2BP6A

Crystal structure of pseudomonas aeruginosa lectin (pa-iil) complexed with a-l-galactopyranoside
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
114
structure length
114
Chain Sequence
ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lectin
molecule keywords PSEUDOMONAS AERUGINOSA LECTIN II
publication title Binding of Different Monosaccharides by Lectin Pa-Iil from Pseudoman Aeruginosa: Thermodynamics Data Correlated with X-Ray Structures.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 20
structure length 114
sequence length 114
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07472 PA-IIL Fucose-binding lectin II (PA-IIL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.400 Mainly Beta Sandwich Jelly Rolls Calcium-mediated lectin 2bp6A00
1W8FA 2BOIA 1OVPA 4CE8A 2VUDA 1OURA 2JDPA 2VNVA 1OXCA 3DCQA 2JDUA 2WRAA 2BP6A 2WR9A 2BV4A 1UQXA 5A6QA 5HCHA 2JDYA 2JDKA 5A6XA 3ZDVA 2BOJA 1OUSA 2JDNA 2CHHA 2XR4A 2JDHA 1W8HA 1GZTA 5D2AA 2JDMA 5A6YA 1OUXA 4UT5A 5A70A 4AOCA 5A6ZA 2VUCA 1OVSA 5A3OA 1UZVA
chains in the Genus database with same CATH superfamily
5JOYA 2EXHA 2E51A 4N7IA 4YW2A 1APNA 2DCJA 2AYHA 3LSEA 4META 3TN92 4XFCA 3TAYA 4Q29A 3SCFA 3SITA 2ZTNA 2FDJA 1CD3G 3T2PA 3GXUA 2B7YA 4FAGA 2ETEA 2QBXA 3O0XA 1SBFA 2V72A 1DGWA 5IVFA 4YFZA 2LM3A 1OBNA 3KD4A 1PO23 4Y1YA 1V6JA 2AEZA 5A7PA 2Z2SB 1D4M1 3CJIB 5FMOL 3PURA 4QKBA 1SPPA 4ATFA 5FUIA 3V0AB 1GU3A 4CEYB 1MACA 3VHPA 4EN0A 1LODA 1CIYA 1UY2A 2XKOA 1W8FA 4B1LA 4ISQA 2V4VA 2AGSA 1AL23 1PVXA 2WQ8A 1QJY3 5F3IA 4DS0A 1PVC2 3VBOC 3C7FA 3VD3A 4KWUA 1J3QA 3LDKA 3BKZA 1NX9A 3I2DA 4GWNA 2DVGA 5FZ4A 2K2SA 1RUH3 3OYWA 2GC0A 2ZS6B 2E26A 3O1PA 4MVTA 3RMXA 1R091 3CF6E 1NY72 3VBFB 3ZN6A 1SLLA 3K46A 4Q4Y2 3KT7A 4H7MA 4CDXA 1S0IA 1QH7A 4OFGA 2CY6A 3H0OA 1RUE2 2A6WA 3H8RA 4TXWA 3SH5A 4GMP3 3QACA 1OVPA 4QDRA 1XQNA 2A71A 3J7MA 3TEXA 4AEKA 4CDQB 1I1EA 2FZ2A 1TG7A 2PYTA 1K12A 1NXD1 1QH6A 4K8FA 5E8AA 2VZOA 4DINB 1FV3A 5FYCA 2V09A 3RZHA 1PZ7A 2CTVA 2Y0OA 4XF0A 2W1SA 3VL8A 4LO6B 3ACHA 4F3JA 3AXDA 1AJKA 1IS5A 3OUIA 2RJLA 3DPRC 1LKNA 3MYXA 1PMJX 2P1BA 2WQ4A 3A7QA 3MPBA 2YU2A 5FUNA 3KV9A 3KV5A 2JE7A 1STMA 4LBQA 4R8HA 3ZXLA 1URXA 2CWSA 1VBA2 2J22A 4GJZA 3AVRA 3PIJA 1US3A 4HLTA 2VMIA 4XJAA 3WW3A 4GQ7A 3UT0A 2R1DA 5DUWA 1FYUA 2JG8B 1E5RA 2WS93 1DCSA 4L0PA 4PLNA 4XBNA 4Z92B 1OFNA 3A0KA 3U4SA 1O5LA 4MGSA 1DLLA 3RZKA 1FV2A 4DIQA 2P4EA 5F2WA 4JGZC 5AC91 2VW0A 3WW2A 4K8RB 3ZLIA 2TNFA 1GWMA 4JKMA 4JGYB 1LRHA 4YG6A 3PVEA 3ZDSA 2XQRA 1TNFA 2XUEA 3QD6A 1H8TA 2JDKA 5DZFA 4DB5A 1POV3 1PK6A 2VZVA 1J59A 1NLSA 5T5PA 3POYA 5EJ1B 4HSJA 4AGRA 1O3RA 3TEWA 5KR7A 2HWD1 2J1EA 4K1ZA 5F9TA 1LAJA 3V56A 5EV7A 2VMEA 3WSOA 3Q8BA 4IV3A 1UZ0A 3OG2A 4XBQA 2VUDA 4WZCA 3WNNA 5I0DA 1IPSA 2QFEA 2SLIA 5FTTC 4CU8A 3I3MA 5CFDB 2YY1A 2MEV1 4Y22B 1MZ6A 2Q8EA 1C1LA 1UF2C 2Q5TA 4KH9A 3ZFEB 3OSDA 1QXRA 3H50A 3OBAA 4WVWA 3ZIWA 4HVQA 3WF1A 5CNAA 1VBC2 3GF6A 1PNFA 4IXLA 4DNYA 2TEPA 2YHJA 1BKZA 2V73A 1PNGA 1Q8SA 3AM2A 4IEUA 2RJKA 3B9CA 3R05A 4NPMA 2IXCA 2J1UA 4FOYA 4LO4B 1BJQA 3OBTA 4QXKA 4Q2FA 4P5YA 4QU2A 3WDWA 3W5MA 2ZGSA 2DUQA 4Q0VA 1ACCA 1NOVA 1FOD1 4P5HA 5AFBA 2P6CA 5CB7A 4MYEA 5FZAA 2H0VA 2HWB1 3GJAA 3LFMA 4CP9B 3I2FA 2BWAA 1W2AX 3NRUA 2G9FA 2BP6A 4N53A 4YZ2A 5M0TA 4Y24A 4D0QA 4OHWA 5C8CB 2JXAA 4QHOA 4W6YA 1U5IA 1GP6A 2DCYA 2XJTA 4Z2WA 1RTVA 4JRLA 1RUF1 3I2IA 2JDYA 3HAGA 4Y4RA 4QX3A 5FPUA 3G7DA 3KMHA 4FPOB 2WJSA 4QGLA 3N7JA 2WO2A 5DG1A 3M3OA 1WW5A 1I9RA 2VR4A 4GB33 4D6QA 3OGJA 4NMIA 3I2OA 3TEZA 1OVSA 2WFF1 4COYA 1G9DA 4I02A 4LEJA 1V9U2 2QQVA 1GV9A 1W2UA 5FZOB 2P17A 4R4ZA 4AHYA 1RIRA 2D7FA 2HWE1 4OUEA 3BTZA 4FOQA 2RS12 4H2AA 2RMU3 2WZR3 3OPWA 4OMCA 4QX7A 3B01A 3BN6A 4WM8C 5FZ7A 1KD7A 1V6IA 2JB8A 1JN2P 4R4XA 5FY4A 5HPOA 3RZLA 3BOWA 1W6MA 1VRH2 2XR4A 3I3BA 5FMCA 4EZ4A 1LHOA 4LO8A 3IMNA 4AQ6A 2A75A 1UU4A 1MEC3 2XLFA 1CAVB 1ULPA 2CGNA 3PL0A 4J1WA 4V1PA 3WP5A 4YZ1A 5BNQA 2K46A 1REEA 3N7LA 4NHMA 1UZVA 1RMU3 4QX5A 2ZZJA 1QJEA 3HVDA 4UFJA 4XTMA 5C8WA 4X8NA 4XBLA 3SEEA 2JENA 2EIGA 4E8DA 1KQRA 1HN0A 2ZAAA 3MIFA 4XFBA 2WZ8A 2PHUA 3PTYA 4L8QA 1QQP1 1YIFA 1W8NA 2WIIB 4DO0A 2VZUA 1POQA 4A44A 1ULGA 4XAEA 2D43A 4RA0A 3PTRB 1AR82 4Q4W1 2W52A 3VGIA 3GZUC 2GC1A 3LWCA 2PHLA 4LTAA 1OOPA 4QQHA 3J8F3 2CDPA 2LTNA 4GH4A 4K9SA 4L11A 1F4AA 2LALA 1RVF1 5DPNA 1Y9QA 1UPIA 3K51A 2BRTA 3HJRA 1REDA 1WWYA 3H8XA 4UFHA 2D40A 1KRIA 3DGTA 2RS31 3EYPA 3ZKUA 1UOFA 3FWEA 2ZHLA 4RS5A 1VBD3 1WZXA 4YGBA 1ULCA 1O3QA 1HRI1 3ZIXA 5A32A 2D6OX 2HWC2 2ZGLA 1QJU3 5GZEA 2X53S 1NAEA 4QX8A 1MS0A 3PHMA 1HB3A 2A1XA 4LA3A 4IEXA 1TME1 1OLRA 1SBEA 1WCQA 4RHV2 4DY5A 4HANA 5L7OA 1RHI3 2UWBA 1PGW1 3DKWA 3FE5A 2QQUA 3AP5A 5DXDA 3SH3A 3QH7A 5JXHA 4YVWA 1N3PA 5A7OA 4QPYA 2XL7A 3M3EA 1RJ8A 3AJZA 3N9LA 1XU2A 4OI0A 3N4MA 5C9AB 3ROUA 2VNGA 2DVAA 3POGA 2EXKA 4BQ5A 1MQTC 1AR92 1QIQA 5LEKA 5A7WA 1IPKA 1GNYA 4TN7A 2FDFA 1OXCA 4XXPA 3V65A 4YM0A 1TMF2 2UWAA 4LBOA 2BJSA 1DP0A 5FYYA 1FMD3 1GWKA 3KT4A 1YI7A 3VDDB 3V64A 3WV6A 3PVNA 1PIV3 1ND3A 3OF1A 2R32A 4LBLA 4FI9A 5FYIA 3ZFFA 1UY1A 1NLQA 5F8PA 4EE2A 3ILNA 3WVJA 3AMNA 4BLJA 1V6KA 5F32A 1OUSA 4XMIA 4B29A 2W68A 4LBNA 4BK5A 2R073 3SKJE 2XWJB 5A70A 5J7MA 2QQIA 2VMGA 3O1TA 5FWJA 1DQ6A 1OD3A 1GLHA 2BUKA 3ZSMA 5IWFA 1EV13 2ENRA 1GOHA 4QQOA 1GP5A 2DCKA 4LLOA 4P9WA 3PJYA 1G9AA 1I5ZA 5BNNA 5L9VA 3ZVXA 1IZ3A 5LB6A 3ZFGB 3LA3A 3KLSA 2BZDA 4YVSA 2OQ6A 2P3KA 3MUY1 5DUUA 3IBMA 4XJ8A 3AYAA 2W92A 3PIGA 5F37A 2ERFA 5LY2A 3ZR6A 2Y33A 2D3PA 3KVAA 3RWNA 4D6RA 2RS52 2VZ1A 5FJHA 1RUJ1 2OQ7A 4Q0QA 1Q8VA 4CDWC 1QDCA 3LE0A 4E4SA 2GU9A 3RWKX 5ABJC 3WQBA 1YO8A 5CFCB 2BVBA 3OEBA 3X29B 4YW5A 1RUOA 4COZA 3QLQA 2YC4A 3VD4A 1DZTA 5BPXA 2Y6FA 3VBHB 4BQ2A 2EXJA 2R30A 3MLJA 5FP4A 4W6XA 2HBTA 5K0UA 3WG3A 1Z7S1 2UY8A 1H1AA 1F5JA 1H2LA 2ZPXA 1JYTA 4P9YA 4B7KA 3FL7A 2C26A 2XKPA 1BEV2 3VKNA 3THPA 2WNVA 2FD8A 4NVPA 4HN1A 2IFRA 5FYMA 5F3EA 2BBAA 3THDA 4E27A 4RFRB 2WO3A 3FN9A 3RVHA 2VUCA 1YQ8A 4A2UA 1ZM1A 1TNRA 3HNYM 1SCRA 4LXLA 4ZU4A 3W20A 2UYBA 3UJOA 2PA7A 4YLZA 3CJXA 3HT2A 3WINE 3KT1A 4OZXA 3ZSJA 4EYUA 4L9BA 3DCQA 4FOVA 2HJIA 1OA4A 1RUG1 3VHNA 1N1VA 1DFQA 1VBE1 1WLDA 3KZ4C 5FJKA 5C4WC 2ZGPA 1WLTA 1ZZ9A 4NIDA 2ZGRA 2QQLA 3UKVA 2PHFA 4FPYA 3USUB 1ASJ3 5FLJA 2OYZA 2AH2A 3ZYGA 1DQ2A 1LHUA 3VUOA 1RUI1 1S0GA 2CHHA 1HKDA 2OW4A 1O4TA 2VD7A 4M0NA 3RYKA 5LY1A 4FBFA 4AGGA 4HPKA 2BPA2 4X8PA 1DGRN 3NJYA 5F1RA 4AXOA 2W95A 4PBOA 4FFFA 3IT8A 2LUWA 3POSA 3UKNA 4OUMA 3D82A 2YPJA 4JAAA 5JR7B 4MGKE 5C3PA 4MV2A 4LUMA 5TSWA 2WZEA 3IIIA 3HOBA 1U5YA 3N7KA 4MGYE 4CCOA 1YQ6A 1QOTA 5B4XA 5FO9B 4RL7A 1ND2A 1POV1 5JSPA 2DUOA 2JDNA 3ATGA 5JCTA 3H9AA 4QXBA 4FFIA 1NCRC 1VALA 2DDUA 2JG9B 3FMGA 5KHIA 1VBB3 4XUQA 4XAAA 4G9SB 1JUHA 1C8M1 3N9QA 4ASLA 2DURA 4CP1A 4CU6A 1YI9A 4L2NA 1ZZBA 3GNEA 4Q4X2 5AVAA 2ZACA 2VZ3A 1D2SA 1KJRA 5KHKA 4LHLA 3VHRA 1QJX3 4WVMA 1AL0G 2EAAA 3NJXA 2NMOA 3MGUA 3I7DA 1MPXA 2CYFA 5AFEA 2YROA 1ENRA 1W9WA 3OGSA 3OUJA 3T2OA 4BE3A 4BQ3A 2YPDA 1XSRA 2DTWA 1RJ7A 1W39A 1ZBA1 2O8QA 2R1BA 2VMCA 4NAOA 5LW9A 1DHKB 5DN2A 5IAXA 1ZRFA 1AX2A 3IDEA 1RC6A 4LJHA 5IVYA 4CP2A 4XVHA 5FZ6A 5CAZA 2QQOA 4Y26A 1I6XA 2L9LA 5A6YA 1QDOA 5BNOA 1JYVA 3PJQA 2VQ0A 4ZS2A 3FUQA 1LNSA 1OLME 4H3WA 1VAVA 2HWD3 1WW4A 1PX4A 1W6QB 3O1VA 2WLPA 4D7YA 3E6BA 3MO4A 2Q1MA 1HQWA 3U37A 1KDKA 1W6PA 2WRAA 3SCGA 1H8TC 1W06A 4IGPA 1PK6C 5LRSA 5CEHA 1DQ0A 4R9BA 3AKTA 4N9HA 1W6NB 4IUGA 4K1YA 1AZDA 1QOSA 1L7QA 4O7XA 5HCHA 3ALQA 1NCQA 3ZDVA 4K21A 1UWWA 5J1XA 3PMEA 1C28A 4XPVA 1WBLA 1JOPA 4O65A 3A21A 3U07A 1IQAA 4GB31 4IV3C 2NQYA 1IOAA 3WF4A 3FJSA 1H9WA 1AXKA 1WMXA 3H1WA 2OPWA 3LD8A 1L7RA 3OY8B 1OLMA 3AKPA 5A3OA 2XJPA 1W2OA 4QPGA 1HLCA 3GZTB 4GWMA 1FOD3 4RGAA 1RUE3 3BOPA 1J3RA 2HWB3 1IS4A 2ZKLA 4GZ9A 3VBSA 1VMJA 3WHUA 5LBBA 4UI9L 3WF0A 4DY3A 3DPRB 3ILRA 4M00A 5C70A 4CUBA 4XJZA 4DXSA 5KWRA 4I3PA 5GLZA 2J42A 4AEJA 4NE9A 1RB8G 3N3HA 3POWA 4NHYA 2D44A 4HKWA 4K40A 3BU7A 3N9OA 1G9FA 1IG0A 3LDBA 5FUPA 2GMPA 4ATEA 3FUOA 4LKDA 5FLIA 3I54A 3KM5A 2WFF3 1ZX5A 1RMU1 5I0TA 5BUVA 4N53C 1QU0A 2WYFA 3TNPB 3HN1A 4JGZB 3RZZA 1VBA3 1X8EA 3RI9A 1CZSA 4XUTA 5ACA2 3M8LA 1MZ5A 1ODMA 5T50A 4PF1A 2BNOA 4AL9A 2Q8DA 1YC61 3WUCA 1UW8A 4Q4V2 3VKLA 3WCRA 1YFXA 2PHXA 4CTEA 1VAKA 3POBA 1UYYA 1UIKA 5F7UA 2XVLA 4FPJA 3UGGA 3D0SA 3Q8FA 1DQ4A 3I8TA 4AQ2A 4QX0A 2DYCA 4BM8A 1IHMA 4IV1B 3S0MA 5FZ1A 4LIVA 4QGNA 5J3UA 2A6YA 4IE7A 3ZSEA 3WW1A 1IS3A 1Y43B 2BERA 2R7EB 3J8F1 3T09A 5FP9A 2X8KA 1FNYA 4BPZA 4QU1A 1CJDA 2E9QA 2J1SA 3O1UA 2DU1A 4Q27A 1LULA 2ADDA 3T3YA 4IE6A 5FXVA 2WZPP 