2BP6A

Crystal structure of pseudomonas aeruginosa lectin (pa-iil) complexed with a-l-galactopyranoside
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
114
structure length
114
Chain Sequence
b'ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PSEUDOMONAS AERUGINOSA LECTIN II
publication title Binding of Different Monosaccharides by Lectin Pa-Iil from Pseudoman Aeruginosa: Thermodynamics Data Correlated with X-Ray Structures.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Lectin
total genus 20
structure length 114
sequence length 114
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07472 PA-IIL Fucose-binding lectin II (PA-IIL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.400 Mainly Beta Sandwich Jelly Rolls Calcium-mediated lectin 2bp6A00
5A6YA 1OVSA 1UZVA 2JDYA 5A3OA 5A6XA 4CE8A 5HCHA 2JDNA 1OVPA 2WRAA 1OUXA 5A6QA 2VUDA 2BOIA 2JDHA 5A6ZA 2JDKA 3ZDVA 5D2AA 2BV4A 1W8HA 2JDMA 4UT5A 1OUSA 1OXCA 2CHHA 2XR4A 1W8FA 3DCQA 2VNVA 1UQXA 2JDUA 2VUCA 2BP6A 2JDPA 4AOCA 2WR9A 5A70A 2BOJA 1OURA 1GZTA
chains in the Genus database with same CATH superfamily
1ZRIA 4IESA 5D8AA 1FMD2 1GZCA 1YFUA 1OD5A 4CDWA 2XWJB 3TEWA 1EY2A 1VBC1 2GC2A 1BZWA 2UU8A 4CDQC 5LY1A 4UW6A 5E88A 4OZOA 3J7NA 3ZDSA 1LESA 2D7FA 1OSGA 2RS31 1GOHA 5FUIA 4A44A 2JEMA 5FO9B 4JDNA 3IDBB 2I45A 3SCGA 2JG9A 2W68A 2P3KA 4JKMA 4NUBA 2HEWF 2C9AA 4XJZA 1BEV2 4YGCA 4LBOA 5F5QA 1AR62 2LM3A 3B9IA 3JQWA 1YJLA 4CDXB 3SHRA 2VCBA 5I0SA 1ND3A 3ZFEA 2VZSA 4Y1ZA 4CDXA 3ETPA 4AFCA 2P17A 4YARA 1NXD1 4FP2A 1HIXA 2IXLA 4LOSA 1XNBA 2YU1A 3ME2A 5A3TA 3EYPA 3VDDB 1KEXA 2RR12 3LB9A 2VNRA 2Z4FA 5K7PA 1STMA 3BKZA 3THCA 1VIWB 3AC0A 5AFEA 3WDUA 3O12A 4UBHA 2UWBA 4AAPA 1XSQA 2VZOA 1UD1A 3WXPA 1O4YA 1S55A 4S2GA 2ZAHA 1IG3A 4CPBA 1YYNA 4ZY9A 5T52A 4UFJA 2D6KA 3S5QA 1O3SA 1MACA 1KFXL 1LOFA 1XQNA 4FOQA 4Z2WA 4TLGA 1YHFA 2X09A 5BNNC 1D2SA 4MX3A 3LQCA 1Q8PA 1UMHA 2VU9A 3ZKYA 1MZ6A 1O4TA 2QQPA 4AFMA 1AL21 1OI6A 4PIXA 3VDAA 3AYAA 4QX5A 3WW2A 2BZDA 4DMIA 2ZS6B 4CTEA 5JZGB 1REFA 4AF9A 1L3JA 3RMXA 5JZGA 2W47A 2D5HA 1TQ5A 2OVUA 5E89A 2ZA9A 1N3QA 5LK7B 4FPYA 2XWBB 3VD5A 4M3CF 3VBFB 1ODMA 2OA2A 4WVVA 3UGHA 2OYZA 5I8SA 4C1XA 3O1RA 5EFUA 1PVC3 2BGPA 4LORA 1O5UA 5J1XA 2QQJA 3N36A 1NE6A 5F1RA 5FZCA 3QLQA 4IV1C 2WNUC 2YV8A 4XHXA 2P3IA 5DUUA 5FUPA 4ZZ5A 1A6CA 3CLPA 4IE4A 3CU7A 1HRI2 4XABA 3SCFA 3ZSMA 4KU8A 1RUF2 5C70A 4GWJA 1GR3A 1R083 1PO23 3ACIA 5F3EA 1JYTA 1PO11 1XE0A 1RC6A 1VBB1 5AC91 4OHXA 2OQ7A 3K75B 4BE3A 2B9VA 4HOOA 1S2BA 2WZR2 1JZ6A 2VUAA 3DXUA 1UNBA 3WNOA 3LCPA 4IXLA 2HJIA 3LEMA 2XVKA 1NAEA 1PK6A 4YM3A 1NKGA 1G86A 4K40A 4AR2A 1K5JA 5JMCA 2RDSA 5C9AC 3INAA 3ILRA 1QJY3 5HCFA 4MGSA 1VLNA 1O8PA 5E6HA 4MV2A 5FP4A 4CE8A 1AHSA 5KR7A 3L2HA 2GP5A 1RUH3 4E27A 1HQWA 4JRLA 2VM9A 1HRV3 3GCXA 1W8TA 3MPPG 3RG0A 4PIYA 4A3XA 4M3CE 2G9FA 1N1SA 1QJX3 2VUJA 3BN6A 2YFUA 1OQ1A 1MS4A 2IC1A 4LXLA 2NYYA 5FK7A 3TBDA 4FXGB 4HVQA 5DQ0A 1L7LA 2P1BA 5FCCA 4LKDA 1FNYA 1I6XA 5K9YA 1QH6A 1RJ8A 5FZOB 2QQMA 1CJPA 2LALA 4XPVA 3JCIA 3VBHA 1NE4A 5FZOA 3WP3A 1RVF1 3ZSEA 1AJOA 2XB6C 1VMFA 4DPNA 2HKXA 3TEYA 1REEA 2E53A 4CEYC 2ADEA 5IUQA 5A7SA 3OGJA 3IAQA 4FOWA 2A70A 4B3NA 4LBJA 4RHV1 2F6BA 2EXKA 4FSJA 4UFMA 1K5MB 2BFUL 3H0OA 1K5MA 5KWRA 4B7KA 5KXEA 4S2HA 2JDKA 4LIUA 1H2NA 3AKSA 4LBKA 4D7TA 2X8KA 4M0NA 3O1UA 1S2EA 2J1AA 4NR1A 4QPGB 4Q4Y2 1UY2A 1SHWB 1C5IA 3BOPA 1VBD1 2GC0A 4QPGA 3U14A 4NAOA 5DPNA 3ZYHA 3S57A 2WO3A 2GN3A 3S7IA 2D3SA 3DGTA 5CADA 1NQDA 1RHI1 1E5RA 4LKSA 1G9AA 1J59A 1F2NA 3CEWA 5C5TA 2DF7A 5FYTA 4KL1A 5IVYA 4D6SA 4LITA 5LBBA 2CAVA 1HJGA 2WABA 1T2XA 2LUWA 4U36A 4A3ZA 3U37A 4CDQB 1RB8G 1MZFA 2DFBA 2WAAA 3M3CA 2OZ6A 1AR63 1UIKA 1RUE1 3MI8A 4XILA 4LK6A 4ARYA 5D2AA 3Q9OA 4COZA 5BYNA 4ZHNA 1I3HA 2BVVA 4YM1A 5F3GA 4CU9A 5FBJA 1APNA 2HEYF 4DRVA 3MW4A 3T1LA 5FFOC 4L92A 4DQAA 1LHWA 3HJRA 3ZYBA 4IEUA 1DU3D 2BW8A 1KS5A 4AQ6A 5IATA 3V0AB 4GMP1 2FDHA 3KV6A 3V0AA 1LTEA 4RFRB 2AYHA 2ZX1A 2AZ5A 4QT6A 5J3UA 1ND2C 5JLVA 1KGYA 2W5FA 5FWEA 2FZ2A 3GYDA 1CD3G 3BOWA 3N9MA 4FCAA 5DAVA 4AVCA 3DV8A 2AENA 3IIAA 3R6SA 3J8F2 3MEPA 4CXWA 1VRH2 1H8TA 4DO0A 2W92A 4PJYA 5DAXA 4MGIE 3WNLA 1VAKA 5AFBA 1RUJ2 4K6BA 1PNGA 1COV3 4LO6B 5I91A 1CX4A 2BJSA 4Y5TA 4JQTA 2JECA 3WZ1A 2VZVA 4XUTA 3KS7A 3NNMA 1SLAA 4EN0A 2PHUA 4CCKA 4XFGA 2PHXA 2GDFA 3MF9A 2E7TA 2ZZQA 5BXXA 1S0GA 2D6PA 4HN1A 3ZXFA 5ANQA 2X5IC 4XF4A 3I2IA 4UWDA 1U5YA 1JXNA 2VMCA 3NKTA 2JE9A 4MO3M 2PQSA 5FAXA 5B4NA 5IFPA 1Q5OA 2XHNA 5C8WA 3UGGA 4JKKA 1WCUA 2VL4A 3P3PA 1G9BA 2D93A 4LUKA 4CU6A 1W9WA 4FPGA 1POQA 4E2SA 3HQUA 5EZWA 1ENXA 1JN2P 2IZWA 1QWRA 1HRI3 3HR9A 4D6RA 5J48A 4RYDA 4N90A 2ZGOA 5FKCA 2Q1ZB 2WNUB 3B02A 1AL22 1XOYA 4IL7A 4QX8A 4B4QA 4QDSA 3I2OA 2WNUA 4NAMA 1H6XA 3POJA 5GZCA 2ZGRA 4YVSC 4LO7A 2WSUA 3ECQA 4GH4C 5FOJB 2AH2A 1JYNA 2QQNA 4CU7A 3N3HA 3AZXA 1DGWA 3JUUA 4HKOA 5IVEA 3TN92 5FPAA 2YMZA 4QHBA 1H9PA 3EB7A 2RJKA 2ZOEB 5BV6A 5IYYA 1UIJA 1BVP1 2XLAA 3UJQA 3OJBA 4DUVA 4ZU7A 2V4AA 3E5UA 1TG7A 3O0WA 4CCCA 1QGLA 1UYPA 1MQTC 3DYMA 2Q4SA 4A6OA 2BFUS 3CJXA 3B01A 4IDZA 2WNVC 2BWCA 4COYA 5C9AB 1D4M2 3USUB 5FZDA 1NLSA 3LE0A 3NWKA 5KXBA 4E2GA 4AHZA 1EPWA 1NCQC 1LEDA 1TMF1 2Y8KA 1QNWA 2IXJA 1RUC3 1R1ZA 1UY3A 1X7NA 2PELA 4CP9B 3FBYA 4M3CB 4NHKA 2ZHKA 2DCYA 4GWIA 4CCJA 4FBFA 2PHTA 1KRIA 1M06G 2JB8A 2ZZJA 4OZXA 4RD7A 4YYOA 2VTFA 2BERA 5BNOB 5C5UA 4COWA 1B35A 5BNOA 1AVBA 3B9CA 4QKDA 5CKQA 4YSFA 3C7GA 4Y26A 2QUOA 4F8AA 2CYFA 1XC6A 3CZJA 5IHRA 2VAUA 4Q4Y3 2I07B 3AZVA 1OUXA 1W0PA 2VZRA 3WVJA 5FPBA 2ADDA 1C1LA 2NQYA 2QBXA 4NPLA 4XJ9A 3VBRA 5DG2A 1PVC1 1XNDA 3M3OA 4Z2AA 4MGTA 2VMEA 2VOKA 5J37A 1GZWA 1K45A 4AVBA 4QPYA 1RVF2 2VNVA 4JDOA 4MH0E 3I2DA 4QB1A 1EUTA 2Z79A 2W2IA 1OLME 3POEA 4DZGA 5FYIA 1NLQA 2VBBA 3O1PA 3GZAA 1IG0A 5I0DA 1WLCA 4R52A 1R081 1PO21 1WA6X 4UFIA 4B7EA 2Y0OA 4XHBA 2EVXA 5KC6A 4JHTA 3ZO0B 1W90A 3QH7A 4CZSA 5JIUA 2LS6A 4LR4A 1MVEA 2JIGA 3J7MA 5A7QA 4A7YA 1O3RA 1JZ7A 4WZFA 3T0DA 1QKQA 1IQAA 3VKNA 5DAQA 3ST7A 3KF5A 4C0BA 1AR71 3RZKA 1W8HA 1Y9MA 1VBD2 2BDRA 3V65A 3I2JA 4PIZA 4NE9A 4K7JA 1QJY1 4A7ZA 1TE1B 1CX1A 2BBAA 2G9ZA 2PHWA 2VR4A 1JZ8A 4YZ3A 1RUH1 1SPPB 4NHYA 5D21A 5A7NA 4AOCA 1HRV1 3AYCA 5FKBA 1A3KA 1AYM2 2ZGUA 2VVEA 3J8F3 3T09A 1QJX1 1NY71 1BMV1 1GNHA 2LW8A 3OGSA 4JTNA 1YI7A 5F5CA 5I0RA 1VRH3 4TTGA 1ND2B 3KWVA 2PHDA 1UU4A 3R4SA 3TNPB 4KQ7A 3AMNA 5LEJA 4UBGA 1RUE2 1SLCA 3MICA 3VKOA 4FPCA 4DXTA 3J7HA 3V0BB 1J3RA 3AXEA 4KG0A 4EN7B 4LT5A 4EZ4A 3V0BA 4XQ4A 1RTVA 3CF6E 3VD7A 3WD5A 4JGZA 1ENQA 3SNMA 4Q0QA 1Z7S3 2Y6LA 4QQLA 3UL2A 1SLLA 2IFRA 2OPKA 1W05A 1HXS1 1MR5A 3CJIA 4H7LA 5ACA2 3RFRA 1CGPA 1UW8A 1WMFA 1UY1A 2XG3A 1F35A 4I01A 4AVVA 3WQ7A 1GZTA 1LOEA 2QJVA 1AXZA 3GJBA 3GZUC 2VQTA 3WEZA 3WQBA 3S5AA 4Y20B 2WJSA 3ITQA 2ZXQA 3PJYA 5FZLA 1ZBE2 2XHKA 2JG8B 4Y20A 3T4HB 3WCRA 4BMEA 5A6XA 1AXKA 2JG8A 2WAOA 3W20A 1WWYA 4ES8A 1J58A 1SCSA 5EP9A 1DGRN 5F6KA 4RN5A 1DQ5A 3H7JA 4X6RB 1AR93 5LA2A 4JGYA 4I0WB 4M0HA 1UMIA 1X9TA 4MZUA 5IAVA 1HB3A 2W9XA 2VOVA 3AYEA 4XMAA 2Q8EA 1FNZA 1GWLA 1LOAA 2VZ1A 3PVNA 2HWC3 3E97A 3HT1A 3GNEA 3PLQA 1TNRA 4QQ2A 2EIDA 5CVRA 4MYEA 5GLVA 3TEZA 3KT4A 5EV7A 1ZZ9A 2R042 1AR61 5D8AC 2VCMA 4CDWC 1W9FA 1G6NA 3OPWA 4PF5A 5FP8A 2WA4A 2JE7A 1KITA 2QZ3A 3TN93 1OA4A 2GAUA 2XJRA 3NV2A 4PT6A 4W6YA 2VE1A 2X10A 3IIIA 1OFSA 4NWWA 5JWPA 2JG9C 3H3UA 4YVSB 5BNPA 4GH4B 3MIHA 3FUQA 5FP9A 2CSGA 1V6IA 2RR11 2JDMA 4LA2A 2ZEZA 5FY0A 4IE0A 4L9BA 4E4DX 4M01A 4ZZ8A 1W9TA 3GF6A 4XJUA 2VMFA 1ND3C 2WL1A 1QDOA 3KD4A 4FQ4A 2PHLA 3ZFEC 4CDXC 1W6OB 3Q8AA 3D0SA 1OURA 4LBQD 2XJSA 3ZR5A 1W6OA 4EQVA 3OEBA 2YBKA 2A5ZA 5FMCA 5LA9A 2TEPA 1DQ0A 1DHKB 3ZXLA 4BQ3A 1U12A 2DTYA 2Y6FA 3HN1A 2WNVB 1L7QA 1OOPA 5I93A 4AI8A 2WNVA 4YM0A 4YGEA 4EWDA 2K0GA 2BOIA 3VHOA 3W5NA 5FDBA 4I3GA 1COV1 1IKQA 3AP5A 4A42A 1NCQB 1QH7A 1JYWA 3MIEA 5ISLA 4MVTA 1NCQA 4Y5Z0 3B5LB 1DZTA 2KA3A 4XMIA 4BZ4A 3TWIA 4RL7A 2A1XA 4XF0A 1X9PA 3AP4A 3NMBA 3C3VA 4AW7A 2E63A 4WV8A 2CDOA 3L9JT 4FFFA 1LOFC 2XVLA 3VZMA 3ZXGA 1D7PM 2QZ2A 3AMQA 4X8NA 5FZBA 1BCXA 4EWAA 1XPWA 3VD9A 2RDQA 4I02A 3KV4A 3D8CA 2YUEA 1S0BA 2C4XA 3KCXA 5DXDA 2C24A 3KM5A 1EV13 4OCTA 2HWB2 3PJQA 3U75A 2GMMA 4LBNA 2HLEA 2Q5TA 1HRI1 1RUF1 5A3PA 1YIPA 3BTYA 4AVAA 3VL8A 4CP1A 3RSJA 4J1WA 1UPIA 1ALYA 1XYNA 3DXTA 3WT3A 3MPBA 1UQXA 2VH9A 4QX7A 4BQYA 5CKNA 4E8DA 1W06A 5A70A 2ORXA 2OX0A 1Y4WA 2DCZA 3UK9A 1Q8VA 4P9IA 5C3OA 5L36A 2Y26A 4XAAA 3OBTA 3WG3A 5FZ4A 1WLDA 1LB2A 3WHUA 1DGRA 4QB6A 2P4EA 4E2QA 4KBBA 4B1MA 1PVC2 1PM4A 2YDEA 1JOBA 4BK5A 1I5PA 3B7MA 1DP0A 5JDBA 1AYM3 4H55A 4IV3C 