3I2OA

Crystal structure of alkb in complex with fe(ii), 2-oxoglutarate and methylated trinucleotide t-mea-t
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
199
structure length
199
Chain Sequence
LAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMSVAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLCQRAATAAGYPDFQPDACLINRYAPGAKLSLHQDKDEPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGIQPLKAGFHPLTIDCRYNLTFRQAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/dna
molecule keywords Alpha-ketoglutarate-dependent dioxygenase alkB
publication title Enzymological and structural studies of the mechanism of promiscuous substrate recognition by the oxidative DNA repair enzyme AlkB.
pubmed doi rcsb
source organism Escherichia coli
total genus 47
structure length 199
sequence length 199
ec nomenclature ec 1.14.11.33: DNA oxidative demethylase.
pdb deposition date 2009-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 3i2oA00
3RZKA 4NJ4A 3O1UA 4QHOA 2FDHA 2FDFA 3KHBA 4ZS2A 3LFMA 4IE7A 4CXYA 4ZHNA 3O1TA 3I2OA 4NPMA 3O1VA 3RZJA 3I3QA 4QKFA 4IE6A 4QKBA 4NIIA 4OCTA 4QKNA 2FDKA 2FD8A 4O7XA 5DABA 3O1MA 4MGTA 3H8OA 3RZHA 4NRMA 3BKZA 3O1OA 3BTZA 3BUCA 4MG2A 4O61A 4RFRB 3RZLA 4NIHA 4IE5A 4JHTA 3H8XA 3BTXA 3O1SA 5F8PA 4NRQA 4IDZA 4QKDA 3T4HB 3BIEA 3T4VA 4NROA 4CXWA 4NIGA 4ZS3A 3H8RA 3RZGA 2FDGA 3S57A 3I49A 3BTYA 2FDIA 3BI3A 4NRPA 4NPLA 4IE0A 4NIDA 3T3YA 4IE4A 3RZMA 3KHCA 2FDJA 3O1RA 4CXXA 2IUWA 3I3MA 3O1PA 3S5AA 3BU0A
chains in the Genus database with same CATH superfamily
4CP9A 3LQCA 3RQ0A 3OSDA 3SC7X 1L7QA 2LROA 5LASA 4M3CF 3VZKA 2VL4A 2X09A 1NAEA 1OI6A 2ID4A 4CDUA 3IPVB 4IGOA 4LBQD 5FJHA 4NUBA 1SCRA 2ZACA 1DDLA 3TN91 4KGQA 1MS5A 1RITA 3I59B 3TN92 2GU9A 5CEHA 4QHBA 2R041 3FLTA 1W0OA 3K77A 2ETEA 2WZR3 4ZXKA 5A32B 1QXPA 3RWKX 4BLIA 1O8SA 1WMEA 2H6BA 3MV11 4Y20A 4FO9A 5BNNC 3CNAA 3RJRA 4UOJA 4LA2A 1U0AA 2W47A 4CA9A 3N35A 3R4DB 5DQ0A 4QHZA 5JR2A 2OA2A 1LGCA 3GBFA 4WVMA 4QKBA 5EP9A 1VPHA 4D94A 2R061 3A0NA 5FLIA 3AP9A 2P6HA 2R062 3B94A 5I8YA 1DHKB 1EUTA 3IIAA 3NRUA 5SV8A 1CPNA 1SPPB 1OPMA 1KITA 1IPKA 2WNVA 4K8FA 1ZA7A 2WUHA 4FOYA 4CU6A 1ND2A 5FREA 1UZWA 5FO9B 2VMEA 5KC6A 3MLLA 3POYA 1O4TA 5FZMA 2QQMA 2ORZA 4AEKA 1RMU1 3WF2A 3MF6A 2A75A 3WEZA 2LS6A 2PLV3 5KXCA 4RSUA 3DXTA 4CP0A 4CRQA 4GZ9A 5LB6A 4YW5A 2B8MA 2WA4A 4FP3A 5EJ3A 3W20A 4XF1A 3UKNA 1OQEA 1S0JA 2XJQA 3VV1A 1LHUA 3H8OA 1LENA 3U07A 1HQNA 2VMHA 2GNDA 5A3WA 1R64A 5F3IA 4BQXA 2JE7A 3GXUA 4HFSA 5T3NA 5J3UA 1ENQA 1FI2A 1AR83 1SLTA 4DNYA 5GLVA 4QWNA 4OUEA 2Q1FA 3ACFA 1W03A 1MVEA 5DZFA 2R073 1UMHA 4JHTA 3P3PA 4QQ2A 1O4ZA 5F39A 1RUJ3 2E6VA 1DP0A 2P17A 4BM8A 4CPBD 3I97A 5FZ6A 2YUEA 1WW5A 2B42B 4P9IA 4EROA 2F6BA 2WLPA 5K0UB 4AHXA 4FQ4A 3WX5A 3JD71 2C6SA 3GGLA 2QBXA 3JD72 1HKDA 1GP6A 2AUYA 4GD4A 4LK6A 4E4ZA 2D6PA 