2BP6A

Crystal structure of pseudomonas aeruginosa lectin (pa-iil) complexed with a-l-galactopyranoside
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
114
structure length
114
Chain Sequence
ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PSEUDOMONAS AERUGINOSA LECTIN II
publication title Binding of Different Monosaccharides by Lectin Pa-Iil from Pseudoman Aeruginosa: Thermodynamics Data Correlated with X-Ray Structures.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Lectin
total genus 20
structure length 114
sequence length 114
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07472 PA-IIL Fucose-binding lectin II (PA-IIL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.400 Mainly Beta Sandwich Jelly Rolls Calcium-mediated lectin 2bp6A00
2JDPA 2JDUA 1OUSA 2BV4A 2JDNA 2JDYA 2XR4A 1UQXA 5D2AA 1OXCA 2VUDA 2JDKA 1W8HA 5A6QA 2WR9A 2BOIA 2VNVA 2BOJA 5A3OA 1OUXA 5HCHA 1UZVA 4AOCA 2BP6A 1OVPA 1GZTA 2JDHA 2JDMA 4UT5A 4CE8A 3DCQA 5A70A 5A6XA 1W8FA 2CHHA 5A6ZA 1OURA 2VUCA 1OVSA 5A6YA 2WRAA 3ZDVA
chains in the Genus database with same CATH superfamily
2VD7A 5JPNB 3TYJA 3POYA 3T0AA 4D7SA 3B93A 3RVHA 3I4IA 4XAAA 2X5IB 5JVVA 2A3YA 2DVFA 2NMOA 2CGPA 1K5MB 1O5LA 4NPRA 4OQ9A 3VUOA 2P37A 2RS31 2YU1A 1J3RA 2YYOA 4MGKE 4L99A 1G9BA 2WO7A 4IEUA 1RHI1 3VBUB 3I2IA 5B4XA 5KHHA 4XDOA 5FQ0A 3MUZ1 4KG0A 1S1AA 2YU2A 3T0BA 3UETA 5LWBA 2Q30A 1BVVA 1NCRC 4XJAA 3RJ2X 4Q4W1 3D8CA 3WNKA 1WZXA 5IW0A 4QQ2A 4WVVA 5FY1A 4YVWC 1JYVA 1OF3A 2RS12 3MEPA 4IEPA 4LMFA 4QB6A 1DBNA 4OMDA 5K8SA 2CSGA 4JTOA 1UQXA 2BFUL 2XJQA 1RUI2 1JW6A 3KZ4C 4MGQA 5FJHA 3UJOA 3WD5A 5FOBB 4OUEA 4Y1XA 2RR12 1PNFA 3QH6A 2BNOA 2RVAA 4PDWB 2V09A 4MHRA 4AEDA 1ND2A 1V6KA 1URXA 1UKGA 5EQUA 4BQ3A 1COV2 3MYXA 5GZFA 3KT1A 5LBBA 4FP2A 4FPGA 4YFWA 5DZGA 3DGTA 2WO1A 1NCQA 3SNMA 1IG3A 2XPJA 4AZZA 2ZMNA 2RS33 4LLOA 3ZYGA 2QQJA 1TMF2 5FZOB 5FZAA 2C26A 2Z79A 2VW0A 4MX3A 1RHI3 1GQHA 1N1TA 3BUCA 4B1MA 1GNZA 4MGSA 3AVRA 2NLRA 3HD8B 4BMEA 1DP0A 3U78A 2OIIA 1AYN1 4GJZA 2E7AA 3KVBA 4LHNA 4Q4W3 1UZZA 1RUE1 3T1LA 3SEPA 4Y5Z0 1JU4A 1UY1A 4QPGB 1MS0A 2RMU2 3SCGA 1JZ3A 3CU7A 4QPIB 5DUVA 1G9FA 3R4DB 3PHMA 1QH6A 3LD8A 1DGWX 4X8PA 1LCLA 3GM8A 2K46A 1OOPC 2JD4A 5E6HA 3OSDA 2H6BA 2G9ZA 2ZACA 4K40A 1W04A 4Q8KA 2E63A 3QLQA 2E6VA 2VMDA 3LIGA 4LEJA 4XMIA 4SLIA 1GFF2 2Y34A 3CZUA 4CEWC 1DYOA 2RS52 3AZVA 4HK9A 5AC91 1VBC1 2P3YA 2QBXA 2XJTA 3AX4A 4ZONA 3EJKA 1X8EA 3D5OA 4QHOA 2VVDA 3H1MA 1FI2A 1W2TA 2UU8A 1PHMA 2R1DA 3CF6E 5JZGC 3MFAA 3A4UA 1LENA 1OT5A 4CDQA 1HV0A 5LBFA 1EUUA 3HQRA 5DAPA 2OYZA 3U10A 4LORA 1MVEA 4WBBA 1YO8A 3LSDA 5FKCA 4ZZ8A 2PAMA 4DB5A 1AYN3 5C33A 4V2VA 1MVQA 2W3JA 1Q8SA 4WM7C 1RUE3 1UMZA 2WS92 1YLLA 2D3RA 2R042 1RIRA 1C5HA 5LBEA 1H8TB 4GB32 2B8MA 2P3IA 4QX2A 3RG0A 5T5LA 1EYBA 1PGW1 2ID4A 5KHIA 3O1MA 1H2LA 3I3DA 3VBFC 2HWC2 2RM22 4YW4A 4QQLA 1GWKA 4QHZA 1OMIA 1KQRA 2BRTA 2P1BA 1F31A 2QQIA 1H2KA 4XIOA 4M0NA 4NAOA 4UXAA 1F5FA 1UY2A 2NZ9A 2GALA 3P3PA 3INAA 1LR5A 1S2KA 4JGYA 2D5FA 1MS3A 4NRQA 4GJYA 4AEDC 1UX6A 1WLDA 2XHNA 4C91A 5AC93 4G9SB 3MIGA 1VBC3 2KXLA 4CUCA 4C0BA 5FMDA 2WT1A 3NJVA 2EXHA 3CMGA 3VZNA 3CLPA 1HB3A 5DDJ2 3ZYHA 5K9YA 1CQ9A 5FREA 4YM2A 1NCQC 1WGPA 4JQRA 2WYSA 4X6QB 3T3YA 2W92A 5E8AA 3BTYA 4M3CF 4E4SA 1RJ8A 3B3QE 3HBZA 2Y38A 1H1IA 4ORFA 2CAVA 3E6BA 3OD4A 3WQ7A 3M8LA 4E4DX 2XL7A 2DFBA 1GOFA 2RHPA 4HN0A 5H9SA 3WQ1A 3K3OA 3AVSA 1RUD2 1R1A1 3EMRA 3FFZA 1NQDA 3J7HA 1QXJA 3LEKA 1SMVA 4LK7A 4JKMA 2B9VA 2C5DA 2Q0AA 1MPXA 5LA2A 2E51A 4N9HA 1KFUL 3LA7A 2OX0A 4FOWA 4OULA 4OZXA 2D97A 1W9SA 2PXJA 4GMP1 4D0QA 1CAXB 2QDNA 3ZX7A 5C3RA 3KV5A 1QF3A 1XNCA 5FLJA 5FO9B 2A3XA 3VL9A 3MF6A 5FYYA 4ZPIA 4Q4X2 2EF6A 4KI5M 1ASJ2 4W6WA 3ZYRA 4DRVA 3TN91 4FOQA 4HSLA 4YGDA 4XJZA 1W6OA 1W8ZA 1SQ4A 4PI2A 1DQ2A 1SBFA 5G05L 1XOYA 2ADDA 3E97A 1JZ7A 1DZRA 2WWSA 2RR11 4IQPA 1FPN1 2FHRA 1H2MA 5LZ6A 1PMJX 1EV12 2JD9A 2RDQA 4N7UA 4BB3A 1OF4A 1WD3A 3MIEA 1PM4A 1COV1 3PMEA 3QACA 3ZFEA 4CE8A 1AR82 4XUOA 2DURA 4Q1RA 2P3JA 1PX3A 3OF1A 1I6XA 4BE3A 1NKGA 4CDQC 5B2GB 1WMEA 4YVSA 1R1A3 3WUCA 3ZXLA 1SFYA 1XNKA 1OBNA 4NIDA 3MLJA 2QQUA 2WNUB 4NWVA 4CEYA 1ZYBA 1Y3TA 1GNHA 2VXRA 5C3SA 1W8NA 2JDYA 1W05A 4GMP3 3VZKA 4D69A 1DYPA 2R32A 4AK3A 2Y6GA 4XMAA 4OHVA 2Q8CA 1TG7A 4TZDA 5GJ6A 4M3CB 2VXJA 3TN93 2XKPA 1UIJA 4DY3A 5KBFA 2DFCA 1DGRN 2JX9A 2LM3A 4QX0A 2WZR2 5FUNA 1ZBA1 4L97A 4I3GA 4J1WA 3RWNA 1UCXA 1WCKA 3BU0A 4ET7A 2RR13 1FPN3 1DQ5A 2W5FA 4YARA 2DCJA 2ADEA 3VDDC 1TZOA 5A6YA 1XYNA 2QNKA 3ES1A 1ODNA 5ACA2 4GH4B 1COV3 1L7QA 1U0AA 3SISA 4AHXA 1R1ZA 4HT1T 4XE9A 2RS51 1CAWB 1T6BX 2B42B 1WD4A 4KU8A 5JXGA 5DQ0A 5A80A 4UFJA 1Q5OA 2GC3A 4A42A 4XABA 3C8XA 4FTSA 4O65A 3ZR6A 4YZ4A 3UKTA 1EAH1 4HKLA 2F4LA 2VU9A 4S2GA 4XACA 4P9IA 3NO8A 3OCPA 5FZ0A 3WDXA 1OPMA 5IWFA 4KBZA 4PLNA 2ZZJA 1LECA 1YQ5A 1PGSA 4Q0QA 2DYCA 5FMOL 4XUNA 4A45A 2H6CA 2E31A 2HEYF 4CP2A 3HR9A 4Q1PA 3TEYA 2WS91 3ZKYA 1US3A 3ROUA 2R041 2VULA 1QMJA 2VCCA 4MYEA 1NLRA 2A6YA 3LPGA 3LGRA 4B3NA 1ZBA3 4FPHA 3AMMA 5T5JA 2DU1A 2WWUA 3MI8A 4WZFA 1X9PA 4FPFA 1AF9A 1IPSA 2QQVA 4FT8A 3URFA 5FPXA 1LESA 1QKQA 2PYTA 4N8MA 3PVEA 4AQ6A 5HCHA 3RZLA 2X05A 2AREA 4JDOA 1PK6A 1KITA 3FWEA 2O0OA 2RS53 3MW2A 1GU3A 3LCPA 2XKOA 2P6CA 1DF0A 3GDBA 4YVWB 5I8SA 1H4GA 1HQNA 1GWMA 3W9AA 3ZKUA 2VO5A 5DDJ1 1UF2C 4XEZA 1OFNA 2B39A 4NHXA 5FYZA 1EAH3 3M70A 2W39A 3PLQA 4BA6A 2R062 3FC0A 4A7ZA 2ZEWA 5EIYB 5EV7A 3A21A 4CDWB 3KV9A 4DXZA 4ES8A 1MZEA 4HK8A 2WS93 4CEYC 1XQNA 1RUD1 1LOGA 2R043 2YY1A 1ULCA 2P34A 3O7OA 3DL3A 1SHWB 1N47A 5C8CA 3NWKA 3WINE 4COWA 4B4QA 5C5TA 4L2NA 4TXWA 2W94A 1QXRA 2YMZA 4MG2A 1O6UA 5IVFA 4PQQA 1O3TA 1C5IA 1HKDA 2FCVA 2YPDA 3A7QA 1SDWA 1QQP2 3O0XA 4S2HA 2P5BA 3ETQA 4XFBA 4HL0A 4LK6A 4Q4X1 3S6PA 1CJPA 1UL9A 1POV0 4HMZA 1AR61 3ZFGB 4ASKA 3VD7A 3U11A 3I8TA 1O3QA 5CG9A 1TME2 4CU7A 1GOHA 4LPLA 2GNMA 3ZXGA 4CCJA 1IKQA 2VECA 5G04L 2VZPA 2YUEA 3QD6A 5DDJ3 5F5QA 2O1QA 2R072 1GZTA 5I0SA 2ZS6B 3VBSB 5FWEA 2XH6A 1SDDB 2XVKA 3ZXJA 1OOPB 3PIJA 3ACFA 4U36A 1QDOA 3RZKA 3MHZA 1UN1A 2W68A 1A8DA 4DXTA 3S0MA 2QQKA 5EFUA 2J42A 2YHJA 4QDQA 1RUD3 3H42B 2WO2A 3HQUA 2JB4A 5CAZA 2RJKA 5C9AA 3PMSA 2DVAA 1BMV2 3U4XA 4QX3A 2D93A 1GBGA 2LS6A 3JU9A 4MSVA 1U12A 2NN8A 2YC0A 4PBPA 4CP1A 5CFCC 2BPA2 4GKXA 3LOBA 1VE0A 2PHWA 5FPAA 3I3QA 4AFDA 1MS1A 5JZGB 5FY9A 5JI7A 3MV01 3MIFA 3E1F1 1U5IA 3EHKA 3OB8A 1Q8PA 4Q4X3 4M0HA 4AW7A 3K3NA 1AR63 2Q1MA 5DABA 4YW1A 5IVJA 1VB2A 4BIFA 1IS5A 4WM7B 4PIZA 5HCBA 3UKVA 2FDGA 3IPVA 4RN5A 2YFUA 1PIV2 1FAYA 3CJIA 3PURA 3D6EA 3VHRA 4D6RA 1JZ6A 1MS5A 1CAVA 1PK6C 2G19A 4NAMA 4EN6B 1G7YA 1I3HA 1LULA 4AE2A 4ARYA 5ACA1 3BOPA 3E6CC 4IGPA 3VBFB 5FXXA 2X09A 1XU2A 3B01A 2NP0A 3POBA 5FY0A 2ZEZA 5BYNA 1AHSA 3PUHA 4AVCA 4NIGA 1S4CA 1UW8A 1QHDA 5DUWA 2WR9A 2UYBA 5FZLA 1QH7A 2WYFA 4N43C 4P9JA 5F8PA 2JG8A 1KEXA 5LK5A 4QGNA 3WG1A 1JYNA 4Y5TA 1JYCA 3I3EA 1AR92 1UPSA 1ZNPA 2LTNA 3B9CA 1WKYA 5ERLA 2HEVF 1W3XA 2WQ4A 2Y6JA 2E33A 1UIKA 5M0TA 3FMGA 3ZXAC 3MFCA 2YB7A 2W47A 2ZEXA 1HJFA 3KT4A 3ACHA 1GKBA 4I0BA 2ZGMA 4LKDA 3N36A 4JGZA 3U75A 4N53B 1WW7A 3OBRA 5FZ7A 5FCCA 1RVF2 4BQ4A 3T0DA 4XFFA 4EWEA 4LITA 4XTMA 4P5HA 5FXWA 1OXCA 1NY72 5JOYA 1MEC1 2OVUA 2BNNA 2F4PA 1RMU2 5JR2A 3DECA 3UGGA 5A1AA 3FBMA 2VOKA 4Y1UA 1WW4A 2DTYA 4XXPA 4XJ8A 1YIFA 4XFIA 4AFCA 3I3MA 3DPRB 3POEA 4MOAA 3ZSMA 1ZX5A 1X8MA 3ZVXA 2VW1A 3GZUC 3Q9OA 2BYVE 4IV1A 4MGZE 3BODA 1YIPA 1F8VA 4FFGA 4ONUA 3J4UH 4IV3B 2K0GA 3L9JT 4FI9A 4IDZA 4QKNA 5CADA 5EWSA 2ARXA 2W1SA 1GUIA 1LOCA 3AMQA 1YFXA 3S30A 4ATFA 4GULA 5JCTA 1Z78A 2J1AA 5F5IA 2Z4FA 3DKQA 4PBOA 1W6NB 4B4PA 5JIAA 3AM2A 4P9GA 4DIQA 3VDBA 4B29A 1DDLA 1Q56A 3K75B 5C9AC 2FDHA 4BHPA 2ZGKA 4K20A 1GANA 2MPFA 5BNOC 1CAXA 4SBVA 2P6HA 2AEYA 3PUSA 2ES3A 4GIQA 3ZXFA 3PVNA 4A4AA 4AQ2A 1XE7A 5HXMA 5HPOA 1MEC3 4BYYA 4HPKA 4FFFA 2O14A 3V65A 4QM8A 2PMWB 4D6SA 4YRDA 3GALA 3HBKA 3VKNA 4AEKA 1LAJA 3O5SA 2FMYA 2HYKA 1OA2A 3JQXA 3CJIC 4M3CE 1H9WA 1LOEA 3ILNA 1QJY1 5BNNA 1CAUB 2QQWA 2BERA 2D3SA 1RUC2 1OQ1A 2R0FA 3D82A 4QPWA 3ZYFA 4AG4A 3AYAA 3WVJA 2VJXA 2D3PA 3VDAA 2XBO2 2ZGLA 1O4TA 1RUOA 2R071 5LK7B 1RHI2 1PMIA 1FMD1 3BCWA 2J1EA 5DUUA 1LGCA 1BHGA 2JG8C 3VDDB 4ASLA 2OPKA 1SBEA 2OUHA 3H9AA 1HB4A 2A6XA 4XTPA 3ATGA 3V0BA 3OUHA 2OQ6A 4CCDA 3FJSA 2GH8A 1BMV1 1WWYA 1R081 4AEJA 2QUOA 2JE8A 3SMHA 1J1LA 1E5RA 5D2AA 5EPAA 4AQTA 1QJZA 1PO12 1B35A 5EHDA 4BOWA 2ZHLA 1Y9QA 2UWAA 5C4WB 2IVIB 1LHWA 4LBQD 2XL9A 3C7GA 5HV4A 4K6BA 3ZN6B 1GOGA 3LKJA 3T08A 2GSYA 4GD4A 3WCSA 1GP5A 5CFDB 1DG6A 4XIKA 2Q4SA 1CN1A 1QJY3 5KXBA 1KDKA 3I2DA 