4ZXEA 3CIHA 2ARXA 3I3QA 1WW4A 3CBNA 5C7GA 4IE6A 3T2QA 4GJZA 1MVQA 1PK6C 2KM2A 2XH6A 3AKQA 3RYKA 1FATA 3HT2A 3LEGA 3T3YA 4UF0B 4NIDA 5F32A 1R082 1EYBA 2ZGMA 4NN0A 4KGGA 5GLZA 2G19A 3QBQA 4P14A 4BDVB 5FY8A 3TRSB 4EROA 2VMGA 3OSDA 2ID4A 3LA2A 2XMLA 3T2OA 1RUC1 4K8FA 1IKPA 3IN9A 4RS5A 2ZMLA 1KFUL 1QF3A 3NRUA 4QDRA 3MFAA 4Q0SA 4PF1A 4BU2A 3MV11 2YGMA 3KVAA 3VZKA 3W59A 1CIWA 1J3QA 5ACA3 3HMYA 5IT6A 1UF2C 4QMAA 4GMP0 4M4PA 4LHLA 2B9UA 4NRPA 5C3SA 1OT5A 5FPVA 1WGPA 5DAWA 5J96B 2E33A 2ET7A 1UKGA 4HLTA 1VB4A 4RA0A 2ZGPA 5FR3A 1GOFA 2VBPA 2VOTA 3VBHC 2DUQA 2XUMA 4XF1A 4XZPA 3N9NA 1HRV2 5DDJ3 1DF0A 4D94A 4Q4Y1 2ZHLA 3D5OA 3MUY1 2XBO3 4DUWA 1BVVA 4XBNA 3OF1A 5IJRA 5JPMB 2R0HA 3H50A 3Q8EA 5F3IA 3ZOIA 4P9XA 1RUNA 3OG2A 4AI1A 2WBKA 1ZM1A 4CCEA 2XDVA 2VO5A 3BPZA 3HAGA 4N53C 4N43A 5IVVA 5A6QA 2ZAAA 5KHIA 1OKQA 3PIGA 3MLKA 4XFIA 3IMMA 4QXKA 2R043 3OBAA 3WX5A 2WUHA 1W2OA 4FOVA 4BLJA 2WINB 5LATA 4LK7A 2A6VA 4OMCA 3RJRA 2IVIB 3KT7A 2HWE2 2E6VA 4ZU4A 1AYN2 1C57A 2VTXJ 3NSTA 1O91A 3ALQA 3W5MA 2P34A 4JVAA 1ZREA 3KGZA 4O65A 2CL2A 2VOXA 3N9OA 4XETA 4AZZA 3OY8A 2LTNA 5D8AB 5F37A 3WF3A 1Y43B 2YGLA 3AXDA 4CDWB 4QB2A 2ZX3A 3LWCA 2JDZA 2VXRA 4FFIA 4LO4B 4UFLA 4ASKA 4QXHA 3LDKA 2GH8A 3LOIA 4I09A 3TNQA 2JENA 5FZAA 5JSPA 1FT9A 3WDTA 5KHJA 2A3WA 2JG9B 2WT1A 4KBZA 3LDBA 2DUPA 3J8F1 3FHAA 3JB4C 2X05A 4ASMB 5JVVA 4ZS3A 3TAYA 2Q30A 1N3OA 2XONA 3OUJA 1VRH1 3QOPA 4NWVA 3A23A 5LBEA 1WMXA 4LO8A 2QQLA 4ISQA 1IPKA 1DYOA 3I3EA 4LHNA 2O0OA 4ATEA 1ND3B 3WV6A 3ZFEB 1ENRA 2JD9A 1RUJ1 3R05A 3IDEA 2IXCA 2BUKA 5EWSA 3SEPA 4UYBA 5AVPA 4NROA 1UY0A 3AL6A 2YPJA 3ZM8A 2WN3A 4LPLA 4Z1VA 3H8XA 1OMIA 3WG1A 3LSDA 3NAPB 4QX1A 3LSEA 3NAPA 1QU0A 4Q0UA 5JXJA 2HEVF 1W6QB 3ABZA 1CAVB 2A71A 3WW1A 1XJAA 3H8UA 1H8TC 1W6QA 1CAVA 3WDVA 3UETA 5KHKA 2GMEA 2BVBA 5LA0A 2XOMA 5KHHA 4DY3A 4KGQA 4XF9A 3NJYA 1SBDA 2WC2A 3H3LA 3KF3A 5T5JA 1XNCA 3AMHA 1R64A 1MZ5A 1PGL2 3U4SA 1MZEA 1BHGA 2DVBA 3MZHA 2HWB3 3WP6A 4YZ4A 3D82A 5FYHA 3ZLIA 4AEDA 2BYVE 2RG4A 3KSCA 1ULFA 1AR91 1UOBA 5CIRA 4C8DA 1UZVA 4IEPA 3TB0A 2ENRA 1ZA4A 2VJXA 2ZX2A 5A1FA 3MW2A 5HBAA 3NVCA 1SDWA 1QJU3 1ZBA2 1QOSA 1COV2 3UNPA 5FZ7A 3LEKA 4CDUA 4CCLA 4K9SA 2HWC1 3KCYA 4PBOA 5L19A 3GCWA 4XIOA 1W04A 2RJ2A 2Y60A 4CUCA 2QFEA 1CONA 5I8TA 4RGKA 2VZUA 1WW5A 1OUSA 4XC9A 4AXOA 4BIFA 5J09A 3D3AA 1OBNA 4DB5A 2VXJA 5FYMA 2NZ9A 3O1SA 2FDKA 2DTWA 5F39A 3TN91 4TWTA 4FQZA 1U5IA 4EN8B 2FD8A 3GBWA 1GQPA 1QQP3 4IEXA 3LZZA 3NV3A 3JZVA 1BK0A 1QIQA 1CZTA 1X50A 4DOUA 2WNOA 1J3PA 4URAA 3DPRB 1LHOA 1HB4A 3FBMA 1LOGA 2ZACA 3DPRA 2RM23 1HQLA 1D4M1 3WCSA 2HYXA 1BK1A 4XCBA 3AKRA 3HNMA 2DVDA 5K4LA 2NN8A 2WWSA 3I7DA 1YLLA 3O7OA 4IV3B 4JQRA 3MYXA 4AHYA 3N9PA 4IV3A 5JSOA 2H6CA 2QQIA 1V0AA 1PK6B 5FLHA 1FI2A 3VB9A 4NHXA 2VC9A 4PCRA 2JD4A 4QGMA 1OA2A 3N35A 4G3YC 5FWJA 4TSVA 3T2PA 4AHWA 5IVJA 1N1TA 4WVZA 4DNYA 5FY5A 3VV1A 4DINB 4DIQA 1OD3A 3O1TA 4BQ4A 4XUQA 4GULA 3OGVA 3ZYPA 3PUIA 4O7XA 5EJ3A 5DABA 5FYVA 3WF1A 2LRPA 4LA3A 3MIFA 2W94A 2W1QA 1W8ZA 2BGCA 1YO8A 4Q4W2 3I3MA 4D7YA 5K8SA 5FZ6A 3M4FA 3H7YA 2QKDA 1ULOA 3VBHB 2VUCA 3OB8A 4N7UA 4QXBA 1B35C 4MUVA 5BNOC 4I2OA 1EV11 3H1MA 4EN9B 4LBMA 4S2FA 5CG8A 1A34A 4JV4A 3RI8A 1QJEA 1DIWA 3MO4A 4AGGA 1RUC2 1W9YA 3FN9A 4J6GA 4KWUA 4YZ1A 2ARBA 2RS13 5FZ9A 5L7OA 3VHPA 4BCUA 5FREA 4HN0A 4IEZA 5HCAA 4LLFA 3AK0A 2GC3A 2IFWA 3EBRA 3LA3A 5GZEA 3VBRC 3EO6A 4AWDA 4N53B 3G7DA 4HL0A 1XNKA 5C33A 2OT7A 4N53A 4MG2A 2HWE3 2YXSA 1AYN3 1FOD3 5FZEA 2Q1MA 3I59A 2OUJA 3LDRA 5D1IA 3ZXAC 4QGNA 4GKXA 2AACA 3HN3A 4Z82A 2K2SA 1BQPA 4KWKA 5FYCA 4F3JA 3GGLA 5LRRA 5BUVA 4PI0A 3SH5A 3SKJE 3ON7A 4CEWA 1JYCA 5DN2A 1TEIA 2C5DA 1XSRA 2WWUA 1TME3 1VR3A 1M4WA 5DUXA 4LTAA 2B4KA 1AYM1 2CV6A 3WP4A 3ZYJB 2AEZA 2QQWA 3PTRB 1NYWA 3IPVB 1IHMA 4LKFA 3IPVA 3ZIWA 3LGRA 4B8EA 4E4SA 1C8M2 5FYSA 2UY9A 2WA3A 4D7SA 2IUWA 1XNAA 1UN1A 4OQ8A 1PMHX 3RZHA 1XRUA 1QXPA 2EF6A 4W50A 4XW3A 2CTVA 2CWSA 4Y4RA 1BJQA 4RQPA 3I49A 4K20A 4QPWA 5ACA1 4JKLA 4YG6A 3HNBM 1HLCA 2VPVA 1PZ7A 4AGRA 1AZDA 4H3WA 4XURA 2ZX4A 2PAMA 3ILNA 4PLMA 1WCSA 2IXHA 2VY0A 2VECA 1DQ2A 2V73A 2EICA 4NMIA 1ASJ2 2CDPA 3UKNA 1ZBE1 2FBEA 2ATFA 2CU5A 5LY2A 2XBO1 3PUSA 4JGZC 3U07A 4ZPIA 1H8TB 2O8QA 5DAPA 4Z8BA 1EPZA 3CJIC 3C7FA 2ZBJA 1UYXA 3H1YA 4AQTA 1QJZA 3T1MA 1YFXA 1ZBA3 3PHMA 3WW3A 4QU1A 3QD6A 2DV9A 4Q26A 2ARCA 1XU1A 2KXLA 4FPHA 4NVPA 5LZ6A 1Z7S2 2X29A 2R041 5DZFA 2PAKA 2JG8C 3MW3A 3B94A 4UW4A 3FLTA 1SEFA 3PVEA 2A73B 4CCNA 3WNXA 1AR83 4JGYC 4PLNA 2OIIA 1KQRA 2F4LA 5EQUA 3H9AA 2A75A 3BGAA 4ZONA 3GXUA 3SH4A 3POBA 4V2WA 2C0ZA 4O61A 4XZUG 1SLBA 1BXHA 5FP3A 3MLJA 1O3TA 2A7AA 1YRZA 5EJ1B 4P5YA 5H9RA 1QOOA 3GHNA 2C9KA 3ZFGA 4AE2A 5KXCA 1Y3TA 1AR92 2XL9A 3K2OA 1NUKA 2GSYA 1W3XA 3GZEA 1OF3A 1OVSA 2A3YA 2C6SA 4FT8A 5FJHA 3B3QE 5CB7A 3W21A 1U0AA 4PQ9A 1H2KA 4P02B 1GUIA 2HWC2 3CKHA 2WT2A 3HQXA 2YBSA 4KI5M 4N9HA 5BNPC 3ZYFA 4WVMB 3PU3A 1Q43A 3PURA 1RMU3 3NW4A 2W1WA 4WVMA 5FBZA 1LRHA 3UYJA 3V56A 3VBSB 2ZEXA 4M4RA 3VBSA 1HDKA 2ZGTA 1A78A 4XQWA 1WBLA 1K42A 2BTVC 4EV0A 1CVNA 2VQUA 4LUMA 1HN0A 2JKBA 3KHCA 4YZ5A 2IXKA 2RS52 4IETA 3THPA 1US3A 1FV2A 1C5HA 2HWD3 1K12A 1PMIA 2R32A 2Y64A 4FO9A 3RWNA 2Y6KA 3DKWA 4SBVA 3UV9A 3AZZA 1OQDA 2ORZA 3KCCA 1UO9A 4XQDA 2ZGKA 1OOPC 5FY7A 4Q4W3 3GBGA 3RYRA 4QQHA 3VL9A 1HJFA 5FXWA 5JOXA 3AMPA 1DLCA 1OHFA 5CFDC 2HWB1 3S6PA 1UX6A 4FTEA 1WCKA 5GLUA 1WLWA 1H1MA 5CEHA 5EPAA 2JICA 4BB3A 4DFSA 2QDRA 4YW4A 2AGSA 3M1HA 5CAZA 1GQGA 3FLRA 2D43A 5FPXA 3K3NA 3B00A 2UY8A 1B35B 1JW6A 1LHUA 1VRBA 2WO1A 4D0QA 4HK8A 5A6YA 4QPIC 3GZTB 2VZTA 1ZVFA 3O14A 4K8RB 4CVUA 1IPSA 4YW5A 3RDIA 2WIIB 3ACGA 1V6JA 2TNFA 2JDHA 1UX7A 4G4FA 1GU3A 3VBRB 3WNKA 2DUOA 3U1XA 2WYFA 3FHIB 5F7UA 3WQ1A 3VKMA 2XKOA 1JU4A 4DEVA 2PFWA 1GZWB 2FCUA 5FP7A 4ZKTB 1JBCA 1JYVA 1S1AA 2NM1A 1W2AX 1W0OA 2R062 1EV12 1G9FA 3A21A 1SMVA 2R7EB 3PUAA 4QM8A 4XJWA 4CXYA 1PX3A 1C8NA 3ZMOA 4TZDA 1KD7A 2XJUA 3BTAA 4K3UA 3HPNA 3RZJA 4OUSA 3UJOA 3ZSKA 5A3UA 1C8M3 3AVSA 1Q3EA 4FP3A 2ZHMA 1QHDA 4ITCA 2SLIA 1AX2A 1SACA 3N7KA 2YROA 5FPLA 5FV3A 4BM8A 4DXRA 1GYKA 2VMIA 1GWKA 1H4GA 1QNYA 1Z0HA 1WMEA 2J1RA 4A4AA 2A3XA 2O14A 5C8CB 1XXNA 5C8CA 1OPOA 5BPXA 5CG9A 3NV4A 5GLTA 2FDJA 2QQKA 1W2NA 5JXIA 1QY4A 4WM7C 1ZZ7A 4FAGA 1HW5A 5CNAA 3VZJA 2FZ1A 1JZ3A 3KVBA 1QXRA 1UOFA 1F4HA 3I4IA 2WWJA 1RITA 2ZGLA 2YC2A 4EJRA 5FPZA 1ASJ3 2XL7A 3FX3A 3VZNA 4YW3A 4E8CA 2PTMA 3ZXKA 1SDDB 4LOTA 3WW4A 2EXIA 1UKRA 2ES3A 4RS5C 3IBMA 2XJVA 1MS9A 4FFGA 1GP5A 3TOJA 1OLRA 1PGW2 2LROA 2BQPA 1GWMA 4GJYA 2MHFA 3AKPA 4ZU5A 4LBQA 1UWWA 3B69A 4HK9A 4Y1VA 4JGZB 4RGGA 5C3RA 3M2MA 1IS3A 2V09A 3I2GA 3PVBB 1E5HA 5ABJA 1FPN3 2EIEA 1MS8A 3POWA 4HKWA 2WKKA 4IQPA 4AGVA 3CJIB 2J42A 3LPGA 1V70A 4B4RA 2XPJA 1PMJX 1N47A 1LU1A 2RMU2 5IK8A 2HWE1 1NZCA 2C26A 2PXJA 1AYN1 1FOD1 3AL5A 4MXWA 4Q27A 5JR7B 1NA1C 3M8LA 4IGPA 4RR3A 1DZRA 4M00A 4B4PA 3ASIA 1ZRDA 3WR0A 4N43C 3ELNA 2WFF2 5DDJ2 3PNAA 5LB6A 4FXKB 3WP5A 2VUDA 3MIGA 4TYSA 2XBO2 4OQ9A 4CP0A 5IVBA 1WUVA 3FC0A 3VHRA 1ZZBA 4JGYB 5T55A 1V9U2 1TME1 4XUNA 4K1YA 4BPZA 5T54A 4Q8KA 3GM8A 3LKJA 1NCRC 3SISA 3N7MA 5A3LA 3FFZA 2J1EA 4MHUA 2CHHA 3K3OA 2VVDA 4ISRA 1XE7A 4PDWC 4GKYA 2FDGA 2UYBA 1T6GC 5FY1A 4F83A 1H30A 2CWMA 1IOAA 3USSA 2BU9A 2FCTA 4YG0A 4AFAA 4CUGA 2QTWB 2O1QA 3DL3A 4WM8A 5H9SA 4EE2A 1VAVA 5FPUA 1ZX5A 4BQ5A 5FLIA 1DG6A 1MEC2 4MXVA 2JDNA 4XEZA 3LF7A 1WCDJ 2RS53 5FY9A 4EYUA 3A22A 4XFHA 5GM0A 3FHQA 3IDAA 5BNPB 1H6YA 2BV4A 2HBTA 5EYYA 4E9KA 1NZIA 5FZ1A 2N7GA 4CRQA 5A33A 3ZVXA 4LLOA 4FPEA 1J1TA 4B29A 1CIYA 1UL9A 3AVRA 3O5SA 3MFCA 3LAGA 3P5BA 4QXCA 1GBGA 2XJTA 2W08A 3TYJA 2J1VA 4BISA 2P6CA 3KLSA 1CPNA 2O8OA 3K4AA 4YFWA 4AI3A 3ETQA 1ZZ8A 1AXYA 1HN1A 3BTZA 3PL0A 4BWOA 5GALA 1UMZA 3SQOA 1PGL1 4YFZA 4YM2A 3POSA 1RXFA 2CGPA 1Q8OA 2YC0A 3VN4A 3ZYRA 2EXJA 4CSWA 4CXXA 3V64A 1OOPB 2D44A 4ET7A 3DN7A 3NAPC 1AL0G 1YQCA 3AFGA 1ZBA1 5FY4A 3Q8FA 4IUGA 2E26A 4L99A 5CFDB 3UGFA 3FE5A 2QE3A 1UOJA 3RZGA 5CFDA 3NNGA 5EIYB 3BIWE 1S0IA 2YHJA 4W6WA 1EUUA 3DCQA 3F2ZA 4IW3A 3C7HA 4QU2A 1PO13 2PYTA 2VG9A 2ZGNA 4AEDC 4CCOA 5AC93 5IVCA 2ZCWA 4HBNA 3WUDA 2WT0A 3FLPA 1AR81 3WF0A 2H6BA 4YVWA 2K9ZA 4XIKA 3T0AA 3RZLA 4QPIB 2A6WA 3QH6A 1W2TA 1MS0A 5FMDA 2VMDA 2R1DA 3FJSA 4QPIA 4CDUC 1V6OA 2R063 4R9BA 3O0XA 4YPJA 2VCAA 3LFIA 2YY1A 1YIFA 2ET1A 1W8OA 3JBG2 5DUVA 3H8OA 3R4DB 1CAXB 2Z2SB 1QJU2 1CAXA 2R6QA 5JMOA 3P6BA 2EXHA 3GDBA 4Q2FA 4LNVA 4FTBA 1UAIA 2Z42A 5CZKA 4LQRA 2ZGQA 1PIV2 1Q8SA 4JCKA 3VZLA 1YI9A 4ES9A 4C91A 5T50A 1RUI3 2XQXA 2RDRA 4I30A 3RWKX 5CBLA 3JD72 4P9LA 1GMMA 3CZUA 2RDNA 1UCXA 3DPRC 1S0EA 2AR6A 1SBFA 