5C33A

Crystal structure of mouse ryanodine receptor 2 spry1 domain
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
190
structure length
179
Chain Sequence
VSSMRPNIFLGVSEGSAQYKKWYYELMVDHTEATHLRVGWASTEGYSPYPGGGEEWGGNGVGDDLFSYGFDGLHLWSGCIARTVSSPNQHLLRTDDVISCLDLSAPSISFRINGQPVQGMFENFNIDGLFFPVVSFSAGIKVRFLLGGRHGEFKFLPPPGYAACYEAVLLKVEHSREYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ryanodine receptor 2
publication title Crystal structures of ryanodine receptor SPRY1 and tandem-repeat domains reveal a critical FKBP12 binding determinant.
pubmed doi rcsb
source organism Mus musculus
molecule tags Contractile protein
total genus 35
structure length 179
sequence length 190
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00622 SPRY SPRY domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.920 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5c33A00
5JI9A 2YUEA 4WVMB 4P9IA 5C33A 4B3NA 2YYOA 4P9JA 5JIUA 4KG0A 2E63A 4B8EA 3KB5A 4P9LA 4N7UA 2WL1A 5F6KA 3ZO0B 4XW3A 3TOJA 2FBEA 5F6LB 4WVMA 5JI7A 2IWGB 2LM3A 4QT6A 2VOKA 4V1PA 4X8PA 3UV9A 4X8NA 4N7IA 5JIAA
chains in the Genus database with same CATH superfamily
5JI9A 1OD3A 2JDNA 5EJZB 3R4SA 1TME1 2EA7A 4I30A 4XJ9A 2R042 1LGCA 1POQA 2H0BA 1SBEA 2OS2A 2WZ8A 4GKXA 2NN8A 3KVBA 1OQEA 2CYFA 3NL1A 4Q4V2 3PVOA 3AZXA 4A6SA 5C8CA 5JR2A 3E6CC 2VMIA 4FPLA 5GZDA 1VBD1 4CDQC 3OPWA 5IYYA 4XUQA 2V5YA 1XYOA 2BVBA 1X8MA 2WL1A 1N1YA 4XURA 1V6IA 4FCAA 4JC1A 1CAWA 1BK0A 2XLAA 1K3IA 1LOFA 1EY2A 3KT4A 4FI9A 2V72A 1NUKA 4I09A 5CB7A 3AYAA 4XBNA 3ZKYA 4AEDB 2BERA 5JR7B 1D4M1 1AR93 2ZX2A 2V4VA 4IEUA 1R1ZA 4AQTA 2I2SA 4QT6A 1GSLA 4MSVA 2R062 4PI0A 5EQUA 2WSUA 3NNGA 3ORJA 1OMIA 2VTXJ 1U12A 3V64A 1SFPA 2QDNA 5JLVA 4RL7A 1RMU1 5LBCA 1NLSA 5FY8A 3QD6A 3U37A 4I3PA 2VZ3A 4AF9A 1WW5A 1QJFA 4P9LA 2HWD1 4KQ7A 1HRI1 4A44A 1Y9GA 1GR3A 2BJSA 1WWYA 1EYBA 1QJX2 2R043 3KT7A 1OOPC 3PIJA 4Q4V3 3IAPA 5IFTA 1VAVA 4WM8B 3IIAA 4QKDA 3VKOA 5JMOA 4PLMA 1DU3D 1KFUL 5LA2A 1C1LA 1JMUB 2D5HA 2ZMLA 2CWMA 2DFBA 2WJSA 4XF0A 4CU8A 1PHMA 1W0OA 1Q8VA 1S0CA 4CP2A 3SKJE 5CVRA 4BISA 1ZA7A 2BV4A 3NMBA 4XIKA 1O4ZA 4A3ZA 3BCWA 3C2UA 1GP4A 3K4DA 3OUIA 1SZBA 4A45A 1YUDA 3PUQA 3KF5A 4JGYC 2R063 1W8TA 4HSLA 5C4WA 2WNUC 2QZ3A 5LW9A 3AVRA 1F8VA 5GM0A 2OQ7A 2D40A 2WN3A 4MUVA 5L7OB 4LO5B 3BKZA 5CG9A 2I45A 2AEYA 1UY2A 5FLHA 1SLCA 1UD1A 2JKBA 3HOBA 1MS8A 4XUTA 1S0FA 2Z5WA 4RHV1 1XYPA 1GP5A 2PHDA 4IQPA 2XLFA 3OGGA 4V1PA 1JYNA 4Q4Y1 5GZCA 1XNAA 3ZSKA 1MS3A 2SLIA 2YV8A 2D44A 2EAAA 3M4FA 4HXCA 4Q8LA 5DABA 4QKFA 1CGPA 2XH6A 2XJVA 5IT6A 4Y5TA 4JKMA 1QJX3 4K20A 1JS9A 1O3TA 4QX8A 3VBOC 2ZS6B 3LFMA 1POV3 1ZZ9A 4IESA 3RWKX 2B39A 2VCBA 4XMAA 3M7AA 4KBZA 2L9LA 5FYTA 4XETA 1XYNA 1PZ7A 1L7LA 5EXOA 1K5MA 2DWRA 2F6BA 3BIWE 4UW3A 2DVGA 4QPGB 4QMAA 2C26A 1LR5A 1W6MA 2D97A 3R05A 1GQHA 2IFWA 5J7MA 4AW7A 1XU2A 2WINB 4WM7C 5FY5A 3UT0A 1S0IA 2PLV1 3ZFFC 4YM3A 3B3QE 3LDRA 4Y24A 3WOGA 4M3CE 5HCHA 4LBNA 1N47A 1X82A 4XQ4A 2W1QA 4BMEA 3RGBA 4L11A 1E5IA 3LEKA 5I0TA 4N43B 3VZOA 4CCDA 5H9SA 5HCFA 2ZX0A 5A32B 3ROUA 1CVNA 3O1TA 2H6BA 3KB5A 2VUJA 3KWVA 3H8XA 2YY1A 4AEKA 3ZN4A 4P9WA 3ZLIA 3C7FA 2JG8B 1CIWA 1TG7A 2E32A 2JXAA 3POFA 4XJUA 3H42B 4D0QA 1PGSA 5A6XA 3KCCA 5JOZA 1UZZA 3MIHA 1C1FA 2ZGQA 5FY4A 4LUMA 4NPRA 4A4AA 2ATFA 4V2VA 1PZ9A 2RS31 3WG3A 5FAXA 1RUD2 3WNMA 1ONAA 5F5QA 4BQ4A 4WVZA 2YC2A 4CEYB 2JD9A 1RL3A 2P34A 2WN2A 5A3LA 3JBG1 3WNPA 5IVCA 1RUE2 1G9DA 1UU5A 3FHAA 3SISA 2WUHA 3HPNA 1VJ2A 1ZREA 3NV2A 1NZIA 1NA1A 2E51A 2YHJA 1DGLA 4UFHA 5FWJA 1EAH1 1RJ7A 4LA3A 4E4DX 1RITA 1PMIA 2VZVA 2Q30A 4L97A 4IV3C 2JDAA 3A7QA 5DG1A 1ACCA 3VBSA 5F6LB 4CRQA 3F95A 3ITQA 4LA2A 1JZ4A 2GNMA 3SH3A 5K8SA 1WCQA 4RFT0 4Q27A 4YW3A 3O1MA 1PIV1 2XL9A 1OI6A 2GP3A 3LPGA 2GMPA 4XZPA 1HN1A 4O7XA 2R1BA 1OSGA 4XQWA 3C3VA 3X29B 2CHHA 1Y3TA 2IXLA 4HK9A 5DZFA 1WCUA 4UXAA 3V65A 3ZFGB 1J3PA 4Y4YA 1JOPA 5A1FA 1RUD3 1O4TA 2B45X 1FOD2 1GQGA 4XHBA 3RPQA 4COUA 5JPMB 5FZDA 4G3YC 5F6KA 3AX4A 1UOFA 3M1HA 3DPRB 4UFLA 4YGDA 4AEDC 4BCUA 1RUE3 5KWRA 1C57A 2D6KA 2ZGLA 1RC6A 1B35A 2AC1A 1GWLA 4OZOA 1WGPA 1LEDA 2WRAA 1R082 3OEAA 1RUJ2 2BGPA 1G6NA 3BU7A 4MGSA 4P9XA 3QOPA 3SCGA 3A0NA 5F3IA 3BPZA 1NYWA 4AVTA 3VHOA 4JGZA 2GDFA 2EXKA 3OSDA 4BB3A 1REFA 3WG2A 3O1OA 4BQ2A 2WLQA 3O0VA 2VCMA 4I3GA 5C3PA 1M06G 1PVC1 1GWMA 1KS5A 1Q43A 4FTSA 3ZM8A 4DQAA 4UF0A 3WY6A 4YLZA 5FO8B 3VDDC 3I2HA 3EJKA 3MIEA 3N7JA 4DUVA 3CLPA 4XMIA 1UU4A 3VBHC 2D7FA 3WINE 1WMEA 5A7WB 4DPNA 5ANNA 4WM8C 4UW4A 4MGQA 1VAKA 3RZZA 1UYPA 3AMMA 4HOOA 1W99A 3MEPA 4JKLA 2BP6A 2G9ZA 1TZOA 1FOD3 3OY8B 3D6EA 4LTAA 2IXJA 2ZMNA 1PX4A 4W4ZA 2QQPA 3U0ZA 1NLRA 4CU6A 5T54A 4ES8A 1KITA 1UY0A 1X8EA 1V70A 4HVQA 5GLUA 4DNYA 1YNAA 2ZCWA 2PFWA 2Q8DA 1UKRA 1R083 1RUJ3 1PO12 2ARAA 3LOIA 5JXIA 1O3RA 3KCXA 4A7YA 1OH3A 2ZHMA 1BQPA 3NAPB 2EXHA 5L7OC 3O0XA 2J1UA 3OGRA 2C0ZA 3NNFA 4FPOB 5FMOS 1UZWA 3WW1A 3U78A 2DCZA 4UOJA 1HJFA 1JYWA 1SPPB 2ZZJA 3IMNA 2DV9A 3TAYA 5BV6A 1DZQA 3T09A 1GBGA 2RHPA 2EF6A 3ZN6A 4OI4A 2HWF1 5FO7B 1GWKA 3D4KA 5JDBA 1J83A 1UY1A 4LOTA 1UWWA 1YRZA 4XFIA 5F1RA 5EJ1B 3UETA 3R0RA 4TWTA 4P9JA 4L8QA 2YFZA 1CONA 3WNKA 1EV12 3ZR6A 5FPAA 