 4N53A 2CU5A 2VMCA 5KC6A 1RUD3 2Y6LA 3ACHA 5E89A 1JOJA 5BNOB 1DLLA 2QNKA 1VB4A 2J1AA 5EJZB 4NRMA 3MFCA 3T0BA 5CFCB 1ZZBA 1GQPA 3HD8B 1CAXB 5FY0A 4AI8A 3ZYFA 5FMOS 1AHSA 1TEIA 4NPMA 3K48A 2XOMA 3AVSA 4YVWA 3VHPA 1RHI1 4IGPA 4EN7B 4IEVA 1R092 3AFGA 5I8YA 3W5MA 4NPLA 2Q8EA 2BUKA 2WWUA 4Y5SA 1QJY2 1ZZ8A 4BQXA 4GWIA 4L11A 4KMQA 1BJQA 4Z2AA 4GH4C 5A3MA 3VBUC 4YM0A 2WS91 5EXOA 4OQ9A 4YW5A 1GZWA 3CIHA 1W90A 4GH4B 2D3RA 3LWCA 5H9RA 3VBUB 3I3BA 4O9GA 1AXKA 3VKFC 3BI3A 5BNNC 1ENQA 2ZX2A 2A73B 5FY8A 4TXWA 2HWE1 1W9SA 3HBKA 3L9JT 1CAWA 3CMGA 4PBPA 2HWC2 4WM8C 4MXVA 5IFTA 1GZ9A 1NUKA 2Z4FA 3BIEA 3PUAA 1CAUB 4AHWA 4R9CA 3RMXA 2Y6FA 5GLWA 4AI1A 2Y38A 3FBYA 2XWBB 5K9YA 1UU4A 2VOWA 1VPHA 4Q29A 4ASKA 3N9PA 2FMYA 3VDDC 4XQWA 2E33A 1W2NA 5FY5A 5LWBA 2ZGPA 3I2GA 5BV6A 3LOBA 3BYWA 5LBBA 1ZZ6A 2BGCA 3ZM8A 2XVLA 2BV4A 2UURA 3HAGA 4FP3A 2ZGRA 3J8F1 3J4UH 5APAA 3GF6A 5A70A 5HI0A 3BTYA 3M7AA 4YGCA 4EV0A 2HWF1 3AP6A 1FAYA 4XVHA 4KU7A 4RGKA 3LIGA 1OH3A 4NHXA 3EHKA 1FX5A 4QXCA 5FXVA 4O7XA 1X9PA 1OVSA 2QQIA 4XUQA 4QPIC 4YZ4A 2E31A 3DN7A 2RS13 1T6GC 3GCWA 4LKFA 4AAXA 2F17A 1YI7A 4O61A 2VZ3A 3H8OA 2BBVA 3P3NA 3VBOB 3GHNA 1V6OA 1R081 1CQ9A 2ET7A 4PF5A 2YDEA 3U10A 3NMBA 1RVF2 4LBLA 1GMMA 1MS1A 2CNAA 3FFQA 1XSRA 4RR3C 1QJY1 1W8TA 2X09A 1XPWA 2XJQA 5IJRA 3WDWA 3NAPA 1BCXA 1UPIA 5LB6A 1BBT2 4JVAA 4XDOA 4B7EA 1UMHA 1UN1A 2VXJA 3BGAA 4IXLA 1VBB1 2BEOA 5ACA3 3POIA 1KD7A 1RUJ2 3RI8A 5JZGB 1ZA7A 1J59A 4R52A 1D0GA 1MEC2 1UKGA 4MGQA 3TB0A 1EAH3 1OFNA 5FPXA 1UX6A 1W6QB 5FYCA 4LLFA 5C9AC 2XONA 4BQ5A 4Z8BA 1PVC3 4UW6A 1PIV3 5FBJA 1QNYA 4KH9A 4QQPA 4D7SA 3AMQA 5DXDA 1IPKA 4M3CE 1ZRCA 4IV1B 2XJTA 2PELA 2XVKA 2JDZA 1DIWA 1Q8PA 1QDCA 4Q4Y2 4WVMB 5ANQA 4BK4A 1JTZX 1O7FA 4Q4V2 3H3ZA 5FXXA 2GAUA 2CDPA 4HVQA 2PAMA 4IEPA 5T55A 3Q8AA 1DQ0A 2YPJA 4IEUA 3T08A 5HV4A 1JI6A 1JH5A 3PU8A 4NPRA 4I0AA 4OUEA 5C4WA 1V0AA 3S7EA 4PQ9A 4A7YA 2YPDA 2ZHMA 3POSA 4LHNA 2GC1A 2V5DA 4Q4W3 5F3GA 2FHRA 4E27A 5IVBA 1P8JA 3CKHA 3KMHA 1AUYA 5A32B 4D0QA 4LA2A 1LR5A 2Y26A 2ORXA 5A7WB 5J48A 1OH4A 1XQNA 3IDAA 4UF0B 2OUHA 5EP9A 1NG0A 4Z2WA 4IEOA 1DQ2A 2HLEA 3OYWA 2RR13 4K1ZA 3AFKA 1VBC2 2FDJA 1QKQA 3ECQA 2XB6C 2ZGQA 3WF3A 4FPKA 4AR2A 5JVVA 3R4DB 4IEXA 2YROA 5H9QA 3BVCA 2UYAA 1W8FA 5C8CA 1V70A 2ZPXA 3DV8A 5F5AA 3WQ1A 3WQ7A 1JXNA 4K3UA 1XYPA 1AJKA 3KCCA 2RS51 4QX3A 1DGRN 1W6MB 1ND3A 2ZZQA 3KM5A 3ACLA 4NWWA 1UU6A 2K0GA 1IPSA 2Y34A 1IQDC 1YCIA 1C8M3 2AR6A 5CZKA 1AVBA 1B09A 3TNPB 2WO7A 4LUMA 4PIYA 4COZA 2ADEA 2RS31 4GMP3 3HNYM 3LAGA 2FDGA 3B94A 1XXNA 4YYOA 1XC6A 2OXBA 4RL7A 5CYYA 3OUJA 1IS3A 3ALQA 3D82A 2MNGA 4CUGA 5JWPA 1POV3 2XKPA 5DAQA 3QCWA 1OOPA 4ASMB 2WZR2 5CG8A 2GN3A 2PXJA 2ENRA 2VOVA 2HWC3 4NAOA 4Z1VA 4ARXA 2ZX1A 3M3CA 1T6BX 4B7KA 3A0KA 3MIFA 4LO5B 4N43A 4OYUA 3W20A 4MADA 1UZWA 4RS5B 1NE4A 1WCDJ 4HMZA 2R071 4OHXA 1BMV1 4Y26A 4M00A 2WWJA 4JTNA 1HB1A 4CP0A 5FLHA 2B45X 3DYPA 4WM7B 2G9ZA 3O0VA 1SCSA 2VCCA 1ND2A 1A8DA 2Y64A 2OIIA 2A70A 4K7JA 4AVBA 3I2OA 5JPNB 1VBA2 4M4PA 1REFA 4R8HA 1O4TA 1DBNA 1H9WA 3O0WA 4Y20B 2PAEA 4KU8A 4KWKA 2FCVA 3WXPA 2W1SA 2YC4A 5IAVA 4EROA 4KWLA 3K51A 5B4NA 3VZNA 3ZKYA 1WCQA 3I3EA 5FK7A 2XR4A 3NNJA 5FTTC 1CAVA 4AHXA 2WNUA 1GP6A 2YC0A 2W3JA 2QZ2A 2VVFA 4KWUA 1JOPA 4D8MA 2W39A 2I45A 1ASJ2 1FNZA 2PLV2 5E8AA 4PBOA 5A7QA 1RVF3 1KEXA 1US2A 3FBMA 5GLVA 4OHYA 1H9PA 1MZ6A 4PJYA 1QOTA 2DBNA 5H9PA 2P17A 2QQPA 1RUC2 1SBFA 2WNVA 2JX9A 5FPLA 1WD4A 2YBSA 1CJDA 3RZLA 2IXCA 3NNGA 1RUJ3 4AK3A 1F15A 2D6LX 3HPNA 4BQ4A 2DUQA 3AJYA 4UI9L 3AK0A 3B9IA 3VL8A 1UY3A 2VNOA 3KVAA 1ULOA 1YFWA 2P6CA 5LK5A 5I0RA 3VDAA 3VHNA 1HXS1 1LOFA 2UY8A 2VL4A 4I3PA 5JSPA 2C9AA 3ITQA 3APBA 2RDNA 4PDWC 4A44A 4IE7A 4QDSA 1M4WA 5SV5A 1XRUA 1PO12 2ADDA 5EYXA 4Q4V3 1W9FA 4BIOA 2BOIA 2B9VA 3VBRB 4CXXA 4ZU7A 3WNLA 3EQEA 3VKLA 4RSUA 