1BKZA 2WS93 4NIGA 4OVEA 4XVHA 1CAUA 1PZ8A 4B1LA 5G04L 4BQXA 4C0HA 1S2KA 1LOBA 4GAZA 2JB4A 4JTOA 1QQP2 5FXXA 2HWD1 3I54A 5A3WA 3RI9A 4CUAA 4Y1YA 3ILFA 3LD8A 3RZMA 2ZKNA 5JXGA 1I1EA 4S2DA 4SLIA 2R073 2GZWA 1KXGA 1LHNA 2ZEWA 4WM7B 1ULDA 4Y5SA 2I2SA 4WM7A 2XLGA 4BYYA 4Q4W1 2RM22 1GANA 3DEMA 1H1IA 1ULCA 1W03A 3NJZA 3ACFA 4I0BA 4BJ0A 5A7WA 2ZX0A 2DVGA 5C6CA 5FZHA 2E32A 1YCIA 4OYUA 1ZYBA 1VAMA 1YXWA 1W8WA 4RS5B 2ILMA 2W52A 3I3DA 1OVPA 1F31A 1RHI3 3T30A 1LU2A 1W2UA 4TLFA 5DUWA 4D69A 2FMDA 3AJZA 3SXWA 5E8AA 1W8UA 3O0VA 4R9CA 2RMU3 4CYDA 2VQ0A 4ZXKA 3FMGA 5LW9A 3OD4A 4EWEA 4RFT0 5F8PA 3K4ZA 2WFF3 4U2AA 1IS6A 1DZQA 3IM0A 2D6OX 1REDA 3LEIA 4JHZA 4BHPA 4AEMA 5FOBB 2V5DA 1ZRFA 3S7EA 5BY5A 5L7OC 3M70A 1W28A 3CMGA 1MS1A 1V9U3 2GH2A 2XGXA 1NA1B 1D2QA 4HANA 1VP6A 3WDYA 1NA1A 4N43B 3SITA 3HBZA 4NIHA 1DCSA 3ZXDA 1W6MA 2OZJA 1WW7A 3OYWB 5CISA 3OYWA 3ZDVA 2YG0A 4D3WA 1LULA 2ERFA 2W0XA 4QKBA 1YC61 1OQEA 1S4CA 1D0HA 3OOXA 1UPSA 2RS12 3THDA 2ARAA 4H2AA 4HETA 1C8M1 1OKOA 4UI9L 1NCRB 2UWAA 4R8HA 5FZIA 1KJLA 3IKWA 4CEWC 1NCRA 3WG4A 1RYYA 3IAPA 1MEC3 3J4UH 4LE3A 3S30A 3DKQA 4PHZA 4PDWB 4CP2A 2B46X 1GKBA 3PTYA 1FOD2 2BOJA 4PDWA 2BRTA 3MF6A 5G05L 1LGNA 1NOVA 1S0CA 1TNFA 3OY8B 4WBBA 5FMBA 2Q8DA 1LKNA 2W3JA 5GZFA 4HSLA 1GSLA 1H4HA 1RUD3 1X8EA 1ZZ6A 2W46A 4UW3A 4XFCA 3ZSJA 1JZ2A 2D98A 2W95A 4R9AA 1TME2 4YGDA 2K46A 1U5ZA 2QVSB 3HQRA 2D40A 3POIA 4Q0PA 3G6JB 1ASJ1 4I3PA 5CU1A 1GP4A 3ACLA 1WKYA 3BTXA 4MHRA 2YYOA 2EAKA 3C7OA 5LBCA 4GWNA 2VW2A 2JXAA 2MNGA 3CQOA 1F5FA 4RQPC 5GJ6A 3FUOA 5FZGA 5FO8B 1VBE2 1TVGA 1YQ6A 5A7PA 5F5IA 5FQ0B 5I0UA 3U4XA 3I3BA 5HXMA 3D4KA 1F8VA 5FQ0A 3KV9A 1BYHA 4H14A 3NL1A 4W65A 4YW7A 4GD4A 3T08A 2W1SA 4AVTA 1FPN1 4KMQA 4URTA 1Z7S1 1W8NA 4XDOA 1IZ3A 4OI4A 4NPMA 2A6YA 2J1TA 2WFPA 3LPFA 3VD3A 3HEIA 3SMHA 1VBA3 4PI2A 4C90A 3JXSA 3SEEA 2FCVA 3E6DA 4HMZA 2OPWA 2MPFA 2BNNA 3HD8B 5DZEA 3CHXA 3FZ3A 1V6MA 2NMOA 4QQOA 3RMYA 1XYOA 4QKNA 4Q4V2 2CY6A 3FFQA 1WBFA 2VCCA 4FVVA 5ERLA 1DDLA 4AEDB 5CYYA 4DXSA 1RUG3 1HB2A 1VE0A 1G7YA 3AZYA 4E4ZA 3CNAA 3JBG3 1X33A 2WRAA 3RYPA 1ODNA 3WDWA 4CDUB 3VDDA 1V00A 2EALA 5L9BA 4XE9A 2BGOA 4L0PA 1AX1A 4BH9A 3OGRA 1C28A 3KT1A 4W4ZA 1PIV3 3WUCA 1JUIA 2OXBA 1DQ4A 4HFSA 4UXAA 4DS0A 3HNYM 3N7LA 2A6XA 2DU1A 1R092 3JD73 4QX0A 3UKTA 3ZFFB 3ZFGC 1TMF3 3BUCA 3ZFFA 2PMWB 1US2A 1UU6A 1AR82 4MGYE 3BODA 4KWJA 5FXZA 5FZ8A 1JTZX 1DLLA 4QGLA 2RS51 2VBDA 5GZGA 5HPOA 2JIJA 4HPKB 5KXDA 3DYOA 3MIDA 1HKDA 4HPKA 3WINE 1JZ5A 2JDYA 5T5PA 1JZ4A 2P3JA 1C1FA 2B7YA 5JI7A 1BBT2 2Y38A 1DGWX 2VD7A 1D4VB 2DCJA 3E5XA 1PGSA 2X53S 4P9GA 4AEKA 5A6ZA 3VBSC 3MIBA 4BK4A 5JSRA 3LOBA 4UFHA 1QEXA 3A0NA 4XDPA 3VBFA 2VZPA 4XTPA 2XKPA 2JDUA 1ENSA 1YFYA 1RMU2 2CNAA 4HKLA 3KV5A 3VKFC 1CZSA 1JHNA 3THTA 2V4VA 1YQ5A 3VBOC 3DECA 4AI9A 2MEV3 3W58A 1GZ9A 1Q8QA 1LNSA 4NRMA 5FTTC 4NRQA 3LA7A 3AJYA 4BQ2A 3WF4A 5T5LA 1LECA 2HWD2 4NHLA 5K0UB 5LBFA 2JWPA 5K0UA 5IAXA 4AI0A 1GV9A 4GB32 5F2SA 5IW0A 2FHRA 3NJXA 1GNZA 4Q29A 3TEXA 4DY5A 2E7QA 1VJ2A 4OHZA 2Z5WA 4P9YA 5M0TA 2R0FA 1WW6A 4LHKA 4XACA 4QD2A 5LCWL 2C1FA 4Z07A 4KWLA 1AR73 3RVHA 4BMBA 2DWRA 2HWF2 1RL3A 2R061 3NKGA 4YG3A 5JOYA 4Q0VA 5EXOA 1WMDA 2H0BA 1LGBA 3ZIXA 2HYKA 3H42B 3MBWA 1NXMA 4HG6B 4LKEA 5FZKA 5KHGA 1LR5A 4CCDA 5L7OB 5LWBA 1JOPA 1R1A3 4DUXA 1G8WA 2CGOA 2ZTNA 3L2YA 4IE5A 1PHMA 1PX4A 2AEYA 2R49A 5F2WA 4CPBD 5A1LA 3AP6A 1EAH3 4Y1XA 2BBVA 4AQ2A 3HBKA 2G4IA 3QCWA 1SBEA 5JOWA 1CWPA 5H9QA 2GNMA 3I59B 4AEJA 2FMYA 1O7FA 1XNTA 3GALA 2D5FA 3N9LA 4PQQA 1RUI1 5LASA 3OEAA 5HCBA 5JIAA 1VPHA 1W8FA 4QX2A 3ZN5A 1NLRA 5SV5A 2PN5A 2ZMKA 1CR7A 1UY4A 2WS91 3CL1A 4CEWB 2BP6A 2VW1A 4XFBA 4N7IA 2OKXA 5IFTA 3ZN4A 1ULEA 1OF4A 4AFDA 4META 5JUVA 1HXS3 2WO2A 3BALA 2PAEA 1PZ9A 2ZKLA 2R071 4Q4X3 3WNNA 2JKXA 3AMMA 4J25A 5C8CC 2FQPA 4HVOA 5B4XA 5KC5A 2PA7A 5JI9A 3KGLA 1Z78A 2DVAA 1VBE3 1PGW1 2ZMNA 3M3QA 5H9PA 2Q0AA 1BLZA 1X8MA 4BQWA 1FMD3 2D6NA 4AG4A 1POV3 1POV0 1RUOA 1MPXA 3K51A 1I9RA 1W0NA 4XJ8A 2R30A 2DBNA 5EHDA 1UZYA 2PLV2 4GIQA 3RPQA 1JOJA 4RQPB 1N1YA 1LJ7A 4XAEA 1FX5A 4DEQA 1F5JA 2RV9A 4ORFA 3WLUA 2BNMA 4IGOA 4K1ZA 1AX0A 2RMU1 2YFZA 4QQPA 2TBVA 4NPRA 5E16A 3UKVA 1BEV3 3B93A 3WNMA 2BWAA 2QQUA 4CDQA 5A32B 3OUIA 4HVRA 5A3MA 2WFF1 5CKMA 1ST8A 4Q4V3 5FYZA 2G1MA 5DDJ1 3AFKA 5A32A 4D6QA 2A6ZA 1O5LA 5FK8A 5ABJC 4JX0A 1WD3A 1HV0A 2B8MA 4HONA 4MLOA 2YC4A 1A8MA 4FPFA 1V9U1 2WN2A 5GKAC 1VB2A 2OS2A 1B09A 1ZRRA 1S0JA 2Y0IA 2GP3A 4XF3A 2RR13 4AK3A 2VW0A 3SKVA 4P08A 1URXA 1VBC2 3A0KA 4RR3C 1UOGA 2VNGA 5A3NA 4KNCA 1SCRA 1D0GA 1FPN2 2RS32 2WDBA 4DRRA 3E6BA 4LO5B 1OA3A 3X29B 5LRSA 1YQ8A 3FL7A 1IS4A 1E57A 1E5IA 1R093 4DXZA 3O1MA 1MEC1 1EP0A 5LEKA 3ZYGA 2B39A 4XTMA 4Y3OA 5I0TA 2UURA 3IWZA 2Y33A 5J7MA 1W3VA 2XR4A 3K77A 4XYXA 1G9DA 3NNJA 2ZGSA 1G9CA 5L9VA 2GC1A 1VMJA 3ZFGB 1RUD1 3ZSLA 1S0FA 4CA9A 1DYPA 1BBT3 2OW4A 1JODA 4UW5A 4JC1A 1RXGA 1PNFA 2VGDA 3J7LA 1Y9QA 2ZJCA 4WM8C 2Q8CA 1JU3A 1UYZA 5BNNB 1I5ZA 2JJ6A 4COUA 1H0BA 3BCWA 2VZ3A 2WLPA 5BNNA 2SBAA 3M7AA 4KH9A 3UT0A 1U5XA 4P9JA 3NNFA 4P00B 2KD7A 1HB1A 3MGUA 2AREA 2RJLA 4YW2A 1LOCA 4RGAA 1UZ0A 3PMSA 1FV3A 2ETEA 2DYCA 3ZPYA 3HVDA 4LULA 1H9WA 3LIGA 2WQ4A 1WCQA 2GU9A 4MGZE 3EMRA 3H1WA 5L9RA 5JR2A 1Q56A 3MHZA 4FFHA 5IWFA 4AVSA 1WLTA 3VHNA 4QKFA 1JYIA 1RUF3 1WA4A 3IT8A 1LEMA 4TN7A 5FZ0A 3APBA 2J22A 1VBA1 2I74A 4XCAA 4GB33 3POGA 1NT0A 1CESA 4IV1B 1JMUB 3U0ZA 4GWMA 2WZR3 4IV1A 3VBOB 4BXFA 1W6PB 2VTXA 2DVFA 3J9SA 3PMEA 3VBOA 3MV01 1W6PA 3D6EA 1GP6A 1Y7BA 3LFMA 2VOWA 3M3EA 1ZZCA 3ES4A 5T5OA 4NIIA 1O8SA 4ARXA 1XU2A 2DCKA 2YZ4A 1RIRA 1UZZA 1VMHA 1C3HA 2HWF3 1KS4A 4LE4A 1GLHA 2D3RA 1F15A 1RUG1 3KMHA 2NLRA 2BPA2 4R4ZA 4NJ4A 2WZ8A 3I8TA 3U78A 2Z69A 3JBG1 1JHJA 2F4PA 3M3IA 4IEVA 5C3PA 2E51A 2AUYA 4MADA 1AJKA 4NO4A 3I2HA 3RRDA 1QJU1 3AZWA 1LHVA 4YVWC 3GBFA 4X6QB 3H8RA 4V2VA 4Y1UA 2V72A 3POYA 3VKLA 4XBLA 2VNOA 3OGGA 2E7AA 1O4ZA 5FZMA 1PIV1 5C9AA 3ES1A 3DUIA 1T6BX 3USUA 1CQ9A 3IDCB 3OD0A 3AP9A 5BNQA 1PO12 3H3ZA 2R16A 1VBB2 3JD71 1O6UA 1SFNA 2OUHA 5AC92 2GN7A 3N4MA 4LIVA 1MS3A 3KQRA 2P6HA 1VALA 4OUEA 5F9TA 4O9GA 1QQP1 3IZOA 4MGKE 4W8JA 4CP9A 2GNBA 3K46A 4M3CA 1YUDA 1SFYA 3VD4A 1FYUA 5FRAA 4O9EA 2JDPA 3RJ2X 3VDBA 3RZZA 5C4WC 4WZCA 5AVAA 2RM21 3VZOA 2UWCA 2XJPA 1CJDA 3AYDA 3AB0A 2BNOA 2CGNA 2AC1A 3OBZA 3PUHA 4CEYB 5JAXA 1K3IA 4JZRA 2XJQA 4XXAA 4E4HA 3BVCA 5A80A 4CEYA 1PVXA 3E1F1 3VBUC 1ULPA 4AAXA 1IQDC 5FZ3A 1OH3A 3HWJA 3BYWA 2PLV3 1SFPA 4XUOA 1OFNA 3EHKA 4OULA 4C1WA 1N1VA 4OUMA 1UXXX 1RUI2 2WQZC 2RE9A 3ACHA 1RJ7A 4A45A 5JOZA 3ZMNA 4F7ZA 3VLBB 5ANNA 1GNYA 1UXZA 3ZXJA 2WS92 2MEV1 5DMYA 2IWGB 5FZFA 5LK5A 2EIBA 1O3QA 1YJKA 1LGCA 2GMPA 2WR9A 2XLFA 4IGQA 4P9WA 4W6XA 1YEWA 2EIGA 4FOYA 4N8MA 3OPTA 4RHV2 3JB8A 3ZPOA 5FUNA 1W6NB 3ZN6B 3Q8BA 4FPOB 3BI3A 2R072 1W6NA 3ZN6A 5CA6A 2WQ8A 4FI9A 3RS6A 2QCSB 3O1VA 3T2TA 2WLQA 4JRAA 3W9AA 2Y6JA 1QJFA 4H7MA 3N7JA 2DFCA 4LBQB 5B2GB 1JS9A 4YRDA 2VULA 5DZGA 3NV1A 1VBC3 1L7RA 3ZXEA 5ABJB 4QM9A 4XJAA 1RHI2 1YFWA 2RS33 1R1A1 1JYXA 2RS11 3OUHA 1F9KA 2PHFA 4BA6A 1SPPA 2WNEA 4ONUA 4AQSA 2JX9A 2RVAA 1EAH1 1V6NA 4GZ9A 3SCHA 3WY6A 4Z92B 4MXWB 2P5BA 3U10A 1LENA 2GALA 2VZQA 3EJKA 1ZNPA 4RR3B 1ND2A 4YWAA 2XQRA 5EYXA 3RNSA 4MSVA 4AYUA 1RUJ3 2VMHA 2EAAA 1ONAA 4HXCA 4Y33A 4OFGA 3WQ0A 3T4VA 3P3NA 3RGBA 4FAHA 5C71A 1KDKA 1XB9A 4IEQA 5HV4A 3VDCA 2D3PA 2YU2A 2YBPA 2OQ6A 4Q1RA 1DFQA 4UT5A 4KU7A 4XFAA 2D6MA 3I2FA 2VQAA 5A7OA 3POFA 4GALA 3KZ4C 4QX3A 4Q4X1 5C3QA 3PUQA 4A2UA 4KG8A 4OHVA 3T0BA 4N9IA 2WZPP 1HV1A 2XVGA 5JCTA 1VBE1 2IVJA 4OI2A 4WM8B 3CDZB 2ZHNA 4ZS2A 4QWNA 1NX9A 1FMD1 3C2UA 4NOTA 2PQQA 3RQ0A 1POV1 4LMFA 4L97A 1KJRA 3HOBA 3A7QA 4CUBA 3AM2A 2RHPA 2X5IB 3A4UA 1N3PA 3AP7A 2X5IA 3ZKUA 1DBNA 5CFCC 5E1RA 3GHMA 2FDFA 5A33B 4NIAA 2E9QA 2W1UA 4AL9A 5FMOL 1Y9GA 3ENRA 1RUD2 3S0MA 1AL23 3U11A 3BPSA 3MDPA 3ATGA 1BEV1 4XDQA 5FO7B 3SLIA 2W39A 4GQ7A 3NNLA 1KDMA 4Q4V1 4PBPA 1NQJA 1JUHA 2QDNA 4UAPA 1J84A 1SLIA 1C4RA 3WG2A 3GJAA 1JH5A 3J26N 3R0RA 3I2KA 4IEYA 1RINA 4Q8LA 4AI2A 4JAAA 1TZOA 1ZA7A 1OC1A 2TUNA 2WO7A 1QXJA 2PHRA 5IK5A 4NHMA 3ZYIB 2W91A 3DF0A 4YW1A 3NO8A 4YVSA 1SZBA 3I97A 3CO2A 2WZEA 2VVFA 3MUZ1 3ORJA 4GH4A 4V1PA 5GZDA 3KQ4B 2Y6HA 4BQ1A 4XFFA 3DYPA 3ZX7A 1YWKA 1D4M3 4OHWA 1FXZA 4HZFA 1ACCA 2Q8OA 1VBA2 2NPIA 5JPNB 1R091 2DDUA 1VBB3 2XUEA 1XBFA 2EA7A 4UOJA 4OMDA 5FYUA 1ZRCA 4GXLA 1MQTB 1IGOA 4YVWB 2WSVA 1P8JA 1MQTA 4JDMA 1H8VA 2QQOA 2JE8A 5FLJA 2HH9A 2YB7A 5HCHA 2UYAA 4IERA 3VDDC 3OBRA 2NP0A 2YPDA 4YLZA 5IVFA 1QOTA 2FDIA 5KBFA 4RSUA 4YNIA 1CPMA 2D6LX 1RUG2 1BBT1 5HXVA 1DQ1A 1DGLA 1WZXA 3Q8CA 1A8DA 2P37A 