3MPPG 3O0VA 5FR3A 5IVCA 3RZGA 4XBNA 1O4YA 1Y43B 4YW2A 5TSWA 4ZKTB 1PIV1 4LHLA 4UWDA 2JICA 5F3CA 1OA3A 1YEWA 1D2QA 1JI6A 3VBHA 4AR2A 1AJKA 2R073 2V4VA 1O5UA 5FLIA 1FMD3 2D40A 2DVDA 4YLZA 5ABJA 5FXVA 1AVBA 4QDRA 3EB7A 5FK8A 4B4RA 1AYN2 3WF0A 1JOBA 4YGCA 1MACA 1LHOA 1RINA 1RUE2 4TLGA 4Y33A 3POGA 1YYNA 4R4XA 4LIVA 1AR91 1JN2P 1R083 1ENQA 2WAOA 3O1PA 3OG2A 4QD2A 2FDIA 2ZGRA 5LRRA 4QKBA 4XF0A 4XVHA 2IFRA 5FZGA 1ND3A 5GLVA 2ZZQA 4HKWA 2F6BA 4NHMA 4AI3A 3I2JA 3GBGA 3IBMA 1YCIA 3N7KA 3P6BA 4BIOA 5GLWA 1IS6A 1XNTA 4LE4A 2ILMA 4CXXA 1RVF1 4AGGA 3U14A 4A6OA 3M3OA 1AL21 1FX5A 1VBC2 1S0IA 1UZWA 1PIV3 2XLGA 4RS5A 2D44A 1G8WA 1RUJ2 1RMU1 2VW2A 3B5LB 3Q8BA 3KV6A 5T50A 1RC6A 5EJ1B 3N35A 4Y24A 4C8DA 3WZ1A 4EYUA 5BNNC 4QKFA 4XUQA 4LJHA 2BUKA 4XZUG 5IJRA 1WBFA 2VQ0A 3UGFA 5BNPA 1LOBA 1L7RA 2NM1A 4Y22B 1AXZA 3RMXA 4AHZA 4EN9B 1WA6X 3USUB 2BTVC 4HVOA 5FYHA 2YGLA 1VBB1 3U37A 4XAEA 1JXNA 3I2HA 4LKFA 1AR93 4JHZA 1W9TA 2B5HA 3I54A 4MGTA 4YM3A 3U4SA 1UWWA 1KFXL 3F2ZA 1RTVA 3WDWA 4OZOA 3OGVA 4Y20B 3ZM8A 4IE4A 4AI0A 1YQ6A 4DINB 1PO22 4H55A 2WKKA 1PZ9A 3VLBB 4EN0A 5IUQA 1W3VA 2VY0A 2JDZA 3LZZA 4IEQA 1LGBA 1W8UA 4NIAA 3SCFA 4P5YA 4DPNA 3PL0A 1JBCA 1NA1C 1RVF3 2Z2SB 1LTEA 1YFUA 3G6JB 1AL23 1WCUA 3THDA 5GZDA 4R9AA 1RUG2 5DN2A 4BCUA 1RMU3 4CXYA 3LA2A 3KB5A 1AJOA 5FMCA 5JXIA 2XQXA 3ZYJB 5CFCB 5B4NA 4XUPA 1ZA4A 2W87A 3PNAA 4YGEA 3A0KA 4CDUA 4CZSA 4PLOA 4R52A 2JG9A 4RGGA 4YNIA 1HX6A 4MLOA 4KWKA 3AZWA 2XMLA 3VBHC 1LOFA 2GN3A 3PIGA 3VZLA 4A3ZA 2BGOA 3IDAA 2GMEA 2NMNA 3NSTA 4A7YA 3I2GA 1R1A2 4CYDA 2D6NA 1RUC1 1VBB3 3WSOA 1HIXA 3OY8B 3WNPA 1VRH1 2EIBA 1DQ0A 2XBO1 2XVGA 4JHTA 3WDTA 1D7PM 2WNVB 4FPOB 4F3JA 2CNAA 2QZ3A 5A7NA 3OEBA 1JHNA 4XUTA 4DNYA 3KLSA 2UURA 3M3CA 4Y4RA 1UOBA 2BBAA 3GHNA 3AP5A 3I2FA 3SITA 4DS0A 4QQHA 3RYKA 3TN92 1O59A 2UWCA 1ND3C 2JE7A 5F7UA 1R092 4RHV2 3VKFC 2GNDA 5JXJA 1EPZA 4N43B 1J59A 3KD4A 4RR3A 4GZ9A 1PO11 3UT0A 3E5XA 3OGSA 1FPN2 1ENRA 4I0AA 4WM8B 4CUBA 2YGMA 1SPPA 1UYZA 3AKPA 4K8RB 5A3MA 3R4UA 3EQEA 1GSLA 3N7LA 4P9YA 4QAWA 4RS5C 4MXWB 1AYM1 4IW3A 3ZO0B 2GC0A 2VMHA 5LA1A 1IPKA 1JTZX 3M4FA 3AFGA 3WOGA 2RE9A 2VBBA 2V5YA 4ZHNA 2JENA 4QGLA 3K4DA 4LO8A 3VBRA 4OHXA 4RQPC 1RUC3 4CRQA 3FX3A 3ZFFA 4ZU7A 5CB7A 1VRH3 5I93A 4MGYE 2XBO3 1SLTA 1M4WA 5JMCA 2X10A 2AGSA 2Q8DA 3WNMA 3IWZA 1YNAA 1A6CA 2A6WA 4Z92B 4NE9A 3GYDA 3AYCA 3KHBA 3K4ZA 1L7LA 2Q8OA 3WF1A 2E26A 3MDPA 3RNSA 4Z2AA 3UESA 2A71A 3MZHA 1AX0A 1REEA 1RUF1 1SZBA 1BEV2 1JODA 3MPBA 3JZVA 3IZOA 1QNYA 1S0EA 2BU9A 3B94A 3BGAA 4HSJA 5LA9A 4CDXB 1ZBA2 2A70A 3CZJA 2N7GA 3BIWE 1PO13 1OD3A 2B7YA 5FOJB 1BJQA 1VLNA 4NVPA 5FZ9A 5L19A 1WLTA 4FQ4A 2GH2A 5F32A 1LHUA 2IVJA 1AYM3 5IAXA 3Q8FA 5T55A 1IPJA 3VZJA 4COUA 5T5OA 5K7PA 1CX1A 4AXOA 3WP4A 4C1WA 1V6OA 5BNOB 3UYJA 3WF2A 5IK4A 4CDUC 2YXSA 5H9PA 1SFPA 1WCSA 1RUJ1 3L2YA 4Q2FA 2DUQA 2JG9C 1UZVA 4LLFA 5L7OB 2JDHA 1UMIA 2ZGTA 1EAH2 2CL2A 1LOFC 2WINB 4JDNA 5IT6A 2KM2A 4ZS3A 4LA3A 2EICA 2PHXA 1MZFA 5DAQA 1X9TA 3NAPA 1C3HA 1WMFA 4XF3A 2IXLA 5A7WB 4EWDA 4YSFA 5J37A 2A75A 1OVSA 2XWJB 4KMQA 4QHBA 3KWVA 1RUF3 4IGOA 2BBVA 1VMHA 3M1HA 5FP3A 2VAUA 4LBJA 4AL9A 4CP9B 1W2AX 4NHLA 2EIGA 4YW3A 4BLIA 4M00A 3UV9A 3JCIA 4FAGA 2BZDA 4LBLA 2C1FA 4Y4YA 3ZMNA 4IEWA 3DN7A 1PO21 2Y60A 5DAWA 1UOJA 5E16A 5FZDA 5FKBA 1I1EA 2SBAA 2WN3A 3VDCA 1WMDA 1ZRRA 3WP3A 2C9KA 3V0AB 2I74A 4FTBA 1W90A 2VZSA 3QCWA 2ZGOA 2VC9A 3C2UA 1ND2C 1OSGA 1CD3G 3NV1A 3SH5A 2JECA 1RUG1 4CTEA 1IS3A 2A73B 1RUJ3 3N7MA 3POSA 3PUQA 2MEV2 5CYYA 1TEIA 1CAUA 3VD5A 2QVSB 2ET7A 4Q8LA 4ZS2A 1UYYA 3AYEA 4YFZA 1WW5A 2TUNA 5LRSA 3RZMA 3N9NA 1FV2A 5D8AA 4QM9A 2XLFA 4FPCA 4QDSA 5LA0A 5CBLA 1MQTB 3POWA 1W8HA 3ZFFC 4BQ5A 3ECQA 3SXWA 3KHCA 2W46A 1XC6A 3DXUA 1AL0G 4NHKA 4WVMB 2ARCA 3AZZA 3O1SA 1VRBA 4GWNA 1KJLA 5L9RA 4JKLA 2QJVA 2EALA 4JKKA 3QBQA 4KWJA 4P9WA 1DLLA 1GZ9A 1PO23 5BV6A 4FFHA 4ZZ5A 1TNFA 4KGGA 4QXCA 1YC61 3OPTA 2XJSA 1AR62 2HBUA 3ZN6A 1R091 2OUJA 3AKQA 4RHV1 3PU3A 4M4RA 5K0UA 5CFDA 2CTVA 1RUG3 2E53A 2XXZA 2X53S 2B4KA 1FNYA 3DYMA 1W2OA 3VBOA 3WXPA 5DMYA 3M3QA 1VAVA 2B9UA 2QQPA 4LUMA 4JRLA 2YC4A 4Z07A 4MGIE 5JUVA 2HWF2 3HEIA 4UFKA 3LFIA 4W8JA 4LBQB 3SKJE 1Y9MA 2RDRA 3NNGA 3FE5A 2ARAA 3GZAA 4XFAA 4FPKA 5IAVA 3M3EA 1IS4A 1ZBE1 1LRHA 2JDPA 2JE9A 2QKDA 2Y0OA 3RI8A 3WDYA 3ZSEA 4HVQA 3UNPA 3NAPC 4I3PA 1LU1A 3WG3A 1NT0A 2R0HA 3K4AA 4LOTA 4BM8A 3BN6A 3H50A 3B02A 5FY7A 1UO9A 2WN2A 3KS7A 5BXXA 2QDRA 1B09A 5DZFA 1EPWA 2JEMA 3TEXA 2XDVA 2JDMA 4TYSA 2CWSA 1BEV1 1WLWA 2VZVA 2WQ8A 4XXAA 4UFHA 1R093 1W0NA 1CZVA 4KL1A 4RHV3 2IFWA 4K7JA 5C7GA 4R4ZA 1UYPA 4JAAA 4AHWA 5FWJA 2VUCA 3DF0A 5A33B 3ALQA 4JGYC 4LQRA 3PVBB 1RITA 2VNRA 1ZZBA 3AC0A 5JIUA 1LB2A 3IAPA 4L92A 2D5HA 1O8SA 4TLFA 4UBHA 4PQ9A 4XOGA 4YG6A 4F83A 4GA9A 4XHBA 4BK5A 1W06A 5FYVA 2DDUA 2QQLA 4W4ZA 3KMHA 4J1XA 1UU6A 1XYOA 4PT6A 5F3IA 1H1MA 3IAQA 3BKZA 2BOIA 3VD4A 3LA3A 4AI1A 1AX1A 2PTMA 1ZBE3 4I0WB 1CJDA 4LIUA 3FN9A 4Y3OA 4FCAA 4W50A 3WNNA 1N1VA 1NXMA 5FPLA 3KV4A 3VZMA 3M3IA 1HXS1 2ENRA 4ITCA 3HPNA 2ZAHA 2VBPA 5I0UA 1FNZA 1NX9A 3AB0A 4Y20A 1US2A 3OGRA 1BEV3 1NZCA 2WC2A 4LBOA 4NN0A 2Q1FA 2XONA 5F1RA 4Q4Y1 1V9U3 1OC1A 3MLKA 2ZGUA 2Y6LA 3I59A 1MEC2 2VH9A 4YZ1A 2J7MA 2EVXA 2UY8A 1SCSA 1SLIA 1N3OA 4QXHA 4UBGA 1QOOA 3JB8A 3ETPA 5J36A 1LKNA 2OW4A 1BVP1 1W2NA 2HYXA 4HBNA 4KU7A 4UF0A 5JDBA 4FSJA 4KGQA 1JOJA 4PIXA 3FL7A 4K3UA 3AZXA 5GKAC 4NIIA 4KQ7A 3RS6A 4ZXKA 4BQYA 4A41A 4HG6B 1NCRB 5CISA 1JH5A 2JIJA 4MV2A 3K48A 1W6MB 1ZZ7A 2JKXA 5FYIA 2ARBA 4X8NA 2ZPXA 5JAXA 3POJA 2MEV1 3ZFEC 1VP6A 1BLZA 3LDRA 2X5IA 1FOD1 2AUYA 5FUPA 3GCWA 1K5MA 1LHVA 3LIHA 2XB6C 4YVSC 2ZHMA 3VV1A 1HXS3 1U5ZA 1YQCA 1I5PA 1FV3A 3I97A 5F37A 4OHWA 3UL2A 1REDA 2ZGSA 5CVRA 3T2TA 2D98A 3VBUA 2VNVA 2WA4A 4AGRA 4FO9A 5FP8A 3CJXA 4HOOA 2ZGQA 4OI4A 2WDBA 3N9OA 1C57A 1J1TA 4Q4Y3 1V6JA 4P02B 1VIWB 3OBTA 4R8HA 2HWE1 1QEXA 1VJ2A 4RQPB 1W6QB 2A1XA 1CESA 4TN7A 5IVYA 2VCAA 5F5CA 5T3NA 3R0RA 5FFOC 3HT1A 4MXVA 3UJQA 3WHUA 5IYYA 1OQDA 4PDWA 5EP9A 4BISA 4CCNA 1QJY2 3GF6A 4FOVA 4H2AA 4D6QA 5IVVA 3OBAA 4JRAA 4DO0A 1D4VB 2B46X 3A22A 1UYXA 3HT2A 5LY2A 3C3VA 2MEV3 4RGAA 3POFA 2VOWA 4CPBA 1W6PB 2VZUA 3D0SA 4EZHA 1FOD3 4DUXA 1A78A 4HANA 2VM9A 1XNAA 4PCRA 4HZFA 3RPQA 2VOTA 4URAA 4YZ5A 1FMD2 2HKXA 2QFEA 2HWF1 4E27A 5L9BA 5A6ZA 3NNFA 2V4AA 4EV0A 4MO3M 3N3HA 3LEMA 1VBE1 3ACGA 4YM1A 2XUEA 5FBZA 3ZXDA 2GC1A 1JYXA 4CEWB 5FZHA 3OD0A 4XETA 1N1SA 1NYWA 5AVPA 1R082 1GZWB 3FHIB 2HWE3 3H7YA 1GP4A 2J1SA 4NPMA 4A44A 5A1LA 3SH4A 2ZGPA 4QPGA 3VL8A 2H0VA 3JQWA 2IXHA 1DFQA 1OKQA 3GBWA 1J3QA 4JQTA 4QPIA 3ZYIB 4CCOA 1GR3A 1ONAA 4FP3A 4M4PA 4FBFA 3HNBM 5A3WA 2CY6A 1CVNA 1H6XA 4QXKA 2IZWA 3B00A 4IEZA 4NUBA 2YZ4A 4AVSA 5FQ0B 5F3EA 2WFF2 4XYXA 2BVVA 4PJYA 4BQ2A 1QIQA 4J6GA 4DY5A 4PHZA 4COZA 2PHRA 3TNPB 2RV9A 1T2XA 5CA6A 1QNWA 2PQQA 4YWAA 5FZ1A 1KXGA 2HWF3 4NHYA 1Q8VA 3U07A 1G9DA 1DGLA 3RSJA 3N9PA 2C6SA 4CPBD 1I9RA 1H4HA 1VBE3 5ANNA 2OZJA 5E88A 3HNYM 3IB3A 3UKNA 1K5MC 2PN5A 3AJYA 4XCAA 3VKOA 5CKQA 3TEWA 3IT8A 4AEDB 2DUPA 3H0OA 1XRUA 3EBRA 3NV3A 5A7WA 1ND2B 3OUJA 3IKWA 4BQXA 3W5NA 3SCHA 4FQZA 2Y64A 4OI0A 2ZCWA 1H8TA 1NQJA 2ZJCA 1QOTA 4AVVA 2G9GA 2OA2A 1GWLA 4IERA 2VMFA 1NCQB 3ON7A 5EYYA 1S0BA 3HMYA 5C8CC 1CIWA 4XQ4A 2BFUS 4FPJA 1UZYA 4AGVA 1E5SA 4MUVA 4R9DA 4XDQA 2VTXJ 1AL22 3TBDA 1SLBA 5L36A 4O61A 4IEVA 4QQOA 1ZZ8A 4UYBA 5EXOA 2J1RA 2VR4A 4CSWA 5JI9A 4G3YC 5F3GA 2VUAA 1N3QA 4AAPA 5EYXA 3ENRA 3OOXA 5FYMA 1CWPA 4LO4B 4RD7A 3NJZA 1ULEA 1NAEA 1OLQA 1RUH2 4JCKA 1MQTA 5H9QA 1A34A 2CGOA 1VBB2 3WV6A 2BV4A 1ST8A 1UXXX 4CU9A 4OLLA 1WA4A 2VBDA 5F5AA 1UX7A 2CWMA 4OFGA 5FZ8A 4LOSA 3WHTA 5J98B 2JB8A 1JS9A 1QJU2 3N7JA 5IVEA 4WVMA 1POV1 3CL1A 1DZTA 1ULDA 3BVCA 4Y1ZA 1ULFA 3WQ0A 3C7EA 4M01A 5LEKA 2PHDA 4QPGC 2JXAA 3MICA 4QPIC 1YRZA 3AP6A 1NUKA 4O9GA 1NLSA 1GYKA 3HNMA 4CDQB 1X36A 4QB2A 4D8MA 3S7IA 1UY4A 1PVXA 1YJLA 1NLQA 1SLCA 4S2DA 1NG0A 2AH2A 3E5UA 4UI9L 4H14A 4WVZA 5IFPA 4LHKA 4JX0A 3BIEA 4Y1YA 4KH9A 1S55A 4CU6A 1S0CA 4W65A 5DAVA 4TSVA 2XOMA 4AWDA 5KR7A 5FZKA 4LUKA 4XPVA 2DU0A 1NE4A 2PQSA 3VKMA 2BGPA 3WNLA 5FPZA 5KXDA 1HB1A 4AF9A 5LY1A 1D4M1 3J8F1 3HIFA 1O8PA 1VRH2 3NKTA 3RYRA 1HN1A 2BWCA 2GC2A 4JC1A 3TRSB 2W1UA 2ZOEB 1POV3 2WNUA 3GJBA 3I7DA 4C1XA 2AR6A 4UW3A 4LBKA 4FAHA 2WZEA 1RJ7A 2A7AA 3X29B 3AMHA 2VE1A 4RSUA 3BTXA 1H8TC 3BTAA 5FO8B 5T54A 4NIHA 1E5HA 3ES4A 3ZN4A 4M3CA 1MR5A 1Y9GA 1VAKA 1DQ4A 2VVEA 4NWWA 1R64A 1TE1B 5FY5A 4UFLA 3RFRA 4JGZC 1HV1A 1BYHA 1VPHA 1UKRA 2WQZC 4H3WA 5FY8A 2E9QA 5DZEA 2KA3A 1HRV1 1OVPA 3GZTB 2AYHA 1AYM2 2GAUA 1VMJA 5AVAA 2C24A 4L11A 1A8MA 4GH4A 