5C33A

Crystal structure of mouse ryanodine receptor 2 spry1 domain
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
190
structure length
179
Chain Sequence
VSSMRPNIFLGVSEGSAQYKKWYYELMVDHTEATHLRVGWASTEGYSPYPGGGEEWGGNGVGDDLFSYGFDGLHLWSGCIARTVSSPNQHLLRTDDVISCLDLSAPSISFRINGQPVQGMFENFNIDGLFFPVVSFSAGIKVRFLLGGRHGEFKFLPPPGYAACYEAVLLKVEHSREYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ryanodine receptor 2
publication title Crystal structures of ryanodine receptor SPRY1 and tandem-repeat domains reveal a critical FKBP12 binding determinant.
pubmed doi rcsb
source organism Mus musculus
molecule tags Contractile protein
total genus 35
structure length 179
sequence length 190
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00622 SPRY SPRY domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.920 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5c33A00
5F6KA 5JI7A 2FBEA 4WVMA 4KG0A 4B3NA 4B8EA 4N7UA 2LM3A 4P9LA 3TOJA 5F6LB 4P9IA 2WL1A 3KB5A 2YUEA 2E63A 5JIAA 3UV9A 4QT6A 3ZO0B 2IWGB 4N7IA 4X8NA 5JIUA 4WVMB 4V1PA 4XW3A 2YYOA 4X8PA 5JI9A 4P9JA 2VOKA 5C33A
chains in the Genus database with same CATH superfamily
2CSGA 2CDPA 2ZABA 5IFPA 1SDDB 1UQXA 1W8OA 3AM2A 1HIXA 4Y1VA 5ABJC 4ASMB 1QKQA 1H6YA 3LFMA 3GJBA 3EO6A 1NE4A 4Y3OA 4YZ1A 4D0QA 1GZCA 3LPGA 4KU7A 3I7DA 4FOYA 4XDPA 1YQCA 1GP6A 1HRV3 4YW3A 2CDOA 4YGBA 2BJSA 3KT1A 4R8HA 4NUBA 3QOPA 4ARYA 2R0HA 1MVQA 5F37A 3CMGA 1IPKA 5ANQA 4IDZA 4IE5A 2XJQA 1CIYA 4QHBA 1Y9GA 2EICA 4DY5A 3WVJA 5C4WC 3AYAA 2PHTA 5FMOL 5T50A 4E4ZA 2YY1A 3S0MA 1R1A2 4GD4A 4IE6A 4P9XA 3DPRB 3MPPG 4YLZA 3TEZA 2ZMLA 1R093 4DNYA 4BQYA 3AZZA 5M0TA 1YWKA 2CU5A 1B35B 4JTNA 5AFEA 1F31A 3I3DA 3OF1A 4QPIA 3ACGA 1HV0A 1C5IA 1RUH1 3ES1A 2VU9A 1FPN2 1L7RA 4LBQD 5K9YA 2DU0A 5FZHA 3M3EA 1VBB2 2ET1A 4OYUA 1W3XA 3TN91 3VD3A 2X29A 5T5OA 2E9QA 4FVVA 3A0NA 5FKBA 3V56A 2IXIA 1PO11 1YRZA 4CCNA 4KGQA 1ZZ8A 3ZN6A 4Q0PA 1SFPA 2D98A 5L9RA 2DCYA 3PVBB 4RR3A 3VHNA 2Q0AA 3ZN5A 3NAPB 5FDBA 5H9QA 3UETA 2J42A 1YQ2A 1JZ4A 3POWA 4JTOA 1HQWA 1ZZ6A 3JB4C 3C7GA 3I3EA 4ORFA 3HMYA 1XU1A 1DZTA 3ACFA 3ILRA 4Q1PA 5CVRA 4A6OA 4BU2A 1W2UA 4GJZA 4Y26A 5F5QA 1NCQB 1KS4A 4YFWA 1PNFA 1RB8G 1NKGA 3FZ3A 1BVVA 5BNPA 4H7MA 4DXSA 2WA3A 4BXFA 2YB7A 1CAVA 1SPPA 4C1WA 3Q8FA 1JBCA 2P1BA 4LULA 3QACA 2GNTA 2ZGOA 5KWRA 1DGWA 1AR72 1AR92 1Y7BA 4A7KA 1UYPA 4IGQA 2OPKA 4GALA 1WMXA 1YFYA 1XNKA 4Q4X1 3KVAA 3WQ0A 5JSOA 2VOWA 4AFBA 3N7LA 1V6JA 3NJZA 2Y6JA 2WNVA 4KNCA 3ABZA 2X5IA 2D5HA 3C8XA 4XJWA 3WNMA 5JLVA 1N47A 2WSUA 2WKKA 1CAUA 1A6CA 3JQWA 5FZ0A 5C3SA 1JOBA 1SG3A 5DUUA 3W5NA 5FQ0B 1KJLA 1XNDA 4N43A 3RZZA 2VUAA 4FPCA 2VZSA 4HPKB 2RR12 2CWMA 3T2QA 4CA9A 4ZONA 4AAXA 3AB0A 4LXLA 1IQAA 3WQ7A 3M70A 2YC4A 4MSVA 3LCPA 4OHWA 4OI1A 2HWF1 5J37A 4QPGC 1VALA 3I97A 3JXSA 4G3YC 5IK7A 1ZRRA 5L73A 2R1BA 2GH2A 2FDHA 1RVF2 3HIFA 5CU1A 1HDKA 5F7UA 2BVBA 2DV9A 4LKEA 3O12A 1PMIA 2MEV3 2A75A 4YG0A 5AC91 2O8QA 3VZOA 3CIHA 4Y5TA 5FP8A 1RUG1 1BXHA 3K51A 3VBHB 4E8CA 3N9NA 1CR7A 2GZWA 4NWVA 4E9KA 1LGCA 4KG8A 4YGCA 4LNVA 4FOQA 3RYKA 2D3RA 3O0XA 1DLCA 3ZYGA 1UYYA 3UV9A 4E2SA 3WOGA 1S1AA 1TMF2 4LR4A 2ETEA 1AJKA 3OYWB 1AL0G 4NIIA 4AQ2A 1W6PB 4XW3A 3U37A 1ASJ2 2GC1A 1O4ZA 2BGCA 3CEWA 1PIV3 4QKBA 5A3UA 5F3IA 2YBKA 4FT8A 3ACIA 1VIWB 3MHZA 3NRUA 5B4XA 5A33A 1ZX5A 5JI7A 2WQZC 1RHI1 3ON7A 5JMCA 3WUCA 3SLIA 1CQ9A 2OUJA 2WZR2 3WT3A 2QQUA 1QF3A 2VUJA 3J9SA 5T55A 1CESA 5K0UC 2ZXQA 4JKMA 1AR63 2B4KA 5FO7B 1TE1B 2I2SA 2JE7A 3K3NA 5JCTA 2HBTA 2G9FA 2ZGQA 3AP7A 4OULA 4DINB 2JDYA 2PLV1 2ZX1A 4BA6A 1W2TA 1A8DA 2IWGB 4H55A 4PF5A 3S7EA 3WZ1A 1LOEA 2J1VA 3BPSA 4MOAA 4GWMA 3SCHA 2QQPA 1S55A 4KL1A 5FZKA 4META 2AYHA 4DEVA 5C33A 4CCKA 4DQAA 2R32A 1HRV2 4MGSA 1W04A 1D0GA 3HOBA 4K1ZA 1ENQA 5EQUA 3ST7A 3WG2A 3C7FA 5I8TA 1HRI3 4YSFA 1MS8A 1AR83 5IVBA 5A32B 3UJOA 2FHRA 3KF5A 3RMXA 3VKMA 3R0RA 4D8MA 4CEWC 3H7YA 4FFHA 1CD3G 5B4NA 1YO8A 1W6NB 5EJ3A 4FAHA 1RXGA 4QWNA 4AVBA 5FZAA 4INDA 1LHUA 1ZBE3 3O1VA 2HWD1 4JVAA 1RUE1 3D0SA 2XDVA 4KWUA 2WR9A 1QU0A 5D2AA 3VN4A 1GFF2 1KFXL 4GAZA 5C6CA 2J1SA 3UKNA 3IM0A 3O14A 2V09A 4PDWB 4Q4Y1 3PU8A 2W95A 1SBFA 2PHUA 3BODA 4GJYA 2Z42A 5BXXA 2JDPA 2VZ3A 4H14A 3TEYA 3VBRA 4P08A 2DVFA 3CJIB 2RDNA 1JZ7A 1UOFA 3VBOA 1G8WA 1VBE3 2Y33A 1PK6C 1S0BA 2Y26A 4AHZA 4PIYA 3VD4A 4HKOA 1NYWA 2G1MA 3VBFA 4YVSA 1WWYA 2VPVA 2ZHLA 1UPSA 4AXOA 1G86A 4K21A 1JYXA 2TNFA 4Z1VA 4M3CF 4QPYA 2GN7A 5JZGB 1IG3A 2DFCA 1FMD3 4IV3C 2VOKA 3C7HA 4A6SA 1R64A 1WCQA 4L11A 4YM1A 4HG6B 1YEWA 4F83A 4UFIA 5L19A 2XJTA 5FZCA 1I6XA 3HPNA 3HAGA 2FBEA 3B93A 2XJPA 4RS5A 4CE8A 4B7KA 4EN9B 3T1MA 4W6XA 3POEA 4Y22B 1QOSA 2QQOA 2ILMA 1FNZA 4BIFA 2HWE1 4CUGA 3PURA 4DMIA 3ZOIA 3I2KA 4AI8A 3GZEA 4ES9A 1NLRA 4S2GA 4COUA 3FMGA 1EAH2 1ODNA 3N7MA 5DUVA 4LBOA 2A6ZA 4AFCA 2CWSA 4GB31 4AEDB 3WCSA 4YWAA 3LEKA 4MHUA 3OBRA 3VUOA 5C3OA 3AKQA 1YJLA 1S0GA 3FHQA 4X6RB 4B4PA 4J1XA 4JHTA 1LHVA 4CP1A 4XXPA 1V6OA 2QFEA 4C0HA 5C9AA 4Q27A 1ND2A 2BOIA 3WY6A 2GP3A 3OBTA 5FZFA 4KBBA 4WM7B 2VUCA 4JAAA 5FY9A 4XBQA 1AXKA 4COYA 5FOJB 3TAYA 2R16A 2WNUC 1YNAA 2E63A 3PTYA 4HOOA 3H1WA 4PI2A 3VKFC 4CDXB 3AP5A 4WVZA 2OQ7A 2MEV2 3RJ2X 3W20A 