3ZPYA 3P3PA 4DUVA 4KBBA 4QT6A 1SACA 2BFUL 5CVRA 3UK9A 4Y22A 1H0BA 1IKQA 3O1VA 2PHTA 3ZOIA 1G9FA 4QB6A 3WDVA 3WNNA 3LEMA 2EVXA 1V6JA 4UFKA 1TQ5A 2VQTA 5F9TA 2WINB 4YW6A 3MZHA 3ZYIB 1TME3 1PZ8A 4NE9A 3ZKUA 3OD0A 4Z92B 1RUE1 3PUSA 3K46A 4RQPB 4FPLA 1SG3A 5D8AB 1OURA 5LA9A 2ZBJA 1D2QA 3N4MA 2XJVA 4XW3A 5KHGA 2W1QA 2J7MA 2GP5A 2GNTA 5DG2A 4XF4A 1DGLA 1ZZCA 4NVPA 4YSFA 4CEWB 1FV3A 4D6SA 3WF2A 1QXPA 4FBFA 2D6MA 3J9SA 1WBLA 1QJEA 1WMEA 1JMUB 3R05A 4N53B 4L97A 1OBNA 2P3YA 2A5ZA 5A80A 3MDPA 2VCAA 2DCYA 1N3QA 2J1EA 3BTXA 4LQRA 4YVWC 4FT8A 1OI6A 4HKWA 3RSJA 3WLUA 2WLPA 1KFUL 3ZYGA 4R9AA 5K0UB 2J1VA 2BNMA 1FI2A 2AC1A 4CUAA 5CFDC 2K9ZA 1F4AA 4GWNA 1PGSA 3FX3A 4CDQC 5JXHA 3N3HA 4M0NA 3LA3A 3ZFGC 3AZWA 1W0NA 1E5RA 3WP3A 5CISA 2WNEA 5EFUA 1N1SA 4YGEA 2VAUA 4OI1A 1UY2A 1C1FA 1QXRA 4NMIA 4UFJA 1PO11 1W99A 1EPWA 2VNGA 2AH2A 2VTFA 1RXFA 5IVCA 1RUF2 4DO0A 4H7MA 2QQVA 5FZAA 1SCRA 1UD1A 4K1YA 5HBAA 5LEJA 3H7YA 1BZWA 1CAWB 2B4KA 2A6ZA 1XBFA 1RGSA 1SEFA 5L9BA 4QX1A 4CCLA 4FFGA 3EBRA 5FZBA 1S0IA 1GZTA 5FY9A 5BNNA 4QKDA 1IS6A 3BUCA 2XPJA 2GNDA 4XMIA 5JXJA 3OY8A 3TN93 1A34A 1Y9QA 4FSJA 1MS8A 1JZ3A 3LEKA 1VBA3 2HWD2 2WN3A 5FMDA 1S1AA 5T5PA 3N7KA 4BK5A 2PN5A 3AMHA 1JZ6A 4CU6A 3VDDA 1Z7S2 3IAQA 4XABA 5FQ0A 1ZRDA 1RUI3 2RMU1 2VM9A 3SCFA 1W6NA 4TWTA 3KVBA 2CHHA 4OI4A 1COV2 1R1A1 2JG8B 4V2VA 3V56A 1BLZA 1QU0A 2KA3A 4JRLA 5FY1A 5A3LA 4BB3A 3WDXA 3N9QA 1LECA 2OZ6A 3NV1A 1YFXA 1ZBA2 3U78A 4XEZA 3AJZA 4E4ZA 4FPJA 1LEDA 3V0AA 1ZREA 2SLIA 3PU3A 3AP9A 4C1WA 4QPIA 2DTYA 3ZN6A 1UY1A 2YHJA 3ZIWA 1F8VA 3ASIA 4URTA 1VIWB 5LA2A 2LRPA 3K4AA 4LULA 1DGRA 2P4EA 1HRI3 3H1WA 5T5OA 3WHUA 1JUHA 1AR72 1X50A 2P3JA 5DAXA 4CDUC 1QJX2 4ZZ5A 3NAPB 5FFOC 5FMCA 4BHPA 3ETPA 1JU3A 3ZXFA 2QDRA 4TLGA 5FP9A 3O1RA 2ZCWA 2GH8A 2MPFA 4YZ2A 1OD5A 4O9EA 1RUG3 4RR3A 5GLUA 2JICA 3POGA 3NRUA 5FMBA 3FFZA 5FYIA 2JDUA 5I8SA 1IGOA 2QVSB 1QQP2 1MQTB 4MVTA 4TSVA 3OGSA 3A22A 1DU3D 3VD9A 4YZ1A 1KFXL 2ARBA 2MHFA 1W8HA 2XL7A 3DGTA 1VBD2 2EALA 5C9AA 4GB33 4RFT0 2A1XA 4YLZA 1JUIA 4DNYA 2PQSA 2WL1A 5C4WC 3C7OA 4BIFA 4RGGA 2ES3A 4FPOB 5FIXA 5FXZA 4HPKB 5KHHA 5IHRA 2E53A 3JZVA 4CXWA 3CDZB 2CSGA 1KXGA 4PT6A 5GZEA 2JD9A 2VQUA 2ZTNA 4NROA 1TE1B 4QKBA 1HB4A 1J1LA 2AACA 3I97A 1AL22 3Q8EA 1NY71 3BB6A 2JB4A 2B42B 2JD4A 3JD71 4JGYC 5EZWA 2RM23 1HKDA 1AR91 4MX3A 5M0TA 3S0MA 4BLJA 3UETA 2WO2A 5F3IA 1H1AA 1XB9A 4S2GA 3WNXA 4LO7A 4IEYA 4LBMA 4QPGB 2DFBA 3OYWB 3R0RA 4XOGA 1MZEA 3THTA 1SQ4A 4HANA 4COWA 2XBO1 3UJOA 3KGLA 4LOTA 3WW1A 1UY4A 3H3LA 1R1ZA 5C8CC 4DPNA 2WN2A 3JUUA 3ZR6A 4META 1G9AA 2R063 2VVDA 4AI2A 4OULA 1AR71 4LEJA 1QJX1 4CCCA 1KDKA 4XPVA 2VZRA 2WLQA 3KCXA 2K2SA 3KZ4C 1WCUA 1ND3B 2AENA 3D0SA 3N9MA 2WAAA 5FPUA 3OBZA 2ID4A 1AR82 2WT2A 3KGZA 4R4ZA 4TLFA 1J84A 5EHDA 3MV11 3ZFEB 4CPBA 4CUBA 4OI0A 1WLDA 1FXZA 1N3PA 4ZKTB 2GMPA 1KS4A 5FWEA 5LBFA 4IESA 1DDLA 3QH6A 4F8AA 3C7GA 2TUNA 1S2KA 1H1MA 1OOPB 2CTVA 2X5IC 4MV2A 4A41A 4BXFA 5L36A 3MLKA 1SLIA 3IPVB 5DDJ1 2W2IA 1AR62 1V9U2 4N43B 4Q5OA 3VZMA 5ERLA 1YEWA 5FYZA 2EXJA 5KXEA 1LOCA 4PI2A 1OKQA 3VBFC 1CIYA 5IWFA 4EJRA 4BISA 2JB8A 2V5YA 1GLHA 2W1UA 3RGBA 4AHYA 5JDBA 2ZXQA 3K2OA 2VZQA 1JZ4A 2HWD3 1FPN3 3CL1A 4LE3A 3M8LA 5IVEA 1FMD2 1ND2B 1DLCA 1OUXA 2QQOA 4FFIA 4A4AA 1LENA 4D6QA 3E1F1 5C5UA 2VBBA 3UT0A 1Z7S3 2YFUA 2N7GA 1RMU2 3WQBA 2RDSA 1J83A 1XNDA 3GNEA 3D6EA 4UW3A 4WVVA 5AC92 1COV3 2XLGA 3B93A 5A3NA 5K4LA 4W8JA 3POYA 4NIGA 3ME2A 4I0BA 1W0OA 4IE0A 2LUWA 5FZLA 2WNUC 4FOYA 3RS6A 4IGOA 1E5HA 3VDCA 1CAVB 5FZ6A 2WNUB 4HSLA 4OI2A 1GFF2 3ELNA 1ZNPA 3K75B 4BMBA 1GNYA 3OUHA 4XFFA 2D3PA 1PGL1 4MSVA 4CCNA 5A6ZA 1E57A 2DCKA 4XF3A 5FCCA 2CWMA 4H55A 3U4SA 3W21A 4IQPA 4A42A 4DRRA 4KL1A 1TMF2 2CWSA 3IKWA 3LSEA 1LESA 2WNVB 2CGOA 2TNFA 4N7UA 3O1OA 3WW4A 2D5FA 4IEWA 4A7KA 3PIGA 2VBDA 2X53S 3S5AA 