2WN3A 1SDDB 3KCCA 1WZXA 1WMDA 3RPQA 4AHZA 4BHPA 1RYYA 4OHXA 3SCFA 3OJBA 3OG2A 1NG0A 1VBC1 1BBT3 1D2QA 2YZ4A 2JB4A 1VBC2 4NRPA 2NZ9A 3WXPA 3I8TA 4NPLA 1XNBA 1JYXA 1W8UA 1MEC3 4KNCA 5C9AA 1G9DA 4MGZE 3KHCA 1JI6A 3GNEA 3KV4A 2A73B 4MSVA 1C3HA 3AXDA 4NHXA 4H2AA 3FL7A 5BNPA 3DCQA 5EHDA 4FSJA 2H0VA 4KU8A 4OI2A 4CVUA 1CESA 3LEIA 2B4KA 5LA2A 4AI8A 4AE2A 4D6QA 1VB2A 2J42A 3LGRA 1QDCA 5CU1A 1J84A 4M4RA 2DV9A 2WAOA 2YG0A 5J36A 2K0GA 4LIUA 2VNRA 4O65A 4LQRA 3RI9A 1JODA 2P3KA 3S7IA 1OC1A 1RC6A 3BPSA 3NNGA 3AYCA 1GZTA 1ND3B 4FPCA 1RB8G 3KF5A 2G9ZA 4B7KA 2ZMKA 2Q30A 4CE8A 4I09A 4SBVA 4ZHNA 3Q8BA 3LA2A 2JDYA 4ZPIA 4E2GA 1F4AA 4A42A 4LO4B 3KVBA 5EPAA 3DL3A 2BRTA 3HBZA 3H7JA 1PIV3 4LKDA 1XNKA 4PBOA 5ACA3 4Y5Z0 2OUHA 4ITCA 4GWNA 1H4GA 4RHV1 5D1IA 2RHPA 4AHYA 4IQPA 1JMUB 1ULEA 1UZVA 4LKSA 4RHV2 5GZCA 1YUDA 2UYAA 2JD4A 4IERA 3V0BB 1CZSA 4GQ7A 3VDDC 2AEYA 3AP6A 4KWKA 1SCSA 1YIFA 1QJFA 1ST8A 3BPZA 1H9PA 1E5RA 3AVSA 3H7YA 1ZM1A 3T30A 2WWSA 1OH4A 3WZ1A 2B9VA 4DMIA 2VZOA 4OCTA 3GJBA 3FLPA 2WNEA 4Y3OA 3BTAA 5DXDA 3D0JA 1H2MA 4LHKA 4UAPA 5IVCA 2WZR1 1NLSA 5FZCA 1QXRA 2BW8A 2WZR2 1Q5OA 1H9WA 1W8WA 3AZWA 1V6LA 1W9FA 4ZU5A 3ROUA 2VD7A 4QPWA 4M00A 2OPKA 2XONA 4XACA 4BMEA 1X50A 2Z79A 1XYOA 4EN7B 2B7YA 5JZGC 4UF0B 1WD3A 1PM4A 1GLHA 4JV4A 4W50A 1WA6X 2XPJA 1NZIA 2CNAA 4LBMA 4P9JA 4UWDA 1GQGA 1UO9A 4BE3A 4YG3A 3VBOB 4P00B 5F6LB 1TNFA 1MACA 2YC0A 3GZEA 1LHOA 4A7YA 2ZHKA 2A6WA 2DCJA 1W8TA 3RYKA 3T09A 3O5SA 3K3OA 3CL1A 2ZGOA 2WDBA 4YM3A 4AQ2A 2Y60A 4ASMB 4AVCA 4Z92B 1NCRC 1EUUA 3SKVA 1IS4A 4NAOA 5FZIA 4AI2A 1IKPA 2D3PA 2PQQA 5FPZA 2PLV1 2PHUA 3KCYA 5JUVA 2RS33 1ZRFA 2QQWA 2PLV2 4FTSA 2VZTA 4AI0A 1OOPA 3N4MA 2R7EB 3UV9A 4DRVA 1KFUL 2Q4SA 4PDWB 3NW4A 4OHZA 4IEZA 1HV1A 1KS5A 1OPOA 4DXRA 1YJLA 4R9CA 1QNYA 3WP6A 4TTGA 2QQPA 1R1A3 2BOJA 4L11A 1AR81 1IG0A 4BJ0A 1AR82 1DF0A 5A7OA 2C4XA 2O1QA 3WNNA 4N53B 2YYOA 3EXUA 3POFA 2JDNA 5C7GA 4AGGA 4M3CB 1XXNA 3VL8A 1D4M3 2P5BA 3AP4A 1VMFA 1RUJ1 4PQ9A 1JZ5A 2XLGA 2C24A 1J58A 1RUJ2 5DZEA 3QBQA 1MS4A 5E89A 3TEYA 4Q4W1 5KR7A 4Q2FA 3ZFGA 1YQCA 4E2QA 4Q4W2 3ITQA 4EE2A 5F7UA 2EIGA 4A4AA 1GP4A 2OQ7A 1LGNA 2YBSA 1O5UA 4YLZA 5FQ0A 2QE3A 2WT1A 2VQAA 4XQ4A 3RFRA 4ARXA 3POJA 5FUIA 2PFWA 5D8AC 4YVSB 1BBT1 5L7OA 1WGPA 2WSUA 4IEPA 1G7YA 3BB6A 5M0TA 2DURA 3KT4A 4SLIA 4ZONA 1NCQC 2MHFA 3E1F1 2EIEA 1B35B 5DMYA 3KF3A 4HPKB 1A34A 2GH8A 4XVHA 1KFXL 1OUXA 1ULCA 1NA1B 2D6OX 2UWCA 1QQP1 3NAPB 4QB2A 2MEV3 4XMIA 2HWE3 4XQWA 1QQP2 5FTTC 4P02B 5F5IA 4QQLA 1W6QA 2E63A 1N1YA 1VMJA 4FQZA 2XWBB 4XDPA 2Y6KA 4AYUA 1FV2A 1EYBA 1QHDA 4NHYA 3L9JT 1UU4A 3ZM8A 4AOCA 1W6NA 2LTNA 5FYTA 3BIWE 3V65A 1OA4A 1K5MB 4YZ5A 3UGGA 1F5FA 2XR4A 1UD1A 2W68A 3APBA 1OQDA 4JGYB 2HEYF 1IS3A 4RQPB 5A1LA 3DPRB 4GH4B 3VD3A 5EV7A 1NQDA 2ZKLA 1H1IA 1LGBA 1PHMA 3M2MA 3IZOA 4EJRA 4MH0E 1GWLA 1I1EA 1K3IA 3VBSA 5ACA1 2ZXQA 5ACA2 