4N53B 2WA4A 3MLLA 2AYHA 2QQIA 2YG0A 2G4IA 2ZGNA 3C7GA 4IE0A 5CYYA 1AYM1 1H2NA 3I59A 3VZKA 5HCBA 4BA6A 2ILMA 3WR0A 1JZ3A 3O12A 2DDUA 2XJSA 3UNPA 1BZWA 1C8NA 1PO13 1JOBA 4QPIB 4FPGA 4Q4X2 1W6PB 2Z79A 3AP6A 3WDTA 3P5BA 3AKSA 3L2YA 4AVCA 2BBVA 4QM9A 3ME2A 4V2WA 1OLRA 4N43C 5BPXA 3L9JT 5B2GB 5G05L 5IHRA 4FP2A 5E89A 5A3PA 4Y1ZA 2FMYA 2VBDA 1NLQA 1Q8OA 2WYSA 4XIOA 5JSPA 3ZFEA 1SQ4A 1J3QA 4PBPA 4QXBA 1WUVA 2BNNA 2J1RA 4E2QA 3M8LA 1QOOA 4LBKA 2I74A 4Q0UA 3WDYA 1KGYA 3MIFA 3ZXDA 2GAUA 2XMLA 2BZDA 2PTMA 5GLWA 3S5QA 5HI0A 4FQZA 2YDEA 3MPBA 5FMBA 2Y6KA 1W90A 3S6PA 4IEVA 3OCPA 3P3NA 3HVDA 4Q1RA 3WP5A 3CNAA 3ZXFA 2BYVE 1JYVA 3B94A 2BQPA 3ZKUA 1QXRA 5L9VA 1IPKA 1EV13 2HYXA 3KQRA 1ENSA 4LO7A 4YZ4A 3KHCA 5K0UA 1W6NA 2C9AA 2FHRA 2PAEA 4LBOA 3HBZA 4HVOA 1R091 1ZNPA 1SLIA 1S0JA 1QF3A 1JYXA 3IN9A 3PJYA 3SMHA 4E4SA 4A3XA 1YCIA 1Q8PA 2D3SA 2P1BA 5AFBA 1WCDJ 3PUHA 2W39A 4Q4X3 4DB5A 4W50A 3BTZA 1R1A2 5T5LA 2JWPA 3VDBA 1KFXL 3K51A 3OB8A 5ACA2 4RS5B 5IVYA 3UESA 5CAZA 5IVVA 3Q9OA 5HXVA 2ZGMA 4FPYA 4GMP3 3E5QA 3JQXA 4P00B 5EJ3A 1BKZA 3AKQA 2IUWA 3BODA 5FZBA 1MS5A 4JHTA 3POYA 1KJRA 1S0BA 2NQYA 5FP3A 2ZHNA 4NUBA 2Z4FA 1ASJ1 2Z2SB 4XACA 1VE0A 1X9TA 2W87A 3DPRC 3J8F2 4DIQA 4KWUA 2OKXA 5IATA 4OCTA 1SBDA 1TVGA 2C6SA 5A3NA 3SEPA 5FBZA 2VGDA 1YYNA 2YC4A 3BB6A 4D7SA 1KJLA 4CA9A 4K40A 1I5ZA 2ET7A 3LB9A 3ZVXA 1Z78A 5A3OA 1ZBE1 1NCQB 2W1WA 4HPKB 1CAXA 3ACGA 5CIRA 1NCRA 1CZTA 4HVRA 4JKKA 4ZY9A 3MF9A 4NHLA 2E53A 1R1A3 1FMD1 1I5PA 3EHKA 1HB3A 3VB9A 1LAJA 1W8UA 1DYKA 2BGOA 1UU6A 3DGTA 4YVWA 5ACA3 5LZ6A 1SFYA 3MI8A 4P9IA 5KHHA 1VRH2 4FPHA 4GA9A 2D6PA 4N7UA 4K1YA 3VBUB 4FAGA 1UY4A 1EUTA 4N90A 5LY2A 1DZRA 1XE7A 4XBQA 1XSQA 2P17A 1I3HA 2W2IA 4O65A 3V0AA 4E8CA 4QKNA 2HH9A 5FFOC 4C1XA 2MPFA 5IAXA 5IVEA 1W2UA 2XBO1 4LJHA 1PGL2 2J1TA 3LA2A 3UV9A 2VR4A 1SLAA 1SDWA 2RE9A 3FLPA 2BVVA 3NKTA 1K42A 2C5DA 2DUQA 3J8F3 3OBTA 4YNIA 4GXLA 3IBMA 4YVSA 4FTEA 4NMIA 1FAYA 4TLGA 3OYWB 3RZKA 3VGIA 4RGGA 5BUVA 3NAPC 5F3CA 2DU1A 1XC6A 4LOSA 5SV8A 4AE2A 1OVSA 1Y9MA 2JICA 1C3HA 5L36A 4ZU4A 1K5JA 4ZU7A 3C7EA 3WF2A 3I3DA 1DQ4A 5JI7A 3WF4A 4DXZA 1H8TA 3T3YA 1VRH3 2OW4A 3WXPA 5LWBA 4M4RA 3A0KA 3AKTA 1IOAA 1VLNA 1W0NA 2JDHA 3ASIA 4CXYA 1QJU1 2Y60A 3K48A 3LAGA 4XVHA 3ZIXA 5KXDA 5D1IA 2ZGOA 4YZ2A 1O91A 3PVNA 4NRPA 3BTYA 1DF0A 3VN4A 2VQUA 5FPUA 1ND3A 1W04A 1AZDA 2JEMA 4PDWA 5I0UA 4DO0A 2X5IC 2KXLA 4N53C 1JYIA 1MVEA 1GLHA 3WCSA 5J37A 2ZJCA 1ULFA 3VBRA 4ES9A 5C8CB 2B42B 4MHRA 3LEMA 3R6SA 3VL8A 2WZR2 5LEJA 2Q0AA 4QPIC 1IKPA 1NQJA 1W9WA 3K3OA 4BU2A 3VBRC 3GCWA 2RDNA 4H7MA 4ET7A 1FPN2 5IFPA 5GLTA 3T2PA 4DRVA 1JI6A 2OZJA 2F4PA 3NJVA 4LKFA 4NAMA 2WNEA 3DKWA 4JRLA 5CFCA 5BNNC 3CJIC 3URFA 3GALA 4RSUA 4B4QA 4CDXA 2HWE2 4FSJA 5J48A 4MH0E 3KQ4B 2BRTA 2VUCA 3J26N 1MZEA 4HFSA 4KWKA 4OHYA 1YQ5A 1F4HA 4XFGA 3SH5A 2R1DA 1OLMA 1ZRRA 4KG8A 4IXLA 4XBLA 1JXNA 1UOBA 4MX3A 1ST8A 5FBJA 5EYXA 1UF2C 2G19A 4XQDA 2ADEA 2VMDA 5JOXA 4AOCA 3FFZA 4CPBA 3VD7A 1WD4A 1OOPB 1LU2A 2Q1FA 3GZUC 4LR4A 3HT1A 1KS4A 2LUWA 4IERA 2MHFA 4CPBD 1AR91 3IMMA 3HNYM 1X33A 3A21A 3JD71 4NWVA 4JQRA 2QE3A 1GNZA 3AXDA 2MEV1 2EXIA 1V9U2 1VP6A 2NMOA 2WZR3 5D21A 4DY3A 4ARXA 1HLCA 2V4AA 3BTAA 2B4KA 2GNDA 1QEXA 2JG9C 1FPN3 4YM0A 5A7PA 3UGHA 2VMFA 2CAVA 3ZYGA 5I8TA 2CL2A 4EN8B 1W9YA 3HQUA 1O3SA 2WNUB 4RS5C 2VCAA 4FPFA 1MQTC 2BW8A 2WZEA 4MHUA 2HWE3 2QQKA 1HJGA 1DLCA 5C6CA 5C4WB 2DVDA 1NE4A 2VOKA 3IPVA 1LB2A 1JZ8A 4KMQA 4I0AA 3DF0A 3OBRA 2R041 5KHKA 4Q4V1 1W2AX 2YPDA 3USSA 4W65A 4GH4A 2A3XA 3HIFA 2RMU2 1LGNA 2JDMA 4TTGA 5I93A 2WNVC 1VALA 3PVEA 2QQMA 1LOAA 2VZOA 1OUXA 3BVCA 4AI0A 3H8UA 5FQ0A 2VQ0A 1SLLA 4NN0A 1OA3A 1ZZBA 4YW5A 3WW4A 3KD4A 3RZHA 2D3PA 1V9U3 3MW3A 4DXSA 3ZDVA 3IAQA 1NCQC 1BCXA 3MBWA 1C5HA 4AEMA 1IS4A 2ZAAA 4E4ZA 4CTEA 1OURA 3NWKA 5JIAA 3WEZA 1LHOA 4QD2A 1UCXA 1VIWB 2JIJA 1JODA 4LEJA 1PMHX 1W6MB 3MZHA 5GLZA 2J1EA 2YBPA 3LZZA 1BBT2 5J3UA 5F5AA 1PK6A 1NOVA 3AFGA 5C9AA 2ZGSA 5BNPA 4AFDA 5IW0A 2JIGA 1UL9A 4ZHNA 1RUC2 4IGPA 2J7MA 2TUNA 3GXUA 4XTPA 2F4LA 3TB0A 1QJX1 4XCAA 4FQ4A 1CZSA 1PO22 3ZN5A 1MS1A 2BDRA 3BI3A 3AKPA 3SLIA 1AR72 1LJ7A 2RMU3 1VBC2 4YFWA 2JDKA 3B93A 1O3QA 2PHTA 2JB8A 3ATGA 1Z7S1 4BIFA 2CU5A 5FP4A 4UT5A 2AREA 4CE8A 3WDXA 4META 2K46A 1OKOA 4RR3A 3IDCB 3WT3A 4HN1A 1UMIA 1GANA 1UKGA 2XPJA 3K2OA 4CDWA 3H0OA 4DUWA 3ZYPA 5DAVA 1VR3A 2XJPA 1MS0A 5JIUA 4LIVA 1WW6A 4GB32 4O9GA 1W6OA 5H9QA 3WNNA 1OLQA 5JZGC 5SV5A 1O6UA 3CBNA 2QQNA 1OA4A 3LCPA 1JU3A 5CZKA 2A6XA 4R9DA 1NXMA 1ZZ6A 2P3IA 3I3EA 1NA1B 2Y0IA 4N9IA 4NAOA 3EBRA 4GALA 4NRMA 4XXAA 4QPWA 4R4ZA 1BBT3 4IV3B 1W9TA 5LEKA 1W39A 3DXTA 1FNZA 1YQCA 5LRRA 1W9FA 5FIXA 4QDQA 1RUC3 1NE6A 4XFHA 2GH8A 1QJY1 2PHLA 4O61A 1PO23 5DDJ2 4RYDA 1QQP2 1ZRFA 1PVXA 1US3A 2YPJA 3C7OA 5CKQA 3T2TA 4BQ5A 1AR73 1MEC1 4AFMA 1Y9QA 1IPSA 1VBC3 1QNYA 2A70A 4M01A 2FMDA 3DCQA 3FUOA 4NO4A 2XWBB 3UKVA 3E97A 1EPWA 3NW4A 1XNBA 1CN1A 4MVTA 3I3QA 5C8CC 2CDOA 3K4AA 2Q5TA 1DQ5A 2FCUA 4AFAA 3CZUA 3VKLA 4WVMA 4IE7A 4COZA 4COWA 1ULPA 5LATA 5EP9A 3HD8B 4KGQA 2BWCA 5FPXA 2JE8A 2ZGTA 4GB33 1LOFC 4X8PA 5D8AA 1ODMA 1GZWB 1GNYA 5T5JA 5F39A 2W68A 4TSVA 3ZXKA 1CZVA 4E4HA 1B35B 2Y38A 3AYEA 1C4RA 4KNCA 1DYOA 4BMBA 4ITCA 