5C33A

Crystal structure of mouse ryanodine receptor 2 spry1 domain
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
190
structure length
179
Chain Sequence
VSSMRPNIFLGVSEGSAQYKKWYYELMVDHTEATHLRVGWASTEGYSPYPGGGEEWGGNGVGDDLFSYGFDGLHLWSGCIARTVSSPNQHLLRTDDVISCLDLSAPSISFRINGQPVQGMFENFNIDGLFFPVVSFSAGIKVRFLLGGRHGEFKFLPPPGYAACYEAVLLKVEHSREYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Contractile protein
molecule keywords Ryanodine receptor 2
publication title Crystal structures of ryanodine receptor SPRY1 and tandem-repeat domains reveal a critical FKBP12 binding determinant.
pubmed doi rcsb
source organism Mus musculus
total genus 35
structure length 179
sequence length 190
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00622 SPRY SPRY domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.920 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5c33A00
5F6KA 4N7IA 2IWGB 5JIAA 2E63A 2FBEA 2YYOA 4P9IA 5C33A 4B8EA 5JIUA 5JI7A 4QT6A 2WL1A 4B3NA 3KB5A 5JI9A 4KG0A 2LM3A 3UV9A 2YUEA 4XW3A 4P9LA 2VOKA 4WVMA 4P9JA 4N7UA 4X8PA 3TOJA 4V1PA 3ZO0B 4WVMB 4X8NA 5F6LB
chains in the Genus database with same CATH superfamily
4AI8A 5FO9B 5FWEA 5FXWA 5FZ6A 3DCQA 3VD7A 1R083 3DEMA 4DPNA 3E5QA 3M3QA 4JC1A 5KXCA 4P14A 4XAEA 1AF9A 1PVC3 2RM21 1W2TA 1C8M1 1DQ5A 5FPZA 2DF7A 4N9IA 4COZA 4MXVA 3K4ZA 1L3JA 4QHBA 1QJY1 3LAGA 4XOGA 1PO22 3KT4A 1ZBA3 2VBBA 3O0XA 1BBT1 3UJOA 3IMMA 3ZFGB 1SCSA 4KMQA 1W8ZA 2BVVA 2ZGLA 2ZEYA 5FJHA 5A3OA 1TZOA 1WWYA 4YFWA 5EYYA 1PIV3 3T1MA 3AB0A 4A7ZA 2F6BA 1K5MA 4IGOA 3AMMA 4CXYA 5M0TA 2LUWA 5FY4A 1GZCA 3MIEA 3Q8FA 1T6GC 2GAUA 2J1EA 2W5FA 3PVNA 4V2WA 4FVVA 4Q0VA 2XJUA 4AZZA 4QQ2A 2E31A 5G05L 1RMU1 2RR13 5DAQA 5C3RA 1GANA 1WD3A 1RUC2 3NNMA 2J7MA 2WZR3 2ET1A 4CEWA 5A6XA 4P5HA 4COYA 1U5ZA 3S0MA 4LIUA 4XABA 1PGL1 1YIPA 3AKQA 1V6NA 1UAIA 2P5BA 2YGLA 4JZRA 1LB2A 4RR3B 2Z2SB 4LXLA 4XILA 5A3PA 4LKSA 4PDWA 5K0UC 4HONA 4QGLA 4CCKA 2V4AA 3WUCA 5EFUA 2W3JA 1ND2A 1W03A 4I02A 3OB8A 3R0RA 4M3CA 4SLIA 2HWE1 3SITA 1KJLA 5GLUA 3I2KA 2Q8OA 3RZJA 4D3WA 2BGCA 2RDRA 4XJAA 5E88A 4JDOA 2D44A 3THDA 2BOIA 1YFUA 4CP9B 3HBKA 4B7KA 4D6RA 1NY72 5F5CA 2DURA 1XNBA 5IVBA 4QXCA 3KF3A 1EV12 5D21A 5KWRA 1BEV1 1LOCA 2CWSA 2GNDA 4CDUA 1JYTA 3MUZ1 3FUQA 1R082 3C2UA 4ISRA 2PHWA 1F2NA 1LHUA 3MEPA 5CADA 1XXNA 3IPVA 5A6QA 1PVC2 3J7LA 1ZBE3 3C7HA 4RD7A 4CCEA 5A1FA 5LA1A 3O1PA 1COV3 2A6ZA 3O1MA 2V73A 3PUAA 2C4XA 4GD4A 3THCA 4HXCA 3KV6A 4DB5A 1W2UA 1BVP1 1ZBA2 3E97A 3WCRA 4HPKA 1XYNA 1V00A 5IVEA 3WINE 2C5DA 4FOVA 2QQJA 1J3PA 1GP4A 4XQWA 1PIV2 2K9ZA 3CQOA 3M3CA 3C7GA 3WDYA 1LOGA 2GNMA 4UFKA 3VHNA 4XDQA 3KWVA 2QBXA 2YDEA 2QE3A 3ZKUA 2YROA 4W6YA 5CG9A 3SXWA 1GU3A 1PMIA 4BLJA 1ND3A 2YG0A 2JD9A 2ZS6B 1RYYA 4COWA 3WP5A 4A45A 2W9XA 2RR12 1GLHA 2VZ3A 4L92A 3VDDC 4AFCA 4LULA 3POBA 3APBA 1AR83 2PHLA 2HWD3 2JKXA 1LHNA 3RJRA 2WZR2 3K4DA 1QMJA 1AR73 2W39A 4AHZA 3MW2A 2HWF3 4GIQA 4COUA 2R30A 1POQA 2V72A 1ODMA 2YU2A 2BOJA 1HB1A 4MGKE 1S2EA 1LAJA 2TBVA 2HBTA 3H0OA 3W5MA 1RUG1 1DG6A 1FV3A 1AR61 1VBA1 2RHPA 1DGRA 4IV1A 2CGNA 3PVBB 4BK4A 2DUOA 4HK9A 1GBGA 1OMIA 5FOJB 4P9WA 1APNA 2H6BA 3QH7A 5IVVA 1CX4A 3OUIA 5F9TA 2JENA 5B4XA 2E7QA 2EALA 3HQRA 5FUPA 3BU0A 1KDKA 3FLTA 1S4CA 4YVWC 4P08A 4TLGA 4MXWA 4GB31 1J59A 3N35A 4IEYA 5JLVA 4GMP0 4KBBA 1QU0A 4QKBA 4AW7A 2HYXA 1FOD3 5D8AC 4J1XA 4HK8A 5FY8A 1CR7A 1ZBE2 1URXA 3N36A 1RXFA 1CAXA 1UXZA 3POWA 5C3OA 5I93A 1COV2 4I2OA 3RZGA 1UZ0A 3U10A 3UT0A 2HWB3 1KS5A 2VOVA 4D69A 1XE0A 2QCSB 3NV3A 4XJUA 4DUVA 3T08A 3TNQA 2XGXA 4YVSA 4XUOA 2VNVA 3E5UA 2RMU1 5IVFA 1VJ2A 2DCJA 3VZOA 1FT9A 1GSLA 4ES8A 1REEA 2LTNA 2PLV3 4ORFA 3WF2A 3ZR6A 4IEWA 1VBE1 3MF9A 1RJ7A 3N4MA 1FPN1 3WY6A 2J22A 3HT1A 4YWAA 5A80A 1S0JA 4JGZA 1R1ZA 5FMDA 3RNSA 4BQYA 5FY9A 4LHNA 3A22A 5GLTA 4KG8A 3MW4A 1PGSA 5L7OA 1HQWA 1LGNA 3VBOC 3ZXEA 3PMSA 5CAZA 3N9MA 2G19A 1AR82 1STMA 2FDFA 2HWD2 1UPSA 2P6CA 2RJLA 2RDNA 1AR72 5HV0A 5JXJA 4CDXC 2HWF2 4CDQA 2GMEA 1GUIA 4BQ5A 5C5UA 3D4KA 1CAWA 4WM7A 2DFCA 1VB2A 3SH5A 4HL0A 1XU2A 1OOPA 2JICA 4R9DA 4A4AA 1L7RA 2VECA 2Q8EA 4C0BA 1SPPB 4R8HA 3SNMA 5IFTA 5LA0A 3R4SA 4NVPA 4PT6A 4PF5A 3ATGA 1AL23 1VRBA 1R093 2DFBA 2B8MA 3FLPA 1X82A 3NMBA 2Q1FA 1NT0A 5CYYA 3SCHA 3VBFA 3N9QA 5BNOA 5B2GB 1IKPA 4ET7A 5JPNB 1LRHA 2A75A 4NUBA 5EV7A 5H9RA 1NCRB 2BDRA 2P3IA 3LKJA 4X6RB 5F2SA 4QXBA 5GZEA 5LATA 2JKBA 2XHKA 2JX9A 1ZRDA 1PK6A 4H2AA 4BIOA 2YU1A 4Q4Y1 5F37A 1RB8G 4GALA 1O3RA 2DUPA 1WCKA 4BDVB 1JU3A 4H3WA 3J4UH 4QPIB 4CUBA 4ASLA 2A6VA 1PX3A 5GKAC 4YRDA 4AL9A 5C8WA 5ISLA 1LHOA 1EPZA 3MICA 4L97A 4Y26A 1QGLA 1UY1A 2PAEA 3GHNA 1FOD2 2FQPA 3IZOA 4Y1UA 4TZDA 1PX4A 3BIEA 1VAMA 3PDQA 5ANNA 2A3WA 1W2NA 3ZFFA 3SH3A 3FN9A 2AZ5A 3PL0A 3POEA 3V0AB 1H8TA 4HG6B 2XWJB 2NMNA 1RVF3 4QM9A 3H3LA 3BTYA 1VBB1 4E8CA 4RS5C 2BBAA 3KHBA 2WO1A 4TN7A 5AVPA 2Y6HA 4PLNA 1UKRA 3KVBA 1UMHA 1UYPA 3HT2A 2PLV2 5FV3A 2YC4A 5T5LA 5IVJA 1POV1 2G9GA 4NO4A 3D5OA 1YFXA 1NAEA 1UIKA 4MHRA 4META 3WUDA 1WCQA 1GOFA 3D0SA 3OUJA 5EYXA 1UMZA 2ZMKA 3WHTA 3PMEA 3ETPA 4Q29A 4FQZA 5JZGA 3OPTA 4DFSA 1ST8A 1HJFA 1NCQA 3WZ1A 5FUIA 3WOGA 3I2OA 1SBDA 1WW6A 2DU1A 4RYDA 3VKFC 3CF6E 4Y5SA 