4QD2A 5A6YA 3GHNA 4Q8LA 3O1SA 1P8JA 4CDQC 2FCUA 4R9DA 5GLZA 5JXJA 3O1TA 2RJ2A 5EYXA 1E5RA 3VZNA 1U0AA 3GF6A 3ZMNA 4M3CE 4QB6A 1NCRC 1BBT1 1VMFA 2SLIA 4HN1A 5SV8A 4D7TA 3RNSA 3T30A 3WHTA 4OZXA 1WD3A 3JZVA 4AQSA 3IAPA 3VHPA 4YM0A 3WX5A 1OBNA 1OOPB 2UWCA 1RC6A 5I8YA 1LAJA 5EIYB 3T1LA 3DF0A 3MIDA 2JB4A 1OF3A 1UY2A 1H8TB 3WF2A 2QQIA 4BPZA 1W8WA 2E26A 2FCVA 2G9GA 1PZ7A 3FL7A 2HEVF 1PIV2 2W39A 3VDAA 5CG8A 4MG2A 2GMMA 3AFKA 2JIJA 4TZDA 3OUHA 4OQ8A 3ILNA 4BIOA 4DOUA 1Y3TA 1OD5A 2BUKA 3LGRA 3OJBA 5DZEA 1O5LA 4XDOA 5FY1A 4CCDA 3ILFA 1AR62 4FPYA 1RUJ1 3I3MA 2PHRA 3I59A 3AMMA 4QHZA 4H2AA 3RZMA 4ISRA 1IS5A 3H8OA 4AHYA 2OA2A 4N8MA 1LENA 4NPMA 4IEVA 3WNKA 4TTGA 1RL3A 4XTPA 1DGWX 3SH4A 2J1EA 5CA6A 1JYWA 1COV1 2E53A 1PMHX 2P17A 5C70A 2G9ZA 2MHFA 3NJXA 4E4DX 4CDWB 1DLLA 1PHMA 3AJZA 3CF6E 4JKLA 4Y1UA 4F8AA 1AR82 4H3WA 5EJZB 1QMJA 2ZGUA 3BTYA 4JGZB 2NP0A 2QQLA 3PMSA 5LEKA 1GQHA 3OY8A 1A78A 3VD5A 3ZR6A 2H0VA 1DGLA 5A7WB 4YVWB 3VL8A 4BE3A 1MS9A 3KT7A 3BYWA 1ZBE2 4NPRA 2VQTA 4TWTA 3K4DA 4AI0A 4BQ5A 3BOWA 5HCFA 5DG1A 4IERA 2OPWA 3B69A 3LEIA 1V6LA 2WFF1 3WNPA 1RJ8A 1YYNA 4YYOA 1NA1C 2BYVE 2D93A 4GKYA 4GH4B 1CPMA 2A7AA 4QXCA 1ND3C 2VW0A 2HJIA 3O1PA 2IFWA 1MEC2 2JE8A 3LA2A 5AVPA 1I5PA 1GMMA 1V9U3 5E89A 1ULDA 4B1LA 4UF0A 4NIAA 1S4CA 3WHUA 1VBE2 3JBG3 3NV2A 2VQAA 1EUTA 3OCPA 3BPZA 4NHMA 2JECA 3S7IA 1FXZA 4OCTA 1RMU1 5KR7A 3RYPA 2OVUA 3WR0A 1SCSA 4M01A 5A1FA 3WG3A 1AX1A 3A0KA 5C3RA 3KSCA 2P2KA 1F4AA 1MS4A 1LRHA 2WT2A 4P5HA 2HKXA 2R063 2VXJA 3V0AA 1FMD2 5JWPA 1I5ZA 4AVSA 1RUD3 3JUUA 3JCIA 5A7NA 2GDFA 3H8UA 2KD7A 4XABA 5EP9A 1WLTA 3B94A 3C2UA 3K4ZA 1V6IA 4NRMA 1O8SA 5AVAA 2PHDA 1GZTA 1HKDA 4LA3A 2P3IA 4P9WA 1TNFA 2Q4SA 5LBCA 2XBO3 5C71A 3PUSA 3BTXA 2DCKA 3RS6A 5L7OA 2XLAA 2OIIA 5DAXA 1QGLA 2RM23 3N36A 3D4KA 1S0JA 4XFHA 1AVBA 1SEFA 3MIHA 3R4SA 4LLFA 3ALQA 4JDNA 2XL7A 3PDQA 1GKBA 1JTZX 1VBD2 4OVEA 2ZEWA 3MBWA 4IEYA 3VD9A 2C9KA 2IUWA 1R1A1 3Q8BA 3ME2A 3ZX7A 3NV1A 4RR3B 1DU3D 5FFOC 3ITQA 3LZZA 4R9BA 2WO7A 2X8KA 3P3PA 2ZGRA 1H30A 1J83A 5CKMA 4UXAA 5FYMA 3S5QA 5FR3A 3HN1A 1VBC3 2BRTA 2RHPA 2Z2SB 2WO3A 4RGKA 5LZ6A 2IVJA 3HT2A 3MIEA 5FPVA 1OVPA 2PQQA 1QH6A 1FPN1 4Y24A 5FLHA 4J6GA 2AEYA 3MV01 1QJU3 5EWSA 2RG4A 1QOOA 3WD5A 3ZXDA 3MW4A 3R05A 2PA7A 1VBB1 3H3LA 3FHIB 4IETA 3NMBA 1B09A 4CEYB 4FTBA 1W6MA 2W91A 3MW2A 3RVHA 5FZ7A 1XSQA 1K45A 1S0CA 5C5UA 1W8ZA 4IGPA 1EPZA 1DFQA 4NRQA 1S0FA 1AL21 2OX0A 3VDDC 4NWWA 2VTXJ 2XJVA 1UX6A 4QPGA 3J8F1 1V70A 3IDCB 2WNVB 4KWLA 5IK8A 1OC1A 2X5IB 1JZ3A 3I54A 5I8SA 1Q8OA 1OUXA 1WCDJ 5JUVA 2EXIA 2DVGA 5DPNA 4W4ZA 4N43B 3OGVA 4FPEA 1OUSA 3ZXJA 1TME2 2DBNA 2VE1A 3POJA 4OMCA 4S2DA 4XUPA 3U1XA 1G7YA 1AR71 1AR91 1GICA 3RZKA 4Y33A 2WAAA 1F5JA 3M7AA 4OUMA 2P3KA 2ZPXA 1XRUA 2C4XA 4DFSA 1X8MA 4TSVA 4A7ZA 5GZCA 1X7NA 2ORXA 2ZA9A 3OG2A 2YC2A 1ZZ9A 1W2AX 3M3IA 1SZBA 5D8AC 3SH5A 1C1FA 2RMU3 3WP3A 5DN2A 4AI9A 4W50A 1EV13 4UI9L 1T6GC 1STMA 5F39A 2ZOEB 2WO1A 2PHLA 5GZDA 5K0UA 2JG8C 2ERFA 3JD71 3AP9A 5J48A 1OT5A 5CKQA 1H1MA 1REDA 4FFIA 5DG2A 4LHKA 4X6QB 3LE0A 4B3NA 5A70A 4B8EA 2IXKA 3EBRA 4LBLA 5FWJA 4ONUA 4BJ0A 2UY8A 4XDQA 1FV3A 3FLTA 2ARCA 1WMFA 4BM8A 4DUVA 1BKZA 3JU9A 2FZ2A 1RVF1 5KHGA 3ZFEC 3J7LA 3KMHA 2XUMA 4B4RA 4HLTA 4AW7A 1D4M3 1JH5A 2ZX0A 4X8NA 1JU4A 1XBFA 4RQPC 3TNQA 4EZ4A 3JB8A 4COZA 1TNRA 5CZKA 3FFZA 1UIKA 2BFUL 5EV7A 3VZJA 5FXZA 2Q1ZB 1JZ8A 3O0VA 4M3CA 1ZZ7A 4CUBA 1Q8PA 1VAMA 1TMF1 4HETA 1REEA 1PO23 1DZQA 2BFUS 3NNLA 4OHVA 4RHV3 4YW5A 2P6CA 3L2HA 2N7GA 4AFAA 1OLRA 3BALA 3ZKUA 1H1AA 1LU2A 3N7JA 4IE0A 5E16A 4LBQB 2IXCA 1V9U2 1UD1A 2ZCWA 3MO4A 3C7EA 5J36A 3JBG2 2E6VA 5LK7B 2YFZA 3P6BA 4LUKA 3W5MA 1ENSA 4BK4A 2GSYA 1N1SA 5DAPA 3RMYA 4P02B 1QJZA 2WINB 5CG9A 3KT4A 3C7OA 3ZXAC 2WZR1 2WZ8A 1ZBA1 5FYSA 5FZMA 2R062 1RITA 1RUD2 4ARXA 3EB7A 5FZ8A 1PK6A 3AZWA 1SLLA 3BIWE 2VVEA 4QGLA 5FJHA 3NJVA 1C8M2 3FC0A 4BLJA 2XBO2 1DDLA 1OLQA 4NE9A 1RUF3 1VMHA 3S57A 5FPBA 3ZSMA 1R082 1VBA3 2RM22 2YV8A 1HRV1 3PLQA 4BB3A 5F5CA 2JDHA 2A73B 1WLWA 4IV3A 2ZGSA 1YXWA 1DHKB 3DPRC 1UNBA 4XACA 3VBRB 2A1XA 2E33A 1CPNA 4XC9A 3KLSA 4YW4A 4FOVA 3VBOB 1B35C 1GZWA 1R091 1O5UA 3ENRA 2RS52 5J09A 1IS3A 4JCKA 1CX1A 4NHLA 4LHLA 3WP6A 1GP4A 3UJQA 4YVSB 1VBC2 4UW6A 3W9AA 4HMZA 3ZSJA 4D69A 3OPZA 5K8SA 2VZOA 1DGRA 1ASJ3 4QX5A 5FXXA 1QJU2 4QX0A 1SFYA 1G9CA 2P6HA 1JI6A 2J1TA 2EIBA 4IL7A 4K40A 1IGOA 2DWRA 2W9XA 2ZKLA 3RG0A 4XHBA 1AF9A 1W6OA 4LKSA 4RS5B 3WF0A 1MS1A 2YBSA 1HLCA 3NAPC 4Z2AA 3V0BA 4BYYA 4AWDA 1YI7A 2D3SA 3D0JA 3LEMA 4OHZA 1NLSA 4DUWA 5JAXA 1YQ8A 1GZ9A 1D7PM 2XL9A 4LOSA 3ZFGB 3SEPA 5HXVA 2V5DA 3ECQA 3RRDA 4B29A 3DUIA 2B7YA 2WNUA 2AZ5A 2Q5TA 5K7PA 1BCXA 2DDUA 3DYPA 4D6QA 2R043 3THTA 4NR1A 2VG9A 2WYSA 2G19A 4BMEA 2R7EB 1QJY3 4ASKA 4CDQA 2UYBA 4JDMA 1CAWB 4NHXA 3WW3A 2B9UA 4A42A 1NCRA 3H3UA 3UT0A 2VBBA 5C9AB 1ND2B 2QCSB 5IATA 1HX6A 3AXDA 3EXUA 4BQXA 2AH2A 2JDZA 5IFTA 4XAEA 3AZVA 3DGTA 3OGRA 2C26A 3A23A 4NPLA 3HBKA 5FYBA 1Q5OA 2VW2A 5FMOS 1LEDA 4CP2A 1J84A 1KEXA 1JXNA 2RMU2 4CUAA 5HV4A 2LM3A 2WLPA 5FY4A 1YFXA 3D5OA 1PVC3 5GLUA 1EV12 4FBFA 3AL5A 2C5DA 1SQ4A 4QKDA 5ANNA 3ETQA 1OMIA 2W5FA 1UF2C 1VRH3 1X8EA 3PL0A 4L0PA 4M4PA 4NVPA 3U11A 1CGPA 1AXZA 1UW8A 