5C33A

Crystal structure of mouse ryanodine receptor 2 spry1 domain
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
190
structure length
179
Chain Sequence
b'VSSMRPNIFLGVSEGSAQYKKWYYELMVDHTEATHLRVGWASTEGYSPYPGGGEEWGGNGVGDDLFSYGFDGLHLWSGCIARTVSSPNQHLLRTDDVISCLDLSAPSISFRINGQPVQGMFENFNIDGLFFPVVSFSAGIKVRFLLGGRHGEFKFLPPPGYAACYEAVLLKVEHSREYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ryanodine receptor 2
publication title Crystal structures of ryanodine receptor SPRY1 and tandem-repeat domains reveal a critical FKBP12 binding determinant.
pubmed doi rcsb
source organism Mus musculus
molecule tags Contractile protein
total genus 35
structure length 179
sequence length 190
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00622 SPRY SPRY domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.920 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5c33A00
5JI9A 4N7UA 2LM3A 4QT6A 2FBEA 5F6KA 4KG0A 4WVMA 2WL1A 3KB5A 4P9LA 2IWGB 2YYOA 2YUEA 5JIAA 5F6LB 5JI7A 4WVMB 4B8EA 4P9JA 4X8PA 4X8NA 5JIUA 3UV9A 3ZO0B 2VOKA 4XW3A 4P9IA 2E63A 4N7IA 5C33A 4V1PA 3TOJA 4B3NA
chains in the Genus database with same CATH superfamily
2E7TA 4K3UA 2BW8A 5IJRA 1JMUB 2Y64A 3P1IA 1WMXA 1JH5A 2B5HA 2P1BA 4QQOA 1UZVA 2ZACA 1DYPA 4XURA 3TN92 1RVF1 1X8MA 2VMCA 2W87A 3ACFA 3WQ1A 3ZSLA 2Q8OA 2XJSA 1JW6A 4Y1XA 1OT5A 1O3QA 3NMBA 4MYEA 2VXRA 2BYVE 3T2PA 3WXPA 1RUI2 4IEPA 1W2NA 3OBZA 3LWCA 1IS3A 1JI6A 1A3KA 1AJKA 1PM7A 2E33A 1WCDJ 2JG8A 3KVAA 4QB6A 5FJKA 2JIGA 2OIIA 3HBZA 1GBGA 4IV3A 3VBRB 3ZO0B 5A6YA 2YY1A 2GC1A 1QOTA 5JMCA 1O59A 4AVVA 3KSCA 3BCWA 1QJY3 4N7IA 5I0TA 3WNXA 3WG2A 5FY9A 2JEMA 1CPNA 4KBBA 5A3LA 3VDDB 1Q8SA 3KZ4C 4LR4A 5GZDA 2JX9A 3J7HA 1WMEA 3QH7A 4META 1LJ7A 1ZZ7A 4NRMA 1SLBA 4RS5C 1PNFA 2KD7A 3D5OA 4QX0A 2YG0A 1LHWA 3DYPA 1RUNA 2H6BA 4LO7A 5LBBA 4RQPA 5CKNA 1ZYBA 5IVEA 1V6IA 4B1MA 1N3QA 4DY3A 5GALA 2EAKA 1LHVA 2MEV1 1CPMA 4A2UA 1JBCA 2XWJB 4N8MA 2WA4A 3C3VA 2WINB 3D8CA 5EWSA 3MEPA 1RB8G 4XC9A 2Q1FA 3ALQA 4UFIA 1DU3D 5DAQA 3LOBA 1KDKA 3BI3A 1UNBA 1EV13 1RUG1 4IXLA 3I59B 4NE9A 2R30A 3AZWA 3ZVXA 4UW3A 4F7ZA 3AMPA 4NUBA 4W50A 4CDQB 4OHWA 1WLDA 1DQ5A 1ALYA 2VL4A 2WNOA 3VB9A 2CGNA 3WF0A 4JRAA 4Z2AA 1X9PA 2ZXQA 1LRHA 1UX7A 4CCKA 5AC92 4E4ZA 4FPKA 2ZX2A 4RR3B 3ZN4A 2VOWA 4LXLA 1MS5A 3N7MA 2XJTA 2WQ8A 4YM3A 3I4IA 1DGLA 3V0BA 1GZ9A 4BU2A 2WABA 4JQTA 4MXVA 4FTSA 4CTEA 3OB8A 4FPGA 1Q3EA 4JDMA 5C8CB 5FPXA 2CYFA 2B39A 1D4M1 1RUE2 2YFZA 2X05A 5E88A 3Q8AA 2BGOA 1BBT2 4O9EA 2ZX1A 4FQZA 1PIV3 1R081 1MS1A 1S4CA 1Y43B 1JOPA 4JDOA 5FKCA 2XONA 1XRUA 4CCEA 1JUHA 3I3DA 3M70A 1HJFA 2EXIA 1X33A 4KGQA 3ZFEC 4BCUA 4FTBA 2WNVA 3HNBM 3KF5A 1ZRDA 1MEC3 1SBFA 4P9XA 3CZUA 5L7OA 2VBBA 2ZHKA 5FY1A 4A6SA 3U75A 4MXWB 1HV0A 1XYPA 2QDRA 3RZLA 1R64A 1PZ8A 3ZFFB 2I45A 4LLFA 4QX8A 5A32B 3RZJA 1L3JA 1O3RA 2NP0A 3IZOA 1PX3A 3GZAA 2DWRA 4AEDB 3KT4A 2Y34A 2XBO2 2YROA 4PLOA 5H9RA 1PIV1 3S6PA 1BCXA 4W65A 2ENRA 2B46X 2VM9A 1PMJX 4C0HA 5J98B 5F37A 1YFUA 5F5CA 1QJZA 4QD2A 5FWJA 1PO12 1AYN3 1UY3A 2BERA 3PNAA 3BGAA 1NXD1 3P5BA 4AFDA 2GN3A 3LAGA 1OA4A 2WO7A 2VNRA 3N7JA 1DG6A 5C3PA 2VJXA 1ZX5A 4MGYE 4NPLA 5GZGA 2N7GA 3E6DA 2A75A 2ZPXA 3AYEA 4ONUA 1SBDA 3JQWA 4WM7B 5GLUA 3FWEA 2GH8A 2NYYA 1ENQA 1TMF2 4ASMB 5BNPA 4LLOA 3TEZA 1K5MC 1O4ZA 3WP4A 1HRV2 2DBIA 2V5YA 2D5FA 4QQHA 4Q1PA 3WF2A 4YYOA 2FDGA 5F39A 2RV9A 3BOWA 4LOTA 5JSOA 1H2KA 3U0ZA 2BFUS 2VQTA 3RYPA 4C0BA 3M3EA 1RMU1 1DBNA 2YB7A 1AJOA 3ILNA 4J1XA 4LBLA 1OUXA 1ZRFA 1DGWX 5FBJA 2R6QA 2BVVA 3J4UH 5F3CA 1FPN1 4W6YA 4AI1A 4CCDA 4EV0A 4CEYC 3PVNA 3ZSKA 3ZXJA 2ZHLA 4B4PA 4QU1A 4JKKA 1PZ9A 1NQJA 1YRZA 2RS33 4O61A 1W9WA 2R49A 1VBE2 4KGGA 1U5XA 1I5PA 5C71A 1E5SA 1PZ7A 1V6OA 1W6PB 1Y9QA 3H1WA 4A7KA 4A3XA 5KC6A 3BU7A 5EPAA 3K46A 5LB6A 4N53A 3VBFA 3VV1A 4M3CE 3VBOA 2DDUA 4NIDA 4EWDA 2J1UA 1OQ1A 3GBWA 3N9LA 4XFFA 3A23A 1QJEA 3E6BA 3AZYA 1JOJA 1N3PA 3PIGA 4KL1A 3WG4A 1UZYA 3VHNA 3MIHA 4GJZA 1W04A 1GLHA 2OX0A 3VZKA 1BLZA 4AHZA 5A7QA 4NRPA 5FZOA 4XQDA 1TME3 2X8KA 1C8M3 2BNMA 1WLTA 2HWD2 1NA1C 2JG8B 1QKQA 2W52A 5D1IA 4EQVA 4E2SA 1WCQA 4IV3B 4M3CF 2QQWA 3AL6A 5BXXA 3A4UA 5E16A 4OZXA 2Q5TA 2VNVA 3MIBA 1OPOA 1H8TA 1CQ9A 4COWA 4M3CB 4QDQA 1UZ0A 4QHOA 3WSOA 1AR82 2VZPA 1YWKA 4NWWA 3WT3A 3DF0A 2ZX3A 4QQ2A 2QCSB 5F5AA 4NAMA 4SLIA 4KWJA 3OJBA 1LHOA 2VZRA 2YU2A 4AW7A 3Q8BA 4RQPB 2WAOA 3ZMNA 1JYXA 1MS9A 3RG0A 2R042 4GULA 2PHUA 2A6ZA 2WQ4A 4GB32 1VIWB 1EPZA 2XL9A 1IQAA 5C5UA 1Q8QA 4IQPA 5GZFA 3K3NA 1MR5A 4PIYA 3E5QA 4R9DA 2GP5A 2WSVA 1PO21 2HWB2 1WW6A 1UZZA 2O8OA 1YHFA 4J1WA 1R1A1 2X53S 2NMNA 2RJ2A 1C3HA 2X5IA 1UWWA 2P6HA 4UFHA 4NIIA 2DV9A 3LPGA 4UW6A 2FDKA 2ZGTA 3VKMA 1A8DA 1JHJA 1TQ5A 4CRQA 1ND3C 3N9OA 4KU7A 1O3TA 2P37A 3HR9A 3POIA 1VPHA 3HD8B 3O0WA 1QY4A 4HVRA 4ET7A 1DF0A 4PCRA 2DBNA 1ULDA 1C1FA 3TN93 4C91A 3TB0A 2JKBA 2EICA 3OGRA 4N90A 4CXWA 4DUVA 2PYTA 3WV6A 4B1LA 3VD9A 3KD4A 3V0BB 1S0JA 4BPZA 4BJ0A 1BVP1 3CDZB 3HAGA 3B9CA 2J1TA 4BMEA 4PIXA 2RE9A 1RUI3 2RDNA 2IXJA 1XE7A 4Q1RA 2C5DA 2WC2A 2P4EA 1I5ZA 4K8RB 4XDPA 3GYDA 2RS12 4Y1VA 4QPWA 5CA6A 3QBQA 4XBNA 2HYKA 2NLRA 4AQTA 5FR3A 3GNEA 3AP6A 1HQLA 4ZXEA 5FXWA 4B8EA 2OS2A 1GV9A 