2ZZQA 1VBD1 2VOWA 3NVCA 3ZPYA 1CGPA 3MV01 5FYBA 1T2XA 4XTPA 4LBQD 4F83A 3MBWA 4G4FA 1SDDB 3WX5A 4MGZE 4I0AA 3IB3A 1YJLA 2FQPA 5EWSA 4B4RA 5EYYA 4FT8A 5FZBA 4NHKA 1E5HA 3V0BB 3SQOA 1KFXL 2NPIA 4PLMA 5FXZA 5BNPA 3W21A 4P9LA 3EB7A 3ZN5A 4IEVA 4HFSA 4YGCA 2E6VA 1PHMA 2XUMA 1JBCA 2WC2A 4IQPA 1SLIA 3VKOA 1GNZA 1S0EA 1VBC3 3LKJA 1K3IA 1RUD2 1RGSA 3VBUB 1CZVA 1MS9A 1Q3EA 3KS7A 3K77A 2FCVA 1Y7BA 4YZ3A 4DMIA 2RM22 3I3QA 4NN0A 2KXLA 4YARA 2RS33 1VIWB 2GNTA 1YQ5A 5JSOA 4JV4A 1FMD1 4C8DA 4Y20B 1HRI3 1F31A 3CBNA 1PIV1 2WDBA 4J25A 1XPWA 1OOPC 4CDQA 4QPIB 3CZUA 2R042 1NE4A 4GH4C 3FFZA 1AXYA 4QT6A 1F15A 4KG0A 3SNMA 1AR72 4OLLA 2QCSB 3NNMA 4KGQA 3BVCA 2JDMA 2VY0A 2R071 3D3AA 3I97A 1JXNA 2X05A 3TOJA 2LROA 5JAXA 3Q8CA 4RS5C 2AENA 2YBKA 2IVJA 5KBFA 4XFAA 2C4XA 5K8SA 2D5HA 2PHTA 5IVEA 1RUC1 5CYYA 3IPVA 4NUBA 5DDJ2 1W04A 4WM8B 2RDQA 3OEAA 1HB4A 5L7OC 1UXZA 1ENXA 2DCZA 2PELA 4MGIE 3B02A 5DZGA 5FLHA 3PLQA 1FT9A 4YVWC 4BXFA 3FHIB 4ORFA 2I74A 1GOGA 1GP4A 3QCWA 5FO8B 4YW3A 2VOKA 5IAVA 2JG8A 1OKQA 5JOZA 4BXSV 2DUPA 4EN7B 1RUNA 1IGOA 4MGTA 4MO3M 4UFIA 4Y1ZA 4A45A 1VRH3 3BALA 1CAWA 3MLLA 4AVBA 3I2GA 5JMCA 1UCXA 4JGYA 3IWZA 3J7HA 1ST8A 2A3WA 3RQ0A 2ZX2A 1VMFA 1HRV2 1VMHA 1COV1 1O7FA 4ONUA 3U4XA 4YPJA 1JOBA 1ND3C 4E8CA 2E63A 3KF5A 4LK6A 4XEZA 1H9PA 2XG3A 2VQAA 3ZFFC 2X5IC 3E6CC 1PGL1 3H1MA 3K4AA 5KXBA 2RJ2A 4S2HA 2UYAA 3WNOA 1G7YA 2Y6JA 5L9BA 3WDXA 1FPN1 3UK9A 5B2GB 1IKPA 3T4VA 4AR2A 4URAA 1X8MA 3LF7A 4XABA 5IFTA 5D2AA 1TEIA 4CA9A 1JZ2A 1N1TA 5FPAA 3D0JA 3P6BA 3PUSA 5CKMA 5G04L 1GMMA 2A6XA 2NYYA 3VDBA 2DTYA 2QKDA 1MR5A 1RUJ3 4MX3A 4BQWA 5C5UA 3ZFEA 1IPJA 5BNNC 1LU2A 2D6PA 3HQXA 3I3DA 4LLFA 3VZJA 3S7IA 1H6XA 5DG2A 5CG9A 3NV3A 4YVSC 4H55A 3A4UA 1GUIA 3JD71 2RM21 3RZMA 3LAGA 4IEZA 4BOWA 3PNAA 1FX5A 4JRAA 2ZGKA 1DG6A 5FK7A 1XNTA 4K7JA 2A6VA 1ASJ1 2YUEA 2HWC3 5EPAA 1FXZA 1Z7S3 5IUQA 5GZGA 5DAWA 4R9DA 1O3TA 2AZ5A 1UN1A 2R0HA 5CG8A 4RHV3 2AC1A 2VO5A 1MQTB 1VPHA 5E1RA 3RYPA 5I0SA 3OUHA 4YG0A 4R52A 4M3CE 4BH9A 4BISA 2YZ4A 3URFA 1UYPA 2E7AA 2ZMNA 1LECA 1OH3A 3ABZA 4GWJA 4D94A 4S2FA 4DUXA 2WABA 3ZXAC 4FQ4A 1B35A 4BIFA 5K0UC 1AR93 3ZM8A 1CONA 1RUG3 2FDHA 1NQJA 1VBE3 2CU5A 1H2MA 3AZXA 4QKFA 4QKNA 2WWUA 5FXWA 5D21A 2GC3A 1WW7A 2WNVC 1TMF3 3DEMA 5FZOA 2W94A 5JVVA 4ZXEA 5C3QA 1LHNA 3NQHA 4QQPA 2IXJA 3LPFA 1RUI3 5C6CA 1XB9A 2JDHA 2PLV1 4KNCA 3VD7A 1T6BX 3L9JT 1VBB1 1W8OA 2C9KA 3VZMA 2JIJA 4M3CA 2B4KA 3PMSA 3MFCA 4YZ5A 4AQTA 2AREA 1R1ZA 3WR0A 2YBSA 2FMDA 5K9YA 1CAUB 1OURA 2R6QA 3AJYA 3IIAA 5IJRA 1QJX1 4CYDA 1S0CA 3AP7A 5GALA 4SLIA 3ZXDA 1LGCA 4AEDB 4FPFA 2KD7A 2P2KA 5IK8A 4Q0UA 3WQ0A 4MLOA 3TN91 4DPNA 1CAXB 2JIGA 1DGWX 4CCNA 4D7SA 4UAPA 1F2NA 5A33A 4AZZA 4ASKA 3HEIA 4Q0PA 3SH4A 1ZZ8A 4CDWB 4D7TA 1H2NA 1X9PA 4WBBA 3VDAA 4I01A 4CEWB 5ABJB 4DRRA 1QY4A 2D93A 4B8EA 1BBT2 1N3OA 1C8M3 3O0WA 1UX6A 2D6KA 2R062 2JKXA 2RS53 4H7LA 4LBMA 4MZUA 4JKKA 1EPWA 4BQXA 3U11A 2GALA 3RS6A 1BK1A 1H2KA 4UF0B 1UYZA 3HNBM 2ID4A 5LRRA 2AACA 2VZSA 1PVC1 5JZGA 1ND2C 3GHNA 3KVBA 4UFLA 1PMIA 5E89A 1RXFA 3T0BA 5CKNA 4A7ZA 5LK7B 3S30A 2XLAA 3ZPOA 4Z8BA 3H7JA 5KC5A 1OKOA 1ZBA3 2F17A 3U78A 5I93A 4XURA 4Z07A 1FATA 3ACLA 4LNVA 2WA3A 5JIAA 1Z0HA 5DAXA 3AL6A 5LA9A 3PDQA 4A7YA 1DDLA 1ZREA 1UIJA 4AYUA 4AFCA 3ME2A 1WLCA 1NY71 4A41A 5FYUA 5C4WB 4Q4Y1 2VVEA 3NAPA 5EXOA 1XYOA 1RUE1 1KFUL 4JTOA 4W8JA 4TSVA 2ARBA 5FZ8A 2A3XA 2XXZA 2JDUA 4XE9A 4EROA 3KQ4B 2B45X 3W59A 1JYXA 2H6BA 1SPPB 4N9IA 3C7HA 4QM9A 4QPWA 5C9AA 3RZJA 3B7MA 5JDBA 4TLFA 4COUA 4P08A 1EAH2 3BPSA 3OCPA 3BYWA 5BNOC 1LB2A 1NZIA 1K5MB 2XVKA 4KBBA 4LHNA 1WUVA 2VH9A 2RDNA 5DZEA 2TUNA 2V4AA 4OHYA 3DYMA 2P5BA 4LA2A 5FYSA 3ZYBA 1OA2A 1WCUA 4KU8A 2FHRA 3D4KA 2BNNA 5FP3A 1LJ7A 2OZ6A 4BB3A 3ASIA 2B8MA 1HJFA 4UW6A 3AZVA 1PMHX 4NRPA 5I0RA 5JXJA 4Q1RA 1VBA1 3IM0A 5FPXA 5FY0A 3KCCA 3OOXA 1Y9MA 4XJ9A 1UAIA 3BPZA 1SMVA 4QB2A 2CL2A 3ZN6B 2Y60A 4CZSA 1NCQC 4LKSA 1Y9GA 3T08A 2RDRA 2VZPA 5JI7A 1NCRB 4CCKA 3ES1A 1UU5A 3GYDA 3IMMA 3VZLA 2ARAA 3HPNA 2HYXA 4XC9A 2VMHA 4IERA 1YUDA 3WNXA 1W8HA 2D6LX 2XHKA 4E9KA 4F7ZA 2ORXA 2VBDA 3MF9A 4QPGC 4BLIA 3EHKA 2LW8A 4XDQA 3DN7A 4EQVA 4CPBA 1MS8A 2DF7A 4P02B 2VXRA 5FDBA 4IL7A 4QDQA 1GZ9A 2E53A 2JWPA 4O9GA 4ZKTB 3RZGA 1CZTA 1A78A 5ANQA 5FXXA 1R1A2 4Q4X3 3POIA 4ASMB 3RDIA 4UXAA 1I5PA 5B4NA 4LBQB 1CJPA 5H9RA 1J3PA 1SEFA 2ZGNA 4W4ZA 2G1MA 2JE8A 2MNGA 1YLLA 3PUQA 5CFCA 1JZ5A 1BYHA 3OTFA 3BTXA 1UY0A 4QQLA 1JOJA 1UOBA 2GAUA 1GZTA 4YW6A 3Q8AA 1ULEA 2CSGA 1OUXA 2VE1A 4IE5A 3VBHA 4FTEA 4E4DX 2JDAA 4AOCA 1VBC1 3LEGA 4ZZ5A 5IYYA 2XBO2 4OVEA 3AX4A 1Q8OA 3L2HA 4JHZA 1CQ9A 1C4RA 1X82A 1ZA4A 3WF3A 4CUAA 1H8TB 3B5LB 4LO7A 1NXMA 4W50A 1PK6B 4LKEA 4PDWB 4MH0E 3SMHA 1S0BA 3HBKA 3ZKYA 3T1MA 4XUOA 5SV8A 2K0GA 4A3XA 3BI3A 4Y33A 1GR3A 1YHFA 3H7YA 1PO22 4DEVA 1V70A 4FPEA 4LOTA 3TB0A 5IVJA 2PAKA 3T0AA 1E5SA 1SQ4A 1JH5A 4UBGA 4JVAA 5JI9A 1S55A 4RFT0 1AL22 3S7EA 5FBZA 4V2WA 1NLRA 1QJY2 4NHLA 4CXYA 2QUOA 2ZMLA 3VBRA 1G6NA 1HJGA 3AKSA 3WD5A 2GNDA 3ZO0B 5A1FA 1QJFA 1V9U1 3A23A 3K4ZA 4COWA 1RUH2 4XF9A 2D3RA 1UY3A 3KF3A 1IKQA 4ZY9A 2VECA 3KCXA 4O61A 2XMLA 5BNPC 1KS5A 3AMQA 4A3ZA 1UO9A 3NNFA 4BYYA 4Z1VA 2IFWA 4LK7A 2GH2A 2RS11 1JZ7A 5CVRA 5H9PA 1HXS2 3VLBB 3P3NA 4XJWA 4AFBA 2GC2A 1SZBA 5GLVA 1XJAA 3DXUA 5T5OA 4LE3A 1O4ZA 1X36A 1VRH1 4XCAA 1C5IA 1S0JA 1PGSA 1J1LA 1WLWA 2Q8CA 2YC0A 3DUIA 4RQPA 1VB2A 2DFCA 1LCLA 4BQYA 2C24A 4MXWA 2EALA 1RUC3 2B42B 2RVAA 1WW6A 2ZGOA 2VBPA 3NMBA 4LO5B 5IFPA 1Q43A 3AK0A 4IGQA 2Z5WA 5ACA3 1ZZCA 4LBJA 3M1HA 2CGPA 4QDSA 3AMPA 3JB4C 1NUKA 3R0RA 4XXAA 4ES8A 3QBQA 3PUHA 4OHVA 2D97A 4YFWA 5LBCA 5GZCA 1LOFA 1AR81 3MICA 2W1QA 4KGGA 3AFKA 1MVQA 3LOIA 3I2KA 5IK4A 1CPMA 4KL1A 1YQ2A 3OD0A 5D8AA 1Y3TA 2W91A 1XXNA 5FZ3A 3ZYHA 2RV9A 1YFYA 1WA4A 2SBAA 1COV3 2D98A 3WXPA 2G9ZA 1MS4A 3ZMOA 2WNUB 1EUUA 2HYKA 2D6NA 1JYCA 3VV1A 4N43B 4NIGA 3MDPA 2W08A 3GCWA 3PU8A 4CU7A 2ZJCA 1AYN2 2HWC1 3J4UH 5IVVA 1DZQA 5FYVA 1DYPA 1FPN3 5A6QA 2VG9A 2C0ZA 3WG4A 2ZABA 1DQ1A 1HX6A 1R64A 1O5UA 2GNBA 4JGYC 2HKXA 4XQWA 4RHV1 1ZRRA 4D69A 3LDRA 2Y38A 4DQAA 1I3HA 3WDUA 3E6DA 3LFIA 1LOEA 1W6NA 2W0XA 3EBRA 3I2JA 4B3NA 3UV9A 1RUD3 1K5JA 1U5XA 1US2A 4QX2A 3UKTA 1UMIA 4RSUA 5F2SA 4AAPA 4B7EA 1AR91 1BK0A 3I49A 3K4DA 3MW2A 2IXKA 3NV2A 3ON7A 2N7GA 1UXXX 3JD73 2RM23 4DOUA 4YG3A 2ZGTA 3OY8A 4M4PA 4NJ4A 2FDIA 4I3GA 1TMF1 4P14A 1SLTA 2BGCA 4Y5TA 4L97A 4E4HA 5A3PA 5A3LA 3M2MA 3TWIA 2PHRA 4XDOA 1AR62 4IEQA 2IXIA 2RR12 3ZYIB 4RS5B 3ZFEC 4AI9A 3CMGA 4PHZA 4AVAA 5FBJA 2Y34A 3OPTA 3ACGA 4I09A 3TYJA 4AHZA 3T2QA 1AR73 4M4RA 3GJBA 4D8MA 3VDCA 2QTWB 4BHPA 5L9RA 5L7OB 5J98B 2I07B 3IAPA 1JYNA 5BY5A 4AVTA 5LA1A 5BXXA 1ULFA 4IEWA 4YVWB 1SBDA 2FMYA 2D5FA 3HQRA 3LQCA 2IC1A 3ELNA 4HL0A 3M70A 4LUKA 5L36A 5IK7A 3W5NA 1WD4A 3KGLA 2ARCA 4XZPA 5FZIA 3A22A 5E16A 5IVBA 4J6GA 2VQTA 4NPLA 5A7WB 5SV5A 5JOWA 2VZQA 1OPMA 4CDXC 4NIHA 2YC2A 1XC6A 3HBZA 1LTEA 1OQDA 1D7PM 2VXJA 1TQ5A 4K3UA 2PLV3 5KXCA 4DUWA 1OT5A 3J7NA 4QWNA 2B39A 2JEMA 2Y0IA 1B35C 1ND3B 5FQ0B 2RS51 5A7SA 1S0FA 2BEOA 4UWDA 3ZFFB 2X5IB 3DECA 2YDEA 4IV1A 2YXSA 1ZBE2 2RMU2 2WZR2 5T3NA 4FPHA 3I3EA 1HRV3 1Q8QA 1WCSA 3MIBA 4CDUA 3S57A 2F6BA 2XOMA 3BGAA 4XQ4A 4XHXA 2JD4A 1W6OA 5LK5A 3R6SA 4YM3A 5HV0A 3PVOA 3TN93 1OLQA 4YYOA 4AEMA 3M3IA 4EWEA 3S5AA 5HCFA 1MEC2 2Y64A 3VN4A 1NYWA 3JBG2 5IW0A 2VMDA 5GZDA 3N7MA 1YRZA 5FY8A 4NROA 5BNNB 4DXZA 1BVP1 4FFHA 1BEV1 1LENA 2P37A 3FLTA 2BW8A 3FX3A 2GNMA 3MLKA 1H30A 3NNGA 1UU6A 3VBOB 3ZYJB 4BDVB 2WINB 5GZFA 5CKQA 3V0BA 1XNKA 5EFUA 1KDMA 1LGBA 3GZEA 1KGYA 5APAA 4FPKA 4O9EA 1BVVA 4NRMA 2YMZA 2Z4FA 2Q1ZB 3BTAA 4UW5A 3VBUA 1PVC3 4OHXA 4LT5A 2C1FA 2I45A 5EHDA 1W0OA 1NA1A 1AYM2 1UQXA 1AVBA 2QQNA 3AYEA 3EMRA 2WYSA 4LHSA 4AVSA 1LHWA 1X7NA 3ECQA 4OI1A 4YM2A 1JW6A 2PHWA 4QPIA 3KCYA 5HCBA 2MHFA 4RR3A 2CNAA 4Q4Y3 1ONAA 5JZGC 2PN5A 5DUXA 2Q4SA 2WNVB 4L99A 2E31A 1XRUA 2VCAA 5JOXA 3WP3A 1UOJA 1GQGA 4AHWA 5JPMB 1RHI2 1VR3A 1YFUA 2ADEA 2BV4A 3IZOA 3N9MA 3UGFA 4XQDA 1QEXA 1YXWA 1LU1A 1SLAA 1RINA 3FLPA 3K75B 4HG6B 4ZS3A 5GM0A 1RXGA 4WM7A 1UMZA 3MW3A 4X6QB 4MUVA 2Z42A 2WWJA 3E1F1 3NAPC 5I8TA 1N1SA 2ZHNA 3QH6A 3K2OA 3BCWA 4YGEA 4OQ8A 1QNWA 1XSQA 2DCTA 2X09A 4YZ4A 4G3YC 4R9AA 4A6SA 4C91A 1K42A 5C9AC 3UL2A 2VMFA 2WAAA 4CE8A 4P9IA 2JD9A 2X29A 4CP0A 4LULA 4Q4X1 5A3WA 4AHXA 3JZVA 1OQ1A 3AZYA 1GZWA 4CCEA 2EVXA 4PQQA 4IEPA 5T5LA 4HPKB 4JKLA 1KJLA 3AZZA 3LA2A 2XQXA 3LIGA 4KWLA 4B1MA 4OYUA 2VCMA 2WA4A 4YW1A 2WN3A 4HSLA 5FY9A 4YM1A 1EV12 2DWRA 5FIXA 5J37A 2W3JA 4IW3A 3FZ3A 3M3QA 1H0BA 1UD1A 5D1IA 3RNSA 2HWF2 4MG2A 2A73B 5DMYA 1SLBA 5C3RA 5C33A 