2WS93 5FLIA 5JSPA 2YPJA 5IVFA 2KA3A 1ACCA 4EE2A 1DYPA 1KDKA 2D6MA 2WN3A 1N1YA 1MZEA 4XJAA 2R49A 1MZ6A 2E51A 3B00A 3USUA 3EYPA 1XNTA 3BN6A 2XH6A 3VBHC 2MEV1 4N53C 2IVIB 1D4M2 2HWC3 2KXLA 2YC0A 2YMZA 4Q1RA 4JGYB 4PLMA 4DRRA 1BVP1 2B9VA 3D8CA 4RFRB 3MLJA 5FZ6A 3H8XA 4O61A 3KV6A 1DQ6A 1ZZCA 4KWJA 5L9VA 4GMP3 3MW3A 3NWKA 4CPBA 3HWJA 4ZU5A 2PELA 5LK5A 1V0AA 3SMHA 5GZFA 1C3HA 3I59B 1H1IA 1PO22 4RHV2 2ZHKA 4QQPA 4HK9A 4ZZ5A 2BOJA 5H9RA 4PBOA 3ZSEA 4FOWA 4QGMA 3FN9A 3ZVXA 3O1UA 1CIWA 4LLOA 3IIIA 3OD0A 1HB1A 3POSA 5FPAA 4HVOA 4IV1A 1PIV1 1BMV1 1ULCA 3GNEA 3AVSA 1YIPA 2BV4A 2G4IA 4QQHA 5APAA 4RD7A 4DZGA 1EAH3 1NA1A 2VBPA 4XUTA 2BNMA 1ND3A 1HW5A 2W94A 4YRDA 3WW2A 1ULEA 1AR61 4LORA 2QUOA 3OY8B 4NHKA 2P3JA 3DYMA 1ZREA 5CADA 3OPWA 5FZOA 1V6NA 2ARXA 4ES8A 1OFNA 3GBGA 4KMQA 4AVVA 1UZ0A 1IS4A 2Q30A 2CYFA 3WLUA 2EAKA 1RUF2 3VD7A 3E6DA 4GWNA 1I3HA 3B7MA 3U78A 1VBA2 5LW9A 1UZVA 3KS7A 4FQZA 2XWBB 1IZ3A 3QCWA 2DVAA 2V4AA 5KXEA 1HRI1 1WA4A 2ET7A 1LOBA 4XF9A 2WA4A 1AR81 2Y6KA 1JN2P 1QXRA 1QXJA 1UMHA 5CEHA 5BNOA 2EVXA 2VNVA 4UF0B 1VJ2A 5A80A 4E2QA 2GU9A 4JQTA 4WVVA 1VB4A 2F4LA 4PLNA 2UY9A 4HZFA 1ZBE1 3POGA 4QDSA 3GJAA 2H6CA 5TSWA 4UFJA 4URAA 2YZ4A 2BNOA 1PGL2 1EP0A 4ISQA 5DMYA 3C3VA 1J59A 3KVBA 4M0NA 3V0AB 5IW0A 1UZWA 1QDOA 4FXKB 3VKLA 3BIEA 3CJIC 1BK0A 4FPOB 5FUIA 4JRLA 2FDFA 3KQRA 3UKTA 3LPFA 1HN1A 4Q0VA 3P5BA 3RGBA 3KGLA 1L7LA 2Y0IA 4C90A 4YM3A 3ZPOA 3MIBA 1DQ4A 4D7YA 4A4AA 2CHHA 5L7OB 1XJAA 2Q8EA 1VBE1 4NIGA 4E4HA 5FWEA 5DAVA 1GU3A 2YBPA 2XGXA 3CL1A 2XLFA 5FYUA 2O1QA 1DG6A 2A71A 1TZOA 1CJPA 2OXBA 3R4UA 4BH9A 4AL9A 3PVOA 5LA1A 1UY0A 1WW6A 4XQDA 1NZCA 4KU8A 4AYUA 2NLRA 2VD7A 1FMD1 2R042 1FT9A 2BGOA 5FLJA 1APNA 3AVRA 4ZXKA 3TNPB 4D6SA 3WINE 1QJY2 2LS6A 2W92A 4XQ4A 5CFCB 4LBKA 4AFMA 3AFGA 5KXCA 1NZIA 1DIWA 1ODMA 1F35A 1YUDA 4XF4A 2Q8DA 5F3GA 4LOTA 3KHBA 3N7KA 3VDDA 1KXGA 1UY4A 5FZIA 4AHWA 3AKTA 1DCSA 5BNNA 2NQYA 4Q2FA 1OA4A 2Q8CA 3EMRA 4R9CA 4FO9A 3VDBA 5FXVA 4AEDC 1H2LA 3GZTB 1W6MB 2CNAA 3AZXA 5CISA 1DBNA 4PCRA 1WCUA 2WC2A 3G7DA 3T08A 3ZYBA 3ZXLA 2D97A 1JMUB 4AEMA 1J58A 1FX5A 1U5IA 1PVC2 1US2A 2GP5A 4L92A 4G9SB 4I02A 5KBFA 4AQ6A 3CQOA 3POFA 4QPGB 4JDOA 1VRH2 3GGLA 1CN1A 4QMAA 1DGRN 4WM7C 1MS0A 2B46X 3MF6A 4MV2A 1VRBA 5FY7A 3ZFFC 4ATEA 4WBBA 1E5HA 1U5YA 5DAQA 1MEC3 2WS92 3I3BA 2A3XA 1UY1A 4G4FA 3O0WA 3KF3A 2W1WA 4CDXC 4OI0A 2D43A 4RN5A 4MZUA 1XE7A 3GCWA 4Z8BA 1LU1A 2YU1A 3L2YA 3I2OA 2WL1A 1AUYA 1C5HA 2QQMA 5K4LA 3UK9A 4Y1XA 4AHXA 3J7HA 3DEMA 3BCWA 2HWC2 4URTA 3OUIA 2GNMA 4AAPA 2BNNA 3H0OA 3LQCA 5GM0A 3HBZA 5G05L 2P3YA 3VBUB 2D6OX 5JI9A 2XQRA 1MS5A 3MIFA 1OOPC 1W9WA 4LHNA 3WDVA 1PM7A 4LO8A 4QM9A 1UN1A 4B4QA 1CVNA 2VTXA 1PX4A 1SBDA 2BGPA 2VMIA 2NM1A 3ZFEA 2VZPA 2JENA 5KHKA 1O3RA 2PQSA 4ZXEA 3KQ4B 1IPJA 4XJUA 1GV9A 3NJYA 1GBGA 1LTEA 3NVCA 1SLTA 1TG7A 2JIGA 2AENA 1AHSA 4FPLA 1GR3A 1W8FA 2VNRA 2OZJA 3H1MA 4ET7A 3M4FA 1SMVA 5FO8B 1VBD3 1XYOA 2WT0A 5FYCA 5IK5A 4QDQA 2VZ1A 2R073 3M3OA 4WVWA 5FYZA 1BHGA 4PIZA 5L9BA 5CFDB 5BV6A 2X53S 4A44A 1X36A 2JG9C 4Y20A 2YPDA 3VBSB 3ZKYA 4E2GA 2Y60A 3MDPA 1K42A 1QHDA 2CAVA 1UOBA 1VAVA 3I2IA 1W8NA 5F32A 1PZ8A 1QIQA 4NJ4A 3ZIWA 4W6WA 4KWKA 4FPFA 4UT5A 2ZX3A 3LSEA 4CDWC 4M3CB 1LHWA 2VZRA 4P9IA 3QD6A 4AI1A 4UOJA 5DZFA 3CKHA 4IUGA 5F3EA 3TRSB 4XFAA 1OKQA 3I2JA 3N9QA 4CSWA 5C8CC 2Y64A 1NXD1 4YVWC 3GBFA 1RUH2 2VAUA 4YW2A 4EN6B 2D6PA 2C0ZA 5FOBB 1XSRA 4Q4V3 4P9GA 3Q8AA 2FMDA 5T54A 3U4SA 4BHPA 1Z7S3 4D3WA 4I0WB 2W1UA 2VECA 1JUHA 1UKRA 2WJSA 4NOTA 2XUEA 3AMNA 3AJYA 4COWA 1EY2A 2RDRA 4XE9A 4ZU4A 4DPNA 4GH4C 2HLEA 4FPHA 5A7QA 3MUY1 3PNAA 4PIXA 4BOWA 4L8QA 1NLQA 2YXSA 5E8AA 5A3WA 3U14A 2WSVA 4LPLA 5LY1A 3P3NA 2FDKA 3UGFA 4Q8KA 1OLME 4XJZA 1B35A 2A70A 2EIDA 1TME3 5SV5A 3IAQA 2CL2A 2BQPA 1KD7A 3CHXA 4XCAA 5FZ4A 1V9U1 2W08A 3I2HA 5FP4A 3HT1A 1XYNA 3JBG1 3BOPA 1CAXA 4EV0A 3OUJA 3KD4A 4DIQA 4XYXA 3BTAA 4IV3B 1LEMA 4WZCA 2MNGA 2QKDA 3CZUA 1XYPA 4Q4W3 2F4PA 2WQ8A 5IWFA 3PMEA 2JJ6A 4NAOA 4KQ7A 4N7UA 2NMOA 2R061 2ZAAA 3INAA 1WW7A 4AOCA 2CGNA 1RUD1 1R1ZA 4Q4X2 1MQTB 3NAPA 4UFMA 3EJKA 4NMIA 1E5IA 1MR5A 5FZBA 2DTWA 2E31A 3FUOA 1ST8A 4BQ3A 2XWJB 2XBO1 2UYAA 2R30A 2BZDA 2AC1A 3TBDA 4PF1A 4ZPIA 5BUVA 2YU2A 3WDTA 2TEPA 3J7MA 4OHXA 5EFUA 2RM21 4XHXA 4LIUA 5ABJA 1W99A 1SACA 1UOGA 4A41A 1POV3 2FDGA 2JEMA 2O8OA 2PN5A 5JXGA 2W2IA 1JYVA 1A34A 2O0OA 5LA9A 4RR3C 4WVMA 3N9OA 3IDAA 4R9AA 3WQ1A 3PUAA 2HWF2 3V0BB 2A3YA 3HQRA 3WNXA 5FPXA 2YG0A 3LDKA 3TOJA 1YQ5A 3KB5A 3POYA 4MH0E 4UFLA 3APBA 4XIOA 2L9LA 5C4WA 4CCOA 1VBC1 3ZO0B 2P5BA 4LHSA 4V1PA 2WNUB 4QPWA 3B3QE 5IUQA 4K8RB 4CEYC 5J1XA 1QJU1 4AEJA 3RZGA 1QQP3 2D3PA 4HN0A 1UXXX 1U5ZA 4IESA 2JE9A 5FQ0A 5FRAA 4CDQB 3VGIA 1OH4A 3K48A 3WNNA 4MVTA 4CCEA 2K46A 2K2SA 3H50A 1AYN3 1W0OA 1Y9MA 2ZGLA 3GCXA 3HVDA 2GALA 4Q0QA 4ASLA 1NCRB 2VUDA 3MF9A 1OHFA 3R6SA 1OKOA 1Q3EA 2EXKA 1DQ0A 3DN7A 2PMWB 3BU7A 2SBAA 3ROUA 1NQDA 1GNHA 1KRIA 1HXS3 2WNVC 5T3NA 2X5IC 1BK1A 3GDBA 3ZYFA 4GKXA 4YGEA 5LRRA 1O4YA 4HFSA 4C0BA 3K75B 4LBNA 4GQ7A 1U5XA 2EIEA 4AVAA 2ZJCA 3NNGA 4QPIB 2XPJA 4N43C 1C8M3 1FOD3 3VBHA 4N53A 2WLQA 3DYOA 1URXA 2VMEA 2VMDA 4HANA 3OD4A 3IPVA 3SKVA 3RZHA 2QZ3A 2XJSA 1R083 3IDEA 4ZS2A 