4BE3A 4OZOA 4WV8A 5JOXA 3TN91 4QX5A 4CDXB 4ZHNA 1AR63 2ZGPA 4IE6A 2WT0A 4HKLA 3IM0A 5LA2A 3K51A 3VLBB 4FPCA 2ETEA 1YIPA 1RUC2 1AYM2 2EXKA 3PTYA 1HB3A 3N9MA 2DURA 3POWA 4JVAA 4E4DX 4CCJA 3T09A 1ACCA 3LZZA 4XQ4A 3LEKA 3I2FA 1VBB3 1P8JA 2WZR2 2XKOA 4LBMA 4L0PA 1COV3 1E5RA 3GHMA 2JDHA 1AVBA 5F2SA 5GZEA 4FI9A 5EZWA 5FZKA 5I8TA 2J22A 3E5XA 3AZXA 2E53A 4AE2A 4DY5A 4OQ9A 2ET1A 1W0NA 4HANA 1W8TA 2KR2A 3POSA 3JBG2 1NLQA 5FZ1A 2C4XA 5H9SA 3TEWA 5FLJA 3USSA 5BNNC 5FMCA 1US2A 1E57A 1YJKA 5A3UA 3AP9A 3R4SA 1VRH3 4OULA 4Y24A 4CUCA 1OH3A 3IAQA 5BNPB 4JKLA 1REEA 1YLLA 3B3QE 1WWYA 2XQXA 5KXDA 4BB3A 4Q0SA 3H8OA 1Z0HA 2LS6A 2HYXA 5CIRA 4AAXA 4FFGA 4XFCA 2JB8A 1OBNA 2BBAA 3LEMA 4Q26A 5FOJB 4UBHA 4Q4X3 1W03A 4LA2A 2GMEA 3OGVA 1RUE3 2BTVC 1YQ6A 3VZOA 5B4NA 5C70A 1PMHX 2GMPA 3HPNA 2XH6A 4Y5TA 1SEFA 1OD5A 3GZEA 4G3YC 4HL0A 1JOBA 5CNAA 5FCCA 2JDMA 3SHRA 4CUBA 2VOKA 1JUIA 5AC91 1LOBA 1HRI2 2DCJA 2VE1A 4P9YA 3JU9A 3CO2A 4AVTA 5BNOA 1W3XA 2AACA 3I8TA 2YBSA 4AI0A 5ABJA 2Z5WA 3DV8A 4Q2FA 5FXVA 4NPMA 4AAPA 5JMOA 4Q4V3 4CVUA 4BWOA 3T1MA 3LA7A 3H7YA 5I0DA 2ES3A 3DEMA 2C26A 4YLZA 1RUE1 1LU2A 3U11A 3ZXGA 3CJXA 4FPLA 5DDJ2 5LBEA 3ZYIB 1M06G 1AX2A 2V4AA 1BBT1 4IEZA 4MSVA 4N53B 2HWF2 4OHVA 5FZ0A 3VBFB 3VBOB 3MIFA 2ZZJA 4MLOA 3HMYA 2XUMA 3UV9A 1W28A 4DXTA 2YFUA 4ZY9A 5IATA 2VNGA 1D4VB 1FATA 5FPAA 2JE8A 2PHFA 3FHIB 4QGLA 5FY4A 4EZ4A 1RHI2 4YZ5A 5CAZA 3CZJA 1RUJ3 2JJ6A 3RWNA 1ZM1A 4GXLA 2Y6JA 3AP7A 4BZ4A 4YVSA 1DLCA 4JDNA 1IKPA 5CZKA 3WY6A 4HT1T 4AG4A 3LEIA 3PU8A 2ZGOA 1B35C 2ZCWA 4M0NA 5HCFA 3S30A 3ZXFA 1H8TB 5GZCA 1LODA 4FAHA 1QJY2 2XBO1 5IVCA 2QQPA 3C7HA 4YZ4A 3VHPA 3GCWA 4CU8A 3B5LB 2VZQA 5FK7A 2DFBA 2P3JA 1K45A 2BGPA 4AVSA 4UOJA 1J1LA 2FMYA 1PO11 1W90A 1HIXA 3VZMA 5LBFA 1JYCA 4KWUA 1JZ2A 3ABZA 5J37A 1UKGA 3UGGA 1QHDA 4YPJA 3AVSA 3JUUA 4UF0A 2L9LA 4GMP3 2W46A 4E9KA 2ARCA 4YVWA 2FHRA 1UOBA 3BB6A 1GQHA 2ZMKA 1J59A 2PA7A 1C5IA 3H0OA 4URAA 5BUVA 2BVBA 2HBUA 4LA3A 4EYUA 1XXNA 1H4HA 1KEXA 3OPZA 1TMF1 2A73B 4H3WA 2YC0A 5JDBA 4HSLA 1SLCA 4FO9A 1HRV1 3WW2A 3OY8B 1EV12 4A4AA 3B9IA 5IVBA 2QZ2A 1EAH2 3R6SA 1RL3A 4QPIA 3AK0A 2RS52 2PFWA 3D82A 1DGRN 5KWRA 2E9QA 1Q8OA 4NR1A 3VHRA 1S2KA 1RJ8A 1ZBE2 4X6RB 2A6WA 2C1FA 1JYTA 3V65A 3GHNA 1M4WA 1ZZ9A 2DVGA 3N9NA 4Z1VA 3BTZA 4XJ8A 1VBD1 1UF2C 5FIXA 1YFXA 3CEWA 4KNCA 2IXKA 4LOSA 3AFKA 4NO4A 3B02A 3ZFGA 3A22A 4AGVA 1B09A 3ZKUA 3CKHA 2B9VA 4QU2A 4J25A 2HWD3 4EWAA 2IVIB 2A70A 3T08A 3THPA 1CAVA 1ND2A 1VBE1 2VU9A 3DXUA 1WZXA 3GBGA 1HXS2 1WCKA 3NKGA 1YFWA 2UU8A 3VBHA 3ZYRA 3LE0A 3PJQA 5A3TA 3H50A 1XSRA 4RGKA 4D6QA 1RXGA 4D0QA 5J3UA 4KQ7A 4BK5A 5F3IA 4W4ZA 1OI6A 4QPGA 2WAAA 3MUZ1 2RVAA 5JOZA 3RYRA 5CFDC 3IIAA 1GZWA 1LGNA 1POV3 2R071 4RL7A 1MEC2 5L73A 5K0UB 3U37A 4CP1A 1EUUA 2R043 2HWD1 1UX6A 2Y6GA 5L9RA 3TYJA 1W0OA 3TNQA 1EPWA 1AL23 5BNQA 4XMAA 5FO9B 3HIFA 3ON7A 3WF3A 2XQRA 3PVEA 3M2MA 4OVEA 2HWB3 2OUJA 1WW7A 4UFMA 1FYUA 2FZ2A 1H0BA 1RUF2 1GQGA 1NT0A 1SCRA 1QU0A 3F95A 4E2GA 1LOGA 3KCYA 1AR81 5L19A 3W20A 5JUVA 2E7AA 1OMIA 1AYN2 5D2AA 4LBQA 5HCHA 1Z78A 2G19A 5C9AC 1W9YA 2Z42A 1Y7BA 2D3SA 3PTRB 5BPXA 1XNTA 4G9SB 2JKXA 3RYKA 2XLAA 3AXEA 2PQQA 1GWLA 2O0OA 1OFNA 2I2SA 3N7KA 4GB31 5JWPA 1X7NA 2J1VA 4K20A 4V2WA 4BQ2A 1ZZ6A 1A8MA 3C2UA 2D7FA 2HWB1 2JWPA 2Q4SA 4GKYA 4L97A 5EYXA 4COUA 4BLIA 4IEWA 4UFLA 4LHNA 4JGYA 1YC61 2IFRA 5FY7A 2W1WA 3ZMOA 1F2NA 3NAPC 2VTXA 3LOIA 3WW4A 2LUWA 2BNOA 4CCMA 3BTAA 1UYPA 1UAIA 1TVGA 3ZOIA 5JZGC 1LTEA 3UK9A 5FP8A 1W2TA 1DIWA 2PHRA 4A42A 1C28A 1KFXL 4QXHA 2CSGA 3IDBB 5FRAA 5FZBA 2AEZA 3ZX7A 2D6KA 1ZVFA 5L36A 1RGSA 5CB7A 2J1RA 4IESA 5ABJB 4CDQC 1XE8A 3TNPB 5FZ3A 5FO7B 5I93A 1OOPA 4TTGA 3JQXA 4YW2A 3UJQA 3RMYA 3AP5A 1H8VA 1HKDA 3ZR5A 3T1LA 1RUC3 2RS32 5CISA 2VCMA 1SLLA 3QCWA 3OCPA 3T0DA 4N43A 4Y5SA 1V6JA 3OSDA 2RS11 4XCBA 2F4LA 5IT6A 5EJ3A 2OPWA 1QQP3 2P2KA 4CE8A 5FZLA 1OUSA 1SG3A 1REFA 3QH6A 2UWCA 4U36A 4XACA 4DXRA 4EE2A 1MVQA 1SACA 3KT7A 3DPRA 4FAGA 4UXAA 2R7EB 1E5IA 4BMBA 4IEOA 1YI9A 2ZGNA 4ISQA 5BY5A 4OQ8A 1OLME 4Q4W2 1Q43A 2A71A 4EJRA 1GNYA 2VW0A 1WMFA 4CDUA 4YVSB 5M0TA 1TME2 4IL7A 4BLJA 1C8M2 1RUC1 2NMOA 2PHLA 1AYM1 3NV4A 1JZ3A 1IS6A 4L8QA 2XJVA 5I0SA 2X10A 2JDYA 3R4UA 4CDWC 1ULFA 2G9FA 3KMHA 5FZEA 4MGTA 2H0BA 3ZN6A 2TUNA 4DFSA 5FLIA 3U07A 2W2IA 1LB2A 3RS6A 1H6YA 4XF3A 2J1SA 2WZR1 4HK9A 4LBNA 4AK3A 4J6GA 4X6QB 5F3GA 4CU6A 2Q8EA 1ZNPA 2MHFA 3VDCA 2HH9A 3FLPA 3BTXA 3RPQA 4JHZA 5ANQA 2ZGKA 4M4PA 4AI2A 5A6QA 1YQ8A 4YM2A 4AEMA 4UF0B 4LJHA 2VCCA 2DUQA 4Z82A 5L9BA 4BQXA 2UWAA 3JBG1 4YVWB 4OHXA 3SITA 5LEJA 4FBFA 3NL1A 4P9LA 2ET7A 4G4FA 4UI9L 2Y0OA 3WNLA 1S0IA 2BPA2 1VR3A 3SXWA 1XNCA 3FUQA 3FFZA 4JAAA 1LAJA 3ES4A 4GH4A 2Q8DA 3ACLA 1JZ5A 1IGOA 2OQ6A 2ORXA 4JGZA 5DN2A 4NJ4A 1FV2A 2FCUA 3LFIA 3KCXA 4QPIB 3ETQA 5FMOL 4CSWA 4XUPA 3PUAA 3OBAA 1WBLA 1F8VA 3O1RA 3CNAA 1GU3A 2WQZC 4PDWC 2HWF3 3I2HA 3SCGA 4ARXA 1HB1A 1WD3A 4D94A 1HRI1 5JXIA 5FZIA 2WYSA 4TLFA 4C90A 3ZFGB 3HJRA 3JD72 3FFQA 2VQ0A 1RHI3 2A3XA 2CTVA 5KXEA 3NJZA 2XR4A 4KI5M 1CAVB 1ND2B 1QWRA 1SDDB 2Y6LA 2WJSA 5A3WA 5JIUA 5DMYA 3NV3A 2DUPA 5FPZA 4AXOA 5A1AA 5DDJ1 3LD8A 5FYTA 3VBHB 1JS9A 4Q0PA 1YXWA 5DUUA 1T6GC 2HWF1 1TEIA 3OGGA 5C33A 3KS7A 