3TEYA 1JU3A 1BBT3 3WNPA 3BB6A 3I2HA 4ARYA 2JDZA 1ND2B 2R063 1XBFA 4BK4A 4HETA 3T0DA 3CJIA 1W8ZA 1R082 3V0AA 3B93A 1FNZA 5DUVA 4CEYA 4FSJA 4EZHA 1BHGA 1SHWB 2XL9A 1D2QA 2OS2A 1QXPA 4QGMA 4QM8A 4XETA 4IDZA 2EA7A 2J1RA 5T52A 4UOJA 3THCA 5LATA 2QNKA 3E97A 4JDOA 3CHXA 1BMV2 4CUGA 1WD3A 4GWIA 1AYM1 4WVMB 3E5UA 5I8SA 2WQZC 1SCSA 4KG8A 4GKYA 4MSVA 1JU4A 4ET7A 5CBLA 5IHRA 5EZWA 4JQRA 3RJ2X 1N47A 2QDRA 4BIOA 4UW3A 1WA6X 2G4IA 2MPFA 5JWPA 3ZSKA 4GMP0 3H8OA 2ES3A 4H14A 1UKRA 2ZKNA 5CFCC 3VBFA 5BNOB 3FLRA 2OA2A 2VQUA 3AXEA 4E4ZA 4P9JA 3RFRA 1HB1A 3JUUA 3SXWA 2VC9A 2YFUA 4AWDA 5HI0A 2AR6A 4LQRA 2ZX1A 3MEPA 4HK8A 3UYJA 1D4M2 4QQ2A 4IGOA 4IE0A 5AVPA 1HV1A 2P3JA 3O1SA 2XLGA 1OSGA 1DZRA 2YFZA 5HV4A 4EWAA 1W6PB 3TNQA 4XFGA 2DFBA 4FQZA 3M3CA 4OMDA 4XUPA 2H0BA 3JB8A 5IT6A 5JR2A 1NT0A 1E57A 1AX0A 4FOWA 1JZ4A 1FI2A 3LSDA 3LA7A 4KQ7A 2G9GA 2WLQA 1JHJA 2XHNA 3ORJA 1GKBA 1GOFA 2AEYA 1YCIA 2JDPA 4ZONA 3MIDA 4NWVA 3J9SA 1WGPA 1NG0A 2R0FA 5JIUA 3ZYRA 1QGLA 1V9U3 4AVVA 1XNDA 5FFOC 1LOBA 1JMUB 3LEIA 1Z78A 3KWVA 5ACA1 4Q26A 3ST7A 1R092 1XE0A 4Q4V1 4QPGB 1M06G 1CAUA 5E88A 5F6LB 1NKGA 2HBUA 1PO12 2A70A 1BCXA 1HQNA 2RS13 5FZKA 1W8UA 5C7GA 2XGXA 3VBRC 1BLZA 4YRDA 3B00A 4U36A 1POV0 4URTA 4AEDA 2HEVF 5F5IA 4QHZA 3RI8A 3R4SA 3ENRA 4HVOA 1ALYA 4NIAA 1K45A 1CAXA 2WSVA 2BOIA 2X10A 2ZGUA 2HWF1 4HOOA 4HZFA 3W58A 1AF9A 2VM9A 1KITA 3RRDA 3BUCA 1W3VA 2GN7A 3JCIA 5ABJA 3CO2A 4CEWA 2UWCA 2ZGMA 3AFGA 1JS9A 3OBZA 2OKXA 1V0AA 1OFSA 3DYOA 5EP9A 4WV8A 2Y6GA 2JKBA 1AXZA 1C57A 3K48A 3GDBA 3KHCA 4UF0A 1UZWA 2GP5A 2RE9A 2CAVA 3BODA 3GCXA 4Q1PA 5DABA 1S0DA 2VNOA 4XOGA 1AR83 4RQPC 3OD4A 4FCAA 5FY7A 4BQ1A 5BYNA 5CFDA 3PUIA 4W65A 3SKVA 2XJUA 3KGZA 4Y22A 2D3SA 4PQ9A 3UETA 2GSYA 2OIIA 1RUD1 2XBO3 5AC92 2HEYF 4JCKA 4DUVA 3RGBA 5FMDA 5FYTA 2WT2A 4GAZA 3GALA 1S1AA 4CXXA 4CPBD 1WMDA 5LWBA 4CCMA 1JYIA 4EWDA 1PZ9A 5C4WA 1LOFC 1YIPA 4A6OA 3WLUA 2ET7A 4XFFA 3U10A 4CP9A 1AX1A 1GNHA 1OPOA 1V6LA 4MGQA 5D8AC 4U2AA 2BWCA 2HWD2 2R041 4QKDA 3U14A 5FPVA 1XOYA 3GBGA 3W9AA 3WNMA 3B94A 1AR71 2Z69A 5C8CA 5DAVA 2EXIA 3HMYA 4XW3A 2YV8A 1REFA 3IKWA 5GLWA 4XIKA 1K5MA 2GDFA 3POFA 1TZOA 4YW7A 2XPJA 2VZRA 3EXUA 5BNPB 2FCTA 1Q8PA 2GMEA 2MEV2 2WO1A 3I59B 3MIEA 1VLNA 3WW4A 4FTSA 4JZRA 1RYYA 3NSTA 1VJ2A 5DDJ1 3LEMA 2J1VA 3H1YA 4KMQA 1ZVFA 4LPLA 1Q56A 2EICA 3O0VA 4HMZA 5FYZA 4FVVA 3DF0A 1A8MA 5A3NA 1PO11 2ZX3A 3D8CA 2P34A 4TZDA 4Q8LA 1HXS3 5KHJA 1FOD2 4IETA 3T4HB 4AF9A 1NCRA 2ARXA 2HWB2 4YWAA 4QB1A 4UFMA 1MS5A 4MOAA 2OUJA 2PQQA 2JE9A 1F5FA 4FPLA 2J1AA 3WQ1A 3WOGA 5F5QA 3CQOA 1HRV1 3MIHA 4FO9A 4RGGA 2B5HA 4LE4A 1PX3A 1GYKA 3DL3A 1RUF2 1N3QA 4PLOA 1CAVA 2ZEXA 3RG0A 2DV9A 5F5AA 2WR9A 3N36A 4PIZA 2IXLA 5FZCA 3AC0A 2VOXA 3E5XA 4JDNA 1C1FA 2BTVC 5HBAA 1G9CA 1QWRA 3ES4A 2BNMA 1OQEA 2BU9A 2E7TA 3WG2A 4PCRA 4EV0A 3IPVB 3WDTA 4JDMA 2WFF2 1IS6A 2W87A 3PU3A 5IATA 5LZ6A 4FTBA 1XNCA 3K3OA 1VB4A 2WSUA 4HK9A 3WHTA 1GICA 1QJZA 2PMWB 2HWE2 5FPLA 4KI5M 5K4LA 3WDVA 2WT0A 1JODA 4XDPA 2WKKA 1V6NA 2W47A 5EYXA 5DQ0A 2ZEZA 2ZEWA 1D0HA 4HN0A 4QD2A 4HBNA 1L3JA 4CU9A 4FFGA 4LITA 1CAWB 1J83A 1W99A 2XH6A 2ZX0A 4CCJA 2WNEA 4E2GA 1LEDA 2PTMA 4F8AA 4XYXA 3ZX7A 3LZZA 3HD8B 2R16A 1CWPA 1AYN3 4PDWA 3S5QA 4HONA 2Q1FA 4NWWA 3C2UA 4LBKA 1A34A 3APBA 3NKGA 3O1OA 5IK5A 4SBVA 1AJOA 2QQMA 4IV1C 3AVSA 5J96B 1BEV3 3O14A 5A6ZA 1H4HA 4AI8A 1BXHA 4L92A 4EN8B 5F3GA 4CDUC 2PQSA 2ZEYA 1CPNA 1QQP2 4UYBA 3D6EA 2J1TA 4HT1T 4KU7A 3NNJA 4OZOA 1BZWA 4AGVA 1SDWA 4XZUG 3NL1A 3ZYFA 1W2TA 4Q4W2 2P6HA 4CXWA 4UBHA 3ETPA 4Y3OA 1G8WA 2QVSB 1YYNA 1JI6A 4NIIA 2LS6A 1A6CA 2EAKA 1UL9A 4Y1VA 4I2OA 2WFPA 3VHOA 5T5JA 3RSJA 4LR4A 1RVF2 4MHUA 1AR63 4JX0A 3VDDA 3VKFC 5HXMA 1ZRDA 4FPCA 2RR13 5LASA 2DU0A 2RS32 2E7QA 2KR2A 3VL9A 5ISLA 1HRI2 3DXTA 3OYWB 1J1TA 5JXGA 3LGRA 3VBUC 3JU9A 3AP9A 5FPBA 5J48A 4RYDA 3O12A 1NA1C 1TME2 2J7MA 5CA6A 5FK8A 1DIWA 4GULA 4CDXB 1PGW2 3ZXKA 2CWMA 1QXJA 4XILA 4A42A 5A3UA 5FMBA 4FPGA 5GLTA 3ZYPA 4AG4A 2Y6HA 2UU8A 4QPIC 1B35B 4ISRA 3KV6A 5FRAA 3ZR5A 2K9ZA 4RR3C 4KBZA 3NKTA 4QHBA 1ZRCA 1JUIA 3WQ7A 3OB8A 3ZFGA 5KHGA 4AQSA 1TE1B 5FY1A 3WY6A 1D4VB 4TWTA 2XJVA 4W6WA 3VBSC 1OHFA 1DYOA 1BBT1 2AUYA 4PBPA 4IE4A 2ATFA 3B3QE 2ORZA 4TYSA 4YGDA 1O4YA 2R061 4AE2A 3INAA 1DBNA 3ZMNA 4PI0A 3CL1A 4ES9A 3FBMA 2VTFA 3HWJA 2ZAHA 1ZBE3 4N7UA 2A5ZA 4ZU5A 1ZA7A 3USSA 4WM7C 4C0BA 4M3CB 1CIWA 1GFF2 1WBFA 3P3PA 4PF5A 1V00A 1IG3A 2KM2A 2PFWA 2DVBA 2XONA 4GALA 3J26N 1W28A 2O8OA 3CLPA 1MZFA 1TVGA 3LCPA 1EYBA 3GHMA 1O91A 2VTXJ 2P3YA 2WNUA 2BFUS 4HKLA 3FC0A 2O0OA 2XWBB 4Q5OA 3AKQA 4N43A 5T54A 3JBG3 1ZYBA 3S6PA 2VW2A 1IQDC 4S2GA 1UX7A 4XF1A 1LR5A 1YQCA 2YG0A 2QE3A 4Z82A 5FR3A 2YGMA 4BA6A 5A33B 1E5IA 1WCDJ 4DXTA 1JZ6A 3G6JB 2WN2A 2PXJA 3T2TA 4AW7A 5C3OA 1U5ZA 1W0NA 3WDYA 1ENQA 2QZ2A 1JZ3A 2YGLA 4GIQA 1GQPA 2DBIA 4ARXA 3MPPG 2YBPA 2CAUA 2OPKA 1HQLA 2FZ1A 4LIUA 1LOCA 2EIEA 1XE8A 3NV1A 4BMEA 3M7AA 4DRVA 4Z2AA 5A1AA 4IV3B 3HN3A 1X50A 4R9CA 4XIOA 5A7NA 5LEJA 1RUJ2 1VP6A 1EAH1 2FBEA 2JX9A 2QJVA 5I8YA 1AYM3 3C7EA 3F95A 2YYOA 4UW4A 2BFUL 4CUCA 5EIYB 3LEKA 1EP0A 2IVIB 5LCWL 4XFHA 5JZGB 2OVUA 3OJBA 2PAMA 2JB4A 3USUA 2D6MA 3CJIC 1PM4A 1XU1A 4I0BA 4Y1XA 5GKAC 3R4DB 2FCUA 2NP0A 3A0NA 5DAPA 4CEYC 5C71A 1XE7A 4D3WA 5JXIA 4TLGA 1D0GA 1ULOA 5FZMA 1Z7S2 3DYPA 3O5SA 1LHVA 1M4WA 4Y5Z0 5H9QA 4AFMA 4ZHNA 4HVRA 2GZWA 2QQPA 2W2IA 2VNRA 2HLEA 4C1WA 3C3VA 1KXGA 4TTGA 2H6CA 1B09A 2GH8A 3NAPB 1AHSA 3N9NA 4A7KA 1DU3D 1LOGA 3LB9A 3MF6A 4NR1A 4OUSA 2HH9A 4YW4A 5JMOA 3CEWA 3GM8A 5GLUA 1XNBA 5FZ0A 1QNYA 4C90A 3QOPA 4LHKA 4N53B 5FY5A 5A3TA 2XJRA 5FOJB 2VULA 3AZWA 1MVEA 2I2SA 4NOTA 2VVDA 5FV3A 1RUG2 3VBFC 2C6SA 2VPVA 1VBE2 2BDRA 4NPRA 3ITQA 2CV6A 1CX1A 3U0ZA 1S4CA 4FAHA 4MHRA 5FAXA 2JG9A 2UURA 4NRQA 5A3MA 4CDQC 4M3CF 5ERLA 5C3SA 2QQJA 1W9YA 5FQ0A 1RUI2 1R1A1 2Z79A 1VAMA 4K6BA 4AI2A 2JICA 2X5IA 3Q9OA 4Q4V3 3UNPA 4CSWA 1O3SA 4NHXA 1OC1A 5L73A 4YSFA 3T30A 1UYXA 2QZ3A 2A3YA 4RD7A 4YNIA 4IESA 2NZ9A 2WS92 3H3ZA 3FHAA 2ILMA 2HWF3 2Y6KA 1H8VA 2XBO1 4P9GA 3SLIA 2W5FA 5J09A 1HDKA 1W6MB 1X9TA 1W05A 3U75A 4ITCA 4BWOA 1S2EA 5ANNA 2ZA9A 3J7LA 3WZ1A 3AYDA 2JG8C 3AP4A 4DEQA 3VBOA 1A3KA 1J84A 1QKQA 3ZN4A 5IVCA 1R083 1ENSA 2VJXA 4AEDC 5JLVA 2ZGQA 1W6QA 3HIFA 3E5QA 4AI0A 1LOAA 1PO21 2BOJA 5KXDA 1GQHA 1C8M2 1EPZA 3HR9A 1MS1A 1W2NA 4WVVA 2BBVA 3AYCA 3PUAA 2V5YA 1W8TA 1C8NA 1X33A 1MS3A 2VVFA 4PIXA 5FYHA 4E2SA 3IN9A 4BJ0A 3CIHA 4GA9A 3JQWA 2JJ6A 4CEWC 4LKFA 2VAUA 5F39A 1AL21 4Y4YA 5F6KA 1ZZ6A 1QJY1 1JHNA 3HQUA 3IDCB 3JQXA 1RL3A 1OOPB 1YWKA 1PM7A 4GH4B 1ZBA2 1AUYA 4CRQA 1RUH1 2RDSA 2IUWA 2PHDA 3ACFA 5FPZA 5FP8A 5FREA 5CFDC 2WT1A 4A4AA 1P8JA 1DQ5A 4I30A 4E2QA 1GZCA 1D4M3 1YFWA 1HN1A 3ETQA 1NZCA 2VCBA 4PI2A 4S2DA 4ZU7A 2R043 1W90A 3VD5A 1EUTA 3PVBB 1HXS1 1S2KA 3F2ZA 2ZBJA 3R4UA 2DVDA 2XJSA 5A32B 3DPRA 1UOGA 3UGHA 4GMP1 2Q8OA 3P1IA 2WNOA 5EJ3A 4N90A 3N35A 4Y1UA 5FZDA 2XB6C 3VD9A 2TBVA 4PIYA 1GBGA 2YB7A 4OHZA 4Y5SA 2UY9A 1OH4A 1UZYA 1OF4A 2Y6LA 5C5TA 4AFDA 4LMFA 3OBRA 3VBRB 1SLCA 5LBEA 5DDJ3 5E6HA 2O1QA 3AP6A 3MIGA 4GB32 4JGZA 3WG1A 5C8CC 1OF3A 1HW5A 1R093 2V5DA 3WP6A 4AFAA 4ZZ8A 3C7GA 3WF2A 1K5MC 1L7LA 1PO13 1W8WA 2OUHA 2E33A 3B69A 4EJRA 3NWKA 3O1RA 3BIWE 5A7QA 3NW4A 5F3CA 3H3UA 2EF6A 1WCKA 3OPZA 1BQPA 1W03A 2WS91 2ZMKA 1W9SA 3RYRA 2VOVA 4XACA 1YNAA 4AVCA 4DXRA 4AI3A 1DGRA 3POEA 4XF4A 2HEWF 4ZPIA 3MV11 3VZKA 1ZNPA 3KV4A 2BQPA 2BVVA 4NO4A 1G9BA 4RQPB 1ZZ7A 2Y8KA 5FZ9A 5LA2A 1AYN1 4MXWB 1O8PA 3JXSA 3GZAA 3H3LA 2C9AA 3WCSA 2QDNA 1RMU2 3BTYA 2G19A 1UY4A 2GMMA 2NN8A 2WBKA 2B9UA 1F4HA 1XYPA 3IDAA 3SCHA 4D6SA 1WKYA 3ILFA 4YVSB 5FCCA 3M4FA 1H6YA 4CCLA 2W1UA 4XMAA 3GBWA 2RHPA 4B4PA 3ZXJA 1GANA 1C3HA 2Q0AA 4IEOA 4GD4A 3WT3A 2ZOEB 3KHBA 1QHDA 1JYWA 4DFSA 2ZHMA 2FDGA 3DKQA 5AC93 3MHZA 1V6OA 5EJZB 2FDKA 1A8DA 5D8AB 3WUDA 4KWJA 2R49A 3H42B 3J8F2 2PAEA 2GP3A 5L19A 1LEMA 2LRPA 3UESA 4AI1A 1LESA 1OD5A 3K3NA 5CISA 4XHBA 4QXCA 1AR61 4UT5A 4Y20A 1Q5OA 2VL4A 2RR11 5I0UA 3U1XA 3SISA 5FZGA 2VGDA 2NLRA 2OX0A 2OZJA 3IDBB 3CKHA 5KXEA 1J58A 1GWLA 1VBD2 4P9XA 5K0UB 2VOTA 4IEYA 3VKMA 3GGLA 1SFYA 1QJU2 2XJQA 1WMEA 2E32A 5LBFA 1RITA 5BV6A 2CDOA 5F5CA 3EJKA 3D5OA 4GJYA 4LOSA 3TRSB 3SHRA 4QXHA 3FBYA 4FP2A 4V2VA 4BU2A 1W9FA 2MEV3 1UNBA 2VUJA 4M01A 4PDWC 3RPQA 3C8XA 3MI8A 1KEXA 1DLCA 2ZX4A 5FP7A 1H1IA 1O59A 3MW4A 4QX1A 5KHHA 2ZHKA 4QMAA 5LA0A 4K20A 3MZHA 4P00B 3MUZ1 2BGPA 4BZ4A 1ULDA 4COVA 3AKRA 4QB6A 2IZWA 2W1WA 4WM8A 4XF3A 2VBBA 2JECA 2Q30A 5EQUA 4HXCA 2WUHA 3RJRA 1EY2A 4PT6A 3UJQA 4GXLA 1U0AA 1QOOA 3FHQA 3THTA 1SG3A 1SACA 1FMD2 4UFKA 4OCTA 1PIV2 1WMFA 2WWSA 3P5BA 4J1XA 