4FTBA 1AZDA 2GC0A 4BXSV 5F5IA 3UKTA 3E5UA 3T2QA 2JDNA 4LTAA 2R1BA 2RE9A 1O4ZA 3POBA 1GOGA 1UAIA 1PGW1 1LHNA 1S0GA 2ZX3A 1LOFC 4Q0PA 1RUD1 2MEV3 1RINA 3ACIA 5B4XA 2D98A 1RHI2 1WD3A 2ZEYA 5JOWA 2AYHA 4YRDA 5FOBB 2JDKA 3NJVA 2PHDA 4IV3C 2QQUA 2DTWA 2Y6HA 3ZR5A 3NO8A 2PQQA 1O91A 4QPWA 4XBNA 4OVEA 3ZVXA 5D2AA 3TEXA 4YFZA 1WW4A 3K4DA 4QQ2A 3LPFA 2WS92 1U5XA 3GCXA 3KS7A 4PDWA 3VBSC 5C3QA 4S2DA 3ZSLA 3ZFFC 4Y22B 2B7YA 2H0BA 1AYN1 3CLPA 1Q56A 3OEBA 1UO9A 1SPPA 4JHZA 3J7MA 4QQHA 5D1IA 5AC91 4FPFA 4YM2A 3VB9A 3RZZA 1JHNA 4M0HA 1W39A 3VGIA 4MO3M 3I3DA 4CYDA 3BIWE 5GM0A 3ES1A 4MGIE 4HG6B 2WKKA 1C5HA 1KITA 1UYYA 3P6BA 4ET7A 5JOYA 2C0ZA 2V4AA 1UZ0A 4U36A 1SLTA 1OQDA 4AVTA 4EZHA 4LO4B 4YG6A 4CEYC 2QQLA 1SMVA 2OQ6A 3I2JA 3IWZA 3RQ0A 5LW9A 3RZJA 1BEV2 1DYPA 1N1YA 1HN0A 4Y3OA 3R6SA 1PHMA 3UL2A 2WFF3 1W3XA 1PMIA 4FXGB 4NUBA 1H1IA 2W9XA 3AVRA 4XF0A 4BMEA 3HOBA 4EWDA 4R4XA 1GP4A 4DXTA 2ZGSA 5BY5A 2HWF2 2DVAA 1QOSA 2Q30A 2YC2A 3AYCA 3D5OA 4QM9A 3S30A 4IEZA 5LA0A 2EXHA 1HX6A 1X33A 5A3PA 1WMDA 1KS5A 2R0FA 3QBQA 2BWAA 1AR83 4Y1YA 4EYUA 4RGAA 1UZZA 2VULA 3PJQA 4PCRA 4ZXKA 4RHV3 5A6XA 2BWCA 2IZWA 1C4RA 4C90A 3O1MA 3WNPA 3O1TA 2W1WA 2IXHA 4BQ2A 1KJRA 3MV01 5JXIA 2YZ4A 1NKGA 2RS11 4FFFA 1R082 1PO23 4QD2A 4UFLA 5CFDA 1QNWA 3ZSMA 1SDDB 4CDQA 1HRV3 5FLJA 3UKNA 1C57A 2ZMLA 2YUEA 1ULFA 4DEVA 5JMCA 3ZFGA 3EXUA 1Y7BA 1OLME 4QGMA 5JI7A 2IC1A 3HN3A 1FOD3 4YW2A 3VV1A 4BPZA 4F83A 1CJPA 1SFYA 2DURA 5FR3A 1KGYA 4F3JA 2QDNA 2BFUS 2VW1A 3AL6A 4BJ0A 1LHOA 1VBB2 3JBG3 3CBNA 2XL9A 3OGRA 3QD6A 1EV13 2EICA 1C8NA 5BNNB 4PQQA 3AP4A 3PJYA 3THDA 1JYIA 2FZ2A 2VR4A 5FKBA 4MLOA 1RUH2 1FMD3 3KV9A 4WM8B 4PHZA 3V0BB 2D40A 2E9QA 2OT7A 5T54A 4CCKA 3K3OA 3SQOA 3POJA 4AAPA 4QXKA 3MPBA 3THPA 4LUKA 1EAH1 1RMU3 5E88A 5SV8A 3IMNA 2JDMA 1H2LA 2WDBA 5EQUA 2B9UA 4BLIA 1PVC1 5DAPA 2ZHKA 5DUWA 3VDDB 1YC61 1BEV1 3ZMNA 5FQ0B 5L7OA 5FREA 3ZN4A 4IE6A 5I0SA 4P00B 1H2KA 1AL0G 5I91A 2HJIA 2VVEA 1WWYA 2FDHA 2HWB1 1YNAA 1Q3EA 1PZ9A 2W68A 2YV8A 3BPSA 2IWGB 4GZ9A 3WDUA 4FI9A 4CCEA 3CJXA 1C3HA 2VUCA 1SDWA 4MHUA 1PNFA 3BCWA 1QH6A 5A7SA 1TG7A 1F5JA 3M1HA 1LEMA 4PLMA 2XGXA 1TMF3 5A3TA 2GC3A 5LBCA 1UOJA 3I54A 4QPIB 3ZN6B 4S2FA 1MS9A 4Q4W1 1F4HA 5FYVA 4XUNA 4AF9A 5GZGA 1X82A 1QOOA 3LKJA 5G04L 1YYNA 3PIJA 1W8UA 2HBUA 2OPKA 4KGGA 3J26N 1F5FA 1K5MC 2VC9A 4NIAA 1S0JA 2EIBA 2FMDA 4XTPA 5FP4A 3O1SA 3BTZA 5FO9B 3MO4A 3FHIB 4H3WA 4QGLA 3GYDA 5DZFA 3T2PA 3FWEA 4Q2FA 1ZBE3 2JIGA 2NMNA 4RR3B 2JECA 2J42A 4XE9A 1JU4A 2VMFA 2Y60A 3CZUA 4W65A 2RS52 2ZAHA 2C9KA 2Z5WA 4CDUA 5J1XA 2CV6A 4DXZA 3UNPA 1GQHA 5T52A 2AREA 3AKRA 2DFCA 4WZFA 2D6KA 4BH9A 4EN0A 3I59A 3SNMA 2RS32 4TN7A 3TYJA 1RUH1 1VBE3 2R7EB 4LBKA 2PHRA 4AEMA 2R041 2C26A 2WZ8A 4N9IA 1C8M1 1W6OB 2JKBA 2OZJA 3AKSA 5C9AB 4QPYA 1OC1A 2D6OX 4FTEA 3LDKA 4YGDA 3RVHA 2HWE3 4YW7A 2D44A 2JE7A 2W92A 4XZUG 5FZ1A 3RWNA 4WV8A 4C0HA 1HQLA 1WW7A 2VW0A 3WD5A 3RNSA 3OGGA 4AWDA 1POV1 3UYJA 4NHMA 3RJ2X 1WGPA 2Q0AA 3VZLA 3FL7A 1N47A 2Y0IA 1QY4A 4JRAA 2R072 1BMV2 2VUDA 2JDYA 4RA0A 2YG0A 5C6CA 1APNA 2XDVA 4XMAA 1GANA 1ENRA 3PLQA 3ZYRA 1IKPA 1REDA 4JKLA 2BOJA 3UGFA 5J7MA 4CVUA 1WZXA 2XG3A 1MS4A 3J8F3 1JZ2A 1MR5A 4K20A 4W50A 3O0XA 4JGYA 1OA2A 3IZOA 1FYUA 5KHJA 4UAPA 2XH6A 1DQ6A 4M3CB 3WR0A 2QTWB 4RD7A 3OCPA 2P6HA 2W91A 4S2HA 3TEYA 3PURA 1LULA 2EXKA 4XZPA 3ZSJA 3CJIA 1GUIA 1XU2A 4HLTA 1YHFA 3VBHA 4AYUA 1NCRC 3WX5A 3FC0A 4XFGA 3K77A 2GH2A 2ZGTA 4P9JA 3ZIXA 4W6WA 4E2QA 2VOTA 1ENSA 4IUGA 4WBBA 1R083 1R093 4BM8A 3ZLIA 1VRH1 2J1TA 1O4YA 3MW4A 2WUHA 4OHZA 3AC0A 5F39A 4D6RA 3DCQA 3PHMA 3OJBA 1QJY3 2Y6KA 2XHNA 3WHTA 4CP9A 1DZQA 3ETQA 1DF0A 2B46X 4XUTA 1D7PM 5BNPA 5I93A 2ZEZA 3MF6A 4P9GA 4HN1A 1HJGA 2BVVA 5FZHA 1IG3A 2Y8KA 2G19A 3HEIA 4D94A 2E7QA 4NHLA 2X5IA 4CP1A 3C2UA 3DKQA 1QJU1 3GXUA 3NNMA 5FY4A 2GMMA 