1YO8A 3KWVA 1QDOA 3GZTB 1QJU2 3GJAA 4RS5A 1PGW1 4RN5A 2IFWA 3PURA 1FMD3 1TNFA 2ZGQA 4XBLA 5EJZB 4YZ3A 4S2GA 4QPGB 2FDJA 4D7YA 1AR62 1F5FA 4YW7A 2WT1A 5KR7A 1GZWB 2E26A 3RNSA 4YGCA 2YPDA 5J96B 2VBDA 2QQUA 2K2SA 5DG1A 5GLVA 1YYNA 3NJYA 2WZ8A 4H7MA 4MGIE 1J1TA 4GMP0 4FQ4A 2ZOEB 5AVAA 4XHXA 4R4XA 5FBZA 1SCSA 3FLRA 2W95A 3PUQA 2RDSA 2NZ9A 4GIQA 4Q4Y3 3OBRA 5C3SA 2Y6FA 2F4PA 1QJY1 1VBB2 3EBRA 1WD4A 2CHHA 2IXCA 1REDA 2QKDA 2K9ZA 4MZUA 4L99A 2FD8A 3M3IA 1COV2 3FC0A 4AFBA 1TZOA 2OPKA 3T4HB 4LBQB 1V9U3 4LBJA 2BJSA 2GC3A 1TG7A 3POFA 1QXJA 1ZA7A 3UNPA 3I97A 1EAH3 1KDMA 4K9SA 1GP6A 3AZZA 1SQ4A 3LSDA 1NYWA 2GNMA 2RS53 1WUVA 4WVMA 4W8JA 1O5UA 1MVEA 4KBZA 4L11A 2D44A 5FO8B 2PHTA 5F1RA 1ZBE3 2QBXA 4HKOA 1IHMA 5T3NA 1S0DA 4HVQA 5LW9A 4RGGA 1OURA 3I7DA 3GDBA 1VRH2 2ZGRA 3Q8FA 1QIQA 5FWEA 1C1LA 1SFNA 2A6VA 2WO2A 3WNOA 4NHMA 1H2NA 2A3YA 4FVVA 4OMCA 4UBGA 4YG0A 1MQTC 1EV11 3MDPA 3MLLA 4FOQA 1W2AX 3N36A 4Q4X2 1EAH1 1LECA 2WWUA 4OMDA 3VHOA 4AOCA 1UMHA 2RS51 4GALA 1RUH2 4RYDA 5FZFA 1HXS3 5CBLA 1IOAA 3R4DB 2Y8KA 1ASJ3 3SMHA 3PU3A 1VLNA 3ZFEA 5FPVA 4DXZA 2KM2A 2DCKA 1XNBA 4L92A 5K8SA 1GUIA 2VTFA 4CYDA 4XZUG 3T2OA 2VMFA 1LOFC 1POV0 3CHXA 3PIJA 4MH0E 4Q4V2 3WNNA 1OLQA 1X8EA 2BRTA 3O12A 4P5HA 4EN0A 2VZUA 2HWC2 1SBEA 1YJLA 4LO5B 4N43B 2GALA 1RTVA 1W6MA 2UYAA 3I2GA 3O5SA 4BQ1A 2VMIA 4FOWA 1QJX3 5DZEA 1HXS1 3N7LA 4FP3A 3Q8EA 1FX5A 1OF4A 2P3KA 2VZSA 1BZWA 1RUF3 5FP4A 1XJAA 3FMGA 3DPRB 4Q8KA 4XF1A 4AFCA 1UYXA 1W6NA 2IXLA 3M3QA 3DKQA 4MHRA 5LZ6A 1EUTA 1YI7A 3ILRA 1QXRA 2OVUA 2R063 3FX3A 4B7EA 3WX5A 3WQ7A 1DZTA 1UN1A 4MUVA 4Y1YA 4CDUB 3DL3A 3KV9A 1MEC1 1RUJ2 4NAOA 2H6CA 4GAZA 5FZ7A 5IK8A 1GZCA 5DPNA 3TWIA 2D3PA 4WVVA 3MLKA 3AXDA 4CDXC 2WA3A 1K5MA 4BIOA 2BZDA 3GM8A 3MBWA 4KWLA 2V72A 1G8WA 1K12A 2FZ1A 1UYZA 3IT8A 4K6BA 2Q0AA 2D6MA 5FYHA 3AL5A 2EXJA 1RUF1 4Y20A 1W9SA 4QQLA 1KQRA 4LHSA 2GNDA 5DUVA 4K1YA 1AYN1 4H7LA 5A70A 3W5NA 4NRQA 2AH2A 4XPVA 1SFYA 1YFYA 3UKVA 2Z69A 1FOD3 3M8LA 5J36A 1O4TA 1UY0A 1MZ5A 1JTZX 3WP6A 4ATEA 1GOGA 1POQA 3K4ZA 3OD0A 4CEYA 2BP6A 4YZ2A 5GLTA 4HETA 3IWZA 4GH4B 4MGZE 4WM8C 1FT9A 4ATFA 1IPSA 4LULA 4L2NA 3D0JA 4HSJA 1J3RA 1ZBA3 4IV1B 4JGZB 3BU0A 4K8FA 4LKFA 5GM0A 2QQMA 2O1QA 3W5MA 1UZWA 1VRBA 2WT2A 2WFF3 3H3LA 1GP4A 2PHDA 3J26N 4LIUA 2D6LX 2Q1MA 2DTWA 4IEQA 4UW4A 4OCTA 2GP3A 2R0HA 2XJQA 5HV0A 4QAWA 5LK5A 1MZEA 3JXSA 3VGIA 2GC2A 4TYSA 3IMNA 5FZ9A 3THCA 3O1VA 2VQUA 1I6XA 2ZGSA 1T6BX 1A34A 3ZYHA 2DU1A 2ZHMA 1NA1A 1O7FA 4Q4W3 3VN4A 3S0MA 3I2OA 5IK4A 1MZ6A 3O1UA 1U5IA 1CZTA 1XBFA 2RS31 1LEDA 2XUEA 4QX2A 1ZRCA 3ZM8A 4QM9A 1ULGA 3MGUA 4XAEA 1UU4A 4OUSA 1V0AA 2BOJA 5JOWA 1NXMA 2PAKA 5C4WA 3AMQA 1VBC3 3T4VA 3VBUC 4IGPA 2VVDA 4BQYA 3OUHA 4CCOA 3JB4C 1J58A 1LESA 1LGCA 2XGXA 4YW3A 4EWEA 5A7WA 4BYYA 2MPFA 2JXAA 2FCVA 1V70A 3ZIWA 2QJVA 1VALA 4CP0A 4QKFA 5EP9A 2O8QA 3URFA 1G9CA 4XYXA 5T5LA 3J7LA 4Q4W1 5JPNB 3TAYA 1U5ZA 3HQXA 2CL2A 1W3VA 1Z7S2 4P08A 1TME1 4XDOA 1C8M1 2WWSA 3FJSA 3JZVA 1AUYA 1HDKA 4Y3OA 1OA2A 2OUHA 5IAXA 1AL22 5C8WA 4XF0A 2OXBA 3I2DA 1SPPA 2ZS6B 3K4AA 1PK6C 2GAUA 1WW5A 2ZTNA 2VZ3A 1CWPA 5C7GA 3WP5A 3I3BA 3ME2A 4QKBA 4YG3A 1S55A 4WZFA 3UYJA 2NM1A 1ND3A 2OA2A 4BISA 1X50A 1ULOA 2VGDA 2VECA 2YBKA 1G9FA 2AR6A 4LBQD 4W6XA 4WVMB 3CJIC 3D6EA 3FBMA 5JR2A 1G9BA 3SKJE 3WNPA 1J84A 1URXA 4P00B 1CZVA 2WWJA 3SH3A 4PBOA 2R32A 3E6CC 3L2YA 3QACA 4PBPA 4CEWC 1EY2A 4XEZA 3RI9A 4ZZ5A 5CVRA 2UY9A 2RMU2 1APNA 1G6NA 3JD73 1XYNA 1HX6A 3RQ0A 3WG1A 4ARYA 5FZHA 1SDWA 2ADDA 4EN8B 2Q30A 2SLIA 5JPMB 3AMHA 1NKGA 1Q5OA 1CR7A 1NUKA 1OVPA 2GN7A 3GGLA 1KJRA 2VO5A 5EIYB 2R16A 5DUXA 3ZFEB 3GXUA 1W2OA 3MIEA 4FPHA 1QJU3 5FZ4A 3T2QA 5FOBB 3S5AA 1F35A 2O14A 3PJYA 4XJWA 2E31A 1WKYA 1OQDA 4IW3A 1DYOA 3VBSC 4NIHA 1N3OA 2WNVB 3JD71 1VMJA 1ZZBA 1AX1A 3OYWA 5KC5A 5L7OB 2G1MA 5KHHA 4Y1ZA 3UESA 1YQ2A 1RUI1 1G86A 3BODA 1NCRC 2PLV2 1W6MB 1BKZA 5A7PA 5C6CA 1OFSA 2YGLA 3KCCA 1HQWA 5FP7A 1W8OA 1LHUA 2YXSA 5FZCA 4TZDA 4KG0A 2JDZA 5HCAA 5FYYA 1QQP2 2WL1A 1OC1A 1QJU1 3MW3A 4DUXA 2ZZQA 1KS4A 2RM23 5A3PA 2GZWA 3RMXA 4DRVA 1AR61 1DP0A 2JG9C 3MV11 4DEQA 4RHV3 2RDRA 3LSEA 1NCQC 4E4SA 5BNNA 3J9SA 4ZU5A 2WN2A 4WZCA 2TNFA 2FDFA 3U14A 3VZJA 5IFPA 2CNAA 2XDVA 2XJUA 4YZ1A 4XIOA 4KG8A 5KBFA 1K5MB 1GOFA 3LB9A 2VD7A 3OF1A 1GWMA 4AQ2A 5FV3A 3HBKA 1QH6A 4GD4A 5K0UC 3BPZA 4OHYA 2K46A 2WLQA 5JR7B 1VBB1 3FL7A 1MS0A 2AGSA 4Y20B 5SV5A 5CFCC 1C57A 4W6WA 5IHRA 1UW8A 2PAEA 3AMNA 1COV1 3M3OA 5A6XA 3VKLA 1PVXA 3HVDA 1GYKA 5EQUA 3H8UA 5D21A 2I07B 5D8AC 3KGZA 4AVAA 2B45X 4A7ZA 1NOVA 3IDAA 1RUD2 1RUH3 2AUYA 3BPSA 1S0BA 1JODA 1W6QA 3EB7A 4PLMA 4TSVA 5AVPA 5FUNA 5LY2A 1OXCA 4CEYB 4C1XA 5J09A 1HQNA 3MF9A 1C8NA 3O1MA 1VRH1 3AX4A 2G4IA 1W6OA 1U0AA 5FYSA 5BYNA 4HBNA 1MS8A 1GKBA 2VOVA 4ZS2A 1HB2A 3N9PA 2QFEA 3WVJA 2AENA 1DFQA 1FI2A 2G9GA 2HWC3 3FUOA 3BVCA 4XIKA 2JDAA 4Q4X1 4CUAA 4D69A 4CU7A 3SNMA 5F6LB 1VMFA 4XDQA 1SLAA 1RUH1 2Z79A 2JDUA 2WNUC 4XXPA 3T0AA 3EXUA 3ACHA 4LT5A 1W8FA 4IGOA 4X8NA 2RR13 3VL8A 1W0PA 5FPUA 2LTNA 1Y3TA 3WD5A 1KRIA 3AKTA 1JXNA 1RIRA 2UY8A 5FZOB 4B3NA 2D3RA 4Q0QA 1B35A 4Q4V1 1LOEA 1PX4A 2I74A 3WDTA 2EXHA 2GDFA 2VMDA 2VUAA 2YDEA 3HWJA 1AF9A 4P5YA 4QX3A 5LY1A 5FK8A 3SLIA 