3CU7A 4OQ9A 1ZBE1 2BYVE 2RMU1 2WZR1 3NO8A 5HCAA 4PJYA 1QF3A 1XYNA 2XVGA 1PZ8A 2YU1A 1S2BA 1RUF3 3LPGA 3VDDC 3CDZB 2R072 5CZKA 5KC6A 4JQTA 5CADA 1MEC1 2F4LA 4I0WB 2VU9A 3TBDA 3HT1A 3JBG1 4MXVA 4XCBA 1ZRIA 1GSLA 3MFAA 3NNLA 1RUC2 1OA3A 4MADA 5I91A 2XDVA 2B9VA 4C0HA 2W9XA 4EN6B 4Q8KA 2HWE3 4B4QA 3HNMA 4BQ4A 4AK3A 5A1LA 1KS4A 3N9PA 4JC1A 4Q0SA 1OI6A 1VRBA 1W9TA 1LGNA 2EIBA 2VZTA 3NJZA 4WVZA 5FKBA 5FO7B 1XNAA 2BGOA 2ZXQA 2Y26A 4FXKB 3AMHA 4INDA 3VB9A 5A6XA 3ZFGC 5DAQA 3O7OA 1YJKA 1CESA 1MZEA 3FFQA 4GKXA 4M0HA 1H1MA 4CDUB 4JHTA 4XJUA 1COV2 2OT7A 1UPSA 2DVFA 1ODNA 1W6OB 4OI2A 3T1LA 2EIDA 3ACIA 1CX4A 3VZOA 1DGLA 3VZNA 2QQWA 3WNLA 1PGL2 2CGOA 1VE0A 5FZEA 4RN5A 1U12A 2VNVA 5K7PA 2IXHA 3EQEA 2B46X 2F4PA 5FKCA 1MQTA 2VCCA 1QJU1 1N1YA 1QQP3 1FPN2 3O1MA 2A7AA 3ZOIA 5HXVA 3LOBA 2QQKA 2WNUC 3ZXGA 2WAOA 1O8SA 1UKGA 1RHI1 1H4GA 4Q4W3 4N43C 3WP4A 4QAWA 4BCUA 1OMIA 3VBHC 3I59A 4DZGA 3NV4A 4RGKA 1C5HA 2OXBA 1NQDA 1CVNA 1EAH3 2W39A 2VTXA 5H9SA 1QMJA 5JUVA 2ET1A 1RVF3 1CR7A 5J36A 4ZXKA 1HIXA 4JTNA 4NAMA 3WNKA 2GN3A 1NA1B 2WL1A 1W3XA 3JD72 5T55A 3ZXFA 4OULA 1FAYA 1NCQB 5A80A 5GJ6A 1W0PA 3RMYA 1ASJ2 2NM1A 4WZFA 4CCCA 1SFPA 4FP3A 5FWEA 5JPNB 2ZCWA 5FZLA 1V6MA 3IAQA 2DBNA 3CNAA 4LORA 4X6RB 1TME3 1JTZX 4KWKA 3KQRA 4RR3B 5G05L 3I4IA 1DYKA 2P3IA 4CVUA 3B9IA 1SFNA 4XUNA 3AMMA 3KSCA 1CN1A 5CIRA 3ZSLA 1HV0A 1NE6A 2RG4A 3EO6A 3POJA 3L2YA 5FOBB 3VBSB 3Q8EA 4XFIA 3AB0A 2VW1A 5FZFA 2KA3A 3OGVA 2W46A 4OI4A 3OGRA 1T6GC 2NMNA 1EV11 4HKOA 2C5DA 1JZ8A 5FZHA 1DF0A 3H8UA 1HB2A 3C7OA 3CZJA 5CU1A 1UMHA 4FXGB 3GBFA 4WM7B 3WEZA 4CDWA 3BIEA 1F8VA 1Y4WA 2A6ZA 1UZZA 1R1A3 1R081 2PLV2 3AL5A 3NJVA 2WO7A 1YEWA 3DV8A 3SEPA 2IWGB 4AAXA 1VBB2 1O6UA 3ZXEA 4CCDA 2O14A 1F9KA 4N8MA 5FMOS 3KB5A 2VUAA 1BMV1 3OGGA 5JSRA 1G86A 4BMBA 3LIHA 1F35A 1GZWB 4EN9B 3SC7X 4C1XA 3BU0A 2JG9C 1QJX2
chains in the Genus database with same CATH topology
1W8FA 2BOIA 1OVPA 4CE8A 2VUDA 1OURA 2JDPA 2VNVA 1OXCA 3DCQA 2JDUA 2WRAA 2BP6A 2WR9A 2BV4A 1UQXA 5A6QA 5HCHA 2JDYA 2JDKA 5A6XA 3ZDVA 2BOJA 1OUSA 2JDNA 2CHHA 2XR4A 2JDHA 1W8HA 1GZTA 5D2AA 2JDMA 5A6YA 1OUXA 4UT5A 5A70A 4AOCA 5A6ZA 2VUCA 1OVSA 5A3OA 1UZVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W8F A;  2BOI A;  1OVP A;  4CE8 A;  2VUD A;  1OUR A;  2JDP A;  2VNV A;  1OXC A;  3DCQ A;  2JDU A;  2WRA A;  2BP6 A;  2WR9 A;  2BV4 A;  1UQX A;  5A6Q A;  5HCH A;  2JDY A;  2JDK A;  5A6X A;  3ZDV A;  2BOJ A;  1OUS A;  2JDN A;  2CHH A;  2XR4 A;  2JDH A;  1W8H A;  1GZT A;  5D2A A;  2JDM A;  5A6Y A;  1OUX A;  4UT5 A;  5A70 A;  4AOC A;  5A6Z A;  2VUC A;  1OVS A;  5A3O A;  1UZV A; 
#chains in the Genus database with same CATH topology
 5JOY A;  2EXH A;  2E51 A;  4N7I A;  4YW2 A;  1APN A;  2DCJ A;  2AYH A;  3LSE A;  4MET A;  3TN9 2;  4XFC A;  3TAY A;  4Q29 A;  3SCF A;  3SIT A;  2ZTN A;  2FDJ A;  1CD3 G;  3T2P A;  3GXU A;  2B7Y A;  4FAG A;  2ETE A;  2QBX A;  3O0X A;  1SBF A;  2V72 A;  1DGW A;  5IVF A;  4YFZ A;  2LM3 A;  1OBN A;  3KD4 A;  1PO2 3;  4Y1Y A;  1V6J A;  2AEZ A;  5A7P A;  2Z2S B;  1D4M 1;  3CJI B;  5FMO L;  3PUR A;  4QKB A;  1SPP A;  4ATF A;  5FUI A;  3V0A B;  1GU3 A;  4CEY B;  1MAC A;  3VHP A;  4EN0 A;  1LOD A;  1CIY A;  1UY2 A;  2XKO A;  1W8F A;  4B1L A;  4ISQ A;  2V4V A;  2AGS A;  1AL2 3;  1PVX A;  2WQ8 A;  1QJY 3;  5F3I A;  4DS0 A;  1PVC 2;  3VBO C;  3C7F A;  3VD3 A;  4KWU A;  1J3Q A;  3LDK A;  3BKZ A;  1NX9 A;  3I2D A;  4GWN A;  2DVG A;  5FZ4 A;  2K2S A;  1RUH 3;  3OYW A;  2GC0 A;  2ZS6 B;  2E26 A;  3O1P A;  4MVT A;  3RMX A;  1R09 1;  3CF6 E;  1NY7 2;  3VBF B;  3ZN6 A;  1SLL A;  3K46 A;  4Q4Y 2;  3KT7 A;  4H7M A;  4CDX A;  1S0I A;  1QH7 A;  4OFG A;  2CY6 A;  3H0O A;  1RUE 2;  2A6W A;  3H8R A;  4TXW A;  3SH5 A;  4GMP 3;  3QAC A;  1OVP A;  4QDR A;  1XQN A;  2A71 A;  3J7M A;  3TEX A;  4AEK A;  4CDQ B;  1I1E A;  2FZ2 A;  1TG7 A;  2PYT A;  1K12 A;  1NXD 1;  1QH6 A;  4K8F A;  5E8A A;  2VZO A;  4DIN B;  1FV3 A;  5FYC A;  2V09 A;  3RZH A;  1PZ7 A;  2CTV A;  2Y0O A;  4XF0 A;  2W1S A;  3VL8 A;  4LO6 B;  3ACH A;  4F3J A;  3AXD A;  1AJK A;  1IS5 A;  3OUI A;  2RJL A;  3DPR C;  1LKN A;  3MYX A;  1PMJ X;  2P1B A;  2WQ4 A;  3A7Q A;  3MPB A;  2YU2 A;  5FUN A;  3KV9 A;  3KV5 A;  2JE7 A;  1STM A;  4LBQ A;  4R8H A;  3ZXL A;  1URX A;  2CWS A;  1VBA 2;  2J22 A;  4GJZ A;  3AVR A;  3PIJ A;  1US3 A;  4HLT A;  2VMI A;  4XJA A;  3WW3 A;  4GQ7 A;  3UT0 A;  2R1D A;  5DUW A;  1FYU A;  2JG8 B;  1E5R A;  2WS9 3;  1DCS A;  4L0P A;  4PLN A;  4XBN A;  4Z92 B;  1OFN A;  3A0K A;  3U4S A;  1O5L A;  4MGS A;  1DLL A;  3RZK A;  1FV2 A;  4DIQ A;  2P4E A;  5F2W A;  4JGZ C;  5AC9 1;  2VW0 A;  3WW2 A;  4K8R B;  3ZLI A;  2TNF A;  1GWM A;  4JKM A;  4JGY B;  1LRH A;  4YG6 A;  3PVE A;  3ZDS A;  2XQR A;  1TNF A;  2XUE A;  3QD6 A;  1H8T A;  2JDK A;  5DZF A;  4DB5 A;  1POV 3;  1PK6 A;  2VZV A;  1J59 A;  1NLS A;  5T5P A;  3POY A;  5EJ1 B;  4HSJ A;  4AGR A;  1O3R A;  3TEW A;  5KR7 A;  2HWD 1;  2J1E A;  4K1Z A;  5F9T A;  1LAJ A;  3V56 A;  5EV7 A;  2VME A;  3WSO A;  3Q8B A;  4IV3 A;  1UZ0 A;  3OG2 A;  4XBQ A;  2VUD A;  4WZC A;  3WNN A;  5I0D A;  1IPS A;  2QFE A;  2SLI A;  5FTT C;  4CU8 A;  3I3M A;  5CFD B;  2YY1 A;  2MEV 1;  4Y22 B;  1MZ6 A;  2Q8E A;  1C1L A;  1UF2 C;  2Q5T A;  4KH9 A;  3ZFE B;  3OSD A;  1QXR A;  3H50 A;  3OBA A;  4WVW A;  3ZIW A;  4HVQ A;  3WF1 A;  5CNA A;  1VBC 2;  3GF6 A;  1PNF A;  4IXL A;  4DNY A;  2TEP A;  2YHJ A;  1BKZ A;  2V73 A;  1PNG A;  1Q8S A;  3AM2 A;  4IEU A;  2RJK A;  3B9C A;  3R05 A;  4NPM A;  2IXC A;  2J1U A;  4FOY A;  4LO4 B;  1BJQ A;  3OBT A;  4QXK A;  4Q2F A;  4P5Y A;  4QU2 A;  3WDW A;  3W5M A;  2ZGS A;  2DUQ A;  4Q0V A;  1ACC A;  1NOV A;  1FOD 1;  4P5H A;  5AFB A;  2P6C A;  5CB7 A;  4MYE A;  5FZA A;  2H0V A;  2HWB 1;  3GJA A;  3LFM A;  4CP9 B;  3I2F A;  2BWA A;  1W2A X;  3NRU A;  2G9F A;  2BP6 A;  4N53 A;  4YZ2 A;  5M0T A;  4Y24 A;  4D0Q A;  4OHW A;  5C8C B;  2JXA A;  4QHO A;  4W6Y A;  1U5I A;  1GP6 A;  2DCY A;  2XJT A;  4Z2W A;  1RTV A;  4JRL A;  1RUF 1;  3I2I A;  2JDY A;  3HAG A;  4Y4R A;  4QX3 A;  5FPU A;  3G7D A;  3KMH A;  4FPO B;  2WJS A;  4QGL A;  3N7J A;  2WO2 A;  5DG1 A;  3M3O A;  1WW5 A;  1I9R A;  2VR4 A;  4GB3 3;  4D6Q A;  3OGJ A;  4NMI A;  3I2O A;  3TEZ A;  1OVS A;  2WFF 1;  4COY A;  1G9D A;  4I02 A;  4LEJ A;  1V9U 2;  2QQV A;  1GV9 A;  1W2U A;  5FZO B;  2P17 A;  4R4Z A;  4AHY A;  1RIR A;  2D7F A;  2HWE 1;  4OUE A;  3BTZ A;  4FOQ A;  2RS1 2;  4H2A A;  2RMU 3;  2WZR 3;  3OPW A;  4OMC A;  4QX7 A;  3B01 A;  3BN6 A;  4WM8 C;  5FZ7 A;  1KD7 A;  1V6I A;  2JB8 A;  1JN2 P;  4R4X A;  5FY4 A;  5HPO A;  3RZL A;  3BOW A;  1W6M A;  1VRH 2;  2XR4 A;  3I3B A;  5FMC A;  4EZ4 A;  1LHO A;  4LO8 A;  3IMN A;  4AQ6 A;  2A75 A;  1UU4 A;  1MEC 3;  2XLF A;  1CAV B;  1ULP A;  2CGN A;  3PL0 A;  4J1W A;  4V1P A;  3WP5 A;  4YZ1 A;  5BNQ A;  2K46 A;  1REE A;  3N7L A;  4NHM A;  1UZV A;  1RMU 3;  4QX5 A;  2ZZJ A;  1QJE A;  3HVD A;  4UFJ A;  4XTM A;  5C8W A;  4X8N A;  4XBL A;  3SEE A;  2JEN A;  2EIG A;  4E8D A;  1KQR A;  1HN0 A;  2ZAA A;  3MIF A;  4XFB A;  2WZ8 A;  2PHU A;  3PTY A;  4L8Q A;  1QQP 1;  1YIF A;  1W8N A;  2WII B;  4DO0 A;  2VZU A;  1POQ A;  4A44 A;  1ULG A;  4XAE A;  2D43 A;  4RA0 A;  3PTR B;  1AR8 2;  4Q4W 1;  2W52 A;  3VGI A;  3GZU C;  2GC1 A;  3LWC A;  2PHL A;  4LTA A;  1OOP A;  4QQH A;  3J8F 3;  2CDP A;  2LTN A;  4GH4 A;  4K9S A;  4L11 A;  1F4A A;  2LAL A;  1RVF 1;  5DPN A;  1Y9Q A;  1UPI A;  3K51 A;  2BRT A;  3HJR A;  1RED A;  1WWY A;  3H8X A;  4UFH A;  2D40 A;  1KRI A;  3DGT A;  2RS3 1;  3EYP A;  3ZKU A;  1UOF A;  3FWE A;  2ZHL A;  4RS5 A;  1VBD 3;  1WZX A;  4YGB A;  1ULC A;  1O3Q A;  1HRI 1;  3ZIX A;  5A32 A;  2D6O X;  2HWC 2;  2ZGL A;  1QJU 3;  5GZE A;  2X53 S;  1NAE A;  4QX8 A;  1MS0 A;  3PHM A;  1HB3 A;  2A1X A;  4LA3 A;  4IEX A;  1TME 1;  1OLR A;  1SBE A;  1WCQ A;  4RHV 2;  4DY5 A;  4HAN A;  5L7O A;  1RHI 3;  2UWB A;  1PGW 1;  3DKW A;  3FE5 A;  2QQU A;  3AP5 A;  5DXD A;  3SH3 A;  3QH7 A;  5JXH A;  4YVW A;  1N3P A;  5A7O A;  4QPY A;  2XL7 A;  3M3E A;  1RJ8 A;  3AJZ A;  3N9L A;  1XU2 A;  4OI0 A;  3N4M A;  5C9A B;  3ROU A;  2VNG A;  2DVA A;  3POG A;  2EXK A;  4BQ5 A;  1MQT C;  1AR9 2;  1QIQ A;  5LEK A;  5A7W A;  1IPK A;  1GNY A;  4TN7 A;  2FDF A;  1OXC A;  4XXP A;  3V65 A;  4YM0 A;  1TMF 2;  2UWA A;  4LBO A;  2BJS A;  1DP0 A;  5FYY A;  1FMD 3;  1GWK A;  3KT4 A;  1YI7 A;  3VDD B;  3V64 A;  3WV6 A;  3PVN A;  1PIV 3;  1ND3 A;  3OF1 A;  2R32 A;  