2RVAA 4O65A 2B5HA 2VZUA 3DXUA 1A8MA 2VH9A 5IVYA 3D82A 3E6BA 1WCSA 5F2WA 1A3KA 3IBMA 1L7QA 4TYSA 2R072 1W05A 3Q8EA 3NNMA 3ZN6B 3S30A 3ZPYA 3OBAA 3USUB 3AZYA 3UGGA 3FLRA 1COV3 2Q1MA 2WWSA 2RS53 2OW4A 1IHMA 2ARAA 1K5MC 4I3GA 4BQ4A 2QTWB 3NNJA 5C7GA 2GNBA 1WUVA 2RMU1 1AJOA 4K6BA 5FZ1A 1ENXA 2VCBA 3KV9A 2F6BA 5D1IA 1XQNA 5BYNA 4RFT0 4NAMA 4MGTA 2ZGKA 4JX0A 1NT0A 3DV8A 1EV11 3FLPA 2TUNA 4OZOA 4V2WA 4IGOA 5BNPB 1GQGA 1EYBA 1K12A 4FFGA 3VL9A 1CAVB 1SPPB 2IZWA 3KCXA 1W3VA 4BWOA 4A3XA 5J96B 1XB9A 1DP0A 4CP9A 5A3TA 2UURA 1PVXA 4XIKA 1OSGA 4EN8B 5FPUA 1SLIA 2J1UA 1V00A 4Q4V2 1XC6A 2GN3A 4F3JA 3NSTA 4IV1B 3UKVA 5F5AA 1H4HA 1JODA 1VPHA 1HB4A 1UAIA 2QQNA 3I3QA 1Z7S2 4QXKA 3OB8A 1D4M1 1KFUL 4OUSA 4YNIA 5FJKA 1MZFA 1Y9QA 3U07A 5A32A 5C5TA 2CAUA 5H9SA 3T2OA 4CXXA 2JDNA 1UKGA 3E6CC 3IDBB 1CAUB 1W6NA 2WRAA 2JICA 3KM5A 4JHZA 2HYKA 3M3CA 3VHRA 5JPNB 2JD9A 2Z79A 1UU4A 5FZOB 3ELNA 2ZGTA 4KGGA 4QQ2A 1PO21 4RHV1 5FYTA 3T3YA 2CGOA 4BMBA 4OLLA 5E1RA 3UNPA 1ZRIA 1RIRA 2VR4A 3SH3A 2JDUA 4CXYA 1H2KA 1OURA 1SFNA 4U2AA 4WM8C 4XEZA 4PHZA 4ZY9A 1K3IA 4SLIA 2VGDA 5LATA 4XBNA 4QT6A 2P37A 5HPOA 2VVFA 3IMMA 3ZIXA 5HXMA 1F15A 4Q4W2 3CJIA 3LKJA 1XOYA 2JKXA 5GZGA 5E6HA 1F9KA 3BB6A 3KZ4C 1W06A 3HQXA 5BNOB 1JU3A 1OA3A 3OGGA 1YQ6A 3F2ZA 4I2OA 1SHWB 1Q8QA 3I49A 1WGPA 2Z4FA 2RR11 5IHRA 1QJX3 3PVNA 4OI2A 1FNYA 4FQ4A 1ALYA 3T0AA 4DXZA 3SKJE 4OQ9A 1RUF1 3AKRA 1H9WA 2R6QA 4AVCA 5A3OA 5DZGA 3AYCA 1VBA1 5FBZA 3VBRC 4BISA 2LUWA 4DXRA 4CDUC 5JOZA 3AC0A 2GMPA 3H3ZA 2DUOA 5I0RA 4F7ZA 2W46A 5I93A 1JUIA 4TXWA 2X09A 4YZ3A 3VBOC 2E32A 4O7XA 5A33B 1BJQA 5JDBA 4PI0A 5L36A 5JXHA 3ZFFA 4Y22A 5DXDA 3A22A 1NAEA 1ZRFA 2OKXA 1OF4A 1UYXA 4YVSC 1LOGA 4Y5SA 4LBJA 2WIIB 2DCZA 2UWAA 1H2NA 4P9JA 4TN7A 5KC5A 4J25A 1XNAA 2NPIA 4LKDA 1UL9A 3HEIA 4FP3A 4CEWA 4MGIE 4GWJA 4XETA 3AXEA 4RL7A 4AEDA 1PGL1 3KCCA 3BKZA 4B7EA 1GOGA 2W1QA 3N4MA 5A6ZA 1ASJ1 5GLWA 1UCXA 1H0BA 4NIHA 1QQP2 3GZUC 4RS5C 3MICA 4C8DA 2ARBA 2V73A 4O9EA 2IFRA 5FO9B 1PGW2 4AVTA 5JOWA 1QWRA 2A6XA 1OLMA 3Q9OA 1AYN2 1M06G 2VMFA 5GLTA 4XJ8A 2BWCA 2D40A 4CCCA 4N7IA 1QY4A 4DB5A 4HK8A 1W9YA 3VDDB 4AQTA 5F5IA 1QEXA 2A6YA 3ZFGC 1PGSA 4WM7A 5BNNB 1BEV3 1HXS2 4MO3M 2PFWA 5FP7A 1US3A 4CDXA 2C1FA 4DO0A 1W6QA 3FBMA 4QQOA 4CPBD 3GALA 1ENRA 1N1VA 4UFHA 3WW1A 4YW7A 4QU1A 5FZ9A 1LJ7A 3Q8CA 5DUXA 5FY0A 1W8UA 5DDJ3 3SEEA 2W3JA 1FOD2 1QJEA 1ZVFA 3U4XA 2R041 3N3HA 1RUC3 2RS13 1Q8VA 5LA2A 2CTVA 5LBEA 4I09A 1J1TA 3ZSLA 2WFPA 1VAKA 1ZM1A 2E7QA 2W47A 2YUEA 3LD8A 1XE0A 5C9AC 3ZXGA 1ZRDA 5FTTC 3LF7A 3E5UA 3EHKA 4XVHA 4LT5A 1UYZA 2W1SA 4NHYA 2XJUA 5FYHA 2NN8A 1IOAA 2J1RA 2JKBA 4AFDA 2JDKA 4IXLA 2VQ0A 1D2SA 4GIQA 1NE6A 1COV2 3VDCA 2Z69A 4RGAA 4XCBA 3VBFB 4B1MA 1DQ1A 4XFIA 5F9TA 3LEGA 2ZEZA 1O59A 4LK6A 3IN9A 3LWCA 4Y4RA 2JD4A 3NW4A 4UWDA 4XUOA 1UO9A 2XVKA 2W68A 1PVC1 2WO2A 2OS2A 2D6NA 3A4UA 3FUQA 4RYDA 3AYDA 5IVEA 5FP9A 1VRH1 1NY72 3QLQA 5FK7A 3ZYIB 2RS33 1N3OA 1W9SA 2WS91 2JG9A 5BY5A 3DL3A 3UL2A 1NX9A 1WA6X 1W28A 5T52A 1KQRA 1AX0A 3ES4A 3POIA 4JGYC 1SBEA 1YC61 1AYM3 2A3WA 1H2MA 5LA0A 2HWC1 4D94A 4N9HA 2ZX4A 1LGBA 1NCQC 5KHHA 4FPGA 1Q56A 2VCAA 3RSJA 4FTEA 3T0DA 2LRPA 5DQ0A 5KC6A 2NMNA 4H7LA 1VP6A 4MXWA 4GMP1 5G04L 5A7WA 5C8CA 4YVWA 1YHFA 1F2NA 3O1MA 4Y20B 2VXRA 2JB8A 5JIAA 5HCHA 2ZAHA 1RMU2 4QGNA 1J3RA 4Q29A 1Y4WA 2AGSA 3THCA 4EWDA 4UW4A 3O1RA 4UYBA 2YYOA 3M2MA 4AR2A 4BQ1A 5ACA3 1W8HA 4GH4A 5FCCA 3LB9A 4C1XA 3LDRA 4EWEA 5FPZA 2J1AA 3VV1A 1EAH1 2HEWF 4XUQA 3LDBA 1TVGA 3IWZA 4RA0A 2K9ZA 2YFUA 3GM8A 3BGAA 2Y6LA 1QNWA 1O8PA 5FIXA 4MGZE 5LRSA 4FFFA 4AEKA 5FBJA 3O7OA 1JS9A 1ZA4A 2DTYA 5FYIA 4BQ2A 2FMYA 3HNMA 3IIAA 1QJX2 2DU1A 3OOXA 4PJYA 4DRVA 5JIUA 3WF3A 1DQ2A 5LCWL 3H1YA 4EROA 3P1IA 1H6XA 4AI2A 1TQ5A 4U36A 4Y5Z0 5A7PA 2RJLA 1CZSA 1SDWA 4IEXA 2JDMA 3TWIA 2ZGNA 4YGDA 3FFQA 4HSLA 1KITA 4M0HA 2ZGPA 2IXJA 3ZMOA 5A3MA 1O3SA 4LEJA 1F5FA 5T5JA 4CCMA 5DAWA 1RUI3 4UW5A 2J22A 4XF0A 2BERA 4R52A 5I0SA 1UMZA 2V4VA 3RPQA 1CAXB 3J7NA 1LODA 2AACA 1VE0A 5CAZA 2AR6A 2VOXA 1RINA 2WWUA 4L9BA 3OEBA 2PTMA 2HWB3 3SISA 2B45X 3WQBA 2OZ6A 2TBVA 3B5LB 5LEJA 3I4IA 1FV2A 5A1AA 1AL22 1X82A 4LO7A 4Y4YA 3HJRA 3J8F2 1DYKA 3OBZA 5L7OC 3WG4A 4GULA 3LIGA 4UW3A 4AG4A 4KG0A 4P14A 1LOAA 1JYIA 1EUUA 1BEV2 1JOJA 5ABJB 1POQA 2WZPP 4CEYA 2B39A 1I9RA 4PLOA 2FDJA 2XOMA 1WBLA 3MZHA 2VOVA 2DUPA 1F4HA 5JMOA 5KHIA 2ORZA 2KM2A 4P9YA 4WVMB 3IZOA 5DDJ2 1GYKA 4R4XA 5A3NA 5CFCC 1OQDA 3J4UH 4QX8A 1WW5A 2GNDA 2PAMA 1RUC2 2RS12 3NNFA 3UGHA 4A3ZA 1LULA 1FAYA 2YGLA 3B02A 3H7JA 2Y6FA 1NQJA 2X05A 2E7TA 1LKNA 5C4WB 3RZLA 2C24A 4UAPA 3WF1A 2UU8A 2F17A 1SLAA 2I74A 1DF0A 1RUH3 2VTFA 4PQQA 3VKOA 3U10A 4QKFA 3E97A 1ULPA 2WQ4A 4NIDA 3E5QA 3PU3A 4NROA 3RI8A 4DUXA 2IC1A 3WF4A 2BBVA 1ZNPA 3SITA 2OUHA 3M8LA 2D44A 2DCJA 3JD72 1KJRA 5GKAC 3TN93 1PM4A 1VB2A 4XFBA 3IT8A 5A7SA 4Q0UA 4PDWC 4MX3A 3MIGA 1PO13 1C4RA 1K5JA 3ACLA 4QX2A 5DABA 4LE4A 1CZVA 4EQVA 2BDRA 3RI9A 2R0FA 2LW8A 2IXHA 5FYVA 1JZ5A 2RS32 1SLBA 4PQ9A 4Z92B 3WCRA 4AGVA 1MEC1 4I30A 3T2TA 3OSDA 4CVUA 3G6JB 1YI9A 4N53B 1O91A 2JDAA 1JZ2A 1K5MA 3K46A 1C1LA 1LOCA 3RZJA 4YW1A 2B42B 3PJQA 5I0UA 5IVCA 1OQEA 3IPVB 1ZZBA 2CGPA 3SQOA 2PHWA 4LE3A 2BW8A 1Q8SA 3VBUC 