5C4WB 3LKJA 3J8F3 1CIYA 5A7NA 4CU9A 3WF1A 5A7WB 3S57A 1FMD2 5I0UA 2P34A 1PM4A 2X09A 1UIKA 4YNIA 4NWVA 3WQBA 4C8DA 5ACA3 3AFGA 4DOUA 5EHDA 4O65A 1HV1A 1KFUL 3FN9A 2HJIA 1CAUA 3POBA 3HN1A 1RUJ1 1DHKB 2C9KA 4HMZA 4LNVA 4FT8A 3WQ0A 4E27A 3VD4A 4F83A 2A6XA 3ACGA 4NN0A 2QQNA 2ERFA 3DXTA 2LM3A 2LW8A 3FBYA 2MEV2 2UYBA 4YG6A 1W06A 3U78A 4Q4Y2 1SPPB 2YGMA 2FBEA 2SBAA 3KV4A 4PQ9A 5LRRA 3ZXLA 4AVBA 2VZOA 1OD3A 5H9PA 3MIDA 4OI1A 2X5IB 3D0SA 1ND3B 3OOXA 4DNYA 4BH9A 1KJLA 3DCQA 4RD7A 1S0EA 3O0XA 1OKOA 5F5IA 1UYYA 1NE4A 1V9U2 2AYHA 4IERA 2W5FA 4IDZA 1R1ZA 4NOTA 3VD7A 1IS5A 1SHWB 1DQ0A 1CD3G 2E51A 3NSTA 4M4RA 1VBA3 2CU5A 2FDHA 2W08A 1C5HA 4LMFA 5DABA 3MICA 3WNMA 5I0RA 4GMP1 3W59A 5KXBA 5DZGA 5KHKA 3KV5A 2J1AA 3L9JT 2Y38A 4LK6A 5IUQA 5IVJA 3D4KA 4YRDA 2QNKA 1DQ6A 4ITCA 4ASLA 2V5DA 4L9BA 5JAXA 1F4HA 4TWTA 3BTYA 2YUEA 2KA3A 4JC1A 4N9IA 2CGOA 5FYVA 5JI7A 3VZLA 5A3MA 3E1F1 3ILFA 3T30A 3DKWA 4QX1A 2VZTA 1A6CA 3D3AA 4QB1A 5LA1A 1ASJ2 4QHBA 1J3QA 5CFDA 2B8MA 4Z2WA 5JSPA 3KVBA 3SC7X 1UD1A 2JDKA 1LR5A 3IPVA 5LWBA 4DB5A 4XUOA 1HW5A 5FYMA 2LROA 3OYWB 4DXSA 5B4XA 2W94A 1G9DA 2YMZA 3C7OA 4S2HA 1D2QA 1S1AA 1W2UA 5FYIA 4XHBA 1DGRA 2JIJA 1Z7S3 5FMDA 1PVC3 2DVDA 1ZRRA 2DCZA 2ZMNA 5EV7A 2GMMA 4IETA 3EYPA 2WUHA 2PTMA 1O4YA 2BNNA 4I0BA 1QJX2 3IMMA 4FXGB 4IE4A 3NNMA 1LOAA 3UKTA 3HT1A 3U4SA 4I0WB 4UAPA 4COZA 4BQWA 4DUWA 5JOYA 1LGBA 1O6UA 1CONA 4AQ6A 5C9AA 2VNOA 1YCIA 4XFHA 2QQJA 4GQ7A 4XFAA 1AR73 1AR93 1S2EA 1V6MA 3H1YA 4TXWA 3VBRC 4P9IA 4CXYA 2R062 4IEYA 5FUPA 5BNNB 3WF4A 1N1SA 4AYUA 1POV1 5LRSA 3EQEA 3USUA 1OA3A 1Z7S1 3VDDC 2R041 1WLCA 2ADEA 2A3WA 5F6KA 3BOPA 1ZZ8A 1AL21 1WA4A 4XFBA 4AGGA 2CDPA 4E8DA 3NAPA 4E2QA 2DUOA 2W1QA 3LPFA 2RMU3 3VZNA 5JZGA 3IDCB 4XTPA 3B94A 5LEKA 1GP5A 4QGNA 1CIWA 1XYOA 3I2KA 5EFUA 2HWE3 4F3JA 1FOD2 4S2DA 3BIEA 1W6QB 2E63A 4A44A 1RC6A 1XC6A 3RZHA 5FYUA 3O1SA 3VDBA 4CDQA 2E7QA 5FKBA 4M0HA 4MGKE 3BIWE 4K1ZA 2VBPA 2EF6A 5HV4A 3MYXA 4UWDA 2ZX4A 1W6OB 5BNOB 4S2FA 1UOGA 5LATA 2RMU1 2EAAA 1H4GA 3RZGA 5ERLA 3RFRA 3DECA 4IUGA 1ZBA2 4D7SA 2BDRA 2PLV3 4RR3C 2VAUA 4X8PA 4HN0A 3SH5A 2WFF2 2QDNA 4GWIA 4XJAA 2V09A 4PI2A 4R9AA 1QF3A 2VCAA 5IFTA 1QXPA 2ZMLA 5C8CC 5A3OA 4BIFA 3O1OA 4QQPA 3O0VA 2VMEA 4Q29A 1JYNA 1UU6A 3JCIA 4HOOA 2QQLA 3I2JA 5C3QA 3RJRA 2FCTA 1B35B 5DG2A 3CF6E 5A7OA 4MO3M 4CDWA 4URTA 1T2XA 1WMDA 3KB5A 4EN9B 5F7UA 1V6KA 2ZBJA 4PJYA 4C1WA 2VOTA 1VBC2 1JU4A 3DN7A 4AVCA 2D6PA 1QQP1 2XG3A 5APAA 3H8XA 1BJQA 2B9UA 3ZFFC 4RGAA 4AFMA 2ID4A 4PQQA 1FAYA 4MADA 1ZZCA 4Q5OA 4QB2A 5EJ1B 1R092 3VDAA 4R8HA 4AEDC 4QWNA 1FXZA 3SISA 1CAUB 3KQ4B 3ZLIA 1QNYA 5FMOS 1US3A 1RUD3 3HEIA 4XTMA 2RHPA 3OGJA 4HVOA 4H14A 5JXJA 1SLIA 4OFGA 5IW0A 3AYAA 5G05L 3KLSA 4HONA 2WSUA 4BQ4A 2JENA 4PI0A 4NPRA 1H9WA 4Z8BA 2OW4A 3ZDSA 4AHYA 3AMMA 4PDWA 1RXFA 1IZ3A 1QEXA 4FPFA 3FHAA 3ORJA 4WM7C 1NLSA 3WINE 4DRRA 2JICA 3PMEA 2WYFA 2D6OX 4YFZA 5BV6A 1AZDA 1RUD1 3DGTA 3MW4A 4XQWA 4YARA 3BUCA 3SEPA 3K4DA 1ULEA 3PVOA 5FP9A 2BBVA 1SZBA 3APBA 3FZ3A 5KHGA 1ULPA 1QOSA 1XU1A 1GANA 3J7MA 4XBQA 3VKFC 5FDBA 1RVF3 1GQPA 1NY72 4M00A 4XJ9A 1JYIA 2YBPA 2VR4A 2PQSA 3S7IA 4HK8A 3RVHA 2XLFA 2P17A 3AZVA 3NV2A 4DQAA 5IVFA 1SLTA 2VZ1A 4QGMA 4AF9A 5A6ZA 5FLHA 4D8MA 1TNRA 2QVSB 3B7MA 2OKXA 4DPNA 1OQEA 2HKXA 4FPYA 3N4MA 3OPWA 4IV1C 2RJKA 2ZKLA 4JGZC 5CFDB 2YC2A 3NNLA 2BEOA 3WZ1A 3LA3A 5FZ6A 3IPVB 4AI8A 1A78A 1J3PA 1QH7A 4FOYA 4IE0A 1GICA 4OUEA 1GZTA 2VW2A 1I9RA 1LENA 1ULCA 4NHXA 4IEUA 1RHI1 4QXKA 5FPLA 4V2VA 3IAPA 4HZFA 3QLQA 2DCYA 2VH9A 3WNKA 1HLCA 4PF1A 1IPJA 1W05A 2IUWA 1LKNA 2MEV3 5CG9A 4NIAA 1YUDA 2DVFA 2EVXA 2XXZA 5EYYA 5A33A 4LHLA 2HEWF 3ZYGA 3WW3A 5C9AB 4GZ9A 1IG3A 1UPSA 5DAWA 2WZPP 2JG8C 2VTXJ 4M3CA 1FMD1 3QOPA 4HN1A 4IV3C 2RM22 1BEV2 1VJ2A 4XOGA 1NAEA 1RUG3 2XJRA 5FQ0A 3WG3A 4QX7A 1IG0A 4RHV2 3USUB 5A80A 1W8UA 1ODMA 4D7TA 2GU9A 2VVEA 2XLGA 2XWBB 5EXOA 2IWGB 3EHKA 3H42B 1DZRA 1XSQA 1O5LA 2PAMA 2W1SA 5F3EA 3LA2A 1OH4A 2D43A 3ZN5A 1JYWA 4YW4A 4Q4Y1 3S7EA 3I49A 4Y26A 3NAPB 4RQPC 3KHBA 1PGL2 2AZ5A 1MQTA 2BUKA 3NKTA 2VVFA 5JZGB 3VUOA 1UU5A 1S2BA 3ASIA 1CZSA 4JGYB 3CLPA 3VKOA 4OI4A 1V9U1 3NWKA 4B29A 4UFKA 2VUCA 3NO8A 1VP6A 2JB4A 2CDOA 2E32A 3OUIA 1D4M3 1H2LA 3PDQA 3AC0A 5IVVA 1I1EA 2P6CA 2QQVA 2D5HA 4Y33A 1QDCA 4LUMA 3U4XA 1R083 3V64A 2NQYA 1XE0A 1LOFA 1ZBE1 2D6NA 3E97A 1H9PA 4UT5A 5LASA 4CUGA 5K7PA 1BQPA 3G7DA 2CV6A 4QKNA 1FNZA 3T3YA 1JZ6A 3MPPG 1N47A 2ZGUA 1TE1B 1OOPB 1V00A 3JB8A 1W99A 4HG6B 5FZMA 3I2IA 4YGBA 5IYYA 4MHUA 5FPBA 2XOMA 1W9FA 3HQRA 3POEA 4AI9A 4EN6B 4NMIA 2WFPA 5T55A 4DZGA 4K7JA 1ASJ1 1GNZA 4AR2A 4K40A 3MW2A 2RR12 2V4VA 2PHXA 2W47A 3X29B 4FFIA 2ZABA 3KGLA 4LTAA 3VL9A 4CDXA 2J42A 4BXFA 3EO6A 4CDWB 3ZPYA 3K2OA 3LDKA 1MS3A 4LE3A 4LITA 4KWKA 3WOGA 2JECA 3DYOA 1W8HA 2WNVC 5DQ0A 3UKNA 3ZN6B 5F8PA 5L7OC 1QJX1 4YW6A 3J8F2 5DAPA 1VE0A 4WBBA 5FYBA 5IVYA 2VUJA 4GKXA 3V56A 5C4WC 3V0AA 1NQDA 3M4FA 4LUKA 5ACA2 2P3YA 2R061 2XJPA 2ZHNA 4MGQA 3NNFA 2DYCA 4KMQA 2W39A 1CJDA 3FHQA 2DVBA 3CMGA 1SMVA 1UY2A 1CN1A 2YV8A 3HOBA 4RFT0 5T5PA 3W21A 1FV3A 1O8PA 1ZRIA 4WM8A 4YM1A 1XNKA 1RMU3 4LPLA 5FY5A 1MS4A 3AVRA 3U10A 5CADA 1QGLA 5FUIA 5E89A 2UWBA 1KS5A 3I3QA 3RSJA 3AYDA 1FPN3 2UURA 