3KHBA 3WSOA 3PDQA 1LAJA 3ZFFC 3VGIA 3WF2A 1QDCA 5J36A 1SG3A 4FPLA 5EJZB 2D97A 3O1OA 1J1LA 2J7MA 2DURA 1O59A 4EZHA 4A41A 1LCLA 4QHZA 3JQXA 2J1SA 2QQVA 2W87A 5C4WB 5IK7A 4FPJA 5FXVA 5C4WA 4EN6B 1RMU1 3BIEA 3EXUA 5A1AA 1W9SA 4OLLA 4CU8A 4J1XA 1OLQA 2GNTA 4I0AA 1CAUB 1TMF2 4ATFA 1CAWB 3IB3A 5IK4A 1RVF3 3VBUB 3BU7A 1OH4A 3UESA 1CAWA 4A7KA 4L2NA 4XBQA 5JZGC 1CZVA 3VBUA 2WYSA 1NG0A 1UU5A 5HV0A 4AFBA 4BXSV 3PIJA 5SV8A 4QDQA 1J83A 3SC7X 4GB31 4RHV3 3VBFC 4BLIA 3K4DA 1F4AA 4G9SB 3AX4A 3WHTA 2WZR1 4D8MA 3E6CC 3WDXA 2B5HA 3HIFA 5FJKA 1DYKA 1AF9A 3JU9A 1YNAA 1E5SA 5A7WB 1HQNA 2ZEYA 3AKTA 2XXZA 5L73A 3C7EA 2KR2A 1YQ2A 3NJVA 1SQ4A 2Q1FA 3LIHA 2ZABA 5FYBA 2HWF1 1UYYA 1OLMA 1VBD3 1IS5A 3N9QA 3FWEA 3ZR6A 2IXIA 2J1UA 1W39A 1RGSA 4Q5OA 4XUPA 4Y24A 3D0JA 5K0UC 3WNPA 2E31A 3SH3A 5FYYA 4COVA 2NMNA 4INDA 2Y34A 2F17A 1ULGA 4LEJA 3BB6A 4K21A 2MEV2 4XXPA 3NQHA 1X82A 5TSWA 4OI0A 4R4XA 2B42B 4UFKA 1SLTA 4R9DA 1PM7A 4FTSA 4ASLA 2DBIA 1RUE3 1PO22 4UF0A 2JDAA 3E5QA 4LJHA 1V6KA 3URFA 1GFF2 3PU8A 4L8QA 3WOGA 2GNDA 2L9LA 2DCTA 3F95A 2B45X 4IE7A 4X8PA 1IPJA 2QNKA 3KB5A 4YW6A 3PVOA 1AR72 5FMOS 1W6MB 4YGBA 4GMP3 4CCMA 5FIXA 4HSJA 1CN1A 1LODA 5JXHA 4LHSA 4YZ2A 1QJY2 2DU0A 1HX6A 4XOGA 4IEWA 4QAWA 5GLWA 5J98B 1H2MA 4OI1A 1R1A2 4BOWA 5T3NA 1RUH2 4P5HA 1XYPA 3BU0A 1ZBE3 1S0DA 1X36A 1EAH2 4FPKA 4HT1T 1QMJA 4WVWA 1WD4A 1QJX2 1NY72 2G9GA 5F6LB 2Y6GA 1BMV2 3IMNA 3P1IA 2PLV1 5APAA 5LA1A 2H0VA 4QHOA 1GQHA 2V5YA 4A6SA 4MOAA 1AUYA 2R1BA 4IEOA 1UZWA 5A3OA 3OTFA 1GICA 1K5MC 5F5AA 3EQEA 2P2KA 4GA9A 4AHXA 1V6LA 3OPZA 5I8YA 2P3YA 5F3CA 4MGQA 5DG1A 4LBLA 4BIOA 3VUOA 5CFCB 3QACA 4QPGC 2ZPXA 3ROUA 2CAUA 1HXS2 1OXCA 5CFCA 3R4UA 3MLLA 4PLOA 1FAYA 1MS5A 1GOGA 4L11A 4Q4X2 4Q1PA 3C8XA 5HI0A 1DQ6A 4OHYA 4TXWA 3OCPA 3K48A 4Y22B 4Y4YA 1H1AA 2BEOA 1OPMA 1H2LA 4Y22A 1W99A 1XE8A 1JI6A 2HBUA
chains in the Genus database with same CATH topology
5A6YA 1OVSA 1UZVA 2JDYA 5A3OA 5A6XA 4CE8A 5HCHA 2JDNA 1OVPA 2WRAA 1OUXA 5A6QA 2VUDA 2BOIA 2JDHA 5A6ZA 2JDKA 3ZDVA 5D2AA 2BV4A 1W8HA 2JDMA 4UT5A 1OUSA 1OXCA 2CHHA 2XR4A 1W8FA 3DCQA 2VNVA 1UQXA 2JDUA 2VUCA 2BP6A 2JDPA 4AOCA 2WR9A 5A70A 2BOJA 1OURA 1GZTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A6Y A;  1OVS A;  1UZV A;  2JDY A;  5A3O A;  5A6X A;  4CE8 A;  5HCH A;  2JDN A;  1OVP A;  2WRA A;  1OUX A;  5A6Q A;  2VUD A;  2BOI A;  2JDH A;  5A6Z A;  2JDK A;  3ZDV A;  5D2A A;  2BV4 A;  1W8H A;  2JDM A;  4UT5 A;  1OUS A;  1OXC A;  2CHH A;  2XR4 A;  1W8F A;  3DCQ A;  2VNV A;  1UQX A;  2JDU A;  2VUC A;  2BP6 A;  2JDP A;  4AOC A;  2WR9 A;  5A70 A;  2BOJ A;  1OUR A;  1GZT A; 
#chains in the Genus database with same CATH topology
 1ZRI A;  4IES A;  5D8A A;  1FMD 2;  1GZC A;  1YFU A;  1OD5 A;  4CDW A;  2XWJ B;  3TEW A;  1EY2 A;  1VBC 1;  2GC2 A;  1BZW A;  2UU8 A;  4CDQ C;  5LY1 A;  4UW6 A;  5E88 A;  4OZO A;  3J7N A;  3ZDS A;  1LES A;  2D7F A;  1OSG A;  2RS3 1;  1GOH A;  5FUI A;  4A44 A;  2JEM A;  5FO9 B;  4JDN A;  3IDB B;  2I45 A;  3SCG A;  2JG9 A;  2W68 A;  2P3K A;  4JKM A;  4NUB A;  2HEW F;  2C9A A;  4XJZ A;  1BEV 2;  4YGC A;  4LBO A;  5F5Q A;  1AR6 2;  2LM3 A;  3B9I A;  3JQW A;  1YJL A;  4CDX B;  3SHR A;  2VCB A;  5I0S A;  1ND3 A;  3ZFE A;  2VZS A;  4Y1Z A;  4CDX A;  3ETP A;  4AFC A;  2P17 A;  4YAR A;  1NXD 1;  4FP2 A;  1HIX A;  2IXL A;  4LOS A;  1XNB A;  2YU1 A;  3ME2 A;  5A3T A;  3EYP A;  3VDD B;  1KEX A;  2RR1 2;  3LB9 A;  2VNR A;  2Z4F A;  5K7P A;  1STM A;  3BKZ A;  3THC A;  1VIW B;  3AC0 A;  5AFE A;  3WDU A;  3O12 A;  4UBH A;  2UWB A;  4AAP A;  1XSQ A;  2VZO A;  1UD1 A;  3WXP A;  1O4Y A;  1S55 A;  4S2G A;  2ZAH A;  1IG3 A;  4CPB A;  1YYN A;  4ZY9 A;  5T52 A;  4UFJ A;  2D6K A;  3S5Q A;  1O3S A;  1MAC A;  1KFX L;  1LOF A;  1XQN A;  4FOQ A;  4Z2W A;  4TLG A;  1YHF A;  2X09 A;  5BNN C;  1D2S A;  4MX3 A;  3LQC A;  1Q8P A;  1UMH A;  2VU9 A;  3ZKY A;  1MZ6 A;  1O4T A;  2QQP A;  4AFM A;  1AL2 1;  1OI6 A;  4PIX A;  3VDA A;  3AYA A;  4QX5 A;  3WW2 A;  2BZD A;  4DMI A;  2ZS6 B;  4CTE A;  5JZG B;  1REF A;  4AF9 A;  1L3J A;  3RMX A;  5JZG A;  2W47 A;  2D5H A;  1TQ5 A;  2OVU A;  5E89 A;  2ZA9 A;  1N3Q A;  5LK7 B;  4FPY A;  2XWB B;  3VD5 A;  4M3C F;  3VBF B;  1ODM A;  2OA2 A;  4WVV A;  3UGH A;  2OYZ A;  5I8S A;  4C1X A;  3O1R A;  5EFU A;  1PVC 3;  2BGP A;  4LOR A;  1O5U A;  5J1X A;  2QQJ A;  3N36 A;  1NE6 A;  5F1R A;  5FZC A;  3QLQ A;  4IV1 C;  2WNU C;  2YV8 A;  4XHX A;  2P3I A;  5DUU A;  5FUP A;  4ZZ5 A;  1A6C A;  3CLP A;  4IE4 A;  3CU7 A;  1HRI 2;  4XAB A;  3SCF A;  3ZSM A;  4KU8 A;  1RUF 2;  5C70 A;  4GWJ A;  1GR3 A;  1R08 3;  1PO2 3;  3ACI A;  5F3E A;  1JYT A;  1PO1 1;  1XE0 A;  1RC6 A;  1VBB 1;  5AC9 1;  4OHX A;  2OQ7 A;  3K75 B;  4BE3 A;  2B9V A;  4HOO A;  1S2B A;  2WZR 2;  1JZ6 A;  2VUA A;  3DXU A;  1UNB A;  3WNO A;  3LCP A;  4IXL A;  2HJI A;  3LEM A;  2XVK A;  1NAE A;  1PK6 A;  4YM3 A;  1NKG A;  1G86 A;  4K40 A;  4AR2 A;  1K5J A;  5JMC A;  2RDS A;  5C9A C;  3INA A;  3ILR A;  1QJY 3;  5HCF A;  4MGS A;  1VLN A;  1O8P A;  5E6H A;  4MV2 A;  5FP4 A;  4CE8 A;  1AHS A;  5KR7 A;  3L2H A;  2GP5 A;  1RUH 3;  4E27 A;  1HQW A;  4JRL A;  2VM9 A;  1HRV 3;  3GCX A;  1W8T A;  3MPP G;  3RG0 A;  4PIY A;  4A3X A;  4M3C E;  2G9F A;  1N1S A;  1QJX 3;  2VUJ A;  3BN6 A;  2YFU A;  1OQ1 A;  1MS4 A;  2IC1 A;  4LXL A;  2NYY A;  5FK7 A;  3TBD A;  4FXG B;  4HVQ A;  5DQ0 A;  1L7L A;  2P1B A;  5FCC A;  4LKD A;  1FNY A;  1I6X A;  5K9Y A;  1QH6 A;  1RJ8 A;  5FZO B;  2QQM A;  1CJP A;  2LAL A;  4XPV A;  3JCI A;  3VBH A;  1NE4 A;  5FZO A;  3WP3 A;  1RVF 1;  3ZSE A;  1AJO A;  2XB6 C;  1VMF A;  4DPN A;  2HKX A;  3TEY A;  1REE A;  2E53 A;  4CEY C;  2ADE A;  5IUQ A;  5A7S A;  3OGJ A;  3IAQ A;  4FOW A;  2A70 A;  4B3N A;  4LBJ A;  4RHV 1;  2F6B A;  2EXK A;  4FSJ A;  4UFM A;  1K5M B;  2BFU L;  3H0O A;  1K5M A;  5KWR A;  4B7K A;  5KXE A;  4S2H A;  2JDK A;  4LIU A;  1H2N A;  3AKS A;  4LBK A;  4D7T A;  2X8K A;  4M0N A;  3O1U A;  1S2E A;  2J1A A;  4NR1 A;  4QPG B;  4Q4Y 2;  1UY2 A;  1SHW B;  1C5I A;  3BOP A;  1VBD 1;  2GC0 A;  4QPG A;  3U14 A;  4NAO A;  5DPN A;  3ZYH A;  3S57 A;  2WO3 A;  2GN3 A;  3S7I A;  2D3S A;  3DGT A;  5CAD A;  1NQD A;  1RHI 1;  1E5R A;  4LKS A;  1G9A A;  1J59 A;  1F2N A;  3CEW A;  5C5T A;  2DF7 A;  5FYT A;  4KL1 A;  5IVY A;  4D6S A;  4LIT A;  5LBB A;  2CAV A;  1HJG A;  2WAB A;  1T2X A;  2LUW A;  4U36 A;  4A3Z A;  3U37 A;  4CDQ B;  1RB8 G;  1MZF A;  2DFB A;  2WAA A;  3M3C A;  2OZ6 A;  1AR6 3;  1UIK A;  1RUE 1;  3MI8 A;  4XIL A;  4LK6 A;  4ARY A;  5D2A A;  3Q9O A;  4COZ A;  5BYN A;  4ZHN A;  1I3H A;  2BVV A;  4YM1 A;  5F3G A;  4CU9 A;  5FBJ A;  1APN A;  2HEY F;  4DRV A;  3MW4 A;  3T1L A;  5FFO C;  4L92 A;  4DQA A;  1LHW A;  3HJR A;  3ZYB A;  4IEU A;  1DU3 D;  2BW8 A;  1KS5 A;  4AQ6 A;  5IAT A;  3V0A B;  4GMP 1;  2FDH A;  3KV6 A;  3V0A A;  1LTE A;  4RFR B;  2AYH A;  2ZX1 A;  2AZ5 A;  4QT6 A;  5J3U A;  1ND2 C;  5JLV A;  1KGY A;  2W5F A;  5FWE A;  2FZ2 A;  3GYD A;  1CD3 G;  3BOW A;  3N9M A;  4FCA A;  5DAV A;  4AVC A;  3DV8 A;  2AEN A;  3IIA A;  3R6S A;  3J8F 2;  3MEP A;  4CXW A;  1VRH 2;  1H8T A;  4DO0 A;  2W92 A;  4PJY A;  5DAX A;  4MGI E;  3WNL A;  1VAK A;  5AFB A;  1RUJ 2;  4K6B A;  1PNG A;  1COV 3;  4LO6 B;  5I91 A;  1CX4 A;  2BJS A;  4Y5T A;  4JQT A;  2JEC A;  3WZ1 A;  2VZV A;  4XUT A;  3KS7 A;  3NNM A;  1SLA A;  4EN0 A;  2PHU A;  4CCK A;  4XFG A;  2PHX A;  2GDF A;  3MF9 A;  2E7T A;  2ZZQ A;  5BXX A;  1S0G A;  2D6P A;  4HN1 A;  3ZXF A;  5ANQ A;  2X5I C;  4XF4 A;  3I2I A;  4UWD A;  1U5Y A;  1JXN A;  2VMC A;  3NKT A;  2JE9 A;  4MO3 M;  2PQS A;  5FAX A;  5B4N A;  5IFP A;  1Q5O A;  2XHN A;  5C8W A;  3UGG A;  4JKK A;  1WCU A;  2VL4 A;  3P3P A;  1G9B A;  2D93 A;  4LUK A;  4CU6 A;  1W9W A;  4FPG A;  1POQ A;  4E2S A;  3HQU A;  5EZW A;  1ENX A;  1JN2 P;  2IZW A;  1QWR A;  1HRI 3;  3HR9 A;  4D6R A;  5J48 A;  4RYD A;  4N90 A;  2ZGO A;  5FKC A;  2Q1Z B;  2WNU B;  3B02 A;  1AL2 2;  1XOY A;  4IL7 A;  4QX8 A;  4B4Q A;  4QDS A;  3I2O A;  2WNU A;  4NAM A;  1H6X A;  3POJ A;  5GZC A;  2ZGR A;  4YVS C;  4LO7 A;  2WSU A;  3ECQ A;  4GH4 C;  5FOJ B;  2AH2 A;  1JYN A;  2QQN A;  4CU7 A;  3N3H A;  3AZX A;  1DGW A;  3JUU A;  4HKO A;  5IVE A;  3TN9 2;  5FPA A;  2YMZ A;  4QHB A;  1H9P A;  3EB7 A;  2RJK A;  2ZOE B;  5BV6 A;  5IYY A;  1UIJ A;  1BVP 1;  2XLA A;  3UJQ A;  3OJB A;  4DUV A;  4ZU7 A;  2V4A A;  3E5U A;  1TG7 A;  3O0W A;  4CCC A;  1QGL A;  1UYP A;  1MQT C;  3DYM A;  2Q4S A;  