5FAXA 4XBQA 5A7QA 4X6RB 3AP7A 3WEZA 1ZREA 2WFF1 2ZTNA 5KHKA 3S57A 1O91A 1D4M3 1D0HA 3B7MA 3J8F3 5FUIA 5SV5A 2VZ3A 4IV1C 1CAWA 1OUSA 3BI3A 3BALA 1S0GA 2YC2A 1MZ6A 5FP7A 3OEAA 5ANQA 1OLRA 4COVA 3BYWA 3CO2A 4OI1A 1W6OB 2BGCA 1F15A 3MV11 4E2GA 2IXJA 5JMOA 2WWJA 3IMNA 4K1YA 4EJRA 3ILRA 1RUF2 1BK0A 5FZOA 3ZSJA 2QCSB 2P4EA 1YFYA 3P5BA 4UFMA 1RB8G 3JD72 3O0WA 2YBSA 5LBCA 1ZZ6A 5JSPA 1F2NA 4Z1VA 2I07B 2H0BA 2D6PA 3ZFEB 4B7EA 2ZX1A 4CVUA 1W2UA 2VTXA 1DZQA 2YFZA 3NV4A 1HRV3 3GZEA 1JZ8A 2E7QA 3WLUA 2FQPA 4V2WA 3LDKA 3NNJA 5A3NA 5HI0A 4YW7A 3AL5A 3MW3A 3WG2A 4CEYB 1YUDA 5A6QA 1OQEA 1S0JA 3DKWA 2WFF3 3EXUA 4LKSA 2QQOA 3PVOA 5D1IA 1VBA2 4FXGB 5FYCA 5KHGA 4NRPA 1CR7A 1V0AA 1UY3A 3AP4A 2OZ6A 1OH4A 4XBLA 5A7OA 5JOXA 5FMBA 1L3JA 4YVWA 5DG2A 3Q8EA 1GNYA 1ULGA 3KCCA 3MGUA 2Q5TA 2J1TA 1AXYA 2R49A 4UFIA 3FLTA 3NQHA 3PUIA 3HWJA 2VZRA 4NO4A 1RUH1 3VZOA 1GLHA 3FHAA 1DQ6A 1W9FA 4CDWA 3LDBA 2HJIA 4LO7A 5J96B 2WNUC 1F5JA 5FK7A 2RJLA 2QE3A 4PLMA 1Q8OA 1RGSA 1DCSA 2XUMA 1QJU1 4XDPA 3WDUA 1LGNA 1LU2A 1OUXA 5C71A 2VMCA 4BK4A 1QWRA 2DBNA 3E5QA 4BXFA 5JPMB 5CEHA 2P17A 4Y26A 5A32B 5FZEA 1B35C 4QU2A 2BWAA 2C4XA 4PIYA 4P00B 3FLRA 1C4RA 2R16A 1GICA 3NL1A 1LHNA 4BWOA 1SACA 4E4HA 3HVDA 3UK9A 3ZSKA 3ZFGA 1Y4WA 2Y6KA 3GGLA 2WJSA 1POQA 1QU0A 4FPYA 1WBLA 1FT9A 3WP6A 3IIIA 1W28A 3O1VA 5FTTC 4GH4C 1XSRA 1OD5A 4H7LA 3VHPA 4CCKA 3GJAA 3O14A 2JJ6A 1HQLA 4AHYA 1GQGA 2WLPA 2ZGNA 3PU8A 1S2BA 1J83A 1MS4A 4AFMA 4LO5B 1S0DA 2XHKA 3BPSA 3SHRA 3S5QA 2VZOA 3OTFA 3VBSA 1RXFA 1OOPA 4QX1A 1RUH3 2RDSA 3WNXA 2FCUA 2VQUA 3H8UA 4IEOA 1XXNA 4LHSA 5ABJC 3J7LA 2VVFA 1SLLA 3LF7A 4HFSA 1AR72 5FP4A 2GMPA 5FMOS 1DGRA 4YZ2A 3WX5A 1BK1A 1IQDC 5J09A 4I09A 5I0RA 2ZX0A 4AFBA 1PK6B 2RJ2A 4CEWA 5IK5A 5J1XA 1QJU3 3ZR5A 4A7KA 2NQYA 2Y6FA 1O7FA 2BNMA 2PELA 2VQAA 2HWB1 1GZCA 4NJ4A 1DQ1A 4D94A 2ZX4A 5JZGA 2R30A 3GNEA 4Z8BA 1HLCA 1W03A 1O4ZA 1OPOA 3ITQA 2DF7A 4N7IA 1CZSA 4DQAA 1J3PA 5C3PA 3OJBA 4AVAA 4WM7A 4XW3A 5A3TA 4Q0SA 3OGGA 1OKOA 4DUVA 2IXCA 4RGKA 4C0HA 5A70A 5IK8A 2ORZA 3DXTA 3KQRA 1NZIA 4BZ4A 2IUWA 4Q4V2 2EIDA 2G4IA 4MADA 1PZ7A 3U1XA 4AEMA 1H0BA 3RRDA 5C8CB 2L9LA 3VBFA 1HRI1 4XFCA 2XG3A 1EY2A 1ZBE2 4AYUA 2VGDA 3NKGA 4EZ4A 5BNPC 1YHFA 1X7NA 2P2KA 2W0XA 5GALA 2I45A 4F7ZA 5FPVA 2GNTA 2Q1ZB 3SC7X 3LFMA 1S0FA 1C8M1 2Q8EA 2DCTA 2GMMA 2D6KA 3TB0A 3O1TA 4N90A 1KRIA 4CDWC 2DCYA 3JB4C 3LAGA 5IVBA 4GMP0 2HWB3 5A3OA 1J58A 3DYPA 5CG8A 2RDNA 4K21A 4IEYA 1ZRFA 1UAIA 1W0OA 4UT5A 2QQMA 3BPZA 5GZCA 1XE0A 4PI0A 1H2NA 1V9U2 3JD71 1BQPA 3N9QA 1JHJA 4OUMA 5C8WA 1N1YA 4N53A 4XF9A 3ZXKA 2F17A 1OHFA 5I8YA 4YYOA 4I2OA 2VNGA 3ZN5A 2C0ZA 2OS2A 2R1BA 4FOYA 2A5ZA 3W5MA 3VB9A 4NRMA 1WUVA 5C9AB 3ZFGC 3OYWB 2Y26A 1H9PA 2JDKA 3DPRA 5I0DA 2EA7A 5FPUA 1HRI3 1ULOA 1M06G 2WZPP 2BOJA 5T52A 2PHTA 1VBA1 2XJRA 3LPFA 4EQVA 1H30A 2B45X 5CU1A 4AVTA 4QMAA 5JOZA 2P3KA 2VMGA 3IIAA 4IV3A 3VBSC 1VB4A 1C8M3 5LATA 5FYUA 1ZA7A 4O7XA 1HXS2 1VR3A 3APBA 5LW9A 2LW8A 1OFSA 1W6NA 3R6SA 3S7EA 3SLIA 3H3LA 3IPVB 1HJGA 3ME2A 3CJIB 3IDEA 3OPZA 1V70A 2D6OX 4IE0A 4LA2A 1CAVB 2AEZA 1UXZA 3H1YA 2D7FA 4Q4Y2 3GXUA 3JD73 3WW2A 4FVVA 3SQOA 2GP3A 3IM0A 3F95A 4Q27A 5FV3A 5FZMA 2V5DA 5FZ4A 3FLPA 1HB2A 2J1UA 3DYOA 4QX5A 1PGL1 3FUOA 3O1UA 2O8QA 4MH0E 1YJKA 1QJX1 2UY9A 2WFPA 4RFT0 5A1FA 4RR3C 2JG8B 1BBT2 1YXWA 3O1OA 5F2SA 3I49A 1F35A 1Q3EA 2PLV1 4HN1A 1E5IA 4LXLA 1V6LA 3I2OA 4IXLA 3OPWA 1VBA3 1Z7S2 4QX7A 4NPLA 2HWD1 1AXKA 4XC9A 2VUJA 5J48A 1FOD2 4Q5OA 3C7OA 4IE7A 1ALYA 3WQBA 1MS8A 1VBD1 3KF3A 4DZGA 2KR2A 2VTFA 4JGZB 5CZKA 3ZXEA 3MW4A 3VBRC 1DGWA 4KBBA 4NOTA 2DBIA 1DLCA 2ZEYA 5FZIA 2AENA 1Q43A 1BCXA 5A7PA 3TOJA 5HCFA 1D2SA 2PHUA 3VDDA 4INDA 3PJQA 3WCRA 5J3UA 2DCKA 2X29A 5FRAA 1AR71 3NJXA 1HQWA 5A3PA 2AC1A 2GNBA 2HWE2 4TWTA 1BXHA 1V00A 4XILA 3H8RA 3JUUA 2AZ5A 3HJRA 4ZY9A 1C8NA 1W9WA 2ZX2A 4IV1B 5A7SA 3WUDA 5FYSA 1XJAA 3H8OA 4G4FA 3LEGA 3JBG2 4RL7A 1QJX3 2WAAA 3NMBA 3ZIWA 1KS4A 1V6MA 2EXIA 3ACLA 2W2IA 4FPLA 5C4WA 2O8OA 4N53C 4META 4N9IA 2PLV3 2NYYA 1ODMA 4R9CA 1GQPA 5E1RA 3KVAA 3CIHA 3T4HB 3T1MA 2KD7A 5FZFA 1F4HA 4XJUA 3IMMA 4QPYA 5FLHA 2ZHKA 3W58A 2Z5WA 2HWD3 3AJZA 2CYFA 3WW1A 2CAUA 3KT7A 3OUIA 2DV9A 3DPRC 1VBD3 2YG0A 5FZ6A 2Z69A 1O3SA 4BDVB 4BJ0A 4AAXA 2W08A 1H8VA 3AYDA 1XYPA 3OGJA 4Q4V1 1CX4A 1VBE2 2WRAA 2BDRA 3ACIA 4IV3C 2WNOA 2Y6HA 2RS11 4HPKB 4OMCA 4W6YA 2CGNA 2JDAA 5EJZB 2VQTA 4URTA 4AI8A 2WO3A 1AR73 3P3NA 1TVGA 1RUI1 1APNA 1ACCA 4DMIA 4B8EA 4OUSA 4GQ7A 1D0GA 1SG3A 3D0JA 4CUGA 5BNNB 3B9IA 3KSCA 3FZ3A 3V64A 5DG1A 4GWIA 4E9KA 1ZZ9A 1HW5A 3ZSLA 4L8QA 1XNDA 4LR4A 4Q0PA 2FZ2A 5BY5A 3ZPYA 4XCBA 1PVC2 1V9U1 1NXD1 4JZRA 3S5AA 4B7KA 1VAMA 4NMIA 5IHRA 3KQ4B 4QB1A 1TMF1 4MVTA 3MBWA 3WNOA 1Z0HA 4Q26A 2V73A 4ASMB 5FYTA 3V0BB 1DYKA 5SV8A 2DWRA 4WV8A 2A6ZA 4Q4V3 3PJYA 1ZZCA 1X33A 2WBKA 3SKVA 3C7HA 3BU7A 2LALA 4DFSA 1B35B 2RS13 2RMU1 5D8AC 5FZBA 3ABZA 1NA1B 2QZ2A 1SLAA 3GHMA 4QWNA 4QXBA 5I0TA 3UGHA 4Y22A 1RUI3 1UOFA 2LRPA 3NNMA 3CKHA 4HVRA 3GCXA 1JOPA 2OT7A 4ZU4A 2WUHA 3USUA 4ISRA 1UNBA 4GWJA 2ZAAA 3TAYA 5JLVA 1SFNA 1LEDA 2OQ7A 1FXZA 3POIA 4XQWA 2LROA 4WZCA 3ZDSA 3VN4A 1ZRDA 3WW3A 4GKYA 3T2QA 2J1VA 2VZQA 5F9TA 2PA7A 1KD7A 2A6VA 1W99A 1C1LA 3VBHB 5AFEA 4RFRB 4LKEA 5AFBA 2Y0IA 1X82A 2FDJA 1FATA 4CCLA 5A32A 2G1MA 5ABJB 4FTEA 3MUY1 5JWPA 5C4WC 1TMF3 1AUYA 3D4KA 3T2OA 1UOGA 2BP6A 2BEOA 3AMPA 2DTWA 5JSOA 2IXKA 4QU1A 3THCA 3W59A 5IK7A 1XSQA 5K0UC 2HEWF 5CFDC 4KWUA 2JWPA 3J26N 1BBT1 1QJEA 3ZLIA 3VBOC 5CFCA 4BQWA 3TWIA 4COYA 5IATA 3USSA 5FYBA 4YW6A 5FJKA 4D7TA 1IZ3A 5C3OA 1E57A 2RMU3 2XWBB 3SH3A 3VGIA 3ZDVA 1Z7S1 1ND3B 3KM5A 4GB31 2PFWA 2PHFA 2ETEA 4FFIA 1MS9A 5LB6A 1MZ5A 3K46A 3P1IA 4L9BA 2NPIA 1RL3A 2HWC1 4QGMA 2RM21 5KC5A 4LT5A 3OY8A 3L2HA 1YI9A 3WG4A 3BB6A 2CV6A 3WT3A 2WNVA 3R05A 4QQPA 2JIGA 4LE3A 3WW4A 1HDKA 2WZ8A 4RS5B 4E2QA 4EWAA 3LOIA 3BOWA 1GMMA 3AKTA 3K2OA 2ATFA 3LE0A 4BPZA 5FZCA 4R9BA 3T09A 4AQSA 3AFKA 2VG9A 3Q8CA 4UAPA 5L73A 2DVBA 5FBJA 3D3AA 4XJWA 2IC1A 3H7JA 3NVCA 5BNPB 2ZBJA 4N43A 1CGPA 3JBG1 3M2MA 2YROA 1BBT3 3O12A 4WM8A 3O1RA 2VMIA 4JTNA 3RQ0A 1ZVFA 3RWKX 1I5ZA 1QGLA 4MXWA 1AZDA 4KNCA 3RZHA 2JKBA 5D21A 1JZ2A 1Z7S3 1D4M2 1W8OA 2XJUA 3J8F2 4GB33 4Z82A 3RYPA 4CCMA 3Q8AA 5C6CA 5HV0A 2SLIA 4CXWA 2ORXA 2TBVA 3SEEA 2W52A 4AFAA 2HWC3 2PAEA 2RM23 1UY0A 3CHXA 1V6IA 5HXVA 4XURA 3T30A 3EYPA 5EZWA 4UW6A 3RMYA 3ZYBA 1ASJ1 1GP6A 1PNGA 1WW6A 1V6NA 3IN9A 2CDPA 5F39A 3KCYA 3RZZA 4W6XA 1UMHA 1JUIA 2A3WA 4P08A 2VNOA 2RG4A 4LTAA 5A3LA 4LBMA 4CDUB 4Z2WA 1W9YA 2WNEA 5C3QA 1OLME 4TTGA 2GP5A 1IOAA 2JG9B 2YBKA 1RYYA 4OHZA 2TEPA 1EV11 4CDXA 1LODA 1HRV2 2R7EB 2ZX3A 3IDBB 4DEVA 3AKSA 2Y33A 3JBG3 1O3RA 3K51A 5KWRA 1QOSA 1AR81 1ZRIA 1HN0A 3V56A 1K12A 1W8TA 1W8WA 1WCDJ 4PF5A 5GLTA 3VHOA 4IETA 3VD3A 5A6XA 3ST7A 1JU3A 2QQNA 2ZXQA 1G86A 1PVC1 2FCTA 2FBEA 2HBTA 3AP9A 3KCXA 3KGZA 1H1AA 3QOPA 4HKOA 2BJSA 4YZ3A 2ZHNA 4GALA 3RGBA 4J25A 1YWKA 3MF9A 3OYWA 3LEIA 4XJ9A 1JMUB 2VCBA 1IG0A 5IFTA 5BNOA 1G9CA 2W95A 2HH9A 3HQXA 4BH9A 5CKNA 2XR4A 2EIEA 4Y5SA 2CDOA 3H8XA 4UW4A 1FYUA 1K3IA 2D6MA 3ELNA 2WSVA 1REFA 1G6NA 1TNRA 2XLAA 5H9RA 5L7OA 2X5IC 4Q0UA 1OLMA 1C1FA 1YI7A 1ASJ3 2ET1A 3CEWA 5T5PA 5A3UA 4JV4A 4RR3B 1G9AA 3LSEA 1A3KA 3H3UA 4OHYA 2WZR1 1SPPB 3PDQA 4XZPA 2DCZA 4LO6B 2WNVC 1IGOA 4Y1VA 3C7FA 3VBUC 5F6LB 1WMXA 1QJFA 1KJRA 2PAKA 1DIWA 4GXLA 2XJVA 3RZJA 3THPA 1EV13 4CP9A 1YQ8A 1JYTA 1OH3A 1XBFA 3H1WA 1W39A 4IE5A 1AR83 3VBRB 1ULPA 3NNLA 2IWGB 4IUGA 5EJ3A 1K5JA 2HLEA 5GM0A 2X8KA 5KC6A 3ZFFB 1PVC3 5LCWL 2W9XA 2ZKNA 3AKRA 5FO7B 4CA9A 4KG8A 4C90A 1SBDA 3HN1A 3V0AA 3NV2A 3WDVA 4PDWC 3G7DA 5FIXA 4CUAA 2EAKA 4O9EA 4WM8C 5KXCA 4A2UA 1DU3D 3J7NA 4H7MA 2WA3A 2W1WA 1OA4A 4GWMA 1C28A 1XPWA 4FPEA 1UU4A 1TQ5A 4E4ZA 1K42A 2QTWB 2OPWA 3N9MA 1EUTA 5LEJA 4P9LA 1SEFA 4LNVA 1IQAA 5F6KA 1IKPA 4K1ZA 2WZR3 3WP5A 3CDZB 3THTA 1X50A 3T4VA 4NR1A 2K9ZA 1QDCA 2V72A 3VKLA 1XE8A 5ACA3 2VMEA 2G9FA 3KGLA 3WY6A 1KS5A 5FP9A 1F4AA 3RI9A 2E32A 4E8CA 3LWCA 4EN8B 3HOBA 4DUWA 4CDXC 1PMHX 3H3ZA 3AL6A 2FDKA 1BKZA 1CPNA 3ZYPA 4XF1A 4RA0A 2XQRA 5DPNA 3AZYA 4OYUA 4BU2A 3WF3A 2WL1A 3A0NA 2WT0A 2WT2A 3CNAA 3NAPB 4YG3A 5KXEA 5FZ3A 5CIRA 2VOXA 1NOVA 3ORJA 2ZMKA 4OQ8A 2R061 1CONA 1VALA 3PTRB 4ZU5A 3FFQA 2BVBA 5I91A 1H6YA 2EXKA 2YDEA 4QKDA 2ZA9A 4YW5A 4DRRA 3JXSA 4F8AA 3ZMOA 2VZTA 4GAZA 2GDFA 4LBQA 1JYWA 4BXSV 5L7OC 1U5XA 1P8JA 3DCQA 1DHKB 2GN7A 3T2PA 5JOWA 1RXGA 2VCMA 1JUHA 4DXSA 4D3WA 4JGYB 4KWLA 3W21A 4JVAA 4E8DA 2BQPA 2MHFA 2OXBA 2EXJA 1QQP1 5DXDA 2OKXA 3BTZA 2VZ1A 1WLCA 3MIDA 1JYIA 2D43A 2HWB2 2LUWA 1YFWA 2GU9A 2DUOA 4PF1A 4HETA 5CKMA 5GLUA 