2VC9A 1CVNA 1VAVA 1BMV2 4B4QA 2WO3A 1Q8VA 4PDWB 2WZEA 4N7UA 2XPJA 1S0FA 1Y9GA 1IKQA 3P3PA 1OSGA 1CAXA 1UMIA 2PHWA 3B00A 5BNPC 4EN7B 1FOD1 1VBA2 3CU7A 5FREA 2Y6HA 2R0FA 4I09A 4AFAA 4LHKA 2BOIA 4ISRA 2VMGA 3M3CA 3NRUA 3OG2A 3PUIA 3A21A 4XAAA 2W0XA 5TSWA 5K4LA 5ISLA 2XMLA 4KU8A 4BOWA 3WEZA 1Y4WA 1BXHA 1N1TA 1VBD2 3IB3A 3K77A 1DYKA 1VB2A 1WLWA 4QXCA 4I0AA 3ZYJB 4PT6A 3U1XA 4XUTA 1OPMA 1YEWA 3AKPA 3MF6A 1ZBA1 3VBUA 5L9VA 1DQ1A 5JVVA 1H1AA 4QDRA 3W58A 1JZ7A 2BFUL 4SBVA 4IEVA 2WFF1 5I91A 3RGBA 2XHKA 4CCNA 4GJYA 2NN8A 4PLNA 2YZ4A 3O1TA 3G6JB 2HLEA 4TLGA 4LE4A 2YC4A 4P02B 4LO4B 4RS5B 4BDVB 4A6OA 1D0HA 2P5BA 3ITQA 2GC0A 2LRPA 4DINB 2R1DA 3MFAA 1NX9A 3ECQA 1R093 3J7NA 4B4RA 3O1PA 1WW4A 4N53C 2IXIA 3VBFC 3H3UA 4FPEA 3MLJA 3VBOC 5LA0A 2R072 3H1MA 5DXDA 5DZFA 2IC1A 1W8NA 4XUQA 3L2HA 1GWKA 1PVC2 1K3IA 1DDLA 4MG2A 1PK6A 4U2AA 2IXHA 3MV01 1LULA 1XU2A 4MVTA 4A7YA 5A33B 4ES8A 2D98A 1VBC1 2JDPA 1Y9MA 2VG9A 3MI8A 1PO23 4CP9A 4LKDA 5FZGA 2HEYF 5T54A 1R1A3 1QJFA 5T5JA 1U5YA 4MGSA 1VB4A 3CJIA 2QQOA 1AR72 1AR92 2W91A 3AM2A 3FE5A 3LFMA 2YYOA 5F5QA 5FJHA 1R091 5FQ0B 1JYVA 1DGWA 1NZCA 1H8TC 4MX3A 4LBKA 2A6YA 4ZS3A 1UOJA 4JTOA 4Q8LA 4R4ZA 2R1BA 3ZYPA 1XPWA 1UIJA 5FFOC 5GJ6A 1AHSA 2OZ6A 1F5JA 5G04L 5JLVA 4CEWA 3GZUC 5DUWA 3TEXA 2QZ3A 3TEYA 3RI8A 2OYZA 5HXVA 5T5OA 1CGPA 3R0RA 1LHNA 1MQTB 4ZU4A 3WHUA 2XVLA 5J7MA 3IBMA 1UKRA 1W39A 3GBFA 3H7JA 4LIVA 4ZZ8A 1X36A 3C7FA 3OY8A 2HWE2 2W9XA 3O7OA 1STMA 2X5IC 3GF6A 2EALA 1F9KA 1UL9A 2RG4A 4JV4A 1OHFA 4LKSA 4INDA 4TN7A 4BHPA 1GOHA 3WDYA 1UMZA 3BKZA 3VBSA 5HXMA 3BYWA 1NE6A 5LBCA 2BWAA 1ODNA 4UFJA 2ZA9A 5DAXA 5KHJA 2Y26A 2OT7A 2JD4A 2Y6KA 5F9TA 3WDWA 1NY71 3THDA 1NCRA 2EIGA 3HN3A 4PF5A 2BGCA 2WNEA 3WDXA 4JZRA 5E6HA 2W1UA 4NHYA 5FMBA 1L7RA 2ZKNA 1SFPA 1KXGA 3PVBB 1U12A 3WDUA 2FMDA 4R9BA 1UQXA 3AB0A 3P3NA 4Q0UA 2F17A 2ZEXA 2BU9A 1JZ4A 4GWNA 2JG9A 5CKQA 1H1MA 1CESA 3DYMA 1NCQA 2J1EA 1W6NB 2JD9A 3LIHA 3NJXA 1BHGA 1H6XA 1MPXA 1BEV3 1UPIA 2CWMA 3K3OA 3RZMA 1DQ4A 1OLRA 3LIGA 3MHZA 3H9AA 3K48A 3RWKX 4FPOB 4O9GA 4BXSV 5CKMA 2B42B 3THTA 2DCTA 3OBTA 1J83A 3ZSMA 3NVCA 3TRSB 2WDBA 1LOCA 3PHMA 5K0UA 1XB9A 3RZZA 2GH2A 3SCFA 4NROA 5CFCA 3ZR6A 3A0KA 2C24A 1UXZA 1DCSA 4YW1A 1HN0A 1D7PM 5FP3A 1BVVA 5FZAA 2YHJA 2VQAA 2K0GA 3V0AB 2Y0IA 4XETA 4H2AA 3RDIA 5D8AA 2P3IA 3ZSJA 1UCXA 3Q9OA 2RM21 1BEV1 2W92A 3A0NA 4A3ZA 3ACIA 3O14A 3T2TA 5T52A 5AFEA 2A1XA 2ARXA 2QE3A 5CEHA 4RHV1 2WRAA 2ATFA 5H9QA 4XZPA 1X82A 5LK7B 4WM8B 1HJGA 4AQSA 4ASKA 2TEPA 3MFCA 3NNJA 4HXCA 3ZXDA 1MACA 2CY6A 2IZWA 4B7KA 5AC93 2WS92 1H2MA 3EJKA 3Q8CA 3SKVA 5JI9A 1PGL1 3OTFA 3WLUA 2B7YA 2ZGMA 3UJOA 4XJZA 5GLZA 4QT6A 4NIGA 3B69A 5A3NA 2WNUA 4MV2A 4ORFA 4DO0A 2PXJA 5HPOA 1CAXB 4IEXA 4YFWA 4OI2A 4OHZA 3NQHA 4COVA 4FSJA 4Y22A 3POJA 3BALA 2OZJA 3TBDA 3C8XA 3SH4A 4I3GA 4P9JA 1BBT3 2WIIB 3MO4A 3ELNA 1IQDC 4Y4YA 4CPBD 5KHIA 2V73A 4XXAA 1AXYA 4XF4A 4QMAA 5JXGA 1NA1B 1F4AA 1RVF2 2ZX0A 3LDBA 2ZJCA 3M1HA 3WR0A 4CCCA 1G9AA 5CG8A 1H30A 4PHZA 4XUNA 3TOJA 3N9QA 5C3RA 3UGFA 1CAWA 1LCLA 1MZFA 1RITA 4HPKA 4P9WA 3VBUB 2A7AA 2Q1ZB 3SQOA 4Z07A 2WKKA 4AZZA 2CAUA 4XMIA 2AEYA 2HWC1 3PUHA 4A45A 5BNOC 4CZSA 2VZVA 5ABJC 1D2SA 1NLRA 1WGPA 2PELA 1UOFA 1L7LA 5LA9A 4ZPIA 4ZXKA 2VXJA 2MNGA 2WLPA 2G9ZA 4UW5A 2IVJA 5DAVA 1K5JA 1AL0G 3A7QA 3HNMA 4PIZA 2XBO3 3ZIXA 4LBOA 3KHCA 1PGW2 2RR11 3OUJA 1AXZA 3HNYM 3P6BA 4Y4RA 3ZXEA 1IPKA 4P9GA 1XOYA 1PO13 3CIHA 1LNSA 3KQRA 4YSFA 4FP2A 2BV4A 3WUDA 1YNAA 4V1PA 2DFCA 3ZYFA 2ZEWA 1PK6B 3ZDVA 3ENRA 3H8RA 2WN3A 2C9AA 2WO1A 3RZKA 4XE9A 4AI3A 1OKQA 1GNHA 2DF7A 5T50A 4IGQA 2W68A 4CP9B 4XABA 3J8F1 1FNYA 1BK0A 2HEVF 4KH9A 4YVSC 5JCTA 1TMF3 5FZDA 4DS0A 5JIAA 3CJIB 1RUOA 5AFBA 1HRV3 4XFGA 3NJVA 4GWJA 3H3ZA 5ACA1 1XNAA 1RUG2 2JE7A 2Y60A 3POYA 1N1VA 2EIDA 1OLMA 1N1YA 4AEKA 4Y1UA 1WA6X 3OEAA 1QMJA 3PLQA 1C4RA 1S0GA 1UY4A 4CEWB 4FTEA 2FQPA 4GWMA 3UL2A 1VAKA 3S5QA 2XKPA 3GALA 4QM8A 3K75B 4EZHA 3VD5A 1ENXA 2Z4FA 3EMRA 4I2OA 4I01A 3E5UA 1VBD3 1NG0A 2Z2SB 4YWAA 2XL7A 4YVWC 3GJBA 2EIEA 1K42A 4K21A 4A41A 1W9TA 4QDSA 1BMV1 2VUDA 4Y5Z0 3ZYBA 4P14A 3AKRA 3W9AA 4M01A 1VBE3 1AXKA 1BYHA 4RSUA 1ENSA 1D4M2 2W3JA 1UY1A 3MIGA 4GA9A 5IK5A 1VBA1 3I3EA 3NW4A 1HN1A 3VBSB 5J48A 2ZAHA 1DQ2A 4JX0A 4FOVA 1R082 4CA9A 4QPIC 1F31A 3C7EA 1NCRB 4QHZA 4WVZA 2WBKA 3QD6A 1Q56A 2ARAA 2DU0A 4QPYA 1CJPA 3N3HA 3WUCA 4AHWA 1JHNA 1KGYA 2C0ZA 2PMWB 4LO8A 5FY8A 5FYZA 5IAVA 3HQUA 2NPIA 2R073 3PUSA 5C5TA 3M7AA 3AKSA 1QNWA 3GCXA 3CBNA 2VY0A 2D93A 2WR9A 4I02A 3WHTA 4LO6B 2YU1A 2BWCA 3AKQA 3ZFGC 4OLLA 3VKNA 2VOXA 1XQNA 4Q0VA 4BQ3A 2JG9B 2DVAA 4NHLA 3VBRA 4CXXA 4BM8A 3AJZA 5HCBA 2FDIA 1NZIA 1PIV2 1NCQB 3PL0A 4IE7A 1ND2C 4YGDA 4AHXA 5KXCA 2CWSA 4AGRA 4ES9A 4HKWA 4COYA 2XVGA 1KD7A 2VPVA 1RINA 1ONAA 4E8CA 1AR83 3VDDA 3VBHC 3I3MA 4HLTA 5I8SA 1UO9A 3IDEA 4JRLA 3WP3A 1WCSA 2Y33A 1ZA4A 5A7SA 4JQRA 3DUIA 1BK1A 3ETPA 1XNDA 2AC1A 1PVC1 2A5ZA 4YW5A 3MPBA 4QPGC 4GB33 5CFCB 1D0GA 3ST7A 4LORA 5GKAC 2VW1A 1JZ8A 4RFRB 3R05A 3C7GA 4I3PA 4N9HA 5D8AB 4IE5A 2XB6C 4H55A 2D97A 2JE9A 5B2GB 2B4KA 3ATGA 1UXXX 4EROA 5IK7A 1AR71 1AR91 1IS4A 3LF7A 3N35A 2AREA 3KF3A 5FXZA 3KV6A 3ZSEA 4RA0A 5FZ8A 5K9YA 1O8SA 1PNGA 3VD3A 3KM5A 