4YW3A 4B7EA 3NQHA 5KR7A 2NM1A 1DFQA 1W0NA 1MQTB 4LLOA 5EXOA 1QJU3 5DG2A 3I3BA 2QDRA 3ZFEA 1DYKA 1SFNA 5A33B 1MS8A 5G04L 2IXCA 2J1VA 2VXJA 2NLRA 3BTZA 1ZM1A 4DRVA 2Y6FA 3C3VA 2R041 1R092 1XPWA 3J7HA 2ZAAA 5T50A 4NIDA 5FP4A 4UYBA 2BU9A 5IFPA 3VD3A 1K5MC 2GN3A 2XJPA 4D6SA 1YI7A 4KL1A 4NRPA 4HSLA 5HCFA 1CN1A 3R4DB 3RI9A 5KXDA 2BW8A 1VRH1 4P9LA 4R4ZA 2VG9A 3ZM8A 1H2LA 2VZPA 2ZAHA 3WQ1A 1XU1A 2YBKA 2B42B 4NPLA 1Y4WA 5LRRA 1VMJA 3EB7A 2WT0A 4FPOB 4JKKA 3KHCA 1W2OA 4CEWC 4G4FA 1QF3A 3VL9A 4LR4A 1V70A 1FV2A 2WN3A 1NOVA 2WFF3 1JYIA 3JBG3 1AX1A 5T54A 5LRSA 2JECA 4ASMB 1FXZA 2CGPA 4PDWC 2Q8CA 1CZVA 2VO5A 2W91A 5FCCA 5LK7B 3VN4A 1C57A 1ND2C 1RVF2 4XYXA 5KHKA 1O59A 5L9BA 2ADDA 1C28A 5LCWL 4MO3M 2E53A 3LZZA 4W4ZA 2A6YA 3WW4A 2JG8B 4XBNA 1SFYA 1W8FA 4LNVA 4CDUB 3DXTA 4U2AA 1L7LA 4AEKA 1RIRA 2VCAA 5DAWA 5F6KA 4EWDA 2G9ZA 4HVRA 4LHSA 3IPVB 3I59B 1XOYA 5DDJ1 1YO8A 2D7FA 4XBQA 5I91A 1RUOA 2DBIA 3GDBA 5FP9A 1UOBA 1RUG2 1VAKA 4IEOA 5L19A 1W04A 3IDAA 4XTMA 2CTVA 2UWCA 2QQWA 3MV11 4HPKB 2PMWB 4Q4X3 2QKDA 4TXWA 3UL2A 3THPA 1H30A 1UD1A 3MLLA 5FZBA 4GULA 4BPZA 3ZDVA 1YNAA 1QJU2 4N7UA 4AVBA 4HKWA 5FPLA 4LO8A 1V9U3 4F83A 3LF7A 4C1XA 1U12A 4M0HA 3BTAA 2VVDA 4Y1XA 5IVYA 2QNKA 4LBOA 3ZXGA 2O8OA 1Q56A 4AQTA 5J96B 4CEYB 3PURA 1ND3B 3WDXA 3K4AA 3WG3A 3GNEA 2JD4A 4OHZA 1OQEA 2A5ZA 2WKKA 1ODNA 2QZ3A 3U07A 1X7NA 3ZN4A 1CAUA 3R6SA 1F15A 1CZTA 1MS5A 1RUF1 3BB6A 1BK1A 1CJDA 2P6HA 5FMOL 4CCOA 2PAMA 1H2MA 4A3ZA 1NLSA 5IVCA 2Q30A 5FPXA 3PVEA 4URAA 3QACA 4DS0A 1EAH3 4XFFA 5FRAA 5FYYA 2FDHA 3HPNA 4IV1B 1S0IA 2WZ8A 2ZXQA 3TB0A 3X29B 1KDMA 3PVOA 2WFF2 4AI1A 1PO21 3JBG2 1GZTA 1GP6A 1O5UA 4JGYA 1B35C 1ZZCA 4JRAA 1G9BA 4ATFA 3ZPYA 3N7KA 1LECA 1VR3A 1BJQA 1LHVA 1PGW2 2A71A 1WA4A 4QX5A 2YY1A 3A0NA 1EUUA 3Q8AA 3DYMA 2LALA 1ACCA 3VBRA 2D5HA 1NE6A 5J37A 2WIIB 1NQDA 1M06G 5AFEA 3AZYA 2GC1A 2ATFA 4LQRA 3D0JA 4MXWB 2JIJA 4IV3A 4DXTA 3JD73 3FHQA 1B09A 4KWJA 4BHPA 1OFSA 1FX5A 2BQPA 2EIDA 4ZKTB 3GF6A 1YCIA 1O6UA 4XPVA 1RUC1 5CKNA 1ASJ3 1ZZ8A 3SISA 2XR4A 1PZ7A 2VZTA 3NJYA 2CY6A 3U37A 1LCLA 1N1TA 4XCAA 4Y1ZA 4GJZA 1OD3A 2FMDA 3FFQA 3ZYFA 3HMYA 5LY2A 4Q4X2 4QKNA 2MPFA 1S0GA 2GN7A 3BGAA 4YVSB 5FZDA 2VL4A 4FPCA 1BHGA 3WDVA 5FZEA 1HJGA 4FP3A 2EAKA 2B45X 3VDDA 1V9U2 2ZKNA 4AVVA 1XNAA 5JVVA 4JGZB 4XHBA 4NHYA 5CISA 1PMHX 4GQ7A 2PHRA 4UW5A 4CCCA 2D5FA 2WJSA 1P8JA 1D7PM 2WA3A 3ZSKA 5L7OB 5A7SA 1US2A 5DZFA 1GWMA 1NY71 4D94A 3WNNA 2IWGB 1HLCA 4NHXA 2VNRA 3WNOA 1EV11 3PUIA 5FZIA 2EAAA 2VPVA 2LRPA 2YPJA 3VBUB 3VDCA 2IZWA 2P17A 1UPIA 3RG0A 3O1VA 4AXOA 1OSGA 4CDQB 3TEYA 1R081 3NV2A 1QXPA 1KITA 2WNVC 4CZSA 1OQDA 1UOFA 1VBB2 4HOOA 1PVC1 3DPRC 4QU2A 3Q8EA 5C9AB 2J1AA 2B46X 2ARAA 5A3LA 1EAH2 3FZ3A 4XUQA 5A7NA 5C5TA 1MVQA 1G9DA 4JRLA 4XW3A 3SEPA 1LOBA 3ZYIB 3VBFB 4F3JA 4WM7C 5JOYA 1ZBA1 1TG7A 3N9OA 3P3NA 1HRV3 4V1PA 5LW9A 3U0ZA 3N3HA 5EIYB 1OOPC 2BYVE 4M00A 4YVWA 3A21A 4CCMA 2WZPP 3FE5A 3UKTA 1W9TA 5D8AA 3OSDA 1PIV1 3WNKA 2VMFA 4ZZ5A 2I2SA 5BNOC 2WWUA 4K8RB 4XUNA 4QKFA 5D1IA 5FP3A 2EXKA 5FYMA 4C1WA 3V0BA 1PO13 2YBSA 4XJ9A 2CU5A 3FFZA 1DGWX 2XG3A 3JD72 2WT2A 3LOIA 3MIHA 1FYUA 1PK6C 3KV9A 1WUVA 2RR11 4ZU7A 2WNOA 3J7MA 3OBRA 3O1TA 4DOUA 3LA3A 4H14A 1MACA 3VKLA 4CU6A 3AYDA 4MHUA 3OBZA 1ASJ2 2WZR1 5BNPC 1ENXA 4DXZA 1H8TB 1XYOA 2ZGOA 2V5DA 1ULPA 3E1F1 5LZ6A 4MYEA 3PUHA 4NHKA 3LDKA 2ZEWA 5C3PA 3LOBA 4GWMA 1AX0A 3ZFFC 3QOPA 4NWWA 2VJXA 4K21A 2DCZA 5FQ0B 2ID4A 4LEJA 3ZMOA 2RG4A 1A8MA 3WP4A 5EPAA 4ZU5A 2ZTNA 5EHDA 3ITQA 3O1RA 3AKPA 1JI6A 3ZDSA 5HI0A 5FFOC 5SV5A 1GV9A 5CFDB 2WQZC 4R9CA 5E16A 3H3ZA 4MGQA 5JPMB 4QDSA 4AEDA 4Q1RA 2ZHMA 1VBD3 4HKLA 1MEC3 2GSYA 4HZFA 2GC0A 2V09A 4LUMA 4BQXA 4S2FA 4TTGA 4M3CE 5LA2A 4OI0A 3A4UA 3TEXA 4AVTA 2W1SA 3MIFA 4EN6B 5JZGC 3WQBA 1W06A 1HQLA 2JEMA 1ZBE1 4MGSA 1NCQC 5FKCA 1N1VA 2C26A 4HN1A 3ZFEB 4U36A 3CBNA 4QQHA 5HCBA 1COV1 2B9VA 1UIJA 3ZYGA 1V6MA 2DWRA 4FFFA 5EWSA 1HRV2 5FK7A 4Q8LA 4YZ1A 3B9CA 3HIFA 2Y38A 4UWDA 2VY0A 4LO5B 4WVMA 1UZWA 1CIYA 1SACA 2HJIA 3TBDA 3M3EA 3CIHA 1YFWA 3SC7X 3GM8A 1RTVA 3IBMA 4Z2AA 4Y4YA 4RQPA 4PIYA 4INDA 5FZCA 3DL3A 2ETEA 2D97A 4N7IA 1XE7A 1XJAA 3B7MA 3NJXA 4JKMA 3FJSA 4FOQA 1PO12 1MPXA 2OUHA 3AL6A 5FREA 2FMYA 3F95A 2VULA 3H1MA 1F9KA 3FBMA 1G9CA 2CDOA 2DYCA 4FQ4A 1ULOA 1I5ZA 2XLAA 4YW7A 1OLMA 5FUNA 2B9UA 1AR81 1QWRA 2HWD1 1K12A 4K6BA 4O9GA 3GZEA 5FO7B 1AR71 3AYAA 2GDFA 2HWF1 3FLRA 5GZFA 1JYXA 4I3GA 2SLIA 5JSRA 5CKQA 5A3UA 2DUQA 4NPMA 2QQLA 4J1WA 5L36A 1AUYA 2OYZA 4NWVA 1MS4A 1LGCA 4QHZA 5GZGA 4QPGC 1RUF2 3MI8A 5L73A 1JU4A 5L9VA 5A3NA 4OI1A 1TEIA 4QDQA 1HRI3 4WVWA 2H0VA 4FXGB 5C33A 1QJEA 1QH7A 3JXSA 5JAXA 4Q4V3 3WR0A 3U4SA 4EE2A 5CFCA 5JSPA 1I6XA 3UKNA 4ITCA 3N9PA 5HBAA 1VBD2 4BE3A 1DDLA 1MEC2 2ZKLA 1JTZX 1X9PA 2J1TA 1HB4A 1XYPA 4N43C 5CNAA 2DDUA 1FOD1 4BWOA 3GGLA 4YW2A 1V0AA 3NV4A 2JE7A 3ZN6A 3CEWA 5KHJA 3IDBB 3POYA 2VUAA 3PIGA 1OURA 1OKQA 1UZZA 4FPLA 4I01A 4O61A 5J36A 3T0AA 2BUKA 3N7MA 4DO0A 1RUI3 5GLZA 3OEBA 3TRSB 2HWB1 4B8EA 1CONA 2CYFA 2W0XA 1UY3A 2VZRA 2X29A 5IT6A 2XJTA 4QB6A 1FAYA 2Y60A 5F32A 3URFA 1HX6A 2DBNA 1CAUB 3WDTA 5K0UB 1FATA 1TNFA 2GC3A 1RXGA 1E5HA 3BN6A 4S2DA 4ARYA 5FZ8A 2PLV1 2YHJA 4QMAA 1NA1C 2BVBA 