4LBL A;  4FI9 A;  5FYI A;  3ZFF A;  1UY1 A;  1NLQ A;  5F8P A;  4EE2 A;  3ILN A;  3WVJ A;  3AMN A;  4BLJ A;  1V6K A;  5F32 A;  1OUS A;  4XMI A;  4B29 A;  2W68 A;  4LBN A;  4BK5 A;  2R07 3;  3SKJ E;  2XWJ B;  5A70 A;  5J7M A;  2QQI A;  2VMG A;  3O1T A;  5FWJ A;  1DQ6 A;  1OD3 A;  1GLH A;  2BUK A;  3ZSM A;  5IWF A;  1EV1 3;  2ENR A;  1GOH A;  4QQO A;  1GP5 A;  2DCK A;  4LLO A;  4P9W A;  3PJY A;  1G9A A;  1I5Z A;  5BNN A;  5L9V A;  3ZVX A;  1IZ3 A;  5LB6 A;  3ZFG B;  3LA3 A;  3KLS A;  2BZD A;  4YVS A;  2OQ6 A;  2P3K A;  3MUY 1;  5DUU A;  3IBM A;  4XJ8 A;  3AYA A;  2W92 A;  3PIG A;  5F37 A;  2ERF A;  5LY2 A;  3ZR6 A;  2Y33 A;  2D3P A;  3KVA A;  3RWN A;  4D6R A;  2RS5 2;  2VZ1 A;  5FJH A;  1RUJ 1;  2OQ7 A;  4Q0Q A;  1Q8V A;  4CDW C;  1QDC A;  3LE0 A;  4E4S A;  2GU9 A;  3RWK X;  5ABJ C;  3WQB A;  1YO8 A;  5CFC B;  2BVB A;  3OEB A;  3X29 B;  4YW5 A;  1RUO A;  4COZ A;  3QLQ A;  2YC4 A;  3VD4 A;  1DZT A;  5BPX A;  2Y6F A;  3VBH B;  4BQ2 A;  2EXJ A;  2R30 A;  3MLJ A;  5FP4 A;  4W6X A;  2HBT A;  5K0U A;  3WG3 A;  1Z7S 1;  2UY8 A;  1H1A A;  1F5J A;  1H2L A;  2ZPX A;  1JYT A;  4P9Y A;  4B7K A;  3FL7 A;  2C26 A;  2XKP A;  1BEV 2;  3VKN A;  3THP A;  2WNV A;  2FD8 A;  4NVP A;  4HN1 A;  2IFR A;  5FYM A;  5F3E A;  2BBA A;  3THD A;  4E27 A;  4RFR B;  2WO3 A;  3FN9 A;  3RVH A;  2VUC A;  1YQ8 A;  4A2U A;  1ZM1 A;  1TNR A;  3HNY M;  1SCR A;  4LXL A;  4ZU4 A;  3W20 A;  2UYB A;  3UJO A;  2PA7 A;  4YLZ A;  3CJX A;  3HT2 A;  3WIN E;  3KT1 A;  4OZX A;  3ZSJ A;  4EYU A;  4L9B A;  3DCQ A;  4FOV A;  2HJI A;  1OA4 A;  1RUG 1;  3VHN A;  1N1V A;  1DFQ A;  1VBE 1;  1WLD A;  3KZ4 C;  5FJK A;  5C4W C;  2ZGP A;  1WLT A;  1ZZ9 A;  4NID A;  2ZGR A;  2QQL A;  3UKV A;  2PHF A;  4FPY A;  3USU B;  1ASJ 3;  5FLJ A;  2OYZ A;  2AH2 A;  3ZYG A;  1DQ2 A;  1LHU A;  3VUO A;  1RUI 1;  1S0G A;  2CHH A;  1HKD A;  2OW4 A;  1O4T A;  2VD7 A;  4M0N A;  3RYK A;  5LY1 A;  4FBF A;  4AGG A;  4HPK A;  2BPA 2;  4X8P A;  1DGR N;  3NJY A;  5F1R A;  4AXO A;  2W95 A;  4PBO A;  4FFF A;  3IT8 A;  2LUW A;  3POS A;  3UKN A;  4OUM A;  3D82 A;  2YPJ A;  4JAA A;  5JR7 B;  4MGK E;  5C3P A;  4MV2 A;  4LUM A;  5TSW A;  2WZE A;  3III A;  3HOB A;  1U5Y A;  3N7K A;  4MGY E;  4CCO A;  1YQ6 A;  1QOT A;  5B4X A;  5FO9 B;  4RL7 A;  1ND2 A;  1POV 1;  5JSP A;  2DUO A;  2JDN A;  3ATG A;  5JCT A;  3H9A A;  4QXB A;  4FFI A;  1NCR C;  1VAL A;  2DDU A;  2JG9 B;  3FMG A;  5KHI A;  1VBB 3;  4XUQ A;  4XAA A;  4G9S B;  1JUH A;  1C8M 1;  3N9Q A;  4ASL A;  2DUR A;  4CP1 A;  4CU6 A;  1YI9 A;  4L2N A;  1ZZB A;  3GNE A;  4Q4X 2;  5AVA A;  2ZAC A;  2VZ3 A;  1D2S A;  1KJR A;  5KHK A;  4LHL A;  3VHR A;  1QJX 3;  4WVM A;  1AL0 G;  2EAA A;  3NJX A;  2NMO A;  3MGU A;  3I7D A;  1MPX A;  2CYF A;  5AFE A;  2YRO A;  1ENR A;  1W9W A;  3OGS A;  3OUJ A;  3T2O A;  4BE3 A;  4BQ3 A;  2YPD A;  1XSR A;  2DTW A;  1RJ7 A;  1W39 A;  1ZBA 1;  2O8Q A;  2R1B A;  2VMC A;  4NAO A;  5LW9 A;  1DHK B;  5DN2 A;  5IAX A;  1ZRF A;  1AX2 A;  3IDE A;  1RC6 A;  4LJH A;  5IVY A;  4CP2 A;  4XVH A;  5FZ6 A;  5CAZ A;  2QQO A;  4Y26 A;  1I6X A;  2L9L A;  5A6Y A;  1QDO A;  5BNO A;  1JYV A;  3PJQ A;  2VQ0 A;  4ZS2 A;  3FUQ A;  1LNS A;  1OLM E;  4H3W A;  1VAV A;  2HWD 3;  1WW4 A;  1PX4 A;  1W6Q B;  3O1V A;  2WLP A;  4D7Y A;  3E6B A;  3MO4 A;  2Q1M A;  1HQW A;  3U37 A;  1KDK A;  1W6P A;  2WRA A;  3SCG A;  1H8T C;  1W06 A;  4IGP A;  1PK6 C;  5LRS A;  5CEH A;  1DQ0 A;  4R9B A;  3AKT A;  4N9H A;  1W6N B;  4IUG A;  4K1Y A;  1AZD A;  1QOS A;  1L7Q A;  4O7X A;  5HCH A;  3ALQ A;  1NCQ A;  3ZDV A;  4K21 A;  1UWW A;  5J1X A;  3PME A;  1C28 A;  4XPV A;  1WBL A;  1JOP A;  4O65 A;  3A21 A;  3U07 A;  1IQA A;  4GB3 1;  4IV3 C;  2NQY A;  1IOA A;  3WF4 A;  3FJS A;  1H9W A;  1AXK A;  1WMX A;  3H1W A;  2OPW A;  3LD8 A;  1L7R A;  3OY8 B;  1OLM A;  3AKP A;  5A3O A;  2XJP A;  1W2O A;  4QPG A;  1HLC A;  3GZT B;  4GWM A;  1FOD 3;  4RGA A;  1RUE 3;  3BOP A;  1J3R A;  2HWB 3;  1IS4 A;  2ZKL A;  4GZ9 A;  3VBS A;  1VMJ A;  3WHU A;  5LBB A;  4UI9 L;  3WF0 A;  4DY3 A;  3DPR B;  3ILR A;  4M00 A;  5C70 A;  4CUB A;  4XJZ A;  4DXS A;  5KWR A;  4I3P A;  5GLZ A;  2J42 A;  4AEJ A;  4NE9 A;  1RB8 G;  3N3H A;  3POW A;  4NHY A;  2D44 A;  4HKW A;  4K40 A;  3BU7 A;  3N9O A;  1G9F A;  1IG0 A;  3LDB A;  5FUP A;  2GMP A;  4ATE A;  3FUO A;  4LKD A;  5FLI A;  3I54 A;  3KM5 A;  2WFF 3;  1ZX5 A;  1RMU 1;  5I0T A;  5BUV A;  4N53 C;  1QU0 A;  2WYF A;  3TNP B;  3HN1 A;  4JGZ B;  3RZZ A;  1VBA 3;  1X8E A;  3RI9 A;  1CZS A;  4XUT A;  5ACA 2;  3M8L A;  1MZ5 A;  1ODM A;  5T50 A;  4PF1 A;  2BNO A;  4AL9 A;  2Q8D A;  1YC6 1;  3WUC A;  1UW8 A;  4Q4V 2;  3VKL A;  3WCR A;  1YFX A;  2PHX A;  4CTE A;  1VAK A;  3POB A;  1UYY A;  1UIK A;  5F7U A;  2XVL A;  4FPJ A;  3UGG A;  3D0S A;  3Q8F A;  1DQ4 A;  3I8T A;  4AQ2 A;  4QX0 A;  2DYC A;  4BM8 A;  1IHM A;  4IV1 B;  3S0M A;  5FZ1 A;  4LIV A;  4QGN A;  5J3U A;  2A6Y A;  4IE7 A;  3ZSE A;  3WW1 A;  1IS3 A;  1Y43 B;  2BER A;  2R7E B;  3J8F 1;  3T09 A;  5FP9 A;  2X8K A;  1FNY A;  4BPZ A;  4QU1 A;  1CJD A;  2E9Q A;  2J1S A;  3O1U A;  2DU1 A;  4Q27 A;  1LUL A;  2ADD A;  3T3Y A;  4IE6 A;  5FXV A;  2WZP P;  2ZZQ A;  1VBD 1;  2VOW A;  3NVC A;  3ZPY A;  1CGP A;  3MV0 1;  5FYB A;  1T2X A;  4XTP A;  4LBQ D;  4F83 A;  3MBW A;  4G4F A;  1SDD B;  3WX5 A;  4MGZ E;  4I0A A;  3IB3 A;  1YJL A;  2FQP A;  5EWS A;  4B4R A;  5EYY A;  4FT8 A;  5FZB A;  4NHK A;  1E5H A;  3V0B B;  3SQO A;  1KFX L;  2NPI A;  4PLM A;  5FXZ A;  5BNP A;  3W21 A;  4P9L A;  3EB7 A;  3ZN5 A;  4IEV A;  4HFS A;  4YGC A;  2E6V A;  1PHM A;  2XUM A;  1JBC A;  2WC2 A;  4IQP A;  1SLI A;  3VKO A;  1GNZ A;  1S0E A;  1VBC 3;  3LKJ A;  1K3I A;  1RUD 2;  1RGS A;  3VBU B;  1CZV A;  1MS9 A;  1Q3E A;  3KS7 A;  3K77 A;  2FCV A;  1Y7B A;  4YZ3 A;  4DMI A;  2RM2 2;  3I3Q A;  4NN0 A;  2KXL A;  4YAR A;  2RS3 3;  1VIW B;  2GNT A;  1YQ5 A;  5JSO A;  4JV4 A;  1FMD 1;  4C8D A;  4Y20 B;  1HRI 3;  1F31 A;  3CBN A;  1PIV 1;  2WDB A;  4J25 A;  1XPW A;  1OOP C;  4CDQ A;  4QPI B;  3CZU A;  2R04 2;  1NE4 A;  4GH4 C;  3FFZ A;  1AXY A;  4QT6 A;  1F15 A;  4KG0 A;  3SNM A;  1AR7 2;  4OLL A;  2QCS B;  3NNM A;  4KGQ A;  3BVC A;  2JDM A;  2VY0 A;  2R07 1;  3D3A A;  3I97 A;  1JXN A;  2X05 A;  3TOJ A;  2LRO A;  5JAX A;  3Q8C A;  4RS5 C;  2AEN A;  2YBK A;  2IVJ A;  5KBF A;  4XFA A;  2C4X A;  5K8S A;  2D5H A;  2PHT A;  5IVE A;  1RUC 1;  5CYY A;  3IPV A;  4NUB A;  5DDJ 2;  1W04 A;  4WM8 B;  2RDQ A;  3OEA A;  1HB4 A;  5L7O C;  1UXZ A;  1ENX A;  2DCZ A;  2PEL A;  4MGI E;  3B02 A;  5DZG A;  5FLH A;  3PLQ A;  1FT9 A;  4YVW C;  4BXF A;  3FHI B;  4ORF A;  2I74 A;  1GOG A;  1GP4 A;  3QCW A;  5FO8 B;  4YW3 A;  2VOK A;  5IAV A;  2JG8 A;  1OKQ A;  5JOZ A;  4BXS V;  2DUP A;  4EN7 B;  1RUN A;  1IGO A;  4MGT A;  4MO3 M;  4UFI A;  4Y1Z A;  4A45 A;  1VRH 3;  3BAL A;  1CAW A;  3MLL A;  4AVB A;  3I2G A;  5JMC A;  1UCX A;  4JGY A;  3IWZ A;  3J7H A;  1ST8 A;  2A3W A;  3RQ0 A;  2ZX2 A;  1VMF A;  1HRV 2;  1VMH A;  1COV 1;  1O7F A;  4ONU A;  3U4X A;  4YPJ A;  1JOB A;  1ND3 C;  4E8C A;  2E63 A;  3KF5 A;  4LK6 A;  4XEZ A;  1H9P A;  2XG3 A;  2VQA A;  3ZFF C;  2X5I C;  3E6C C;  1PGL 1;  3H1M A;  3K4A A;  5KXB A;  2RJ2 A;  4S2H A;  2UYA A;  3WNO A;  1G7Y A;  2Y6J A;  5L9B A;  3WDX A;  1FPN 1;  3UK9 A;  5B2G B;  1IKP A;  3T4V A;  4AR2 A;  4URA A;  1X8M A;  3LF7 A;  4XAB A;  5IFT A;  5D2A A;  1TEI A;  4CA9 A;  1JZ2 A;  1N1T A;  5FPA A;  3D0J A;  3P6B A;  3PUS A;  5CKM A;  5G04 L;  1GMM A;  2A6X A;  2NYY A;  3VDB A;  2DTY A;  2QKD A;  1MR5 A;  1RUJ 3;  4MX3 A;  4BQW A;  5C5U A;  3ZFE A;  1IPJ A;  5BNN C;  1LU2 A;  2D6P A;  3HQX A;  3I3D A;  4LLF A;  3VZJ A;  3S7I A;  1H6X A;  5DG2 A;  5CG9 A;  3NV3 A;  4YVS C;  4H55 A;  3A4U A;  1GUI A;  3JD7 1;  2RM2 1;  3RZM A;  3LAG A;  4IEZ A;  4BOW A;  3PNA A;  1FX5 A;  4JRA A;  2ZGK A;  1DG6 A;  5FK7 A;  1XNT A;  4K7J A;  2A6V A;  1ASJ 1;  2YUE A;  2HWC 3;  5EPA A;  1FXZ A;  1Z7S 3;  5IUQ A;  5GZG A;  5DAW A;  4R9D A;  1O3T A;  2AZ5 A;  1UN1 A;  2R0H A;  5CG8 A;  4RHV 3;  2AC1 A;  2VO5 A;  1MQT B;  1VPH A;  5E1R A;  3RYP A;  5I0S A;  3OUH A;  4YG0 A;  4R52 A;  4M3C E;  4BH9 A;  4BIS A;  2YZ4 A;  3URF A;  1UYP A;  2E7A A;  2ZMN A;  1LEC A;  1OH3 A;  3ABZ A;  4GWJ A;  4D94 A;  4S2F A;  4DUX A;  2WAB A;  3ZXA C;  4FQ4 A;  1B35 A;  4BIF A;  5K0U C;  1AR9 3;  3ZM8 A;  1CON A;  1RUG 3;  2FDH A;  1NQJ A;  1VBE 3;  2CU5 A;  1H2M A;  3AZX A;  