3IDCB 5GLZA 2YV8A 1Q8QA 1TME1 4V1PA 3AXEA 4A3XA 4DOUA 4BLJA 4XF4A 1YQ2A 3ASIA 1Y7BA 5D8AB 1F9KA 2RS32 4S2FA 3J9SA 1PX4A 3AMNA 3QH7A 4AOCA 2CU5A 2VL4A 3TNQA 3VHNA 1PM7A 3KF5A 3DV8A 2R063 5A33A 4K9SA 3PTYA 1JZ5A 1K45A 5L9VA 2XJPA 3CBNA 4YPJA 1CZTA 4RYDA 4Q4W2 1J84A 3GBFA 5JSRA 1ZRCA 4YGBA 1HRI2 2WLQA 4XHXA 4IE6A 3ILFA 3FHQA 4I30A 5JR7B 1KGYA 2UYAA 3RDIA 4A6SA 2JDNA 4QT6A 4DXRA 5I8TA 4ISQA 3AXDA 4P9XA 3OBZA 2K2SA 4IESA 3U0ZA 4FXKB 5FY4A 5C70A 1NA1A 2FD8A 1C8M2 2VUDA 1MQTC 2PHLA 3DEMA 3EO6A 1AX2A 1UZ0A 3A23A 1QQP3 1CIYA 2R6QA 3E6DA 1XU1A 4B1LA 5K0UB 4IEXA 5ISLA 4I01A 3N4MA 2YBPA 2XVLA 4Q29A 2ZKLA 3VBOB 3R4SA 4HONA 1CPMA 1QXPA 1TME3 1UPIA 1W8FA 3PUAA 4IGQA 2J22A 5KHJA 2WABA 5GZGA 2D6LX 2VOVA 4ZXEA 2JDUA 1ENXA 3N9LA 4ES9A 1U5YA 3MO4A 4YVSB 4AI2A 2IXIA 3TEZA 1LEMA 3ZOIA 4BMBA 2E7TA 2MNGA 3DUIA 4ARXA 3I3BA 4HLTA 3ZIXA 4UOJA 4E2SA 4CU8A 1GV9A 4IL7A 4YM0A 1LNSA 1BZWA 4WVWA 5CNAA 5E89A 3HN3A 4AI9A 3W20A 3VD9A 1VMFA 4UW5A 1NCRA 3HAGA 1W6MA 3I2KA 3WF4A 4ATEA 1N3PA 4P14A 4Q0VA 1UU5A 2VPVA 5APAA 3NW4A 2CHHA 3M7AA 4CCCA 3LB9A 4DEQA 1XB9A 5FXZA 4OI2A 2FMDA 1RUNA 1SCRA 2XGXA 5DUXA 3J7MA 2DVGA 4LULA 2WSUA 1WCQA 5J7MA 5AC92 2ZMLA 1ENSA 3ZPOA 4EROA 2UWBA 1NY71 1KDMA 5DAXA 3LQCA 2TNFA 4CP0A 4HXCA 1PGL2 2FZ1A 4XFGA 4RQPA 4JDMA 1W6QA 1IHMA 1QJX2 5BNQA 4EE2A 3NJYA 2BW8A 5FPBA 5BPXA 5C5UA 4OCTA 2ZABA 2PLV2 2ERFA 3B69A 1OURA 4L0PA 1W0PA 2I2SA 4MZUA 1PZ8A 5BUVA 1T6GC 2HWD2 1XNBA 4XQDA 5LASA 5F2WA 1PGW2 2W91A 1JZ4A 5GZEA 2C9AA 1VBD2 4D7YA 3K77A 3MIBA 1S2EA 1W6PA 5JXHA 3WR0A 2Z42A 4K8FA 4LBNA 3NRUA 5HCAA 5K4LA 3FUQA 2Y8KA 1STMA 3I59B 2AACA 1LOAA 4I02A 1UD1A 4NROA 4AVBA 1ZM1A 1NE6A 4BQ1A 5FDBA 2EAAA 2GZWA 3MLLA 4OVEA 4XFHA 4UF0B 4EN7B 1QY4A 4CCEA 1OI6A 2FDFA 2WIIB 5HBAA 1EP0A 4QX8A 4MHUA 3RJRA 3AK0A 4U2AA 2W1QA 2YPJA 1LJ7A 3MIHA 1GZWA 3CQOA 4YG0A 3FBYA
chains in the Genus database with same CATH topology
2JDPA 2JDUA 1OUSA 2BV4A 2JDNA 2JDYA 2XR4A 1UQXA 5D2AA 1OXCA 2VUDA 2JDKA 1W8HA 5A6QA 2WR9A 2BOIA 2VNVA 2BOJA 5A3OA 1OUXA 5HCHA 1UZVA 4AOCA 2BP6A 1OVPA 1GZTA 2JDHA 2JDMA 4UT5A 4CE8A 3DCQA 5A70A 5A6XA 1W8FA 2CHHA 5A6ZA 1OURA 2VUCA 1OVSA 5A6YA 2WRAA 3ZDVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JDP A;  2JDU A;  1OUS A;  2BV4 A;  2JDN A;  2JDY A;  2XR4 A;  1UQX A;  5D2A A;  1OXC A;  2VUD A;  2JDK A;  1W8H A;  5A6Q A;  2WR9 A;  2BOI A;  2VNV A;  2BOJ A;  5A3O A;  1OUX A;  5HCH A;  1UZV A;  4AOC A;  2BP6 A;  1OVP A;  1GZT A;  2JDH A;  2JDM A;  4UT5 A;  4CE8 A;  3DCQ A;  5A70 A;  5A6X A;  1W8F A;  2CHH A;  5A6Z A;  1OUR A;  2VUC A;  1OVS A;  5A6Y A;  2WRA A;  3ZDV A; 
#chains in the Genus database with same CATH topology
 2VD7 A;  5JPN B;  3TYJ A;  3POY A;  3T0A A;  4D7S A;  3B93 A;  3RVH A;  3I4I A;  4XAA A;  2X5I B;  5JVV A;  2A3Y A;  2DVF A;  2NMO A;  2CGP A;  1K5M B;  1O5L A;  4NPR A;  4OQ9 A;  3VUO A;  2P37 A;  2RS3 1;  2YU1 A;  1J3R A;  2YYO A;  4MGK E;  4L99 A;  1G9B A;  2WO7 A;  4IEU A;  1RHI 1;  3VBU B;  3I2I A;  5B4X A;  5KHH A;  4XDO A;  5FQ0 A;  3MUZ 1;  4KG0 A;  1S1A A;  2YU2 A;  3T0B A;  3UET A;  5LWB A;  2Q30 A;  1BVV A;  1NCR C;  4XJA A;  3RJ2 X;  4Q4W 1;  3D8C A;  3WNK A;  1WZX A;  5IW0 A;  4QQ2 A;  4WVV A;  5FY1 A;  4YVW C;  1JYV A;  1OF3 A;  2RS1 2;  3MEP A;  4IEP A;  4LMF A;  4QB6 A;  1DBN A;  4OMD A;  5K8S A;  2CSG A;  4JTO A;  1UQX A;  2BFU L;  2XJQ A;  1RUI 2;  1JW6 A;  3KZ4 C;  4MGQ A;  5FJH A;  3UJO A;  3WD5 A;  5FOB B;  4OUE A;  4Y1X A;  2RR1 2;  1PNF A;  3QH6 A;  2BNO A;  2RVA A;  4PDW B;  2V09 A;  4MHR A;  4AED A;  1ND2 A;  1V6K A;  1URX A;  1UKG A;  5EQU A;  4BQ3 A;  1COV 2;  3MYX A;  5GZF A;  3KT1 A;  5LBB A;  4FP2 A;  4FPG A;  4YFW A;  5DZG A;  3DGT A;  2WO1 A;  1NCQ A;  3SNM A;  1IG3 A;  2XPJ A;  4AZZ A;  2ZMN A;  2RS3 3;  4LLO A;  3ZYG A;  2QQJ A;  1TMF 2;  5FZO B;  5FZA A;  2C26 A;  2Z79 A;  2VW0 A;  4MX3 A;  1RHI 3;  1GQH A;  1N1T A;  3BUC A;  4B1M A;  1GNZ A;  4MGS A;  3AVR A;  2NLR A;  3HD8 B;  4BME A;  1DP0 A;  3U78 A;  2OII A;  1AYN 1;  4GJZ A;  2E7A A;  3KVB A;  4LHN A;  4Q4W 3;  1UZZ A;  1RUE 1;  3T1L A;  3SEP A;  4Y5Z 0;  1JU4 A;  1UY1 A;  4QPG B;  1MS0 A;  2RMU 2;  3SCG A;  1JZ3 A;  3CU7 A;  4QPI B;  5DUV A;  1G9F A;  3R4D B;  3PHM A;  1QH6 A;  3LD8 A;  1DGW X;  4X8P A;  1LCL A;  3GM8 A;  2K46 A;  1OOP C;  2JD4 A;  5E6H A;  3OSD A;  2H6B A;  2G9Z A;  2ZAC A;  4K40 A;  1W04 A;  4Q8K A;  2E63 A;  3QLQ A;  2E6V A;  2VMD A;  3LIG A;  4LEJ A;  4XMI A;  4SLI A;  1GFF 2;  2Y34 A;  3CZU A;  4CEW C;  1DYO A;  2RS5 2;  3AZV A;  4HK9 A;  5AC9 1;  1VBC 1;  2P3Y A;  2QBX A;  2XJT A;  3AX4 A;  4ZON A;  3EJK A;  1X8E A;  3D5O A;  4QHO A;  2VVD A;  3H1M A;  1FI2 A;  1W2T A;  2UU8 A;  1PHM A;  2R1D A;  3CF6 E;  5JZG C;  3MFA A;  3A4U A;  1LEN A;  1OT5 A;  4CDQ A;  1HV0 A;  5LBF A;  1EUU A;  3HQR A;  5DAP A;  2OYZ A;  3U10 A;  4LOR A;  1MVE A;  4WBB A;  1YO8 A;  3LSD A;  5FKC A;  4ZZ8 A;  2PAM A;  4DB5 A;  1AYN 3;  5C33 A;  4V2V A;  1MVQ A;  2W3J A;  1Q8S A;  4WM7 C;  1RUE 3;  1UMZ A;  2WS9 2;  1YLL A;  2D3R A;  2R04 2;  1RIR A;  1C5H A;  5LBE A;  1H8T B;  4GB3 2;  2B8M A;  2P3I A;  4QX2 A;  3RG0 A;  5T5L A;  1EYB A;  1PGW 1;  2ID4 A;  5KHI A;  3O1M A;  1H2L A;  3I3D A;  3VBF C;  2HWC 2;  2RM2 2;  4YW4 A;  4QQL A;  1GWK A;  4QHZ A;  1OMI A;  1KQR A;  2BRT A;  2P1B A;  1F31 A;  2QQI A;  1H2K A;  4XIO A;  4M0N A;  4NAO A;  4UXA A;  1F5F A;  1UY2 A;  2NZ9 A;  2GAL A;  3P3P A;  3INA A;  1LR5 A;  1S2K A;  4JGY A;  2D5F A;  1MS3 A;  4NRQ A;  4GJY A;  4AED C;  1UX6 A;  1WLD A;  2XHN A;  4C91 A;  5AC9 3;  4G9S B;  3MIG A;  1VBC 3;  2KXL A;  4CUC A;  4C0B A;  5FMD A;  2WT1 A;  3NJV A;  2EXH A;  3CMG A;  3VZN A;  3CLP A;  1HB3 A;  5DDJ 2;  3ZYH A;  5K9Y A;  1CQ9 A;  5FRE A;  4YM2 A;  1NCQ C;  1WGP A;  4JQR A;  2WYS A;  4X6Q B;  3T3Y A;  2W92 A;  5E8A A;  3BTY A;  4M3C F;  4E4S A;  1RJ8 A;  3B3Q E;  3HBZ A;  2Y38 A;  1H1I A;  4ORF A;  2CAV A;  3E6B A;  3OD4 A;  3WQ7 A;  3M8L A;  4E4D X;  2XL7 A;  2DFB A;  1GOF A;  2RHP A;  4HN0 A;  5H9S A;  3WQ1 A;  3K3O A;  3AVS A;  1RUD 2;  1R1A 1;  3EMR A;  3FFZ A;  1NQD A;  3J7H A;  1QXJ A;  3LEK A;  1SMV A;  4LK7 A;  4JKM A;  2B9V A;  2C5D A;  2Q0A A;  1MPX A;  5LA2 A;  2E51 A;  4N9H A;  1KFU L;  3LA7 A;  2OX0 A;  4FOW A;  4OUL A;  4OZX A;  2D97 A;  1W9S A;  2PXJ A;  4GMP 1;  4D0Q A;  1CAX B;  2QDN A;  3ZX7 A;  5C3R A;  3KV5 A;  1QF3 A;  1XNC A;  5FLJ A;  5FO9 B;  2A3X A;  3VL9 A;  3MF6 A;  5FYY A;  4ZPI A;  4Q4X 2;  2EF6 A;  4KI5 M;  1ASJ 2;  4W6W A;  3ZYR A;  4DRV A;  3TN9 1;  4FOQ A;  4HSL A;  4YGD A;  4XJZ A;  1W6O A;  1W8Z A;  1SQ4 A;  4PI2 A;  1DQ2 A;  1SBF A;  5G05 L;  1XOY A;  2ADD A;  3E97 A;  1JZ7 A;  1DZR A;  2WWS A;  2RR1 1;  4IQP A;  1FPN 1;  2FHR A;  1H2M A;  5LZ6 A;  1PMJ X;  1EV1 2;  2JD9 A;  2RDQ A;  4N7U A;  4BB3 A;  1OF4 A;  1WD3 A;  3MIE A;  1PM4 A;  1COV 1;  3PME A;  3QAC A;  3ZFE A;  4CE8 A;  1AR8 2;  4XUO A;  2DUR A;  4Q1R A;  2P3J A;  1PX3 A;  3OF1 A;  1I6X A;  4BE3 A;  1NKG A;  4CDQ C;  5B2G B;  1WME A;  4YVS A;  1R1A 3;  3WUC A;  3ZXL A;  1SFY A;  1XNK A;  1OBN A;  4NID A;  3MLJ A;  2QQU A;  2WNU B;  4NWV A;  4CEY A;  1ZYB A;  1Y3T A;  1GNH A;  2VXR A;  5C3S A;  1W8N A;  2JDY A;  1W05 A;  4GMP 3;  3VZK A;  4D69 A;  1DYP A;  2R32 A;  4AK3 A;  2Y6G A;  4XMA A;  4OHV A;  2Q8C A;  1TG7 A;  4TZD A;  5GJ6 A;  4M3C B;  2VXJ A;  3TN9 3;  2XKP A;  1UIJ A;  4DY3 A;  5KBF A;  2DFC A;  1DGR N;  2JX9 A;  2LM3 A;  4QX0 A;  2WZR 2;  5FUN A;  1ZBA 1;  4L97 A;  4I3G A;  4J1W A;  3RWN A;  1UCX A;  1WCK A;  3BU0 A;  4ET7 A;  2RR1 3;  1FPN 3;  1DQ5 A;  2W5F A;  4YAR A;  2DCJ A;  2ADE A;  3VDD C;  1TZO A;  5A6Y A;  1XYN A;  2QNK A;  3ES1 A;  1ODN A;  5ACA 2;  4GH4 B;  1COV 3;  1L7Q A;  1U0A A;  3SIS A;  4AHX A;  1R1Z A;  4HT1 T;  4XE9 A;  2RS5 1;  1CAW B;  1T6B X;  2B42 B;  1WD4 A;  4KU8 A;  5JXG A;  5DQ0 A;  5A80 A;  4UFJ A;  1Q5O A;  2GC3 A;  4A42 A;  4XAB A;  3C8X A;  4FTS A;  4O65 A;  3ZR6 A;  4YZ4 A;  3UKT A;  1EAH 1;  4HKL A;  2F4L A;  2VU9 A;  4S2G A;  4XAC A;  4P9I A;  3NO8 A;  3OCP A;  5FZ0 A;  3WDX A;  1OPM A;  5IWF A;  4KBZ A;  4PLN A;  2ZZJ A;  1LEC A;  1YQ5 A;  1PGS A;  4Q0Q A;  2DYC A;  5FMO L;  4XUN A;  4A45 A;  2H6C A;  2E31 A;  2HEY F;  4CP2 A;  3HR9 A;  4Q1P A;  3TEY A;  2WS9 1;  3ZKY A;  1US3 A;  3ROU A;  2R04 1;  2VUL A;  1QMJ A;  2VCC A;  4MYE A;  1NLR A;  2A6Y A;  3LPG A;  3LGR A;  4B3N A;  1ZBA 3;  4FPH A;  3AMM A;  5T5J A;  2DU1 A;  2WWU A;  