4GKYA 1XE8A 2WYSA 3RFRA 3S5QA 3ZIXA 5JXHA 1PNGA 1JYCA 3LPGA 4QX8A 4QXKA 2BNNA 4NIAA 1UOGA 1W99A 1Q3EA 1W8OA 3IAQA 3ILRA 4YG6A 3TAYA 5C70A 1G9AA 1OQ1A 4IEZA 5EQUA 4X6QB 2P34A 3W58A 2JXAA 2XOMA 3POGA 4YZ3A 1QNYA 4AQ2A 4KWKA 3VZJA 2VNOA 1PZ9A 2VOWA 4EN7B 1U5IA 1D0HA 1ZRRA 4XMIA 3I4IA 3NAPC 5FZOA 1WLWA 4ASKA 4P9IA 3W9AA 4EROA 1YUDA 2WNEA 4QPWA 1H1MA 1LOEA 3NNLA 1QJFA 1H6XA 2VM9A 3HJRA 2J1UA 4QGMA 3K51A 4JGYC 3BPSA 3USUA 5FZGA 1UCXA 2IVIB 2FZ1A 3AP5A 1X33A 4MGZE 4Z2WA 4B4RA 3D6EA 5JSOA 1AL21 2R7EB 1R091 2ZCWA 3AM2A 3H7YA 4FOWA 5ABJA 2WT1A 3WW2A 1HRI2 4O9EA 3RWKX 5C6CA 3B00A 3VBRC 1IPSA 2QUOA 4QB1A 3PU8A 1X8EA 4XF4A 3OBTA 4E27A 1OA4A 1ZA4A 4S2HA 4Q4V2 5I0SA 1Y43B 3GCWA 2RS13 1D4VB 4IV3C 5FY0A 2X09A 4BQ3A 2XDVA 2GMPA 4XF9A 3ABZA 4XACA 4XFGA 2E9QA 3MF6A 5EP9A 3NKGA 2HWC3 4IERA 1OD5A 2X8KA 1ZRCA 3DGTA 5IK8A 1H4GA 5FXVA 3VDDB 3POSA 1WMXA 3FMGA 3NJVA 3JU9A 2VD7A 3EMRA 4QX1A 5IWFA 4BJ0A 2CNAA 3TEWA 4DXRA 4NIIA 2VR4A 2FDJA 1RUD3 1UYYA 3RGBA 1RVF1 2VC9A 4DZGA 3O1OA 3ZXFA 5FYCA 5I8YA 1KGYA 1LR5A 2IUWA 4R52A 2PXJA 4YW4A 5FYBA 4W50A 3ACHA 4BIFA 2GU9A 1KD7A 1M4WA 1UXXX 4O7XA 3ZSLA 4QX7A 4LE3A 1TQ5A 5E1RA 1W6QB 5HCAA 3B94A 1FNZA 1B35A 1NLQA 3MPPG 4P9YA 2NZ9A 3KLSA 3JQXA 4FPGA 3CL1A 1QDCA 2R073 4EN0A 1ZRFA 4Q2FA 5GLVA 1XBFA 3RWNA 3N7LA 5FZLA 3VBSA 3WNPA 1K3IA 3SQOA 1IOAA 1X8MA 2D6MA 5J98B 1MZ6A 3IIAA 4YVWB 5FTTC 1BLZA 2XL7A 1R1A3 1J3QA 1S0FA 2E63A 3MYXA 2GP5A 1TMF3 4Y22B 2EVXA 4I0BA 1Y9GA 1QJU1 5D8AB 1HIXA 1QHDA 5FPAA 2OQ6A 4MX3A 4MGTA 4IEUA 4ZONA 4YG0A 2DV9A 5E6HA 1NG0A 4YZ5A 1GWKA 3K77A 1MR5A 1W6OB 3OGSA 5LBEA 2A1XA 1JMUB 5H9PA 4BXFA 2VVFA 3AMQA 4JDMA 4UFIA 4TLFA 1H1AA 1YQCA 3KQ4B 4PIXA 2BEOA 4PJYA 4ZXKA 4AEMA 5BNNA 1OFNA 2ARCA 1UMIA 3FHAA 1RUE3 3OY8B 1PM7A 4NROA 1CESA 2RS12 3DECA 3AK0A 4W8JA 3RZKA 4YGCA 2UWBA 2VTFA 1G9FA 4R4XA 3RPQA 1Q8PA 1DIWA 2HWC2 2VW1A 2EICA 1JZ3A 4UFLA 4JTNA 1K45A 5FLIA 3AKSA 3ECQA 1F5JA 2ARBA 3OF1A 4HSJA 2WFF1 3VBOB 3JBG1 2ZGSA 2DVGA 4XZUG 1WZXA 1U0AA 4Y20A 2PELA 4E9KA 4JDNA 3PU3A 4I0AA 1TME3 4NHMA 2MEV3 1PGW1 4CCLA 4CDXB 1HV0A 1RUD2 1W8WA 5FYSA 2WNVA 1O3QA 3O12A 1U5XA 3WXPA 4UF0A 3DPRA 3THTA 2MHFA 1NQJA 1DU3D 4WVZA 2DCTA 5FYVA 1A6CA 2GZWA 2ZABA 3ENRA 4LLFA 4S2GA 4IE5A 1LENA 2IXLA 1C1LA 5A32A 2Y6KA 3AKTA 1FMD3 1YLLA 1YQ5A 4ZS2A 1BQPA 3MW3A 4AEDC 4IE4A 3I2JA 4I3PA 4LTAA 1SLLA 2ZZJA 5IAVA 2ZGNA 3BYWA 4L2NA 4Y5Z0 2Q8DA 2R072 3S6PA 2WRAA 2FDGA 5EZWA 4C8DA 4PCRA 3BOWA 4ZHNA 1LHWA 1LEMA 2JE8A 2O1QA 1ZREA 2EA7A 2AENA 3HR9A 3RS6A 4KQ7A 4Y33A 5GM0A 2XB6C 1AL0G 2JJ6A 4Q4X1 4YNIA 1OBNA 4XF0A 2YFUA 1R1A2 3AXDA 5IYYA 4WVMB 3RMYA 3BPZA 2QQIA 3R4UA 1TMF2 2HEYF 3UGHA 4D0QA 2PHFA 3CDZB 1KRIA 3KD4A 1IQAA 3W21A 2P4EA 1V9U1 2H6CA 1OA2A 3OGRA 1F31A 3OYWB 3ZYHA 5BNPA 2VZQA 5FZ7A 1TVGA 4YM1A 1O8SA 1X36A 2BFUL 2X5IA 5JUVA 2WL1A 1C8NA 2NYYA 3AP7A 3JB8A 4N90A 4F8AA 4RQPC 5AFBA 4OUMA 4RS5B 1Y3TA 1G8WA 1N1YA 1OUXA 1XNDA 1RUE2 2KA3A 2YXSA 4RL7A 4IE6A 4BMBA 2ORZA 2H0BA 2J1RA 3LFMA 3T3YA 3C8XA 4RFRB 2ZGTA 2B7YA 4P5YA 1OLQA 1VMFA 1SDDB 2HWB2 1O7FA 2Z4FA 1SG3A 4N53C 3NVCA 4WM8A 3Q9OA 2D6KA 5CIRA 2WO7A 3V56A 2JDKA 5F5QA 2D6OX 4L0PA 1JODA 4XFCA 2DCYA 1EAH1 3LFIA 4Z8BA 3WCSA 4LBQA 1YEWA 1FNYA 5A1AA 2AR6A 4XDOA 3U11A 4PI2A 4K1ZA 1BYHA 4LO7A 2GNBA 1TME2 4FI9A 4OLLA 2MEV2 4CXXA 1HB3A 2EXJA 3AL5A 1UYZA 2CAUA 2OZJA 1SLIA 3IDCB 4CDWA 4LK7A 4A6OA 2VOTA 3VHRA 4OI4A 4CU8A 1CX1A 2E7TA 4PBOA 3SKJE 3IAPA 1UZYA 4TYSA 4FTSA 1JZ4A 2ZMNA 2VVEA 2DU0A 3JD71 1DYPA 1X9TA 2WAOA 5CFCC 3MIBA 1FMD2 2JDYA 5FO8B 5FPVA 3HBZA 5HXMA 3WNLA 2VMCA 1K5MB 1EUTA 1MS3A 2VQ0A 3E6BA 3ZN6B 1ASJ1 1TNRA 2R0HA 2JDHA 4A3XA 4IGPA 5T5OA 3T2QA 4LOTA 1H2NA 3VKNA 4AI0A 4PF1A 1AL22 2G1MA 5BNQA 1DLCA 5BXXA 2VW0A 4LA3A 2W68A 1Q5OA 5FZ1A 2XJSA 4FOYA 1KEXA 2A73B 2W1UA 5AC93 3USSA 2TNFA 4CEWB 3ZSEA 4Q27A 4BISA 1FI2A 2PA7A 2JDZA 2ZX0A 1CQ9A 3LEMA 2KM2A 3WNXA 1IQDC 3C7EA 1JZ6A 2QQPA 4X8PA 2E6VA 1EYBA 4QQPA 3LSEA 4E2QA 4EN8B 5IW0A 4PDWB 3WF4A 3HN3A 1JOBA 3IN9A 3ES1A 1XNKA 2WR9A 4QKDA 2W08A 3ILFA 4AVSA 1ND2B 3OEAA 3H42B 2OQ7A 2XL9A 2VH9A 1O8PA 4KWLA 4M3CB 4WV8A 5FZOB 2KR2A 1ENQA 4RFT0 5A6ZA 2BERA 3LD8A 4Q4W3 4QPGA 5FAXA 3H8OA 1H6YA 1PVXA 3VKMA 1UX7A 4KG0A 4P9GA 4PI0A 5IHRA 4GWIA 5C8CA 4Q8KA 4BZ4A 2W1WA 3KT7A 2VCBA 3USUB 5J09A 1H8VA 4ZZ8A 1H0BA 3FX3A 3K2OA 4LMFA 4M4RA 2JDAA 4AEJA 4L11A 1UU4A 2QQVA 4XJWA 3UK9A 2OPKA 2XUMA 3AX4A 1HRV1 5C3QA 2Q5TA 1MZFA 1EPWA 4PQQA 4DRRA 1QY4A 1A8DA 5LWBA 1OPOA 5T5JA 3ILNA 1UYXA 4N43A 2C0ZA 1UOJA 5ABJC 4DY5A 4OZXA 4XCBA 2FZ2A 1QQP3 4AR2A 4CP0A 2OS2A 2VBDA 4XMAA 3AYCA 1AR93 1UU6A 2ZX1A 4EV0A 4CPBA 4A44A 2XKOA 1PO11 4LKDA 4BLIA 1OH4A 3VGIA 2W95A 4EWAA 1GOHA 3POIA 3VV1A 4HMZA 2PYTA 1YJKA 4BQ1A 4Y5TA 4QD2A 4PHZA 1ONAA 5H9QA 1O91A 3BODA 3ZOIA 3UGFA 2W92A 4M3CF 4BM8A 3VL8A 1NA1A 4FPFA 3MDPA 2JWPA 4XJZA 4FBFA 3O14A 4KU7A 5LBBA 1PHMA 5DUVA 3M2MA 3PTYA 5FXXA 1JOJA 2VW2A 1IHMA 4XFBA 1WCUA 3ZFGA 1ALYA 3M70A 4QM8A 5AC92 1CD3G 4QDRA 1Q8SA 3OOXA 3BCWA 4NAMA 3R05A 2EXHA 4K1YA 1XRUA 4LBQD 5ACA3 2VMDA 3NAPA 5CA6A 2WC2A 1B35B 5DN2A 3J8F3 4MGYE 4LBLA 2UYBA 3KT1A 1HV1A 2A70A 2UU8A 3MV01 1UX6A 5FP8A 1OF4A 3S30A 3TN93 2A6WA 3C7FA 2PHTA 3LDBA 4LO4B 2JB8A 3K46A 3N9LA 