4A45A 1AYM2 2I07B 1QXPA 5JZGC 1CONA 3MPBA 1CWPA 2XJRA 1LESA 1NXMA 2ZEXA 4QB2A 3SCGA 2BVVA 2MPFA 2QNKA 1HQLA 4EWAA 1RGSA 3V64A 1WZXA 4HL0A 5EJ1B 2A6WA 2VULA 1QNYA 4JV4A 4BCUA 5A6XA 1LR5A 2Q8OA 1WMDA 4LO6B 4WV8A 3DKQA 3HD8B 2PYTA 4Q4X3 3FWEA 4CU7A 4WZFA 3UESA 4CCJA 4AE2A 3E1F1 3WSOA 4YPJA 3PUQA 5GZEA 3D3AA 3H42B 1UOJA 1F8VA 1ZBA2 4K3UA 4LMFA 5FZ3A 5ACA2 3NV3A 1GWMA 4Q0SA 3OPTA 5HV0A 1OXCA 3EQEA 1Z78A 4NO4A 1FATA 1MVEA 5JR2A 4HKLA 4CP9B 5CFDC 1VBD1 1S0DA 2VY0A 4LBQA 4XFGA 4XMAA 4YZ4A 3VBSC 1PNGA 1H9PA 2HWF3 2R071 4I3PA 3RWNA 3ZSKA 5BNQA 3THDA 5IAXA 1LOFC 2WZEA 4LQRA 3NO8A 1RXFA 1C8NA 2BBAA 1MZ5A 4BK5A 4MHRA 3NKTA 5F6KA 3SNMA 2AEZA 4WM8A 3RFRA 5AC93 5FZLA 3KV4A 4IQPA 2DURA 1XE8A 2C6SA 2YROA 1GANA 1W0NA 1RUG3 4GMP0 5F3CA 1WD4A 2XHKA 5F6LB 3N35A 3N9LA 5FY8A 1R092 1JHNA 3GZAA 2DFBA 2QE3A 3AKSA 5D8AA 5FAXA 3ZYJB 1LCLA 2WNEA 1MACA 3PJYA 2VZTA 1XNCA 2ADDA 4DXTA 1RUI2 3M1HA 4YZ2A 1SCRA 4Q4V1 2JG8A 3AMPA 3PUIA 3T4VA 5FMCA 5FZEA 5AFBA 2XMLA 2OYZA 1Z7S1 1FI2A 1T2XA 1X9PA 2ZBJA 3RYRA 5J7MA 3S5AA 2K0GA 4L2NA 3DKWA 1H8TC 2HWB2 3QH7A 4CDUA 4J1WA 1RHI3 5IAVA 4IEQA 4C91A 1E57A 2Y8KA 3F95A 1QH7A 2J7MA 2QBXA 4P9LA 2EXJA 4CZSA 2LROA 4RQPA 3NV4A 4W8JA 1H8VA 1GP5A 3KWVA 5CKNA 2YHJA 1V6KA 1TME1 2PLV3 5K0UB 5IVJA 2DVDA 2YDEA 1VMJA 2LTNA 2NZ9A 3MLLA 3WNLA 3TYJA 1G9AA 1C28A 3CJXA 3PHMA 4KI5M 4FPJA 5GJ6A 4HVRA 5T5LA 4EYUA 2BTVC 4DEQA 3M3QA 3MLKA 1YIFA 1CZTA 5DUWA 2Z5WA 1HN0A 2VO5A 3VKNA 2VL4A 4KH9A 2GC2A 2ZACA 1M4WA 4O9GA 4Q4W1 4QM8A 1JOPA 3BU0A 1MQTC 1OPMA 3MEPA 1HB2A 2B8MA 1PMJX 4MXVA 5E88A 5FV3A 3RQ0A 3ZFFB 5A7OA 2EIGA 1UWWA 2DUQA 4HXCA 4GWIA 3ZFGA 3H9AA 2VZVA 2E7AA 4BQWA 4IW3A 2D6KA 2I45A 4CEWB 5C3PA 1WLDA 2ZZJA 2HWD3 4JGZC 1RUE3 4P00B 3KV5A 1NUKA 1W39A 3L9JT 1HV1A 3VZMA 3ORJA 5I0TA 2QQVA 3T09A 2Y0OA 2RDQA 3I2FA 1POV1 4Q4Y3 1CAWA 4Y1YA 1LHNA 4EZHA 4K20A 1WBFA 3TN92 1UY3A 3W58A 4XF3A 1JHJA 3MFAA 1PO12 5FUPA 5CIRA 2WBKA 4BDVB 3AMQA 1ZRCA 1ZYBA 4LBMA 1HQNA 3DPRA 5LY2A 2WNOA 3O5SA 3UYJA 4QB1A 3TB0A 1W6QB 3E5XA 2XVGA 5LBBA 2XKPA 5FUNA 3MI8A 3S6PA 3V65A 2ES3A 3NKGA 1N3PA 1KGYA 1AX2A 1PK6B 4MYEA 4YG3A 3LOIA 4IEZA 1QQP1 2XXZA 3FE5A 4IE4A 4LTAA 2KR2A 1IPSA 1U12A 3CDZB 3I8TA 4XTMA 3WEZA 2XG3A 5IK4A 1PGW1 2WT1A 5EPAA 1S2EA 4HONA 1AYN1 2WUHA 2BEOA 2VCCA 4E4SA 5FZDA 2A6VA 3MV11 1OH3A 3AKPA 3K77A 1O3QA 1HXS1 4IEUA 2WYFA 1BMV2 2DVBA 4XJ9A 2VCMA 2OT7A 2HWE3 1Z0HA 4QPIC 1GZWB 1O6UA 4DS0A 5EHDA 2VM9A 3ACHA 5FK8A 5C3QA 3HN3A 4XOGA 2BPA2 3WV6A 3ETPA 4XAAA 4XURA 1UXZA 1JW6A 4JGYA 3DCQA 4OMDA 1C8M1 1FOD1 4GB33 4RSUA 3ZDSA 3K4AA 4N90A 3HNYM 4ZU7A 1J3QA 1N3QA 3B9CA 3ZYRA 5H9PA 1LECA 1NCQA 3GBWA 1IKQA 1GQPA 3BI3A 4QU2A 1R081 3I2DA 4OUEA 1IG0A 1XPWA 4M00A 2A5ZA 4L97A 1DZRA 1W6OB 3LOBA 3FX3A 4CRQA 1UPIA 3AMHA 1Q43A 1S0EA 2JG9B 1S0IA 1GOHA 5FPLA 1KDMA 3USSA 2GC0A 4PBPA 1LHOA 3ZLIA 1S2BA 2HH9A 3KGZA 3PTRB 3RWKX 3CBNA 1BQPA 4FCAA 4AI3A 3N9PA 3HQUA 2RS51 2VJXA 1D2QA 4RGGA 1HRI2 1PZ9A 2ZGMA 4GXLA 3BUCA 3WDUA 3WUDA 5AC92 3AL6A 3PIGA 5BNPC 1YLLA 4XUNA 4K1YA 1RUG2 4MXWB 1W8TA 1X50A 4ZHNA 5C8CB 4D7SA 3THPA 5FP3A 3R4DB 4XF1A 1GWLA 1BBT3 1NY71 2RV9A 5BPXA 4LO4B 3CU7A 4HPKA 4MGQA 4OHYA 4BLIA 4CUCA 1LB2A 4QKNA 3OGJA 4IV1C 2XLGA 2ZTNA 4BXSV 4QX3A 1QJFA 5HBAA 4D6RA 3N9MA 3VB9A 3ZXEA 4I0AA 1G6NA 1GWKA 2PXJA 3LIHA 3A21A 3PUHA 2BU9A 2JWPA 2PAEA 4QHOA 3X29B 1RHI2 5IT6A 1OVSA 2VOTA 5GALA 5HCAA 1E5SA 2X10A 2BWAA 2HYXA 2EA7A 1EPWA 2NYYA 2Y6GA 4DY3A 1C57A 4YZ5A 5I0DA 2QQWA 1GOFA 2Y38A 5T5PA 4IEOA 5J98B 1W2OA 3KCYA 3ZYHA 1LGNA 1RUJ3 2PLV2 2FD8A 2DCTA 3OYWA 3IMNA 3K3OA 3KHCA 4TLFA 3LAGA 1W6PA 1VLNA 2EF6A 2AUYA 2XB6C 3W59A 4CU8A 5EZWA 5FREA 1UU6A 3AP6A 4MGKE 2D6LX 3B9IA 5IYYA 5LWBA 3W21A 3H8RA 4TLGA 1IS6A 5BNOC 3TEWA 1W0PA 4LA2A 5FZGA 3U0ZA 4K9SA 2C9AA 3WP4A 4X8PA 2QVSB 1MPXA 4XXAA 2WWJA 3OGSA 1Y43B 4QX1A 1ONAA 5C8WA 1W9TA 2QJVA 2ATFA 4E27A 1G9DA 5KXBA 1REFA 5F1RA 3CZJA 1GNZA 1QJX1 5B2GB 1WLCA 2HWD2 1HJGA 2PHFA 3ATGA 1RUE2 2VMHA 5FXWA 1TEIA 1GLHA 4Q5OA 3SXWA 1X33A 4UBHA 3WG1A 5I91A 1V6MA 2XONA 1PX3A 2WFF3 2ZHMA 2VC9A 3T2PA 4R4ZA 5CFCA 4QDRA 2Q1FA 5EYYA 4Q4Y2 3IKWA 4Q26A 1WW4A 2P34A 3LA3A 3JQXA 3AK0A 1NA1B 2CY6A 4OFGA 4K7JA 3ZYPA 3MYXA 2QDRA 3WXPA 4QX7A 2D7FA 5F8PA 1ND3B 4K8FA 5GLVA 2JXAA 4XQWA 3ZXKA 1ZA7A 1GNYA 3LA7A 5KHJA 1X9TA 4ITCA 1UIJA 4S2FA 2W52A 2VQUA 4Z2WA 4UBGA 4JZRA 1RMU3 3BVCA 4EN7B 4LKFA 2JX9A 3MUZ1 3ZM8A 4PT6A 4HVQA 4CP0A 2DYCA 4PDWA 5F2SA 3HNBM 5FKCA 4AZZA 2OQ6A 3T0BA 2VNGA 2VBDA 5BNNC 2H0BA 3OEAA 2XKOA 5CNAA 4LJHA 4QAWA 3WDWA 5CB7A 4HBNA 3T4HB 4AK3A 1O3TA 4YG6A 4E8DA 1BEV1 1DQ5A 4LK7A 5JR7B 1KS5A 5LB6A 2O14A 1POV0 4JC1A 1QOTA 1OA2A 4GA9A 2HWE2 2Y34A 2FZ1A 4Z82A 4EN0A 5D21A 2QDNA 1XU2A 2EALA 3MGUA 1W03A 3LSDA 2ZKNA 5DDJ1 2ZMNA 4HKWA 3VBUA 3POBA 4GB32 4L99A 2QQJA 4N9IA 4XILA 3VLBB 4FAGA 5JZGA 4OI4A 1RUC1 2RS11 3DECA 5EXOA 1WMEA 1R1A3 5A3PA 2FCTA 1D4VB 4ZZ8A 4V2VA 4CTEA 1OFSA 1JYTA 1RTVA 1BZWA 1RYYA 4CU6A 2R1DA 2HBUA 2XQXA 3RJRA 4FTSA 1J1LA 1FPN3 2EAAA 1K5MB 2ZX2A 4I01A 4KBZA 3O1OA 4FP2A 4GZ9A 3VBFC 3DXTA 5FYYA 4HT1T 4A7YA 4AGRA 1VBB3 4JRAA 3VHOA 5J3UA 4JQRA 4M4RA 3WP5A 1YCIA 2WAOA 4IE7A 2DF7A 2RDSA 5CBLA 1ULGA 3PVEA 4S2HA 4Y1ZA 5FMBA 2VMCA 2ZEYA 1LNSA 