3JB8A 1F9KA 4FCAA 2QTWB 3LIHA 4JGZA 3I4IA 3RZHA 3ALQA 3NQHA 2V5DA 4NRMA 4CDWA 5C33A 3WP5A 1RIRA 4EN6B 3ZFFB 1WMFA 4XYXA 2YBKA 3BTZA 1OF3A 3HOBA 1Q8OA 2W52A 3DUIA 4LO6B 3DYOA 5A33B 4CEYA 1V6OA 4L9BA 2GN3A 5CAZA 2WABA 5FO8B 5FZ1A 1FPN3 2HYXA 4BU2A 3ENRA 3T1LA 1JYNA 5BY5A 1ZNPA 1UIJA 3LIGA 3PIGA 4CDXB 1CD3G 1GZ9A 2FCVA 3HMYA 1MS8A 1EPZA 3O1SA 5D21A 3WW1A 1H30A 3TEXA 2VVDA 4QXHA 5DDJ3 4ZU4A 4BDVB 5CBLA 5H9PA 3O0VA 3BCWA 1GZCA 2NN8A 2PMWB 3AJYA 1LU1A 4DXTA 2EIBA 4XUNA 2CTVA 1W8NA 4K21A 5JLVA 1GZWB 4QPYA 5GM0A 1W2TA 4OQ8A 4P9XA 1CIYA 1G86A 2W95A 1MS1A 1UZYA 1UY2A 4I2OA 1RJ7A 1Y43B 4QM8A 4I02A 1UXXX 4LPLA 3T0AA 2P6CA 5KWRA 1J3PA 3QH6A 4BOWA 2BNMA 1BJQA 4OULA 4IL7A 3WDVA 1QJU3 1OF4A 1COV1 3KM5A 2XVLA 2XKOA 1RVF3 3MIDA 1COV2 4FOQA 4P9GA 4UW3A 5FY1A 3USUB 4B4QA 2C9AA 3OUIA 5K0UC 4LUKA 3GM8A 4CXXA 3WQ0A 2XJUA 4UW4A 4RS5A 3WQBA 2RS31 2RS11 2NQYA 3IMNA 2B5HA 1Y9MA 2RS12 1SLAA 1UOBA 1GOFA 3KQ4B 5CZKA 1RHI3 5DPNA 4LKFA 4XBLA 4NIAA 2AGSA 3J7NA 1YQ8A 4UW5A 3VKLA 3WCSA 2PHTA 2CGNA 2ZJCA 4FVVA 5GLUA 4L2NA 1R1A1 4ZS2A 2I07B 2OKXA 3WNPA 1DGWA 2GALA 4NVPA 4LHNA 1TME3 2WQZC 4S2DA 4AEDB 1YNAA 1J1TA 4GWIA 3H3UA 4D7TA 3IMMA 5DUWA 2DCTA 2VC9A 3JU9A 5I93A 1GANA 2RS53 3QD6A 4XEZA 2G1MA 1D4M1 4Q0UA 4URTA 1YJKA 4YRDA 5FMCA 3VDCA 1SEFA 2ZGUA 3IM0A 3KV5A 1RUI3 2ET1A 4JKKA 1CJDA 1W8FA 2J1EA 2GP5A 3I54A 4WM7B 3N7KA 4WBBA 1Q3EA 3P5BA 3NKTA 3OGJA 4M3CE 3ZN6A 3EO6A 1FMD3 3MYXA 3ON7A 4YW6A 2Y64A 5FR3A 4ZXEA 1ND3C 4CDQA 2IXHA 5CG8A 4AWDA 5CFCB 2RDNA 4Q4V3 2XBO3 1ZZ6A 5C5TA 1CAUB 5HCFA 5A3NA 4ISRA 2XXZA 5FFOC 2XQRA 4HKWA 2ZZQA 4A6SA 1V6IA 3IIIA 1ULFA 4CCDA 4WM8A 4D69A 4RR3A 4HL0A 3SEPA 4YGCA 4LEJA 4UXAA 4N9HA 2ADEA 4J1WA 3FLRA 3RG0A 4UFLA 5FK7A 3NJZA 4FAHA 5JIUA 4QX1A 5DG1A 2MEV1 2HWE1 4G9SB 4E8DA 4ZZ5A 4Q8KA 4KH9A 2HWE2 4COWA 3QLQA 1F4HA 1UYYA 3IDBB 4KG0A 4XDQA 5I0DA 2HWF3 4XUOA 1H1MA 4FFGA 3NWKA 1MQTA 1CZVA 3WNXA 1WLWA 1YFUA 1UAIA 4KQ7A 2OIIA 1XE0A 1YQ5A 3JUUA 1N3QA 3RZLA 5EFUA 5FY8A 3C3VA 5L9BA 3ZN5A 3KCXA 1RTVA 3TWIA 1D0HA 1IQDC 3PUSA 2FQPA 4OMCA 4BXFA 5L9VA 3GALA 5A1FA 2PN5A 3VL9A 5JCTA 1MS3A 4LE3A 5T5PA 4ES8A 3HNMA 3VBOC 4XAAA 4MXWB 1XU2A 2W91A 2VPVA 1W2AX 3MBWA 1OLMA 2WL1A 3VZMA 1LEDA 2E53A 3CJIA 4Y4YA 2WZPP 1FNZA 4XUTA 3I2KA 3KSCA 3I49A 5IFTA 3ZYFA 5C3QA 4XPVA 4EZHA 1M4WA 3BI3A 4TLFA 2FMYA 1FPN1 1F31A 4I3PA 1V9U1 1FPN2 3AKPA 2VQUA 1V9U2 3OEAA 4AL9A 2EALA 2IC1A 2CAUA 3R05A 1W9WA 3S6PA 2X5IB 3O1RA 3OEBA 4LOTA 1W6PA 1ENXA 2QZ3A 1NOVA 1ZBA1 3K4AA 2ZX3A 3R6SA 3T0DA 1BHGA 1ZBA2 4PDWC 1MR5A 2CYFA 5LK5A 1GNZA 2AEZA 2DU1A 2CDPA 1CAWB 2A5ZA 4Q29A 1H0BA 5CKQA 4NHLA 4QGMA 1UXZA 2E7TA 1XOYA 4GWJA 2VMIA 3RZKA 4CDUB 4Y1YA 2PQSA 4ET7A 1CQ9A 4KBBA 4N53C 4QX7A 4NAMA 3U14A 1CZTA 2DCYA 2DUQA 3DGTA 2DCKA 2A70A 3U78A 4B8EA 4IE7A 3MICA 3SH5A 4FPJA 5C4WA 4LT5A 2JE8A 4P9YA 2B46X 3TN93 5A7WB 1LTEA 3I3BA 3M3QA 4AVTA 