4MGTA 2R16A 1NQDA 2Y0OA 2W08A 3A23A 1HXS2 4G4FA 3PMEA 5JCTA 2VCMA 4LIUA 2ILMA 4PI0A 3VBFA 2EAKA 5FPVA 4QAWA 1O59A 1A3KA 2QZ3A 5F5CA 5KR7A 1LU2A 4AFAA 2OUJA 2BGPA 1DGWX 4LBOA 4H14A 4AHZA 1Y9GA 4D7YA 4I2OA 2VMEA 4N8MA 2PAKA 1CPNA 2VO5A 3N9OA 4I01A 4ZS3A 2DVBA 3WDTA 2JDAA 4UFHA 1X9TA 3R4UA 5TSWA 2OKXA 1D2SA 3PUQA 3SHRA 1N1TA 1JYVA 2RV9A 5F2SA 2VQ0A 2GNMA 4UT5A 4XYXA 1W06A 3BU0A 1RUE2 4Q0VA 2C5DA 3BU7A 3OGVA 4DS0A 4NO4A 3IDCB 3H8RA 1C5IA 2OVUA 4INDA 2CY6A 2G9GA 5LASA 1LU1A 4ITCA 3VD4A 4ZU4A 1LRHA 2YFZA 5GZDA 2R6QA 2WA3A 4QQLA 1DQ1A 2ZGMA 2X10A 1SLBA 4E4SA 1OSGA 3VN4A 5DMYA 4XDQA 3QOPA 4OMCA 5IATA 1BBT3 1TNRA 4C91A 2RS53 3KQRA 5JOZA 3AKPA 1QH7A 3POFA 3LIHA 3ZDSA 4CE8A 1B35C 1G6NA 5ISLA 3AXDA 4CCDA 2DVDA 3ABZA 3ZXGA 1I9RA 3CF6E 1MEC3 3VDBA 5FYTA 1VALA 2QJVA 2RVAA 1XYOA 5FWJA 4OUMA 3EMRA 5CAZA 4HVRA 4L92A 4XHXA 4NIIA 2BJSA 1W8NA 4V2WA 3RZGA 5AFBA 1KDMA 4CDXC 4IV3A 4PDWB 4Q4Y3 5FP3A 2HYXA 2VW2A 1LOGA 5C71A 3B69A 3WINE 3BPZA 1ULDA 4HETA 2Z79A 3HNMA 3IDBB 4BQWA 4FAHA 5JUVA 1ZA4A 5KXCA 5H9SA 3NW4A 1FT9A 3I2HA 4YPJA 4C8DA 5A1FA 3I2DA 3VBSA 4WVWA 3ZFFA 1VLNA 4HK9A 2VMHA 3BN6A 5FDBA 4Q0QA 1L7QA 3PMSA 4JV4A 2KXLA 2W52A 2Q1ZB 2HYKA 4CP2A 1G8WA 1IOAA 5EJ3A 2R30A 3WCSA 2P34A 1AYM1 3OG2A 1WMFA 2G4IA 2IXKA 1H30A 2VZPA 1VBC3 3VD3A 2O0OA 3SCGA 2J1SA 5HCHA 4XBQA 5F6LB 1UCXA 5HCFA 4AW7A 2QBXA 5IVVA 4NIHA 2RMU2 1A8MA 3H8UA 4CEYA 1ALYA 3N36A 5FZFA 2QQNA 1O5UA 4LORA 2ZX0A 1R1A2 2VECA 3WVJA 4FQZA 2W95A 3TRSB 2JIJA 3RYRA 3ES4A 3U07A 2WNOA 2D6NA 3OBAA 3TEWA 1W2TA 1CVNA 3ZXKA 4HZFA 5L19A 4GD4A 3LGRA 1ULCA 1ONAA 4ZONA 4P5YA 4YVWB 3R4SA 3D3AA 4A2UA 2JG9C 4XFCA 3P5BA 5FZ4A 3RRDA 5CFDB 2WR9A 4YVSA 2CGPA 1N1VA 2KM2A 4CDQB 2PA7A 3INAA 2YYOA 1RL3A 4MUVA 4Q1PA 3ZFGB 1G9CA 2WZR3 1RYYA 3WF1A 3A4UA 1DP0A 5FJKA 5EV7A 1GZWB 2ZGOA 4B29A 3O5SA 5FZKA 1QJZA 1PX4A 4AVCA 3ZO0B 4BU2A 1Q5OA 1LJ7A 1PK6C 1QF3A 2CAUA 5FYYA 4PIZA 3KLSA 4C0BA 5FZMA 4LE4A 3RI9A 1OHFA 2VE1A 1DGWA 4HT1T 1JS9A 4JDMA 1CAXA 5B2GB 3H42B 4K9SA 1RUG1 5DUVA 4COVA 1LB2A 1VE0A 4QQOA 2PTMA 1NA1C 3GHMA 3WDYA 2A6VA 4PLOA 3A7QA 3MIDA 2WYSA 3ON7A 5IUQA 2DVGA 2XQXA 5L7OC 3RYPA 4LBJA 4MGYE 2ETEA 2KD7A 1RJ7A 2XUMA 3C3VA 4N7IA 3ORJA 5L7OB 3AZYA 2DUOA 4YG3A 1GWKA 3OTFA 1UOFA 1R64A 3DPRC 3NV3A 5JIAA 5FOJB 1QIQA 5FZIA 3ACGA 3WF4A 2JE8A 4L0PA 4GB31 1H6XA 3WZ1A 1OLMA 5FO8B 4NHYA 5CKNA 2D7FA 2JEMA 1RC6A 3KQ4B 1NCQC 2HEWF 3B02A 4OHWA 4W6YA 2Q4SA 4FPCA 1NY72 1DQ4A 3JD72 1ASJ3 2PLV3 2ZZJA 1AR92 4YZ3A 3FUOA 1UX7A 3GJAA 3JB4C 3WCRA 5CADA 4OZOA 4I3GA 1RUC3 4OHVA 5C3SA 4GWMA 2RM21 2XBO2 4XUPA 4BQ3A 3JQXA 4CDWC 3MLLA 3AYAA 2VZ1A 2P3KA 3HVDA 3ZXDA 2J22A 4CU7A 2OA2A 2VUJA 1JZ8A 4DUWA 1K5MA 2B39A 3IIIA 5FPZA 5FUNA 4JQRA 2F4PA 4XFAA 4CDUB 3QLQA 1UQXA 4XCBA 3RZKA 3AZZA 4KWJA 4A45A 2I07B 2VZVA 4CCOA 1PZ7A 1OXCA 1YXWA 3WG4A 3TOJA 1TVGA 4I30A 5JPMB 4HKOA 3RZMA 1WMXA 5LA1A 4FP2A 3VL9A 3L2HA 5F37A 2YU2A 1WW6A 2ET1A 1IQAA 3H9AA 2KR2A 3KF3A 5DPNA 1PO13 2E7AA 1UZVA 2FZ1A 3U4XA 3LD8A 1VAMA 1IS4A 3ZXEA 1RUOA 4DFSA 4B3NA 2BBAA 1I1EA 1W9WA 5DDJ2 5FZCA 2EIDA 3M3EA 1U5IA 1W8ZA 3SISA 4COUA 4EQVA 2VMIA 5IVFA 3O12A 3Q9OA 1EUTA 1BVP1 1XOYA 5AFEA 5C4WB 1WLCA 3F2ZA 3NKGA 2HKXA 4F7ZA 2DDUA 2FD8A 1JYWA 1O8PA 1YRZA 3GJBA 4IERA 3KHCA 3KV5A 5FYBA 3TNQA 1S2EA 4I09A 4E4DX 1LOEA 3H50A 2WSUA 1E5IA 3UJQA 4DINB 3MYXA 4LKSA 1OT5A 4JHTA 1FPN1 2RMU3 4JGYB 1LHVA 1PMJX 1UWWA 3AZVA 4GQ7A 4ZU5A 4GA9A 5I0TA 4AI0A 5C5TA 1IHMA 4U2AA 4WVMA 4G3YC 3CJIC 3WG3A 1DQ5A 4ISRA 3VBHC 3AZXA 4ZZ8A 1PM7A 2JWPA 1RUNA 4XJZA 1FNYA 1XE8A 2F4LA 2O8QA 5CB7A 4LK6A 4AGRA 1LGCA 5FBZA 4LOSA 3VZOA 4W4ZA 5DG1A 2CL2A 1S4CA 5FXWA 4AQ6A 1Y9MA 1JODA 5FYSA 5LRRA 1CR7A 3POWA 3SH3A 3FUQA 3D8CA 4CPBD 2FDFA 3SEEA 3VKNA 4LBQA 4AEJA 2ZEXA 2QQMA 1PGL2 1YQCA 5FJHA 3RYKA 1D4M1 3P1IA 1BK0A 1NCRA 3FE5A 5A7WA 