3ZN4A 5JOXA 2ENRA 4UFKA 1CX4A 5CFDA 4CYDA 4MGYE 1AL23 2YGMA 4I0BA 3VBSA 3ZXFA 1BBT2 2ZZQA 2ADEA 5LBFA 1D0HA 1N1TA 4LUMA 2RS31 2Y6HA 3GHMA 1LOFA 3J8F3 2RE9A 5IVVA 1RUNA 2UWBA 2ZHNA 3J26N 4IEPA 1JZ6A 1YFUA 1L3JA 4P5YA 1IQDC 5ERLA 1CJDA 3PIJA 1UZZA 3ZDVA 1NG0A 2LALA 3VZKA 4QXBA 5IJRA 2V5YA 2AREA 1AYM1 2D5FA 1SLCA 5KXDA 5FY5A 5A6QA 5HI0A 2V72A 1OI6A 5JXIA 4SBVA 5FMDA 3AX4A 1UZYA 1AR73 1AR93 3B01A 3GYDA 2WDBA 2RJKA 4AGGA 1VR3A 1S2KA 1NOVA 1J3PA 4FXGB 3VZLA 1JYNA 1OPOA 1T6BX 4QQLA 4A2UA 4XMIA 1W2NA 4FI9A 5JVVA 1QJY1 5A1LA 1ND2C 1RUJ2 3QH6A 4LITA 4WM8B 1OD3A 2GH8A 4IEWA 2GAUA 1WKYA 1OOPA 1WCKA 2DBIA 4JKKA 2XR4A 3IB3A 5ACA1 1O7FA 1BLZA 1H8TA 1XXNA 4XFFA 5A3LA 3QBQA 3CNAA 2FQPA 2CV6A 4W65A 2P4EA 2ZMKA 3A7QA 3MFCA 5D8AB 3RDIA 2XHNA 3SC7X 3HR9A 4CXWA 4ZKTB 2ID4A 4Z07A 5ISLA 2XVLA 3FHAA 2RR13 3OTFA 4XBLA 4FSJA 3JD73 4HSJA 4YW6A 1UX7A 3SCFA 4EJRA 3BTZA 1G9BA 5CYYA 2JG8B 2H6BA 4YARA 2VZQA 2W87A 1H4GA 3D6EA 4NN0A 1RVF3 2HEYF 4BZ4A 1FYUA 2PHXA 3NL1A 2VVDA 3ZR5A 4XFCA 1OQ1A 4CDUB 2ZS6B 2WABA 2VW1A 3ZFEB 4CCLA 2PAKA 1QDCA 3U75A 4XPVA 1GSLA 3TEXA 3FBYA 1RUOA 2WFF2 4MADA 5JOYA 5JSRA 1MQTA 4RQPB 2GC3A 3AP4A 1AZDA 3ASIA 2WN2A 3SHRA 1TMF3 3GXUA 1YJKA 4AF9A 4COVA 3CLPA 5JPMB 1DYOA 4FPKA 1BYHA 1UU5A 4W6YA 1ULOA 4YM2A 3WNOA 1HJFA 4CDWA 1RUI1 3WDXA 2BP6A 1G9FA 2QQKA 1RJ7A 4JGZA 4LIVA 5LASA 3URFA 3FJSA 4ATFA 1I1EA 3AYEA 3CO2A 5HCBA 1W9FA 2IXLA 4MLOA 2GMEA 4NRPA 4XZUG 2QZ2A 2EXHA 2VMGA 4LO5B 2FDIA 2HWB1 4QXHA 4CU9A 1MS3A 1XNBA 4XZPA 1GUIA 3WW4A 1YFWA 1W90A 2W0XA 3NQHA 1HB3A 1JYCA 1IKPA 2WZR3 3K2OA 1O4TA 1ULFA 1ZBA3 3I2GA 3LFIA 4ZS3A 4YFZA 3WDYA 2VNOA 1AXYA 4MUVA 1UMIA
chains in the Genus database with same CATH topology
2ZABA 3AM2A 1HIXA 4Y1VA 5ABJC 4ASMB 1QKQA 3EO6A 1NE4A 4YZ1A 1GZCA 4KU7A 3I7DA 4FOYA 1HRV3 4YW3A 4YGBA 3KT1A 4R8HA 3QOPA 2R0HA 1MVQA 1IPKA 2XJQA 4QHBA 4DY5A 3WVJA 5C4WC 3AYAA 2PHTA 5FMOL 5T50A 4E4ZA 2YY1A 3S0MA 1R1A2 4P9XA 3DPRB 3MPPG 4YLZA 2ZMLA 1R093 4DNYA 3AZZA 1YWKA 1B35B 4JTNA 5AFEA 1F31A 3OF1A 4QPIA 1HV0A 1C5IA 1RUH1 3ES1A 2VU9A 1FPN2 4LBQD 5K9YA 2DU0A 3M3EA 1VBB2 2ET1A 3TN91 2X29A 5T5OA 2E9QA 4FVVA 3A0NA 3V56A 2IXIA 1PO11 1YRZA 4KGQA 1ZZ8A 3ZN6A 4Q0PA 2D98A 2DCYA 3PVBB 4RR3A 3VHNA 2Q0AA 3ZN5A 3NAPB 5FDBA 5H9QA 3POWA 4JTOA 1HQWA 1ZZ6A 3JB4C 4ORFA 3HMYA 1XU1A 1DZTA 3ILRA 4Q1PA 5CVRA 1W2UA 4Y26A 5F5QA 1NCQB 1KS4A 4YFWA 1PNFA 1RB8G 3FZ3A 1BVVA 5BNPA 4H7MA 2WA3A 1CAVA 4C1WA 1JBCA 4LULA 3QACA 2GNTA 2ZGOA 5KWRA 1DGWA 1AR72 1AR92 1Y7BA 4A7KA 2OPKA 4GALA 1YFYA 1XNKA 4Q4X1 3WQ0A 5JSOA 2VOWA 4AFBA 3N7LA 1V6JA 3NJZA 2WNVA 4KNCA 2X5IA 2D5HA 4XJWA 5JLVA 1N47A 2WSUA 2WKKA 1CAUA 1A6CA 3JQWA 5DUUA 5FQ0B 1KJLA 1XNDA 4N43A 3RZZA 2VUAA 4FPCA 4HPKB 2RR12 2CWMA 3AB0A 3WQ7A 1IQAA 3M70A 4MSVA 3LCPA 4OHWA 4OI1A 2HWF1 5J37A 4QPGC 1VALA 4G3YC 5IK7A 1ZRRA 5L73A 2R1BA 2GH2A 1RVF2 3HIFA 5CU1A 1HDKA 2BVBA 2DV9A 3O12A 1PMIA 2MEV3 2A75A 4YG0A 5AC91 2O8QA 3VZOA 1RUG1 1BXHA 3K51A 3VBHB 1CR7A 2GZWA 4NWVA 4E9KA 1LGCA 4KG8A 4YGCA 4LNVA 4FOQA 3RYKA 2D3RA 3O0XA 3ZYGA 3UV9A 4E2SA 3WOGA 1S1AA 1TMF2 4LR4A 2ETEA 1AJKA 3OYWB 1AL0G 4AQ2A 1W6PB 4XW3A 1ASJ2 2GC1A 1O4ZA 2BGCA 3CEWA 1PIV3 4FT8A 1VIWB 5A33A 1ZX5A 5JI7A 2WQZC 1RHI1 5JMCA 3WUCA 3SLIA 1CQ9A 2OUJA 2WZR2 3WT3A 1QF3A 2VUJA 3J9SA 5T55A 1CESA 5K0UC 1AR63 5FO7B 1TE1B 2I2SA 2JE7A 5JCTA 2G9FA 2ZGQA 3AP7A 4OULA 4DINB 2PLV1 2ZX1A 4BA6A 1A8DA 2IWGB 4H55A 4PF5A 3S7EA 3WZ1A 1LOEA 4GWMA 3SCHA 2QQPA 1S55A 4KL1A 4META 2AYHA 5C33A 4DQAA 2R32A 1HRV2 3ST7A 3WG2A 1D0GA 4K1ZA 3ZFFC 1ENQA 5I8TA 1HRI3 4YSFA 1MS8A 1AR83 5A32B 3UJOA 2FHRA 3RMXA 3VKMA 3R0RA 4CEWC 3H7YA 1CD3G 1YO8A 1W6NB 5EJ3A 4FAHA 4AVBA 4INDA 1LHUA 1ZBE3 2HWD1 4JVAA 1RUE1 3D0SA 1QU0A 3VN4A 1GFF2 1KFXL 5C6CA 3UKNA 3IM0A 3O14A 2V09A 4PDWB 4Q4Y1 1SBFA 2PHUA 3BODA 5BXXA 2Z42A 4H14A 3VBRA 2DVFA 3CJIB 3VBOA 1G8WA 1VBE3 1PK6C 1S0BA 2Y26A 4AHZA 4PIYA 4HKOA 1NYWA 3VBFA 4YVSA 2VPVA 2ZHLA 1UPSA 4AXOA 1G86A 4K21A 2TNFA 4Z1VA 4M3CF 4QPYA 2GN7A 5JZGB 2DFCA 1FMD3 4IV3C 2VOKA 4L11A 4YM1A 4F83A 5L19A 2XJTA 1I6XA 4RS5A 3HAGA 2FBEA 3B93A 2XJPA 4B7KA 4EN9B 3T1MA 4W6XA 4Y22B 1QOSA 2ILMA 1FNZA 4BIFA 2HWE1 4DMIA 4AI8A 4ES9A 1NLRA 4S2GA 4COUA 3FMGA 1EAH2 3N7MA 5DUVA 4LBOA 2A6ZA 4AFCA 2CWSA 4GB31 4AEDB 3WCSA 3OBRA 3VUOA 3AKQA 1YJLA 1S0GA 4B4PA 4X6RB 4J1XA 1LHVA 4CP1A 4XXPA 1V6OA 2QFEA 4C0HA 5C9AA 4Q27A 1ND2A 3WY6A 3OBTA 4KBBA 4WM7B 4JAAA 4XBQA 1AXKA 4COYA 5FOJB 2R16A 2WNUC 1YNAA 2E63A 3PTYA 3VKFC 3H1WA 4CDXB 3AP5A 4WVZA 3RJ2X 2MEV2 4QD2A 3GHNA 4Q8LA 4CDQC 4R9DA 5GLZA 5EYXA 3VZNA 1U0AA 3GF6A 3ZMNA 4M3CE 1NCRC 1BBT1 2SLIA 4HN1A 5SV8A 4D7TA 3RNSA 3WHTA 4OZXA 1WD3A 3JZVA 4AQSA 3VHPA 4YM0A 3WX5A 1OOPB 2UWCA 1RC6A 5I8YA 3T1LA 3DF0A 3MIDA 1H8TB 4BPZA 2G9GA 1PZ7A 2HEVF 1PIV2 2W39A 5CG8A 2GMMA 3AFKA 4TZDA 3ILNA 4BIOA 4DOUA 1Y3TA 1OD5A 2BUKA 3LGRA 3OJBA 5DZEA 1O5LA 3ILFA 1AR62 4FPYA 1RUJ1 2PHRA 3I59A 3AMMA 4ISRA 1IS5A 4AHYA 2OA2A 1LENA 4IEVA 1RL3A 4XTPA 1DGWX 3SH4A 5CA6A 1COV1 2E53A 2P17A 2MHFA 4E4DX 4CDWB 1DLLA 1PHMA 3AJZA 3CF6E 4Y1UA 4F8AA 1AR82 4H3WA 1QMJA 2ZGUA 4JGZB 2NP0A 5LEKA 3PMSA 1GQHA 3OY8A 1A78A 2H0VA 1DGLA 3VL8A 4YVWB 4BE3A 1MS9A 3KT7A 1ZBE2 4NPRA 4TWTA 4AI0A 