4CEWB 1QJU1 1YQ6A 1YC61 1RVF1 3KS7A 1FV3A 3PDQA 3AB0A 3W9AA 4JRLA 4AFMA 5J1XA 2VZ1A 1ZBE3 1SACA 1GKBA 2VZQA 2VXJA 3MI8A 5A3OA 4WVMB 1IS5A 1ZREA 1HXS3 3PUAA 2IXKA 3T1MA 3WNMA 1E5IA 1JTZX 1RHI1 4QM9A 5JOXA 5IVYA 1RHI2 4QKFA 1KDKA 1OHFA 1QJY2 2VNVA 5FYIA 4YVSC 3BGAA 3ES1A 4YZ3A 4FXGB 5JXGA 3OGSA 2WYSA 4N9IA 3C7GA 5HBAA 3CBNA 1AHSA 2YB7A 4U2AA 1B35C 2D40A 5KHJA 1ALYA 2K9ZA 3HQUA 4IV1B 4LBLA 2WNOA 4LHLA 1NA1C 1TEIA 3NAPC 2Q8CA 4ZU7A 2RS51 4CCKA 4HVOA 4N7IA 4K40A 2RS52 5FAXA 3MIGA 4FPEA 2ZGKA 2C5DA 4LO8A 4YW2A 1RUI1 1VRBA 5LZ6A 1LJ7A 1PGSA 5FZOB 3N9OA 3VD7A 4LHSA 3C7EA 1LNSA 2N7GA 5DUUA 1K5MC 3FC0A 1ASJ1 4DRRA 1NZCA 4Q4V1 1ASJ2 2EXHA 4GA9A 4JGYC 4RQPC 5IW0A 4DUVA 3B3QE 2W1UA 4M01A 4O61A 4C90A 3DPRC 3OPWA 4MYEA 3RDIA 3WQ7A 1HRI1 2RDSA 1QOSA 3E6CC 1HRI2 5FY5A 1JZ8A 1HLCA 1RUC3 4UFKA 2E9QA 4MVTA 3H8XA 2VBPA 3K75B 4R9BA 2VH9A 2DVGA 2BGOA 2D44A 3PJYA 1V0AA 4P5YA 5ANNA 5H9RA 2FBEA 5LEJA 2TNFA 3OCPA 5IJRA 2XQXA 2A7AA 2YFZA 2E31A 3ZFFC 3M3OA 1KGYA 5FXZA 3ELNA 1V6MA 5BNNA 2HWF1 2BWAA 4NIGA 2R6QA 1X82A 1GQPA 2HWF2 2YV8A 2QQIA 3N9LA 3PLQA 5LEKA 4FPLA 4RFT0 3AKRA 3PVOA 3I2FA 1TG7A 5JWPA 5CG9A 4CDXC 2NPIA 3PVNA 4LLFA 2GP3A 1BLZA 1OUSA 1O3SA 4L97A 1OXCA 1WCKA 4IE4A 1FNYA 4UFIA 2VCBA 3EB7A 1WD4A 1MZEA 3KMHA 3T2PA 5BNPB 2QQJA 3CZJA 1IS6A 5HCAA 3LF7A 2CL2A 1NE4A 4BIOA 3L2YA 2J1RA 3CU7A 2MNGA 1RXFA 3VBHB 2IVJA 1WKYA 5LBFA 1W6MB 2VZVA 1LOFC 3S30A 4Y24A 3O1PA 1DG6A 1VP6A 4H3WA 3WVJA 3ETQA 1I5PA 4Y5TA 4D6RA 2YROA 2ARAA 3P3NA 1KXGA 4JDOA 3AX4A 2DFCA 1JYWA 2VOKA 2WS93 3OY8B 1W0NA 1YRZA 4NR1A 1SFNA 3V56A 1J3RA 1BVP1 1BK1A 2CHHA 2WA3A 3Q8EA 3HNYM 3H42B 3B00A 3GYDA 2HWD2 5EYYA 5BNOB 1LULA 5JMCA 1OKOA 3RYRA 1O7FA 5HI0A 1VLNA 3MV01 4Y5SA 1N3PA 3E5XA 4IXLA 2BBVA 4PT6A 2Q8DA 2JX9A 2VW1A 5A7NA 4XUPA 3DKWA 5FP7A 1JHNA 2R30A 4JHZA 1UN1A 1PK6B 1RUG2 4AEDC 1H4HA 5E6HA 4NIIA 3HN1A 3WNOA 2ORXA 1G9CA 4L99A 3VBUB 3ETPA 1KQRA 2ZX4A 4G3YC 2E32A 4HBNA 1JYIA 2BVVA 2Q0AA 1I9RA 3WNLA 1S0IA 1RL3A 1WCSA 2XJVA 4MO3M 5A80A 2WBKA 4CCNA 1WW6A 1ENSA 2V72A 1OQ1A 2JKBA 4GAZA 1ZBE1 3MO4A 2K2SA 4Q0VA 3PU8A 4J6GA 4WM7C 1ZBE2 3VBFB 4AEJA 3RS6A 2VE1A 4BYYA 4P08A 1HXS1 4AFDA 2NM1A 2Q8OA 5CFCC 1HXS2 1V6NA 1RUH3 3K46A 4QQOA 1A8MA 1HJFA 1UQXA 2PHRA 2D6NA 1LHNA 1S1AA 3FFZA 3LKJA 4XF3A 4XFGA 5DN2A 3WHTA 1QXJA 4MG2A 2TBVA 1CX1A 5AVPA 2V09A 4RFRB 1K12A 1XPWA 1H2LA 5DAXA 3V0AA 2YPJA 4XC9A 4XIKA 5FV3A 5JPNB 5E1RA 5FBZA 2ARXA 3ZDVA 2ZGSA 5J37A 3FWEA 5FZ0A 4NRQA 5HCBA 1JYTA 2WO3A 1XJAA 2A6ZA 4HVRA 4KGGA 2BFUL 2XH6A 1BXHA 1VE0A 4DFSA 2Y26A 4EN8B 5FYUA 2VU9A 2G9GA 1QGLA 1UL9A 3NMBA 1TQ5A 2JDHA 2O14A 3NVCA 4I0AA 4Q4Y3 4CXWA 1AR63 1NLQA 4PLOA 4GMP3 1X8MA 4CCOA 2D97A 3AZVA 1SMVA 1WCQA 1PZ8A 2BTVC 5FKCA 4COYA 4Q8LA 1AX1A 1Q8VA 3VDDA 3UNPA 2CGOA 4NIDA 2NP0A 1P8JA 2DUOA 2PHWA 1RUC1 3S0MA 3FFQA 4YG6A 4A45A 1RUC2 1ZZBA 2ZEZA 1APNA 1URXA 5DAWA 