3U37A 3C8XA 4YW1A 2LROA 4GJZA 2WBKA 5BNPC 3F95A 3M4FA 2NMOA 4FOWA 1I5PA 1ODMA 3KB5A 5F1RA 3PVOA 5BXXA 1JYCA 3EB7A 1V6LA 1RUF3 1AX2A 5F3CA 4IE5A 3SMHA 2BU9A 2BNNA 1XNCA 1HV1A 4HONA 4X8PA 1GZCA 4ORFA 2WRAA 5EYYA 4ONUA 5EIYB 4MG2A 1X7NA 2X5IB 4ZY9A 1HQNA 1PGW2 1ODNA 1RUD2 3I2FA 4KBZA 5E6HA 1CX4A 1Q8SA 2P2KA 2VXRA 2JDPA 3LZZA 4NRQA 5BNQA 3TEZA 1H2MA 3VBFB 3KF5A 2Y33A 4ZS2A 5HCBA 4XUOA 3U1XA 4A6OA 4Y4YA 2A3YA 4YZ5A 2MEV1 1IG0A 5F32A 5L9RA 2VZUA 5J96B 1SFPA 5IK7A 2DV9A 4LBNA 5GZCA 3LA7A 4YNIA 1W9YA 2WZPP 1WBFA 3ZN5A 4JQTA 2RHPA 3LF7A 5FRAA 2WQ4A 4DEQA 5FK8A 1MS0A 1AYN2 3VZJA 1M06G 3OGJA 2WC2A 1ZRFA 3KWVA 4DOUA 5FZ0A 4IGQA 4LHSA 4KNCA 2UWCA 4QXHA 1CD3G 2BP6A 1YQ2A 3CHXA 2VNRA 3I4IA 2LTNA 2QQJA 1UL9A 4HN0A 2WA4A 1KRIA 3HT1A 2BERA 3GGLA 3JXSA 2VZSA 1AR93 4RS5A 4UBHA 1ZBA3 4AOCA 4EWAA 2FCTA 4P02B 2VPVA 1HJFA 3UGHA 4A6SA 1RJ8A 1BVVA 3LQCA 4QB1A 4HSJA 4Y1ZA 2LALA 3SH4A 4XDPA 4P14A 2RJ2A 5L9VA 1G9DA 2G9FA 1O5LA 1QGLA 1T2XA 3KV6A 4QX2A 4A3ZA 4LIVA 5ABJC 4MZUA 1W3VA 2ZHNA 4P9IA 4QX5A 1PMHX 3FJSA 3UESA 1AR73 1W04A 2K46A 2VBPA 1Q8VA 2EIEA 1QJX3 3OUIA 4FOQA 4CSWA 4Q8KA 5LY2A 3LEGA 5JXGA 3DEMA 4Y4RA 2HEYF 3I8TA 3WUDA 1YQ6A 3MF9A 1GICA 1HW5A 2RJKA 4NWVA 5FP7A 3ZXAC 3SKJE 4Q4X1 2OYZA 1NLQA 5LBEA 3SH5A 4NHKA 3SLIA 1UOGA 1QQP3 2DF7A 3DECA 3E6DA 3ILNA 1B35A 4FPHA 4HFSA 2ZGLA 1UIKA 3A21A 5GLTA 3NJXA 5FO7B 3VHRA 2RS12 3BOPA 2H0VA 2DCTA 3AKQA 4HXCA 4YW3A 1VBD3 4I0WB 4IV3B 4C1XA 1OA4A 1YFYA 4AEDC 5J37A 1PO21 2GSYA 3I7DA 4WVZA 1HRV1 3PVNA 3I2IA 2RG4A 4GXLA 1DZRA 5KC5A 1LKNA 1IZ3A 1K45A 1XNAA 4DIQA 1Q43A 2AUYA 2GN7A 2VTXA 3ZYPA 4CDXA 3VBSB 2UWBA 1MVQA 1W2AX 1WW5A 4YM1A 3OD4A 2XUEA 3ZFFB 4LT5A 3W58A 2NPIA 3CNAA 2WIIB 4UYBA 4XACA 3PDQA 4D3WA 1AL23 2VD7A 3JBG1 1NE6A 2A71A 5KHIA 1EV11 4Z07A 1EAH2 1MACA 4OQ8A 1MPXA 3U75A 5KXBA 4ARYA 2Z69A 2E26A 1PVC2 1CONA 4CA9A 5GKAC 1D0HA 5GALA 1PIV2 3ENRA 3PUIA 4I02A 1C28A 4UW5A 3DKWA 4CEYB 3VZKA 1Q8OA 4MGZE 3IAPA 4N90A 4YW4A 5LZ6A 3N7LA 2A75A 2H6BA 3VKMA 3WP5A 1Y4WA 1STMA 5DUUA 4AGVA 2HWB2 1L3JA 4XQ4A 3FLTA 1UOBA 1F9KA 4E9KA 4BQYA 4GMP0 4FOVA 2E32A 4AI3A 2R1DA 3EO6A 2W5FA 1G9BA 3T4VA 5G05L 1AX0A 4JCKA 4JGZC 4YVSC 1POV0 4FPEA 4Q4W2 4RQPA 1BHGA 3FHQA 2WQ8A 2VNVA 2IUWA 4A3XA 2C24A 4CXYA 4LPLA 1HB2A 4K40A 5FYUA 5JSRA 1O3RA 5HXMA 2ZHLA 4KG8A 2A6XA 2JG9A 3J7HA 5AVAA 1AR63 1I5ZA 1N3OA 1V9U3 1RIRA 5LEKA 5BNOC 2SBAA 4L8QA 1W6PA 1CPMA 2PHXA 1LTEA 5CFCC 4AE2A 4BYYA 5FLIA 2VOKA 4COYA 1SLAA 4CU9A 3GZEA 2D43A 4QHZA 3ZSEA 1UYXA 1OMIA 4QKFA 4E8DA 1XSQA 2AEZA 5KBFA 1ZBE1 4LO8A 4FO9A 4ZPIA 5K0UA 1U5YA 3WY6A 1PK6A 1W0PA 3PVEA 3VD7A 2EF6A 4FXKB 3HQRA 3U14A 1UMIA 5FUPA 2ARAA 4QM8A 3OY8B 2R042 5ACA1 1C8M2 4P5HA 3NL1A 3T2TA 3RG0A 1AYN3 2W47A 1VBE1 1HIXA 3CU7A 4AFMA 1NA1A 4BWOA 5AC93 5IK8A 2PYTA 1OPOA 1TZOA 4QU2A 1NLRA 1PIV1 3OB8A 2Q8OA 3SKVA 1L7LA 3MIHA 1W6NB 3WG1A 2YU1A 4DY3A 3QACA 2F6BA 2WZEA 3AP5A 3WNKA 3CQOA 4Y5Z0 4AFDA 2XLAA 2NP0A 1D4VB 3WP4A 3DPRA 1W9TA 3LPGA 5IVYA 3OPWA 1NXD1 1PVXA 5LCWL 3WQ0A 2LW8A 1PX3A 1X8MA 1S0FA 2CYFA 1XJAA 2DCJA 4KGQA 5D21A 3V0AB 1O3SA 1NCQA 1C1LA 4XXAA 1LGBA 1J3RA 1WKYA 3ACFA 4BZ4A 3POEA 1V6KA 1I6XA 4BOWA 3WNOA 4XF9A 5A7OA 2EIGA 3MHZA 4O65A 1QMJA 1HN1A 4KI5M 5IK5A 3SXWA 2HBTA 3RZHA 4IW3A 2FDKA 1HDKA 2QUOA 1OQEA 4LKEA 1OLQA 4LNVA 1K5MB 2EA7A 2IVJA 1UW8A 2GALA 1XNKA 3USUA 5CA6A 1EUUA 2RR11 3U0ZA 4CDWA 2JG8A 2O8OA 1JHJA 4K8FA 1U12A 1RHI3 1UNBA 4FAGA 3VUOA 4DXSA 3W9AA 4N9HA 3WUCA 3VBOC 3KCYA 1VRH2 2BPA2 2FDIA 2BYVE 2BGOA 1BQPA 5FZ9A 3ILRA 3Q8BA 4XC9A 4XJ8A 3ZPOA 3DF0A 1X36A 4XJ9A 5KXDA 2XHKA 1R091 2WS93 5C33A 4OCTA 1HQWA 1ZRRA 3GDBA 4HVOA 2TBVA 2AEYA 2C6SA 4QDQA 3TAYA 4E4HA 2DU1A 2OPWA 1J1TA 3N7MA 4GMP1 3H1YA 1YWKA 5F7UA 3T4HB 2WWSA 4DQAA 2A3WA 1ZZ7A 4JDOA 5F5QA 5JZGC 4FFHA 1QJU2 4OUSA 2ZX4A 3NKTA 5CNAA 5FYHA 5FZEA 