3BOWA 5HCFA 5DG1A 4IERA 3B69A 1V6LA 2WFF1 1RJ8A 1YYNA 4YYOA 1NA1C 2BYVE 2D93A 4GKYA 4GH4B 1CPMA 2A7AA 1ND3C 2VW0A 2HJIA 2IFWA 1MEC2 3LA2A 5AVPA 1V9U3 5E89A 1ULDA 3WHUA 1VBE2 3JBG3 3NV2A 2VQAA 3OCPA 3BPZA 4NHMA 2JECA 3S7IA 1FXZA 1RMU1 3RYPA 2OVUA 3WR0A 1SCSA 4M01A 3WG3A 1AX1A 3A0KA 3KSCA 2P2KA 1MS4A 1LRHA 2WT2A 4P5HA 2HKXA 2R063 3V0AA 1FMD2 5JWPA 1I5ZA 4AVSA 1RUD3 3JUUA 3JCIA 2GDFA 3H8UA 1WLTA 3B94A 3C2UA 1V6IA 5AVAA 2PHDA 1HKDA 4LA3A 2P3IA 4P9WA 1TNFA 2Q4SA 2XBO3 2DCKA 3RS6A 5L7OA 2XLAA 2OIIA 1QGLA 2RM23 3N36A 3D4KA 1S0JA 4XFHA 1AVBA 1SEFA 3MIHA 3R4SA 4LLFA 3ALQA 4JDNA 2XL7A 1GKBA 1JTZX 1VBD2 4OVEA 4IEYA 1R1A1 3ME2A 3ZX7A 3NV1A 4RR3B 1DU3D 5FFOC 3LZZA 4R9BA 2X8KA 3P3PA 2ZGRA 1H30A 4UXAA 3HN1A 1VBC3 2Z2SB 2RHPA 3HT2A 3MIEA 5FLHA 2PQQA 1QH6A 1FPN1 4Y24A 4J6GA 1QJU3 5EWSA 1QOOA 3WD5A 3ZXDA 3MW4A 3R05A 2PA7A 1VBB1 3FHIB 4IETA 1B09A 4CEYB 4FTBA 1W6MA 3MW2A 1S0CA 1EPZA 1DFQA 1S0FA 1AL21 3VDDC 4NWWA 2XJVA 4QPGA 1UX6A 3J8F1 1V70A 3IDCB 2WNVB 4KWLA 5IK8A 2X5IB 3I54A 5I8SA 1Q8OA 1WCDJ 2EXIA 2DVGA 4N43B 4FPEA 3ZXJA 1TME2 4S2DA 1G7YA 1AR71 1AR91 1GICA 1F5JA 3M7AA 4OUMA 2P3KA 2ZPXA 1XRUA 4DFSA 1X8MA 4TSVA 4A7ZA 5GZCA 1X7NA 2ZA9A 1ZZ9A 3M3IA 5D8AC 3SH5A 1C1FA 2RMU3 3WP3A 1EV13 1T6GC 2ZOEB 2PHLA 5GZDA 5K0UA 2JG8C 2ERFA 3JD71 3AP9A 5J48A 1H1MA 1REDA 5DG2A 4LHKA 4X6QB 4B3NA 4B8EA 2IXKA 3EBRA 4LBLA 4ONUA 2UY8A 4XDQA 1FV3A 3FLTA 1WMFA 4BM8A 1BKZA 3JU9A 2FZ2A 1RVF1 5KHGA 3ZFEC 3KMHA 2XUMA 4B4RA 4HLTA 4AW7A 1D4M3 1JH5A 2ZX0A 4X8NA 3TNQA 4RQPC 3JB8A 4COZA 1TNRA 3FFZA 1UIKA 2BFUL 5EV7A 3VZJA 2Q1ZB 3O0VA 4M3CA 1ZZ7A 1Q8PA 1VAMA 1TMF1 4HETA 1REEA 1PO23 1DZQA 2BFUS 4RHV3 4OHVA 4YW5A 3L2HA 4AFAA 2N7GA 1OLRA 3BALA 1H1AA 1LU2A 3N7JA 5E16A 4LBQB 2IXCA 1V9U2 1UD1A 2ZCWA 5J36A 3JBG2 2E6VA 5LK7B 4LUKA 1ENSA 2GSYA 1N1SA 3RMYA 1QJZA 2WINB 5CG9A 3KT4A 3ZXAC 2WZR1 1ZBA1 2R062 1RITA 1RUD2 1PK6A 3AZWA 1SLLA 3BIWE 2VVEA 4QGLA 1C8M2 3FC0A 4BLJA 2XBO2 1DDLA 1OLQA 1RUF3 3ZSMA 1R082 1VBA3 2RM22 2YV8A 1HRV1 3PLQA 2A73B 1WLWA 4IV3A 2ZGSA 1YXWA 1DHKB 3DPRC 3VBRB 1CPNA 3KLSA 4YW4A 4FOVA 3VBOB 1B35C 1GZWA 1R091 1O5UA 3ENRA 2RS52 5J09A 1IS3A 4JCKA 4NHLA 4LHLA 3WP6A 3UJQA 4YVSB 1VBC2 4UW6A 3W9AA 4HMZA 3ZSJA 4D69A 3OPZA 5K8SA 1DGRA 1ASJ3 4QX5A 1QJU2 1G9CA 1SFYA 4K40A 4IL7A 1IGOA 2DWRA 2ZKLA 3RG0A 4XHBA 1AF9A 1W6OA 4RS5B 1MS1A 1HLCA 3NAPC 3V0BA 4BYYA 4AWDA 1YI7A 2D3SA 3D0JA 4OHZA 1NLSA 5JAXA 1GZ9A 2XL9A 3ZFGB 5HXVA 3ECQA 3RRDA 4B29A 3DUIA 2B7YA 2WNUA 2AZ5A 2Q5TA 5K7PA 1BCXA 2R043 3THTA 4NR1A 2VG9A 4CDQA 4BMEA 1QJY3 2UYBA 4JDMA 1CAWB 3WW3A 2B9UA 1NCRA 3H3UA 5C9AB 1ND2B 2QCSB 1HX6A 3AXDA 3EXUA 2AH2A 2JDZA 3AZVA 3DGTA 1Q5OA 2VW2A 5FMOS 1LEDA 4CP2A 2RMU2 1JXNA 2LM3A 2WLPA 1YFXA 3D5OA 1PVC3 5GLUA 1EV12 4FBFA 2C5DA 1SQ4A 3ETQA 1OMIA 1UF2C 1VRH3 1X8EA 4NVPA 3U11A 1CGPA 1AXZA 1UW8A 2WS93 5FLIA 5JSPA 2YPJA 2KA3A 1DYPA 1KDKA 2D6MA 1N1YA 1MZEA 4XJAA 2R49A 1MZ6A 2E51A 3B00A 3USUA 2XH6A 3VBHC 2MEV1 4N53C 1D4M2 2HWC3 2KXLA 2YC0A 2YMZA 4Q1RA 4JGYB 4PLMA 4DRRA 1BVP1 3D8CA 3MLJA 1DQ6A 1ZZCA 4KWJA 4GMP3 3MW3A 3NWKA 3HWJA 4ZU5A 2PELA 5LK5A 3SMHA 5GZFA 1C3HA 3I59B 1H1IA 1PO22 4RHV2 2ZHKA 4QQPA 4HK9A 3ZSEA 5H9RA 4PBOA 4FOWA 4QGMA 3ZVXA 1CIWA 4LLOA 3OD0A 3POSA 4HVOA 4IV1A 1PIV1 1BMV1 1ULCA 3GNEA 1YIPA 2G4IA 4QQHA 4RD7A 4DZGA 1EAH3 1NA1A 2BNMA 1ND3A 1HW5A 4YRDA 3WW2A 1ULEA 1AR61 4NHKA 2QUOA 3OY8B 1ZREA 2P3JA 5CADA 4ES8A 1V6NA 2ARXA 1OFNA 3GBGA 4AVVA 1IS4A 2Q30A 2CYFA 3WLUA 2EAKA 1RUF2 3E6DA 4GWNA 1I3HA 3B7MA 1VBA2 3KS7A 4FQZA 2XWBB 1IZ3A 3QCWA 2DVAA 5KXEA 1HRI1 1WA4A 2ET7A 1LOBA 4XF9A 2WA4A 1AR81 1JN2P 1QXRA 1QXJA 5BNOA 2EVXA 1VJ2A 4E2QA 2GU9A 4WVVA 1VB4A 4PLNA 2UY9A 4HZFA 1ZBE1 2H6CA 5TSWA 2YZ4A 2BNOA 1PGL2 1EP0A 4ISQA 3C3VA 1J59A 4M0NA 3V0AB 1QDOA 4FXKB 3VKLA 3CJIC 4FPOB 4JRLA 3KQRA 3UKTA 4YM3A 4Q0VA 3KGLA 2Y0IA 4C90A 3MIBA 1DQ4A 4D7YA 5L7OB 1VBE1 2XGXA 3CL1A 2XLFA 2O1QA 1DG6A 2A71A 4BH9A 1CJPA 3R4UA 3PVOA 1WW6A 4XQDA 1NZCA 4KU8A 4AYUA 2NLRA 1FMD1 2R042 1FT9A 5FLJA 1APNA 4ZXKA 3TNPB 3WINE 1QJY2 4XQ4A 5CFCB 4LBKA 4AFMA 3AFGA 5KXCA 1DIWA 1YUDA 4XF4A 3N7KA 3VDDA 1KXGA 4AHWA 3AKTA 5BNNA 2NQYA 4Q2FA 1OA4A 4R9CA 4FO9A 4AEDC 1H2LA 3GZTB 1W6MB 2CNAA 3AZXA 1DBNA 4PCRA 2WC2A 3G7DA 3ZXLA 2D97A 4AEMA 1J58A 1FX5A 1U5IA 1PVC2 5KBFA 4L92A 4G9SB 4I02A 4AQ6A 4QPGB 4JDOA 1VRH2 4QMAA 1CN1A 4WM7C 1DGRN 1MS0A 2B46X 3MF6A 4MV2A 4ATEA 4WBBA 1U5YA 1MEC3 2WS92 2A3XA 4G4FA 3O0WA 4OI0A 4CDXC 2D43A 4MZUA 1XE7A 4Z8BA 1LU1A 3L2YA 2WL1A 1AUYA 1C5HA 3UK9A 4Y1XA 4AHXA 3BCWA 2HWC2 4URTA 2GNMA 2BNNA 3H0OA 5GM0A 3HBZA 3VBUB 2D6OX 5JI9A 1MS5A 3MIFA 1OOPC 3WDVA 4LHNA 1PM7A 4LO8A 4QM9A 1UN1A 4B4QA 1CVNA 1SBDA 2VMIA 2NM1A 3ZFEA 2JENA 5KHKA 1O3RA 1IPJA 4XJUA 1GV9A 1GBGA 1LTEA 3NVCA 1SLTA 2AENA 1AHSA 4FPLA 1GR3A 2VNRA 2OZJA 3H1MA 3M4FA 1SMVA 5FO8B 1VBD3 1XYOA 2WT0A 5IK5A 3M3OA 2R073 4WVWA 4PIZA 5CFDB 5BV6A 1X36A 2JG9C 4Y20A 3VBSB 4E2GA 3MDPA 1QHDA 2CAVA 1VAVA 1PZ8A 3ZIWA 4W6WA 4KWKA 4FPFA 4CDWC 2ZX3A 3LSEA 4M3CB 1LHWA 4P9IA 3QD6A 4AI1A 5DZFA 3TRSB 4XFAA 1OKQA 5C8CC 4EN6B 1NXD1 4YVWC 3GBFA 1RUH2 4YW2A 2D6PA 2C0ZA 5FOBB 4Q4V3 4P9GA 2FMDA 5T54A 4BHPA 1Z7S3 4D3WA 4I0WB 2VECA 1JUHA 1UKRA 2WJSA 4NOTA 