4QKF A;  4QKN A;  2WWU A;  5FXW A;  5D21 A;  2GC3 A;  1WW7 A;  2WNV C;  1TMF 3;  3DEM A;  5FZO A;  2W94 A;  5JVV A;  4ZXE A;  5C3Q A;  1LHN A;  3NQH A;  4QQP A;  2IXJ A;  3LPF A;  1RUI 3;  5C6C A;  1XB9 A;  2JDH A;  2PLV 1;  4KNC A;  3VD7 A;  1T6B X;  3L9J T;  1VBB 1;  1W8O A;  2C9K A;  3VZM A;  2JIJ A;  4M3C A;  2B4K A;  3PMS A;  3MFC A;  4YZ5 A;  4AQT A;  2ARE A;  1R1Z A;  3WR0 A;  2YBS A;  2FMD A;  5K9Y A;  1CAU B;  1OUR A;  2R6Q A;  3AJY A;  3IIA A;  5IJR A;  1QJX 1;  4CYD A;  1S0C A;  3AP7 A;  5GAL A;  4SLI A;  3ZXD A;  1LGC A;  4AED B;  4FPF A;  2KD7 A;  2P2K A;  5IK8 A;  4Q0U A;  3WQ0 A;  4MLO A;  3TN9 1;  4DPN A;  1CAX B;  2JIG A;  1DGW X;  4CCN A;  4D7S A;  4UAP A;  1F2N A;  5A33 A;  4AZZ A;  4ASK A;  3HEI A;  4Q0P A;  3SH4 A;  1ZZ8 A;  4CDW B;  4D7T A;  1H2N A;  1X9P A;  4WBB A;  3VDA A;  4I01 A;  4CEW B;  5ABJ B;  4DRR A;  1QY4 A;  2D93 A;  4B8E A;  1BBT 2;  1N3O A;  1C8M 3;  3O0W A;  1UX6 A;  2D6K A;  2R06 2;  2JKX A;  2RS5 3;  4H7L A;  4LBM A;  4MZU A;  4JKK A;  1EPW A;  4BQX A;  3U11 A;  2GAL A;  3RS6 A;  1BK1 A;  1H2K A;  4UF0 B;  1UYZ A;  3HNB M;  2ID4 A;  5LRR A;  2AAC A;  2VZS A;  1PVC 1;  5JZG A;  1ND2 C;  3GHN A;  3KVB A;  4UFL A;  1PMI A;  5E89 A;  1RXF A;  3T0B A;  5CKN A;  4A7Z A;  5LK7 B;  3S30 A;  2XLA A;  3ZPO A;  4Z8B A;  3H7J A;  5KC5 A;  1OKO A;  1ZBA 3;  2F17 A;  3U78 A;  5I93 A;  4XUR A;  4Z07 A;  1FAT A;  3ACL A;  4LNV A;  2WA3 A;  5JIA A;  1Z0H A;  5DAX A;  3AL6 A;  5LA9 A;  3PDQ A;  4A7Y A;  1DDL A;  1ZRE A;  1UIJ A;  4AYU A;  4AFC A;  3ME2 A;  1WLC A;  1NY7 1;  4A41 A;  5FYU A;  5C4W B;  4Q4Y 1;  2VVE A;  3NAP A;  5EXO A;  1XYO A;  1RUE 1;  1KFU L;  4JTO A;  4W8J A;  4TSV A;  2ARB A;  5FZ8 A;  2A3X A;  2XXZ A;  2JDU A;  4XE9 A;  4ERO A;  3KQ4 B;  2B45 X;  3W59 A;  1JYX A;  2H6B A;  1SPP B;  4N9I A;  3C7H A;  4QM9 A;  4QPW A;  5C9A A;  3RZJ A;  3B7M A;  5JDB A;  4TLF A;  4COU A;  4P08 A;  1EAH 2;  3BPS A;  3OCP A;  3BYW A;  5BNO C;  1LB2 A;  1NZI A;  1K5M B;  2XVK A;  4KBB A;  4LHN A;  1WUV A;  2VH9 A;  2RDN A;  5DZE A;  2TUN A;  2V4A A;  4OHY A;  3DYM A;  2P5B A;  4LA2 A;  5FYS A;  3ZYB A;  1OA2 A;  1WCU A;  4KU8 A;  2FHR A;  3D4K A;  2BNN A;  5FP3 A;  1LJ7 A;  2OZ6 A;  4BB3 A;  3ASI A;  2B8M A;  1HJF A;  4UW6 A;  3AZV A;  1PMH X;  4NRP A;  5I0R A;  5JXJ A;  4Q1R A;  1VBA 1;  3IM0 A;  5FPX A;  5FY0 A;  3KCC A;  3OOX A;  1Y9M A;  4XJ9 A;  1UAI A;  3BPZ A;  1SMV A;  4QB2 A;  2CL2 A;  3ZN6 B;  2Y60 A;  4CZS A;  1NCQ C;  4LKS A;  1Y9G A;  3T08 A;  2RDR A;  2VZP A;  5JI7 A;  1NCR B;  4CCK A;  3ES1 A;  1UU5 A;  3GYD A;  3IMM A;  3VZL A;  2ARA A;  3HPN A;  2HYX A;  4XC9 A;  2VMH A;  4IER A;  1YUD A;  3WNX A;  1W8H A;  2D6L X;  2XHK A;  4E9K A;  4F7Z A;  2ORX A;  2VBD A;  3MF9 A;  4QPG C;  4BLI A;  3EHK A;  2LW8 A;  4XDQ A;  3DN7 A;  4EQV A;  4CPB A;  1MS8 A;  2DF7 A;  4P02 B;  2VXR A;  5FDB A;  4IL7 A;  4QDQ A;  1GZ9 A;  2E53 A;  2JWP A;  4O9G A;  4ZKT B;  3RZG A;  1CZT A;  1A78 A;  5ANQ A;  5FXX A;  1R1A 2;  4Q4X 3;  3POI A;  4ASM B;  3RDI A;  4UXA A;  1I5P A;  5B4N A;  4LBQ B;  1CJP A;  5H9R A;  1J3P A;  1SEF A;  2ZGN A;  4W4Z A;  2G1M A;  2JE8 A;  2MNG A;  1YLL A;  3PUQ A;  5CFC A;  1JZ5 A;  1BYH A;  3OTF A;  3BTX A;  1UY0 A;  4QQL A;  1JOJ A;  1UOB A;  2GAU A;  1GZT A;  4YW6 A;  3Q8A A;  1ULE A;  2CSG A;  1OUX A;  2VE1 A;  4IE5 A;  3VBH A;  4FTE A;  4E4D X;  2JDA A;  4AOC A;  1VBC 1;  3LEG A;  4ZZ5 A;  5IYY A;  2XBO 2;  4OVE A;  3AX4 A;  1Q8O A;  3L2H A;  4JHZ A;  1CQ9 A;  1C4R A;  1X82 A;  1ZA4 A;  3WF3 A;  4CUA A;  1H8T B;  3B5L B;  4LO7 A;  1NXM A;  4W50 A;  1PK6 B;  4LKE A;  4PDW B;  4MH0 E;  3SMH A;  1S0B A;  3HBK A;  3ZKY A;  3T1M A;  4XUO A;  5SV8 A;  2K0G A;  4A3X A;  3BI3 A;  4Y33 A;  1GR3 A;  1YHF A;  3H7Y A;  1PO2 2;  4DEV A;  1V70 A;  4FPE A;  4LOT A;  3TB0 A;  5IVJ A;  2PAK A;  3T0A A;  1E5S A;  1SQ4 A;  1JH5 A;  4UBG A;  4JVA A;  5JI9 A;  1S55 A;  4RFT 0;  1AL2 2;  3S7E A;  5FBZ A;  4V2W A;  1NLR A;  1QJY 2;  4NHL A;  4CXY A;  2QUO A;  2ZML A;  3VBR A;  1G6N A;  1HJG A;  3AKS A;  3WD5 A;  2GND A;  3ZO0 B;  5A1F A;  1QJF A;  1V9U 1;  3A23 A;  3K4Z A;  4COW A;  1RUH 2;  4XF9 A;  2D3R A;  1UY3 A;  3KF3 A;  1IKQ A;  4ZY9 A;  2VEC A;  3KCX A;  4O61 A;  2XML A;  5BNP C;  1KS5 A;  3AMQ A;  4A3Z A;  1UO9 A;  3NNF A;  4BYY A;  4Z1V A;  2IFW A;  4LK7 A;  2GH2 A;  2RS1 1;  1JZ7 A;  5CVR A;  5H9P A;  1HXS 2;  3VLB B;  3P3N A;  4XJW A;  4AFB A;  2GC2 A;  1SZB A;  5GLV A;  1XJA A;  3DXU A;  5T5O A;  4LE3 A;  1O4Z A;  1X36 A;  1VRH 1;  4XCA A;  1C5I A;  1S0J A;  1PGS A;  1J1L A;  1WLW A;  2Q8C A;  2YC0 A;  3DUI A;  4RQP A;  1VB2 A;  2DFC A;  1LCL A;  4BQY A;  2C24 A;  4MXW A;  2EAL A;  1RUC 3;  2B42 B;  2RVA A;  1WW6 A;  2ZGO A;  2VBP A;  3NMB A;  4LO5 B;  5IFP A;  1Q43 A;  3AK0 A;  4IGQ A;  2Z5W A;  5ACA 3;  1ZZC A;  4LBJ A;  3M1H A;  2CGP A;  4QDS A;  3AMP A;  3JB4 C;  1NUK A;  3R0R A;  4XXA A;  4ES8 A;  3QBQ A;  3PUH A;  4OHV A;  2D97 A;  4YFW A;  5LBC A;  5GZC A;  1LOF A;  1AR8 1;  3MIC A;  2W1Q A;  4KGG A;  3AFK A;  1MVQ A;  3LOI A;  3I2K A;  5IK4 A;  1CPM A;  4KL1 A;  1YQ2 A;  3OD0 A;  5D8A A;  1Y3T A;  2W91 A;  1XXN A;  5FZ3 A;  3ZYH A;  2RV9 A;  1YFY A;  1WA4 A;  2SBA A;  1COV 3;  2D98 A;  3WXP A;  2G9Z A;  1MS4 A;  3ZMO A;  2WNU B;  1EUU A;  2HYK A;  2D6N A;  1JYC A;  3VV1 A;  4N43 B;  4NIG A;  3MDP A;  2W08 A;  3GCW A;  3PU8 A;  4CU7 A;  2ZJC A;  1AYN 2;  2HWC 1;  3J4U H;  5IVV A;  1DZQ A;  5FYV A;  1DYP A;  1FPN 3;  5A6Q A;  2VG9 A;  2C0Z A;  3WG4 A;  2ZAB A;  1DQ1 A;  1HX6 A;  1R64 A;  1O5U A;  2GNB A;  4JGY C;  2HKX A;  4XQW A;  4RHV 1;  1ZRR A;  4D69 A;  3LDR A;  2Y38 A;  4DQA A;  1I3H A;  3WDU A;  3E6D A;  3LFI A;  1LOE A;  1W6N A;  2W0X A;  3EBR A;  3I2J A;  4B3N A;  3UV9 A;  1RUD 3;  1K5J A;  1U5X A;  1US2 A;  4QX2 A;  3UKT A;  1UMI A;  4RSU A;  5F2S A;  4AAP A;  4B7E A;  1AR9 1;  1BK0 A;  3I49 A;  3K4D A;  3MW2 A;  2IXK A;  3NV2 A;  3ON7 A;  2N7G A;  1UXX X;  3JD7 3;  2RM2 3;  4DOU A;  4YG3 A;  2ZGT A;  3OY8 A;  4M4P A;  4NJ4 A;  2FDI A;  4I3G A;  1TMF 1;  4P14 A;  1SLT A;  2BGC A;  4Y5T A;  4L97 A;  4E4H A;  5A3P A;  5A3L A;  3M2M A;  3TWI A;  2PHR A;  4XDO A;  1AR6 2;  4IEQ A;  2IXI A;  2RR1 2;  3ZYI B;  4RS5 B;  3ZFE C;  4AI9 A;  3CMG A;  4PHZ A;  4AVA A;  5FBJ A;  2Y34 A;  3OPT A;  3ACG A;  4I09 A;  3TYJ A;  4AHZ A;  3T2Q A;  1AR7 3;  4M4R A;  3GJB A;  4D8M A;  3VDC A;  2QTW B;  4BHP A;  5L9R A;  5L7O B;  5J98 B;  2I07 B;  3IAP A;  1JYN A;  5BY5 A;  4AVT A;  5LA1 A;  5BXX A;  1ULF A;  4IEW A;  4YVW B;  1SBD A;  2FMY A;  2D5F A;  3HQR A;  3LQC A;  2IC1 A;  3ELN A;  4HL0 A;  3M70 A;  4LUK A;  5L36 A;  5IK7 A;  3W5N A;  1WD4 A;  3KGL A;  2ARC A;  4XZP A;  5FZI A;  3A22 A;  5E16 A;  5IVB A;  4J6G A;  2VQT A;  4NPL A;  5A7W B;  5SV5 A;  5JOW A;  2VZQ A;  1OPM A;  4CDX C;  4NIH A;  2YC2 A;  1XC6 A;  3HBZ A;  1LTE A;  1OQD A;  1D7P M;  2VXJ A;  1TQ5 A;  4K3U A;  2PLV 3;  5KXC A;  4DUW A;  1OT5 A;  3J7N A;  4QWN A;  2B39 A;  2JEM A;  2Y0I A;  1B35 C;  1ND3 B;  5FQ0 B;  2RS5 1;  5A7S A;  1S0F A;  2BEO A;  4UWD A;  3ZFF B;  2X5I B;  3DEC A;  2YDE A;  4IV1 A;  2YXS A;  1ZBE 2;  2RMU 2;  2WZR 2;  5T3N A;  4FPH A;  3I3E A;  1HRV 3;  1Q8Q A;  1WCS A;  3MIB A;  4CDU A;  3S57 A;  2F6B A;  2XOM A;  3BGA A;  4XQ4 A;  4XHX A;  2JD4 A;  1W6O A;  5LK5 A;  3R6S A;  4YM3 A;  5HV0 A;  3PVO A;  3TN9 3;  1OLQ A;  4YYO A;  4AEM A;  3M3I A;  4EWE A;  3S5A A;  5HCF A;  1MEC 2;  2Y64 A;  3VN4 A;  1NYW A;  3JBG 2;  5IW0 A;  2VMD A;  5GZD A;  3N7M A;  1YRZ A;  5FY8 A;  4NRO A;  5BNN B;  4DXZ A;  1BVP 1;  4FFH A;  1BEV 1;  1LEN A;  2P37 A;  3FLT A;  2BW8 A;  3FX3 A;  2GNM A;  3MLK A;  1H30 A;  3NNG A;  1UU6 A;  3VBO B;  3ZYJ B;  4BDV B;  2WIN B;  5GZF A;  5CKQ A;  3V0B A;  1XNK A;  5EFU A;  1KDM A;  1LGB A;  3GZE A;  1KGY A;  5APA A;  4FPK A;  4O9E A;  1BVV A;  4NRM A;  2YMZ A;  2Z4F A;  2Q1Z B;  3BTA A;  4UW5 A;  3VBU A;  1PVC 3;  4OHX A;  4LT5 A;  2C1F A;  2I45 A;  5EHD A;  1W0O A;  1NA1 A;  1AYM 2;  1UQX A;  1AVB A;  2QQN A;  3AYE A;  3EMR A;  2WYS A;  4LHS A;  4AVS A;  1LHW A;  1X7N A;  3ECQ A;  4OI1 A;  4YM2 A;  1JW6 A;  2PHW A;  4QPI A;  3KCY A;  5HCB A;  2MHF A;  4RR3 A;  2CNA A;  4Q4Y 3;  1ONA A;  5JZG C;  2PN5 A;  5DUX A;  2Q4S A;  2WNV B;  4L99 A;  2E31 A;  1XRU A;  2VCA A;  5JOX A;  3WP3 A;  1UOJ A;  1GQG A;  4AHW A;  5JPM B;  1RHI 2;  1VR3 A;  1YFU A;  2ADE A;  2BV4 