4QHOA 2A7AA 1WA6X 2HWC1 3T1LA 4P9LA 3N35A 2ZABA 5K8SA 4CUCA 4Q1RA 4A7ZA 3IMMA 1MQTA 3WOGA 1OF3A 1ZZ9A 1ACCA 1BEV3 2XXZA 4IV1C 1YIPA 3JU9A 4MXWA 4P9XA 5C8CB 5JIUA 2VY0A 2ZGUA 3T2OA 5IW0A 2EXIA 3W5NA 3AM2A 4RFRB 4XXPA 4QXBA 4DY5A 2HWB3 5J98B 3B00A 2HWF3 1ULGA 2ZACA 5FZOA 1CIWA 1RXGA 2AZ5A 5FZ7A 2GU9A 3H8XA 3N9NA 5DZGA 3T30A 3NVCA 2C4XA 5A33A 1GNZA 1GOHA 3LE0A 4HPKA 4AQ2A 1W28A 5FZGA 4LBQB 4XJUA 3FN9A 1K3IA 3AX4A 3I49A 1ENXA 4UBGA 4P9YA 5T50A 3AMNA 2UWAA 1DCSA 1NCRB 1TME2 4Q0SA 5DZEA 4XILA 4YM3A 3H0OA 2A6WA 4Q26A 3V65A 1UXXX 2PHUA 1YJLA 1HV0A 2C1FA 3HT2A 2VU9A 4DXRA 3B01A 3IM0A 4QPGA 3AL5A 4EWEA 3N7JA 4D7TA 4YGBA 5A6QA 4RYDA 4XFBA 3BOWA 4HOOA 3T3YA 1RVF1 2WT1A 1FV2A 4NJ4A 2NZ9A 4XHBA 4QHBA 5FAXA 1YQ5A 1V6NA 1VBB3 3KD4A 2CGNA 3S6PA 2WAOA 1UMZA 1DYKA 1O3QA 4XAAA 3ZSKA 2EAAA 1BBT1 2ZOEB 3LFIA 3AKTA 3N9LA 3BALA 1RUH3 2R49A 2D5HA 2ZS6B 1A78A 3EYPA 4HK8A 5EWSA 4ATFA 2R043 3IN9A 4CCJA 3PUHA 1RUJ1 3MW2A 1CN1A 2R0HA 4XCAA 1MEC1 2I2SA 5FPAA 3ZFEA 4LA3A 1SBEA 4XQDA 2W94A 4GALA 2WSVA 5LATA 1WCKA 2XJRA 3EJKA 3HWJA 3H3UA 5HCAA 2BZDA 4JKMA 3E97A 4FTSA 1OKOA 2BRTA 3LOIA 3IPVA 4Q4Y1 4L2NA 2VQAA 3HQXA 4Q4V1 5C3RA 4RS5C 4QKNA 3ZYJB 3M70A 5GZFA 5L73A 1ULPA 2RDQA 2R32A 1EP0A 1GWLA 3H1MA 1Z78A 4DRVA 2VZTA 2LS6A 5E1RA 5J36A 2XMLA 3I2KA 1AX1A 1GOFA 2WO1A 3K3NA 4GJYA 4WM7C 1G7YA 2E51A 3MIEA 1KQRA 3GM8A 3DYMA 5FY7A 2WYFA 1O8SA 1VB2A 4J1XA 4K6BA 3SCHA 1H8TA 3B3QE 1AYM2 1QEXA 3K4ZA 1TME1 3T1MA 1UYPA 2YBPA 3TN92 4EN8B 4LITA 1JZ5A 4LMFA 3GZUC 3GALA 3O1PA 5BUVA 2DBIA 4UOJA 1CZSA 1WUVA 2IXJA 4M3CF 3I3MA 5ABJA 1VBC1 1SLLA 2J1UA 5DQ0A 3AMMA 4EN9B 1FATA 1RUI2 1YFUA 2ZJCA 3J7NA 1S0EA 5DN2A 5HV0A 2D97A 4AQTA 5IYYA 1VRH3 1GNHA 1Y3TA 2YGMA 2NQYA 2QE3A 1NX9A 5CU1A 5A7NA 1B35B 3URFA 1XU1A 4IEQA 4XBLA 3KT1A 3S57A 1GYKA 2RS33 3Q8FA 2GMEA 4AEKA 3GZTB 1UU5A 3AYDA 5JMOA 2Q8CA 1CX1A 1LODA 1JBCA 3DUIA 2JKXA 4OLLA 2QKDA 3M3IA 3JCIA 5I8TA 1LCLA 1QJU3 1WLTA 3LCPA 4CDXB 1HRI2 3VLBB 4LJHA 5GJ6A 4AEDA 3WT3A 3WG2A 2WZR1 1OPMA 1SPPB 3OBTA 4PIXA 1OVPA 5FYMA 1I3HA 1UKRA 3MBWA 3DXTA 5A3UA 2R073 2DU0A 3PTRB 2ARXA 1QXJA 4DMIA 1WA4A 5T3NA 5FMOL 4UFIA 1X8EA 2Q1FA 1RUG2 4AXOA 1YO8A 5IT6A 2ZA9A 2XJUA 3MGUA 4B4RA 2X29A 3WW3A 3USSA 3A0NA 1SBDA 4HBNA 3RWKX 2FCUA 3VBRC 1ZVFA 2OS2A 1U5ZA 4XTMA 2J1RA 3VKOA 1RB8G 1EPZA 5FPBA 3T09A 1XE7A 5DAVA 4XURA 1PNGA 4Y5TA 3WEZA 1VP6A 4D69A 4K21A 3TN91 2NYYA 1Q8QA 3HJRA 3MI8A 4WZCA 1HB3A 4BCUA 4OZXA 4CCMA 1VBA1 2OW4A 4GB32 4LHLA 4YARA 3FZ3A 1NXMA 4UWDA 5EPAA 3MICA 4P08A 1GU3A 3VHOA 1DYOA 3KSCA 3WP6A 2VCBA 1MVEA 1RUI1 4RQPC 3HN1A 1DZTA 4IL7A 4NRPA 2E63A 3ILFA 2PHLA 2XQRA 4H2AA 5D8AC 4GWJA 1CGPA 2YGLA 4URAA 2FQPA 3MPPG 3PVBB 4MHRA 4CZSA 5C3PA 3C7FA 3NJZA 4CEWC 4HKLA 2XLFA 1IS5A 5C7GA 5IAXA 1ASJ1 1US3A 3T0DA 2PLV1 1V6MA 2RM22 4FPGA 4JGZA 4AVSA 3SEPA 2JG9B 1MZ5A 2Q1MA 4N53C 3FLRA 3D0JA 5A7PA 1QHDA 4EE2A 2WT0A 1K42A 5J09A 2RDRA 1W03A 5LRSA 2BNOA 3IB3A 1W6PB 1RUC1 3HBZA 1LOAA 1J3QA 3AP7A 5LK7B 1H8VA 2JDHA 4GKXA 5K0UC 2QQWA 1HRI1 1MS3A 2R062 5BNOA 1XNTA 1HXS3 4UW4A 5DUXA 2BQPA 2BTVC 4LXLA 1PK6B 2VTXJ 3CZJA 1PM4A 3LEIA 4AFCA 5CFCA 1OUSA 2D3SA 3HNBM 2Z42A 4FQ4A 5CBLA 1LOBA 1QDOA 3DYOA 4ZXEA 1F2NA 2ORZA 4XETA 5JI9A 4LLOA 2G1MA 4XIKA 1NZIA 2XKOA 2YXSA 3O14A 3ROUA 4AFBA 1NA1B 1OFSA 5BYNA 3MIBA 4IETA 1JYTA 4K8RB 3OPTA 1J3PA 4Y24A 3GZAA 2B5HA 2PMWB 1ULEA 1GSLA 3MFAA 4JC1A 2ZGKA 3NQHA 2O14A 1JN2P 2Y6JA 3RDIA 2VZOA 1RTVA 4GH4A 3VBUA 3DPRB 3OOXA 3TBDA 1UF2C 4AVAA 4NN0A 2VUAA 1RUE3 1Y43B 1AYM3 1J58A 1NOVA 4KQ7A 4WM8A 1W2OA 3V0BA 1CAUA 1NCQB 3H7JA 2VMDA 2ZMKA 1W2UA 3JQWA 1S0CA 4FCAA 1FPN2 1CESA 1W05A 1ZX5A 2E7TA 4QWNA 4NIDA
chains in the Genus database with same CATH topology