4YM2A 2DVDA 1VBD1 1GWLA 1MEC1 4NHLA 5F3CA 5I8SA 4XURA 1S55A 4Q4W2 4GH4C 3WDUA 4LBKA 4YGBA 4AK3A 4LA2A 4AAPA 1QOOA 4HT1T 4ARXA 3AXEA 2OT7A 4W65A 3VBSC 1A3KA 4RR3A 1DHKB 1C3HA 4BYYA 1OH3A 5FIXA 1W9YA 4UFJA 4H7LA 1NZCA 3DYOA 1RINA 4BOWA 5CG8A 4OUSA 3LPFA 3T2OA 3A0KA 3VHOA 4FAGA 3ZR5A 1E5IA 4I09A 1S2BA 4XFHA 1CVNA 3VHPA 2E32A 3Q8CA 2QDNA 3B02A 3BALA 1CAXB 5EJ3A 1WCSA 4LPLA 2QJVA 4LJHA 4Y1VA 4DIQA 4IEQA 1QQP2 1AR92 2Q0AA 4LHLA 5AVAA 5BNNC 3FUOA 2ZPXA 3OUHA 3P1IA 3KB5A 4IETA 2NPIA 5LK5A 4DUWA 3BVCA 3B5LB 2XVLA 1XNCA 4Q5OA 2ZEXA 5FY7A 1REDA 4LKEA 1N3OA 1BZWA 2NN8A 4Y24A 4PIZA 2BJSA 4JCKA 3IB3A 4YLZA 5IK5A 2V5YA 3B9IA 5L9RA 4F7ZA 1YQ8A 2Y34A 3GZTB 1LU2A 4KGQA 2OPWA 2YFZA 3ASIA 4W6XA 3U78A 2WNVB 5LEJA 5FMOS 2XHNA 5A3TA 1RJ8A 3DPRB 4HETA 5EJZB 4UW4A 2VMEA 4J25A 3IMNA 4XUTA 1O3TA 4JTOA 1GZWA 4C0HA 4XE9A 1WBFA 2RS33 5A32B 1OLME 1W6PA 1WW4A 2JG9C 2F4PA 1S1AA 1HRI1 1CAWB 4WM7B 3ZXAC 5ACA2 4NAOA 5GJ6A 1JYVA 1AYN3 1OT5A 1OOPB 1U5YA 2C24A 3J8F2 5APAA 5BUVA 2LM3A 1GKBA 3U1XA 4MOAA 4Q4V1 3WG1A 4EZ4A 2A7AA 2GMMA 3RVHA 4LOSA 5JXIA 3TN92 3V65A 4M0NA 4BQ4A 2F4LA 3RMXA 5IUQA 1ZZ7A 3AJZA 3OGJA 5FYUA 5BNOB 1DGRN 1OF3A 2W94A 1W90A 3AC0A 1SEFA 1V6KA 5KC6A 4XQDA 4FTBA 3MLJA 3ORJA 1DZTA 2O8QA 3I2GA 4CPBD 4DMIA 1PK6B 2JE9A 1JS9A 1UNBA 1WLTA 4RGAA 2Y6GA 3K3NA 3POFA 2A3XA 3HNMA 1QIQA 3LCPA 4GXLA 4KI5M 3SCFA 3GXUA 5BNPB 2JB4A 5A6YA 1OC1A 2K46A 2ZGKA 3HWJA 4AYUA 5JI9A 4FPEA 1RUI1 3M8LA 1IZ3A 2FHRA 4FFGA 1QJX3 2D3RA 4AF9A 4ZPIA 3NNGA 1VP6A 3KSCA 4HVQA 3EO6A 3AYEA 3TOJA 3ZFFB 4YSFA 3M7AA 4B4PA 5IAXA 4W6WA 1DLLA 2X5IC 4I30A 3KQRA 4CP1A 2KD7A 2YMZA 3OD0A 4CUGA 3PJQA 1LJ7A 3RYPA 1CGPA 3B01A 1SLCA 4K7JA 5F5IA 4YZ2A 4LBQB 2XJVA 1CPNA 4WM8C 1GQHA 3L2HA 4N8MA 4B1MA 3MGUA 5T5PA 2ZX2A 2E26A 4DNYA 2CL2A 1F35A 3LB9A 2FDKA 3PJYA 1YC61 1BMV2 3WLUA 3GZUC 2Y0IA 4B4QA 4CU9A 1A78A 1ULDA 2AC1A 3LA7A 4AWDA 2D3PA 5FPUA 2IXKA 5KBFA 5JZGB 2WS93 1GQPA 1EP0A 1NCQB 5F6LB 2XKPA 3NRUA 4LE4A 4IEVA 2XWBB 2WNUC 2CGOA 3POJA 5IJRA 3VDAA 2ZJCA 2RS32 2IVJA 3ZYRA 1XSRA 4D7SA 4CDWC 2ENRA 4XUPA 3I49A 1F4HA 5JOXA 3ZYPA 3DUIA 1AYN2 2ET7A 3T30A 5CB7A 3GHMA 1AZDA 3PUQA 2HEWF 3DKWA 4K40A 3A23A 3WW3A 2BGPA 4UI9L 1QEXA 4E4ZA 2RS11 5KC5A 1UY0A 3WG2A 3LSDA 1JHNA 2DVFA 4A7KA 4YPJA 3RZHA 4QX3A 3DKQA 2XUEA 1W9FA 2RS53 5FYZA 2HWC1 1LGBA 4UT5A 2PHUA 3I2FA 1CZSA 3T2PA 5T3NA 2XBO3 4LBMA 4NJ4A 2CDPA 2XJQA 2HBUA 4J6GA 2B5HA 1HB2A 3M3OA 5FMCA 2WA4A 3CKHA 1AXZA 3QH6A 5DG1A 1RUJ3 1UWWA 3LIHA 5F5AA 5JIAA 1HN0A 1SPPA 2FBEA 2R6QA 1JZ7A 4OVEA 1MZEA 1RUD1 1UY4A 2QQKA 1SLTA 4I0WB 5LB6A 3BTXA 4FXKB 4N53A 2PFWA 1QJX2 4AQSA 1OLRA 2ORXA 1D4M3 4JAAA 4XF1A 1QDOA 2OIIA 1WMDA 3H3UA 5KXEA 3WHUA 4G9SB 1GNYA 2WQ4A 2QQOA 3EYPA 4QPGB 3WVJA 4AVAA 1O4YA 2RVAA 2Z69A 5DZEA 1AHSA 4HLTA 4IEPA 1HXS3 5BYNA 4YFZA 3RZMA 2XVKA 1W05A 1IPKA 2QFEA 4QPIA 4XBLA 1N47A 3K3OA 1WD4A 4OHWA 3HNBM 2R071 3KM5A 3ZYBA 5E8AA 3IIIA 2JDUA 2B39A 3ZPOA 1AYM3 3IWZA 2BWAA 4AHXA 2DVAA 2PN5A 1UKGA 4Q0SA 2R49A 5C8CC 5HCHA 1JH5A 1CAVA 3LA2A 1R1A1 3LIGA 2W46A 4JVAA 2YBPA 5FYIA 3V0AA 4B29A 1TMF1 4N43B 1HW5A 1LU1A 4D6QA 3KV5A 5FY5A 3ME2A 5J7MA 1PNFA 2WS92 3LE0A 3AMHA 3VBHA 2YC0A 1O5LA 3T0DA 5T52A 4AVCA 1RUH3 2LS6A 3OCPA 3ZKYA 1ZX5A 2O0OA 4E8DA 2L9LA 3L9JT 3AVRA 3Q8BA 3ACFA 3CZJA 5JMCA 3N9NA 3LWCA 1DYOA 1RHI3 1RUE1 2LW8A 4QXHA 1O3SA 2AREA 3CJIC 2YV8A 2AEZA 5FZHA 3WG4A 5JIUA 4MGIE 3FL7A 1NA1B 3LEKA 4OHXA 5C71A 3HVDA 3L2YA 3RYKA 3JB4C 1VBC3 3O5SA 5J48A 2RS52 3KCXA 4XHXA 4AGVA 2E33A 4JKLA 2BV4A 5ANQA 5KXBA 2XBO2 1MQTA 2VQAA 1GQGA 1AJOA 5I0RA 1Q8QA 3AMPA 1DQ2A 3VLBB 5CBLA 1RUJ2 3NAPB 4BB3A 1ENSA 5A33A 2JDMA 1TME1 2IXHA 2MEV1 4BQWA 4CCDA 4JQRA 3B93A 3I2DA 2QQNA 3ZFGC 4EZHA 3T4VA 3KV4A 4XJ8A 2FCVA 1S0CA 1IKQA 4WZFA 3T2TA 5KHIA 3VD9A 2Z42A 4E4HA 1AXKA 1D4M2 2XQRA 2XVGA 4D7YA 4BCUA 4JGYB 2VCCA 1WW5A 4EQVA 4XFAA 2VQTA 1WGPA 1OKOA 1IGOA 3ZSMA 1Y9MA 2IXIA 4FP2A 5FWJA 4KGGA 3I3MA 1FMD1 3B3QE 5BY5A 2XQXA 1KFUL 4UOJA 4JV4A 5DUXA 1OPMA 1VB4A 1C4RA 1HXS2 1K5JA 2D6LX 3VBRB 4LHKA 2VZSA 4P02B 2J1SA 4COVA 3E5XA 4RHV3 3NW4A 3GBWA 4PQ9A 1JUIA 3WP6A 3ZMNA 4IV3B 1WBLA 1AYM2 2HLEA 2PHXA 4SBVA 1DQ6A 5IATA 3DF0A 3WV6A 4RR3C 1WMFA 3MUY1 1NXMA 1YRZA 2K0GA 4BU2A 3N7JA 5JWPA 3ELNA 1YHFA 3TWIA 1E5RA 1GFF2 4ATEA 3S5AA 1GNZA 4K9SA 4LK6A 1H9WA 1OHFA 5GZCA 1JZ5A 2YPDA 3O1SA 4GMP3 1DGWA 4PLMA 1IS6A 4TSVA 1VALA 3JUUA 4BH9A 1LULA 1DBNA 1O4TA 1UL9A 4MG2A 4M4PA 3OG2A 2JG8A 1DF0A 1RUH2 2I45A 4CTEA 2W87A 4PLOA 1OVSA 2D6PA 2VZOA 4AGRA 3ROUA 3QCWA 4AFDA 5CVRA 4DEVA 3H8RA 2VOKA 2VTXJ 3WD5A 1KXGA 3QBQA 3T0BA 3HNYM 2VE1A 3I59A 3NKTA 4ZU4A 4AHWA 1RHI2 2W47A 3D3AA 4XFIA 5A3WA 2OKXA 2A3YA 4NIHA 4FO9A 3EQEA 1RUI2 1D0GA 4JX0A 4CUAA 1VBC2 4NRQA 4IW3A 3IT8A 3JCIA 2GH8A 1SHWB 4MVTA 2OX0A 3B69A 4XIKA 1GZWB 3G7DA 1W2AX 1QJZA 2EIEA 1W6PB 1Y9QA 4OCTA 5I0TA 4RA0A 1RGSA 5FZMA 1RITA 4XETA 1I3HA 3NJZA 5DAVA 4GH4A 1YQ6A 4OFGA 4CEYA 4HFSA 3ES4A 4YW1A 3GALA 2ZGRA 2GC2A 5A7QA 3ZX7A 3M1HA 2VOXA 3ZXLA 4OMCA 4IE7A 2GALA 2G9FA 4HANA 4E2GA 5CKMA 3I7DA 2GP3A 1HKDA 3A7QA 2D43A 1SFPA 2VU9A 3FWEA 3MFAA 1AX2A 1Z7S3 2VXRA 2WSVA 3PTRB 1S0BA 5C4WA 4BXSV 3V0BB 4RHV2 1S0DA 2R063 4GWNA 1ZZ9A 1NXD1 4BA6A 3J9SA 3H8UA 2CAVA 