3AMNA 3AJYA 4COWA 1EY2A 4ZU4A 4XE9A 4DPNA 4GH4C 4FPHA 3PNAA 4PIXA 4BOWA 4L8QA 2YXSA 5E8AA 2WSVA 3P3NA 4Q8KA 4XJZA 1B35A 2A70A 1TME3 5SV5A 2CL2A 2BQPA 1KD7A 1V9U1 2W08A 3HT1A 1XYNA 3JBG1 3BOPA 1CAXA 4EV0A 3KD4A 4XYXA 3BTAA 4IV3B 1LEMA 4WZCA 2MNGA 2QKDA 1XYPA 4Q4W3 2F4PA 3PMEA 2JJ6A 4KQ7A 4N7UA 2NMOA 2R061 2ZAAA 3INAA 1WW7A 2CGNA 1RUD1 1R1ZA 4Q4X2 1MQTB 3NAPA 3EJKA 1MR5A 2DTWA 3FUOA 2XWJB 2XBO1 2UYAA 2R30A 3TBDA 5BUVA 3WDTA 2TEPA 4OHXA 5EFUA 2RM21 4XHXA 5ABJA 1SACA 1POV3 2JEMA 2O8OA 2PN5A 2O0OA 4RR3C 4WVMA 4R9AA 3WQ1A 2HWF2 3V0BB 2A3YA 3WNXA 5FPXA 3TOJA 3KB5A 3POYA 4MH0E 3APBA 4XIOA 5C4WA 1VBC1 3ZO0B 4V1PA 2WNUB 5IUQA 3B3QE 4CEYC 1QJU1 4AEJA 1QQP3 2D3PA 4HN0A 1U5ZA 4IESA 2JE9A 5FQ0A 5FRAA 4CDQB 3VGIA 3K48A 4MVTA 2K2SA 3H50A 1AYN3 1W0OA 2ZGLA 4ASLA 2GALA 4Q0QA 1NCRB 3MF9A 1OHFA 3R6SA 1Q3EA 2EXKA 1DQ0A 3DN7A 3BU7A 2SBAA 3ROUA 1NQDA 1GNHA 1KRIA 1HXS3 2WNVC 5T3NA 2X5IC 1BK1A 4GKXA 4YGEA 5LRRA 1O4YA 4HFSA 4C0BA 4LBNA 4GQ7A 1U5XA 4AVAA 2ZJCA 2XPJA 4QPIB 4N43C 1C8M3 1FOD3 3VBHA 4N53A 2WLQA 1URXA 4HANA 3OD4A 3IPVA 2QZ3A 2XJSA 1R083 3IDEA 2B5HA 1A8MA 2VH9A 3D82A 3E6BA 1WCSA 1A3KA 3IBMA 4TYSA 2R072 3ZN6B 3S30A 3ZPYA 3USUB 3AZYA 3FLRA 1COV3 2Q1MA 2WWSA 2RS53 2OW4A 1IHMA 1K5MC 4I3GA 2GNBA 1WUVA 2RMU1 1AJOA 4K6BA 1ENXA 5D1IA 2F6BA 1XQNA 5BYNA 4RFT0 2ZGKA 3DV8A 1EV11 3FLPA 2TUNA 5BNPB 1GQGA 1EYBA 3VL9A 1CAVB 3KCXA 2IZWA 4BWOA 4A3XA 5J96B 2UURA 1PVXA 4XIKA 1OSGA 4EN8B 1SLIA 4F3JA 1V00A 4Q4V2 2GN3A 3NSTA 4IV1B 3UKVA 1H4HA 1UAIA 1Z7S2 4QXKA 1D4M1 1KFUL 4OUSA 4YNIA 1MZFA 1Y9QA 3U07A 5A32A 2CAUA 5H9SA 1UKGA 3E6CC 3IDBB 1CAUB 1W6NA 2JICA 3KM5A 2HYKA 3M3CA 3VHRA 5JPNB 2Z79A 3WP5A 1UU4A 3ELNA 2ZGTA 4KGGA 4QQ2A 1PO21 4RHV1 2CGOA 4BMBA 4OLLA 5E1RA 1RIRA 3SH3A 1H2KA 1SFNA 4U2AA 4WM8C 4XEZA 4SLIA 2VGDA 4XBNA 4QT6A 2P37A 2VVFA 3ZIXA 4Q4W2 3CJIA 3LKJA 5GZGA 1F9KA 3BB6A 3KZ4C 3HQXA 5BNOB 1OA3A 3OGGA 4I2OA 1Q8QA 1WGPA 2RR11 1QJX3 3PVNA 4OI2A 1FNYA 4FQ4A 1ALYA 4DXZA 1RUF1 3AKRA 1H9WA 2R6QA 4AVCA 5DZGA 3AYCA 1VBA1 5FBZA 3VBRC 2LUWA 5JOZA 4CDUC 2GMPA 3H3ZA 2DUOA 5I0RA 4F7ZA 5I93A 1JUIA 3VBOC 4YZ3A 5A33B 5JDBA 1BJQA 5L36A 3ZFFA 4Y22A 5DXDA 1ZRFA 4YVSC 1LOGA 4LBJA 2WIIB 2DCZA 2UWAA 1H2NA 4P9JA 5KC5A 2NPIA 1UL9A 4FP3A 4CEWA 4MGIE 4XETA 3AXEA 4RL7A 4AEDA 1PGL1 3KCCA 4B7EA 3N4MA 1ASJ1 5GLWA 1UCXA 1H0BA 1QQP2 3GZUC 4RS5C 3MICA 2ARBA 2V73A 4O9EA 2IFRA 5FO9B 1PGW2 4AVTA 5JOWA 1QWRA 2A6XA 3Q9OA 1M06G 1AYN2 5GLTA 4XJ8A 2BWCA 2D40A 4N7IA 1QY4A 4DB5A 4HK8A 3VDDB 4AQTA 2A6YA 3ZFGC 1PGSA 4WM7A 5BNNB 1BEV3 1HXS2 2PFWA 4CDXA 2C1FA 1W6QA 3FBMA 4QQOA 3GALA 1ENRA 1N1VA 3WW1A 1LJ7A 5DUXA 5DDJ3 1FOD2 1ZVFA 3U4XA 2R041 3N3HA 2RS13 1RUC3 1Q8VA 2CTVA 4I09A 1J1TA 3ZSLA 2WFPA 1VAKA 1ZM1A 2E7QA 2YUEA 5C9AC 3ZXGA 1ZRDA 5FTTC 3E5UA 3EHKA 4LT5A 2XJUA 2NN8A 1IOAA 2JKBA 4AFDA 4IXLA 2VQ0A 1D2SA 4GIQA 1NE6A 1COV2 2Z69A 4RGAA 3VBFB 1DQ1A 4XFIA 5F9TA 3IN9A 3LWCA 2JD4A 3NW4A 2XVKA 2W68A 1PVC1 2D6NA 3A4UA 3FUQA 3AYDA 1VRH1 1NY72 3QLQA 3ZYIB 2RS33 1N3OA 2WS91 2JG9A 5BY5A 3DL3A 3UL2A 5T52A 1KQRA 1AX0A 3ES4A 4JGYC 1SBEA 1AYM3 2A3WA 1H2MA 2HWC1 4D94A 4N9HA 2ZX4A 1LGBA 1NCQC 5KHHA 4FPGA 1Q56A 3RSJA 4FTEA 5KC6A 2NMNA 4H7LA 1VP6A 4MXWA 4GMP1 5C8CA 4YVWA 1YHFA 1F2NA 4Y20B 2VXRA 5JIAA 2ZAHA 1RMU2 4QGNA 1J3RA 4Q29A 2AGSA 4EWDA 4UW4A 4BQ1A 2YYOA 3M2MA 5ACA3 4GH4A 5FCCA 3LB9A 4C1XA 4EWEA 5FPZA 3VV1A 1EAH1 2HEWF 3IWZA 4RA0A 2K9ZA 1QNWA 4MGZE 5LRSA 4AEKA 3O7OA 2DTYA 1ZA4A 2FMYA 3IIAA 4PJYA 1QJX2 2DU1A 4DRVA 5JIUA 1DQ2A 3H1YA 4EROA 4AI2A 1TQ5A 4U36A 4Y5Z0 2RJLA 1SDWA 4IEXA 3TWIA 2ZGNA 4YGDA 3FFQA 4HSLA 1KITA 4M0HA 2ZGPA 2IXJA 3ZMOA 5A3MA 1O3SA 4LEJA 1F5FA 5T5JA 1RUI3 4UW5A 4XF0A 4R52A 5I0SA 1UMZA 3RPQA 1CAXB 1LODA 5CAZA 2AR6A 2VOXA 1RINA 4L9BA 2PTMA 2HWB3 3SISA 2B45X 2OZ6A 2TBVA 3B5LB 5LEJA 3I4IA 1FV2A 1AL22 1X82A 4LO7A 4Y4YA 3J8F2 1DYKA 5L7OC 3WG4A 4GULA 4UW3A 4AG4A 4KG0A 4P14A 1LOAA 1JYIA 1BEV2 1JOJA 5ABJB 2WZPP 4CEYA 2B39A 1I9RA 4PLOA 1WBLA 3MZHA 2VOVA 2DUPA 5KHIA 2KM2A 4P9YA 4WVMB 5DDJ2 1GYKA 4R4XA 5CFCC 1OQDA 3J4UH 1WW5A 2GNDA 2PAMA 1RUC2 2RS12 1LULA 1FAYA 2YGLA 3B02A 3H7JA 1NQJA 2E7TA 1LKNA 5C4WB 2UU8A 1SLAA 2I74A 1DF0A 1RUH3 3VKOA 3U10A 3E97A 2WQ4A 3E5QA 3RI8A 2BBVA 2IC1A 1ZNPA 3SITA 2OUHA 3M8LA 2D44A 2DCJA 3JD72 1KJRA 5GKAC 3TN93 1VB2A 4XFBA 1G9BA 3IT8A 4Q0UA 4PDWC 4MX3A 3MIGA 1PO13 1C4RA 3ACLA 4LE4A 3RI9A 2R0FA 2IXHA 2RS32 1SLBA 4PQ9A 4Z92B 3WCRA 4AGVA 1MEC1 4I30A 3T2TA 3G6JB 1YI9A 4N53B 1O91A 1K5MA 1C1LA 1LOCA 4YW1A 2B42B 3PJQA 5I0UA 1OQEA 3IPVB 1ZZBA 2CGPA 2PHWA 4LE3A 2BW8A 1Q8SA 3VBUC 1AYM2 2I07B 1QXPA 5JZGC 1CONA 3MPBA 2XJRA 1LESA 1NXMA 3SCGA 2BVVA 2MPFA 2QNKA 1HQLA 4EWAA 1RGSA 3V64A 4HL0A 2A6WA 2VULA 1QNYA 4JV4A 4BCUA 1LR5A 2Q8OA 1WMDA 4LO6B 4WV8A 5JSRA 3HD8B 2PYTA 4Q4X3 3FWEA 4WZFA 4AE2A 5GZEA 1F8VA 1ZBA2 4K3UA 5ACA2 3NV3A 4Q0SA 3EQEA 1Z78A 4NO4A 1FATA 1MVEA 4HKLA 5CFDC 1VBD1 1S0DA 2VY0A 4LBQA 4XFGA 4XMAA 4YZ4A 3VBSC 1PNGA 1H9PA 2HWF3 2R071 4I3PA 3RWNA 3ZSKA 5BNQA 1LOFC 3NO8A 1C8NA 1MZ5A 3NKTA 5F6KA 3SNMA 4WM8A 5AC93 4IQPA 2DURA 1XE8A 2YROA 1GANA 4GMP0 1RUG3 1WD4A 2XHKA 5F6LB 3N35A 1R092 1JHNA 3GZAA 2DFBA 2QE3A 3AKSA 5D8AA 5FAXA 3ZYJB 1LCLA 2WNEA 1MACA 3PJYA