4A6O A;  2BFU S;  3CJX A;  3B01 A;  4IDZ A;  2WNV C;  2BWC A;  4COY A;  5C9A B;  1D4M 2;  3USU B;  5FZD A;  1NLS A;  3LE0 A;  3NWK A;  5KXB A;  4E2G A;  4AHZ A;  1EPW A;  1NCQ C;  1LED A;  1TMF 1;  2Y8K A;  1QNW A;  2IXJ A;  1RUC 3;  1R1Z A;  1UY3 A;  1X7N A;  2PEL A;  4CP9 B;  3FBY A;  4M3C B;  4NHK A;  2ZHK A;  2DCY A;  4GWI A;  4CCJ A;  4FBF A;  2PHT A;  1KRI A;  1M06 G;  2JB8 A;  2ZZJ A;  4OZX A;  4RD7 A;  4YYO A;  2VTF A;  2BER A;  5BNO B;  5C5U A;  4COW A;  1B35 A;  5BNO A;  1AVB A;  3B9C A;  4QKD A;  5CKQ A;  4YSF A;  3C7G A;  4Y26 A;  2QUO A;  4F8A A;  2CYF A;  1XC6 A;  3CZJ A;  5IHR A;  2VAU A;  4Q4Y 3;  2I07 B;  3AZV A;  1OUX A;  1W0P A;  2VZR A;  3WVJ A;  5FPB A;  2ADD A;  1C1L A;  2NQY A;  2QBX A;  4NPL A;  4XJ9 A;  3VBR A;  5DG2 A;  1PVC 1;  1XND A;  3M3O A;  4Z2A A;  4MGT A;  2VME A;  2VOK A;  5J37 A;  1GZW A;  1K45 A;  4AVB A;  4QPY A;  1RVF 2;  2VNV A;  4JDO A;  4MH0 E;  3I2D A;  4QB1 A;  1EUT A;  2Z79 A;  2W2I A;  1OLM E;  3POE A;  4DZG A;  5FYI A;  1NLQ A;  2VBB A;  3O1P A;  3GZA A;  1IG0 A;  5I0D A;  1WLC A;  4R52 A;  1R08 1;  1PO2 1;  1WA6 X;  4UFI A;  4B7E A;  2Y0O A;  4XHB A;  2EVX A;  5KC6 A;  4JHT A;  3ZO0 B;  1W90 A;  3QH7 A;  4CZS A;  5JIU A;  2LS6 A;  4LR4 A;  1MVE A;  2JIG A;  3J7M A;  5A7Q A;  4A7Y A;  1O3R A;  1JZ7 A;  4WZF A;  3T0D A;  1QKQ A;  1IQA A;  3VKN A;  5DAQ A;  3ST7 A;  3KF5 A;  4C0B A;  1AR7 1;  3RZK A;  1W8H A;  1Y9M A;  1VBD 2;  2BDR A;  3V65 A;  3I2J A;  4PIZ A;  4NE9 A;  4K7J A;  1QJY 1;  4A7Z A;  1TE1 B;  1CX1 A;  2BBA A;  2G9Z A;  2PHW A;  2VR4 A;  1JZ8 A;  4YZ3 A;  1RUH 1;  1SPP B;  4NHY A;  5D21 A;  5A7N A;  4AOC A;  1HRV 1;  3AYC A;  5FKB A;  1A3K A;  1AYM 2;  2ZGU A;  2VVE A;  3J8F 3;  3T09 A;  1QJX 1;  1NY7 1;  1BMV 1;  1GNH A;  2LW8 A;  3OGS A;  4JTN A;  1YI7 A;  5F5C A;  5I0R A;  1VRH 3;  4TTG A;  1ND2 B;  3KWV A;  2PHD A;  1UU4 A;  3R4S A;  3TNP B;  4KQ7 A;  3AMN A;  5LEJ A;  4UBG A;  1RUE 2;  1SLC A;  3MIC A;  3VKO A;  4FPC A;  4DXT A;  3J7H A;  3V0B B;  1J3R A;  3AXE A;  4KG0 A;  4EN7 B;  4LT5 A;  4EZ4 A;  3V0B A;  4XQ4 A;  1RTV A;  3CF6 E;  3VD7 A;  3WD5 A;  4JGZ A;  1ENQ A;  3SNM A;  4Q0Q A;  1Z7S 3;  2Y6L A;  4QQL A;  3UL2 A;  1SLL A;  2IFR A;  2OPK A;  1W05 A;  1HXS 1;  1MR5 A;  3CJI A;  4H7L A;  5ACA 2;  3RFR A;  1CGP A;  1UW8 A;  1WMF A;  1UY1 A;  2XG3 A;  1F35 A;  4I01 A;  4AVV A;  3WQ7 A;  1GZT A;  1LOE A;  2QJV A;  1AXZ A;  3GJB A;  3GZU C;  2VQT A;  3WEZ A;  3WQB A;  3S5A A;  4Y20 B;  2WJS A;  3ITQ A;  2ZXQ A;  3PJY A;  5FZL A;  1ZBE 2;  2XHK A;  2JG8 B;  4Y20 A;  3T4H B;  3WCR A;  4BME A;  5A6X A;  1AXK A;  2JG8 A;  2WAO A;  3W20 A;  1WWY A;  4ES8 A;  1J58 A;  1SCS A;  5EP9 A;  1DGR N;  5F6K A;  4RN5 A;  1DQ5 A;  3H7J A;  4X6R B;  1AR9 3;  5LA2 A;  4JGY A;  4I0W B;  4M0H A;  1UMI A;  1X9T A;  4MZU A;  5IAV A;  1HB3 A;  2W9X A;  2VOV A;  3AYE A;  4XMA A;  2Q8E A;  1FNZ A;  1GWL A;  1LOA A;  2VZ1 A;  3PVN A;  2HWC 3;  3E97 A;  3HT1 A;  3GNE A;  3PLQ A;  1TNR A;  4QQ2 A;  2EID A;  5CVR A;  4MYE A;  5GLV A;  3TEZ A;  3KT4 A;  5EV7 A;  1ZZ9 A;  2R04 2;  1AR6 1;  5D8A C;  2VCM A;  4CDW C;  1W9F A;  1G6N A;  3OPW A;  4PF5 A;  5FP8 A;  2WA4 A;  2JE7 A;  1KIT A;  2QZ3 A;  3TN9 3;  1OA4 A;  2GAU A;  2XJR A;  3NV2 A;  4PT6 A;  4W6Y A;  2VE1 A;  2X10 A;  3III A;  1OFS A;  4NWW A;  5JWP A;  2JG9 C;  3H3U A;  4YVS B;  5BNP A;  4GH4 B;  3MIH A;  3FUQ A;  5FP9 A;  2CSG A;  1V6I A;  2RR1 1;  2JDM A;  4LA2 A;  2ZEZ A;  5FY0 A;  4IE0 A;  4L9B A;  4E4D X;  4M01 A;  4ZZ8 A;  1W9T A;  3GF6 A;  4XJU A;  2VMF A;  1ND3 C;  2WL1 A;  1QDO A;  3KD4 A;  4FQ4 A;  2PHL A;  3ZFE C;  4CDX C;  1W6O B;  3Q8A A;  3D0S A;  1OUR A;  4LBQ D;  2XJS A;  3ZR5 A;  1W6O A;  4EQV A;  3OEB A;  2YBK A;  2A5Z A;  5FMC A;  5LA9 A;  2TEP A;  1DQ0 A;  1DHK B;  3ZXL A;  4BQ3 A;  1U12 A;  2DTY A;  2Y6F A;  3HN1 A;  2WNV B;  1L7Q A;  1OOP A;  5I93 A;  4AI8 A;  2WNV A;  4YM0 A;  4YGE A;  4EWD A;  2K0G A;  2BOI A;  3VHO A;  3W5N A;  5FDB A;  4I3G A;  1COV 1;  1IKQ A;  3AP5 A;  4A42 A;  1NCQ B;  1QH7 A;  1JYW A;  3MIE A;  5ISL A;  4MVT A;  1NCQ A;  4Y5Z 0;  3B5L B;  1DZT A;  2KA3 A;  4XMI A;  4BZ4 A;  3TWI A;  4RL7 A;  2A1X A;  4XF0 A;  1X9P A;  3AP4 A;  3NMB A;  3C3V A;  4AW7 A;  2E63 A;  4WV8 A;  2CDO A;  3L9J T;  4FFF A;  1LOF C;  2XVL A;  3VZM A;  3ZXG A;  1D7P M;  2QZ2 A;  3AMQ A;  4X8N A;  5FZB A;  1BCX A;  4EWA A;  1XPW A;  3VD9 A;  2RDQ A;  4I02 A;  3KV4 A;  3D8C A;  2YUE A;  1S0B A;  2C4X A;  3KCX A;  5DXD A;  2C24 A;  3KM5 A;  1EV1 3;  4OCT A;  2HWB 2;  3PJQ A;  3U75 A;  2GMM A;  4LBN A;  2HLE A;  2Q5T A;  1HRI 1;  1RUF 1;  5A3P A;  1YIP A;  3BTY A;  4AVA A;  3VL8 A;  4CP1 A;  3RSJ A;  4J1W A;  1UPI A;  1ALY A;  1XYN A;  3DXT A;  3WT3 A;  3MPB A;  1UQX A;  2VH9 A;  4QX7 A;  4BQY A;  5CKN A;  4E8D A;  1W06 A;  5A70 A;  2ORX A;  2OX0 A;  1Y4W A;  2DCZ A;  3UK9 A;  1Q8V A;  4P9I A;  5C3O A;  5L36 A;  2Y26 A;  4XAA A;  3OBT A;  3WG3 A;  5FZ4 A;  1WLD A;  1LB2 A;  3WHU A;  1DGR A;  4QB6 A;  2P4E A;  4E2Q A;  4KBB A;  4B1M A;  1PVC 2;  1PM4 A;  2YDE A;  1JOB A;  4BK5 A;  1I5P A;  3B7M A;  1DP0 A;  5JDB A;  1AYM 3;  4H55 A;  4IV3 C;  4ZXE A;  3CIH A;  2ARX A;  3I3Q A;  1WW4 A;  3CBN A;  5C7G A;  4IE6 A;  3T2Q A;  4GJZ A;  1MVQ A;  1PK6 C;  2KM2 A;  2XH6 A;  3AKQ A;  3RYK A;  1FAT A;  3HT2 A;  3LEG A;  3T3Y A;  4UF0 B;  4NID A;  5F32 A;  1R08 2;  1EYB A;  2ZGM A;  4NN0 A;  4KGG A;  5GLZ A;  2G19 A;  3QBQ A;  4P14 A;  4BDV B;  5FY8 A;  3TRS B;  4ERO A;  2VMG A;  3OSD A;  2ID4 A;  3LA2 A;  2XML A;  3T2O A;  1RUC 1;  4K8F A;  1IKP A;  3IN9 A;  4RS5 A;  2ZML A;  1KFU L;  1QF3 A;  3NRU A;  4QDR A;  3MFA A;  4Q0S A;  4PF1 A;  4BU2 A;  3MV1 1;  2YGM A;  3KVA A;  3VZK A;  3W59 A;  1CIW A;  1J3Q A;  5ACA 3;  3HMY A;  5IT6 A;  1UF2 C;  4QMA A;  4GMP 0;  4M4P A;  4LHL A;  2B9U A;  4NRP A;  5C3S A;  1OT5 A;  5FPV A;  1WGP A;  5DAW A;  5J96 B;  2E33 A;  2ET7 A;  1UKG A;  4HLT A;  1VB4 A;  4RA0 A;  2ZGP A;  5FR3 A;  1GOF A;  2VBP A;  2VOT A;  3VBH C;  2DUQ A;  2XUM A;  4XF1 A;  4XZP A;  3N9N A;  1HRV 2;  5DDJ 3;  1DF0 A;  4D94 A;  4Q4Y 1;  2ZHL A;  3D5O A;  3MUY 1;  2XBO 3;  4DUW A;  1BVV A;  4XBN A;  3OF1 A;  5IJR A;  5JPM B;  2R0H A;  3H50 A;  3Q8E A;  5F3I A;  3ZOI A;  4P9X A;  1RUN A;  3OG2 A;  4AI1 A;  2WBK A;  1ZM1 A;  4CCE A;  2XDV A;  2VO5 A;  3BPZ A;  3HAG A;  4N53 C;  4N43 A;  5IVV A;  5A6Q A;  2ZAA A;  5KHI A;  1OKQ A;  3PIG A;  3MLK A;  4XFI A;  3IMM A;  4QXK A;  2R04 3;  3OBA A;  3WX5 A;  2WUH A;  1W2O A;  4FOV A;  4BLJ A;  2WIN B;  5LAT A;  4LK7 A;  2A6V A;  4OMC A;  3RJR A;  2IVI B;  3KT7 A;  2HWE 2;  2E6V A;  4ZU4 A;  1AYN 2;  1C57 A;  2VTX J;  3NST A;  1O91 A;  3ALQ A;  3W5M A;  2P34 A;  4JVA A;  1ZRE A;  3KGZ A;  4O65 A;  2CL2 A;  2VOX A;  3N9O A;  4XET A;  4AZZ A;  3OY8 A;  2LTN A;  5D8A B;  5F37 A;  3WF3 A;  1Y43 B;  2YGL A;  3AXD A;  4CDW B;  4QB2 A;  2ZX3 A;  3LWC A;  2JDZ A;  2VXR A;  4FFI A;  4LO4 B;  4UFL A;  4ASK A;  4QXH A;  3LDK A;  2GH8 A;  3LOI A;  4I09 A;  3TNQ A;  2JEN A;  5FZA A;  5JSP A;  1FT9 A;  3WDT A;  5KHJ A;  2A3W A;  2JG9 B;  2WT1 A;  4KBZ A;  3LDB A;  2DUP A;  3J8F 1;  3FHA A;  3JB4 C;  2X05 A;  4ASM B;  5JVV A;  4ZS3 A;  3TAY A;  2Q30 A;  1N3O A;  2XON A;  3OUJ A;  1VRH 1;  3QOP A;  4NWV A;  3A23 A;  5LBE A;  1WMX A;  4LO8 A;  2QQL A;  4ISQ A;  1IPK A;  1DYO A;  3I3E A;  4LHN A;  2O0O A;  4ATE A;  1ND3 B;  3WV6 A;  3ZFE B;  1ENR A;  2JD9 A;  1RUJ 1;  3R05 A;  3IDE A;  2IXC A;  2BUK A;  5EWS A;  3SEP A;  4UYB A;  5AVP A;  4NRO A;  1UY0 A;  3AL6 A;  2YPJ A;  3ZM8 A;  2WN3 A;  4LPL A;  4Z1V A;  3H8X A;  1OMI A;  3WG1 A;  3LSD A;  3NAP B;  4QX1 A;  3LSE A;  3NAP A;  1QU0 A;  4Q0U A;  5JXJ A;  2HEV F;  1W6Q B;  3ABZ A;  1CAV B;  2A71 A;  3WW1 A;  1XJA A;  3H8U A;  1H8T C;  1W6Q A;  1CAV A;  3WDV A;  3UET A;  5KHK A;  2GME A;  2BVB A;  5LA0 A;  2XOM A;  5KHH A;  4DY3 A;  4KGQ A;  4XF9 A;  3NJY A;  1SBD A;  2WC2 A;  3H3L A;  3KF3 A;  5T5J A;  1XNC A;  3AMH A;  1R64 A;  1MZ5 A;  1PGL 2;  3U4S A;  1MZE A;  1BHG A;  2DVB A;  3MZH A;  2HWB 3;  3WP6 A;  4YZ4 A;  3D82 A;  5FYH A;  3ZLI A;  4AED A;  2BYV E;  2RG4 A;  3KSC A;  1ULF A;  1AR9 1;  1UOB A;  5CIR A;  4C8D A;  1UZV A;  4IEP A;  3TB0 A;  2ENR A;  1ZA4 A;  2VJX A;  2ZX2 A;  5A1F A;  3MW2 A;  5HBA A;  3NVC A;  1SDW A;  1QJU 3;  1ZBA 2;  1QOS A;  1COV 2;  3UNP A;  5FZ7 A;  3LEK A;  4CDU A;  4CCL A;  4K9S A;  