2D40A 3I59A 1ENRA 4OYUA 2ARBA 4O7XA 1YIFA 3RJ2X 3SCHA 1Q8PA 2ILMA 3T0BA 1E5HA 4FPJA 4D6RA 1RMU2 2C6SA 4JKMA 1WBFA 2H0VA 2RJLA 2E6VA 3ES1A 4BK4A 2RDQA 3NV1A 4RR3A 1FPN2 2J7MA 1WCUA 1OF3A 1JN2P 3AYCA 5E1RA 5ANNA 2WNUB 1GR3A 3UT0A 2PN5A 4FXKB 2XVKA 3WW1A 4MOAA 1W8WA 4Y22B 5F2WA 1YQ5A 2HWE1 5GLWA 5C8CA 3IKWA 2RS13 4AEJA 4JGYC 4D6SA 1KITA 3UETA 1X9TA 1ZREA 2HBTA 4Q27A 1PHMA 1GMMA 1RJ7A 4DEVA 1RYYA 2ZGLA 3LEGA 5IWFA 5JXHA 4QKDA 3IN9A 1CAWB 1L7QA 3I54A 3HT2A 3LQCA 3MUY1 4FFFA 4HPKB 5CU1A 5FYCA 5J1XA 3LDRA 4WVWA 4XCAA 3WDVA 2GSYA 2OQ7A 4JTNA 1AYM3 2EIBA 4XILA 2PLV1 2YPJA 2VMHA 1OOPC 2QTWB 4MXWA 4LKEA 4NVPA 5CYYA 3AJYA 5F32A 3ROUA 3UGHA 3ZFFA 4R9CA 1PMIA 3BN6A 5A32A 1G7YA 1JU3A 4ZONA 3ZXKA 2JDNA 4YGEA 3RRDA 4AEDA 2WZR3 4N43C 3IIIA 3POGA 5A1FA 4XF9A 2QQKA 4FFHA 5C3OA 1YQCA 5HI0A 4AL9A 4LQRA 4UYBA 4QXBA 4F8AA 1VMHA 4NHKA 1F15A 1W8ZA 5I8YA 2CGPA 2TBVA 4AWDA 5A1LA 4Z92B 4OUMA 3ZKYA 3ZPOA 3CQOA 3DPRC 1HB4A 1I3HA 2X29A 3B93A 3JBG3 4XJUA 4CCLA 3AP4A 3KT1A 5HBAA 1GSLA 3B01A 2ORZA 4CDUC 2GNBA 2WS93 1GFF2 3WCRA 1H1IA 1PO22 4YM0A 4JHTA 4WM7A 1AX0A 1R1A2 5E8AA 5JSRA 1QOOA 1S0CA 2GNTA 2BQPA 2CAVA 2EA7A 4E4HA 4XW3A 1DLLA 2LALA 2ZAAA 2KXLA 2VULA 3FLTA 4I30A 4HFSA 1ST8A 3F2ZA 2DTYA 1O3SA 5FAXA 1CX4A 1VAMA 3CL1A 4R52A 1CX1A 1EYBA 1EP0A 3OEBA 4OI0A 4LK7A 4CPBA 5SV8A 5LCWL 3OGSA 2XHNA 3PMSA 1HRI3 2F6BA 2WS91 3INAA 3OPTA 1O91A 4JCKA 2Q8CA 4CP2A 2ZEZA 4LEJA 5FY0A 4DMIA 1V6NA 5FXXA 4ZU7A 1LEMA 2QUOA 3ZXAC 5FTTC 3SEEA 4XFIA 3MZHA 1LU1A 1PGSA 4BQ5A 2QQIA 4ZKTB 3LCPA 4XVHA 4BA6A 4IV1A 4D3WA 1V6LA 1OVSA 3OD4A 3LGRA 4FCAA 4GH4C 2ZEYA 5DDJ3 1W6PA 3NNGA 1DZQA 4DIQA 2VCBA 3WCSA
chains in the Genus database with same CATH topology
2E7TA 4K3UA 2BW8A 1JH5A 2B5HA 4QQOA 2ZACA 1DYPA 3TN92 1RVF1 1X8MA 3WQ1A 3ZSLA 2Q8OA 2XJSA 1JW6A 4Y1XA 1O3QA 4MYEA 2VXRA 2BYVE 3WXPA 1RUI2 4IEPA 3LWCA 1IS3A 1A3KA 1AJKA 1PM7A 2JG8A 1WCDJ 3ZO0B 2OIIA 3HBZA 1GBGA 4IV3A 3VBRB 5JMCA 2YY1A 2GC1A 1QOTA 4AVVA 3KSCA 3BCWA 1QJY3 4N7IA 5I0TA 3WNXA 3WG2A 2JEMA 1CPNA 4KBBA 5A3LA 3VDDB 1Q8SA 3KZ4C 4LR4A 5GZDA 2JX9A 3QH7A 1WMEA 4META 1LJ7A 1ZZ7A 1SLBA 4RS5C 1PNFA 3D5OA 1LHWA 1RUNA 2H6BA 4LO7A 4RQPA 1ZYBA 1V6IA 1N3QA 4DY3A 5GALA 2EAKA 1LHVA 2MEV1 1CPMA 4A2UA 1JBCA 2XWJB 2WA4A 3C3VA 2WINB 3D8CA 5EWSA 3MEPA 1RB8G 3ALQA 1DU3D 3LOBA 1KDKA 1EV13 1RUG1 4IXLA 3I59B 2R30A 3AZWA 3ZVXA 4UW3A 4F7ZA 3AMPA 4CDQB 4OHWA 1WLDA 1DQ5A 1ALYA 2CGNA 4JRAA 1LRHA 5AC92 4E4ZA 4FPKA 2ZX2A 4RR3B 3ZN4A 2VOWA 1MS5A 3N7MA 2XJTA 4YM3A 3I4IA 1DGLA 3V0BA 1GZ9A 4MXVA 4FTSA 4CTEA 4FPGA 1Q3EA 4JDMA 5C8CB 5FPXA 2CYFA 2B39A 1D4M1 1RUE2 5E88A 1BBT2 4O9EA 2ZX1A 4FQZA 1PIV3 1R081 1MS1A 4JDOA 1Y43B 1XRUA 1JUHA 3M70A 2EXIA 1X33A 4KGQA 3ZFEC 4BCUA 4FTBA 2WNVA 1ZRDA 1MEC3 1SBFA 4P9XA 5L7OA 2ZHKA 4MXWB 1HV0A 1XYPA 2QDRA 3ZFFB 1PZ8A 2I45A 4LLFA 5A32B 1L3JA 1O3RA 2NP0A 3GZAA 2DWRA 4AEDB 3KT4A 4PLOA 2XBO2 2YROA 5H9RA 1PIV1 3S6PA 1BCXA 4W65A 2ENRA 2B46X 4C0HA 5J98B 1YFUA 1QJZA 4QD2A 1PO12 1AYN3 3PNAA 1NXD1 4AFDA 2GN3A 3LAGA 1OA4A 2VNRA 3N7JA 1DG6A 1ZX5A 4MGYE 5GZGA 2N7GA 3E6DA 2A75A 2ZPXA 3AYEA 4ONUA 1SBDA 3JQWA 4WM7B 5GLUA 3FWEA 2GH8A 2NYYA 1ENQA 1TMF2 4ASMB 5BNPA 4LLOA 1K5MC 1O4ZA 3WP4A 1HRV2 2V5YA 2D5FA 4QQHA 4Q1PA 4YYOA 3BOWA 5JSOA 1H2KA 3U0ZA 2BFUS 3RYPA 4C0BA 3M3EA 1RMU1 1DBNA 4J1XA 1AJOA 3ILNA 4LBLA 1ZRFA 1DGWX 2R6QA 2BVVA 3J4UH 1FPN1 4W6YA 4AI1A 4EV0A 4CEYC 3PVNA 3ZSKA 3ZXJA 2ZHLA 4B4PA 1PZ9A 1NQJA 1YRZA 2RS33 2R49A 1VBE2 4KGGA 1U5XA 1PZ7A 1V6OA 1W6PB 1Y9QA 3H1WA 4A7KA 4A3XA 5KC6A 3BU7A 4N53A 3VBFA 3VV1A 4M3CE 3VBOA 4EWDA 1OQ1A 3GBWA 4XFFA 3E6BA 3AZYA 1JOJA 1N3PA 4KL1A 3WG4A 1UZYA 3VHNA 3MIHA 4AHZA 1GLHA 3VZKA 4XQDA 1TME3 2X8KA 1C8M3 2BNMA 1WLTA 2HWD2 1NA1C 2JG8B 1QKQA 2W52A 5D1IA 4E2SA 4IV3B 4M3CF 5BXXA 3A4UA 5E16A 4OZXA 2Q5TA 3MIBA 1OPOA 1H8TA 1CQ9A 4COWA 4M3CB 1AR82 1YWKA 4NWWA 3WT3A 3DF0A 2ZX3A 4QQ2A 2QCSB 4SLIA 4KWJA 3OJBA 1LHOA 4AW7A 4RQPB 3ZMNA 1MS9A 3RG0A 2R042 4GULA 2PHUA 2A6ZA 2WQ4A 4GB32 1VIWB 1EPZA 2XL9A 1IQAA 1Q8QA 4IQPA 5GZFA 1MR5A 4PIYA 3E5QA 4R9DA 2WSVA 1PO21 2HWB2 1WW6A 1UZZA 2O8OA 1YHFA 4J1WA 1R1A1 2X53S 2NMNA 2X5IA 1C3HA 2DV9A 4UW6A 2ZGTA 3VKMA 1A8DA 1TQ5A 4CRQA 1ND3C 4KU7A 1O3TA 2P37A 3HR9A 3HD8B 3O0WA 1QY4A 4HVRA 1DF0A 4PCRA 1ULDA 1C1FA 3TN93 4C91A 3TB0A 2JKBA 4N90A 2PYTA 3WV6A 3KD4A 3V0BB 1S0JA 4BPZA 1BVP1 3HAGA 3B9CA 4BMEA 4PIXA 2RE9A 1RUI3 2IXJA 1XE7A 4Q1RA 2C5DA 2WC2A 1I5ZA 3GYDA 2RS12 4Y1VA 5CA6A 3QBQA 4XBNA 2HYKA 2NLRA 4AQTA 3GNEA 3AP6A 1HQLA 4B8EA 1GV9A 4BE3A 5JOXA 4WV8A 3TN91 4QX5A 4CDXB 1AR63 2ZGPA 2WT0A 4HKLA 3IM0A 3K51A 3VLBB 4FPCA 2ETEA 1YIPA 1RUC2 1AYM2 2EXKA 3PTYA 2DURA 3POWA 4JVAA 4E4DX 3LZZA 4XQ4A 1VBB3 2WZR2 2XKOA 4LBMA 1COV3 3GHMA 1AVBA 5GZEA 5I8TA 5EZWA 3E5XA 4AE2A 3AZXA 2E53A 4DY5A 2ET1A 4HANA 3POSA 3JBG2 5H9SA 5FLJA 3USSA 5BNNC 1E57A 1YJKA 3AP9A 3R4SA 1VRH3 4OULA 4Y24A 5BNPB 1REEA 1YLLA 3B3QE 5KXDA 4Q0SA 1Z0HA 5CIRA 4XFCA 4Q26A 5FOJB 4UBHA 4Q4X3 4LA2A 2GMEA 1RUE3 2BTVC 3VZOA 2GMPA 2XH6A 1SEFA 1OD5A 4G3YC 4HL0A 5CNAA 5FCCA 3SHRA 2VOKA 1JUIA 5AC91 1LOBA 1HRI2 2DCJA 4P9YA 3JU9A 3CO2A 4AVTA 5BNOA 3I8TA 4AI0A 5ABJA 2Z5WA 3DV8A 4Q2FA 4Q4V3 4BWOA 3T1MA 3LA7A 3H7YA 