1W0PA 4MGYE 5JDBA 3FX3A 3KD4A 3NNJA 5LRRA 1R093 5F5CA 3WSOA 2IUWA 5GLZA 1GWMA 4QB1A 4TSVA 4Q4W3 3USSA 2O8OA 1S0GA 4UFMA 3ZR6A 1Y9GA 3AK0A 4ATFA 4D6SA 4W65A 1VBA3 2FCTA 5FZAA 1YQ2A 2IXLA 1OBNA 1XNCA 3GF6A 4CUAA 3EQEA 4MX3A 1CAVA 1E5HA 3SH3A 5JZGA 5L7OB 4HONA 2J22A 4MADA 2FDHA 2WKKA 3GHMA 5GLWA 1MPXA 3SQOA 5HPOA 2QQOA 4YSFA 5GZDA 4OHYA 2X5IC 4Y22A 4AF9A 3WDTA 4QPGB 3I2OA 3DYPA 1WBLA 5EJ1B 5T55A 4W4ZA 2C9KA 1W6QB 4ARYA 3KV6A 1Q8PA 4DS0A 1QQP3 1NCRA 4GKYA 1AX2A 4IEQA 4CDUC 5C8CB 4QU1A 2OVUA 3RI8A 3TAYA 4YW3A 1JW6A 4IGPA 4COZA 3NJYA 4YW4A 3TEZA 2OS2A 5F2SA 3ORJA 4XCBA 1BVVA 2WS91 1NKGA 1T6GC 4CEWC 5HXVA 5BV6A 2WS92 4AGVA 4TZDA 1IPJA 2ZGLA 4DEQA 4XJ9A 3PURA 3CKHA 4OI1A 4BQ1A 5DABA 3LOBA 2Y0OA 3MFAA 4I30A 2ZS6B 3RZZA 3T2TA 1TZOA 2W5FA 4CCEA 1BMV1 1DZQA 4DOUA 1BMV2 1U5YA 1ZYBA 4IV3B 4E4HA 2BVBA 1LU2A 2AZ5A 3WDYA 5BUVA 4YZ4A 3THTA 2IVIB 2UWBA 3VDAA 1GP5A 1Y9QA 4Q1RA 3OYWA 4XJAA 4A6OA 2PHDA 2Y6HA 1QNWA 1MS0A 4AHWA 4BQ2A 2YGMA 3U11A 5A6QA 4EWAA 5JSPA 5B4XA 2RE9A 2XUMA 4IV1C 5J48A 2VZ3A 2OT7A 1AZDA 3IDCB 2VMDA 4HN1A 4FXKB 3ZYJB 4GXLA 2HH9A 4KMQA 2Y8KA 1XE8A 5D8AA 3KGLA 2VCMA 2ZEYA 2VUDA 3SNMA 3SXWA 4LBQB 3POEA 4LE4A 1F8VA 4NWVA 1QJEA 3W21A 4MXVA 2JIJA 2VBBA 4XHBA 1DYOA 5F5QA 5B4NA 2EAKA 4V1PA 1NCQA 4Q0PA 5DAPA 2WIIB 4QB6A 1VAMA 2OZ6A 5FP3A 1X9PA 2D43A 1RUH1 2Y6GA 4XAEA 3T08A 2GNBA 1RUH2 2Z4FA 5GZEA 1QDOA 1UOGA 5CFDA 3UJQA 2FDGA 1OKQA 1GFF2 3I7DA 4UBHA 4CCMA 1JBCA 3MLJA 4XFFA 4B1MA 2XGXA 3VHPA 4H7LA 3IPVA 3W5MA 2V5YA 4E2SA 4BK5A 3MZHA 4QX0A 3I59A 1COV3 1VBD2 2FDJA 4FFHA 3SLIA 4CUGA 5J96B 2QKDA 5A32A 1JZ3A 4O9GA 3SKJE 2XL9A 1J1LA 2BBAA 4WZCA 1SLIA 3PJQA 1H6YA 4WVVA 4OLLA 2RS13 1CIWA 2AACA 3ES4A 3LA7A 3MPPG 4OZXA 1V6JA 2Q1ZB 3H1WA 1GOGA 2ZA9A 3BU0A 3RYPA 3CMGA 2Y34A 4Q4Y1 3B7MA 4RYDA 4A41A 1AUYA 1AR61 1JUHA 4Q4Y2 4GMP1 1N1TA 1AR62 4CZSA 1C1FA 1AR73 2OZJA 3HVDA 1DQ2A 1TMF2 2BEOA 2ZHNA 5BNPC 2CWSA 2VGDA 1SPPA 2Y6FA 4OFGA 3GCWA 4RA0A 4GKXA 3E97A 1BKZA 1PVC3 2X53S 5FPUA 1ZVFA 2CWMA 1EV11 3VBHC 2BYVE 5I8TA 1EV12 2JICA 2IXJA 1IOAA 2WAAA 4NPRA 4PI2A 4BISA 1O59A 1CX4A 4YGDA 3B02A 3TNQA 1R091 2BU9A 4P14A 1R092 5C5UA 2PHLA 5FPXA 2A6XA 4AFCA 3LZZA 1VBA1 1RUNA 2WQ8A 4YVWB 1VBA2 1JYVA 2QVSB 5ABJB 5HV4A 1OMIA 1BZWA 3K3NA 3LAGA 1C8NA 4H14A 1G9AA 2VJXA 5F5AA 5DAQA 5BNOC 1U5ZA 4HKLA 4Q26A 4BCUA 2GSYA 4X8NA 2FD8A 1Q8SA 3HNBM 4FAGA 3AZZA 4QX3A 1L7RA 2PTMA 2HKXA 1OURA 3WUDA 4C0BA 1F5JA 2JG8B 2VUCA 4PF5A 2W1SA 1VALA 1UCXA 3B93A 1BYHA 5JAXA 4B4RA 3IDEA 1AXKA 4W6XA 1NUKA 4MGTA 3C7HA 5K0UA 4OUMA 3RMYA 1PK6C 5EZWA 1VMHA 2DDUA 1H8TB 3VBUC 5AFBA 1PZ9A 2XKPA 4YM2A 3M4FA 4LMFA 3RNSA 4N43B 2RV9A 4QX5A 3VBRB 1LESA 2PHFA 1CAXB 2XL7A 5FZ3A 2PHXA 3C7FA 3AL5A 4MOAA 4BZ4A 2J1AA 1PVXA 3H3LA 4JTOA 3VBFC 3F2ZA 5F8PA 2WFPA 4QKDA 5E16A 5JMOA 3J4UH 3B9CA 4OQ9A 5APAA 3I2IA 1MVQA 4AI9A 1PMHX 3CJIB 1FYUA 2JDKA 5GKAC 1OLQA 