A;  3IZO A;  3N9M A;  3UGF A;  4XQD A;  1QEX A;  1YXW A;  1LU1 A;  1SLA A;  1RIN A;  3FLP A;  3K75 B;  4HG6 B;  4ZS3 A;  5GM0 A;  1RXG A;  4WM7 A;  1UMZ A;  3MW3 A;  4X6Q B;  4MUV A;  2Z42 A;  2WWJ A;  3E1F 1;  3NAP C;  5I8T A;  1N1S A;  2ZHN A;  3QH6 A;  3K2O A;  3BCW A;  4YGE A;  4OQ8 A;  1QNW A;  1XSQ A;  2DCT A;  2X09 A;  4YZ4 A;  4G3Y C;  4R9A A;  4A6S A;  4C91 A;  1K42 A;  5C9A C;  3UL2 A;  2VMF A;  2WAA A;  4CE8 A;  4P9I A;  2JD9 A;  2X29 A;  4CP0 A;  4LUL A;  4Q4X 1;  5A3W A;  4AHX A;  3JZV A;  1OQ1 A;  3AZY A;  1GZW A;  4CCE A;  2EVX A;  4PQQ A;  4IEP A;  5T5L A;  4HPK B;  4JKL A;  1KJL A;  3AZZ A;  3LA2 A;  2XQX A;  3LIG A;  4KWL A;  4B1M A;  4OYU A;  2VCM A;  2WA4 A;  4YW1 A;  2WN3 A;  4HSL A;  5FY9 A;  4YM1 A;  1EV1 2;  2DWR A;  5FIX A;  5J37 A;  2W3J A;  4IW3 A;  3FZ3 A;  3M3Q A;  1H0B A;  1UD1 A;  5D1I A;  3RNS A;  2HWF 2;  4MG2 A;  2A73 B;  5DMY A;  1SLB A;  5C3R A;  5C33 A;  3TEY A;  1JU3 A;  1BBT 3;  3WNP A;  3BB6 A;  3I2H A;  4ARY A;  2JDZ A;  1ND2 B;  2R06 3;  1XBF A;  4BK4 A;  4HET A;  3T0D A;  3CJI A;  1W8Z A;  1R08 2;  3V0A A;  3B93 A;  1FNZ A;  5DUV A;  4CEY A;  4FSJ A;  4EZH A;  1BHG A;  1SHW B;  2XL9 A;  1D2Q A;  2OS2 A;  1QXP A;  4QGM A;  4QM8 A;  4XET A;  4IDZ A;  2EA7 A;  2J1R A;  5T52 A;  4UOJ A;  3THC A;  5LAT A;  2QNK A;  3E97 A;  4JDO A;  3CHX A;  1BMV 2;  4CUG A;  1WD3 A;  4GWI A;  1AYM 1;  4WVM B;  3E5U A;  5I8S A;  2WQZ C;  1SCS A;  4KG8 A;  4GKY A;  4MSV A;  1JU4 A;  4ET7 A;  5CBL A;  5IHR A;  5EZW A;  4JQR A;  3RJ2 X;  1N47 A;  2QDR A;  4BIO A;  4UW3 A;  1WA6 X;  2G4I A;  2MPF A;  5JWP A;  3ZSK A;  4GMP 0;  3H8O A;  2ES3 A;  4H14 A;  1UKR A;  2ZKN A;  5CFC C;  3VBF A;  5BNO B;  3FLR A;  2OA2 A;  2VQU A;  3AXE A;  4E4Z A;  4P9J A;  3RFR A;  1HB1 A;  3JUU A;  3SXW A;  2VC9 A;  2YFU A;  4AWD A;  5HI0 A;  2AR6 A;  4LQR A;  2ZX1 A;  3MEP A;  4HK8 A;  3UYJ A;  1D4M 2;  4QQ2 A;  4IGO A;  4IE0 A;  5AVP A;  1HV1 A;  2P3J A;  3O1S A;  2XLG A;  1OSG A;  1DZR A;  2YFZ A;  5HV4 A;  4EWA A;  1W6P B;  3TNQ A;  4XFG A;  2DFB A;  4FQZ A;  3M3C A;  4OMD A;  4XUP A;  2H0B A;  3JB8 A;  5IT6 A;  5JR2 A;  1NT0 A;  1E57 A;  1AX0 A;  4FOW A;  1JZ4 A;  1FI2 A;  3LSD A;  3LA7 A;  4KQ7 A;  2G9G A;  2WLQ A;  1JHJ A;  2XHN A;  3ORJ A;  1GKB A;  1GOF A;  2AEY A;  1YCI A;  2JDP A;  4ZON A;  3MID A;  4NWV A;  3J9S A;  1WGP A;  1NG0 A;  2R0F A;  5JIU A;  3ZYR A;  1QGL A;  1V9U 3;  4AVV A;  1XND A;  5FFO C;  1LOB A;  1JMU B;  3LEI A;  1Z78 A;  3KWV A;  5ACA 1;  4Q26 A;  3ST7 A;  1R09 2;  1XE0 A;  4Q4V 1;  4QPG B;  1M06 G;  1CAU A;  5E88 A;  5F6L B;  1NKG A;  2HBU A;  1PO1 2;  2A70 A;  1BCX A;  1HQN A;  2RS1 3;  5FZK A;  1W8U A;  5C7G A;  2XGX A;  3VBR C;  1BLZ A;  4YRD A;  3B00 A;  4U36 A;  1POV 0;  4URT A;  4AED A;  2HEV F;  5F5I A;  4QHZ A;  3RI8 A;  3R4S A;  3ENR A;  4HVO A;  1ALY A;  4NIA A;  1K45 A;  1CAX A;  2WSV A;  2BOI A;  2X10 A;  2ZGU A;  2HWF 1;  4HOO A;  4HZF A;  3W58 A;  1AF9 A;  2VM9 A;  1KIT A;  3RRD A;  3BUC A;  1W3V A;  2GN7 A;  3JCI A;  5ABJ A;  3CO2 A;  4CEW A;  2UWC A;  2ZGM A;  3AFG A;  1JS9 A;  3OBZ A;  2OKX A;  1V0A A;  1OFS A;  3DYO A;  5EP9 A;  4WV8 A;  2Y6G A;  2JKB A;  1AXZ A;  1C57 A;  3K48 A;  3GDB A;  3KHC A;  4UF0 A;  1UZW A;  2GP5 A;  2RE9 A;  2CAV A;  3BOD A;  3GCX A;  4Q1P A;  5DAB A;  1S0D A;  2VNO A;  4XOG A;  1AR8 3;  4RQP C;  3OD4 A;  4FCA A;  5FY7 A;  4BQ1 A;  5BYN A;  5CFD A;  3PUI A;  4W65 A;  3SKV A;  2XJU A;  3KGZ A;  4Y22 A;  2D3S A;  4PQ9 A;  3UET A;  2GSY A;  2OII A;  1RUD 1;  2XBO 3;  5AC9 2;  2HEY F;  4JCK A;  4DUV A;  3RGB A;  5FMD A;  5FYT A;  2WT2 A;  4GAZ A;  3GAL A;  1S1A A;  4CXX A;  4CPB D;  1WMD A;  5LWB A;  4CCM A;  1JYI A;  4EWD A;  1PZ9 A;  5C4W A;  1LOF C;  1YIP A;  4A6O A;  3WLU A;  2ET7 A;  4XFF A;  3U10 A;  4CP9 A;  1AX1 A;  1GNH A;  1OPO A;  1V6L A;  4MGQ A;  5D8A C;  4U2A A;  2BWC A;  2HWD 2;  2R04 1;  4QKD A;  3U14 A;  5FPV A;  1XOY A;  3GBG A;  3W9A A;  3WNM A;  3B94 A;  1AR7 1;  2Z69 A;  5C8C A;  5DAV A;  2EXI A;  3HMY A;  4XW3 A;  2YV8 A;  1REF A;  3IKW A;  5GLW A;  4XIK A;  1K5M A;  2GDF A;  3POF A;  1TZO A;  4YW7 A;  2XPJ A;  2VZR A;  3EXU A;  5BNP B;  2FCT A;  1Q8P A;  2GME A;  2MEV 2;  2WO1 A;  3I59 B;  3MIE A;  1VLN A;  3WW4 A;  4FTS A;  4JZR A;  1RYY A;  3NST A;  1VJ2 A;  5DDJ 1;  3LEM A;  2J1V A;  3H1Y A;  4KMQ A;  1ZVF A;  4LPL A;  1Q56 A;  2EIC A;  3O0V A;  4HMZ A;  5FYZ A;  4FVV A;  3DF0 A;  1A8M A;  5A3N A;  1PO1 1;  2ZX3 A;  3D8C A;  2P34 A;  4TZD A;  4Q8L A;  1HXS 3;  5KHJ A;  1FOD 2;  4IET A;  3T4H B;  4AF9 A;  1NCR A;  2ARX A;  2HWB 2;  4YWA A;  4QB1 A;  4UFM A;  1MS5 A;  4MOA A;  2OUJ A;  2PQQ A;  2JE9 A;  1F5F A;  4FPL A;  2J1A A;  3WQ1 A;  3WOG A;  5F5Q A;  3CQO A;  1HRV 1;  3MIH A;  4FO9 A;  4RGG A;  2B5H A;  4LE4 A;  1PX3 A;  1GYK A;  3DL3 A;  1RUF 2;  1N3Q A;  4PLO A;  1CAV A;  2ZEX A;  3RG0 A;  2DV9 A;  5F5A A;  2WR9 A;  3N36 A;  4PIZ A;  2IXL A;  5FZC A;  3AC0 A;  2VOX A;  3E5X A;  4JDN A;  1C1F A;  2BTV C;  5HBA A;  1G9C A;  1QWR A;  3ES4 A;  2BNM A;  1OQE A;  2BU9 A;  2E7T A;  3WG2 A;  4PCR A;  4EV0 A;  3IPV B;  3WDT A;  4JDM A;  2WFF 2;  1IS6 A;  2W87 A;  3PU3 A;  5IAT A;  5LZ6 A;  4FTB A;  1XNC A;  3K3O A;  1VB4 A;  2WSU A;  4HK9 A;  3WHT A;  1GIC A;  1QJZ A;  2PMW B;  2HWE 2;  5FPL A;  4KI5 M;  5K4L A;  3WDV A;  2WT0 A;  1JOD A;  4XDP A;  2WKK A;  1V6N A;  2W47 A;  5EYX A;  5DQ0 A;  2ZEZ A;  2ZEW A;  1D0H A;  4HN0 A;  4QD2 A;  4HBN A;  1L3J A;  4CU9 A;  4FFG A;  4LIT A;  1CAW B;  1J83 A;  1W99 A;  2XH6 A;  2ZX0 A;  4CCJ A;  2WNE A;  4E2G A;  1LED A;  2PTM A;  4F8A A;  4XYX A;  3ZX7 A;  3LZZ A;  3HD8 B;  2R16 A;  1CWP A;  1AYN 3;  4PDW A;  3S5Q A;  4HON A;  2Q1F A;  4NWW A;  3C2U A;  4LBK A;  1A34 A;  3APB A;  3NKG A;  3O1O A;  5IK5 A;  4SBV A;  1AJO A;  2QQM A;  4IV1 C;  3AVS A;  5J96 B;  1BEV 3;  3O14 A;  5A6Z A;  1H4H A;  4AI8 A;  1BXH A;  4L92 A;  4EN8 B;  5F3G A;  4CDU C;  2PQS A;  2ZEY A;  1CPN A;  1QQP 2;  4UYB A;  3D6E A;  2J1T A;  4HT1 T;  4KU7 A;  3NNJ A;  4OZO A;  1BZW A;  4AGV A;  1SDW A;  4XZU G;  3NL1 A;  3ZYF A;  1W2T A;  4Q4W 2;  2P6H A;  4CXW A;  4UBH A;  3ETP A;  4Y3O A;  1G8W A;  2QVS B;  1YYN A;  1JI6 A;  4NII A;  2LS6 A;  1A6C A;  2EAK A;  1UL9 A;  4Y1V A;  4I2O A;  2WFP A;  3VHO A;  5T5J A;  3RSJ A;  4LR4 A;  1RVF 2;  4MHU A;  1AR6 3;  4JX0 A;  3VDD A;  3VKF C;  5HXM A;  1ZRD A;  4FPC A;  2RR1 3;  5LAS A;  2DU0 A;  2RS3 2;  2E7Q A;  2KR2 A;  3VL9 A;  5ISL A;  1HRI 2;  3DXT A;  3OYW B;  1J1T A;  5JXG A;  3LGR A;  3VBU C;  3JU9 A;  3AP9 A;  5FPB A;  5J48 A;  4RYD A;  3O12 A;  1NA1 C;  1TME 2;  2J7M A;  5CA6 A;  5FK8 A;  1DIW A;  4GUL A;  4CDX B;  1PGW 2;  3ZXK A;  2CWM A;  1QXJ A;  4XIL A;  4A42 A;  5A3U A;  5FMB A;  4FPG A;  5GLT A;  3ZYP A;  4AG4 A;  2Y6H A;  2UU8 A;  4QPI C;  1B35 B;  4ISR A;  3KV6 A;  5FRA A;  3ZR5 A;  2K9Z A;  4RR3 C;  4KBZ A;  3NKT A;  4QHB A;  1ZRC A;  1JUI A;  3WQ7 A;  3OB8 A;  3ZFG A;  5KHG A;  4AQS A;  1TE1 B;  5FY1 A;  3WY6 A;  1D4V B;  4TWT A;  2XJV A;  4W6W A;  3VBS C;  1OHF A;  1DYO A;  1BBT 1;  2AUY A;  4PBP A;  4IE4 A;  2ATF A;  3B3Q E;  2ORZ A;  4TYS A;  4YGD A;  1O4Y A;  2R06 1;  4AE2 A;  3INA A;  1DBN A;  3ZMN A;  4PI0 A;  3CL1 A;  4ES9 A;  3FBM A;  2VTF A;  3HWJ A;  2ZAH A;  1ZBE 3;  4N7U A;  2A5Z A;  4ZU5 A;  1ZA7 A;  3USS A;  4WM7 C;  4C0B A;  4M3C B;  1CIW A;  1GFF 2;  1WBF A;  3P3P A;  4PF5 A;  1V00 A;  1IG3 A;  2KM2 A;  2PFW A;  2DVB A;  2XON A;  4GAL A;  3J26 N;  1W28 A;  2O8O A;  3CLP A;  1MZF A;  1TVG A;  3LCP A;  1EYB A;  3GHM A;  1O91 A;  2VTX J;  2P3Y A;  2WNU A;  2BFU S;  4HKL A;  3FC0 A;  2O0O A;  2XWB B;  4Q5O A;  3AKQ A;  4N43 A;  5T54 A;  3JBG 3;  1ZYB A;  3S6P A;  2VW2 A;  1IQD C;  4S2G A;  1UX7 A;  4XF1 A;  1LR5 A;  1YQC A;  2YG0 A;  2QE3 A;  4Z82 A;  5FR3 A;  2YGM A;  4BA6 A;  5A33 B;  1E5I A;  1WCD J;  4DXT A;  1JZ6 A;  3G6J B;  2WN2 A;  2PXJ A;  3T2T A;  4AW7 A;  5C3O A;  1U5Z A;  1W0N A;  3WDY A;  1ENQ A;  2QZ2 A;  1JZ3 A;  2YGL A;  4GIQ A;  1GQP A;  2DBI A;  4ARX A;  3MPP G;  2YBP A;  2CAU A;  2OPK A;  1HQL A;  2FZ1 A;  4LIU A;  1LOC A;  2EIE A;  1XE8 A;  3NV1 A;  4BME A;  3M7A A;  4DRV A;  4Z2A A;  5A1A A;  4IV3 B;  3HN3 A;  1X50 A;  4R9C A;  4XIO A;  5A7N A;  5LEJ A;  1RUJ 2;  1VP6 A;  1EAH 1;  2FBE A;  2JX9 A;  2QJV A;  5I8Y A;  1AYM 3;  3C7E A;  3F95 A;  2YYO A;  4UW4 A;  2BFU L;  4CUC A;  5EIY B;  3LEK A;  1EP0 