2ES3A 4YLZA 1RUE1 1LU2A 3U11A 3ZXGA 3CJXA 4FPLA 5DDJ2 1M06G 3ZYIB 1AX2A 1BBT1 4IEZA 4MSVA 4N53B 2HWF2 4OHVA 3VBFB 3VBOB 3MIFA 2ZZJA 4MLOA 3HMYA 2XUMA 3UV9A 2VNGA 1D4VB 1FATA 5CAZA 2PHFA 3FHIB 4QGLA 1RHI2 1RUJ3 2JJ6A 3RWNA 1ZM1A 4GXLA 4BZ4A 3AP7A 4YVSA 4JDNA 3WY6A 1IKPA 4HT1T 4AG4A 2ZGOA 1B35C 2ZCWA 4M0NA 5HCFA 3S30A 3ZXFA 1H8TB 5GZCA 1LODA 4FAHA 1QJY2 2XBO1 2QQPA 4YZ4A 3VHPA 3B5LB 2DFBA 2P3JA 4AVSA 1J1LA 2FMYA 1PO11 1HIXA 3VZMA 1JYCA 5J37A 1UKGA 1QHDA 3JUUA 4GMP3 4E9KA 4YVWA 2FHRA 3BB6A 1J59A 1GQHA 2ZMKA 2PA7A 1C5IA 3H0OA 5BUVA 2BVBA 4LA3A 1XXNA 1H4HA 3OPZA 1TMF1 2A73B 4H3WA 2YC0A 5JDBA 4HSLA 1SLCA 4FO9A 1HRV1 3WW2A 3OY8B 1EV12 3B9IA 2QZ2A 1EAH2 3R6SA 1RL3A 4QPIA 3AK0A 2RS52 2PFWA 3D82A 1DGRN 5KWRA 2E9QA 1Q8OA 4NR1A 3VHRA 1S2KA 1RJ8A 1ZBE2 4X6RB 2A6WA 2C1FA 3V65A 3GHNA 1M4WA 1ZZ9A 2DVGA 4Z1VA 4XJ8A 1VBD1 1UF2C 1YFXA 3CEWA 4KNCA 2IXKA 3AFKA 4NO4A 3B02A 3ZFGA 4AGVA 1B09A 4QU2A 2HWD3 4EWAA 2A70A 3THPA 1CAVA 1ND2A 1VBE1 2VU9A 3GBGA 1HXS2 1WCKA 3NKGA 1YFWA 2UU8A 3VBHA 3ZYRA 3PJQA 3H50A 5J3UA 4KQ7A 1OI6A 4QPGA 5JOZA 3RYRA 5CFDC 3IIAA 1GZWA 1LGNA 1POV3 2R071 4RL7A 1MEC2 5L73A 5K0UB 4CP1A 2R043 2HWD1 1UX6A 3TYJA 1W0OA 3TNQA 1EPWA 1AL23 5BNQA 4XMAA 5FO9B 3HIFA 3PVEA 4OVEA 3M2MA 2HWB3 2OUJA 1WW7A 1FYUA 2FZ2A 1H0BA 1RUF2 1GQGA 1SCRA 1QU0A 4E2GA 1LOGA 3KCYA 1AR81 5L19A 2E7AA 1OMIA 1AYN2 4LBQA 1Z78A 5C9AC 2Z42A 1Y7BA 2D3SA 5BPXA 4G9SB 3RYKA 2XLAA 3AXEA 2PQQA 2O0OA 4GB31 1OFNA 2I2SA 3N7KA 5JWPA 1X7NA 4K20A 1ZZ6A 1A8MA 3C2UA 2D7FA 2HWB1 2Q4SA 4GKYA 4L97A 5EYXA 4COUA 4BLIA 4IEWA 4LHNA 4JGYA 2IFRA 3ZMOA 1F2NA 3NAPC 3LOIA 3WW4A 2LUWA 2BNOA 3BTAA 1UAIA 5JZGC 1LTEA 3UK9A 1DIWA 2PHRA 1C28A 1KFXL 3IDBB 5FRAA 3ZX7A 2D6KA 1ZVFA 5L36A 1RGSA 5CB7A 4IESA 5ABJB 4CDQC 1XE8A 3TNPB 5FO7B 5I93A 1OOPA 3JQXA 4YW2A 3UJQA 3RMYA 3AP5A 1H8VA 1HKDA 3T1LA 1RUC3 2RS32 3QCWA 1SLLA 3OCPA 4N43A 1V6JA 2RS11 5IT6A 5EJ3A 1QQP3 2P2KA 1REFA 3QH6A 2UWCA 4U36A 1MVQA 1SACA 3KT7A 3DPRA 4FAGA 4UXAA 4BMBA 4IEOA 1YI9A 2ZGNA 4ISQA 5BY5A 4Q4W2 1Q43A 2A71A 4EJRA 2VW0A 1WMFA 4CDUA 4YVSB 1TME2 4IL7A 4BLJA 1C8M2 1RUC1 2NMOA 2PHLA 1AYM1 3NV4A 1IS6A 4L8QA 2XJVA 5I0SA 3R4UA 4CDWC 1ULFA 2G9FA 3KMHA 2H0BA 3ZN6A 2TUNA 4DFSA 5FLIA 3U07A 1LB2A 3RS6A 4XF3A 2WZR1 4HK9A 4LBNA 4AK3A 4J6GA 4X6QB 1ZNPA 2MHFA 3FLPA 3RPQA 2ZGKA 4AI2A 4YM2A 4AEMA 4Z82A 2DUQA 2UWAA 3JBG1 4YVWB 4OHXA 3SITA 5LEJA 4FBFA 3NL1A 4P9LA 2ET7A 4G4FA 2Y0OA 1S0IA 2BPA2 1VR3A 3SXWA 1XNCA 3FUQA 3FFZA 4JAAA 3ES4A 4GH4A 3ACLA 1IGOA 4JGZA 1FV2A 5FMOL 3KCXA 4QPIB 3ETQA 1WBLA 1F8VA 3CNAA 2WQZC 4PDWC 2HWF3 3SCGA 1WD3A 4D94A 1HRI1 4TLFA 4C90A 3ZFGB 3JD72 3FFQA 2VQ0A 1RHI3 2A3XA 2CTVA 5KXEA 3NJZA 1CAVB 1ND2B 1QWRA 2WJSA 5JIUA 3NV3A 2DUPA 5FPZA 4AXOA 5DDJ1 3VBHB 4Q0PA 1YXWA 5DUUA 1T6GC 2HWF1 1TEIA 3OGGA 5C33A 3KS7A 1YO8A 1QDOA 3GZTB 1QJU2 4RS5A 1PGW1 2IFWA 1FMD3 1TNFA 2ZGQA 4XBLA 4YZ3A 4S2GA 4QPGB 4D7YA 1AR62 1F5FA 2WT1A 1GZWB 3RNSA 4YGCA 5J96B 2K2SA 5DG1A 5GLVA 1YYNA 4H7MA 4MGIE 1J1TA 4GMP0 4FQ4A 2ZOEB 5AVAA 4XHXA 4R4XA 5FBZA 1SCSA 3FLRA 4GIQA 4Q4Y3 2NZ9A 3OBRA 2F4PA 1QJY1 1VBB2 3EBRA 1WD4A 2IXCA 1REDA 2QKDA 2K9ZA 4MZUA 4L99A 3M3IA 1COV2 3FC0A 4AFBA 2OPKA 4LBQB 1V9U3 4LBJA 2GC3A 1QXJA 1EAH3 1KDMA 4K9SA 3AZZA 1SQ4A 3LSDA 1NYWA 2GNMA 2RS53 1WUVA 4WVMA 1O5UA 1MVEA 4L11A 2D44A 5FO8B 2PHTA 5F1RA 1ZBE3 4HKOA 5T3NA 1IHMA 4HVQA 1S0DA 4RGGA 3I7DA 1VRH2 2ZGRA 1C1LA 1SFNA 2A6VA 4NHMA 1H2NA 2A3YA 4FVVA 4UBGA 4YG0A 1MQTC 1EV11 3MDPA 3MLLA 4FOQA 3N36A 4Q4X2 1EAH1 1LECA 3VHOA 2RS51 4GALA 1RUH2 5CBLA 1HXS3 1IOAA 3R4DB 1ASJ3 3SMHA 1VLNA 3ZFEA 4DXZA 2KM2A 2DCKA 1XNBA 4L92A 5K8SA 4CYDA 1LOFC 1POV0 4EN0A 4MH0E 4Q4V2 1OLQA 1X8EA 3O12A 4P5HA 2HWC2 1SBEA 1YJLA 4LO5B 4N43B 2GALA 1RTVA 1W6MA 2UYAA 3O5SA 4BQ1A 2VMIA 4FOWA 1QJX3 5DZEA 1HXS1 3N7LA 4FP3A 1FX5A 2P3KA 1BZWA 1RUF3 4Q8KA 3FMGA 3DPRB 4XF1A 4AFCA 3M3QA 1W6NA 2IXLA 3ILRA 1YI7A 1QXRA 2OVUA 2R063 3FX3A 4B7EA 3WX5A 3WQ7A 1DZTA 1UN1A 4MUVA 4Y1YA 4CDUB 3DL3A 1MEC1 1RUJ2 5IK8A 2H6CA 1GZCA 3TWIA 2D3PA 4WVVA 3MLKA 3AXDA 4CDXC 2WA3A 1K5MA 4BIOA 4KWLA 1G8WA 2FZ1A 3IT8A 4K6BA 2Q0AA 2D6MA 1RUF1 2EXJA 4Y20A 4QQLA 1KQRA 2GNDA 5DUVA 4K1YA 1AYN1 4H7LA 2AH2A 4XPVA 1SFYA 1YFYA 3UKVA 2Z69A 1FOD3 3M8LA 5J36A 1O4TA 3WP6A 1MZ5A 1JTZX 4ATEA 3OD0A 4CEYA 4YZ2A 5GLTA 4HETA 3IWZA 4GH4B 4MGZE 4WM8C 1FT9A 4ATFA 4LULA 4L2NA 3D0JA 4HSJA 1J3RA 1ZBA3 4IV1B 4JGZB 4K8FA 5GM0A 2O1QA 2WT2A 2WFF3 3J26N 2PHDA 2D6LX 2Q1MA 2DTWA 4IEQA 4UW4A 2R0HA 2XJQA 5LK5A 1MZEA 3VGIA 2GC2A 4TYSA 3IMNA 1I6XA 2ZGSA 2DU1A 2ZHMA 1NA1A 1O7FA 4Q4W3 3VN4A 3S0MA 5IK4A 1MZ6A 1U5IA 2RS31 1ZRCA 1LEDA 4QM9A 1ULGA 3MGUA 1UU4A 4OUSA 5JOWA 1NXMA 2PAKA 5C4WA 3AMQA 1VBC3 3VBUC 2VVDA 3JB4C 1J58A 1LESA 1LGCA 2XGXA 4YW3A 4EWEA 4BYYA 2MPFA 2JXAA 1V70A 3ZIWA 2QJVA 1VALA 4CP0A 1G9CA 2O8QA 3URFA 4XYXA 5T5LA 4Q4W1 5JPNB 3TAYA 1U5ZA 3HQXA 2CL2A 1Z7S2 1TME1 1C8M1 2WWSA 3FJSA 3JZVA 1AUYA 1HDKA 1OA2A 2OUHA 1AL22 4XF0A 3I2DA 2ZS6B 1PK6C 2GAUA 1WW5A 2ZTNA 3WP5A 3ME2A 5AFBA 4YG3A 1S55A 4WZFA 2NM1A 1ND3A 2OA2A 1X50A 2VGDA 2VECA 1G9FA 2AR6A 4LBQD 4W6XA 4WVMB 3CJIC 3D6EA 3FBMA 1G9BA 1URXA 3SH3A 4PBOA 2R32A 3E6CC 3L2YA 3QACA 4PBPA 4CEWC 1EY2A 4XEZA 3RI9A 5CVRA 