3U4SA 3WF1A 3MIHA 4FFFA 3VZNA 3AJZA 3NJVA 2VQTA 4QMAA 4XDOA 2PAEA 3T2OA 1JOPA 5CIRA 2RM23 2DYCA 1NY72 3F95A 1H2NA 1G6NA 3SCGA 5H9QA 3EHKA 1V9U3 4E8CA 5KHKA 4KWUA 4AFBA 2JXAA 3UL2A 3MLKA 2EXIA 2FZ2A 5FYCA 1CR7A 2A3XA 4PIXA 4W6YA 1UKGA 3A22A 3H1MA 5KBFA 1LOCA 1W6OB 1ZBA3 3WR0A 3SCHA 5AC91 4DXSA 1GU3A 5AC92 3J26N 1QJX3 1STMA 1A8DA 1TVGA 2IXIA 3D0SA 3HJRA 2D5HA 4XMAA 5FMOL 3ACLA 4R52A 1UY3A 2VBDA 1U5IA 5KHHA 4DY5A 3ZN4A 3Q8AA 2EAAA 1DGRA 3FUQA 4QX8A 3VZJA 2VOWA 4OI4A 4YW1A 4HANA 3V0BA 1F15A 2EF6A 4V2VA 5F37A 3NV3A 5CKNA 2QZ2A 1ZRCA 1IZ3A 1G9BA 2XUEA 4M0HA 5LA9A 2VAUA 3WF4A 2DVAA 2JG9B 2ZKNA 3ZKYA 1ZRRA 4CUCA 3NSTA 4JQTA 2RJLA 4S2HA 1S2BA 2A71A 3AFKA 5IK8A 3AP7A 2VCAA 2XG3A 4PIYA 1I3HA 4META 3MUZ1 2VOVA 5C71A 1S0DA 4X6RB 4A44A 1VBE1 2AC1A 1VBE2 2VVFA 5L7OC 4YZ1A 5IT6A 1QIQA 4UF0A 3THPA 2Z5WA 4MV2A 5FBJA 1QJY3 5KXBA 5LW9A 1DU3D 3GZAA 5IVEA 4LTAA 2ZEXA 3P1IA 3PU3A 1KJLA 4GJYA 3VBOA 4HVQA 1AR71 3OGRA 5L9RA 3WDUA 1AR72 1ULPA 4QPGC 1PMJX 1S0EA 4FPKA 1O5LA 4EN0A 3H3ZA 1DCSA 1GBGA 5T5JA 1PVC1 2WZ8A 4MGQA 4JVAA 5FZHA 1PVC2 3JBG2 4YPJA 3RJ2X 1KJRA 1HV0A 3FE5A 3SHRA 3ZXGA 5C8CC 5IATA 1G9FA 2VUJA 2RJKA 1DYPA 3IKWA 5EXOA 4IEVA 4Y33A 5JPMB 2E33A 1H6XA 1SBDA 2D6LX 2ZGMA 1RUD2 3GHNA 3O14A 3PHMA 4YG0A 4CUBA 3BKZA 4PDWA 2OX0A 3GBGA 1QOOA 3P6BA 1ZZCA 3IT8A 1ASJ3 3I3EA 3FJSA 3POWA 3VKNA 4AI1A 4A7KA 4CP2A 2AREA 3IN9A 1W8OA 5LBBA 2WT2A 3ZYPA 5I8SA 4Q5OA 4N7UA 1HRI3 3BOPA 3BYWA 4LOSA 3ZXFA 4IE5A 5JR7B 4N53A 2VTXA 1SHWB 3AC0A 4PBPA 1L3JA 1CGPA 2WT0A 4W8JA 4IV3C 4LA3A 3ZPYA 1LHVA 2P1BA 4B7EA 1UIKA 1GV9A 4QDQA 4I0BA 4HSJA 4RL7A 1Y3TA 3JQWA 4QPIB 3CEWA 5IYYA 5FLJA 4XJZA 4AW7A 4CPBA 3RZGA 4ISQA 3I2GA 4MGKE 5JOZA 1BCXA 2XHKA 2TEPA 4V2WA 3TRSB 2WWJA 2CV6A 3M3EA 2IFWA 4YVSA 4I3GA 5CVRA 3NNLA 3C7OA 5JXHA 5AFEA 2GNMA 3AZXA 2IXCA 3ACGA 4YM0A 2HBTA 2YHJA 4XFBA 2WO7A 4O9EA 1B35A 1DGLA 4HPKA 4KBZA 4MZUA 1AX0A 4QDSA 2WZEA 3C2UA 3ZXJA 2WNUB 2VY0A 3MIFA 2ZHMA 3OBRA 3I3MA 3NAPA 1RGSA 4C8DA 1DZRA 2DU0A 2CSGA 2W92A 4JQRA 3ZOIA 1Z7S1 4BQ3A 1H1AA 2A6YA 4H55A 1XSRA 1Z7S2 3O1UA 4D3WA 3ACIA 1LOGA 3VDBA 1CJPA 1US2A 2RM21 4YYOA 1LEMA 5FPBA 1OLME 2RM22 1CWPA 3O12A 2X29A 2F4PA 2GH2A 4Y1XA 1K5JA 2W87A 3FZ3A 2HWD3 4LJHA 4RD7A 4AGRA 1K5MA 1ZRIA 3M70A 5IK4A 5J98B 2X8KA 2AYHA 3OB8A 4JGYA 4RQPA 4L92A 4NPMA 3ZSEA 4JDNA 5CADA 3B69A 2EXKA 3DPRA 4GH4A 4EN9B 1S0FA 4AI3A 3FBMA 3O0WA 3WDXA 2RMU3 4A3ZA 4IGQA 1QJX1 4L0PA 1SFYA 5FZ8A 4H7MA 5FO7B 1QJX2 1ZX5A 2Y6JA 2DUPA 5FZLA 2PYTA 4CP9B 1JHJA 5FP9A 2VMCA 2G19A 4GJZA 1IKQA 4QXKA 5FJKA 5A6ZA 3WP3A 1UW8A 1RUG3 1A78A 3JCIA 4JTNA 1UNBA 3CLPA 4NHMA 3G7DA 1C4RA 2D5FA 1SBEA 3ZFFA 3WG4A 1IG3A 4LR4A 3U75A 1DLLA 5A33A 4C1XA 2GDFA 3L2HA 4XBNA 3WCRA 4DINB 4ES9A 2Y38A 3C8XA 3M3IA 1S4CA 4XF9A 1I5ZA 3J8F3 3PTYA 5HXMA 4Y20B 1MS9A 1HQLA 4KWLA 1D0GA 2YDEA 4E4DX 3LB9A 4CDXA 3AKSA 1KRIA 3PNAA 1CPMA 