A;  2IVI B;  5LCW L;  4XFH A;  5JZG B;  2OVU A;  3OJB A;  2PAM A;  2JB4 A;  3USU A;  2D6M A;  3CJI C;  1PM4 A;  1XU1 A;  4I0B A;  4Y1X A;  5GKA C;  3R4D B;  2FCU A;  2NP0 A;  3A0N A;  5DAP A;  4CEY C;  5C71 A;  1XE7 A;  4D3W A;  5JXI A;  4TLG A;  1D0G A;  1ULO A;  5FZM A;  1Z7S 2;  3DYP A;  3O5S A;  1LHV A;  1M4W A;  4Y5Z 0;  5H9Q A;  4AFM A;  4ZHN A;  4HVR A;  2GZW A;  2QQP A;  2W2I A;  2VNR A;  2HLE A;  4C1W A;  3C3V A;  1KXG A;  4TTG A;  2H6C A;  1B09 A;  2GH8 A;  3NAP B;  1AHS A;  3N9N A;  4A7K A;  1DU3 D;  1LOG A;  3LB9 A;  3MF6 A;  4NR1 A;  4OUS A;  2HH9 A;  4YW4 A;  5JMO A;  3CEW A;  3GM8 A;  5GLU A;  1XNB A;  5FZ0 A;  1QNY A;  4C90 A;  3QOP A;  4LHK A;  4N53 B;  5FY5 A;  5A3T A;  2XJR A;  5FOJ B;  2VUL A;  3AZW A;  1MVE A;  2I2S A;  4NOT A;  2VVD A;  5FV3 A;  1RUG 2;  3VBF C;  2C6S A;  2VPV A;  1VBE 2;  2BDR A;  4NPR A;  3ITQ A;  2CV6 A;  1CX1 A;  3U0Z A;  1S4C A;  4FAH A;  4MHR A;  5FAX A;  2JG9 A;  2UUR A;  4NRQ A;  5A3M A;  4CDQ C;  4M3C F;  5ERL A;  5C3S A;  2QQJ A;  1W9Y A;  5FQ0 A;  1RUI 2;  1R1A 1;  2Z79 A;  1VAM A;  4K6B A;  4AI2 A;  2JIC A;  2X5I A;  3Q9O A;  4Q4V 3;  3UNP A;  4CSW A;  1O3S A;  4NHX A;  1OC1 A;  5L73 A;  4YSF A;  3T30 A;  1UYX A;  2QZ3 A;  2A3Y A;  4RD7 A;  4YNI A;  4IES A;  2NZ9 A;  2WS9 2;  3H3Z A;  3FHA A;  2ILM A;  2HWF 3;  2Y6K A;  1H8V A;  2XBO 1;  4P9G A;  3SLI A;  2W5F A;  5J09 A;  1HDK A;  1W6M B;  1X9T A;  1W05 A;  3U75 A;  4ITC A;  4BWO A;  1S2E A;  5ANN A;  2ZA9 A;  3J7L A;  3WZ1 A;  3AYD A;  2JG8 C;  3AP4 A;  4DEQ A;  3VBO A;  1A3K A;  1J84 A;  1QKQ A;  3ZN4 A;  5IVC A;  1R08 3;  1ENS A;  2VJX A;  4AED C;  5JLV A;  2ZGQ A;  1W6Q A;  3HIF A;  3E5Q A;  4AI0 A;  1LOA A;  1PO2 1;  2BOJ A;  5KXD A;  1GQH A;  1C8M 2;  1EPZ A;  3HR9 A;  1MS1 A;  1W2N A;  4WVV A;  2BBV A;  3AYC A;  3PUA A;  2V5Y A;  1W8T A;  1C8N A;  1X33 A;  1MS3 A;  2VVF A;  4PIX A;  5FYH A;  4E2S A;  3IN9 A;  4BJ0 A;  3CIH A;  4GA9 A;  3JQW A;  2JJ6 A;  4CEW C;  4LKF A;  2VAU A;  5F39 A;  1AL2 1;  4Y4Y A;  5F6K A;  1ZZ6 A;  1QJY 1;  1JHN A;  3HQU A;  3IDC B;  3JQX A;  1RL3 A;  1OOP B;  1YWK A;  1PM7 A;  4GH4 B;  1ZBA 2;  1AUY A;  4CRQ A;  1RUH 1;  2RDS A;  2IUW A;  2PHD A;  3ACF A;  5FPZ A;  5FP8 A;  5FRE A;  5CFD C;  2WT1 A;  4A4A A;  1P8J A;  1DQ5 A;  4I30 A;  4E2Q A;  1GZC A;  1D4M 3;  1YFW A;  1HN1 A;  3ETQ A;  1NZC A;  2VCB A;  4PI2 A;  4S2D A;  4ZU7 A;  2R04 3;  1W90 A;  3VD5 A;  1EUT A;  3PVB B;  1HXS 1;  1S2K A;  3F2Z A;  2ZBJ A;  3R4U A;  2DVD A;  2XJS A;  5A32 B;  3DPR A;  1UOG A;  3UGH A;  4GMP 1;  2Q8O A;  3P1I A;  2WNO A;  5EJ3 A;  4N90 A;  3N35 A;  4Y1U A;  5FZD A;  2XB6 C;  3VD9 A;  2TBV A;  4PIY A;  1GBG A;  2YB7 A;  4OHZ A;  4Y5S A;  2UY9 A;  1OH4 A;  1UZY A;  1OF4 A;  2Y6L A;  5C5T A;  4AFD A;  4LMF A;  3OBR A;  3VBR B;  1SLC A;  5LBE A;  5DDJ 3;  5E6H A;  2O1Q A;  3AP6 A;  3MIG A;  4GB3 2;  4JGZ A;  3WG1 A;  5C8C C;  1OF3 A;  1HW5 A;  1R09 3;  2V5D A;  3WP6 A;  4AFA A;  4ZZ8 A;  3C7G A;  3WF2 A;  1K5M C;  1L7L A;  1PO1 3;  1W8W A;  2OUH A;  2E33 A;  3B69 A;  4EJR A;  3NWK A;  3O1R A;  3BIW E;  5A7Q A;  3NW4 A;  5F3C A;  3H3U A;  2EF6 A;  1WCK A;  3OPZ A;  1BQP A;  1W03 A;  2WS9 1;  2ZMK A;  1W9S A;  3RYR A;  2VOV A;  4XAC A;  1YNA A;  4AVC A;  4DXR A;  4AI3 A;  1DGR A;  3POE A;  4XF4 A;  2HEW F;  4ZPI A;  3MV1 1;  3VZK A;  1ZNP A;  3KV4 A;  2BQP A;  2BVV A;  4NO4 A;  1G9B A;  4RQP B;  1ZZ7 A;  2Y8K A;  5FZ9 A;  5LA2 A;  1AYN 1;  4MXW B;  1O8P A;  3JXS A;  3GZA A;  3H3L A;  2C9A A;  3WCS A;  2QDN A;  1RMU 2;  3BTY A;  2G19 A;  1UY4 A;  2GMM A;  2NN8 A;  2WBK A;  2B9U A;  1F4H A;  1XYP A;  3IDA A;  3SCH A;  4D6S A;  1WKY A;  3ILF A;  4YVS B;  5FCC A;  3M4F A;  1H6Y A;  4CCL A;  2W1U A;  4XMA A;  3GBW A;  2RHP A;  4B4P A;  3ZXJ A;  1GAN A;  1C3H A;  2Q0A A;  4IEO A;  4GD4 A;  3WT3 A;  2ZOE B;  3KHB A;  1QHD A;  1JYW A;  4DFS A;  2ZHM A;  2FDG A;  3DKQ A;  5AC9 3;  3MHZ A;  1V6O A;  5EJZ B;  2FDK A;  1A8D A;  5D8A B;  3WUD A;  4KWJ A;  2R49 A;  3H42 B;  3J8F 2;  2PAE A;  2GP3 A;  5L19 A;  1LEM A;  2LRP A;  3UES A;  4AI1 A;  1LES A;  1OD5 A;  3K3N A;  5CIS A;  4XHB A;  4QXC A;  1AR6 1;  4UT5 A;  4Y20 A;  1Q5O A;  2VL4 A;  2RR1 1;  5I0U A;  3U1X A;  3SIS A;  5FZG A;  2VGD A;  2NLR A;  2OX0 A;  2OZJ A;  3IDB B;  3CKH A;  5KXE A;  1J58 A;  1GWL A;  1VBD 2;  4P9X A;  5K0U B;  2VOT A;  4IEY A;  3VKM A;  3GGL A;  1SFY A;  1QJU 2;  2XJQ A;  1WME A;  2E32 A;  5LBF A;  1RIT A;  5BV6 A;  2CDO A;  5F5C A;  3EJK A;  3D5O A;  4GJY A;  4LOS A;  3TRS B;  3SHR A;  4QXH A;  3FBY A;  4FP2 A;  4V2V A;  4BU2 A;  1W9F A;  2MEV 3;  1UNB A;  2VUJ A;  4M01 A;  4PDW C;  3RPQ A;  3C8X A;  3MI8 A;  1KEX A;  1DLC A;  2ZX4 A;  5FP7 A;  1H1I A;  1O59 A;  3MW4 A;  4QX1 A;  5KHH A;  2ZHK A;  4QMA A;  5LA0 A;  4K20 A;  3MZH A;  4P00 B;  3MUZ 1;  2BGP A;  4BZ4 A;  1ULD A;  4COV A;  3AKR A;  4QB6 A;  2IZW A;  2W1W A;  4WM8 A;  4XF3 A;  2VBB A;  2JEC A;  2Q30 A;  5EQU A;  4HXC A;  2WUH A;  3RJR A;  1EY2 A;  4PT6 A;  3UJQ A;  4GXL A;  1U0A A;  1QOO A;  3FHQ A;  3THT A;  1SG3 A;  1SAC A;  1FMD 2;  4UFK A;  4OCT A;  1PIV 2;  1WMF A;  2WWS A;  3P5B A;  4J1X A;  3CU7 A;  4OQ9 A;  1ZBE 1;  2BYV E;  2RMU 1;  2WZR 1;  3NO8 A;  5HCA A;  4PJY A;  1QF3 A;  1XYN A;  2XVG A;  1PZ8 A;  2YU1 A;  1S2B A;  1RUF 3;  3LPG A;  3VDD C;  3CDZ B;  2R07 2;  5CZK A;  5KC6 A;  4JQT A;  5CAD A;  1MEC 1;  2F4L A;  4I0W B;  2VU9 A;  3TBD A;  3HT1 A;  3JBG 1;  4MXV A;  4XCB A;  1ZRI A;  1GSL A;  3MFA A;  3NNL A;  1RUC 2;  1OA3 A;  4MAD A;  5I91 A;  2XDV A;  2B9V A;  4C0H A;  2W9X A;  4EN6 B;  4Q8K A;  2HWE 3;  4B4Q A;  3HNM A;  4BQ4 A;  4AK3 A;  5A1L A;  1KS4 A;  3N9P A;  4JC1 A;  4Q0S A;  1OI6 A;  1VRB A;  1W9T A;  1LGN A;  2EIB A;  2VZT A;  3NJZ A;  4WVZ A;  5FKB A;  5FO7 B;  1XNA A;  2BGO A;  2ZXQ A;  2Y26 A;  4FXK B;  3AMH A;  4IND A;  3VB9 A;  5A6X A;  3ZFG C;  5DAQ A;  3O7O A;  1YJK A;  1CES A;  1MZE A;  3FFQ A;  4GKX A;  4M0H A;  1H1M A;  4CDU B;  4JHT A;  4XJU A;  1COV 2;  2OT7 A;  1UPS A;  2DVF A;  1ODN A;  1W6O B;  4OI2 A;  3T1L A;  2EID A;  3ACI A;  1CX4 A;  3VZO A;  1DGL A;  3VZN A;  2QQW A;  3WNL A;  1PGL 2;  2CGO A;  1VE0 A;  5FZE A;  4RN5 A;  1U12 A;  2VNV A;  5K7P A;  2IXH A;  3EQE A;  2B46 X;  2F4P A;  5FKC A;  1MQT A;  2VCC A;  1QJU 1;  1N1Y A;  1QQP 3;  1FPN 2;  3O1M A;  2A7A A;  3ZOI A;  5HXV A;  3LOB A;  2QQK A;  2WNU C;  3ZXG A;  2WAO A;  1O8S A;  1UKG A;  1RHI 1;  1H4G A;  4Q4W 3;  4N43 C;  3WP4 A;  4QAW A;  4BCU A;  1OMI A;  3VBH C;  3I59 A;  4DZG A;  3NV4 A;  4RGK A;  1C5H A;  2OXB A;  1NQD A;  1CVN A;  1EAH 3;  2W39 A;  2VTX A;  5H9S A;  1QMJ A;  5JUV A;  2ET1 A;  1RVF 3;  1CR7 A;  5J36 A;  4ZXK A;  1HIX A;  4JTN A;  4NAM A;  3WNK A;  2GN3 A;  1NA1 B;  2WL1 A;  1W3X A;  3JD7 2;  5T55 A;  3ZXF A;  4OUL A;  1FAY A;  1NCQ B;  5A80 A;  5GJ6 A;  1W0P A;  3RMY A;  1ASJ 2;  2NM1 A;  4WZF A;  4CCC A;  1SFP A;  4FP3 A;  5FWE A;  5JPN B;  2ZCW A;  5FZL A;  1V6M A;  3IAQ A;  2DBN A;  3CNA A;  4LOR A;  4X6R B;  1TME 3;  1JTZ X;  4KWK A;  3KQR A;  4RR3 B;  5G05 L;  3I4I A;  1DYK A;  2P3I A;  4CVU A;  3B9I A;  1SFN A;  4XUN A;  3AMM A;  3KSC A;  1CN1 A;  5CIR A;  3ZSL A;  1HV0 A;  1NE6 A;  2RG4 A;  3EO6 A;  3POJ A;  3L2Y A;  5FOB B;  3VBS B;  3Q8E A;  4XFI A;  3AB0 A;  2VW1 A;  5FZF A;  2KA3 A;  3OGV A;  2W46 A;  4OI4 A;  3OGR A;  1T6G C;  2NMN A;  1EV1 1;  4HKO A;  2C5D A;  1JZ8 A;  5FZH A;  1DF0 A;  3H8U A;  1HB2 A;  3C7O A;  3CZJ A;  5CU1 A;  1UMH A;  4FXG B;  3GBF A;  4WM7 B;  3WEZ A;  4CDW A;  3BIE A;  1F8V A;  1Y4W A;  2A6Z A;  1UZZ A;  1R1A 3;  1R08 1;  2PLV 2;  3AL5 A;  3NJV A;  2WO7 A;  1YEW A;  3DV8 A;  3SEP A;  2IWG B;  4AAX A;  1VBB 2;  1O6U A;  3ZXE A;  4CCD A;  2O14 A;  1F9K A;  4N8M A;  5FMO S;  3KB5 A;  2VUA A;  1BMV 1;  3OGG A;  5JSR A;  1G86 A;  4BMB A;  3LIH A;  1F35 A;  1GZW B;  4EN9 B;  3SC7 X;  4C1X A;  3BU0 A;  2JG9 C;  1QJX 2; 
#chains in the Genus database with same CATH homology
 1W8F A;  2BOI A;  1OVP A;  4CE8 A;  2VUD A;  1OUR A;  2JDP A;  2VNV A;  1OXC A;  3DCQ A;  2JDU A;  2WRA A;  2BP6 A;  2WR9 A;  2BV4 A;  1UQX A;  5A6Q A;  5HCH A;  2JDY A;  2JDK A;  5A6X A;  3ZDV A;  2BOJ A;  1OUS A;  2JDN A;  2CHH A;  2XR4 A;  2JDH A;  1W8H A;  1GZT A;  5D2A A;  2JDM A;  5A6Y A;  1OUX A;  4UT5 A;  5A70 A;  4AOC A;  5A6Z A;  2VUC A;  1OVS A;  5A3O A;  1UZV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...