2HWC 1;  3KCY A;  4PBO A;  5L19 A;  3GCW A;  4XIO A;  1W04 A;  2RJ2 A;  2Y60 A;  4CUC A;  2QFE A;  1CON A;  5I8T A;  4RGK A;  2VZU A;  1WW5 A;  1OUS A;  4XC9 A;  4AXO A;  4BIF A;  5J09 A;  3D3A A;  1OBN A;  4DB5 A;  2VXJ A;  5FYM A;  2NZ9 A;  3O1S A;  2FDK A;  2DTW A;  5F39 A;  3TN9 1;  4TWT A;  4FQZ A;  1U5I A;  4EN8 B;  2FD8 A;  3GBW A;  1GQP A;  1QQP 3;  4IEX A;  3LZZ A;  3NV3 A;  3JZV A;  1BK0 A;  1QIQ A;  1CZT A;  1X50 A;  4DOU A;  2WNO A;  1J3P A;  4URA A;  3DPR B;  1LHO A;  1HB4 A;  3FBM A;  1LOG A;  2ZAC A;  3DPR A;  2RM2 3;  1HQL A;  1D4M 1;  3WCS A;  2HYX A;  1BK1 A;  4XCB A;  3AKR A;  3HNM A;  2DVD A;  5K4L A;  2NN8 A;  2WWS A;  3I7D A;  1YLL A;  3O7O A;  4IV3 B;  4JQR A;  3MYX A;  4AHY A;  3N9P A;  4IV3 A;  5JSO A;  2H6C A;  2QQI A;  1V0A A;  1PK6 B;  5FLH A;  1FI2 A;  3VB9 A;  4NHX A;  2VC9 A;  4PCR A;  2JD4 A;  4QGM A;  1OA2 A;  3N35 A;  4G3Y C;  5FWJ A;  4TSV A;  3T2P A;  4AHW A;  5IVJ A;  1N1T A;  4WVZ A;  4DNY A;  5FY5 A;  3VV1 A;  4DIN B;  4DIQ A;  1OD3 A;  3O1T A;  4BQ4 A;  4XUQ A;  4GUL A;  3OGV A;  3ZYP A;  3PUI A;  4O7X A;  5EJ3 A;  5DAB A;  5FYV A;  3WF1 A;  2LRP A;  4LA3 A;  3MIF A;  2W94 A;  2W1Q A;  1W8Z A;  2BGC A;  1YO8 A;  4Q4W 2;  3I3M A;  4D7Y A;  5K8S A;  5FZ6 A;  3M4F A;  3H7Y A;  2QKD A;  1ULO A;  3VBH B;  2VUC A;  3OB8 A;  4N7U A;  4QXB A;  1B35 C;  4MUV A;  5BNO C;  4I2O A;  1EV1 1;  3H1M A;  4EN9 B;  4LBM A;  4S2F A;  5CG8 A;  1A34 A;  4JV4 A;  3RI8 A;  1QJE A;  1DIW A;  3MO4 A;  4AGG A;  1RUC 2;  1W9Y A;  3FN9 A;  4J6G A;  4KWU A;  4YZ1 A;  2ARB A;  2RS1 3;  5FZ9 A;  5L7O A;  3VHP A;  4BCU A;  5FRE A;  4HN0 A;  4IEZ A;  5HCA A;  4LLF A;  3AK0 A;  2GC3 A;  2IFW A;  3EBR A;  3LA3 A;  5GZE A;  3VBR C;  3EO6 A;  4AWD A;  4N53 B;  3G7D A;  4HL0 A;  1XNK A;  5C33 A;  2OT7 A;  4N53 A;  4MG2 A;  2HWE 3;  2YXS A;  1AYN 3;  1FOD 3;  5FZE A;  2Q1M A;  3I59 A;  2OUJ A;  3LDR A;  5D1I A;  3ZXA C;  4QGN A;  4GKX A;  2AAC A;  3HN3 A;  4Z82 A;  2K2S A;  1BQP A;  4KWK A;  5FYC A;  4F3J A;  3GGL A;  5LRR A;  5BUV A;  4PI0 A;  3SH5 A;  3SKJ E;  3ON7 A;  4CEW A;  1JYC A;  5DN2 A;  1TEI A;  2C5D A;  1XSR A;  2WWU A;  1TME 3;  1VR3 A;  1M4W A;  5DUX A;  4LTA A;  2B4K A;  1AYM 1;  2CV6 A;  3WP4 A;  3ZYJ B;  2AEZ A;  2QQW A;  3PTR B;  1NYW A;  3IPV B;  1IHM A;  4LKF A;  3IPV A;  3ZIW A;  3LGR A;  4B8E A;  4E4S A;  1C8M 2;  5FYS A;  2UY9 A;  2WA3 A;  4D7S A;  2IUW A;  1XNA A;  1UN1 A;  4OQ8 A;  1PMH X;  3RZH A;  1XRU A;  1QXP A;  2EF6 A;  4W50 A;  4XW3 A;  2CTV A;  2CWS A;  4Y4R A;  1BJQ A;  4RQP A;  3I49 A;  4K20 A;  4QPW A;  5ACA 1;  4JKL A;  4YG6 A;  3HNB M;  1HLC A;  2VPV A;  1PZ7 A;  4AGR A;  1AZD A;  4H3W A;  4XUR A;  2ZX4 A;  2PAM A;  3ILN A;  4PLM A;  1WCS A;  2IXH A;  2VY0 A;  2VEC A;  1DQ2 A;  2V73 A;  2EIC A;  4NMI A;  1ASJ 2;  2CDP A;  3UKN A;  1ZBE 1;  2FBE A;  2ATF A;  2CU5 A;  5LY2 A;  2XBO 1;  3PUS A;  4JGZ C;  3U07 A;  4ZPI A;  1H8T B;  2O8Q A;  5DAP A;  4Z8B A;  1EPZ A;  3CJI C;  3C7F A;  2ZBJ A;  1UYX A;  3H1Y A;  4AQT A;  1QJZ A;  3T1M A;  1YFX A;  1ZBA 3;  3PHM A;  3WW3 A;  4QU1 A;  3QD6 A;  2DV9 A;  4Q26 A;  2ARC A;  1XU1 A;  2KXL A;  4FPH A;  4NVP A;  5LZ6 A;  1Z7S 2;  2X29 A;  2R04 1;  5DZF A;  2PAK A;  2JG8 C;  3MW3 A;  3B94 A;  4UW4 A;  3FLT A;  1SEF A;  3PVE A;  2A73 B;  4CCN A;  3WNX A;  1AR8 3;  4JGY C;  4PLN A;  2OII A;  1KQR A;  2F4L A;  5EQU A;  3H9A A;  2A75 A;  3BGA A;  4ZON A;  3GXU A;  3SH4 A;  3POB A;  4V2W A;  2C0Z A;  4O61 A;  4XZU G;  1SLB A;  1BXH A;  5FP3 A;  3MLJ A;  1O3T A;  2A7A A;  1YRZ A;  5EJ1 B;  4P5Y A;  5H9R A;  1QOO A;  3GHN A;  2C9K A;  3ZFG A;  4AE2 A;  5KXC A;  1Y3T A;  1AR9 2;  2XL9 A;  3K2O A;  1NUK A;  2GSY A;  1W3X A;  3GZE A;  1OF3 A;  1OVS A;  2A3Y A;  2C6S A;  4FT8 A;  5FJH A;  3B3Q E;  5CB7 A;  3W21 A;  1U0A A;  4PQ9 A;  1H2K A;  4P02 B;  1GUI A;  2HWC 2;  3CKH A;  2WT2 A;  3HQX A;  2YBS A;  4KI5 M;  4N9H A;  5BNP C;  3ZYF A;  4WVM B;  3PU3 A;  1Q43 A;  3PUR A;  1RMU 3;  3NW4 A;  2W1W A;  4WVM A;  5FBZ A;  1LRH A;  3UYJ A;  3V56 A;  3VBS B;  2ZEX A;  4M4R A;  3VBS A;  1HDK A;  2ZGT A;  1A78 A;  4XQW A;  1WBL A;  1K42 A;  2BTV C;  4EV0 A;  1CVN A;  2VQU A;  4LUM A;  1HN0 A;  2JKB A;  3KHC A;  4YZ5 A;  2IXK A;  2RS5 2;  4IET A;  3THP A;  1US3 A;  1FV2 A;  1C5H A;  2HWD 3;  1K12 A;  1PMI A;  2R32 A;  2Y64 A;  4FO9 A;  3RWN A;  2Y6K A;  3DKW A;  4SBV A;  3UV9 A;  3AZZ A;  1OQD A;  2ORZ A;  3KCC A;  1UO9 A;  4XQD A;  2ZGK A;  1OOP C;  5FY7 A;  4Q4W 3;  3GBG A;  3RYR A;  4QQH A;  3VL9 A;  1HJF A;  5FXW A;  5JOX A;  3AMP A;  1DLC A;  1OHF A;  5CFD C;  2HWB 1;  3S6P A;  1UX6 A;  4FTE A;  1WCK A;  5GLU A;  1WLW A;  1H1M A;  5CEH A;  5EPA A;  2JIC A;  4BB3 A;  4DFS A;  2QDR A;  4YW4 A;  2AGS A;  3M1H A;  5CAZ A;  1GQG A;  3FLR A;  2D43 A;  5FPX A;  3K3N A;  3B00 A;  2UY8 A;  1B35 B;  1JW6 A;  1LHU A;  1VRB A;  2WO1 A;  4D0Q A;  4HK8 A;  5A6Y A;  4QPI C;  3GZT B;  2VZT A;  1ZVF A;  3O14 A;  4K8R B;  4CVU A;  1IPS A;  4YW5 A;  3RDI A;  2WII B;  3ACG A;  1V6J A;  2TNF A;  2JDH A;  1UX7 A;  4G4F A;  1GU3 A;  3VBR B;  3WNK A;  2DUO A;  3U1X A;  2WYF A;  3FHI B;  5F7U A;  3WQ1 A;  3VKM A;  2XKO A;  1JU4 A;  4DEV A;  2PFW A;  1GZW B;  2FCU A;  5FP7 A;  4ZKT B;  1JBC A;  1JYV A;  1S1A A;  2NM1 A;  1W2A X;  1W0O A;  2R06 2;  1EV1 2;  1G9F A;  3A21 A;  1SMV A;  2R7E B;  3PUA A;  4QM8 A;  4XJW A;  4CXY A;  1PX3 A;  1C8N A;  3ZMO A;  4TZD A;  1KD7 A;  2XJU A;  3BTA A;  4K3U A;  3HPN A;  3RZJ A;  4OUS A;  3UJO A;  3ZSK A;  5A3U A;  1C8M 3;  3AVS A;  1Q3E A;  4FP3 A;  2ZHM A;  1QHD A;  4ITC A;  2SLI A;  1AX2 A;  1SAC A;  3N7K A;  2YRO A;  5FPL A;  5FV3 A;  4BM8 A;  4DXR A;  1GYK A;  2VMI A;  1GWK A;  1H4G A;  1QNY A;  1Z0H A;  1WME A;  2J1R A;  4A4A A;  2A3X A;  2O14 A;  5C8C B;  1XXN A;  5C8C A;  1OPO A;  5BPX A;  5CG9 A;  3NV4 A;  5GLT A;  2FDJ A;  2QQK A;  1W2N A;  5JXI A;  1QY4 A;  4WM7 C;  1ZZ7 A;  4FAG A;  1HW5 A;  5CNA A;  3VZJ A;  2FZ1 A;  1JZ3 A;  3KVB A;  1QXR A;  1UOF A;  1F4H A;  3I4I A;  2WWJ A;  1RIT A;  2ZGL A;  2YC2 A;  4EJR A;  5FPZ A;  1ASJ 3;  2XL7 A;  3FX3 A;  3VZN A;  4YW3 A;  4E8C A;  2PTM A;  3ZXK A;  1SDD B;  4LOT A;  3WW4 A;  2EXI A;  1UKR A;  2ES3 A;  4RS5 C;  3IBM A;  2XJV A;  1MS9 A;  4FFG A;  1GP5 A;  3TOJ A;  1OLR A;  1PGW 2;  2LRO A;  2BQP A;  1GWM A;  4GJY A;  2MHF A;  3AKP A;  4ZU5 A;  4LBQ A;  1UWW A;  3B69 A;  4HK9 A;  4Y1V A;  4JGZ B;  4RGG A;  5C3R A;  3M2M A;  1IS3 A;  2V09 A;  3I2G A;  3PVB B;  1E5H A;  5ABJ A;  1FPN 3;  2EIE A;  1MS8 A;  3POW A;  4HKW A;  2WKK A;  4IQP A;  4AGV A;  3CJI B;  2J42 A;  3LPG A;  1V70 A;  4B4R A;  2XPJ A;  1PMJ X;  1N47 A;  1LU1 A;  2RMU 2;  5IK8 A;  2HWE 1;  1NZC A;  2C26 A;  2PXJ A;  1AYN 1;  1FOD 1;  3AL5 A;  4MXW A;  4Q27 A;  5JR7 B;  1NA1 C;  3M8L A;  4IGP A;  4RR3 A;  1DZR A;  4M00 A;  4B4P A;  3ASI A;  1ZRD A;  3WR0 A;  4N43 C;  3ELN A;  2WFF 2;  5DDJ 2;  3PNA A;  5LB6 A;  4FXK B;  3WP5 A;  2VUD A;  3MIG A;  4TYS A;  2XBO 2;  4OQ9 A;  4CP0 A;  5IVB A;  1WUV A;  3FC0 A;  3VHR A;  1ZZB A;  4JGY B;  5T55 A;  1V9U 2;  1TME 1;  4XUN A;  4K1Y A;  4BPZ A;  5T54 A;  4Q8K A;  3GM8 A;  3LKJ A;  1NCR C;  3SIS A;  3N7M A;  5A3L A;  3FFZ A;  2J1E A;  4MHU A;  2CHH A;  3K3O A;  2VVD A;  4ISR A;  1XE7 A;  4PDW C;  4GKY A;  2FDG A;  2UYB A;  1T6G C;  5FY1 A;  4F83 A;  1H30 A;  2CWM A;  1IOA A;  3USS A;  2BU9 A;  2FCT A;  4YG0 A;  4AFA A;  4CUG A;  2QTW B;  2O1Q A;  3DL3 A;  4WM8 A;  5H9S A;  4EE2 A;  1VAV A;  5FPU A;  1ZX5 A;  4BQ5 A;  5FLI A;  1DG6 A;  1MEC 2;  4MXV A;  2JDN A;  4XEZ A;  3LF7 A;  1WCD J;  2RS5 3;  5FY9 A;  4EYU A;  3A22 A;  4XFH A;  5GM0 A;  3FHQ A;  3IDA A;  5BNP B;  1H6Y A;  2BV4 A;  2HBT A;  5EYY A;  4E9K A;  1NZI A;  5FZ1 A;  2N7G A;  4CRQ A;  5A33 A;  3ZVX A;  4LLO A;  4FPE A;  1J1T A;  4B29 A;  1CIY A;  1UL9 A;  3AVR A;  3O5S A;  3MFC A;  3LAG A;  3P5B A;  4QXC A;  1GBG A;  2XJT A;  2W08 A;  3TYJ A;  2J1V A;  4BIS A;  2P6C A;  3KLS A;  1CPN A;  2O8O A;  3K4A A;  4YFW A;  4AI3 A;  3ETQ A;  1ZZ8 A;  1AXY A;  1HN1 A;  3BTZ A;  3PL0 A;  4BWO A;  5GAL A;  1UMZ A;  3SQO A;  1PGL 1;  4YFZ A;  4YM2 A;  3POS A;  1RXF A;  2CGP A;  1Q8O A;  2YC0 A;  3VN4 A;  3ZYR A;  2EXJ A;  4CSW A;  4CXX A;  3V64 A;  1OOP B;  2D44 A;  4ET7 A;  3DN7 A;  3NAP C;  1AL0 G;  1YQC A;  3AFG A;  1ZBA 1;  5FY4 A;  3Q8F A;  4IUG A;  2E26 A;  4L99 A;  5CFD B;  3UGF A;  3FE5 A;  2QE3 A;  1UOJ A;  3RZG