3MI8 A;  4WZF A;  1X9P A;  4FPF A;  1AF9 A;  1IPS A;  2QQV A;  4FT8 A;  3URF A;  5FPX A;  1LES A;  1QKQ A;  2PYT A;  4N8M A;  3PVE A;  4AQ6 A;  5HCH A;  3RZL A;  2X05 A;  2ARE A;  4JDO A;  1PK6 A;  1KIT A;  3FWE A;  2O0O A;  2RS5 3;  3MW2 A;  1GU3 A;  3LCP A;  2XKO A;  2P6C A;  1DF0 A;  3GDB A;  4YVW B;  5I8S A;  1H4G A;  1HQN A;  1GWM A;  3W9A A;  3ZKU A;  2VO5 A;  5DDJ 1;  1UF2 C;  4XEZ A;  1OFN A;  2B39 A;  4NHX A;  5FYZ A;  1EAH 3;  3M70 A;  2W39 A;  3PLQ A;  4BA6 A;  2R06 2;  3FC0 A;  4A7Z A;  2ZEW A;  5EIY B;  5EV7 A;  3A21 A;  4CDW B;  3KV9 A;  4DXZ A;  4ES8 A;  1MZE A;  4HK8 A;  2WS9 3;  4CEY C;  1XQN A;  1RUD 1;  1LOG A;  2R04 3;  2YY1 A;  1ULC A;  2P34 A;  3O7O A;  3DL3 A;  1SHW B;  1N47 A;  5C8C A;  3NWK A;  3WIN E;  4COW A;  4B4Q A;  5C5T A;  4L2N A;  4TXW A;  2W94 A;  1QXR A;  2YMZ A;  4MG2 A;  1O6U A;  5IVF A;  4PQQ A;  1O3T A;  1C5I A;  1HKD A;  2FCV A;  2YPD A;  3A7Q A;  1SDW A;  1QQP 2;  3O0X A;  4S2H A;  2P5B A;  3ETQ A;  4XFB A;  4HL0 A;  4LK6 A;  4Q4X 1;  3S6P A;  1CJP A;  1UL9 A;  1POV 0;  4HMZ A;  1AR6 1;  3ZFG B;  4ASK A;  3VD7 A;  3U11 A;  3I8T A;  1O3Q A;  5CG9 A;  1TME 2;  4CU7 A;  1GOH A;  4LPL A;  2GNM A;  3ZXG A;  4CCJ A;  1IKQ A;  2VEC A;  5G04 L;  2VZP A;  2YUE A;  3QD6 A;  5DDJ 3;  5F5Q A;  2O1Q A;  2R07 2;  1GZT A;  5I0S A;  2ZS6 B;  3VBS B;  5FWE A;  2XH6 A;  1SDD B;  2XVK A;  3ZXJ A;  1OOP B;  3PIJ A;  3ACF A;  4U36 A;  1QDO A;  3RZK A;  3MHZ A;  1UN1 A;  2W68 A;  1A8D A;  4DXT A;  3S0M A;  2QQK A;  5EFU A;  2J42 A;  2YHJ A;  4QDQ A;  1RUD 3;  3H42 B;  2WO2 A;  3HQU A;  2JB4 A;  5CAZ A;  2RJK A;  5C9A A;  3PMS A;  2DVA A;  1BMV 2;  3U4X A;  4QX3 A;  2D93 A;  1GBG A;  2LS6 A;  3JU9 A;  4MSV A;  1U12 A;  2NN8 A;  2YC0 A;  4PBP A;  4CP1 A;  5CFC C;  2BPA 2;  4GKX A;  3LOB A;  1VE0 A;  2PHW A;  5FPA A;  3I3Q A;  4AFD A;  1MS1 A;  5JZG B;  5FY9 A;  5JI7 A;  3MV0 1;  3MIF A;  3E1F 1;  1U5I A;  3EHK A;  3OB8 A;  1Q8P A;  4Q4X 3;  4M0H A;  4AW7 A;  3K3N A;  1AR6 3;  2Q1M A;  5DAB A;  4YW1 A;  5IVJ A;  1VB2 A;  4BIF A;  1IS5 A;  4WM7 B;  4PIZ A;  5HCB A;  3UKV A;  2FDG A;  3IPV A;  4RN5 A;  2YFU A;  1PIV 2;  1FAY A;  3CJI A;  3PUR A;  3D6E A;  3VHR A;  4D6R A;  1JZ6 A;  1MS5 A;  1CAV A;  1PK6 C;  2G19 A;  4NAM A;  4EN6 B;  1G7Y A;  1I3H A;  1LUL A;  4AE2 A;  4ARY A;  5ACA 1;  3BOP A;  3E6C C;  4IGP A;  3VBF B;  5FXX A;  2X09 A;  1XU2 A;  3B01 A;  2NP0 A;  3POB A;  5FY0 A;  2ZEZ A;  5BYN A;  1AHS A;  3PUH A;  4AVC A;  4NIG A;  1S4C A;  1UW8 A;  1QHD A;  5DUW A;  2WR9 A;  2UYB A;  5FZL A;  1QH7 A;  2WYF A;  4N43 C;  4P9J A;  5F8P A;  2JG8 A;  1KEX A;  5LK5 A;  4QGN A;  3WG1 A;  1JYN A;  4Y5T A;  1JYC A;  3I3E A;  1AR9 2;  1UPS A;  1ZNP A;  2LTN A;  3B9C A;  1WKY A;  5ERL A;  2HEV F;  1W3X A;  2WQ4 A;  2Y6J A;  2E33 A;  1UIK A;  5M0T A;  3FMG A;  3ZXA C;  3MFC A;  2YB7 A;  2W47 A;  2ZEX A;  1HJF A;  3KT4 A;  3ACH A;  1GKB A;  4I0B A;  2ZGM A;  4LKD A;  3N36 A;  4JGZ A;  3U75 A;  4N53 B;  1WW7 A;  3OBR A;  5FZ7 A;  5FCC A;  1RVF 2;  4BQ4 A;  3T0D A;  4XFF A;  4EWE A;  4LIT A;  4XTM A;  4P5H A;  5FXW A;  1OXC A;  1NY7 2;  5JOY A;  1MEC 1;  2OVU A;  2BNN A;  2F4P A;  1RMU 2;  5JR2 A;  3DEC A;  3UGG A;  5A1A A;  3FBM A;  2VOK A;  4Y1U A;  1WW4 A;  2DTY A;  4XXP A;  4XJ8 A;  1YIF A;  4XFI A;  4AFC A;  3I3M A;  3DPR B;  3POE A;  4MOA A;  3ZSM A;  1ZX5 A;  1X8M A;  3ZVX A;  2VW1 A;  3GZU C;  3Q9O A;  2BYV E;  4IV1 A;  4MGZ E;  3BOD A;  1YIP A;  1F8V A;  4FFG A;  4ONU A;  3J4U H;  4IV3 B;  2K0G A;  3L9J T;  4FI9 A;  4IDZ A;  4QKN A;  5CAD A;  5EWS A;  2ARX A;  2W1S A;  1GUI A;  1LOC A;  3AMQ A;  1YFX A;  3S30 A;  4ATF A;  4GUL A;  5JCT A;  1Z78 A;  2J1A A;  5F5I A;  2Z4F A;  3DKQ A;  4PBO A;  1W6N B;  4B4P A;  5JIA A;  3AM2 A;  4P9G A;  4DIQ A;  3VDB A;  4B29 A;  1DDL A;  1Q56 A;  3K75 B;  5C9A C;  2FDH A;  4BHP A;  2ZGK A;  4K20 A;  1GAN A;  2MPF A;  5BNO C;  1CAX A;  4SBV A;  2P6H A;  2AEY A;  3PUS A;  2ES3 A;  4GIQ A;  3ZXF A;  3PVN A;  4A4A A;  4AQ2 A;  1XE7 A;  5HXM A;  5HPO A;  1MEC 3;  4BYY A;  4HPK A;  4FFF A;  2O14 A;  3V65 A;  4QM8 A;  2PMW B;  4D6S A;  4YRD A;  3GAL A;  3HBK A;  3VKN A;  4AEK A;  1LAJ A;  3O5S A;  2FMY A;  2HYK A;  1OA2 A;  3JQX A;  3CJI C;  4M3C E;  1H9W A;  1LOE A;  3ILN A;  1QJY 1;  5BNN A;  1CAU B;  2QQW A;  2BER A;  2D3S A;  1RUC 2;  1OQ1 A;  2R0F A;  3D82 A;  4QPW A;  3ZYF A;  4AG4 A;  3AYA A;  3WVJ A;  2VJX A;  2D3P A;  3VDA A;  2XBO 2;  2ZGL A;  1O4T A;  1RUO A;  2R07 1;  5LK7 B;  1RHI 2;  1PMI A;  1FMD 1;  3BCW A;  2J1E A;  5DUU A;  1LGC A;  1BHG A;  2JG8 C;  3VDD B;  4ASL A;  2OPK A;  1SBE A;  2OUH A;  3H9A A;  1HB4 A;  2A6X A;  4XTP A;  3ATG A;  3V0B A;  3OUH A;  2OQ6 A;  4CCD A;  3FJS A;  2GH8 A;  1BMV 1;  1WWY A;  1R08 1;  4AEJ A;  2QUO A;  2JE8 A;  3SMH A;  1J1L A;  1E5R A;  5D2A A;  5EPA A;  4AQT A;  1QJZ A;  1PO1 2;  1B35 A;  5EHD A;  4BOW A;  2ZHL A;  1Y9Q A;  2UWA A;  5C4W B;  2IVI B;  1LHW A;  4LBQ D;  2XL9 A;  3C7G A;  5HV4 A;  4K6B A;  3ZN6 B;  1GOG A;  3LKJ A;  3T08 A;  2GSY A;  4GD4 A;  3WCS A;  1GP5 A;  5CFD B;  1DG6 A;  4XIK A;  2Q4S A;  1CN1 A;  1QJY 3;  5KXB A;  1KDK A;  3I2D A;  3MPP G;  3O0V A;  5FR3 A;  5IVC A;  3RZG A;  4XBN A;  1O4Y A;  1Y43 B;  4YW2 A;  5TSW A;  4ZKT B;  1PIV 1;  4LHL A;  4UWD A;  2JIC A;  5F3C A;  1OA3 A;  1YEW A;  1D2Q A;  1JI6 A;  3VBH A;  4AR2 A;  1AJK A;  2R07 3;  2V4V A;  1O5U A;  5FLI A;  1FMD 3;  2D40 A;  2DVD A;  4YLZ A;  5ABJ A;  5FXV A;  1AVB A;  4QDR A;  3EB7 A;  5FK8 A;  4B4R A;  1AYN 2;  3WF0 A;  1JOB A;  4YGC A;  1MAC A;  1LHO A;  1RIN A;  1RUE 2;  4TLG A;  4Y33 A;  3POG A;  1YYN A;  4R4X A;  4LIV A;  1AR9 1;  1JN2 P;  1R08 3;  1ENQ A;  2WAO A;  3O1P A;  3OG2 A;  4QD2 A;  2FDI A;  2ZGR A;  5LRR A;  4QKB A;  4XF0 A;  4XVH A;  2IFR A;  5FZG A;  1ND3 A;  5GLV A;  2ZZQ A;  4HKW A;  2F6B A;  4NHM A;  4AI3 A;  3I2J A;  3GBG A;  3IBM A;  1YCI A;  3N7K A;  3P6B A;  4BIO A;  5GLW A;  1IS6 A;  1XNT A;  4LE4 A;  2ILM A;  4CXX A;  1RVF 1;  4AGG A;  3U14 A;  4A6O A;  3M3O A;  1AL2 1;  1FX5 A;  1VBC 2;  1S0I A;  1UZW A;  1PIV 3;  2XLG A;  4RS5 A;  2D44 A;  1G8W A;  1RUJ 2;  1RMU 1;  2VW2 A;  3B5L B;  3Q8B A;  3KV6 A;  5T50 A;  1RC6 A;  5EJ1 B;  3N35 A;  4Y24 A;  4C8D A;  3WZ1 A;  4EYU A;  5BNN C;  4QKF A;  4XUQ A;  4LJH A;  2BUK A;  4XZU G;  5IJR A;  1WBF A;  2VQ0 A;  3UGF A;  5BNP A;  1LOB A;  1L7R A;  2NM1 A;  4Y22 B;  1AXZ A;  3RMX A;  4AHZ A;  4EN9 B;  1WA6 X;  3USU B;  2BTV C;  4HVO A;  5FYH A;  2YGL A;  1VBB 1;  3U37 A;  4XAE A;  1JXN A;  3I2H A;  4LKF A;  1AR9 3;  4JHZ A;  1W9T A;  2B5H A;  3I54 A;  4MGT A;  4YM3 A;  3U4S A;  1UWW A;  1KFX L;  3F2Z A;  1RTV A;  3WDW A;  4OZO A;  3OGV A;  4Y20 B;  3ZM8 A;  4IE4 A;  4AI0 A;  1YQ6 A;  4DIN B;  1PO2 2;  4H55 A;  2WKK A;  1PZ9 A;  3VLB B;  4EN0 A;  5IUQ A;  1W3V A;  2VY0 A;  2JDZ A;  3LZZ A;  4IEQ A;  1LGB A;  1W8U A;  4NIA A;  3SCF A;  4P5Y A;  4DPN A;  3PL0 A;  1JBC A;  1NA1 C;  1RVF 3;  2Z2S B;  1LTE A;  1YFU A;  3G6J B;  1AL2 3;  1WCU A;  3THD A;  5GZD A;  4R9A A;  1RUG 2;  5DN2 A;  4BCU A;  1RMU 3;  4CXY A;  3LA2 A;  3KB5 A;  1AJO A;  5FMC A;  5JXI A;  2XQX A;  3ZYJ B;  5CFC B;  5B4N A;  4XUP A;  1ZA4 A;  2W87 A;  3PNA A;  4YGE A;  3A0K A;  4CDU A;  4CZS A;  4PLO A;  4R52 A;  2JG9 A;  4RGG A;  4YNI A;  1HX6 A;  4MLO A;  4KWK A;  3AZW A;  2XML A;  3VBH C;  1LOF A;  2GN3 A;  3PIG A;  3VZL A;  4A3Z A;  2BGO A;  3IDA A;  2GME A;  2NMN A;  3NST A;  4A7Y A;  3I2G A;  1R1A 2;  4CYD A;  2D6N A;  1RUC 1;  1VBB 3;  3WSO A;  1HIX A;  3OY8 B;  3WNP A;  1VRH 1;  2EIB A;  1DQ0 A;  2XBO 1;  2XVG A;  4JHT A;  3WDT A;  1D7P M;  2WNV B;  4FPO B;  4F3J A;  2CNA A;  2QZ3 A;  5A7N A;  3OEB A;  1JHN A;  4XUT A;  4DNY A;  3KLS A;  2UUR A;  3M3C A;  4Y4R A;  1UOB A;  2BBA A;  3GHN A;  3AP5 A;  3I2F A;  3SIT A;  4DS0 A;  4QQH A;  3RYK A;  3TN9 2;  1O59 A;  2UWC A;  1ND3 C;  2JE7 A;  5F7U A;  1R09 2;  4RHV 2;  3VKF C;  2GND A;  5JXJ A;  1EPZ A;  4N43 B;  1J59 A;  3KD4 A;  4RR3 A;  4GZ9 A;  1PO1 1;  3UT0 A;  3E5X A;  3OGS A;  1FPN 2;  1ENR A;  4I0A A;  4WM8 B;  4CUB A;  2YGM A;  1SPP A;  1UYZ A;  3AKP A;  4K8R B;  5A3M A;  3R4U A;  3EQE A;  1GSL A;  3N7L A;  4P9Y A;  4QAW A;  4RS5 C;  4MXW B;  1AYM 1;  4IW3 A;  3ZO0 B;  2GC0 A;  2VMH A;  5LA1 A;  1IPK A;  1JTZ X;  3M4F A;  3AFG A;  3WOG A;  2RE9 A;  2VBB A;  2V5Y A;  4ZHN A;  2JEN A;  4QGL A;  3K4D A;  4LO8 A;  3VBR A;  4OHX