4OVEA 3BU0A 4BK4A 1DG6A 1WMFA 2RS12 3TWIA 1AL0G 2WWSA 4JGZB 1RUOA 5A7OA 1LENA 4ZXEA 3TNQA 3UKTA 4P9GA 2ZKLA 5FZOA 1AXZA 3VDDB 3WZ1A 4NHMA 1AYN2 5DDJ3 1OFNA 1QQP3 5AC92 3VBHB 3D8CA 2J42A 4UF0B 4OQ8A 3RI9A 4F7ZA 1RUG2 2XVKA 5CU1A 3S7EA 3ACHA 4N7IA 1UYXA 3PU3A 1QXJA 1A8MA 2WA3A 4HONA 4M0NA 3VHNA 4XF9A 3E6DA 1X9PA 1TE1B 4OHVA 4PF5A 4FFIA 4FBFA 3Q8AA 4Y26A 1HXS1 2XJTA 5C7GA 1VBE2 1SDDB 3CQOA 2VU9A 3HN3A 3RS6A 2LS6A 3ZXEA 1REDA 4B7KA 1AUYA 5HPOA 4QWNA 3S57A 4IETA 3S5AA 3LA7A 4MO3M 1Q3EA 1W3XA 2WAAA 5DXDA 5C4WC 1RVF2 5T5PA 2Q8EA 4UFKA 2RS13 4A7ZA 4I0BA 3A4UA 1WBLA 2WBKA 1D0GA 1NKGA 2Z42A 4S2DA 3WD5A 3JU9A 1AYN3 3ZX7A 5LY1A 3Q8BA 1AR82 1ULDA 3GBFA 1FOD1 4LHLA 5AC93 3ZYRA 2QQOA 1DP0A 1GMMA 1RUG3 3AVSA 2R30A 5EV7A 4PIZA 4NIGA 2X10A 3TEYA 2BGCA 5L73A 1K12A 1MR5A 2VMEA 3HQRA 1RUJ1 3MUZ1 2BOIA 4MXVA 4LO4B 4NROA 3U4XA 1RHI2 1UPSA 3RVHA 2XVLA 2HBTA 1S0GA 3PUIA 1J84A 1F35A 2UYBA 2HEYF 1JTZX 2UY9A 1H6YA 4ATFA 5FZ4A 1S1AA 2X8KA 3T1MA 1AXKA 4B1LA 4BXSV 1K5MC 4BM8A 1PMJX 1VBE3 1RJ8A 2JX9A 4Y5SA 1FX5A 2VECA 2Y64A 1AHSA 3K46A 4QQ2A 3ZPOA 3I2FA 1TME2 1ULGA 2FQPA 1F5JA 2A1XA 4OQ9A 1OPOA 4AGVA 1RVF3 2P2KA 3RRDA 1G86A 2QVSB 4QX5A 2A73B 1DIWA 1H1IA 1RUI1 1VBD2 1WZXA 2R0HA 4QPYA 4EV0A 4XFBA 4LQRA 2HWB1 3HMYA 2WDBA 2RDSA 2D6MA 4YW6A 1AR83 4IL7A 1OPMA 4LKDA 3KMHA 3CL1A 5A6ZA 2JECA 4CEWA 5FZEA 1D4M2 5FZLA 4JVAA 2K2SA 5FMOL 4E27A 2VZSA 3GJAA 3TRSB 1L3JA 4Y1YA 5KXCA 1IHMA 1YFXA 5LK5A 1UZVA 3THTA 1YLLA 5FTTC 4IEZA 2A71A 4EN0A 3VBFA 3OPTA 1RHI3 3QACA 4LBLA 4B1MA 1WKYA 4HT1T 2HEVF 1RMU2 2B5HA 4XCBA 4Y22A 3S30A 4CCNA 2EIEA 4B29A 4DRRA 1LOBA 2BFUS 1IGOA 3EYPA 1NG0A 3H9AA 4GWMA 4CZSA 2W46A 5FREA 4NIHA 1W6NB 1X36A 4YW2A 1HRI2 1CAUA 1NA1C 1QU0A 5E8AA 3THDA 4BOWA 5FUPA 3AL5A 4Y1XA 3THCA 1W8FA 1TME3 3E1F1 3GBGA 2ERFA 3RYRA 2HWC2 4X6RB 3ACLA 2XWJB 3LKJA 2J1VA 5FPLA 1IZ3A 2XQXA 2VOXA 3VBSC 1VBD3 3LOBA 3USUB 2WFF1 5FK7A 5FXWA 4JV4A 3W58A 1W03A 4HETA 3U1XA 3POSA 4IEXA 4Z82A 2DTWA 1D4M3 2A6WA 4GD4A 1YO8A 1XJAA 5FLJA 1XPWA 1Y7BA 4RQPA 1COV1 3WW3A 1AR62 3AYDA 3RMYA 4DEVA 5LRSA 4LK6A 5A3MA 4Q4W1 2Y6GA 1LNSA 2VNRA 2ZOEB 3WW2A 4OHWA 1GFF2 3GYDA 2X05A 1V6MA 4MGZE 1RMU3 1HDKA 2E26A 4Q2FA 1UW8A 4RN5A 2YU1A 4QU2A 4FFHA 4Q0PA 1B35C 3IT8A 2FDKA 5FOBB 4XUNA 4LLFA 3ZMNA 1HRI3 1W2TA 2V09A 1OQ1A 5JMCA 4FOQA 2FZ2A 3WF3A 5JUVA 2OT7A 4LLOA 5H9PA 4K3UA 2HWC3 4JGZC 5FZHA 1CAXB 3ZOIA 1SMVA 4QQHA 4PHZA 2R7EB 5JCTA 1J3RA 4AI3A 1W8WA 2VOTA 3ZR5A 5JVVA 3H1MA 5AFEA 5A33B 3ELNA 1DQ1A 2ZKNA 1LODA 3RMXA 2DUOA 3ZSMA 4EROA 5ANQA 5HCAA 1H8VA 3D82A 1AR63 1F4AA 1S2KA 2AH2A 2VZUA 3NKGA 4HL0A 1GICA 4GKYA 3CMGA 1LHNA 4RGAA 3RNSA 5C33A 2ZTNA 3HT2A 2DU0A 2EXJA 2ZGUA 3AZYA 2FCTA 4J6GA 1EUUA 5D2AA 3H7JA 3KVAA 4HSJA 3T0BA 2E7QA 2VZ1A 3BOPA 3ECQA 4YZ5A 5DAQA 1UIKA 4Q0VA 1RUF1 2TNFA 5FYBA 3JCIA 2O1QA 3NQHA 5CKMA 1LHWA 5G04L 2WS91 1LECA 3DV8A 1OBNA 2UWBA 1GNHA 1YWKA 1ZVFA 2RS32 3WV6A 4C0HA 3VDAA 3ZYFA 5E16A 1HRV1 5EFUA 1XXNA 4H14A 3I97A 1ZBA2 1H8TB 1XE0A 4QXKA 5FPBA 4BPZA 4D6SA 2ZXQA 4FTBA 2ZABA 1LU1A 1T2XA 4RD7A 1Q8SA 4N8MA 2CWSA 1ULOA 2VBBA 1O4YA 2YC0A 1S0EA 3GGLA 2X5IB 5KC6A 2GALA 3FLTA 2A6ZA 2PAKA 5FYCA 3GF6A 4NPMA 1G8WA 3ILFA 4PDWB 4Q1PA 2BU9A 3CZJA 4BJ0A 1GQPA 3I2DA 1ZYBA 2ZEXA 4GWIA 5I0SA 2GC3A 3N9MA 3VBRB 1UMZA 3B69A 1W8OA 3TN91 4M0HA 1JHJA 3KGZA 1XQNA 1PIV2 2VO5A 1Z0HA 1G9FA 4XAAA 4CUGA 3OUJA 4R9BA 5BNNB 4QPGA 5T55A 3CJIB 5GKAC 4OI1A 1QJEA 2Q1ZB 5DUXA 5F3EA 2W5FA 4KU7A 2VPVA 4BQ1A 2RS33 4LITA 5KXEA 5GLVA 4YYOA 4Y1UA 3OGSA 1J58A 3ILRA 4CDXB 1SACA 2XUEA 3Q8FA 5F5IA 5IJRA 3ZFEC 4QXCA 2DBNA 1ZBA3 2WT2A 3NV3A 2X53S 4FXKB 1BVVA 4EJRA 3P6BA 1RGSA 2EALA 1YIFA 4P02B 1G9CA 3O1VA 3E5UA 4XILA 1YC61 1VBA2 1D4VB 2IVJA 3WDWA 1H2MA 2ZGPA 1YFYA 1AX1A 4UWDA 1T6BX 1NQDA 4CU7A 3RSJA 3H7YA 5CFDA 4XABA 5EIYB 1OHFA 1QHDA 1XE8A 2JG8A 1SLBA 4DS0A 1BMV2 1H4GA 2WKKA 3TEXA 4NPLA 4FVVA 4OUMA 4DEQA 3H3UA 4R8HA 1W0PA 1SCSA 4BYYA 4QKBA 5K0UC 4W6YA 1IS3A 3DYMA 3ON7A 2A3WA 3ILNA 3Q8CA 4EN9B 5A7QA 2DCKA 2VOWA 5F5CA 3HAGA 3LF7A 4AHYA 1E5SA 4LIUA 2JG9B 1X7NA 1OC1A 4XW3A 1PIV3 2NLRA 2VMCA 3I54A 4XJAA 3DN7A 4JDOA 2W0XA 5CNAA 1UYZA 2VD7A 5FJHA 2BTVC 1PGW1 4TYSA 5FZ3A 3MYXA 1MQTB 2JDPA 1W28A 2FD8A 2RR11 5FWEA 5FJKA 2W52A 1U5XA 3W20A 4A42A 1NAEA 2AGSA 2WO7A 4I02A 3VHPA 5LA1A 1Y4WA 4XOGA 3WQBA 1QH7A 5IVJA 1LCLA 4C1WA 2XGXA 3O7OA 4QDRA 3PMEA 3N9OA 1VB4A 3GNEA 1VBA3 2ZX3A 3FX3A 2WR9A 3MO4A 2WNVB 3UL2A 2PHWA 4EN6B 2V5DA 1GZ9A 1C8M1 2W1SA 4GH4B 4GWJA 3SEEA 4HMZA 1W2OA 3PVBB 4HG6B 1JBCA 4UI9L 2GC0A 4FT8A 4MV2A 2VW2A 3BYWA 5FR3A 1REEA 4XF1A 3ZIWA 4JHZA 3ZFGA 1XNCA 3F2ZA 1T6GC 5FMCA 3FWEA 1DFQA 3N9PA 3T1LA 2W47A 5AVAA 5DAPA 3ALQA 1CR7A 5FQ0B 1SFNA 3LWCA 4E2GA 1WLDA 2WT1A 4J1XA 1UYYA 4C90A 3A22A 3LEGA 4IEPA 2QQWA 2VCCA 1SG3A 1TNFA 1TMF2 4L92A 4LKSA 2CGOA 2AR6A 2RJLA 2Q8OA 1NCRC 3WNOA 1O5UA 4J25A 3WLUA 5GALA 3APBA 4B8EA 1HV0A 1QJZA 2XDVA 3SCFA 4OHZA 4GZ9A 3D0JA 1CQ9A 2NYYA 2B9UA 4YRDA 1S2BA 4YVWC 1FYUA 4OHXA 1FATA 1MZFA 4NE9A 3ACIA 4SBVA 1BEV1 3ST7A 3WVJA 5BNPB 1MZ5A 2ARBA 3ZYJB 3HWJA 1AYM2 2E6VA 2VTXA 3V56A 1DGWA 2Z69A 4EE2A 2RS51 1NX9A 2XQRA 4AAXA 3R4UA 3J7LA 4AWDA 4RA0A 3O1RA 4Q5OA 4CYDA 2NZ9A 4YM2A 2VNGA 3AJYA 