4PIZA 4XJUA 1ACCA 4AEMA 2Z2SB 1DBNA 1LOAA 1UOJA 4YVWC 2CU5A 3B01A 1W04A 2R1BA 3DYMA 4QQHA 3UESA 2RG4A 5ABJC 1ZZ8A 1M06G 5EWSA 2XDVA 1N1VA 4DIQA 1ULGA 1GZWA 1QJY1 3KWVA 4IEUA 2WNVB 1QKQA 1LOFA 1X8EA 4D0QA 4LXLA 1ND2B 5FIXA 5L36A 2LRPA 3HT2A 3D3AA 3ILRA 3VN4A 1SLBA 4WZFA 2DFBA 2JG8C 3RRDA 1DQ5A 2P3JA 4TXWA 1PGW1 3I3DA 2BWCA 5CYYA 5LWBA 3KQRA 1PGW2 3LDRA 4I01A 4LORA 3ZFEA 4C91A 2XVGA 4FPOB 2WR9A 1RUF1 2D93A 2Q5TA 3USUA 4AZZA 4BQ4A 1HIXA 1RUF2 2VZPA 3T4VA 2V4VA 5BXXA 3ZYGA 2BNNA 1LKNA 4WV8A 1H8TC 1QWRA 3DF0A 1S2EA 4N43C 4Q0QA 4LLOA 1QH7A 4TWTA 1JZ2A 3VBRC 4FBFA 4AVAA 1C57A 3SISA 3HBKA 2YC4A 1FX5A 1NE6A 3LDBA 4K20A 4OVEA 3S57A 1A3KA 3O0XA 3QOPA 5LA1A 1XSQA 4A3XA 1NLRA 3ZDSA 4K1YA 4XURA 1IPSA 4AK3A 1N3OA 1KDMA 4AEDA 3BVCA 4A7ZA 3NV2A 1XBFA 2VUAA 1PO13 4UT5A 5F6KA 5IAXA 5A6XA 2ZTNA 3D82A 1RXGA 3B5LB 4FTBA 3AYAA 3VKOA 3CJIC 5A7QA 2GC3A 2FCUA 5FZBA 5JSOA 5T50A 2D6KA 5CB7A 3S5AA 4HN0A 5A7PA 1O3QA 3HAGA 1LODA 1UY0A 4AG4A 4CDWB 4WM7A 1SZBA 5EIYB 5F1RA 2J1SA 4RGAA 2J1VA 4AR2A 4PCRA 3VLBB 1YLLA 2AH2A 2QQVA 1NYWA 3KHBA 5CFCA 3BODA 5DZGA 1AL21 1CAUA 5C9AB 1AL22 2H6CA 5FOJB 3ZYBA 2BERA 2AR6A 1WBFA 2PA7A 1PM7A 3VHRA 2Q1MA 4BQYA 2GZWA 2L9LA 3OBZA 2MPFA 4JX0A 2GMEA 3ZXDA 1S55A 4QQPA 3OPTA 2JWPA 5I0SA 4Z82A 5FZDA 3N7MA 2HEVF 1L7LA 5A3UA 1YEWA 3KZ4C 3UKVA 2J7MA 2A3YA 4PF1A 3ZXAC 1LHWA 3WINE 1AYM3 4AAXA 2JG9C 4OZOA 2KD7A 2QUOA 4CSWA 2V73A 5I0UA 3JXSA 3DXUA 4CTEA 5T5LA 3NV1A 2LW8A 4HK8A 2LALA 1QY4A 4DB5A 2HWD1 1VB4A 2ZHLA 5D2AA 4O7XA 4YGEA 1EPWA 3M8LA 3AL6A 2ERFA 3TYJA 2ZX0A 5AVAA 4CU7A 3KVAA 4HG6B 3HQRA 3FHIB 2ZABA 3AMHA 4INDA 1EY2A 2RMU1 3GDBA 4UW6A 2RMU2 4MGSA 3J7MA 2CY6A 1R1ZA 4YFZA 5I91A 1N47A 5FY0A 4OI0A 4QX2A 1XRUA 4MXWA 3UKTA 4FFIA 4IETA 1SDWA 1E57A 3TB0A 1LOEA 5FZEA 3ZKUA 1RUG1 4XILA 4D7YA 2DF7A 4LBKA 2VQ0A 2VXRA 1YIPA 1YWKA 1W8HA 2DVFA 3K2OA 4HZFA 3J8F1 1FXZA 4UBGA 3J8F2 3LWCA 4LITA 4X6QB 1LRHA 4RGGA 2BPA2 5FZ9A 3WDWA 1O6UA 2BDRA 1RUOA 4K8RB 4FI9A 4LNVA 3ZMOA 3IDAA 3FMGA 5KHIA 4Q1PA 3ZSLA 5C3OA 3ZSKA 1HRV2 1XC6A 5GZFA 1CAWA 5CFDB 3OGVA 3ZO0B 3DV8A 3ZR5A 1JOJA 3WV6A 2BQPA 4TLGA 3ECQA 1YHFA 2NMNA 5FLHA 3BTYA 3LE0A 2ZX2A 3M1HA 3W5NA 1AXZA 1ODNA 1DGWX 3T3YA 1UPSA 2R042 4COVA 2C26A 1X7NA 1UYPA 2NLRA 1VBD3 3KT7A 3MEPA 4GIQA 4MHRA 5A7WA 5F9TA 4CEWA 3W58A 1JH5A 4AVVA 4MHUA 3R4SA 4TYSA 1US3A 3WP4A 4EQVA 1OOPB 4QPIC 1D2SA 4XOGA 5A3PA 5FZFA 5GZGA 2W9XA 5F3GA 2PAMA 1VIWB 4ZKTB 1FATA 5FMOS 4LBOA 4K1ZA 3OBTA 3FN9A 1HX6A 3JQXA 4Y26A 1TMF3 2P34A 2G9FA 3AXEA 2LM3A 4GULA 3LEGA 1GR3A 1Z78A 3J7HA 2O8QA 5A3MA 2I2SA 3E6BA 1KD7A 2VVEA 3POIA 3VD9A 1D4VB 1Y4WA 3ILNA 3AYDA 5LK7B 4XF0A 5IAVA 1RMU2 1EV13 1LR5A 2WNUC 2UYBA 2XJSA 1PO11 1V70A 4IV1A 2VO5A 4X8PA 4XFCA 1PO12 2F4LA 2VNOA 3ZFGB 1OFSA 2D3RA 5FXWA 4EWEA 3ZYHA 2EVXA 3GCXA 1C28A 2EXJA 5FZ7A 3RZJA 3AKQA 2KA3A 2RJ2A 3AZYA 5EYXA 5FQ0B 5IHRA 2ZGTA 