4V1PA 4XF1A 1OA3A 4KG0A 1AF9A 4H7LA 3QH7A 2IFRA 2IFWA 2JG8C 4R9DA 3USUB 3V64A 1VR3A 4CDWB 2DYCA 3CO2A 3KT7A 4BQ1A 1OQ1A 1NZCA 3NSTA 3LSDA 2PHFA 2VH9A 2W0XA 1D4M2 2QCSB 2R061 2XJPA 4M01A 1GQGA 4B8EA 2Q5TA 4J1WA 1G86A 3I59B 1S2BA 4TZDA 3AMPA 2UY9A 3GBFA 3B7MA 2GC2A 1EY2A 4MYEA 3VBOA 1ZYBA 4FPYA 4ES9A 3HMYA 3NAPC 3OF1A 4XFIA 3ZMOA 4PLNA 3IBMA 4Q8LA 4LO6B 1RUF1 1BK1A 1LGNA 1UZYA 1VJ2A 4X6RB 1LHUA 2DVFA 5K7PA 4MH0E 1MQTC 2HEVF 4Y1VA 2XVGA 3ST7A 3AB0A 5JZGA 2VGDA 1RITA 2MEV2 1YI9A 4BE3A 2ERFA 2BW8A 1SLCA 2QFEA 5JR7B 4MXWB 4BA6A 1W6QA 3OPZA 1A6CA 4B4QA 1BKZA 3UKVA 3BTAA 2JE9A 1HLCA 1W6OA 3MIGA 4YFWA 2HWD1 2UYBA 2YY1A 4SBVA 2H6CA 3IIAA 4IV1A 5JLVA 4LHKA 1UPSA 4UXAA 1GV9A 1R1A3 1XYNA 2V09A 1Z7S1 1ZM1A 3IDEA 4LBQD 5A33B 3CJIB 4W6XA 1Z0HA 1O3TA 3BODA 3VBHB 1COV1 4E2GA 5JOXA 3MW3A 2GDFA 4JDNA 4GKYA 3TWIA 2VMGA 4GIQA 4JTOA 2VG9A 5A32A 4QPGC 1ZBA1 1DFQA 4SLIA 4Y1UA 3RPQA 1GR3A 3MEPA 2JJ6A 4AGGA 3HIFA 4MGKE 1MZFA 3NV4A 2D93A 4AG4A 3AYEA 3NV2A 4TYSA 4NOTA 2CAVA 5BNPB 4M3CA 2WFF2 2WQZC 4YG0A 2ATFA 1ND3C 4Q4X2 2YMZA 4QGNA 3CEWA 2O1QA 3ZFEC 1AJOA 4CTEA 4CRQA 4EN6B 3AXEA 1QWRA 4LR4A 1W6MA 1YLLA 3B9CA 1SFNA 3NWKA 4RHV2 2DWRA 1QQP1 2X8KA 2IXLA 2AGSA 4XIOA 3ZX7A 1DG6A 1OOPC 2JXAA 1YUDA 1XNBA 1PO22 3JB8A 3RJRA 1HRV2 1VBD1 4N43C 1GBGA 2VOXA 3GBWA 1KJLA 2PFWA 1EYBA 3GBGA 3WW2A 2UU8A 1JW6A 1FOD2 4X6QB 5BPXA 4E2SA 4X8NA 3G7DA 4XFHA 2FBEA 2ZKNA 4R9BA 1VAKA 3E5XA 3JBG2 3JD73 1H8TC 4GULA 5T5LA 1EV12 1ND2C 2P3IA 3M3QA 1H8TB 4ATEA 1AL21 2PHWA 3ZXJA 3RMYA 4L9BA 3D4KA 4WM7A 3E6CC 2XBO3 3M2MA 2GZWA 1URXA 3MLJA 3LA2A 2WFPA 3FMGA 2TEPA 2LM3A 2NLRA 5ABJB 1OLRA 5HXVA 1NLSA 1YJKA 4ES8A 4Y20A 3KT4A 2ZGNA 3LB9A 4J6GA 1H2NA 1WCSA 4L99A 2WFF1 1D4M3 5AVPA 2JENA 1S0DA 3DL3A 4JAAA 1LHWA 4Z82A 2A3XA 4Q27A 1VAVA 5CIRA 2D6PA 2XJSA 5CG9A 2DCZA 1AR81 4NR1A 2WNVC 5I0UA 5GLZA 3E6BA 2WJSA 2A6YA 4RHV1 4P9WA 2IXIA 1S0BA 2Z2SB 4AVVA 5DDJ3 5T5JA 3L2YA 1H4HA 1H4GA 4Y1XA 3E5QA 4AEDB 1U0AA 2NM1A 5C8WA 5IK4A 4FVVA 3HR9A 1AR61 5E16A 1V9U1 1TNFA 3IT8A 3ATGA 1BXHA 1FOD1 3WV6A 4OFGA 1ZBE2 4B4PA 3ZXLA 2I74A 2P37A 5ACA2 4DB5A 5J3UA 1DHKB 1AXYA 5JAXA 1VBE2 1FMD1 1V00A 2NN8A 3OBRA 2GNBA 4QMAA 1GKBA 2B8MA 2V73A 2XWJB 3VBRA 1RMU1 1V6IA 4AQSA 1IPJA 3O7OA 2ZAAA 2HWE2 2ZMNA 3U11A 5KWRA 3M3OA 3FLPA 4ISQA 4ASLA 3W59A 1BYHA 3X29B 1NQJA 1MS5A 1S55A 1NYWA 3PTYA 3PNAA 1REEA 5JSOA 4DZGA 1AXZA 4JGZB 4YVSB 5D8AA 5KHKA 2BVBA 1UIJA 4XJWA 3S7IA 5F6KA 1F31A 1TMF1 3SITA 4XJAA 1WLWA 4G9SB 4HL0A 3J8F2 3G6JB 2RJLA 2E6VA 3UV9A 4CEWA 4Q0UA 1YIFA 2DUPA 4Q4X3 3B5LB 2ZKLA 2RR12 4N53A 5KC6A 1RUD3 5E89A 1JOJA 5BNOB 1DLLA 2QNKA 1VB4A 3MFCA 5CFCB 1ZZBA 3HD8B 1CAXB 4AI8A 5FMOS 1AHSA 1TEIA 3K48A 3VHPA 4YVWA 1RHI1 4EN7B 4IEVA 1R092 3AFGA 5I8YA 2BUKA 1QJY2 1ZZ8A 4L11A 1BJQA 4GH4C 5A3MA 3VBUC 4YM0A 2WS91 5EXOA 4YW5A 1GZWA 4GH4B 2D3RA 3LWCA 5H9RA 3VBUB 4O9GA 1AXKA 3VKFC 5BNNC 1ENQA 2ZX2A 2A73B 2HWE1 3L9JT 1CAWA 4PBPA 2HWC2 4WM8C 4MXVA 1GZ9A 1CAUB 4AHWA 4R9CA 3RMXA 5GLWA 4AI1A 2Y38A 3FBYA 2XWBB 5K9YA 1UU4A 2VOWA 4Q29A 2FMYA 3VDDC 4XQWA 2ZGPA 5BV6A 3LOBA 1ZZ6A 2BGCA 2XVLA 2UURA 3HAGA 4FP3A 2ZGRA 3J8F1 3J4UH 5HI0A 3GF6A 3M7AA 4YGCA 4EV0A 2HWF1 3AP6A 1FAYA 4KU7A 3EHKA 1FX5A 4YZ4A 4QPIC 3DN7A 2RS13 1T6GC 1YI7A 2BBVA 3P3NA 3VBOB 3GHNA 1V6OA 1R081 1CQ9A 2ET7A 4PF5A 2YDEA 3U10A 1RVF2 4LBLA 1MS1A 2CNAA 3FFQA 4RR3C 1QJY1 2XJQA 3WDWA 3NAPA 1BCXA 1UPIA 4B7EA 1BBT2 4JVAA 1UN1A 4IXLA 1VBB1 2BEOA 5ACA3 1KD7A 1RUJ2 3RI8A 5JZGB 1J59A 4R52A 1D0GA 1MEC2 1UKGA 3TB0A 5FPXA 1EAH3 1OFNA 1UX6A 1W6QB 4LLFA 5C9AC 4Z8BA 1PVC3 4UW6A 1PIV3 1QNYA 4KH9A 4QQPA 4D7SA 3AMQA 5DXDA 1IPKA 4M3CE 1ZRCA 4IV1B 2XJTA 2PELA 2XVKA 2JDZA 1DIWA 1Q8PA 1QDCA 4Q4Y2 4WVMB 1JTZX 1O7FA 4Q4V2 3H3ZA 2GAUA 4HVQA 2PAMA 4IEPA 5T55A 4IEUA 1DQ0A 2YPJA 1JH5A 4NPRA 4I0AA 5C4WA 3S7EA 4PQ9A 4A7YA 2ZHMA 3POSA 4LHNA 2GC1A 4Q4W3 4E27A 2FHRA 3KMHA 1AUYA 5A32B 4LA2A 1LR5A 2Y26A 5J48A 1XQNA 2OUHA 