1WW7A 3B7MA 3G6JB 3MHZA 3RQ0A 4ORFA 4OZXA 1D2SA 4AQ2A 1YQ6A 1D2QA 4AVSA 1L7QA 2YB7A 3POWA 4KL1A 4YVSC 3ES1A 3N7LA 3ZPYA 1W8ZA 4CDWB 5F8PA 2W9XA 3RYKA 4H7LA 3AJZA 5JZGB 3MLKA 4WVVA 5FPZA 4EWDA 2DVAA 2JB4A 2FDGA 1TMF3 1W6OB 2BNMA 4GAZA 2RM21 4Z92B 4QX7A 1H4HA 1YI9A 4CCEA 5KHIA 1A34A 2HYKA 3HN1A 1VPHA 2VJXA 3AMNA 4XJWA 1WW4A 3V0BA 1YJLA 3MW2A 5FV3A 3ZSEA 5ABJA 1G9AA 1HN0A 2G1MA 4NHYA 3DYOA 3NV4A 1H8TC 1ENRA 3LD8A 4XHXA 1IQDC 3PHMA 5FZ7A 5TSWA 2XG3A 5EHDA 2NP0A 2XKOA 5I8YA 2CV6A 2W92A 5KHJA 1AYM3 1R092 5F2WA 1BVP1 1ND2A 1ZRDA 2OYZA 4B7EA 4R4XA 2VVFA 3MPPG 2QTWB 1ALYA 1J1TA 2QJVA 4QHOA 3AZWA 3RZGA 1ND3C 4SLIA 4PDWC 1JYCA 2FCVA 3AL6A 1UXXX 2D5FA 5DUVA 2NMNA 1RYYA 2OPWA 3VZMA 4NIDA 2WQ8A 5F3GA 3PIGA 4C91A 2EAKA 4H2AA 3PJQA 1CAWB 1GYKA 4E2SA 1VBB1 5T50A 2PHFA 2VL4A 2F17A 2YYOA 1C5IA 4ISQA 5CFCC 2P5BA 2CSGA 2GC2A 3AC0A 1QMJA 4A6OA 4CDXC 3POIA 1ASJ2 2WSVA 3J7NA 1W6PA 3MDPA 4K21A 2IZWA 5FP7A 3QH7A 2RV9A 4DZGA 4LT5A 3VUOA 1JUHA 2VE1A 5KC5A 1J59A 2DF7A 1OFSA 1R093 1UZYA 3AP5A 4UFMA 3AMPA 3POJA 1HQLA 3SC7X 2GP5A 2W08A 1LTEA 1ZBE2 2J22A 3HEIA 1W6QA 1O5LA 2A3YA 3UGGA 5DN2A 4GB31 1QOSA 4LE3A 1PM7A 2DCTA 1FMD2 4N9HA 3FN9A 3AP4A 4BDVB 4M3CF 1CJPA 1UZ0A 2ZHKA 4K9SA 2WYFA 1FXZA 4IEOA 3N7KA 4ZPIA 5FZGA 3WUDA 1NXD1 1DYPA 4CXWA 4CUCA 3FUQA 1OF3A 2VTFA 2YBSA 5LBBA 4QX0A 3WQ0A 4QQPA 1FNYA 4COVA 4IV1A 4XFFA 4A41A 2ZA9A 2R072 2DCJA 4Y33A 3WP4A 3S0MA 2D6OX 4JAAA 1JW6A 4FPEA 4U36A 1AX0A 1S4CA 5ISLA 2A6YA 4FP3A 4CCMA 1KQRA 2PHRA 5DDJ1 3SH4A 4AG4A 1QQP1 5FZ9A 4BQWA 3BALA 1ASJ3 1M4WA 3POGA 3M70A 3MICA 3T30A 4LK7A 1I6XA 4JTOA 4JDNA 1QOTA 4G9SB 5FP8A 5FZAA 5GZEA 3MFAA 1AL22 3FJSA 1QH6A 4PF1A 4P14A 2EICA 5FZ1A 3FL7A 3N36A 5A1AA 3ZSJA 4X6QB 2DURA 5CBLA 1MACA 4GH4C 2XXZA 1OD5A 1ZBE3 4XDQA 4XUOA 2Q1MA 2CGPA 1RTVA 5IUQA 1AVBA 2JDZA 3KM5A 3NSTA 4QB6A 4ASMB 1FMD3 2R061 4OUSA 1KXGA 2B7YA 3WP3A 4XFCA 4NHXA 3DECA 4XJ8A 5JXJA 4RFRB 2H6CA 4AHZA 1GZCA 3LGRA 3KS7A 2GN7A 3LIHA 5IK5A 3SHRA 1RUH2 3NJZA 3KSCA 3T4VA 1FT9A 2TBVA 1K5MB 4QGMA 4AFCA 4EZ4A 4IUGA 4AGGA 1AX2A 4YWAA 2QDRA 4QHBA 3J4UH 1QJU2 2R073 3FBYA 3RG0A 2W3JA 2OIIA 3PLQA 3OPZA 2O0OA 5LASA 4OI2A 4BK5A 1I9RA 3OTFA 2Y6LA 4HPKA 5A3UA 5C5UA 3NJXA 1PK6C 5C9AC 1H2LA 1VRBA 3WF1A 4CCLA 5BNPC 4JTNA 3VKMA 3LEIA 4GQ7A 2KA3A 1RUG1 4S2GA 1W06A 4XAEA 3UGFA 3VDCA 5KHGA 1AL23 4KWLA 1POV1 4C8DA 2VXRA 5DAXA 5FZIA 2WC2A 2ZGKA 4R9AA 3THPA 2D6LX 1HQNA 1HV1A 4FOVA 1VMHA 2OVUA 3GHNA 5KBFA 2VZPA 3VBUA 5IK8A 4Y20A 4KBBA 4I0WB 1ZX5A 3OGJA 3H3ZA 4GWNA 1KDMA 4DY5A 4XC9A 5A1LA 2EIBA 4CEWB 1TQ5A 1VBE1 3B5LB 4LHSA 1YQ2A 5LA0A 4RR3C 1BK1A 4D6RA 1H1AA 5J96B 4FOYA 3ZXJA 4CDWC 4ASKA 2VQAA 1W3VA 1RUH3 4CP1A 5LB6A 3NO8A 2JJ6A 2XR4A 1E5HA 4GJYA 2LTNA 1V0AA 3VV1A 4ZU5A 1LKNA 2IXIA 2XONA 1QJU3 1YHFA 4Y4RA 3K3NA 1U5YA 5BNOA 3PUAA 4AVVA 4I01A 2E31A 3R4DB 5LCWL 1CAUB 4MGIE 1GKBA 3AM2A 1URXA 1U0AA 5A7SA 4FFGA 3I2KA 3VBSB 3I49A 1TNRA 1QDOA 3D3AA 2GU9A 3JD72 2PYTA 2CDPA 4CP9A 2E33A 2MEV2 3IM0A 3NRUA 3WNLA 4BE3A 1G7YA 5FZ0A 4WZFA 5DPNA 2CTVA 2UYAA 3QBQA 2GNBA 3OD0A 3KGLA 5FZCA 3W21A 2JE9A 3O0WA 2ZX4A 1STMA 2ZAHA 2O8QA 4PI2A 5FY1A 3OUHA 5L9RA 1I1EA 4K7JA 5L9BA 1SEFA 3POEA 4KI5M 5FYMA 2W95A 1NY72 3M3IA 5JPNB 1FV3A 4CDQA 4K6BA 1CIYA 2P3YA 4Y5Z0 5F37A 5AVPA 2AACA 2VVDA 3FBMA 5FY7A 5D8AC 5C3RA 3SQOA 1XNTA 2H0VA 5A80A 3WDVA 3N9QA 1UNBA 1ODNA 2UY8A 4FAHA 2ZHLA 1KDKA 2YMZA 4CCCA 3T2OA 3TYJA 1W2NA 2YFUA 1IQAA 4IE6A 2LW8A 1YEWA 2VM9A 5FUIA 5K9YA 3IZOA 1GOHA 3INAA 4NIAA 1H30A 1AF9A 2ZZQA 3AZZA 4HZFA 1NZCA 2BNOA 3H8OA 2VOVA 1BLZA 3TOJA 2MNGA 5C5TA 1Q5OA 1RUD1 2BFUL 2E7AA 4CUBA 3JD73 3W9AA 3AKRA 5FKCA 4COYA 2MEV3 2ZBJA 5E1RA 4WBBA 1RUE1 5LA9A 4XF3A 2O14A 1POV0 3I2OA 2FDHA 1YI7A 4KH9A 3N35A 2WNOA 3KF3A 2E7TA 5GJ6A 1WBFA 4LBQA 1JZ6A 3EMRA 4WV8A 4QU1A 4M4PA 2W91A 1OOPA 1JUIA 4AR2A 5A3TA 3VZNA 1GU3A 2KR2A 5L19A 3GBWA 2HWC1 3OJBA 3VKFC 5FZMA 4CSWA 4DXRA 4DOUA 2VNVA 4LBQD 4CDUA 1GOGA 3WP6A 5KXBA 2AUYA 5E88A 4UW6A 5C3OA 4TLFA 4YM1A 3P3PA 4CDUC 1L7RA 4EYUA 4CCKA 1UOGA 1BHGA 4Q8KA 1Z7S2 4ASLA 3HNMA 4JRAA 4JGYA 4LBJA 5CG8A 2EIDA 1PX3A 2WNUA 1U5ZA 4KGGA 3LDBA 3IB3A 2PMWB 4U2AA 1AR61 4L99A 3I8TA 4M3CA 1N3PA 5DG2A 2YZ4A 3ZN6B 2RVAA 1AJOA 1H2KA 2R6QA 3LPFA 4PJYA 4BHPA 4AHXA 4NHKA 3K77A 3ZYHA 3CF6E 3WDUA 2Y34A 1R081 3CEWA 1K45A 4W6XA 1IPJA 2YXSA 3GM8A 4ZS2A 2VZQA 3C8XA 1PNGA 1WCSA 5FXZA 3CU7A 3POBA 2XJUA 3VBOA 1XB9A 3I7DA 2HEWF 4XE9A 1JHNA 3GZTB 4XYXA 2O8OA 1UX6A 2Y6FA 2YUEA 3I59B 4O9EA 4LXLA 1V6JA 4QM8A 1QJY2 4AHWA 1XOYA 3RI8A 4MXWA 3M3EA 1X50A 5IK4A 3JUUA 2WAOA 1DBNA 1MEC2 1LULA 4QHZA 1BJQA 3S7IA 3U4SA 3GJBA 4BIOA 2ID4A 3FHQA 2RDQA 1Z7S3 2DYCA 4LUKA 4XEZA 4WM7A 4YZ3A 3B01A 2WABA 3ZFFA 1JYTA 5A6QA 1SBFA 2WO3A 1N1SA 4AI2A 3K75B 2IWGB 3ZFEB 1UIJA 3O1PA 1H1MA 3BTXA 3FE5A 3TEWA 4OI0A 5EWSA 4QX2A 2FZ1A 5BXXA 2HJIA 2QQVA 2VUAA 3AK0A 2VW0A 2X29A 1DQ6A 2NPIA 4CEWC 2K9ZA 2UU8A 2DTYA 2PN5A 1PO11 1H9PA 1XNKA 2UWCA 4UFJA 1ZA4A 4KU8A 5DMYA 1H9WA 2CGNA 2E63A 4TZDA 5F2SA 1N3OA 4URTA 2VG9A 3BOWA 5EYYA 5CFDB 3UJOA 4XUPA 3VBFC 3LDKA 2Q8CA 5K0UB 2RJKA 5T3NA 2HWD2 2RDRA 2HBUA 1MS9A 3U11A 2GH2A 2OA2A 1UO9A 1QJY3 3T2QA 1QY4A 1V00A 2G9GA 2G9FA 1FI2A 5LK7B 4Q0QA 4XZUG 3ACFA 