A;  5CFD A;  3NNG A;  5EIY B;  3BIW E;  1S0I A;  2YHJ A;  4W6W A;  1EUU A;  3DCQ A;  3F2Z A;  4IW3 A;  3C7H A;  4QU2 A;  1PO1 3;  2PYT A;  2VG9 A;  2ZGN A;  4AED C;  4CCO A;  5AC9 3;  5IVC A;  2ZCW A;  4HBN A;  3WUD A;  2WT0 A;  3FLP A;  1AR8 1;  3WF0 A;  2H6B A;  4YVW A;  2K9Z A;  4XIK A;  3T0A A;  3RZL A;  4QPI B;  2A6W A;  3QH6 A;  1W2T A;  1MS0 A;  5FMD A;  2VMD A;  2R1D A;  3FJS A;  4QPI A;  4CDU C;  1V6O A;  2R06 3;  4R9B A;  3O0X A;  4YPJ A;  2VCA A;  3LFI A;  2YY1 A;  1YIF A;  2ET1 A;  1W8O A;  3JBG 2;  5DUV A;  3H8O A;  3R4D B;  1CAX B;  2Z2S B;  1QJU 2;  1CAX A;  2R6Q A;  5JMO A;  3P6B A;  2EXH A;  3GDB A;  4Q2F A;  4LNV A;  4FTB A;  1UAI A;  2Z42 A;  5CZK A;  4LQR A;  2ZGQ A;  1PIV 2;  1Q8S A;  4JCK A;  3VZL A;  1YI9 A;  4ES9 A;  4C91 A;  5T50 A;  1RUI 3;  2XQX A;  2RDR A;  4I30 A;  3RWK X;  5CBL A;  3JD7 2;  4P9L A;  1GMM A;  3CZU A;  2RDN A;  1UCX A;  3DPR C;  1S0E A;  2AR6 A;  1SBF A;  1BKZ A;  2WS9 3;  4NIG A;  4OVE A;  4XVH A;  1CAU A;  1PZ8 A;  4B1L A;  5G04 L;  4BQX A;  4C0H A;  1S2K A;  1LOB A;  4GAZ A;  2JB4 A;  4JTO A;  1QQP 2;  5FXX A;  2HWD 1;  3I54 A;  5A3W A;  3RI9 A;  4CUA A;  4Y1Y A;  3ILF A;  3LD8 A;  3RZM A;  2ZKN A;  5JXG A;  1I1E A;  4S2D A;  4SLI A;  2R07 3;  2GZW A;  1KXG A;  1LHN A;  2ZEW A;  4WM7 B;  1ULD A;  4Y5S A;  2I2S A;  4WM7 A;  2XLG A;  4BYY A;  4Q4W 1;  2RM2 2;  1GAN A;  3DEM A;  1H1I A;  1ULC A;  1W03 A;  3NJZ A;  3ACF A;  4I0B A;  4BJ0 A;  5A7W A;  2ZX0 A;  2DVG A;  5C6C A;  5FZH A;  2E32 A;  1YCI A;  4OYU A;  1ZYB A;  1VAM A;  1YXW A;  1W8W A;  4RS5 B;  2ILM A;  2W52 A;  3I3D A;  1OVP A;  1F31 A;  1RHI 3;  3T30 A;  1LU2 A;  1W2U A;  4TLF A;  5DUW A;  4D69 A;  2FMD A;  3AJZ A;  3SXW A;  5E8A A;  1W8U A;  3O0V A;  4R9C A;  2RMU 3;  4CYD A;  2VQ0 A;  4ZXK A;  3FMG A;  5LW9 A;  3OD4 A;  4EWE A;  4RFT 0;  5F8P A;  3K4Z A;  2WFF 3;  4U2A A;  1IS6 A;  1DZQ A;  3IM0 A;  2D6O X;  1RED A;  3LEI A;  4JHZ A;  4BHP A;  4AEM A;  5FOB B;  2V5D A;  1ZRF A;  3S7E A;  5BY5 A;  5L7O C;  3M70 A;  1W28 A;  3CMG A;  1MS1 A;  1V9U 3;  2GH2 A;  2XGX A;  1NA1 B;  1D2Q A;  4HAN A;  1VP6 A;  3WDY A;  1NA1 A;  4N43 B;  3SIT A;  3HBZ A;  4NIH A;  1DCS A;  3ZXD A;  1W6M A;  2OZJ A;  1WW7 A;  3OYW B;  5CIS A;  3OYW A;  3ZDV A;  2YG0 A;  4D3W A;  1LUL A;  2ERF A;  2W0X A;  4QKB A;  1YC6 1;  1OQE A;  1S4C A;  1D0H A;  3OOX A;  1UPS A;  2RS1 2;  3THD A;  2ARA A;  4H2A A;  4HET A;  1C8M 1;  1OKO A;  4UI9 L;  1NCR B;  2UWA A;  4R8H A;  5FZI A;  1KJL A;  3IKW A;  4CEW C;  1NCR A;  3WG4 A;  1RYY A;  3IAP A;  1MEC 3;  3J4U H;  4LE3 A;  3S30 A;  3DKQ A;  4PHZ A;  4PDW B;  4CP2 A;  2B46 X;  1GKB A;  3PTY A;  1FOD 2;  2BOJ A;  4PDW A;  2BRT A;  3MF6 A;  5G05 L;  1LGN A;  1NOV A;  1S0C A;  1TNF A;  3OY8 B;  4WBB A;  5FMB A;  2Q8D A;  1LKN A;  2W3J A;  5GZF A;  4HSL A;  1GSL A;  1H4H A;  1RUD 3;  1X8E A;  1ZZ6 A;  2W46 A;  4UW3 A;  4XFC A;  3ZSJ A;  1JZ2 A;  2D98 A;  2W95 A;  4R9A A;  1TME 2;  4YGD A;  2K46 A;  1U5Z A;  2QVS B;  3HQR A;  2D40 A;  3POI A;  4Q0P A;  3G6J B;  1ASJ 1;  4I3P A;  5CU1 A;  1GP4 A;  3ACL A;  1WKY A;  3BTX A;  4MHR A;  2YYO A;  2EAK A;  3C7O A;  5LBC A;  4GWN A;  2VW2 A;  2JXA A;  2MNG A;  3CQO A;  1F5F A;  4RQP C;  5GJ6 A;  3FUO A;  5FZG A;  5FO8 B;  1VBE 2;  1TVG A;  1YQ6 A;  5A7P A;  5F5I A;  5FQ0 B;  5I0U A;  3U4X A;  3I3B A;  5HXM A;  3D4K A;  1F8V A;  5FQ0 A;  3KV9 A;  1BYH A;  4H14 A;  3NL1 A;  4W65 A;  4YW7 A;  4GD4 A;  3T08 A;  2W1S A;  4AVT A;  1FPN 1;  4KMQ A;  4URT A;  1Z7S 1;  1W8N A;  4XDO A;  1IZ3 A;  4OI4 A;  4NPM A;  2A6Y A;  2J1T A;  2WFP A;  3LPF A;  3VD3 A;  3HEI A;  3SMH A;  1VBA 3;  4PI2 A;  4C90 A;  3JXS A;  3SEE A;  2FCV A;  3E6D A;  4HMZ A;  2OPW A;  2MPF A;  2BNN A;  3HD8 B;  5DZE A;  3CHX A;  3FZ3 A;  1V6M A;  2NMO A;  4QQO A;  3RMY A;  1XYO A;  4QKN A;  4Q4V 2;  2CY6 A;  3FFQ A;  1WBF A;  2VCC A;  4FVV A;  5ERL A;  1DDL A;  4AED B;  5CYY A;  4DXS A;  1RUG 3;  1HB2 A;  1VE0 A;  1G7Y A;  3AZY A;  4E4Z A;  3CNA A;  3JBG 3;  1X33 A;  2WRA A;  3RYP A;  1ODN A;  3WDW A;  4CDU B;  3VDD A;  1V00 A;  2EAL A;  5L9B A;  4XE9 A;  2BGO A;  4L0P A;  1AX1 A;  4BH9 A;  3OGR A;  1C28 A;  3KT1 A;  4W4Z A;  1PIV 3;  3WUC A;  1JUI A;  2OXB A;  1DQ4 A;  4HFS A;  4UXA A;  4DS0 A;  3HNY M;  3N7L A;  2A6X A;  2DU1 A;  1R09 2;  3JD7 3;  4QX0 A;  3UKT A;  3ZFF B;  3ZFG C;  1TMF 3;  3BUC A;  3ZFF A;  2PMW B;  1US2 A;  1UU6 A;  1AR8 2;  4MGY E;  3BOD A;  4KWJ A;  5FXZ A;  5FZ8 A;  1JTZ X;  1DLL A;  4QGL A;  2RS5 1;  2VBD A;  5GZG A;  5HPO A;  2JIJ A;  4HPK B;  5KXD A;  3DYO A;  3MID A;  1HKD A;  4HPK A;  3WIN E;  1JZ5 A;  2JDY A;  5T5P A;  1JZ4 A;  2P3J A;  1C1F A;  2B7Y A;  5JI7 A;  1BBT 2;  2Y38 A;  1DGW X;  2VD7 A;  1D4V B;  2DCJ A;  3E5X A;  1PGS A;  2X53 S;  4P9G A;  4AEK A;  5A6Z A;  3VBS C;  3MIB A;  4BK4 A;  5JSR A;  3LOB A;  4UFH A;  1QEX A;  3A0N A;  4XDP A;  3VBF A;  2VZP A;  4XTP A;  2XKP A;  2JDU A;  1ENS A;  1YFY A;  1RMU 2;  2CNA A;  4HKL A;  3KV5 A;  3VKF C;  1CZS A;  1JHN A;  3THT A;  2V4V A;  1YQ5 A;  3VBO C;  3DEC A;  4AI9 A;  2MEV 3;  3W58 A;  1GZ9 A;  1Q8Q A;  1LNS A;  4NRM A;  5FTT C;  4NRQ A;  3LA7 A;  3AJY A;  4BQ2 A;  3WF4 A;  5T5L A;  1LEC A;  2HWD 2;  4NHL A;  5K0U B;  5LBF A;  2JWP A;  5K0U A;  5IAX A;  4AI0 A;  1GV9 A;  4GB3 2;  5F2S A;  5IW0 A;  2FHR A;  3NJX A;  1GNZ A;  4Q29 A;  3TEX A;  4DY5 A;  2E7Q A;  1VJ2 A;  4OHZ A;  2Z5W A;  4P9Y A;  5M0T A;  2R0F A;  1WW6 A;  4LHK A;  4XAC A;  4QD2 A;  5LCW L;  2C1F A;  4Z07 A;  4KWL A;  1AR7 3;  3RVH A;  4BMB A;  2DWR A;  2HWF 2;  1RL3 A;  2R06 1;  3NKG A;  4YG3 A;  5JOY A;  4Q0V A;  5EXO A;  1WMD A;  2H0B A;  1LGB A;  3ZIX A;  2HYK A;  3H42 B;  3MBW A;  1NXM A;  4HG6 B;  4LKE A;  5FZK A;  5KHG A;  1LR5 A;  4CCD A;  5L7O B;  5LWB A;  1JOP A;  1R1A 3;  4DUX A;  1G8W A;  2CGO A;  2ZTN A;  3L2Y A;  4IE5 A;  1PHM A;  1PX4 A;  2AEY A;  2R49 A;  5F2W A;  4CPB D;  5A1L A;  3AP6 A;  1EAH 3;  4Y1X A;  2BBV A;  4AQ2 A;  3HBK A;  2G4I A;  3QCW A;  1SBE A;  5JOW A;  1CWP A;  5H9Q A;  2GNM A;  3I59 B;  4AEJ A;  2FMY A;  1O7F A;  1XNT A;  3GAL A;  2D5F A;  3N9L A;  4PQQ A;  1RUI 1;  5LAS A;  3OEA A;  5HCB A;  5JIA A;  1VPH A;  1W8F A;  4QX2 A;  3ZN5 A;  1NLR A;  5SV5 A;  2PN5 A;  2ZMK A;  1CR7 A;  1UY4 A;  2WS9 1;  3CL1 A;  4CEW B;  2BP6 A;  2VW1 A;  4XFB A;  4N7I A;  2OKX A;  5IFT A;  3ZN4 A;  1ULE A;  1OF4 A;  4AFD A;  4MET A;  5JUV A;  1HXS 3;  2WO2 A;  3BAL A;  2PAE A;  1PZ9 A;  2ZKL A;  2R07 1;  4Q4X 3;  3WNN A;  2JKX A;  3AMM A;  4J25 A;  5C8C C;  2FQP A;  4HVO A;  5B4X A;  5KC5 A;  2PA7 A;  5JI9 A;  3KGL A;  1Z78 A;  2DVA A;  1VBE 3;  1PGW 1;  2ZMN A;  3M3Q A;  5H9P A;  2Q0A A;  1BLZ A;  1X8M A;  4BQW A;  1FMD 3;  2D6N A;  4AG4 A;  1POV 3;  1POV 0;  1RUO A;  1MPX A;  3K51 A;  1I9R A;  1W0N A;  4XJ8 A;  2R30 A;  2DBN A;  5EHD A;  1UZY A;  2PLV 2;  4GIQ A;  3RPQ A;  1JOJ A;  4RQP B;  1N1Y A;  1LJ7 A;  4XAE A;  1FX5 A;  4DEQ A;  1F5J A;  2RV9 A;  4ORF A;  3WLU A;  2BNM A;  4IGO A;  4K1Z A;  1AX0 A;  2RMU 1;  2YFZ A;  4QQP A;  2TBV A;  4NPR A;  5E16 A;  3UKV A;  1BEV 3;  3B93 A;  3WNM A;  2BWA A;  2QQU A;  4CDQ A;  5A32 B;  3OUI A;  4HVR A;  5A3M A;  2WFF 1;  5CKM A;  1ST8 A;  4Q4V 3;  5FYZ A;  2G1M A;  5DDJ 1;  3AFK A;  5A32 A;  4D6Q A;  2A6Z A;  1O5L A;  5FK8 A;  5ABJ C;  4JX0 A;  1WD3 A;  1HV0 A;  2B8M A;  4HON A;  4MLO A;  2YC4 A;  1A8M A;  4FPF A;  1V9U 1;  2WN2 A;  5GKA C;  1VB2 A;  2OS2 A;  1B09 A;  1ZRR A;  1S0J A;  2Y0I A;  2GP3 A;  4XF3 A;  2RR1 3;  4AK3 A;  2VW0 A;  3SKV A;  4P08 A;  1URX A;  1VBC 2;  3A0K A;  4RR3 C;  1UOG A;  2VNG A;  5A3N A;  4KNC A;  1SCR A;  1D0G A;  1FPN 2;  2RS3 2;  2WDB A;  4DRR A;  3E6B A;  4LO5 B;  1OA3 A;  3X29 B;  5LRS A;  1YQ8 A;  3FL7 A;  1IS4 A;  1E57 A;  1E5I A;  1R09 3;  4DXZ A;  3O1M A;  1MEC 1;  1EP0 A;  5LEK A;  3ZYG A;  2B39 A;  4XTM A;  4Y3O A;  5I0T A;  2UUR A;  3IWZ A;  2Y33 A;  5J7M A;  1W3V A;  2XR4 A;  3K77 A;  4XYX A;  1G9D A;  3NNJ A;  2ZGS A;  1G9C A;  5L9V A;  2GC1 A;  1VMJ A;  3ZFG B;  1RUD 1;  3ZSL A;  1S0F A;  4CA9 A;  1DYP A;  1BBT 3;  2OW4 A;  1JOD A;  4UW5 A;  4JC1 A;  1RXG A;  1PNF A;  2VGD A;  3J7L A;  1Y9Q A;  2ZJC A;  4WM8 C;  2Q8C A;  1JU3 A;  1UYZ A;  5BNN B;  1I5Z A;  2JJ6 A;  4COU A;  1H0B A;  3BCW A;  2VZ3 A;  2WLP A;  5BNN A;  2SBA A;  3M7A A;  4KH9 A;  3UT0 A;  1U5X A;  4P9J A;  3NNF A;  4P00 B;  2KD7 A;  1HB1 A;  3MGU A;  2ARE