1NG0A 4Z2WA 4IEOA 1DQ2A 3OYWA 2RR13 4K1ZA 3AFKA 1VBC2 1QKQA 3ECQA 2XB6C 2ZGQA 4FPKA 5JVVA 3R4DB 4IEXA 2YROA 5H9QA 2UYAA 5C8CA 1V70A 2ZPXA 3DV8A 3WQ1A 3WQ7A 1JXNA 4K3UA 1XYPA 1AJKA 3KCCA 2RS51 1DGRN 1W6MB 1ND3A 2ZZQA 3KM5A 3ACLA 4NWWA 2K0GA 1UU6A 1YCIA 1C8M3 2AR6A 1AVBA 1B09A 3TNPB 4LUMA 4PIYA 4COZA 2RS31 4GMP3 3LAGA 3B94A 1XXNA 4YYOA 4RL7A 1IS3A 3ALQA 3D82A 2MNGA 5JWPA 1POV3 2XKPA 4ASMB 3QCWA 1OOPA 2WZR2 5CG8A 2GN3A 2ENRA 2VOVA 2HWC3 4Z1VA 2ZX1A 3M3CA 4B7KA 3A0KA 3MIFA 4LO5B 4N43A 4RS5B 1NE4A 1WCDJ 4HMZA 2R071 4OHXA 1BMV1 4Y26A 4M00A 4JTNA 4CP0A 5FLHA 2B45X 4WM7B 3O0VA 1SCSA 1ND2A 1A8DA 2OIIA 2A70A 4K7JA 4AVBA 5JPNB 1VBA2 1REFA 4R8HA 1O4TA 1DBNA 1H9WA 3O0WA 4Y20B 2PAEA 4KU8A 4KWKA 3WXPA 4EROA 4KWLA 3K51A 3VZNA 5FTTC 1CAVA 4AHXA 2WNUA 2YC0A 2QZ2A 2VVFA 2W39A 2I45A 1ASJ2 1FNZA 2PLV2 5E8AA 4PBOA 1RVF3 3FBMA 5GLVA 4OHYA 1H9PA 1MZ6A 4PJYA 1QOTA 5H9PA 2P17A 2QQPA 1RUC2 1SBFA 2WNVA 2JX9A 1WD4A 1CJDA 2IXCA 1RUJ3 4AK3A 2D6LX 2DUQA 3AJYA 3VL8A 3AK0A 3B9IA 2VNOA 1YFWA 5LK5A 5I0RA 3VHNA 1HXS1 1LOFA 2UY8A 4I3PA 5JSPA 2C9AA 3APBA 4PDWC 5SV5A 1M4WA 1XRUA 1PO12 5EYXA 4Q4V3 4BIOA 3VBRB 4ZU7A 3EQEA 3VKLA 4RSUA 3ZPYA 3P3PA 4KBBA 4QT6A 1SACA 2BFUL 5CVRA 3UK9A 4Y22A 1H0BA 1IKQA 2PHTA 1G9FA 3WDVA 2EVXA 1V6JA 1TQ5A 5F9TA 2WINB 3MZHA 3ZYIB 1TME3 1PZ8A 3OD0A 4Z92B 1RUE1 4RQPB 4FPLA 5D8AB 2ZBJA 1D2QA 3N4MA 2XJVA 4XW3A 5KHGA 2GNTA 5DG2A 4XF4A 1DGLA 1ZZCA 4NVPA 4YSFA 4CEWB 1FV3A 1QXPA 4FBFA 2D6MA 3J9SA 1WBLA 3R05A 1WMEA 4N53B 4L97A 2A5ZA 3MDPA 2DCYA 1N3QA 4YVWC 4FT8A 1OI6A 4HKWA 3RSJA 3WLUA 2WLPA 1KFUL 3ZYGA 4R9AA 5K0UB 2BNMA 1FI2A 5CFDC 2K9ZA 4GWNA 4CDQC 1PGSA 3FX3A 3N3HA 4M0NA 3LA3A 3ZFGC 3AZWA 3WP3A 2WNEA 5EFUA 1N1SA 4YGEA 4OI1A 1C1FA 1QXRA 1PO11 1EPWA 2VNGA 2AH2A 1RUF2 4H7MA 1SCRA 1UD1A 4K1YA 5HBAA 5LEJA 3H7YA 1BZWA 1CAWB 2A6ZA 1RGSA 1SEFA 3EBRA 5BNNA 1S0IA 1IS6A 2XPJA 2GNDA 4XMIA 3OY8A 3TN93 1Y9QA 4FSJA 1MS8A 1VBA3 2HWD2 1S1AA 5T5PA 3N7KA 2PN5A 3AMHA 3VDDA 1Z7S2 5FQ0A 1ZRDA 1RUI3 2RMU1 3SCFA 1W6NA 4TWTA 4OI4A 1COV2 1R1A1 2JG8B 3V56A 1QU0A 2KA3A 4JRLA 5A3LA 3WDXA 1LECA 2OZ6A 3NV1A 1YFXA 1ZBA2 4XEZA 3AJZA 4E4ZA 4FPJA 1LEDA 3V0AA 1ZREA 2SLIA 3AP9A 4C1WA 4QPIA 2DTYA 3ZN6A 2YHJA 3ZIWA 1F8VA 3ASIA 4URTA 1VIWB 4LULA 1DGRA 1HRI3 3H1WA 5T5OA 3WHUA 1JUHA 2P3JA 1AR72 1X50A 4CDUC 1QJX2 3NAPB 5FFOC 4BHPA 3ZXFA 2QDRA 2ZCWA 2GH8A 2MPFA 4YZ2A 1OD5A 4O9EA 1RUG3 4RR3A 5GLUA 2JICA 3FFZA 5I8SA 1IGOA 2QVSB 1QQP2 1MQTB 4MVTA 4TSVA 1DU3D 4YZ1A 1KFXL 2ARBA 2MHFA 2XL7A 3DGTA 1VBD2 2EALA 5C9AA 4GB33 4RFT0 4YLZA 1JUIA 4DNYA 2WL1A 5C4WC 4BIFA 4RGGA 2ES3A 4FPOB 4HPKB 5KHHA 2E53A 3JZVA 1KXGA 5GZEA 2ZTNA 1TE1B 1J1LA 1AL22 1NY71 3BB6A 4JGYC 2B42B 2JD4A 3JD71 5EZWA 2RM23 1HKDA 1AR91 4MX3A 3S0MA 4BLJA 1H1AA 4S2GA 3WNXA 4LO7A 4IEYA 4LBMA 4QPGB 2DFBA 3OYWB 3R0RA 4XOGA 1MZEA 3THTA 1SQ4A 4HANA 4COWA 2XBO1 3UJOA 3KGLA 3WW1A 5C8CC 1R1ZA 4DPNA 3JUUA 4META 2R063 2VVDA 4AI2A 4OULA 1AR71 4LEJA 1QJX1 1KDKA 4XPVA 3KCXA 2WLQA 2K2SA 3KZ4C 1ND3B 2AENA 3D0SA 1AR82 2WT2A 3KGZA 4R4ZA 4TLFA 3ZFEB 4OI0A 4FTBA 1WLDA 1FXZA 1N3PA 4ZKTB 2GMPA 1KS4A 4IESA 1DDLA 3QH6A 4F8AA 2TUNA 1S2KA 2X5IC 1H1MA 1OOPB 2CTVA 4MV2A 5L36A 3MLKA 1SLIA 3IPVB 5DDJ1 1AR62 1V9U2 4N43B 3VZMA 2EXJA 5KXEA 1LOCA 1OKQA 3VBFC 4EJRA 2V5YA 1GLHA 4AHYA 5JDBA 2HWD3 1FPN3 3CL1A 4LE3A 3M8LA 1FMD2 1ND2B 1LENA 1Z7S3 2N7GA 1RMU2 4WVVA 1XNDA 3GNEA 4UW3A 3D6EA 5AC92 1COV3 2XLGA 3B93A 3POYA 3ME2A 4I0BA 1W0OA 2LUWA 2WNUC 4FOYA 3RS6A 1CAVB 2WNUB 4HSLA 4OI2A 1GFF2 3ELNA 1ZNPA 4BMBA 4XFFA 2D3PA 1PGL1 4MSVA 1E57A 2DCKA 4XF3A 5FCCA 2CWMA 4H55A 4DRRA 4IQPA 4KL1A 1TMF2 2CWSA 3IKWA 3LSEA 1LESA 2WNVB 2CGOA 2TNFA 4N7UA 3WW4A 2D5FA 4IEWA 4A7KA 2X53S 1AZDA 2GC0A 3UKTA 3E5UA 4LTAA 2R1BA 2RE9A 1O4ZA 1UAIA 1PGW1 1LHNA 1S0GA 2ZX3A 1LOFC 4Q0PA 1RUD1 2MEV3 <