1TEIA 1MEC3 4D3WA 2DUPA 2KM2A 5FXXA 2D3RA 1ZBA1 4Q0SA 3CIHA 2FDJA 3DXUA 4LPLA 1IG3A 2GSYA 3VD4A 3SNMA 2IXCA 2VUDA 1OVPA 3KT1A 3QH6A 3I2JA 1CAVA 2VULA 4IDZA 4UAPA 5HXMA 4YG0A 3J9SA 4IV3A 1EV11 5HV0A 3WNXA 3W5NA 3OEBA 5B4NA 4CCOA 1HXS2 1DDLA 4S2FA 2IXHA 2XJQA 3HQXA 4HANA 5FZKA 1US2A 3AB0A 3WHUA 3UJQA 5JXGA 4HKOA 1ENQA 4RQPC 3N9NA 1F9KA 4BZ4A 1IKQA 1JN2P 2WO1A 3HR9A 3JQWA 4ZXKA 4QB2A 4Q4X1 4D6QA 4ZKTB 3PTRB 4KWJA 1OF4A 3SCHA 4RHV2 2C9KA 1JZ7A 2JDYA 2HWD3 4Q4Y2 1UOJA 1HIXA 4LO8A 2JKXA 4D69A 1FV2A 4PLOA 3TNPB 4AEDA 2FDIA 3VD9A 4AZZA 4GMP1 5J36A 5CKNA 1WLTA 4NR1A 5HBAA 1NCRB 3AZVA 1EPZA 1GZWA 2HKXA 2VH9A 2XL7A 4MZUA 1WD3A 2B8MA 4YVWB 2Y0OA 1E57A 1VBA1 2VW1A 4EWEA 2ARCA 4MG2A 1MZ6A 5J09A 2OQ6A 3ES4A 3DKQA 4EQVA 2AENA 5IK7A 2ET1A 4BLJA 2C1FA 2Y33A 2K0GA 2XLGA 1HXS3 3AP7A 5CADA 3V0AB 1BMV1 4ZS3A 2PLV2 4F8AA 4H3WA 4QGNA 3RDIA 3VDDA 2Y26A 2DVBA 3CKHA 3L2HA 3ZSLA 1KEXA 4YPJA 2PA7A 3HBKA 3VBHA 3VZLA 1CX1A 1YFUA 2IC1A 1RUNA 4WM8A 1RXGA 2VXJA 5APAA 2PXJA 1S0DA 1UXZA 4MGTA 4ZONA 1W8NA 2WT0A 3W59A 1R1A1 4HKWA 2NM1A 4DUXA 1WA4A 1F31A 4RHV3 4CXXA 4A2UA 1RUI2 5ACA1 1MVQA 4Z07A 4Q4Y3 4YVSB 3H8RA 3O1UA 2HWB2 3IDBB 3LIGA 4LNVA 4YG3A 1EP0A 5JSOA 5DZEA 4B4PA 4NWWA 4P08A 1GP6A 3DYPA 5FP9A 2OXBA 4AEJA 4YW4A 1Q8QA 1CWPA 1QNWA 1UN1A 2EIGA 4PT6A 3OF1A 5IAVA 3B00A 1WMXA 2BOJA 2LRPA 4MGKE 4AK3A 3I3BA 2R0FA 5I8SA 2UWAA 3JBG2 4YGBA 5L7OA 4K8RB 1XBFA 4QAWA 3V0BB 3N7MA 1DQ0A 2Q4SA 2CAUA 3J8F1 4MOAA 5ABJB 5FYIA 4D94A 2XB6C 4UBGA 3VL9A 4AQSA 2XUMA 5FLIA 3U14A 2RJ2A 3AYCA 2PLV3 3I4IA 4BLIA 5JOWA 1EAH2 3WQ1A 5FOJB 2GMEA 4LE4A 4Z1VA 2PAMA 4OMDA 1ND2B 1JZ2A 1ND3B 1DGRA 5LBFA 3K4ZA 2OUHA 3AFKA 3Q8EA 1OT5A 2VBPA 3OBAA 1LRHA 3RZMA 4URAA 4NVPA 1TMF1 5FKBA 2E9QA 1RUI3 4IW3A 3PNAA 5FPVA 5FYUA 2HWB3 2WFF2 3MW4A 3WSOA 3IDEA 1A8DA 1VRH1 4E9KA 3WX5A 5FXVA 3MUY1 1O7FA 4FPJA 5I0DA 2PELA 2ZEZA 1QDCA 3KV5A 4Z2WA 5FYZA 1O8SA 1DLLA 1CD3G 4YGCA 5CFCB 1OQDA 2JDUA 4QPGC 3VKNA 4CU9A 1COV2 4XJZA 2A75A 3SKVA 3D0SA 4GMP0 4YW7A 4DMIA 4F83A 2ZEYA 2BPA2 3ZXAC 4Q4W2 1PGL1 5FK8A 3JBG3 4QX1A 3U10A 3P1IA 4Y1VA 1UY3A 3O5SA 5J98B 3DEMA 4N43A 1WLWA 2WZPP 1PM4A 4Y3OA 5CEHA 5A32A 3O1SA 1ZZ8A 2DVFA 3MV01 1DQ2A 2KD7A 2ORXA 1D0HA 2OZ6A 2VQTA 3FFQA 2J1SA 5ERLA 4BXFA 5K7PA 1EAH3 1UAIA 1YXWA 1V6KA 1OUSA 3WUCA 2YGLA 3H1YA 3M2MA 5CFDC 3I2GA 5IVBA 2B9VA 2BEOA 2JG8C 1PVC2 1W6QB 2ZACA 2ZGRA 1XSRA 4GIQA 1ZRCA 1IS6A 1HQWA 3GDBA 4CEYA 4GJZA 4E8DA 4LBMA 5E6HA 2WFF3 3OGVA 3E5XA 3N9LA 1G9BA 2A5ZA 3RZJA 4CEYC 1QXPA 1U5IA 1BYHA 3SITA 1E5RA 4YG6A 1A78A 2XHNA 3FMGA 4UYBA 4IV1B 1J1LA 5FUNA 3WQ7A 2W94A 5F32A 3EB7A 3QCWA 3M3CA 1COV3 1IG0A 4XDPA 4LORA 2ADDA 1GOFA 1JZ5A 2RG4A 1O8PA 1OA2A 4Q4W3 2WFPA 1R64A 4BWOA 5IVFA 3IPVB 2ZEWA 5C70A 3N4MA 2VZRA 3HJRA 1MPXA 4GULA 4NOTA 2DFCA 1N3QA 4WZCA 4RGKA 2WZR1 3USUA 4AGRA 3DL3A 2QBXA 1B09A 2BBAA 2ARXA 1RUF2 4PQQA 3H3LA 1H0BA 1FPN1 2WO2A 5J1XA 3QLQA 1JU4A 1DGWX 2UURA 2WS92 1PVC3 5A70A 4TXWA 5FZFA 4BQ3A 3ZFGC 2HWE1 1DCSA 1HRV2 4YFZA 3DPRA 4PLNA 2ETEA 2HWF2 2XHKA 3ETQA 1HB1A 5C8WA 2JE7A 4UFIA 4B3NA 4YARA 1ZZCA 2OX0A 3B02A 2GC1A 4FOWA 1IS5A 1CPNA 5K4LA 3VD5A 3RJRA 1A3KA 2C24A 4AI8A 1HX6A 2CY6A 3G7DA 4OMCA 4QGLA 5A3WA 1W05A 1PK6B 3AMQA 5C9AB 4JZRA 4JCKA 3KZ4C 1DHKB 5T52A 2V73A 5T5OA 3WG1A 3J7HA 4FPCA 5HV4A 3RWNA 1CX4A 4F3JA 1LOGA 2YBKA 1OKQA 4BQYA 1ZZ7A 1QIQA 3NVCA 4M00A 2WWUA 1V9U1 1V6LA 2YGMA 1SCRA 1CJDA 1WLCA 2DCYA 4L2NA 4XF4A 5A33A 3TN92 4UW5A 5A7WA 1RUF3 3LSEA 1JOJA 1N1VA 2QUOA 2VC9A 3FLRA 4AVBA 3JB4C 4Y20B 4R52A 4DINB 1ULCA 2D6NA 4UBHA 2ZMKA 2WS93 3MIDA 4RR3B 2LALA 5FYVA 4OULA 4HKLA 2R071 3OY8A 2DBIA 3GHMA 4LMFA 3JB8A 1OH4A 4XPVA 1QKQA 5A7NA 1ZM1A 4OYUA 3KLSA 2XKPA 2XOMA 1HRV3 4C0BA 2HWF3 5EZWA 2X09A 4AFBA 5I0RA 1DZTA 2D43A 4NIIA 1ZRIA 4X8NA 4QXHA 4ARYA 4PIXA 4DFSA 1KD7A 4YSFA 1AL21 4IGOA 1C28A 3H1WA 1RINA 2RMU1 3NAPA 5FYHA 2AEZA 3MGUA 5BNOB 2D98A 3MLJA 3UK9A 4CUAA 3W5MA 3WF0A 5ABJC 5FYSA 2QQUA 3ABZA 5BYNA 1N1TA 3AMHA 2A7AA 3U07A 3OBZA 1LEMA 1SPPA 1LHUA 5C3QA 1SHWB 3T08A 3D5OA 1UX7A 5BY5A 1UPIA 2QKDA 1VAMA 1ND2C 2J1AA 4QQOA 1CPMA 4CP9B 3AXEA 3GZEA 3KCYA 3LSDA 3PU8A 3TN93 2VZTA 3ZDSA 5FDBA 5F9TA 1RUH1 2Y6HA 3ZXLA 3WCRA 1PGW2 4L0PA 2B46X 4YGEA 2RR12 3NNLA 5DQ0A 2QCSB 4AI1A 1JH5A 3IKWA 5FO9B 3I3MA 1S2EA 1OXCA 2GN3A 1BBT1 4WVMB 3VHRA 1V6NA 2X5IA 3I2IA 4N53A 4MLOA 2I07B 4B4RA 3LE0A 2R49A 1RUC1 4PBOA 5D8AB 1XNDA 3VLBB 4ZZ8A 4AQ6A 5JOYA 1PO21 4CDQB 4QPIA 2P37A 3LA3A 2IXKA 3NNMA 2ENRA 4R9CA 4JX0A 4MGYE 1AR71 2JD4A 3MF6A 2QQLA 4FPKA 3ZO0B 2R16A 1VBC1 1C8M2 2GNTA 3FZ3A 3JXSA 3VZJA 4ZZ5A 4PCRA 4IE4A 4LHNA 5FZ6A 3NNJA 1Y43B 3OG2A 5JWPA 5FRAA 4XDOA 3H50A 1F2NA 1F5FA 3CDZB 5BNNA 2C4XA 3CJIA 4QQLA 1NT0A 4LULA 4Z2AA 4Z8BA 2TEPA 3BUCA 5B4XA 5FZOB 4TN7A 5GZGA 4HK8A 1MS4A 3JZVA 3T0AA 5C71A 4QDSA 3C7HA 4OUEA 2R32A 3MIBA 3PUSA 3OD4A 3UYJA 1XU1A 1QWRA 5DUUA 4AXOA 3VD3A 4I2OA 3IIIA 4IEWA 3EO6A 5FMDA 5C3SA 2HLEA 2FDFA 2RR13 1YQ8A 5H9RA 1PNFA 4D7TA 1S55A 2PQQA 2XJRA 1YJKA 2LROA 4W8JA 1UMHA 2GZWA 4LBQB 5DZGA 1ULEA 3KV6A 3NJYA 3PURA 1BEV2 2CNAA 2W1UA 3BPSA 4MADA 3UKNA 3TBDA 3EXUA 1AJKA 2QZ2A 3MIGA 4HLTA 4IV1C 3BGAA 2JENA 4NJ4A 5FY9A 2A6VA 2PHUA 3U75A 2XBO2 3ZYBA 2RS52 3CHXA 4CDUB 1H6XA 2PQSA 4J1WA 3RFRA 1BXHA 4WVWA 3ZYIB 3IDAA 1C8M3 1UQXA 1OLME 2JG9A 3FHIB 3O14A 3OOXA 4LO6B 3RJ2X 2WQZC 3B9CA 5CISA 3B9IA 2P3JA 3HNBM 4RS5A 3E6BA 5DUWA 5JAXA 1MQTA 2Y6JA 4EWAA 5BNQA 4FO9A 5A6YA 4P5YA 4JDMA 4QB1A 4JGYB 1APNA 3BIEA 2YROA 4LKEA 2ZPXA 3RYPA 3ZXGA 1HB4A 5FZ8A 1Q56A 1QGLA 1WMDA 4PQ9A 3RZLA 1GUIA 4M3CB 1CESA 2BWAA 1NY71 2EVXA 3PMSA 4ATEA 5CA6A 5JXHA 4HN0A 3FC0A 4XXPA 2RM22 1HB2A 2ES3A 5FYYA 2WNVA 1F15A 3PDQA 1D7PM 2ORZA 2WIIB 1HW5A 4H55A 1VB2A 5M0TA 4FXGB 2RS11 4DXTA 3M3QA 2GMMA 1BEV3 3CO2A 3CJXA 1O59A 3KV4A 4KG0A 1GV9A 3VBOB 4YZ1A 1ENXA 4XFAA 2XVGA 1AYN1 2XBO3 4BH9A 1P8JA 2P4EA 4YW1A 2RS53 1NCQA 1XRUA 5AC91 2Y8KA 2YU2A 4MXWB 1LGBA 1GZTA 2IFRA 2WLPA 4XTMA 1WA6X 4ISRA 5GZFA 4CCJA 3PTYA 4K1ZA 1RXFA 3IWZA 4P9YA 4QX3A 2OUJA 3LFIA 4LHKA 4S2HA 1HKDA 1RB8G 1VMFA 3NV1A 2VMGA 3EQEA 3ZFFB 4WM7B 1YIPA 2N7GA 4CVUA 2P3KA 4AYUA 4FFFA 5F7UA 3BN6A 4INDA 4AVAA 3N3HA 3MFCA 1VBB2 3MV11 3PL0A 1WCKA 4W6WA 3SXWA 4P5HA 3VBUC 3WHTA 4AL9A 1LOEA 4CP0A 4JQTA 1W8HA 2RM23 4K8FA 2OPKA 3T4HB 4D7YA 3LQCA 3M3OA 4BQXA 2WWJA 2QNKA 2D93A 4NRQA 5LBEA 3VBFB 3ETPA 1RIRA 2SBAA 2WQ4A 2FBEA 2P6HA 1RVF1 4D8MA 3GZAA 1A6CA 4IEQA 4Y22B 4IGQA 5I91A 2LM3A 2P6CA 3ENRA 2BUKA 2ZX1A 4ONUA 3TEZA 1AXYA 2VY0A 3A23A 3OYWA 1DGRN 3ZMOA 3T0DA 1AR81 1LHVA 1PZ8A 4IE5A 5BNOC 4Q29A 2VAUA 3GCXA 3J7MA 4EN7B 5JZGA 4L9BA 1W9SA 1AR92 2VMHA 1LOCA 2PHXA 3KV9A 1YFWA 5FY0A 2QFEA 1LESA 1SLTA 1V6OA 2VNOA 4Q26A 4IEYA 4AAPA 1RHI1 1CAVB 1VMJA 5FCCA 5KR7A 3DUIA 4PIYA 4EZHA 3KHBA 2QQJA 4HBNA 3WG4A 1VBB3 2AZ5A 5EPAA 4G4FA 1KRIA 3AP9A 2IVIB 2VVEA 4MYEA 4OLLA 4A7KA 4RQPB 5JSRA 5DAWA 4OFGA 5IWFA 4AI9A
chains in the Genus database with same CATH topology
5JI9A 3R4SA 1TME1 2EA7A 4I30A 4XJ9A 2R042 1LGCA 2H0BA 4GKXA 1SBEA 4Q4V2 4ZKTB 2NN8A 1OQEA 2CYFA 3NL1A 3E6CC 3PVOA 3AZXA 5C8CA 2VMIA 4FPLA 5GZDA 1VBD1 4CDQC 2V5YA 1XYOA 2BVBA 1X8MA 2WL1A 1N1YA 1V6IA 4FCAA 4JC1A 1CAWA 2XLAA 1LOFA 3KT4A 1EY2A 4I09A 5CB7A 3AYAA 4XBNA 4AEDB 5JR7B 1D4M1 1AR93 2ZX2A 4IEUA 4AQTA 1R1ZA 2I2SA 4QT6A 1GSLA 4MSVA 2R062 2WSUA 1OMIA 1U12A 3V64A 2QDNA 5JLVA 4RL7A 1RMU1 1NLSA 3QD6A 4I3PA 4AF9A 1WW5A 4P9LA 2HWD1 4KQ7A 1HRI1 1GR3A 1EYBA 1QJX2 2R043 3KT7A 1OOPC 4Q4V3 1VAVA 4WM8B 3IIAA 3VKOA 4PLMA 1DU3D 1KFUL 1C1LA 2D5HA 2ZMLA 2CWMA 2DFBA 2WJSA 4XF0A 1PHMA 1W0OA 1Q8VA 1S0CA 4CP2A 5CVRA 4XIKA 1O4ZA 3BCWA 3C2UA 1YUDA 4JGYC 2R063 4HSLA 5C4WA 2WNUC 2QZ3A 1F8VA 5GM0A 2D40A 4MUVA 5L7OB 4LO5B 2I45A 5FLHA 1SLCA 1UD1A 2JKBA 1MS8A 1S0FA 2Z5WA 4RHV1 1XYPA 2PHDA 4IQPA 4V1PA 2XLFA 3OGGA 4Q4Y1 5GZCA 3ZSKA 1MS3A 2SLIA 2YV8A 2D44A 2EAAA 3M4FA 4Q8LA 1CGPA 2XH6A 2XJVA 5IT6A 1QJX3 4K20A 1O3TA 3VBOC 2ZS6B 4IESA 1POV3 1ZZ9A 2B39A 4XMAA 3M7AA 4XETA 1XYNA 1PZ7A 5EXOA 1K5MA 2DWRA 2F6BA 3BIWE 4UW3A 2DVGA 4QPGB 4QMAA 3R05A 1LR5A 1W6MA 2D97A 5J7MA 1GQHA 2IFWA 4AW7A 1XU2A 2WINB 4WM7C 3ZFFC 1S0IA 2PLV1 4YM3A 3B3QE 4Y24A 3WOGA 4M3CE 4LBNA 1N47A 1X82A 4XQ4A 4BMEA 4L11A 5I0TA 4N43B 3VZOA 5H9SA 5HCFA 2ZX0A 5A32B 3ROUA 1CVNA 2H6BA 3KB5A 2VUJA 2YY1A 4AEKA 3ZN4A 4P9WA 2JG8B 1CIWA 2JXAA 4XJUA 1PGSA 5JOZA 3KCCA 1UZZA 3MIHA 1C1FA 2ZGQA 4LUMA 4NPRA 2ATFA 3WG3A 1PZ9A 2RS31 5FAXA 1RUD2 1ONAA 5F5QA 4WVZA 4CEYB 1RL3A 2P34A 5A3LA 3JBG1 1G9DA 1RUE2 1UU5A 3SISA 1VJ2A 1ZREA 3NV2A 1NA1A 2E51A 2YHJA 1DGLA 1EAH1 1RJ7A 4LA3A 4E4DX 1RITA 1PMIA 2Q30A 4L97A 4IV3C 5DG1A 3VBSA 4CRQA 5F6LB 4LA2A 2GNMA 3SH3A 5K8SA 4RFT0 4Q27A 4YW3A 1PIV1 2XL9A 1OI6A 2GMPA 4XZPA 2R1BA 1OSGA 4XQWA 3C3VA 3X29B 4HK9A 1Y3TA 2IXLA 5DZFA 3V65A 3ZFGB 4UXAA 1J3PA 4Y4YA 1RUD3 1O4TA 2B45X 1FOD2 1GQGA 4XHBA 3RPQA 4COUA 5JPMB 4G3YC 5F6KA 3AX4A 3M1HA 4YGDA 3DPRB 4BCUA 4AEDC 5KWRA 1RUE3 1C57A 2D6KA 2ZGLA 1RC6A 1B35A 1WGPA 1LEDA 1R082 1RUJ2 3BU7A 1G6NA 4P9XA 3QOPA 3SCGA 3A0NA 3BPZA 1NYWA 4AVTA 3VHOA 4JGZA 2GDFA 2EXKA 1REFA 3WG2A 1M06G 2WLQA 3O0VA 4I3GA 1PVC1 1KS5A 1Q43A 4FTSA 4DQAA 3WY6A 4YLZA 5FO8B 3VDDC 3EJKA 3MIEA 3N7JA 3CLPA 4XMIA 1UU4A 3VBHC 2D7FA 3WINE 1WMEA 4DPNA 4WM8C 4UW4A 1VAKA 3RZZA 3AMMA 3MEPA 1FOD3 3OY8B 3D6EA 4LTAA 2IXJA 2ZMNA 2QQPA 3U0ZA 1NLRA 5T54A 4ES8A 1KITA 1X8EA 1V70A 4HVQA 5GLUA 4DNYA 1YNAA 2ZCWA 2PFWA 1UKRA 1R083 1RUJ3 1PO12 3LOIA 1O3RA 3KCXA 4A7YA 2ZHMA 1BQPA 3NAPB 2EXHA 5L7OC 3O0XA 2C0ZA 5FMOS 4FPOB 3WW1A 2DCZA 2ZZJA 3IMNA 2DV9A 3TAYA 5BV6A 1DZQA 1GBGA 2RHPA 2EF6A 3ZN6A 4OI4A 2HWF1 5FO7B 3D4KA 5JDBA 4XFIA 1YRZA 5F1RA 3R0RA 4TWTA 4P9JA 4L8QA 1CONA 1EV12 4N53B 2WA4A 3MLLA 2AYHA 2ZGNA 2G4IA 1AYM1 1H2NA 3I59A 3VZKA 5HCBA 4BA6A 2ILMA 3WR0A 3O12A 2XJSA 1BZWA 1C8NA 1PO13 4QPIB 4FPGA 4Q4X2 1W6PB 2Z79A 3AP6A 3WDTA 3AKSA 3L2YA 4AVCA 2BBVA 4QM9A 3ME2A 1OLRA 4N43C 5BPXA 3L9JT 5B2GB 4FP2A 5E89A 4Y1ZA 2FMYA 5JSPA 1Q8OA 4XIOA 3ZFEA 1SQ4A 1J3QA 4PBPA 1WUVA 2BNNA 4E2QA 3M8LA 1QOOA 4LBKA 2I74A 4Q0UA 3WDYA 3MIFA 3ZXDA 2GAUA 2PTMA 5GLWA 5HI0A 4FQZA 2YDEA 3MPBA 3S6PA 4IEVA 3OCPA 3P3NA 4Q1RA 3WP5A 3CNAA 3ZXFA 2BYVE 3B94A 2BQPA 1QXRA 1IPKA 1EV13 3KQRA 1ENSA 4LO7A 4YZ4A 5K0UA 1W6NA 2C9AA 2FHRA 2PAEA 4LBOA 3HBZA 4HVOA 1R091 1ZNPA 1SLIA 1S0JA 1QF3A 3IN9A 3PJYA 3SMHA 4E4SA 4A3XA 1YCIA 1Q8PA 2D3SA 5AFBA 1WCDJ 2W39A 4Q4X3 4DB5A 1R1A2 5T5LA 1KFXL 3K51A 5ACA2 4RS5B 5CAZA 3Q9OA 5HXVA 