3LGRA 1W3VA 4TWTA 1V6JA 4LUKA 2AGSA 3RDIA 2RM23 5FJKA 1W6NA 1C8M3 1UN1A 4K8FA 5AC91 2XJRA 2BGOA 4P00B 4CXWA 2DTWA 2DTYA 1YI9A 1IS5A 1QJY3 1MVEA 3UJQA 5A7OA 3RI8A 3SHRA 1DP0A 4QB2A 5CEHA 1BBT3 3AP9A 4XZPA 1ULCA 5F3EA 1ULFA 4XQ4A 5DZGA 2F17A 4LT5A 1H4HA 1CJPA 4UFHA 2Q4SA 3W20A 1PZ8A 1XB9A 1G86A 4K3UA 4MUVA 4P9XA 2YUEA 3IKWA 4YYOA 3PHMA 2EXIA 2XLGA 4UW3A 3KZ4C 1DQ1A 4Q4W1 3WF3A 3KS7A 2JG9A 3P3PA 3WSOA 4OUEA 5B4NA 1Q8VA 2VUCA 1RMU3 4AEDB 2WN2A 1XNTA 5FBZA 1E57A 4ONUA 4LO6B 4A41A 1W8TA 4K20A 4ISQA 1DZRA 1LOFA 1F8VA 1KFXL 3EBRA 4IQPA 4A6SA 4FCAA 2LROA 3LQCA 2J42A 5F3IA 4AAXA 4DEQA 5FMBA 4Q0UA 3T4HB 2UY8A 3TNPB 1W28A 3V64A 2NQYA 4A42A 1F5FA 1W9SA 3ZSJA 5DQ0A 1XSQA 1WA6X 1BXHA 2ES3A 2P1BA 4N9HA 2AACA 2BZDA 2X53S 5JOZA 1SBEA 2ILMA 4NN0A 3SEEA 3SLIA 5C3SA 4KNCA 2Y26A 4QAWA 1QQP1 1RUNA 1W6MA 3AZVA 2HWE3 1AR91 2JDPA 4IXLA 3I3EA 3KVAA 1VLNA 1O4ZA 4MH0E 3VBUA 3W59A 2TEPA 3RSJA 4CU7A 1I5PA 3WNMA 1WKYA 2ZOEB 3E6CC 4HVOA 1PM4A 3KCCA 4RQPB 4OYUA 4A2UA 1Z7S2 1I9RA 4UW6A 4BK5A 5LBCA 2WFPA 2ZHLA 5C9AA 4AG4A 5JMOA 3E6DA 3BKZA 4OHYA 2UY9A 3I54A 1BEV3 2R062 2XXZA 3ACIA 3LDRA 1UY2A 1Z78A 2NMOA 2ZHKA 3CNAA 3PLQA 4N53B 1IG0A 1VPHA 2QQMA 4GJYA 3O0WA 3NWKA 3MBWA 2CSGA 2ZA9A 5EJ1B 4UAPA 2RM22 4YW6A 1C8M2 1IG3A 1L7QA 5LEKA 2EF6A 3CMGA 4CA9A 5I0UA 3GCXA 3NSTA 4M01A 1SQ4A 1QJY2 1SMVA 5DMYA 3VD5A 3ST7A 5ACA1 5F7UA 1JZ8A 1BBT2 3J8F1 1J1LA 1ZA7A 4CSWA 1NCRC 1SLBA 5JR7B 3WT3A 4R9AA 3KGLA 3VUOA 1D2QA 3TN91 4OULA 4KBZA 1NKGA 4FFHA 3NO8A 1JOPA 4QHOA 5HPOA 4UBHA 4H55A 3ON7A 3RRDA 3WQ7A 5A70A 4QPIC 1ZVFA 3WP3A 2WNUA 4OI2A 3ZXKA 4FT8A 1IS3A 1CAVB 2R1DA 2ZZQA 5DUWA 1JYWA 1GNHA 2OVUA 4LITA 4AFBA 1UW8A 5CFCB 4MSVA 4GAZA 3MHZA 4ES9A 1RMU2 5LBFA 3EJKA 3MZHA 2WQ8A 3ZVXA 1OI6A 3VBHB 1BK0A 1VE0A 5K7PA 2D40A 1UO9A 3MIDA 5FDBA 5FQ0A 5FZ4A 1PGL2 2VBPA 3SKVA 4QGNA 1HN1A 1QOSA 3AZZA 5BV6A 2P37A 4YM0A 1CWPA 2V4VA 1IS4A 2W52A 2PQQA 3VBHC 1Q8OA 4L9BA 5CFDA 4AI2A 1WLDA 4GKXA 2AYHA 1RUG3 1VBA3 1AR63 1C5IA 3HQXA 2XPJA 2Y6JA 3ZN5A 4FFIA 2RDSA 4KWUA 5GLWA 1OXCA 3D8CA 2I07B 2HWE2 5DUUA 4Q0PA 1QNWA 1CPMA 3S57A 3QD6A 2EIBA 4Q0QA 5FLJA 2VMIA 2XLFA 5ERLA 2RE9A 5I8TA 3T09A 1I1EA 3H50A 1RC6A 2D6NA 2HH9A 2SBAA 4QQLA 2BFUS 3H9AA 1DQ4A 2FCUA 5FXZA 3G6JB 4CE8A 2Y0OA 1V6OA 3AFKA 3WEZA 1NE4A 3BI3A 4Q1PA 3DXUA 4MADA 1BEV2 4GB33 3U4XA 2UURA 1BMV1 4B1LA 4EYUA 1LTEA 4GZ9A 1MQTC 3M3IA 3ZLIA 4YZ4A 3AMNA 3O1UA 2XONA 2WINB 4URTA 4XEZA 5CU1A 3ALQA 1X50A 3HD8B 4RSUA 4FPJA 4WBBA 4C91A 2RS31 2A6XA 5HXVA 5A7WA 1QKQA 4QX2A 3UNPA 2BBVA 2W1QA 1YQ2A 2WZEA 4P9JA 1YJLA 2BPA2 3UETA 2QZ2A 1AYN1 5FYHA 2AEYA 4ZY9A 1LEDA 4QPYA 3BOPA 3J26N 4FPYA 2VGDA 3CZUA 2RMU3 2E7AA 1JUHA 4NIGA 2D3SA 5ABJB 5K4LA 4FAHA 2VAUA 1J58A 1VBE3 3AP6A 1FPN3 1NLRA 2AUYA 3CU7A 5TSWA 4AGGA 2YC2A 3FBYA 2Y8KA 1R64A 4B3NA 2OZ6A 3DN7A 3P5BA 4E4SA 1J1TA 1GR3A 5FZ0A 5JXGA 5CZKA 1HQNA 3OTFA 2ADEA 4JQTA 3CJIA 1KS4A 2ARXA 3WW1A 5J3UA 2HKXA 3WQ0A 1LOAA 4IUGA 3GZAA 2I74A 1V6IA 3VZLA 1BVVA 1C5HA 3U14A 1QJX1 5KHGA 1D2SA 3LEIA 3MIGA 3WF1A 3HEIA 5FY1A 2OA2A 4CUCA 5FZKA 2RDQA 3AZWA 3DV8A 4BQ2A 2JG8C 4AE2A 1SLAA 1VBA2 1RL3A 4CDUC 1AR62 1JN2P 1W39A 1G7YA 1SZBA 1UQXA 3OJBA 4QU1A 4HBNA 1JXNA 1LNSA 4XIOA 5FZ3A 1WMEA 2WWJA 5JI7A 4A7YA 2C6SA 3JZVA 3IM0A 3UESA 2WO3A 3I2IA 1JZ2A 4XAAA 1YWKA 1YIFA 4AQ6A 3O0VA 4QQOA 4QWNA 1UU5A 3RYRA 4Q4Y3 5A7PA 1UZVA 2DVBA 3EXUA 2ZX3A 3WF0A 4NE9A 3RQ0A 4ZXEA 3S7EA 4X8NA 4GB32 2VQUA 4GH4B 4MV2A 1BCXA 1JHJA 4LKFA 4H7MA 1WLCA 5GZDA 1YFYA 5T55A 5E89A 3VBSB 4YW5A 2JDNA 4XDPA 2WO2A 2WS91 3VKOA 1KJRA 3S7IA 2ZX4A 2B4KA 3GBFA 4Q26A 3OGGA 5K0UA 1NZIA 4GA9A 5GALA 5FKBA 1F4AA 3ZIWA 4AI9A 4CEYC 1NYWA 2D93A 2YGMA 1ND3C 1SDWA 2R1BA 2WABA 2RV9A 3BUCA 4LORA 1VBB3 2BWCA 4CP2A 1N3PA 2IC1A 3AP4A 4O65A 4XF3A 5DXDA 5K8SA 4AHYA 5C4WB 2ZACA 3AKRA 3BU7A 2RMU2 1GYKA 2WSUA 4D8MA 5LA9A 4DINB 3I8TA 4NMIA 3GJBA 3HN1A 3VZKA 3TEZA 1VBE2 1FPN2 4RGKA 2RS51 3VZMA 1POV3 5BNNB 4E2SA 3WDWA 1W6NB 2X05A 5C4WC 3PIJA 3H7JA 3HQUA 3AZXA 2VUDA 3GYDA 4XVHA 1Y7BA 4WVVA 2XBO1 2P3YA 5LASA 4IV1C 3WX5A 3BIWE 4CP9A 3MLKA 1GMMA 4EN9B 1XC6A 4UFMA 1RUJ1 1HDKA 2RJ2A 3ACLA 3TYJA 2P3JA 4DXSA 4RN5A 3I97A 2UWAA 2R0FA 2FDIA 2KXLA 5A3MA 4D7TA 5FLHA 5FYTA 2XMLA 2Z5WA 4C90A 3H8XA 1JBCA 4HN0A 2FCTA 1D4M1 5KHHA 2WUHA 4AFAA 2CWMA 3AJYA 2WYFA 4AOCA 3VDBA 4Y20B 3MFCA 1PMJX 2P3KA 4Z07A 2BRTA 1ULEA 3K48A 4IGQA 5DAPA 1DZQA 5FBJA 2PAKA 2BTVC 2BP6A 1AXYA 1G6NA 2R043 3C7OA 1W3XA 2JG9B 4IE0A 4XXAA 5JCTA 3VB9A 3RZLA 1HXS1 2N7GA 3J7NA 4UF0B 1ZZ6A 1K42A 1H2KA 4OMDA 1MS9A 2AH2A 2ZGMA 3KGZA 5H9SA 2K2SA 3NNFA 1KQRA 4MZUA 4OZOA 4QT6A 1AYM1 2C1FA 3GBGA 5DAXA 5DPNA 1VRH3 4Q4Y2 4V2VA 2CHHA 4FPKA 3ZXJA 5K9YA 3M4FA 4CVUA 4Y1YA 2CV6A 2C9AA 2P2KA 5FK8A 3UV9A 1VMHA 1LOFC 1DGLA 3NV1A 4YVSC 5F1RA 1GP5A 1VIWB 2ZMLA 5FZFA 3PNAA 1XQNA 3P6BA 1W6MB 4JHZA 3DYPA 4JGZC 1RUH1 4AFMA 4HKOA 1WW7A 5DABA 2X10A 1N1SA 3CO2A 3EHKA 4G3YC 2XH6A 1W6QA 2VZUA 4JHTA 4NPRA 5L7OC 3AFGA 2BNOA 4ZS3A 1V6LA 4QX0A 1RHI1 3OD4A 4L99A 2UYAA 3ETQA 5F2WA 1VAVA 3I2HA 3UYJA 3VBUC 1LKNA 1QOTA 2QQUA 1AVBA 2X5IB 4CDQC 4CRQA 5FP7A 3FC0A 4E4DX 1VBC1 3OBAA 1QH6A 1US3A 1TE1B 1W0PA 2VZVA 4IEXA 3VZNA 2VZ1A 3U75A 2PQSA 4YG3A 3SH4A 1WCDJ 