2UY9A 2RMU2 1APNA 1G6NA 3JD73 1XYNA 1HX6A 3RQ0A 3WG1A 1SDWA 4EN8B 2Q30A 2SLIA 5JPMB 3AMHA 1Q5OA 1CR7A 2GN7A 1KJRA 2R16A 5DUXA 3ZFEB 3MIEA 4FPHA 1QJU3 5FOBB 3PJYA 4XJWA 1OQDA 3VBSC 1N3OA 2WNVB 3JD71 5KC5A 1ZZBA 1AX1A 3OYWA 5L7OB 5KHHA 4Y1ZA 1RUI1 1G86A 3BODA 1NCRC 2PLV2 1W6MB 1BKZA 5C6CA 1OFSA 2YGLA 3KCCA 1HQWA 1LHUA 2YXSA 4TZDA 4KG0A 2JDZA 5HCAA 1QQP2 2WL1A 1QJU1 3MW3A 2ZZQA 1KS4A 2RM23 2GZWA 3RMXA 4DRVA 1AR61 2JG9C 4RHV3 3LSEA 4E4SA 1NCQC 5BNNA 3J9SA 4ZU5A 4WZCA 2TNFA 3VZJA 2CNAA 4YZ1A 2XJUA 4XIOA 4KG8A 5KBFA 1K5MB 3LB9A 3OF1A 4AQ2A 1QH6A 5K0UC 4OHYA 3BPZA 5JR7B 2WLQA 1VBB1 1MS0A 2AGSA 4Y20B 5SV5A 5CFCC 1C57A 4W6WA 1UW8A 2PAEA 3AMNA 1COV1 3M3OA 3VKLA 1PVXA 1GYKA 3H8UA 2I07B 5D8AC 3KGZA 4AVAA 2B45X 4A7ZA 1NOVA 4PLMA 1RUD2 1RUH3 2AUYA 5AVPA 1S0BA 1W6QA 3TBDA 4TSVA 4CEYB 5J09A 4C1XA 1HQNA 3MF9A 1C8NA 1VRH1 3AX4A 2G4IA 1W6OA 1U0AA 5BYNA 4HBNA 1MS8A 1GKBA 2VOVA 3WVJA 2QFEA 2AENA 1DFQA 1FI2A 2G9GA 2HWC3 3FUOA 4XIKA 4Q4X1 4D69A 3SNMA 5F6LB 4XDQA 1SLAA 1RUH1 2Z79A 2WNUC 4XXPA 4LT5A 3EXUA 4X8NA 2RR13 3VL8A 1W0PA 2LTNA 1Y3TA 3WD5A 1KRIA 3AKTA 1JXNA 1RIRA 2UY8A 4B3NA 2D3RA 4Q0QA 1B35A 4Q4V1 1LOEA 2I74A 3WDTA 2EXHA 2GDFA 2YDEA 2VUAA 3HWJA 1AF9A 3SLIA 5C4WB 3LKJA 3J8F3 1FMD2 5I0UA 2P34A 1UIKA 4YNIA 4NWVA 5ACA3 3AFGA 4DOUA 1HV1A 1KFUL 2HJIA 1CAUA 3WQ0A 3HN1A 1RUJ1 1DHKB 4HMZA 4LNVA 4FT8A 4E27A 4F83A 2A6XA 4NN0A 2ERFA 2LM3A 3FBYA 2MEV2 2UYBA 4YG6A 4Q4Y2 3ZXLA 2YGMA 2FBEA 2SBAA 4PQ9A 5LRRA 4AVBA 5H9PA 3MIDA 4OI1A 2X5IB 3D0SA 1ND3B 4DNYA 4BH9A 1KJLA 4RD7A 1S0EA 3O0XA 1NE4A 1V9U2 2AYHA 4IERA 1R1ZA 4NOTA 1IS5A 1DQ0A 1CD3G 2E51A 3NSTA 1VBA3 2W08A 1C5HA 3MICA 5I0RA 4GMP1 3W59A 5KXBA 5DZGA 5KHKA 3L9JT 2Y38A 5IUQA 3D4KA 4YRDA 2QNKA 1DQ6A 4ITCA 4ASLA 4L9BA 5JAXA 4TWTA 2YUEA 2KA3A 4JC1A 4N9IA 2CGOA 5JI7A 3VZLA 5A3MA 3ILFA 3DKWA 1A6CA 1ASJ2 4QHBA 1J3QA 5CFDA 2B8MA 4Z2WA 5JSPA 1UD1A 1LR5A 3IPVA 4DB5A 1HW5A 3OYWB 1G9DA 2YMZA 4S2HA 1D2QA 1S1AA 1W2UA 4XHBA 1DGRA 1Z7S3 1PVC3 2DVDA 1ZRRA 2DCZA 2ZMNA 5EV7A 2GMMA 4IETA 2PTMA 1O4YA 2BNNA 4I0BA 1QJX2 4FXGB 1LOAA 3UKTA 3HT1A 4I0WB 4COZA 5JOYA 1LGBA 1CONA 4AQ6A 5C9AA 2VNOA 1YCIA 4XFHA 4GQ7A 4XFAA 1AR73 1AR93 3H1YA 1V6MA 3VBRC 4P9IA 2R062 4IEYA 5BNNB 4AYUA 1N1SA 1POV1 5LRSA 3EQEA 3USUA 1OA3A 1Z7S1 3VDDC 2R041 1WLCA 2A3WA 5F6KA 3BOPA 1ZZ8A 1AL21 1WA4A 4XFBA 4AGGA 3NAPA 4E2QA 2DUOA 2RMU3 3VZNA 5JZGA 3IDCB 4XTPA 3B94A 5LEKA 4QGNA 1CIWA 1XYOA 5EFUA 2HWE3 4F3JA 1FOD2 4S2DA 1W6QB 2E63A 1RC6A 4CDQA 2E7QA 4M0HA 4MGKE 3BIWE 4K1ZA 2EF6A 3MYXA 2ZX4A 1W6OB 5BNOB 4S2FA 2RMU1 2EAAA 1H4GA 1ZBA2 4D7SA 2PLV3 4RR3C 4X8PA 4HN0A 3SH5A 2WFF2 2QDNA 4XJAA 2V09A 4R9AA 1QF3A 1QXPA 2ZMLA 5C8CC 4BIFA 4QQPA 3O0VA 4Q29A 1UU6A 3JCIA 3RJRA 1B35B 5DG2A 3CF6E 4CDWA 4URTA 3KB5A 1WMDA 4EN9B 1V6KA 2ZBJA 4PJYA 4C1WA 1VBC2 3DN7A 4AVCA 2D6PA 1QQP1 2XG3A 1BJQA 2B9UA 3ZFFC 4RGAA 4AFMA 1FAYA 1ZZCA 1R092 4R8HA 4AEDC 1FXZA 3SISA 1CAUB 1QNYA 5FMOS 1RUD3 4XTMA 2RHPA 3OGJA 4HVOA 4H14A 1SLIA 4OFGA 3AYAA 3KLSA 2WSUA 2JENA 4NPRA 1H9WA 4Z8BA 2OW4A 3ZDSA 4AHYA 3AMMA 4PDWA 1IZ3A 4FPFA 4WM7C 3WINE 1NLSA 4DRRA 2JICA 3PMEA 2D6OX 4YFZA 5BV6A 1AZDA 1RUD1 3DGTA 3MW4A 4XQWA 4YARA 1ULEA 3PVOA 2BBVA 3APBA 3FZ3A 5KHGA 1QOSA 1XU1A 1GANA 4XBQA 3VKFC 5FDBA 1RVF3 1NY72 4M00A 4XJ9A 1JYIA 3S7IA 4HK8A 2XLFA 2P17A 3AZVA 3NV2A 4DQAA 1SLTA 4QGMA 4AF9A 5FLHA 1TNRA 2QVSB 3B7MA 4DPNA 1OQEA 2HKXA 4FPYA 3N4MA 4IV1C 2RJKA 2ZKLA 4JGZC 5CFDB 3WZ1A 2BEOA 3LA3A 3IPVB 4AI8A 1A78A 1J3PA 1QH7A 4FOYA 1GICA 2VW2A 1I9RA 1LENA 1ULCA 4QXKA 4IEUA 1RHI1 4HZFA 3QLQA 2DCYA 2VH9A 1HLCA 1IPJA 2MEV3 1LKNA 5CG9A 1YUDA 2DVFA 2EVXA 5EYYA 5A33A 4LHLA 2HEWF 3ZYGA 3WW3A 5C9AB 1UPSA 2WZPP 2JG8C 4M3CA 1FMD1 3QOPA 4HN1A 4IV3C 2RM22 1BEV2 1VJ2A 4XOGA 1RUG3 2XJRA 5FQ0A 3WG3A 4RHV2 3USUB 4D7TA 2GU9A 2VVEA 2XLGA 2XWBB 5EXOA 2IWGB 3EHKA 1DZRA 1O5LA 2PAMA 3LA2A 3ZN5A 2D43A 4YW4A 4Q4Y1 3S7EA 4Y26A 3NAPB 4RQPC 1PGL2 2AZ5A 1MQTA 2BUKA 3NKTA 2VVFA 5JZGB 3VUOA 1UU5A 1S2BA 3ASIA 4JGYB 3CLPA 3VKOA 4OI4A 1V9U1 3NWKA 4B29A 3NO8A 1VP6A 1D4M3 1H2LA 1I1EA 2D5HA 1QDCA 4LUMA 3U4XA 1R083 3V64A 2NQYA 1ZBE1 1LOFA 2D6NA 3E97A 5K7PA 1H9PA 1BQPA 3G7DA 2CV6A 1FNZA 3MPPG 1N47A 2ZGUA 1TE1B 1OOPB 1V00A 3JB8A 4YGBA 4EN6B 2WFPA 5T55A 4DZGA 4K7JA 1ASJ1 1GNZA 4K40A 3MW2A 2RR12 2PHXA 3X29B 2ZABA 3KGLA 4LTAA 3VL9A 4CDXA 3EO6A 4CDWB 3ZPYA 1MS3A 4LE3A 4KWKA 3WOGA 2JECA 2WNVC 3UKNA 3ZN6B 5L7OC 1QJX1 3J8F2 4WBBA 2VUJA 4GKXA 3V56A 3V0AA 1NQDA 3M4FA 4LUKA 5ACA2 2R061 2XJPA 2ZHNA 2DYCA 2W39A 1CJDA 2DVBA 1SMVA 2YV8A 1CN1A 4RFT0 5T5PA 1FV3A 4WM8A 4YM1A 1XNKA 1RMU3 3U10A 1MS4A 5CADA 1QGLA 5E89A 2UWBA 1KS5A 3RSJA 3AYDA 1FPN3 2UURA 1CVNA 1VAVA 1BMV2 4B4QA 1Q8VA 4PDWB 4N7UA 2XPJA 1S0FA 3P3PA 1IKQA 1OSGA 1CAXA 2PHWA 3B00A 5BNPC 4EN7B 1FOD1 1VBA2 3CU7A 5FREA 2R0FA 4I09A 4AFAA 4LHKA 4ISRA 2VMGA 3M3CA 2W0XA 5TSWA 4KU8A 4BOWA 1BXHA 1N1TA 1VBD2 1DYKA 1VB2A 1WLWA 3ZYJB 4I0AA 1OPMA 3AKPA 3MF6A 1ZBA1 3VBUA 1DQ1A 5JVVA 1H1AA 3W58A 2BFUL 4SBVA 4IEVA 2WFF1 5I91A 2XHKA 2NN8A 4PLNA 2YZ4A 3G6JB 4LE4A 4RS5B 4LO4B 1D0HA 2GC0A 4DINB 2R1DA 3MFAA 3ECQA 1R093 4B4RA 1WW4A 4N53C 2IXIA 3VBFC 3H3UA 4FPEA 3MLJA 3VBOC 2R072 3H1MA 5DXDA 5DZFA 2IC1A 3L2HA