A;  2RJL A;  4YW2 A;  1LOC A;  4RGA A;  1UZ0 A;  3PMS A;  1FV3 A;  2ETE A;  2DYC A;  3ZPY A;  3HVD A;  4LUL A;  1H9W A;  3LIG A;  2WQ4 A;  1WCQ A;  2GU9 A;  4MGZ E;  3EMR A;  3H1W A;  5L9R A;  5JR2 A;  1Q56 A;  3MHZ A;  4FFH A;  5IWF A;  4AVS A;  1WLT A;  3VHN A;  4QKF A;  1JYI A;  1RUF 3;  1WA4 A;  3IT8 A;  1LEM A;  4TN7 A;  5FZ0 A;  3APB A;  2J22 A;  1VBA 1;  2I74 A;  4XCA A;  4GB3 3;  3POG A;  1NT0 A;  1CES A;  4IV1 B;  1JMU B;  3U0Z A;  4GWM A;  2WZR 3;  4IV1 A;  3VBO B;  4BXF A;  1W6P B;  2VTX A;  2DVF A;  3J9S A;  3PME A;  3VBO A;  3MV0 1;  1W6P A;  3D6E A;  1GP6 A;  1Y7B A;  3LFM A;  2VOW A;  3M3E A;  1ZZC A;  3ES4 A;  5T5O A;  4NII A;  1O8S A;  4ARX A;  1XU2 A;  2DCK A;  2YZ4 A;  1RIR A;  1UZZ A;  1VMH A;  1C3H A;  2HWF 3;  1KS4 A;  4LE4 A;  1GLH A;  2D3R A;  1F15 A;  1RUG 1;  3KMH A;  2NLR A;  2BPA 2;  4R4Z A;  4NJ4 A;  2WZ8 A;  3I8T A;  3U78 A;  2Z69 A;  3JBG 1;  1JHJ A;  2F4P A;  3M3I A;  4IEV A;  5C3P A;  2E51 A;  2AUY A;  4MAD A;  1AJK A;  4NO4 A;  3I2H A;  3RRD A;  1QJU 1;  3AZW A;  1LHV A;  4YVW C;  3GBF A;  4X6Q B;  3H8R A;  4V2V A;  4Y1U A;  2V72 A;  3POY A;  3VKL A;  4XBL A;  2VNO A;  3OGG A;  2E7A A;  1O4Z A;  5FZM A;  1PIV 1;  5C9A A;  3ES1 A;  3DUI A;  1T6B X;  3USU A;  1CQ9 A;  3IDC B;  3OD0 A;  3AP9 A;  5BNQ A;  1PO1 2;  3H3Z A;  2R16 A;  1VBB 2;  3JD7 1;  1O6U A;  1SFN A;  2OUH A;  5AC9 2;  2GN7 A;  3N4M A;  4LIV A;  1MS3 A;  3KQR A;  2P6H A;  1VAL A;  4OUE A;  5F9T A;  4O9G A;  1QQP 1;  3IZO A;  4MGK E;  4W8J A;  4CP9 A;  2GNB A;  3K46 A;  4M3C A;  1YUD A;  1SFY A;  3VD4 A;  1FYU A;  5FRA A;  4O9E A;  2JDP A;  3RJ2 X;  3VDB A;  3RZZ A;  5C4W C;  4WZC A;  5AVA A;  2RM2 1;  3VZO A;  2UWC A;  2XJP A;  1CJD A;  3AYD A;  3AB0 A;  2BNO A;  2CGN A;  2AC1 A;  3OBZ A;  3PUH A;  4CEY B;  5JAX A;  1K3I A;  4JZR A;  2XJQ A;  4XXA A;  4E4H A;  3BVC A;  5A80 A;  4CEY A;  1PVX A;  3E1F 1;  3VBU C;  1ULP A;  4AAX A;  1IQD C;  5FZ3 A;  1OH3 A;  3HWJ A;  3BYW A;  2PLV 3;  1SFP A;  4XUO A;  1OFN A;  3EHK A;  4OUL A;  4C1W A;  1N1V A;  4OUM A;  1UXX X;  1RUI 2;  2WQZ C;  2RE9 A;  3ACH A;  1RJ7 A;  4A45 A;  5JOZ A;  3ZMN A;  4F7Z A;  3VLB B;  5ANN A;  1GNY A;  1UXZ A;  3ZXJ A;  2WS9 2;  2MEV 1;  5DMY A;  2IWG B;  5FZF A;  5LK5 A;  2EIB A;  1O3Q A;  1YJK A;  1LGC A;  2GMP A;  2WR9 A;  2XLF A;  4IGQ A;  4P9W A;  4W6X A;  1YEW A;  2EIG A;  4FOY A;  4N8M A;  3OPT A;  4RHV 2;  3JB8 A;  3ZPO A;  5FUN A;  1W6N B;  3ZN6 B;  3Q8B A;  4FPO B;  3BI3 A;  2R07 2;  1W6N A;  3ZN6 A;  5CA6 A;  2WQ8 A;  4FI9 A;  3RS6 A;  2QCS B;  3O1V A;  3T2T A;  2WLQ A;  4JRA A;  3W9A A;  2Y6J A;  1QJF A;  4H7M A;  3N7J A;  2DFC A;  4LBQ B;  5B2G B;  1JS9 A;  4YRD A;  2VUL A;  5DZG A;  3NV1 A;  1VBC 3;  1L7R A;  3ZXE A;  5ABJ B;  4QM9 A;  4XJA A;  1RHI 2;  1YFW A;  2RS3 3;  1R1A 1;  1JYX A;  2RS1 1;  3OUH A;  1F9K A;  2PHF A;  4BA6 A;  1SPP A;  2WNE A;  4ONU A;  4AQS A;  2JX9 A;  2RVA A;  1EAH 1;  1V6N A;  4GZ9 A;  3SCH A;  3WY6 A;  4Z92 B;  4MXW B;  2P5B A;  3U10 A;  1LEN A;  2GAL A;  2VZQ A;  3EJK A;  1ZNP A;  4RR3 B;  1ND2 A;  4YWA A;  2XQR A;  5EYX A;  3RNS A;  4MSV A;  4AYU A;  1RUJ 3;  2VMH A;  2EAA A;  1ONA A;  4HXC A;  4Y33 A;  4OFG A;  3WQ0 A;  3T4V A;  3P3N A;  3RGB A;  4FAH A;  5C71 A;  1KDK A;  1XB9 A;  4IEQ A;  5HV4 A;  3VDC A;  2D3P A;  2YU2 A;  2YBP A;  2OQ6 A;  4Q1R A;  1DFQ A;  4UT5 A;  4KU7 A;  4XFA A;  2D6M A;  3I2F A;  2VQA A;  5A7O A;  3POF A;  4GAL A;  3KZ4 C;  4QX3 A;  4Q4X 1;  5C3Q A;  3PUQ A;  4A2U A;  4KG8 A;  4OHV A;  3T0B A;  4N9I A;  2WZP P;  1HV1 A;  2XVG A;  5JCT A;  1VBE 1;  2IVJ A;  4OI2 A;  4WM8 B;  3CDZ B;  2ZHN A;  4ZS2 A;  4QWN A;  1NX9 A;  1FMD 1;  3C2U A;  4NOT A;  2PQQ A;  3RQ0 A;  1POV 1;  4LMF A;  4L97 A;  1KJR A;  3HOB A;  3A7Q A;  4CUB A;  3AM2 A;  2RHP A;  2X5I B;  3A4U A;  1N3P A;  3AP7 A;  2X5I A;  3ZKU A;  1DBN A;  5CFC C;  5E1R A;  3GHM A;  2FDF A;  5A33 B;  4NIA A;  2E9Q A;  2W1U A;  4AL9 A;  5FMO L;  1Y9G A;  3ENR A;  1RUD 2;  3S0M A;  1AL2 3;  3U11 A;  3BPS A;  3MDP A;  3ATG A;  1BEV 1;  4XDQ A;  5FO7 B;  3SLI A;  2W39 A;  4GQ7 A;  3NNL A;  1KDM A;  4Q4V 1;  4PBP A;  1NQJ A;  1JUH A;  2QDN A;  4UAP A;  1J84 A;  1SLI A;  1C4R A;  3WG2 A;  3GJA A;  1JH5 A;  3J26 N;  3R0R A;  3I2K A;  4IEY A;  1RIN A;  4Q8L A;  4AI2 A;  4JAA A;  1TZO A;  1ZA7 A;  1OC1 A;  2TUN A;  2WO7 A;  1QXJ A;  2PHR A;  5IK5 A;  4NHM A;  3ZYI B;  2W91 A;  3DF0 A;  4YW1 A;  3NO8 A;  4YVS A;  1SZB A;  3I97 A;  3CO2 A;  2WZE A;  2VVF A;  3MUZ 1;  3ORJ A;  4GH4 A;  4V1P A;  5GZD A;  3KQ4 B;  2Y6H A;  4BQ1 A;  4XFF A;  3DYP A;  3ZX7 A;  1YWK A;  1D4M 3;  4OHW A;  1FXZ A;  4HZF A;  1ACC A;  2Q8O A;  1VBA 2;  2NPI A;  5JPN B;  1R09 1;  2DDU A;  1VBB 3;  2XUE A;  1XBF A;  2EA7 A;  4UOJ A;  4OMD A;  5FYU A;  1ZRC A;  4GXL A;  1MQT B;  1IGO A;  4YVW B;  2WSV A;  1P8J A;  1MQT A;  4JDM A;  1H8V A;  2QQO A;  2JE8 A;  5FLJ A;  2HH9 A;  2YB7 A;  5HCH A;  2UYA A;  4IER A;  3VDD C;  3OBR A;  2NP0 A;  2YPD A;  4YLZ A;  5IVF A;  1QOT A;  2FDI A;  5KBF A;  4RSU A;  4YNI A;  1CPM A;  2D6L X;  1RUG 2;  1BBT 1;  5HXV A;  1DQ1 A;  1DGL A;  1WZX A;  3Q8C A;  1A8D A;  2P37 A;  3KHB A;  3WSO A;  3PDQ A;  1LAJ A;  3ZFF C;  3VGI A;  3WF2 A;  1QDC A;  5J36 A;  1SG3 A;  4FPL A;  5EJZ B;  2D97 A;  3O1O A;  1J1L A;  2J7M A;  2DUR A;  1O59 A;  4EZH A;  4A41 A;  1LCL A;  4QHZ A;  3JQX A;  2J1S A;  2QQV A;  2W87 A;  5C4W B;  5IK7 A;  4FPJ A;  5FXV A;  5C4W A;  4EN6 B;  1RMU 1;  3BIE A;  3EXU A;  5A1A A;  1W9S A;  4OLL A;  4CU8 A;  4J1X A;  1OLQ A;  2GNT A;  4I0A A;  1CAU B;  1TMF 2;  4ATF A;  1CAW B;  3IB3 A;  5IK4 A;  1RVF 3;  3VBU B;  3BU7 A;  1OH4 A;  3UES A;  1CAW A;  4A7K A;  4L2N A;  4XBQ A;  5JZG C;  1CZV A;  3VBU A;  2WYS A;  1NG0 A;  1UU5 A;  5HV0 A;  4AFB A;  4BXS V;  3PIJ A;  5SV8 A;  4QDQ A;  1J83 A;  3SC7 X;  4GB3 1;  4RHV 3;  3VBF C;  4BLI A;  3K4D A;  1F4A A;  4G9S B;  3AX4 A;  3WHT A;  2WZR 1;  4D8M A;  3E6C C;  3WDX A;  2B5H A;  3HIF A;  5FJK A;  1DYK A;  1AF9 A;  3JU9 A;  1YNA A;  1E5S A;  5A7W B;  1HQN A;  2ZEY A;  3AKT A;  2XXZ A;  5L73 A;  3C7E A;  2KR2 A;  1YQ2 A;  3NJV A;  1SQ4 A;  2Q1F A;  3LIH A;  2ZAB A;  5FYB A;  2HWF 1;  1UYY A;  1OLM A;  1VBD 3;  1IS5 A;  3N9Q A;  3FWE A;  3ZR6 A;  2IXI A;  2J1U A;  1W39 A;  1RGS A;  4Q5O A;  4XUP A;  4Y24 A;  3D0J A;  5K0U C;  3WNP A;  2E31 A;  3SH3 A;  5FYY A;  4COV A;  2NMN A;  4IND A;  2Y34 A;  2F17 A;  1ULG A;  4LEJ A;  3BB6 A;  4K21 A;  2MEV 2;  4XXP A;  3NQH A;  1X82 A;  5TSW A;  4OI0 A;  4R4X A;  2B42 B;  4UFK A;  1SLT A;  4R9D A;  1PM7 A;  4FTS A;  4ASL A;  2DBI A;  1RUE 3;  1PO2 2;  4UF0 A;  2JDA A;  3E5Q A;  4LJH A;  1V6K A;  3URF A;  1GFF 2;  3PU8 A;  4L8Q A;  3WOG A;  2GND A;  2L9L A;  2DCT A;  3F95 A;  2B45 X;  4IE7 A;  4X8P A;  1IPJ A;  2QNK A;  3KB5 A;  4YW6 A;  3PVO A;  1AR7 2;  5FMO S;  1W6M B;  4YGB A;  4GMP 3;  4CCM A;  5FIX A;  4HSJ A;  1CN1 A;  1LOD A;  5JXH A;  4LHS A;  4YZ2 A;  1QJY 2;  2DU0 A;  1HX6 A;  4XOG A;  4IEW A;  4QAW A;  5GLW A;  5J98 B;  1H2M A;  4OI1 A;  1R1A 2;  4BOW A;  5T3N A;  1RUH 2;  4P5H A;  1XYP A;  3BU0 A;  1ZBE 3;  1S0D A;  1X36 A;  1EAH 2;  4FPK A;  4HT1 T;  1QMJ A;  4WVW A;  1WD4 A;  1QJX 2;  1NY7 2;  2G9G A;  5F6L B;  2Y6G A;  1BMV 2;  3IMN A;  3P1I A;  2PLV 1;  5APA A;  5LA1 A;  2H0V A;  4QHO A;  1GQH A;  2V5Y A;  4A6S A;  4MOA A;  1AUY A;  2R1B A;  4IEO A;  1UZW A;  5A3O A;  3OTF A;  1GIC A;  1K5M C;  5F5A A;  3EQE A;  2P2K A;  4GA9 A;  4AHX A;  1V6L A;  3OPZ A;  5I8Y A;  2P3Y A;  5F3C A;  4MGQ A;  5DG1 A;  4LBL A;  4BIO A;  3VUO A;  5CFC B;  3QAC A;  4QPG C;  2ZPX A;  3ROU A;  2CAU A;  1HXS 2;  1OXC A;  5CFC A;  3R4U A;  3MLL A;  4PLO A;  1FAY A;  1MS5 A;  1GOG A;  4L11 A;  4Q4X 2;  4Q1P A;  3C8X A;  5HI0 A;  1DQ6 A;  4OHY A;  4TXW A;  3OCP A;  3K48 A;  4Y22 B;  4Y4Y A;  1H1A A;  2BEO A;  1OPM A;  1H2L A;  4Y22 A;  1W99 A;  1XE8 A;  1JI6 A;  2HBU A; 
#chains in the Genus database with same CATH homology
 5A6Y A;  1OVS A;  1UZV A;  2JDY A;  5A3O A;  5A6X A;  4CE8 A;  5HCH A;  2JDN A;  1OVP A;  2WRA A;  1OUX A;  5A6Q A;  2VUD A;  2BOI A;  2JDH A;  5A6Z A;  2JDK A;  3ZDV A;  5D2A A;  2BV4 A;  1W8H A;  2JDM A;  4UT5 A;  1OUS A;  1OXC A;  2CHH A;  2XR4 A;  1W8F A;  3DCQ A;  2VNV A;  1UQX A;  2JDU A;  2VUC A;  2BP6 A;  2JDP A;  4AOC A;  2WR9 A;  5A70 A;  2BOJ A;  1OUR A;  1GZT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...