A;  4RQP C;  1RUC 3;  4CRQ A;  3FX3 A;  3ZFF A;  4ZU7 A;  5CB7 A;  1VRH 3;  5I93 A;  4MGY E;  2XBO 3;  1SLT A;  1M4W A;  5JMC A;  2X10 A;  2AGS A;  2Q8D A;  3WNM A;  3IWZ A;  1YNA A;  1A6C A;  2A6W A;  4Z92 B;  4NE9 A;  3GYD A;  3AYC A;  3KHB A;  3K4Z A;  1L7L A;  2Q8O A;  3WF1 A;  2E26 A;  3MDP A;  3RNS A;  4Z2A A;  3UES A;  2A71 A;  3MZH A;  1AX0 A;  1REE A;  1RUF 1;  1SZB A;  1BEV 2;  1JOD A;  3MPB A;  3JZV A;  3IZO A;  1QNY A;  1S0E A;  2BU9 A;  3B94 A;  3BGA A;  4HSJ A;  5LA9 A;  4CDX B;  1ZBA 2;  2A70 A;  3CZJ A;  2N7G A;  3BIW E;  1PO1 3;  1OD3 A;  2B7Y A;  5FOJ B;  1BJQ A;  1VLN A;  4NVP A;  5FZ9 A;  5L19 A;  1WLT A;  4FQ4 A;  2GH2 A;  5F32 A;  1LHU A;  2IVJ A;  1AYM 3;  5IAX A;  3Q8F A;  5T55 A;  1IPJ A;  3VZJ A;  4COU A;  5T5O A;  5K7P A;  1CX1 A;  4AXO A;  3WP4 A;  4C1W A;  1V6O A;  5BNO B;  3UYJ A;  3WF2 A;  5IK4 A;  4CDU C;  2YXS A;  5H9P A;  1SFP A;  1WCS A;  1RUJ 1;  3L2Y A;  4Q2F A;  2DUQ A;  2JG9 C;  1UZV A;  4LLF A;  5L7O B;  2JDH A;  1UMI A;  2ZGT A;  1EAH 2;  2CL2 A;  1LOF C;  2WIN B;  4JDN A;  5IT6 A;  2KM2 A;  4ZS3 A;  4LA3 A;  2EIC A;  2PHX A;  1MZF A;  5DAQ A;  1X9T A;  3NAP A;  1C3H A;  1WMF A;  4XF3 A;  2IXL A;  5A7W B;  4EWD A;  4YSF A;  5J37 A;  2A75 A;  1OVS A;  2XWJ B;  4KMQ A;  4QHB A;  3KWV A;  1RUF 3;  4IGO A;  2BBV A;  1VMH A;  3M1H A;  5FP3 A;  2VAU A;  4LBJ A;  4AL9 A;  4CP9 B;  1W2A X;  4NHL A;  2EIG A;  4YW3 A;  4BLI A;  4M00 A;  3UV9 A;  3JCI A;  4FAG A;  2BZD A;  4LBL A;  2C1F A;  4Y4Y A;  3ZMN A;  4IEW A;  3DN7 A;  1PO2 1;  2Y60 A;  5DAW A;  1UOJ A;  5E16 A;  5FZD A;  5FKB A;  1I1E A;  2SBA A;  2WN3 A;  3VDC A;  1WMD A;  1ZRR A;  3WP3 A;  2C9K A;  3V0A B;  2I74 A;  4FTB A;  1W90 A;  2VZS A;  3QCW A;  2ZGO A;  2VC9 A;  3C2U A;  1ND2 C;  1OSG A;  1CD3 G;  3NV1 A;  3SH5 A;  2JEC A;  1RUG 1;  4CTE A;  1IS3 A;  2A73 B;  1RUJ 3;  3N7M A;  3POS A;  3PUQ A;  2MEV 2;  5CYY A;  1TEI A;  1CAU A;  3VD5 A;  2QVS B;  2ET7 A;  4Q8L A;  4ZS2 A;  1UYY A;  3AYE A;  4YFZ A;  1WW5 A;  2TUN A;  5LRS A;  3RZM A;  3N9N A;  1FV2 A;  5D8A A;  4QM9 A;  2XLF A;  4FPC A;  4QDS A;  5LA0 A;  5CBL A;  1MQT B;  3POW A;  1W8H A;  3ZFF C;  4BQ5 A;  3ECQ A;  3SXW A;  3KHC A;  2W46 A;  1XC6 A;  3DXU A;  1AL0 G;  4NHK A;  4WVM B;  2ARC A;  3AZZ A;  3O1S A;  1VRB A;  4GWN A;  1KJL A;  5L9R A;  4JKL A;  2QJV A;  2EAL A;  4JKK A;  3QBQ A;  4KWJ A;  4P9W A;  1DLL A;  1GZ9 A;  1PO2 3;  5BV6 A;  4FFH A;  4ZZ5 A;  1TNF A;  4KGG A;  4QXC A;  1YC6 1;  3OPT A;  2XJS A;  1AR6 2;  2HBU A;  3ZN6 A;  1R09 1;  2OUJ A;  3AKQ A;  4RHV 1;  3PU3 A;  4M4R A;  5K0U A;  5CFD A;  2CTV A;  1RUG 3;  2E53 A;  2XXZ A;  2X53 S;  2B4K A;  1FNY A;  3DYM A;  1W2O A;  3VBO A;  3WXP A;  5DMY A;  3M3Q A;  1VAV A;  2B9U A;  2QQP A;  4LUM A;  4JRL A;  2YC4 A;  4Z07 A;  4MGI E;  5JUV A;  2HWF 2;  3HEI A;  4UFK A;  3LFI A;  4W8J A;  4LBQ B;  3SKJ E;  1Y9M A;  2RDR A;  3NNG A;  3FE5 A;  2ARA A;  3GZA A;  4XFA A;  4FPK A;  5IAV A;  3M3E A;  1IS4 A;  1ZBE 1;  1LRH A;  2JDP A;  2JE9 A;  2QKD A;  2Y0O A;  3RI8 A;  3WDY A;  3ZSE A;  4HVQ A;  3UNP A;  3NAP C;  4I3P A;  1LU1 A;  3WG3 A;  1NT0 A;  2R0H A;  3K4A A;  4LOT A;  4BM8 A;  3BN6 A;  3H50 A;  3B02 A;  5FY7 A;  1UO9 A;  2WN2 A;  3KS7 A;  5BXX A;  2QDR A;  1B09 A;  5DZF A;  1EPW A;  2JEM A;  3TEX A;  2XDV A;  2JDM A;  4TYS A;  2CWS A;  1BEV 1;  1WLW A;  2VZV A;  2WQ8 A;  4XXA A;  4UFH A;  1R09 3;  1W0N A;  1CZV A;  4KL1 A;  4RHV 3;  2IFW A;  4K7J A;  5C7G A;  4R4Z A;  1UYP A;  4JAA A;  4AHW A;  5FWJ A;  2VUC A;  3DF0 A;  5A33 B;  3ALQ A;  4JGY C;  4LQR A;  3PVB B;  1RIT A;  2VNR A;  1ZZB A;  3AC0 A;  5JIU A;  1LB2 A;  3IAP A;  4L92 A;  2D5H A;  1O8S A;  4TLF A;  4UBH A;  4PQ9 A;  4XOG A;  4YG6 A;  4F83 A;  4GA9 A;  4XHB A;  4BK5 A;  1W06 A;  5FYV A;  2DDU A;  2QQL A;  4W4Z A;  3KMH A;  4J1X A;  1UU6 A;  1XYO A;  4PT6 A;  5F3I A;  1H1M A;  3IAQ A;  3BKZ A;  2BOI A;  3VD4 A;  3LA3 A;  4AI1 A;  1AX1 A;  2PTM A;  1ZBE 3;  4I0W B;  1CJD A;  4LIU A;  3FN9 A;  4Y3O A;  4FCA A;  4W50 A;  3WNN A;  1N1V A;  1NXM A;  5FPL A;  3KV4 A;  3VZM A;  3M3I A;  1HXS 1;  2ENR A;  4ITC A;  3HPN A;  2ZAH A;  2VBP A;  5I0U A;  1FNZ A;  1NX9 A;  3AB0 A;  4Y20 A;  1US2 A;  3OGR A;  1BEV 3;  1NZC A;  2WC2 A;  4LBO A;  4NN0 A;  2Q1F A;  2XON A;  5F1R A;  4Q4Y 1;  1V9U 3;  1OC1 A;  3MLK A;  2ZGU A;  2Y6L A;  3I59 A;  1MEC 2;  2VH9 A;  4YZ1 A;  2J7M A;  2EVX A;  2UY8 A;  1SCS A;  1SLI A;  1N3O A;  4QXH A;  4UBG A;  1QOO A;  3JB8 A;  3ETP A;  5J36 A;  1LKN A;  2OW4 A;  1BVP 1;  1W2N A;  2HYX A;  4HBN A;  4KU7 A;  4UF0 A;  5JDB A;  4FSJ A;  4KGQ A;  1JOJ A;  4PIX A;  3FL7 A;  4K3U A;  3AZX A;  5GKA C;  4NII A;  4KQ7 A;  3RS6 A;  4ZXK A;  4BQY A;  4A41 A;  4HG6 B;  1NCR B;  5CIS A;  1JH5 A;  2JIJ A;  4MV2 A;  3K48 A;  1W6M B;  1ZZ7 A;  2JKX A;  5FYI A;  2ARB A;  4X8N A;  2ZPX A;  5JAX A;  3POJ A;  2MEV 1;  3ZFE C;  1VP6 A;  1BLZ A;  3LDR A;  2X5I A;  1FOD 1;  2AUY A;  5FUP A;  3GCW A;  1K5M A;  1LHV A;  3LIH A;  2XB6 C;  4YVS C;  2ZHM A;  3VV1 A;  1HXS 3;  1U5Z A;  1YQC A;  1I5P A;  1FV3 A;  3I97 A;  5F37 A;  4OHW A;  3UL2 A;  1RED A;  2ZGS A;  5CVR A;  3T2T A;  2D98 A;  3VBU A;  2VNV A;  2WA4 A;  4AGR A;  4FO9 A;  5FP8 A;  3CJX A;  4HOO A;  2ZGQ A;  4OI4 A;  2WDB A;  3N9O A;  1C57 A;  1J1T A;  4Q4Y 3;  1V6J A;  4P02 B;  1VIW B;  3OBT A;  4R8H A;  2HWE 1;  1QEX A;  1VJ2 A;  4RQP B;  1W6Q B;  2A1X A;  1CES A;  4TN7 A;  5IVY A;  2VCA A;  5F5C A;  5T3N A;  3R0R A;  5FFO C;  3HT1 A;  4MXV A;  3UJQ A;  3WHU A;  5IYY A;  1OQD A;  4PDW A;  5EP9 A;  4BIS A;  4CCN A;  1QJY 2;  3GF6 A;  4FOV A;  4H2A A;  4D6Q A;  5IVV A;  3OBA A;  4JRA A;  4DO0 A;  1D4V B;  2B46 X;  3A22 A;  1UYX A;  3HT2 A;  5LY2 A;  3C3V A;  2MEV 3;  4RGA A;  3POF A;  2VOW A;  4CPB A;  1W6P B;  2VZU A;  3D0S A;  4EZH A;  1FOD 3;  4DUX A;  1A78 A;  4HAN A;  2VM9 A;  1XNA A;  4PCR A;  4HZF A;  3RPQ A;  2VOT A;  4URA A;  4YZ5 A;  1FMD 2;  2HKX A;  2QFE A;  2HWF 1;  4E27 A;  5L9B A;  5A6Z A;  3NNF A;  2V4A A;  4EV0 A;  4MO3 M;  3N3H A;  3LEM A;  1VBE 1;  3ACG A;  4YM1 A;  2XUE A;  5FBZ A;  3ZXD A;  2GC1 A;  1JYX A;  4CEW B;  5FZH A;  3OD0 A;  4XET A;  1N1S A;  1NYW A;  5AVP A;  1R08 2;  1GZW B;  3FHI B;  2HWE 3;  3H7Y A;  1GP4 A;  2J1S A;  4NPM A;  4A44 A;  5A1L A;  3SH4 A;  2ZGP A;  4QPG A;  3VL8 A;  2H0V A;  3JQW A;  2IXH A;  1DFQ A;  1OKQ A;  3GBW A;  1J3Q A;  4JQT A;  4QPI A;  3ZYI B;  4CCO A;  1GR3 A;  1ONA A;  4FP3 A;  4M4P A;  4FBF A;  3HNB M;  5A3W A;  2CY6 A;  1CVN A;  1H6X A;  4QXK A;  2IZW A;  3B00 A;  4IEZ A;  4NUB A;  2YZ4 A;  4AVS A;  5FQ0 B;  5F3E A;  2WFF 2;  4XYX A;  2BVV A;  4PJY A;  4BQ2 A;  1QIQ A;  4J6G A;  4DY5 A;  4PHZ A;  4COZ A;  2PHR A;  3TNP B;  2RV9 A;  1T2X A;  5CA6 A;  1QNW A;  2PQQ A;  4YWA A;  5FZ1 A;  1KXG A;  2HWF 3;  4NHY A;  1Q8V A;  3U07 A;  1G9D A;  1DGL A;  3RSJ A;  3N9P A;  2C6S A;  4CPB D;  1I9R A;  1H4H A;  1VBE 3;  5ANN A;  2OZJ A;  5E88 A;  3HNY M;  3IB3 A;  3UKN A;  1K5M C;  2PN5 A;  3AJY A;  4XCA A;  3VKO A;  5CKQ A;  3TEW A;  3IT8 A;  4AED B;  2DUP A;  3H0O A;  1XRU A;  3EBR A;  3NV3 A;  5A7W A;  1ND2 B;  3OUJ A;  3IKW A;  4BQX A;  3W5N A;  3SCH A;  4FQZ A;  2Y64 A;  4OI0 A;  2ZCW A;  1H8T A;  1NQJ A;  2ZJC A;  1QOT A;  4AVV A;  2G9G A;  2OA2 A;  1GWL A;  4IER A;  2VMF A;  1NCQ B;  3ON7 A;  5EYY A;  1S0B A;  3HMY A;  5C8C C;  1CIW A;  4XQ4 A;  2BFU S;  4FPJ A;  1UZY A;  4AGV A;  1E5S A;  4MUV A;  4R9D A;  4XDQ A;  2VTX J;  1AL2 2;  3TBD A;  1SLB A;  5L36 A;  4O61 A;  4IEV A;  4QQO A;  1ZZ8 A;  4UYB A;  5EXO A;  2J1R A;  2VR4 A;  4CSW A;  5JI9 A;  4G3Y C;  5F3G A;  2VUA A;  1N3Q A;  4AAP A;  5EYX A;  3ENR A;  3OOX A;  5FYM A;  1CWP A;  4LO4 B;  4RD7 A;  3NJZ A;  1ULE A;  1NAE A;  1OLQ A;  1RUH 2;  4JCK A;  1MQT A;  5H9Q A;  1A34 A;  2CGO A;  1VBB 2;  3WV6 A;  2BV4 A;  1ST8 A;  1UXX X;  4CU9 A;  4OLL A;  1WA4 A;  2VBD A;  5F5A A;  1UX7 A;  2CWM A;  4OFG A;  5FZ8 A;  4LOS A;  3WHT A;  5J98 B;  2JB8 A;  1JS9 A;  1QJU 2;  3N7J A;  5IVE A;  4WVM A;  1POV 1;  3CL1 A;  1DZT A;  1ULD A;  3BVC A;  4Y1Z A;  1ULF A;  3WQ0 A;  3C7E A;  4M01 A;  5LEK A;  2PHD A;  4QPG C;  2JXA A;  3MIC A;  4QPI C;  1YRZ A;  3AP6 A;  1NUK A;  4O9G A;  1NLS A;  1GYK A;  3HNM A;  4CDQ B;  1X36 A;  4QB2 A;  4D8M A;  3S7I A;  1UY4 A;  1PVX A;  1YJL A;  1NLQ A;  1SLC A;  4S2D A;  1NG0 A;  2AH2 A;  3E5U A;  4UI9 L;  4H14 A;  4WVZ A;  5IFP A;  4LHK