2ZGMA 4FPYA 4GMP3 3E5QA 3JQXA 5EJ3A 1BKZA 3AKQA 3BODA 1MS5A 3POYA 1KJRA 1S0BA 2NQYA 2ZHNA 1ASJ1 2Z2SB 3DPRC 3J8F2 1SBDA 5FBZA 2VGDA 1YYNA 3BB6A 4D7SA 1KJLA 4K40A 1I5ZA 2ET7A 3LB9A 3ZVXA 1Z78A 1ZBE1 1NCQB 4HPKB 1CAXA 5CIRA 1NCRA 4HVRA 3MF9A 4NHLA 2E53A 1R1A3 1FMD1 3EHKA 1DYKA 3DGTA 1UU6A 4YVWA 5ACA3 1SFYA 3MI8A 4P9IA 5KHHA 1VRH2 4FPHA 4GA9A 2D6PA 4N7UA 4K1YA 3VBUB 4FAGA 4N90A 1DZRA 1XE7A 4XBQA 2P17A 1I3HA 3V0AA 5FFOC 4C1XA 2MPFA 1W2UA 2XBO1 1PGL2 3LA2A 3UV9A 1SLAA 1SDWA 2RE9A 3FLPA 2BVVA 3NKTA 2C5DA 2DUQA 3J8F3 3OBTA 4YNIA 4GXLA 3IBMA 4YVSA 4FTEA 1FAYA 3OYWB 3VGIA 4RGGA 5BUVA 3NAPC 2DU1A 5SV8A 4AE2A 2JICA 1C3HA 5L36A 4ZU4A 4ZU7A 1DQ4A 5JI7A 4DXZA 1H8TA 1VRH3 2OW4A 3WXPA 3A0KA 3AKTA 1IOAA 1VLNA 3ASIA 1QJU1 3K48A 3LAGA 5KXDA 3ZIXA 5D1IA 2ZGOA 4YZ2A 1O91A 3PVNA 1DF0A 3VN4A 1ND3A 1AZDA 2JEMA 4PDWA 5I0UA 2X5IC 2KXLA 4N53C 1JYIA 1MVEA 1GLHA 3WCSA 5J37A 2ZJCA 1ULFA 3VBRA 4ES9A 5C8CB 2B42B 3R6SA 3VL8A 2WZR2 5LEJA 2Q0AA 4QPIC 1IKPA 1NQJA 3VBRC 4H7MA 1FPN2 5GLTA 4DRVA 2OZJA 2F4PA 2WNEA 3DKWA 4JRLA 5CFCA 5BNNC 3CJIC 3URFA 3GALA 4RSUA 4B4QA 4CDXA 2HWE2 4FSJA 5J48A 4MH0E 3J26N 4HFSA 4KWKA 1MZEA 4OHYA 4XFGA 3SH5A 2R1DA 1ZRRA 4KG8A 4IXLA 4XBLA 1JXNA 4MX3A 5EYXA 1UF2C 4XQDA 5JOXA 3FFZA 1WD4A 1OOPB 1LU2A 3GZUC 4LR4A 3HT1A 1KS4A 2LUWA 4IERA 2MHFA 1AR91 1X33A 3JD71 4NWVA 4JQRA 2QE3A 1GNZA 3AXDA 2MEV1 2EXIA 1V9U2 1VP6A 2NMOA 2WZR3 4DY3A 1HLCA 3BTAA 2GNDA 2JG9C 1FPN3 4YM0A 3ZYGA 2CAVA 5I8TA 2CL2A 4EN8B 1O3SA 2WNUB 4RS5C 4FPFA 1MQTC 2BW8A 2HWE3 5C6CA 5C4WB 2DVDA 1NE4A 2VOKA 3IPVA 1LB2A 4I0AA 3DF0A 3OBRA 2R041 5KHKA 4Q4V1 3USSA 4W65A 4GH4A 2A3XA 3HIFA 2RMU2 1LGNA 5I93A 2WNVC 1VALA 3PVEA 1LOAA 4AI0A 3H8UA 5FQ0A 2VQ0A 1SLLA 4NN0A 1OA3A 1ZZBA 4YW5A 3WW4A 3KD4A 2D3PA 1V9U3 3MW3A 1NCQC 1BCXA 1C5HA 4AEMA 1IS4A 2ZAAA 4E4ZA 4CTEA 3NWKA 5JIAA 1LHOA 4QD2A 1UCXA 1VIWB 4LEJA 1W6MB 3MZHA 5GLZA 3LZZA 1BBT2 5J3UA 1PK6A 1NOVA 3AFGA 5C9AA 2ZGSA 5BNPA 4AFDA 1UL9A 1RUC2 4XTPA 2TUNA 3TB0A 1QJX1 4FQ4A 1PO22 3ZN5A 1MS1A 3AKPA 3SLIA 1AR72 1LJ7A 2RMU3 1VBC2 4YFWA 3B93A 1O3QA 2PHTA 3ATGA 4BIFA 1Z7S1 2AREA 3WDXA 4META 4RR3A 3IDCB 3WT3A 4HN1A 1GANA 1UKGA 2XPJA 4CDWA 3H0OA 3ZYPA 1VR3A 2XJPA 1MS0A 5JIUA 1WW6A 4GB32 4O9GA 1W6OA 5H9QA 1OLQA 5JZGC 5SV5A 1OA4A 3LCPA 2A6XA 4R9DA 1NXMA 1ZZ6A 2P3IA 1NA1B 2Y0IA 4N9IA 3EBRA 4GALA 4XXAA 5LEKA 4R4ZA 1BBT3 4IV3B 1W39A 1FNZA 5LRRA 1RUC3 1NE6A 4XFHA 2GH8A 1QJY1 2PHLA 1PO23 5DDJ2 1QQP2 1ZRFA 1PVXA 2YPJA 3T2TA 1AR73 1MEC1 4AFMA 1Y9QA 1VBC3 2A70A 1QNYA 4M01A 2FMDA 3FUOA 4NO4A 2XWBB 3UKVA 3E97A 1EPWA 3NW4A 1XNBA 1CN1A 4MVTA 5C8CC 2Q5TA 1DQ5A 4AFAA 3VKLA 4WVMA 4COZA 4COWA 3HD8B 4KGQA 2BWCA 5FPXA 2ZGTA 4GB33 1LOFC 4X8PA 5D8AA 1GZWB 5T5JA 2W68A 4TSVA 3ZXKA 1B35B 2Y38A 3AYEA 1C4RA 4KNCA 4BMBA 4ITCA 4OVEA 1DG6A 1WMFA 2RS12 3TWIA 1AL0G 2WWSA 4JGZB 1RUOA 1LENA 3TNQA 3UKTA 4P9GA 2ZKLA 3VDDB 1AXZA 3WZ1A 4NHMA 1AYN2 5DDJ3 1OFNA 1QQP3 5AC92 3VBHB 3D8CA 3RI9A 4F7ZA 1RUG2 2XVKA 5CU1A 3S7EA 4N7IA 1QXJA 1A8MA 2WA3A 3VHNA 4M0NA 4XF9A 3E6DA 4OHVA 1TE1B 4PF5A 4FBFA 4Y26A 1HXS1 2XJTA 1VBE2 2VU9A 3RS6A 3ZXEA 1REDA 4B7KA 1AUYA 4IETA 3LA7A 1Q3EA 5DXDA 5C4WC 1RVF2 5T5PA 2RS13 4A7ZA 4I0BA 3A4UA 1WBLA 1D0GA 2Z42A 4S2DA 3WD5A 3JU9A 1AYN3 3ZX7A 1AR82 1ULDA 3GBFA 1FOD1 4LHLA 5AC93 3ZYRA 1RUG3 2R30A 5EV7A 4PIZA 2BGCA 5L73A 1MR5A 1RUJ1 4MXVA 4LO4B 3U4XA 1RHI2 1UPSA 2XVLA 1S0GA 2UYBA 2UY9A 2HEYF 1JTZX 4ATFA 3T1MA 1S1AA 2X8KA 1AXKA 1K5MC 4BM8A 1VBE3 1RJ8A 2JX9A 1FX5A 2VECA 1AHSA 4QQ2A 1TME2 1ULGA 2FQPA 1F5JA 1OPOA 4AGVA 1RVF3 2P2KA 3RRDA 1G86A 2QVSB 4QX5A 2A73B 1DIWA 1H1IA 1RUI1 1VBD2 2R0HA 4QPYA 4EV0A 4XFBA 2HWB1 3HMYA 2D6MA 1AR83 4IL7A 1OPMA 3KMHA 3CL1A 2JECA 4CEWA 1D4M2 4E27A 4JVAA 2K2SA 5FMOL 3TRSB 1L3JA 4Y1YA 5KXCA 1IHMA 1YFXA 5LK5A 3THTA 1YLLA 5FTTC 4IEZA 2A71A 4EN0A 3VBFA 1RHI3 3QACA 4LBLA 4HT1T 2HEVF 1RMU2 2B5HA 4Y22A 3S30A 4B29A 4DRRA 1LOBA 2BFUS 1IGOA 3H9AA 1NG0A 4GWMA 4CZSA 5FREA 1W6NB 1X36A 4YW2A 1HRI2 1CAUA 1NA1C 1QU0A 5E8AA 4BOWA 4Y1XA 1TME3 3GBGA 2ERFA 3RYRA 2HWC2 4X6RB 3ACLA 2XWJB 3LKJA 1IZ3A 2VOXA 3VBSC 1VBD3 3LOBA 3USUB 2WFF1 4JV4A 3W58A 4HETA 3POSA 4IEXA 4Z82A 2DTWA 1D4M3 2A6WA 1YO8A 5FLJA 1Y7BA 4RQPA 1COV1 3WW3A 1AR62 3AYDA 3RMYA 5LRSA 5A3MA 4Q4W1 2VNRA 2ZOEB 3WW2A 4OHWA 1GFF2 3GYDA 1V6MA 4MGZE 1RMU3 1HDKA 4Q2FA 1UW8A 4QU2A 4Q0PA 1B35C 3IT8A 5FOBB 4LLFA 3ZMNA 1HRI3 2V09A 1OQ1A 5JMCA 4FOQA 2FZ2A 4LLOA 5H9PA 4K3UA 2HWC3 4JGZC 1CAXB 1SMVA 4QQHA 5JCTA 1J3RA 4AI3A 5JVVA 3H1MA 5AFEA 5A33B 3ELNA 1DQ1A 2ZKNA 1LODA 3RMXA 2DUOA 3ZSMA 4EROA 5HCAA 1H8VA 3D82A 1AR63 1S2KA 2AH2A 3NKGA 4HL0A 1GICA 4GKYA 1LHNA 4RGAA 3RNSA 5C33A 2ZTNA 3HT2A 2DU0A 2EXJA 2ZGUA 3AZYA 4J6GA 3H7JA 4HSJA 2E7QA 3BOPA 3ECQA 4YZ5A 1UIKA 4Q0VA 1RUF1 2TNFA 3JCIA 2O1QA 1LHWA 2WS91 1LECA 3DV8A 2UWBA 1GNHA 1YWKA 1ZVFA 2RS32 3WV6A 4C0HA 5E16A 1HRV1 5EFUA 1XXNA 4H14A 1ZBA2 1H8TB 4QXKA 4BPZA 4FTBA 2ZABA 1LU1A 4RD7A 1Q8SA 2CWSA 1O4YA 2YC0A 1S0EA 2X5IB 5KC6A 2GALA 3FLTA 2A6ZA 2PAKA 3GF6A 1G8WA 3ILFA 4PDWB 4Q1PA 3I2DA 1ZYBA 5I0SA 2GC3A 3VBRB 1UMZA 3B69A 3TN91 4M0HA 3KGZA 1XQNA 1PIV2 1Z0HA 1G9FA 4R9BA 5BNNB 4QPGA 5T55A 3CJIB 5GKAC 4OI1A 2Q1ZB 5DUXA 4KU7A 2VPVA 4BQ1A 