5DDJ3 5C9AC 1MZ5A 1Q43A 5I0DA 4NRMA 1ENRA 3RJ2X 5LY1A 1W0OA 5A1LA 3INAA 4Y22A 4NR1A 3T1LA 4YGDA 4FPHA 5IK4A 4WM8B 3VBFC 1POV0 3HOBA 2Q1ZB 2VNGA 2W2IA 1REFA 2JIGA 2RJKA 1W6OA 4EWEA 4KH9A 4L8QA 2WAAA 1GZ9A 1ZNPA 2IFWA 1ZYBA 3PUSA 3MPBA 4Y3OA 3D82A 3LEGA 2BNMA 2YB7A 4PBPA 1YXWA 1OVPA 1J84A 2TUNA 2WNUB 3OY8A 2IFRA 5FZ9A 4CYDA 1OA3A 4IESA 3GJAA 2Y6LA 2R042 1CIWA 1MS1A 2EIGA 4UXAA 3JQWA 3UGGA 4CDWB 4DQAA 4YARA 3SMHA 5JR2A 2WLPA 4EJRA 1AJKA 4OQ9A 1H9PA 4RHV1 5JDBA 4UBGA 2NP0A 4FSJA 1H8TC 3W5NA 2ERFA 2QTWB 1RUF3 1VRH2 3H1YA 3VBOA 5BPXA 1NX9A 4RGGA 4YGEA 1QXJA 1ZZBA 3RZZA 4CCNA 1IPJA 4FTEA 4CDXA 1W8HA 2VUJA 1W8NA 1N3QA 2WLQA 4GMP1 2Q1MA 1W8UA 2ZGPA 1PO23 4GWJA 1YYNA 3CLPA 4MLOA 1EY2A 1Z0HA 4BMEA 1LESA 2QVSB 5CFDC 3CHXA 2MNGA 5FPBA 1JYNA 2HYKA 1J83A 3OPZA 3ZXDA 5FZAA 2HEVF 2VCMA 2VMHA 1T6BX 3IDEA 4NOTA 3UKVA 2WWSA 1C1FA 1NUKA 1SCRA 4IL7A 3NL1A 2VMGA 1T2XA 2Y64A 4WZCA 2YZ4A 2DCKA 2ZBJA 5SV8A 2ZGUA 3ACGA 1NCRA 1RUC3 3OPWA 5DDJ2 3ZFEC 5JOWA 4XTPA 2GH2A 4R9BA 4OHVA 3NNJA 4YM3A 4Z92B 2R16A 1QXRA 2G4IA 2E51A 5FR3A 1LODA 3I3QA 3ZO0B 4LIVA 1E5SA 3H1WA 4IDZA 2GNTA 4XC9A 3QLQA 5A7WB 4AI3A 1ZRIA 3OYWA 1J3RA 2ZEZA 5C8CB 3F2ZA 1OUSA 1W9WA 3VD4A 3ZYJB 5IK7A 2IXJA 2Z79A 2Y33A 1MS0A 2C9KA 4KU8A 4Z82A 1DQ0A 1JW6A 1UF2C 2WBKA 5C7GA 1S2KA 1DCSA 3I3DA 2FD8A 5F8PA 3OGVA 4DY3A 3FHIB 3KF5A 2YYOA 5J1XA 5FOBB 1GOGA 3HAGA 4CCJA 4RS5A 2PHDA 2OUJA 2WDBA 2OXBA 4Y4RA 1A34A 2ZGQA 1BKZA 5F39A 4Z1VA 5D2AA 1GICA 1S0EA 2ZHNA 1ULGA 3KCYA 2PTMA 4XXPA 1SBFA 2O14A 2VTXA 3MO4A 1Z7S1 3CJXA 2R32A 3KMHA 3O7OA 5HV4A 5F3GA 1EV13 3K75B 1H1IA 4LBJA 3CJIB 4LBNA 3AVSA 2R061 4DUXA 4OQ8A 2OW4A 2D98A 3SCGA
chains in the Genus database with same CATH topology
4AI8A 5FO9B 1R083 4DPNA 3E5QA 3M3QA 4JC1A 5KXCA 4P14A 1AF9A 1PVC3 2RM21 1C8M1 1DQ5A 5FPZA 2DF7A 4N9IA 4COZA 4MXVA 1L3JA 4QHBA 1QJY1 3LAGA 4XOGA 1PO22 3KT4A 1ZBA3 3O0XA 1BBT1 3UJOA 3ZFGB 1SCSA 2BVVA 2ZGLA 4YFWA 5EYYA 1PIV3 3T1MA 3AB0A 4A7ZA 2F6BA 1K5MA 3AMMA 2LUWA 1GZCA 3MIEA 1T6GC 2GAUA 3PVNA 4FVVA 4Q0VA 2XJUA 4QQ2A 1RMU1 2RR13 1GANA 1WD3A 1RUC2 2WZR3 2ET1A 4CEWA 4P5HA 4COYA 1U5ZA 3S0MA 1PGL1 1YIPA 3AKQA 1V6NA 1UAIA 2YGLA 1LB2A 4RR3B 2Z2SB 4XILA 4PDWA 5K0UC 4QGLA 3WUCA 5EFUA 1ND2A 4I02A 3R0RA 4M3CA 4SLIA 2HWE1 3SITA 1KJLA 5GLUA 2Q8OA 4D3WA 2BGCA 4XJAA 5E88A 4JDOA 2D44A 1YFUA 4B7KA 1NY72 2DURA 1XNBA 1EV12 5KWRA 1BEV1 1LOCA 2CWSA 2GNDA 4CDUA 3FUQA 1R082 3C2UA 4ISRA 2PHWA 1F2NA 1LHUA 3MEPA 5CADA 1XXNA 3IPVA 1PVC2 1ZBE3 4RD7A 1COV3 2A6ZA 2V73A 4DB5A 1W2UA 1BVP1 1ZBA2 3E97A 3WCRA 4HPKA 1XYNA 1V00A 3WINE 2C5DA 4FOVA 1J3PA 4XQWA 1PIV2 2K9ZA 3M3CA 3WDYA 1LOGA 2GNMA 3VHNA 4XDQA 2YDEA 2QE3A 2YROA 4W6YA 5CG9A 3SXWA 1PMIA 4BLJA 1ND3A 2ZS6B 4COWA 3WP5A 2RR12 1GLHA 4L92A 3VDDC 4AFCA 4LULA 3APBA 1AR83 2PHLA 2HWD3 1LHNA 3RJRA 2WZR2 1QMJA 1AR73 2W39A 4AHZA 3MW2A 2HWF3 4GIQA 4COUA 2R30A 4MGKE 2TBVA 3H0OA 1RUG1 1DG6A 1FV3A 1AR61 1VBA1 2RHPA 1DGRA 4IV1A 2CGNA 3PVBB 2DUOA 4HK9A 1GBGA 1OMIA 5FOJB 4P9WA 1APNA 2H6BA 3QH7A 1CX4A 5F9TA 2JENA 2E7QA 2EALA 1KDKA 3FLTA 4YVWC 4MXWA 4GB31 1J59A 3N35A 4IEYA 5JLVA 4GMP0 4KBBA 1QU0A 4AW7A 5D8AC 1FOD3 4J1XA 4HK8A 1CR7A 1ZBE2 1URXA 3N36A 1CAXA 3POWA 5I93A 1COV2 4I2OA 3U10A 2HWB3 1KS5A 2VOVA 4D69A 2QCSB 3NV3A 4XJUA 3TNQA 2XGXA 4YVSA 3E5UA 2RMU1 1VJ2A 2DCJA 3VZOA 1FT9A 1GSLA 4ES8A 1REEA 2LTNA 2PLV3 4ORFA 4IEWA 1VBE1 3MF9A 1RJ7A 3N4MA 1FPN1 3WY6A 3HT1A 1S0JA 4JGZA 1R1ZA 3RNSA 4LHNA 5GLTA 4KG8A 3MW4A 1PGSA 5L7OA 1HQWA 1LGNA 3VBOC 3ZXEA 3PMSA 5CAZA 1AR82 2HWD2 1UPSA 2RJLA 1AR72 4CDXC 2HWF2 4CDQA 2GMEA 3D4KA 1CAWA 4WM7A 2DFCA 1VB2A 3SH5A 4HL0A 1XU2A 1OOPA 2JICA 4R9DA 2VECA 4C0BA 3SNMA 4R8HA 3R4SA 4NVPA 5F5QA 4PF5A 3ATGA 1AL23 1R093 2DFBA 2B8MA 3FLPA 1X82A 3SCHA 3VBFA 5BNOA 5JPNB 5B2GB 1IKPA 1LRHA 2A75A 5EV7A 5H9RA 1NCRB 2P3IA 3LKJA 4X6RB 5GZEA 2JKBA 2XHKA 2JX9A 1ZRDA 1PK6A 4BIOA 4Q4Y1 1RB8G 4GALA 1O3RA 2DUPA 1WCKA 4H3WA 3J4UH 4QPIB 4ASLA 2A6VA 5GKAC 5C8WA 4YRDA 1LHOA 1EPZA 3MICA 4L97A 4Y26A 1QGLA 2PAEA 3GHNA 4Y1UA 1FOD2 2FQPA 4TZDA 1VAMA 2A3WA 3ZFFA 3SH3A 2AZ5A 3V0AB 1H8TA 2XWJB 2NMNA 1RVF3 4QM9A 1VBB1 4RS5C 5AVPA 4PLNA 1UKRA 3HT2A 5T5LA 2PLV2 1POV1 2G9GA 4NO4A 3D5OA 1YFXA 1UIKA 3WUDA 4META 3D0SA 5EYXA 1UMZA 2ZMKA 3WHTA 3PMEA 4Q29A 4FQZA 5JZGA 4DFSA 1NCQA 3WZ1A 3WOGA 1SBDA 1WW6A 2DU1A 3VKFC 3CF6E 4YW3A 4B7EA 2NM1A 1DFQA 1MQTB 4LLOA 5EXOA 1QJU3 5DG2A 2QDRA 3ZFEA 1DYKA 1SFNA 5A33B 1MS8A 2IXCA 2NLRA 1ZM1A 4DRVA 3C3VA 2R041 1R092 2ZAAA 5T50A 1K5MC 2GN3A 2XJPA 1YI7A 4KL1A 4HSLA 5HCFA 1CN1A 3R4DB 3RI9A 5KXDA 2BW8A 1VRH1 4P9LA 4R4ZA 2VG9A 1H2LA 2ZAHA 3WQ1A 1XU1A 2B42B 5LRRA 2WT0A 4FPOB 4CEWC 4G4FA 1QF3A 3VL9A 4LR4A 1V70A 1FV2A 1NOVA 2WFF3 1JYIA 3JBG3 1AX1A 5T54A 5LRSA 2JECA 4ASMB 1FXZA 2CGPA 4PDWC 5FCCA 5LK7B 3VN4A 1C57A 1ND2C 1RVF2 4XYXA 5KHKA 1C28A 2E53A 3LZZA 2A6YA 3WW4A 2JG8B 4XBNA 1SFYA 4LNVA 4CDUB 4U2AA 4AEKA 1RIRA 5F6KA 4EWDA 4HVRA 3IPVB 3I59B 5DDJ1 1YO8A 2D7FA 4XBQA 5I91A 1RUOA 1RUG2 1VAKA 4IEOA 5L19A 4XTMA 2CTVA 2UWCA 4HPKB 4Q4X3 2QKDA 3UL2A 3THPA 1H30A 1UD1A 3MLLA 4GULA 4BPZA 1YNAA 1QJU2 4N7UA 4AVBA 4HKWA 4LO8A 1V9U3 4F83A 4C1XA 1U12A 4M0HA 3BTAA 2VVDA 4Y1XA 2QNKA 4LBOA 3ZXGA 2O8OA 