A;  4JX0 A;  3BIE A;  4Y1Y A;  4KH9 A;  1S55 A;  4CU6 A;  1S0C A;  4W65 A;  5DAV A;  4TSV A;  2XOM A;  4AWD A;  5KR7 A;  5FZK A;  4LUK A;  4XPV A;  2DU0 A;  1NE4 A;  2PQS A;  3VKM A;  2BGP A;  3WNL A;  5FPZ A;  5KXD A;  1HB1 A;  4AF9 A;  5LY1 A;  1D4M 1;  3J8F 1;  3HIF A;  1O8P A;  1VRH 2;  3NKT A;  3RYR A;  1HN1 A;  2BWC A;  2GC2 A;  4JC1 A;  3TRS B;  2W1U A;  2ZOE B;  1POV 3;  2WNU A;  3GJB A;  3I7D A;  4C1X A;  2AR6 A;  4UW3 A;  4LBK A;  4FAH A;  2WZE A;  1RJ7 A;  2A7A A;  3X29 B;  3AMH A;  2VE1 A;  4RSU A;  3BTX A;  1H8T C;  3BTA A;  5FO8 B;  5T54 A;  4NIH A;  1E5H A;  3ES4 A;  3ZN4 A;  4M3C A;  1MR5 A;  1Y9G A;  1VAK A;  1DQ4 A;  2VVE A;  4NWW A;  1R64 A;  1TE1 B;  5FY5 A;  4UFL A;  3RFR A;  4JGZ C;  1HV1 A;  1BYH A;  1VPH A;  1UKR A;  2WQZ C;  4H3W A;  5FY8 A;  2E9Q A;  5DZE A;  2KA3 A;  1HRV 1;  1OVP A;  3GZT B;  2AYH A;  1AYM 2;  2GAU A;  1VMJ A;  5AVA A;  2C24 A;  4L11 A;  1A8M A;  4GH4 A;  5FAX A;  4XBQ A;  5A7Q A;  4X6R B;  3AP7 A;  3WEZ A;  1ZRE A;  2WFF 1;  2ZTN A;  5KHK A;  3S57 A;  1O91 A;  1D4M 3;  1D0H A;  3B7M A;  3J8F 3;  5FUI A;  5SV5 A;  2VZ3 A;  4IV1 C;  1CAW A;  1OUS A;  3BI3 A;  3BAL A;  1S0G A;  2YC2 A;  1MZ6 A;  5FP7 A;  3OEA A;  5ANQ A;  1OLR A;  4COV A;  3BYW A;  3CO2 A;  4OI1 A;  1W6O B;  2BGC A;  1F15 A;  3MV1 1;  4E2G A;  2IXJ A;  5JMO A;  2WWJ A;  3IMN A;  4K1Y A;  4EJR A;  3ILR A;  1RUF 2;  1BK0 A;  5FZO A;  3ZSJ A;  2QCS B;  2P4E A;  1YFY A;  3P5B A;  4UFM A;  1RB8 G;  3JD7 2;  3O0W A;  2YBS A;  5LBC A;  1ZZ6 A;  5JSP A;  1F2N A;  4Z1V A;  2I07 B;  2H0B A;  2D6P A;  3ZFE B;  4B7E A;  2ZX1 A;  4CVU A;  1W2U A;  2VTX A;  1DZQ A;  2YFZ A;  3NV4 A;  1HRV 3;  3GZE A;  1JZ8 A;  2E7Q A;  3WLU A;  2FQP A;  4V2W A;  3LDK A;  3NNJ A;  5A3N A;  5HI0 A;  4YW7 A;  3AL5 A;  3MW3 A;  3WG2 A;  4CEY B;  1YUD A;  5A6Q A;  1OQE A;  1S0J A;  3DKW A;  2WFF 3;  3EXU A;  4LKS A;  2QQO A;  3PVO A;  5D1I A;  1VBA 2;  4FXG B;  5FYC A;  5KHG A;  4NRP A;  1CR7 A;  1V0A A;  1UY3 A;  3AP4 A;  2OZ6 A;  1OH4 A;  4XBL A;  5A7O A;  5JOX A;  5FMB A;  1L3J A;  4YVW A;  5DG2 A;  3Q8E A;  1GNY A;  1ULG A;  3KCC A;  3MGU A;  2Q5T A;  2J1T A;  1AXY A;  2R49 A;  4UFI A;  3FLT A;  3NQH A;  3PUI A;  3HWJ A;  2VZR A;  4NO4 A;  1RUH 1;  3VZO A;  1GLH A;  3FHA A;  1DQ6 A;  1W9F A;  4CDW A;  3LDB A;  2HJI A;  4LO7 A;  5J96 B;  2WNU C;  1F5J A;  5FK7 A;  2RJL A;  2QE3 A;  4PLM A;  1Q8O A;  1RGS A;  1DCS A;  2XUM A;  1QJU 1;  4XDP A;  3WDU A;  1LGN A;  1LU2 A;  1OUX A;  5C71 A;  2VMC A;  4BK4 A;  1QWR A;  2DBN A;  3E5Q A;  4BXF A;  5JPM B;  5CEH A;  2P17 A;  4Y26 A;  5A32 B;  5FZE A;  1B35 C;  4QU2 A;  2BWA A;  2C4X A;  4PIY A;  4P00 B;  3FLR A;  1C4R A;  2R16 A;  1GIC A;  3NL1 A;  1LHN A;  4BWO A;  1SAC A;  4E4H A;  3HVD A;  3UK9 A;  3ZSK A;  3ZFG A;  1Y4W A;  2Y6K A;  3GGL A;  2WJS A;  1POQ A;  1QU0 A;  4FPY A;  1WBL A;  1FT9 A;  3WP6 A;  3III A;  1W28 A;  3O1V A;  5FTT C;  4GH4 C;  1XSR A;  1OD5 A;  4H7L A;  3VHP A;  4CCK A;  3GJA A;  3O14 A;  2JJ6 A;  1HQL A;  4AHY A;  1GQG A;  2WLP A;  2ZGN A;  3PU8 A;  1S2B A;  1J83 A;  1MS4 A;  4AFM A;  4LO5 B;  1S0D A;  2XHK A;  3BPS A;  3SHR A;  3S5Q A;  2VZO A;  3OTF A;  3VBS A;  1RXF A;  1OOP A;  4QX1 A;  1RUH 3;  2RDS A;  3WNX A;  2FCU A;  2VQU A;  3H8U A;  4IEO A;  1XXN A;  4LHS A;  5ABJ C;  3J7L A;  2VVF A;  1SLL A;  3LF7 A;  4HFS A;  1AR7 2;  5FP4 A;  2GMP A;  5FMO S;  1DGR A;  4YZ2 A;  3WX5 A;  1BK1 A;  1IQD C;  5J09 A;  4I09 A;  5I0R A;  2ZX0 A;  4AFB A;  1PK6 B;  2RJ2 A;  4CEW A;  5IK5 A;  5J1X A;  1QJU 3;  3ZR5 A;  4A7K A;  2NQY A;  2Y6F A;  1O7F A;  2BNM A;  2PEL A;  2VQA A;  2HWB 1;  1GZC A;  4NJ4 A;  1DQ1 A;  4D94 A;  2ZX4 A;  5JZG A;  2R30 A;  3GNE A;  4Z8B A;  1HLC A;  1W03 A;  1O4Z A;  1OPO A;  3ITQ A;  2DF7 A;  4N7I A;  1CZS A;  4DQA A;  1J3P A;  5C3P A;  3OJB A;  4AVA A;  4WM7 A;  4XW3 A;  5A3T A;  4Q0S A;  3OGG A;  1OKO A;  4DUV A;  2IXC A;  4RGK A;  4C0H A;  5A70 A;  5IK8 A;  2ORZ A;  3DXT A;  3KQR A;  1NZI A;  4BZ4 A;  2IUW A;  4Q4V 2;  2EID A;  2G4I A;  4MAD A;  1PZ7 A;  3U1X A;  4AEM A;  1H0B A;  3RRD A;  5C8C B;  2L9L A;  3VBF A;  1HRI 1;  4XFC A;  2XG3 A;  1EY2 A;  1ZBE 2;  4AYU A;  2VGD A;  3NKG A;  4EZ4 A;  5BNP C;  1YHF A;  1X7N A;  2P2K A;  2W0X A;  5GAL A;  2I45 A;  4F7Z A;  5FPV A;  2GNT A;  2Q1Z B;  3SC7 X;  3LFM A;  1S0F A;  1C8M 1;  2Q8E A;  2DCT A;  2GMM A;  2D6K A;  3TB0 A;  3O1T A;  4N90 A;  1KRI A;  4CDW C;  2DCY A;  3JB4 C;  3LAG A;  5IVB A;  4GMP 0;  2HWB 3;  5A3O A;  1J58 A;  3DYP A;  5CG8 A;  2RDN A;  4K21 A;  4IEY A;  1ZRF A;  1UAI A;  1W0O A;  4UT5 A;  2QQM A;  3BPZ A;  5GZC A;  1XE0 A;  4PI0 A;  1H2N A;  1V9U 2;  3JD7 1;  1BQP A;  3N9Q A;  1JHJ A;  4OUM A;  5C8W A;  1N1Y A;  4N53 A;  4XF9 A;  3ZXK A;  2F17 A;  1OHF A;  5I8Y A;  4YYO A;  4I2O A;  2VNG A;  3ZN5 A;  2C0Z A;  2OS2 A;  2R1B A;  4FOY A;  2A5Z A;  3W5M A;  3VB9 A;  4NRM A;  1WUV A;  5C9A B;  3ZFG C;  3OYW B;  2Y26 A;  1H9P A;  2JDK A;  3DPR A;  5I0D A;  2EA7 A;  5FPU A;  1HRI 3;  1ULO A;  1M06 G;  2WZP P;  2BOJ A;  5T52 A;  2PHT A;  1VBA 1;  2XJR A;  3LPF A;  4EQV A;  1H30 A;  2B45 X;  5CU1 A;  4AVT A;  4QMA A;  5JOZ A;  2P3K A;  2VMG A;  3IIA A;  4IV3 A;  3VBS C;  1VB4 A;  1C8M 3;  5LAT A;  5FYU A;  1ZA7 A;  4O7X A;  1HXS 2;  1VR3 A;  3APB A;  5LW9 A;  2LW8 A;  1OFS A;  1W6N A;  3R6S A;  3S7E A;  3SLI A;  3H3L A;  3IPV B;  1HJG A;  3ME2 A;  3CJI B;  3IDE A;  3OPZ A;  1V70 A;  2D6O X;  4IE0 A;  4LA2 A;  1CAV B;  2AEZ A;  1UXZ A;  3H1Y A;  2D7F A;  4Q4Y 2;  3GXU A;  3JD7 3;  3WW2 A;  4FVV A;  3SQO A;  2GP3 A;  3IM0 A;  3F95 A;  4Q27 A;  5FV3 A;  5FZM A;  2V5D A;  5FZ4 A;  3FLP A;  1HB2 A;  2J1U A;  3DYO A;  4QX5 A;  1PGL 1;  3FUO A;  3O1U A;  2O8Q A;  4MH0 E;  1YJK A;  1QJX 1;  2UY9 A;  2WFP A;  4RFT 0;  5A1F A;  4RR3 C;  2JG8 B;  1BBT 2;  1YXW A;  3O1O A;  5F2S A;  3I49 A;  1F35 A;  1Q3E A;  2PLV 1;  4HN1 A;  1E5I A;  4LXL A;  1V6L A;  3I2O A;  4IXL A;  3OPW A;  1VBA 3;  1Z7S 2;  4QX7 A;  4NPL A;  2HWD 1;  1AXK A;  4XC9 A;  2VUJ A;  5J48 A;  1FOD 2;  4Q5O A;  3C7O A;  4IE7 A;  1ALY A;  3WQB A;  1MS8 A;  1VBD 1;  3KF3 A;  4DZG A;  2KR2 A;  2VTF A;  4JGZ B;  5CZK A;  3ZXE A;  3MW4 A;  3VBR C;  1DGW A;  4KBB A;  4NOT A;  2DBI A;  1DLC A;  2ZEY A;  5FZI A;  2AEN A;  1Q43 A;  1BCX A;  5A7P A;  3TOJ A;  5HCF A;  1D2S A;  2PHU A;  3VDD A;  4IND A;  3PJQ A;  3WCR A;  5J3U A;  2DCK A;  2X29 A;  5FRA A;  1AR7 1;  3NJX A;  1HQW A;  5A3P A;  2AC1 A;  2GNB A;  2HWE 2;  4TWT A;  1BXH A;  1V00 A;  4XIL A;  3H8R A;  3JUU A;  2AZ5 A;  3HJR A;  4ZY9 A;  1C8N A;  1W9W A;  2ZX2 A;  4IV1 B;  5A7S A;  3WUD A;  5FYS A;  1XJA A;  3H8O A;  4G4F A;  3LEG A;  3JBG 2;  4RL7 A;  1QJX 3;  2WAA A;  3NMB A;  3ZIW A;  1KS4 A;  1V6M A;  2EXI A;  3ACL A;  2W2I A;  4FPL A;  5C4W A;  2O8O A;  4N53 C;  4MET A;  4N9I A;  2PLV 3;  2NYY A;  1ODM A;  4R9C A;  1GQP A;  5E1R A;  3KVA A;  3CIH A;  3T4H B;  3T1M A;  2KD7 A;  5FZF A;  1F4H A;  4XJU A;  3IMM A;  4QPY A;  5FLH A;  2ZHK A;  3W58 A;  2Z5W A;  2HWD 3;  3AJZ A;  2CYF A;  3WW1 A;  2CAU A;  3KT7 A;  3OUI A;  2DV9 A;  3DPR C;  1VBD 3;  2YG0 A;  5FZ6 A;  2Z69 A;  1O3S A;  4BDV B;  4BJ0 A;  4AAX A;  2W08 A;  1H8V A;  3AYD A;  1XYP A;  3OGJ A;  4Q4V 1;  1CX4 A;  1VBE 2;  2WRA A;  2BDR A;  3ACI A;  4IV3 C;  2WNO A;  2Y6H A;  2RS1 1;  4HPK B;  4OMC A;  4W6Y A;  2CGN A;  2JDA A;  5EJZ B;  2VQT A;  4URT A;  4AI8 A;  2WO3 A;  1AR7 3;  3P3N A;  1TVG A;  1RUI 1;  1APN A;  1ACC A;  4DMI A;  4B8E A;  4OUS A;  4GQ7 A;  1D0G A;  1SG3 A;  3D0J A;  4CUG A;  5BNN B;  3B9I A;  3KSC A;  3FZ3 A;  3V64 A;  5DG1 A;  4GWI A;  4E9K A;  1ZZ9 A;  1HW5 A;  3ZSL A;  4L8Q A;  1XND A;  4LR4 A;  4Q0P A;  2FZ2 A;  5BY5 A;  3ZPY A;  4XCB A;  1PVC 2;  1V9U 1;  1NXD 1;  4JZR A;  3S5A A;  4B7K A;  1VAM A;  4NMI A;  5IHR A;  3KQ4 B;  4QB1 A;  1TMF 1;  4MVT A;  3MBW A;  3WNO A;  1Z0H A;  4Q26 A;  2V73 A;  4ASM B;  5FYT A;  3V0B B;  1DYK A;  5SV8 A;  2DWR A;  4WV8 A;  2A6Z A;  4Q4V 3;  3PJY A;  1ZZC A;  1X33 A;  2WBK A;  3SKV A;  3C7H A;  3BU7 A;  2LAL A;  4DFS A;  1B35 B;  2RS1 3;  2RMU 1;  5D8A C;  5FZB A;  3ABZ A;  1NA1 B;  2QZ2 A;  1SLA A;  3GHM A;  4QWN A;  4QXB A;  5I0T A;  3UGH A;  4Y22 A;  1RUI 3;  1UOF A;  2LRP A;  3NNM A;  3CKH A;  4HVR A;  3GCX A;  1JOP A;  2OT7 A;  4ZU4 A;  2WUH A;  3USU A;  4ISR A;  1UNB A;  4GWJ A;  2ZAA A;  3TAY A;  5JLV A;  1SFN A;  1LED A;  2OQ7 A;  1FXZ A;  3POI A;  4XQW A;  2LRO A;  4WZC A;  3ZDS A;  3VN4 A;  1ZRD A;  3WW3 A;  4GKY A;  3T2Q A;  2J1V A;  2VZQ A;  5F9T A;  2PA7 A;  1KD7 A;  2A6V A;  1W99 A;  1C1L A;  3VBH B;  5AFE A;  4RFR B;  4LKE A;  5AFB A;  2Y0I A;  1X82 A;  2FDJ A;  1FAT A;  4CCL A;  5A32 A;  2G1M A;  5ABJ B;  4FTE A;  3MUY 1;  5JWP A;  5C4W C;  1TMF 3;  1AUY A;  3D4K A;  3T2O A;  1UOG A;  2BP6 A;  2BEO A;  3AMP A;  2DTW A;  5JSO A;  2IXK A;  4QU1 A;  3THC A;  3W59 A;  5IK7 A;  1XSQ A;  5K0U C;  2HEW F;  5CFD C;  4KWU A;  2JWP A;  3J26 N;  1BBT 1;  1QJE A;  3ZLI A;  3VBO C;  5CFC A;  4BQW A;  3TWI A;  4COY A;  5IAT A;  3USS A;  5FYB A;  4YW6 A;  5FJK A;  4D7T A;  1IZ3 A;  5C3O A;  1E57 A;  2RMU 3;  2XWB B;  3SH3 A;  3VGI A;  3ZDV A;  1Z7S 1;  1ND3 B;  3KM5 A;  4GB3 1;  2PFW A;  2PHF A;  2ETE A;  4FFI A;  1MS9 A;  5LB6 A;  1MZ5 A;  3K46 A;  3P1I A;  4L9B A;  2NPI A;  1RL3 A;  2HWC 1;  4QGM A;  2RM2 1;  5KC5 A;  4LT5 A;  3OY8 A;  3L2H A;  1YI9 A;  3WG4 A;  3BB6 A;  2CV6 A;  3WT3 A;  2WNV A;  3R05 A;  4QQP A;  2JIG A;  4LE3 A;  3WW4 A;  1HDK A;  2WZ8 A;  4RS5 B;  4E2Q A;  4EWA A;  3LOI A;  3BOW A;  1GMM A;  3AKT A;  3K2O A;  2ATF A;  3LE0 A;  4BPZ A;  5FZC A;  4R9B A;  3T09 A;  4AQS A;  3AFK A;  2VG9 A;  3Q8C A;  4UAP A;  5L73 A;  2DVB A;  5FBJ A;  3D3A A;  4XJW A;  2IC1 A;  3H7J A;  3NVC A;  5BNP B;  2ZBJ A;  4N43 A;  1CGP A;  3JBG 1;  3M2M A;  2YRO A;  1BBT 3;  3O12 A;  4WM8 A;  3O1R A;  2VMI A;  4JTN A;  3RQ0 A;  1ZVF A;  3RWK X;  1I5Z A;  1QGL A;  4MXW A;  1AZD A;  4KNC A;  3RZH A;  2JKB A;  5D21 A;  1JZ2 A;  1Z7S 3;  1D4M 2;  1W8O A;  2XJU A;  3J8F 2;  4GB3 3;  4Z82 A;  3RYP A;  4CCM A;  3Q8A A;  5C6C A;  5HV0 A;  2SLI A;  4CXW A;  2ORX A;  2TBV A;  3SEE A;  2W52 A;  4AFA A;  2HWC 3;  2PAE A;  2RM2 3;  1UY0 A;  3CHX A;  1V6I A;  5HXV A;  4XUR A;  3T30 A;  3EYP A;  5EZW A;  4UW6 A;  3RMY A;  3ZYB A;  1ASJ 1;  1GP6 A;  1PNG A;  1WW6 A;  1V6N A;  3IN9 A;  2CDP A;  5F39 A;  3KCY A;  3RZZ A;  4W6X A;  1UMH A;  1JUI A;  2A3W A;  4P08 A;  2VNO A;  2RG4 A;  4LTA A;  5A3L A;  4LBM A;  4CDU B;  4Z2W A;  1W9Y A;  2WNE A;  5C3Q A;  1OLM E;  4TTG A;  2GP5 A;  1IOA A;  2JG9 B;  2YBK A;  1RYY A;  4OHZ A;  2TEP A;  1EV1 1;  4CDX A;  1LOD A;  1HRV 2;  2R7E B;  2ZX3 A;  3IDB B;  4DEV A;  3AKS A;  2Y33 A;  3JBG 3;  1O3R A;  3K51 A;  5KWR A;  1QOS A;  1AR8 1;  1ZRI A;  1HN0 A;  3V56 A;  1K12 A;  1W8T A;  1W8W A;  1WCD J;  4PF5 A;  5GLT A;  3VHO A;  4IET A;  3VD3 A;  5A6X A;  3ST7 A;  1JU3 A;  2QQN A;  2ZXQ A;  1G86 A;  1PVC 1;  2FCT A;  2FBE A;  2HBT A;  3AP9 A;  3KCX A;  3KGZ A;  1H1A A;  3QOP A;  4HKO A;  2BJS A;  4YZ3 A;  2ZHN A;  4GAL A;  3RGB A;  4J25 A;  1YWK A;  3MF9 A;  3OYW A;  3LEI A;  4XJ9 A;  1JMU B;  2VCB A;  1IG0 A;  5IFT A;  5BNO A;  1G9C A;  2W95 A;  2HH9 A;  3HQX A;  4BH9 A;  5CKN A;  2XR4 A;  2EIE A;  4Y5S A;  2CDO A;  3H8X A;  4UW4 A;  1FYU A;  1K3I A;  2D6M A;  3ELN A;  2WSV A;  1REF A;  1G6N A;  1TNR A;  2XLA A;  5H9R A;  5L7O A;  2X5I C;  4Q0U A;  1OLM A;  1C1F A;  1YI7 A;  1ASJ 3;  2ET1 A;  3CEW A;  5T5P A;  5A3U A;  4JV4 A;  4RR3 B;  1G9A A;  3LSE A;  1A3K A;  3H3U A;  4OHY A;  2WZR 1;  1SPP B;  3PDQ A;  4XZP A;  2DCZ A;  4LO6 B;  2WNV C;  1IGO A;  4Y1V A;  3C7F A;  3VBU C;  5F6L B;  1WMX A;  1QJF A;  1KJR A;  2PAK A;  1DIW A;  4GXL A;  2XJV A;  3RZJ A;  3THP A;  1EV1 3;  4CP9 A;  1YQ8 A;  1JYT A;  1OH3 A;  1XBF A;  3H1W A;  1W39 A;  4IE5 A;  1AR8 3;  3VBR B;  1ULP A;  3NNL A;  2IWG B;  4IUG A;  5EJ3 A;  1K5J A;  2HLE A;  5GM0 A;  2X8K A;  5KC6 A;  3ZFF B;  1PVC 3;  5LCW L;  2W9X A;  2ZKN A;  3AKR A;  5FO7 B;  4CA9 A;  4KG8 A;  4C90 A;  1SBD A;  3HN1 A;  3V0A A;  3NV2 A;  3WDV A;  4PDW C;  3G7D A;  5FIX A;  4CUA A;  2EAK A;  4O9E A;  4WM8 C;  5KXC A;  4A2U A;  1DU3 D;  3J7N A;  4H7M A;  2WA3 A;  2W1W A;  1OA4 A;  4GWM A;  1C28 A;  1XPW A;  4FPE A;  1UU4 A;  1TQ5 A;  4E4Z A;  1K42 A;  2QTW B;  2OPW A;  3N9M A;  1EUT A;  5LEJ A;  4P9L A;  1SEF A;  4LNV A;  1IQA A;  5F6K A;  1IKP A;  4K1Z A;  2WZR 3;  3WP5 A;  3CDZ B;  3THT A;  1X50 A;  3T4V A;  4NR1 A;  2K9Z A;  1QDC A;  2V72 A;  3VKL A;  1XE8 A;  5ACA 3;  2VME A;  2G9F A;  3KGL A;  3WY6 A;  1KS5 A;  5FP9 A;  1F4A A;  3RI9 A;  2E32 A;  4E8C A;  3LWC A;  4EN8 B;  3HOB A;  4DUW A;  4CDX C;  1PMH X;  3H3Z A;  3AL6 A;  2FDK A;  1BKZ A;  1CPN A;  3ZYP A;  4XF1 A;  4RA0 A;  2XQR A;  5DPN A;  3AZY A;  4OYU A;  4BU2 A;  3WF3 A;  2WL1 A;  3A0N A;  2WT0 A;  2WT2 A;  3CNA A;  3NAP B;  4YG3 A;  5KXE A;  5FZ3 A;  5CIR A;  2VOX A;  1NOV A;  3ORJ A;  2ZMK A;  4OQ8 A;  2R06 1;  1CON A;  1VAL A;  3PTR B;  4ZU5 A;  3FFQ A;  2BVB A;  5I91 A;  1H6Y A;  2EXK A;  2YDE A;  4QKD A;  2ZA9 A;  4YW5 A;  4DRR A;  3JXS A;  4F8A A;  3ZMO A;  2VZT A;  4GAZ A;  2GDF A;  4LBQ A;  1JYW A;  4BXS V;  5L7O C;  1U5X A;  1P8J A;  3DCQ A;  1DHK B;  2GN7 A;  3T2P A;  5JOW A;  1RXG A;  2VCM A;  1JUH A;  4DXS A;  4D3W A;  4JGY B;  4KWL A;  3W21 A;  4JVA A;  4E8D A;  2BQP A;  2MHF A;  2OXB A;  2EXJ A;  1QQP 1;  5DXD A;  2OKX A;  3BTZ A;  2VZ1 A;  1WLC A;  3MID A;  1JYI A;  2D43 A;  2HWB 2;  2LUW A;  1YFW A;  2GU9 A;  2DUO A;  4PF1 A;  4HET A;  5CKM A;  5GLU A;  3IDC B;  5GLZ A;  2YV8 A;  1Q8Q A;  1TME 1;  4V1P A;  3AXE A;  4A3X A;  4DOU A;  4BLJ A;  4XF4 A;  1YQ2 A;  3ASI A;  1Y7B A;  5D8A B;  1F9K A;  2RS3 2;  4S2F A;  3J9S A;  1PX4 A;  3AMN A;  3QH7 A;  4AOC A;  2CU5 A;  2VL4 A;  3TNQ A;  3VHN A;  1PM7 A;  3KF5 A;  3DV8 A;  2R06 3;  5A33 A;  4K9S A;  3PTY A;  1JZ5 A;  1K45 A;  5L9V A;  2XJP A;  3CBN A;  4YPJ A;  1CZT A;  4RYD A;  4Q4W 2;  1J84 A;  3GBF A;  5JSR A;  1ZRC A;  4YGB A;  1HRI 2;  2WLQ A;  4XHX A;  4IE6 A;  3ILF A;  3FHQ A;  4I30 A;  5JR7 B;  1KGY A;  2UYA A;  3RDI A;  4A6S A;  2JDN A;  4QT6 A;  4DXR A;  5I8T A;  4ISQ A;  3AXD A;  4P9X A;  3OBZ A;  2K2S A;  4IES A;  3U0Z A;  4FXK B;  5FY4 A;  5C70 A;  1NA1 A;  2FD8 A;  1C8M 2;  2VUD A;  1MQT C;  2PHL A;  3DEM A;  3EO6 A;  1AX2 A;  1UZ0 A;  3A23 A;  1QQP 3;  1CIY A;  2R6Q A;  3E6D A;  1XU1 A;  4B1L A;  5K0U B;  4IEX A;  5ISL A;  4I01 A;  3N4M A;  2YBP A;  2XVL A;  4Q29 A;  2ZKL A;  3VBO B;  3R4S A;  4HON A;  1CPM A;  1QXP A;  1TME 3;  1UPI A;  1W8F A;  3PUA A;  4IGQ A;  2J22 A;  5KHJ A;  2WAB A;  5GZG A;  2D6L X;  2VOV A;  4ZXE A;  2JDU A;  1ENX A;  3N9L A;  4ES9 A;  1U5Y A;  3MO4 A;  4YVS B;  4AI2 A;  2IXI A;  3TEZ A;  1LEM A;  3ZOI A;  4BMB A;  2E7T A;  2MNG A;  3DUI A;  4ARX A;  3I3B A;  4HLT A;  3ZIX A;  4UOJ A;  4E2S A;  4CU8 A;  1GV9 A;  4IL7 A;  4YM0 A;  1LNS A;  1BZW A;  4WVW A;  5CNA A;  5E89 A;  3HN3 A;  4AI9 A;  3W20 A;  3VD9 A;  1VMF A;  4UW5 A;  1NCR A;  3HAG A;  1W6M A;  3I2K A;  3WF4 A;  4ATE A;  1N3P A;  4P14 A;  4Q0V A;  1UU5 A;  2VPV A;  5APA A;  3NW4 A;  2CHH A;  3M7A A;  4CCC A;  3LB9 A;  4DEQ A;  1XB9 A;  5FXZ A;  4OI2 A;  2FMD A;  1RUN A;  1SCR A;  2XGX A;  5DUX A;  3J7M A;  2DVG A;  4LUL A;  2WSU A;  1WCQ A;  5J7M A;  5AC9 2;  2ZML A;  1ENS A;  3ZPO A;  4ERO A;  2UWB A;  1NY7 1;  1KDM A;  5DAX A;  3LQC A;  2TNF A;  4CP0 A;  4HXC A;  1PGL 2;  2FZ1 A;  4XFG A;  4RQP A;  4JDM A;  1W6Q A;  1IHM A;  1QJX 2;  5BNQ A;  4EE2 A;  3NJY A;  2BW8 A;  5FPB A;  5BPX A;  5C5U A;  4OCT A;  2ZAB A;  2PLV 2;  2ERF A;  3B69 A;  1OUR A;  4L0P A;  1W0P A;  2I2S A;  4MZU A;  1PZ8 A;  5BUV A;  1T6G C;  2HWD 2;  1XNB A;  4XQD A;  5LAS A;  5F2W A;  1PGW 2;  2W91 A;  1JZ4 A;  5GZE A;  2C9A A;  1VBD 2;  4D7Y A;  3K77 A;  3MIB A;  1S2E A;  1W6P A;  5JXH A;  3WR0 A;  2Z42 A;  4K8F A;  4LBN A;  3NRU A;  5HCA A;  5K4L A;  3FUQ A;  2Y8K A;  1STM A;  3I59 B;  2AAC A;  1LOA A;  4I02 A;  1UD1 A;  4NRO A;  4AVB A;  1ZM1 A;  1NE6 A;  4BQ1 A;  5FDB A;  2EAA A;  2GZW A;  3MLL A;  4OVE A;  4XFH A;  4UF0 B;  4EN7 B;  1QY4 A;  4CCE A;  1OI6 A;  2FDF A;  2WII B;  5HBA A;  1EP0 A;  4QX8 A;  4MHU A;  3RJR A;  3AK0 A;  4U2A A;  2W1Q A;  2YPJ A;  1LJ7 A;  3MIH A;  1GZW A;  3CQO A;  4YG0 A;  3FBY A; 
#chains in the Genus database with same CATH homology
 2JDP A;  2JDU A;  1OUS A;  2BV4 A;  2JDN A;  2JDY A;  2XR4 A;  1UQX A;  5D2A A;  1OXC A;  2VUD A;  2JDK A;  1W8H A;  5A6Q A;  2WR9 A;  2BOI A;  2VNV A;  2BOJ A;  5A3O A;  1OUX A;  5HCH A;  1UZV A;  4AOC A;  2BP6 A;  1OVP A;  1GZT A;  2JDH A;  2JDM A;  4UT5 A;  4CE8 A;  3DCQ A;  5A70 A;  5A6X A;  1W8F A;  2CHH A;  5A6Z A;  1OUR A;  2VUC A;  1OVS A;  5A6Y A;  2WRA A;  3ZDV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...