2RS33 5KXEA 5GLVA 4YYOA 4Y1UA 1J58A 3ILRA 4CDXB 1SACA 3ZFEC 1ZBA3 2WT2A 3NV3A 2X53S 4FXKB 1BVVA 4EJRA 1RGSA 2EALA 1YIFA 1G9CA 3E5UA 4XILA 3WDWA 1VBA2 1D4VB 1H2MA 2ZGPA 1YFYA 1AX1A 1NQDA 3RSJA 3H7YA 5CFDA 1OHFA 1QHDA 1XE8A 2JG8A 1SLBA 4DS0A 1BMV2 1H4GA 2WKKA 4FVVA 4OUMA 3H3UA 4R8HA 1W0PA 1SCSA 4BYYA 5K0UC 4W6YA 1IS3A 2A3WA 3ILNA 4EN9B 2DCKA 2VOWA 3HAGA 4AHYA 2JG9B 1X7NA 4XW3A 1PIV3 2NLRA 3I54A 4XJAA 3DN7A 4JDOA 2W0XA 5CNAA 2BTVC 1PGW1 4TYSA 3MYXA 1MQTB 2RR11 2W52A 1U5XA 2AGSA 4I02A 3VHPA 4XOGA 1QH7A 1LCLA 4C1WA 2XGXA 3O7OA 3PMEA 1VB4A 3GNEA 1VBA3 2ZX3A 3FX3A 2WNVB 3UL2A 2PHWA 4EN6B 1GZ9A 1C8M1 4GH4B 4HMZA 3PVBB 1JBCA 2GC0A 4FT8A 4MV2A 2VW2A 1REEA 4XF1A 3ZIWA 3ZFGA 1XNCA 1T6GC 3FWEA 1DFQA 3T1LA 5AVAA 3ALQA 1CR7A 5FQ0B 1SFNA 3LWCA 4E2GA 1WLDA 2WT1A 4J1XA 4C90A 4IEPA 1TNFA 1TMF2 4L92A 2Q8OA 2CGOA 2AR6A 2RJLA 1NCRC 1O5UA 3WLUA 5GALA 3APBA 4B8EA 1HV0A 1QJZA 3SCFA 4OHZA 3D0JA 1CQ9A 2NYYA 2B9UA 4YRDA 1S2BA 4YVWC 1FYUA 4OHXA 1FATA 1MZFA 4SBVA 1BEV1 3ST7A 3WVJA 5BNPB 1MZ5A 2ARBA 3ZYJB 3HWJA 1AYM2 2E6VA 3V56A 1DGWA 2Z69A 2RS51 3R4UA 4AWDA 4RA0A 4CYDA 2NZ9A 4YM2A 2VNGA 3AJYA 1WW7A 3B7MA 3G6JB 3RQ0A 4ORFA 4OZXA 1D2SA 4AQ2A 4AVSA 1D2QA 3POWA 4KL1A 4YVSC 3ES1A 3N7LA 3ZPYA 4CDWB 3RYKA 4H7LA 3AJZA 5JZGB 3MLKA 4WVVA 5FPZA 4EWDA 2DVAA 1TMF3 1W6OB 2BNMA 2RM21 4Z92B 1H4HA 1YI9A 5KHIA 2HYKA 3HN1A 3AMNA 4XJWA 1WW4A 3V0BA 1YJLA 3MW2A 3ZSEA 5ABJA 1G9AA 3NV4A 1H8TC 1ENRA 4XHXA 5TSWA 3PHMA 2NP0A 2XG3A 2XKOA 5I8YA 2CV6A 5KHJA 1AYM3 1R092 1BVP1 1ND2A 1ZRDA 2OYZA 4B7EA 4R4XA 2VVFA 3MPPG 1ALYA 1J1TA 2QJVA 3AZWA 1ND3C 4SLIA 4PDWC 1JYCA 5DUVA 2D5FA 2NMNA 3VZMA 4C91A 2EAKA 3PJQA 1CAWB 1GYKA 4E2SA 1VBB1 5T50A 2PHFA 2YYOA 1C5IA 4ISQA 5CFCC 2GC2A 1QMJA 4CDXC 1ASJ2 2WSVA 1W6PA 3MDPA 4K21A 2IZWA 3QH7A 4DZGA 4LT5A 3VUOA 1JUHA 5KC5A 1J59A 2DF7A 1OFSA 1R093 1UZYA 3AP5A 3AMPA 1HQLA 2W08A 1LTEA 1ZBE2 1W6QA 1O5LA 2A3YA 4GB31 1QOSA 4LE3A 1PM7A 2DCTA 1FMD2 4N9HA 3AP4A 4M3CF 1CJPA 2ZHKA 4K9SA 1FXZA 4IEOA 3N7KA 3WUDA 1NXD1 1DYPA 3FUQA 3WQ0A 4QQPA 1FNYA 4COVA 4IV1A 4XFFA 2ZA9A 2R072 2DCJA 3WP4A 3S0MA 2D6OX 4JAAA 1JW6A 4FPEA 4U36A 1AX0A 2A6YA 4FP3A 1KQRA 2PHRA 5DDJ1 3SH4A 4AG4A 1QQP1 3BALA 1ASJ3 1M4WA 3M70A 3MICA 1I6XA 4JTOA 4JDNA 1QOTA 4G9SB 5GZEA 3MFAA 1AL22 3FJSA 1QH6A 4P14A 3N36A 3ZSJA 4X6QB 2DURA 5CBLA 1MACA 4GH4C 1OD5A 1ZBE3 4XDQA 2Q1MA 2CGPA 1RTVA 5IUQA 1AVBA 2JDZA 3KM5A 3NSTA 4ASMB 1FMD3 2R061 4OUSA 1KXGA 2B7YA 3WP3A 4XFCA 4XJ8A 2H6CA 4AHZA 1GZCA 3LGRA 3KS7A 2GN7A 5IK5A 3SHRA 1RUH2 3NJZA 3KSCA 1FT9A 2TBVA 1K5MB 4QGMA 4AFCA 4AGGA 1AX2A 2QDRA 4QHBA 3J4UH 1QJU2 2R073 3FBYA 3RG0A 2OIIA 3PLQA 3OPZA 2O0OA 4OI2A 1I9RA 3OTFA 4HPKA 1PK6C 5C9AC 1H2LA 5BNPC 4JTNA 3VKMA 4GQ7A 2KA3A 1RUG1 4S2GA 5KHGA 1AL23 4KWLA 1POV1 2VXRA 2WC2A 2ZGKA 4R9AA 3THPA 2D6LX 1HQNA 1HV1A 4FOVA 5KBFA 2OVUA 3GHNA 3VBUA 5IK8A 4Y20A 4KBBA 4I0WB 1ZX5A 3OGJA 3H3ZA 4GWNA 1KDMA 4DY5A 4CEWB 1TQ5A 1VBE1 3B5LB 4RR3C 1BK1A 5J96B 1H1AA 4FOYA 3ZXJA 4CDWC 2VQAA 1RUH3 4CP1A 3NO8A 2JJ6A 2LTNA 3VV1A 4ZU5A 1LKNA 2IXIA 1QJU3 1YHFA 1U5YA 5BNOA 4AVVA 4I01A 3R4DB 1CAUB 4MGIE 1GKBA 3AM2A 1URXA 1U0AA 3VBSB 1TNRA 1QDOA 2GU9A 3JD72 2PYTA 2MEV2 3IM0A 4BE3A 1G7YA 4WZFA 2CTVA 2UYAA 3QBQA 2GNBA 3OD0A 3KGLA 2JE9A 3O0WA 2ZX4A 2ZAHA 2O8QA 1I1EA 4K7JA 1SEFA 1NY72 3M3IA 5JPNB 1FV3A 4CDQA 4K6BA 4Y5Z0 5AVPA 2VVDA 3FBMA 5D8AC 2H0VA 3WDVA 2UY8A 4FAHA 2ZHLA 1KDKA 2YMZA 3TYJA 1IQAA 5K9YA 3INAA 1H30A 1AF9A 2ZZQA 3AZZA 4HZFA 1NZCA 2BNOA 2VOVA 3TOJA 2MNGA 1Q5OA 1RUD1 2BFUL 2E7AA 3JD73 3W9AA 3AKRA 4COYA 2MEV3 2ZBJA 5E1RA 4WBBA 1RUE1 4XF3A 1POV0 1YI7A 4KH9A 3N35A 2E7TA 5GJ6A 1WBFA 4LBQA 4WV8A 1OOPA 1JUIA 3VZNA 5L19A 3GBWA 2HWC1 3OJBA 3VKFC 4DOUA 4LBQD 4CDUA 3WP6A 5KXBA 2AUYA 5E88A 4UW6A 4TLFA 4YM1A 3P3PA 4CDUC 4Q8KA 1Z7S2 4ASLA 4JRAA 4JGYA 4LBJA 5CG8A 2WNUA 4KGGA 4U2AA 1U5ZA 1AR61 4L99A 3I8TA 4M3CA 1N3PA 5DG2A 2YZ4A 3ZN6B 1AJOA 1H2KA 2R6QA 4PJYA 4BHPA 4AHXA 4NHKA 3CF6E 3WDUA 1R081 3CEWA 4W6XA 1IPJA 2YXSA 1PNGA 1WCSA 3CU7A 2XJUA 3VBOA 3I7DA 2HEWF 4XE9A 1JHNA 3GZTB 4XYXA 2O8OA 1UX6A 2YUEA 3I59B 4O9EA 4QM8A 1V6JA 4AHWA 1QJY2 3RI8A 4MXWA 3M3EA 1X50A 5IK4A 3JUUA 1DBNA 1MEC2 1LULA 1BJQA 3S7IA 4BIOA 1Z7S3 2DYCA 4LUKA 4XEZA 4WM7A 4YZ3A 3B01A 3ZFFA 1SBFA 1N1SA 4AI2A 2IWGB 3ZFEB 1UIJA 1H1MA 3FE5A 4OI0A 5EWSA 5BXXA 2FZ1A 2HJIA 2VUAA 3AK0A 2VW0A 2X29A 1DQ6A 2NPIA 4CEWC 2K9ZA 2UU8A 2DTYA 2PN5A 1PO11 1H9PA 1XNKA 2UWCA 1ZA4A 4KU8A 1H9WA 2CGNA 2E63A 4TZDA 1N3OA 4URTA 2VG9A 3BOWA 5EYYA 5CFDB 3UJOA 3VBFC 5K0UB 2RJKA 5T3NA 2HWD2 1MS9A 3U11A 2GH2A 2OA2A 1QJY3 1QY4A 1V00A 2G9GA 2G9FA 1FI2A 5LK7B 4Q0QA 1TEIA 1MEC3 4D3WA 2DUPA 2KM2A 2D3RA 1ZBA1 4Q0SA 2GSYA 3SNMA 2IXCA 3KT1A 3QH6A 1CAVA 2VULA 4YG0A 3J9SA 4IV3A 1EV11 3WNXA 1HXS2 1DDLA 4S2FA 2IXHA 2XJQA 3HQXA 4HANA 3AB0A 3WHUA 3UJQA 4HKOA 1ENQA 4RQPC 1F9KA 4BZ4A 1IKQA 1JN2P 3HR9A 3JQWA 4ZXKA 4Q4X1 4KWJA 3SCHA 4RHV2 2HWD3 4Q4Y2 1HIXA 4LO8A 4D69A 1FV2A 4PLOA 3TNPB 4AEDA 4GMP1 5J36A 1WLTA 4NR1A 5HBAA 1NCRB 3AZVA 1EPZA 1GZWA 2HKXA 2VH9A 2XL7A 4MZUA 1WD3A 2B8MA 4YVWB 2Y0OA 1E57A 1VBA1 2VW1A 4EWEA 1MZ6A 5J09A 3ES4A 2AENA 5IK7A 2ET1A 4BLJA 2C1FA 2K0GA 2XLGA 1HXS3 3AP7A 5CADA 3V0AB 1BMV1 2PLV2