1Q56A 4AQTA 5J96B 4CEYB 1ND3B 3WDXA 3WG3A 3GNEA 2JD4A 4OHZA 1OQEA 2A5ZA 2WKKA 2QZ3A 3U07A 3ZN4A 1X7NA 1CAUA 3R6SA 1MS5A 1RUF1 3BB6A 1BK1A 1CJDA 5FMOL 2PAMA 1H2MA 1NLSA 2Q30A 5FPXA 3PVEA 3QACA 1EAH3 4XFFA 5FRAA 3TB0A 4IV1B 1S0IA 3X29B 1KDMA 3PVOA 2WFF2 4AI1A 1PO21 3JBG2 1O5UA 4JGYA 1B35C 1ZZCA 4JRAA 1G9BA 4ATFA 3ZPYA 3N7KA 1LECA 1VR3A 1BJQA 1LHVA 1PGW2 2A71A 1WA4A 4QX5A 2YY1A 3A0NA 2LALA 3VBRA 2D5HA 1NE6A 5J37A 2WIIB 1NQDA 1M06G 5AFEA 3AZYA 2GC1A 2ATFA 4MXWB 3D0JA 4IV3A 3JD73 1B09A 4KWJA 4BHPA 1OFSA 1FX5A 2BQPA 4ZKTB 3GF6A 1YCIA 4XPVA 1RUC1 1ASJ3 1ZZ8A 3SISA 1PZ7A 2CY6A 1LCLA 1N1TA 4Y1ZA 2FMDA 3FFQA 3HMYA 4Q4X2 2MPFA 1S0GA 2GN7A 4YVSB 4FPCA 3WDVA 4FP3A 2EAKA 2B45X 3VDDA 1V9U2 2ZKNA 4AVVA 5JVVA 4JGZB 4XHBA 4GQ7A 2PHRA 4UW5A 2D5FA 2WJSA 2WA3A 3ZSKA 5L7OB 5DZFA 1NY71 4D94A 2IWGB 1HLCA 2VNRA 1EV11 2EAAA 2VPVA 2YPJA 3VBUB 2IZWA 2P17A 1UPIA 3RG0A 4AXOA 1OSGA 4CDQB 1R081 3NV2A 1QXPA 1KITA 2WNVC 4CZSA 1OQDA 1VBB2 1PVC1 3DPRC 4QU2A 5C9AB 2B46X 5A3LA 1EAH2 3FZ3A 1G9DA 1MVQA 4JRLA 4XW3A 1LOBA 3ZYIB 3VBFB 4F3JA 4WM7C 5JOYA 1ZBA1 3P3NA 3U0ZA 4V1PA 1HRV3 3N3HA 1OOPC 2BYVE 4M00A 4YVWA 2WZPP 3FE5A 3UKTA 5D8AA 1PIV1 2I2SA 5BNOC 5D1IA 3V0BA 4C1WA 2EXKA 1PO13 4XJ9A 3LOIA 3FFZA 1DGWX 2XG3A 3JD72 2WT2A 3MIHA 1FYUA 1PK6C 1WUVA 2RR11 4ZU7A 3OBRA 4DOUA 3LA3A 4H14A 1MACA 3VKLA 3AYDA 1ASJ2 2WZR1 5BNPC 1ENXA 4DXZA 1H8TB 1XYOA 2ZGOA 4MYEA 4NHKA 3LOBA 4GWMA 1AX0A 3ZFFC 3QOPA 4NWWA 4K21A 2DCZA 5FQ0B 4LEJA 3ZMOA 1A8MA 3WP4A 4ZU5A 2ZTNA 3AKPA 3ZDSA 5HI0A 5FFOC 5SV5A 1GV9A 5CFDB 2WQZC 4R9CA 5E16A 3H3ZA 5JPMB 4AEDA 4Q1RA 2ZHMA 1VBD3 4HKLA 1MEC3 2GSYA 4HZFA 2GC0A 2V09A 4LUMA 4S2FA 4M3CE 4OI0A 3A4UA 4AVTA 3MIFA 4EN6B 5JZGC 2JEMA 1HQLA 1ZBE1 1NCQC 1N1VA 4HN1A 3ZFEB 4U36A 4QQHA 5HCBA 1COV1 1UIJA 3ZYGA 1V6MA 2DWRA 5EWSA 1HRV2 4Q8LA 4YZ1A 3B9CA 3HIFA 2Y38A 2VY0A 4LO5B 4WVMA 2HJIA 1SACA 3TBDA 3M3EA 1YFWA 3IBMA 1RTVA 4Y4YA 4RQPA 4PIYA 4INDA 3DL3A 2ETEA 2D97A 4N7IA 1XE7A 3B7MA 3FJSA 4FOQA 1PO12 5FREA 2OUHA 2FMYA 2VULA 3H1MA 1F9KA 3FBMA 1G9CA 2DYCA 4FQ4A 1I5ZA 2XLAA 2B9UA 1AR81 1QWRA 2HWD1 4O9GA 4K6BA 5FO7B 1AR71 3AYAA 2GDFA 2HWF1 3FLRA 5GZFA 4I3GA 2SLIA 5JSRA 2DUQA 4J1WA 5L36A 1AUYA 2OYZA 4NWVA 1MS4A 1LGCA 5GZGA 4QPGC 1RUF2 3MI8A 5L73A 4OI1A 1TEIA 1HRI3 4WVWA 2H0VA 4FXGB 5C33A 1QH7A 5JAXA 4Q4V3 3WR0A 5CFCA 5JSPA 1I6XA 3UKNA 4ITCA 5HBAA 1VBD2 4BE3A 1DDLA 1MEC2 2ZKLA 1JTZX 1XYPA 4N43C 5CNAA 1FOD1 4BWOA 4YW2A 3NV4A 2JE7A 3ZN6A 3CEWA 5KHJA 3IDBB 3POYA 2VUAA 1OKQA 1UZZA 4FPLA 4I01A 5J36A 2BUKA 3N7MA 1RUI3 5GLZA 3TRSB 2HWB1 4B8EA 1CONA 2CYFA 2W0XA 2X29A 5IT6A 2XJTA 1FAYA 5K0UB 3URFA 1HX6A 1CAUB 3WDTA 1FATA 1TNFA 2GC3A 4S2DA 4DS0A 2PLV1 2YHJA 4QMAA 1NA1C 2BVBA 4GKYA 1XE8A 3ZIXA 1PNGA 1JYCA 4QXKA 2BNNA 1Q3EA 3ILRA 4YG6A 3TAYA 1G9AA 1OQ1A 4IEZA 4X6QB 2P34A 3W58A 2JXAA 4YZ3A 4AQ2A 1QNYA 4KWKA 3VZJA 2VNOA 1PZ9A 2VOWA 4EN7B 1U5IA 1D0HA 1ZRRA 4XMIA 3I4IA 3NAPC 1WLWA 4P9IA 3W9AA 4EROA 1YUDA 2WNEA 1H1MA 1LOEA 4QGMA 3K51A 4JGYC 3USUA 1UCXA 2FZ1A 3AP5A 1X33A 4MGZE 4Z2WA 4B4RA 3D6EA 5JSOA 1AL21 2ZCWA 1R091 3AM2A 3H7YA 4FOWA 5ABJA 2WT1A 3WW2A 1HRI2 4O9EA 5C6CA 3B00A 3VBRC 2QUOA 1X8EA 4XF4A 3OBTA 4E27A 1OA4A 1ZA4A 4S2HA 4Q4V2 5I0SA 1Y43B 4IV3C 2RS13 1D4VB 2GMPA 4XF9A 4XFGA 2E9QA 3MF6A 3NKGA 2HWC3 4IERA 1OD5A 2X8KA 1ZRCA 3DGTA 5IK8A 1H4GA 3VDDB 3POSA 3FMGA 3JU9A 2CNAA 1RUD3 1RVF1 4DZGA 3ZXFA 5I8YA 1LR5A 4R52A 4YW4A 4BIFA 2GU9A 1KD7A 1M4WA 3ZSLA 4LE3A 1TQ5A 5E1RA 1W6QB 5HCAA 3B94A 1FNZA 1B35A 3MPPG 4P9YA 2NZ9A 3KLSA 3JQXA 4FPGA 3CL1A 1QDCA 2R073 4EN0A 1ZRFA 4Q2FA 5GLVA 3RWNA 3N7LA 3VBSA 1IOAA 1X8MA 2D6MA 5J98B 1MZ6A 3IIAA 4YVWB 5FTTC 2XL7A 1R1A3 1J3QA 1S0FA 2E63A 3MYXA 1TMF3 4Y22B 2EVXA 4I0BA 5D8AB 1QJU1 1HIXA 1QHDA 4MX3A 4IEUA 4YG0A 2DV9A 1NG0A 4YZ5A 1MR5A 1W6OB 5H9PA 2VVFA 3AMQA 4JDMA 4TLFA 1H1AA 4ZXKA 4AEMA 4PIXA 2BEOA 4PJYA 5BNNA 1OFNA 1RUE3 3OY8B 1PM7A 1CESA 2RS12 3AK0A 4YGCA 2UWBA 1G9FA 4R4XA 3RPQA 1Q8PA 1DIWA 2HWC2 2VW1A 4JTNA 5FLIA 3AKSA 3ECQA 1F5JA 2ARBA 3OF1A 4HSJA 2WFF1 3VBOB 3JBG1 2ZGSA 2DVGA 1U0AA 4Y20A 2PELA 4E9KA 4JDNA 4I0AA 1TME3 4NHMA 2MEV3 1PGW1 4CDXB 1HV0A 1RUD2 2WNVA 1O3QA 3O12A 1U5XA 3WXPA 3DPRA 3THTA 2MHFA 1NQJA 1DU3D 4WVZA 2DCTA 1A6CA 2GZWA 2ZABA 3ENRA 4LLFA 4S2GA 1LENA 2IXLA 1C1LA 5A32A 3AKTA 1FMD3 1YLLA 1BQPA 3MW3A 4AEDC 4I3PA 4LTAA 1SLLA 2ZZJA 3S6PA 2ZGNA 4L2NA 4Y5Z0 2R072 5EZWA 4PCRA 3BOWA 1ZREA 1LHWA 1LEMA 2O1QA 2EA7A 2AENA 3HR9A 3RS6A 4KQ7A 5GM0A 2XB6C 1AL0G 2JJ6A 4Q4X1 4YNIA 4XF0A 1R1A2 3AXDA 4WVMB 3RMYA 3BPZA 3R4UA 1TMF2 2HEYF 2PHFA 1KRIA 3KD4A 1IQAA 1V9U1 2H6CA 1OA2A 1F31A 3OYWB 5BNPA 4YM1A 1X36A 2BFUL 2X5IA 2WL1A 1C8NA 2NYYA 3AP7A 3JB8A 4N90A 4F8AA 4RQPC 5AFBA 4OUMA 4RS5B 1Y3TA 1G8WA 1N1YA 2YXSA 1XNDA 1RUE2 2KA3A 4RL7A 4BMBA 2H0BA 2ZGTA 2B7YA 5KHIA 1OLQA 4N53C 2HWB2 1O7FA 4WM8A 3NVCA 3Q9OA 2D6KA 5CIRA 3V56A 2D6OX 4XFCA 2DCYA 1EAH1 4Z8BA 3WCSA 4LBQA 1FNYA 2AR6A 3U11A 4K1ZA 1BYHA 4LO7A 2GNBA 1TME2 4OLLA 2MEV2 2EXJA 2CAUA 2OZJA 1SLIA 3IDCB 4CDWA 3VHRA 4OI4A 2E7TA 4PBOA 1UZYA 4TYSA 4FTSA 2ZMNA 2VVEA 2DU0A 3JD71 1DYPA 5CFCC 5FO8B 3MIBA 1FMD2 3HBZA 3ZN6B 1K5MB 2VQ0A 1MS3A 3E6BA 1ASJ1 1TNRA 2R0HA 4A3XA 5T5OA 1H2NA 3VKNA 4AI0A 1AL22 5BNQA 5BXXA 2VW0A 4LA3A 2W68A 1Q5OA 2XJSA 4FOYA 2A73B 5AC93 3USSA 2TNFA 4CEWB 3ZSEA 4Q27A 1FI2A 2PA7A 2JDZA 2ZX0A 1CQ9A 2KM2A 3WNXA 2QQPA 4X8PA 2E6VA 1EYBA 4QQPA 3LSEA 4E2QA 4EN8B 4PDWB 3IN9A 3ES1A 1XNKA 2W08A 3ILFA 4AVSA 1ND2B 2XL9A 2VH9A 4KWLA 4M3CB 4WV8A 1ENQA 4RFT0 4Q4W3 4QPGA 5FAXA 1PVXA 3VKMA 4KG0A 4P9GA 5C8CA 4Q8KA 4BZ4A 3KT7A 3USUB 5J09A 1H8VA 1H0BA 3FX3A 4AEJA 4L11A 1UU4A 4XJWA 3UK9A 2OPKA 2XUMA 3AX4A 1HRV1 2Q5TA 1MZFA 1EPWA 4DRRA 1QY4A 1A8DA 1OPOA 5T5JA 3ILNA 4N43A 2C0ZA 5ABJC 4DY5A 4OZXA 2FZ2A 1QQP3 4CP0A 4XMAA 3AYCA 1AR93 1UU6A 2ZX1A 4EV0A 2XKOA 1PO11 4BLIA 3VGIA 4EWAA 3VV1A 4HMZA 2PYTA 1YJKA 4BQ1A 4QD2A 5H9QA 1ONAA 1O91A 3BODA 4M3CF 4BM8A 3VL8A 1NA1A 4FPFA 3MDPA 4XJZA 4FBFA 3O14A 4KU7A 1PHMA 5DUVA 3M2MA 3PTYA 1JOJA 2VW2A 1IHMA 4XFBA 3ZFGA 1ALYA 3M70A 4QM8A 5AC92 1CD3G 1Q8SA 3BCWA 3R05A 2EXHA 4K1YA 1XRUA 4LBQD 5ACA3 3NAPA 5CA6A 2WC2A 1B35B 3J8F3 4MGYE 4LBLA 2UYBA 3KT1A 1HV1A 2A70A 2UU8A 1UX6A 3S30A 3TN93 2A6WA 2PHTA 4LO4B 4YM2A 2DVDA 1VBD1 1MEC1 4NHLA 5I8SA 1S55A 4Q4W2 4GH4C 3WDUA 4LBKA 4YGBA 4AK3A 4LA2A 1QOOA 4HT1T 3AXEA 4W65A 3VBSC 1A3KA 4RR3A 1DHKB 1C3HA 4BYYA 4H7LA 1NZCA 1RINA 4BOWA 5CG8A 4OUSA 4FAGA 3A0KA 3VHOA 4I09A 1S2BA 4XFHA 1CVNA 3VHPA 2QDNA 3B02A 3BALA 1CAXB 5EJ3A 1WCSA 2QJVA 4Y1VA 4IEQA 1QQP2 1AR92 2Q0AA 4LHLA 5AVAA 5BNNC 3FUOA 2ZPXA 3KB5A 4IETA 2NPIA 5LK5A 3B5LB 2XVLA 1XNCA 1REDA 1N3OA 1BZWA 2NN8A 4Y24A 4PIZA 4JCKA 4YLZA 5IK5A 2V5YA 3B9IA 4F7ZA 3GZTB 1LU2A 4KGQA 3ASIA 4W6XA 2WNVB 5LEJA 5FMOS 1RJ8A 3DPRB 4HETA 4UW4A 3IMNA 1O3TA 4JTOA 1GZWA 4C0HA 4XE9A 1WBFA 2RS33 5A32B 1W6PA 1WW4A 2JG9C 2F4PA 1S1AA 1HRI1 1CAWB 4WM7B 3ZXAC 5ACA2 5GJ6A 1AYN3 1OOPB 1U5YA 3J8F2 5BUVA 2LM3A 1GKBA 4Q4V1 3WG1A 2A7AA 2GMMA 3TN92 3V65A 4M0NA 3RMXA 5IUQA 1ZZ7A 3AJZA 3OGJA 5BNOB 1DGRN 5KC6A 1SEFA 1V6KA 4XQDA 4FTBA 3MLJA 1DZTA 2O8QA 4DMIA 1PK6B 2JE9A 1WLTA 4RGAA 2A3XA 3LCPA 3SCFA 4GXLA 5BNPB 2ZGKA 3HWJA 4AYUA 5JI9A 4FPEA 1RUI1 3M8LA 1IZ3A 2FHRA 1QJX3 2D3RA 4AF9A 1VP6A 3KSCA 4HVQA 3EO6A 3AYEA 3TOJA 3ZFFB 4YSFA 3M7AA 4B4PA 4W6WA 1DLLA 2X5IC 4I30A 3KQRA 4CP1A 2YMZA 3OD0A 3PJQA 1LJ7A 3RYPA 1CGPA 3B01A 1SLCA 4K7JA 4YZ2A 4LBQB 2XJVA 1CPNA 4WM8C 1GQHA 3L2HA 3MGUA 5T5PA 2ZX2A 4DNYA 2CL2A 3LB9A 3PJYA 1BMV2 3WLUA 3GZUC 2Y0IA 4B4QA 1A78A 1ULDA 3LA7A 4AWDA 2D3PA 2IXKA 5KBFA 5JZGB 2WS93 1EP0A 1NCQB 5F6LB 2XKPA 4LE4A 4IEVA 2XWBB 2WNUC 2CGOA 2ZJCA 2RS32 3ZYRA 4D7SA 4CDWC 2ENRA 5JOXA 3ZYPA 3DUIA 1AYN2 2ET7A 5CB7A 3GHMA 1AZDA 2HEWF 3DKWA 4K40A 3WW3A 4E4ZA 2RS11 5KC5A 3WG2A 3LSDA 1JHNA 2DVFA 4A7KA 2RS53 2HWC1 1LGBA 2PHUA 5T3NA 2XBO3 4LBMA 2XJQA 4J6GA 2B5HA 3M3OA 2WA4A 5DG1A 1AXZA 3QH6A 1RUJ3 5JIAA 2FBEA 2R6QA 4OVEA 1MZEA 1RUD1 1SLTA 4I0WB 4FXKB 4N53A 2PFWA 1QJX2 4AQSA 1OLRA 1D4M3 4JAAA 4XF1A 1QDOA 2OIIA 1WMDA 3H3UA 5KXEA 3WHUA 4G9SB 2WQ4A 4QPGB 3WVJA 4AVAA 1O4YA 5DZEA 2Z69A 1AHSA 4HLTA 4IEPA 1HXS3 5BYNA 4YFZA 2XVKA 2QFEA 1IPKA 4QPIA 4XBLA 1N47A 1WD4A 4OHWA 2R071 3KM5A 5E8AA 2B39A 1AYM3 3IWZA 2BWAA 4AHXA 2DVAA 2PN5A 1UKGA 4Q0SA 2R49A 5C8CC 1JH5A 1CAVA 3LA2A 1R1A1 4JVAA 3V0AA 4B29A 1TMF1 4N43B 1HW5A 1LU1A 3ME2A 5J7MA 1PNFA 2WS92 3AMHA 3VBHA 2YC0A 1O5LA 5T52A 4AVCA 1RUH3 3OCPA 1ZX5A 2O0OA 3L9JT 5JMCA 3LWCA 1RHI3 1RUE1 1O3SA 2AREA 3CJIC 2YV8A 3WG4A 5JIUA 4MGIE 1NA1B 4OHXA 3L2YA 3RYKA 3JB4C 1VBC3 3O5SA 5J48A 2RS52 3KCXA 4XHXA 4AGVA 5KXBA 2XBO2 1MQTA 2VQAA 1GQGA 1AJOA 5I0RA 1Q8QA 3AMPA 1DQ2A 3VLBB 5CBLA 1RUJ2 3NAPB 1ENSA 5A33A 1TME1 2IXHA 2MEV1 4JQRA 3B93A 3I2DA 3ZFGC 4XJ8A 4WZFA 1S0CA 1IKQA 3T2TA 2Z42A 1AXKA 1D4M2 2XVGA 4D7YA 4BCUA 4JGYB 1WW5A 4XFAA 1WGPA 1IGOA 3ZSMA 2IXIA 4FP2A 4KGGA 1FMD1 3B3QE 5BY5A 1KFUL 5DUXA 4JV4A 1OPMA 1VB4A 1C4RA 1HXS2 2D6LX 3VBRB 4LHKA 4COVA 3E5XA 4RHV3 3NW4A 3GBWA 4PQ9A 1JUIA 3WP6A 3ZMNA 4IV3B 1WBLA 1AYM2 2PHXA 4SBVA 1DQ6A 3DF0A 3WV6A 4RR3C 1WMFA 1NXMA 1YRZA 2K0GA 5JWPA 3N7JA 3ELNA 1YHFA 3TWIA 4ATEA 1GFF2 1GNZA 4K9SA 1H9WA 1OHFA 5GZCA 4GMP3 1DGWA 4PLMA 1IS6A 4TSVA 1VALA 3JUUA 4BH9A 1LULA 1DBNA 1O4TA 1UL9A 2JG8A 1DF0A 1RUH2 2I45A 4CTEA 4PLOA 2D6PA 4AGRA 3ROUA 3QCWA 4AFDA 5CVRA 2VOKA 3WD5A 1KXGA 3QBQA 4ZU4A 3I59A 3NKTA 4AHWA 1RHI2 4XFIA 2A3YA 4FO9A 3EQEA 1RUI2 1D0GA 1VBC2 3IT8A 3JCIA 2GH8A 4MVTA 3B69A 4XIKA 1GZWB 3G7DA 1QJZA 1W6PB 1Y9QA 5I0TA 4RA0A 1RGSA 1RITA 4XETA 1I3HA 3NJZA 4GH4A 4OFGA 4CEYA 4HFSA 3ES4A 4YW1A 3GALA 2ZGRA 2GC2A 3ZX7A 3M1HA 2VOXA 3ZXLA 4E2GA 2GALA 2G9FA 4HANA 3I7DA 1HKDA 2D43A 2VU9A 3FWEA 3MFAA 1AX2A 1Z7S3 2VXRA 2WSVA 1S0BA 5C4WA 3V0BB 4RHV2 1S0DA 2R063 4GWNA 1ZZ9A 1NXD1 4BA6A 3J9SA 3H8UA 2CAVA 3LGRA 4TWTA 1V6JA 4LUKA 2AGSA 3RDIA 2RM23 1W6NA 1C8M3 1UN1A 4K8FA 5AC91 2XJRA 2DTWA 2DTYA 1YI9A 1IS5A 1QJY3 1MVEA 3UJQA 3RI8A 3SHRA 1BBT3 3AP9A 4XZPA 1ULCA 1ULFA 4XQ4A 5DZGA 4LT5A 1H4HA 1CJPA 2Q4SA 1PZ8A 1G86A 4K3UA 4MUVA 4P9XA 2YUEA 3IKWA 4YYOA 3PHMA 2EXIA 2XLGA 4UW3A 3KZ4C 1DQ1A 4Q4W1 3KS7A 2JG9A 3P3PA 1Q8VA 1RMU3 4AEDB 5FBZA 1E57A 4ONUA 4LO6B 4K20A 4ISQA 1DZRA 1LOFA 1F8VA 1KFXL 3EBRA 4IQPA 4FCAA 4Q0UA 2UY8A 3TNPB 3V64A 2NQYA 1F5FA 3ZSJA 1BXHA 2ES3A 4N9HA 2X53S 5JOZA 1SBEA 2ILMA 4NN0A 3SLIA 4KNCA 2Y26A 1QQP1 1RUNA 1W6MA 3AZVA 2HWE3 1AR91 4IXLA 1VLNA 1O4ZA 4MH0E 3VBUA 3W59A