5BNQA 3ZXLA 2W08A 4IE6A 2ZCWA 4OUSA 5FZOA 3N7JA 1QOTA 1O4YA 1UY4A 4CYDA 5FUPA 4HSLA 4HK9A 3DECA 4HETA 3AMQA 5A1AA 1REDA 1DFQA 2XB6C 5F32A 3VHNA 1OA3A 4R4XA 4DEVA 4IESA 1LCLA 1HB3A 2QFEA 2YBPA 2XJRA 2ZZJA 2RDQA 1WLDA 4XZPA 1JN2P 4S2FA 2QQNA 4LULA 5A7SA 4NOTA 3DEMA 3ST7A 1W28A 3LDKA 3GZTB 3D8CA 3PUHA 3X29B 2K46A 1CN1A 1WUVA 3ZXEA 2UU8A 4GWMA 4J25A 5T5OA 4DUWA 4QXCA 4BLJA 1UMIA 2QNKA 3UT0A 1FAYA 2YC2A 2P3IA 4XQDA 1W6NB 4XE9A 1Q56A 3LEKA 4PLMA 3WD5A 4ZY9A 1AYM1 2WFF1 4AQTA 1AYM2 2WFF2 5DAVA 1DLCA 3MPBA 1WLTA 2XVKA 2KM2A 2SLIA 3RSJA 3B9IA 1IQAA 4NIHA 1PNFA 2CDOA 2P3YA 5IUQA 3IAQA 1HQWA 1AJOA 1AL0G 2W1WA 3CIHA 3D4KA 1GUIA 2VW0A 3H1YA 3KV9A 4JKMA 1OA2A 1LOBA 4IDZA 4WVWA 2DCZA 3VBSB 2P4EA 3T4HB 1YI9A 3WF0A 3BIEA 2WLQA 3A4UA 3KB5A 1QH6A 5L73A 4YZ2A 4JGZB 5ANQA 4JDMA 3VBHA 3G6JB 3RWNA 2WNVC 1W99A 4L8QA 1W6MA 1XE7A 4UFHA 4AQSA 3OUHA 1POV0 4QD2A 1ND2C 3CO2A 1R083 4ZS3A 3RGBA 2FHRA 3GZUC 2B45X 4CEYB 2BJSA 3PL0A 4LO5B 2NMOA 1SLLA 3WNKA 1C8M3 4PHZA 1IGOA 4FOVA 2C0ZA 1MZFA 5F3EA 3OY8A 5FP8A 4B29A 3TNPB 1XB9A 2ZOEB 3CF6E 2P2KA 1VBB3 4PI0A 3MW2A 1W3XA 4HT1T 5FOBB 4HKOA 4NMIA 4XTMA 1DQ1A 5BNOA 4QGNA 1UZ0A 4CCCA 4Q4X3 1T2XA 1ONAA 1UMZA 2I74A 5I0RA 5AC93 1RINA 1UU6A 1H2KA 1DQ0A 1K45A 2WRAA 5G04L 3ZSMA 4XF4A 2WJSA 5EJZB 1CVNA 3NO8A 3OGGA 3AKTA 5KC5A 1JOBA 5KHGA 1KS4A 4ZZ8A 4E4SA 1GWKA 4BMBA 3AVRA 4Z8BA 2FDFA 1WWYA 2ILMA 1PK6A 4BA6A 4RGKA 1F35A 2ADDA 2VG9A 3OOXA 5FMDA 4BXSV 2A1XA 3VBUA 3CJXA 5K9YA 2JDPA 3IBMA 5T54A 1VBD1 1RJ8A 1AJKA 2WWUA 4RS5B 1HW5A 1MZ6A 3ASIA 5FYVA 1HB2A 2JD9A 1C5HA 3O1VA 1JZ4A 1J3QA 1U12A 3A21A 1VBE3 2YMZA 2BGPA 4NWWA 3VBFA 3U0ZA 4D8MA 4K3UA 2D3SA 2VULA 5FPVA 3HPNA 2WN2A 4AVBA 2ARCA 3GBWA 4AQ6A 3KGZA 1REEA 5C9AC 4ASKA 3WG2A 2HWC3 5F3CA 2VZRA 3SEEA 1TMF1 2E26A 4QGLA 3MFCA 5BPXA 2GNTA 2ZMLA 2OYZA 1F2NA 5A3LA 1Z0HA 3WW4A 1ZA4A 3WHUA 5JXIA 4YW7A 3O7OA 1JUIA 1VR3A 1XQNA 2CAVA 4CCJA 1YI7A 3PIJA 5FY4A 3JBG3 5FKBA 4Z1VA 2VM9A 3ACHA 4JKLA 4Y1ZA 1DQ6A 3N9PA 5FYBA 1XYPA 3LSEA 4HXCA 4ONUA 4QU2A 3CQOA 1DGRN 2QQKA 5E8AA 3O1MA 3V64A 3ZN6B 4E27A 2BP6A 2XJTA 3A7QA 4CDQB 1RUD3 1QEXA 3MIBA 1AYN3 2G4IA 3LPFA 1GICA 4W6WA 3PVBB 2WSVA 3BUCA 1EP0A 5FZ4A 1HB1A 3ZIWA 4WM8B 4XJWA 4RR3B 3E6DA 5BYNA 1POV3 3WLUA 1OVSA 1PX3A 1SLCA 4GB33 2R071 1O3TA 2R072 4AXOA 1S0BA 4PLNA 3T2QA 3BTXA 1W9SA 3ABZA 2E7QA 3D5OA 3NNFA 1TNRA 3ZSJA 1AR93 3H8UA 3K51A 1OVPA 5FZKA 1HJGA 4CU8A 5FWJA 1OH3A 4K7JA 1HN1A 2VZUA 1REFA 4NO4A 4Z2WA 1O3RA 2IZWA 5FXVA 1MQTB 1JZ6A 3MW4A 5SV5A 2JE9A 3NJXA 3LOIA 1RUE3 4B3NA 2OW4A 1B09A 3WY6A 2FDIA 1UX6A 1YO8A 1BBT2 1NXMA 2AENA 1MEC1 3IB3A 3K4ZA 3K4DA 2R32A 2VECA 4XIOA 1MEC2 2XJPA 1W8ZA 1UY1A 2R0HA 2ZX1A 3AMNA 4EZ4A 1VAVA 4QPGA 5CKMA 5HCHA 3UYJA 4YWAA 2RR13 3FBYA 5I0TA 5CFDC 3NV4A 5KXEA 1PO23 2W39A 3NNMA 3N9MA 3OD0A 1GNHA 5CISA 1H8VA 2ZGQA 5FP4A 5C8CA 4LKEA 1Z7S3 4J1XA 3MUY1 3MGUA 3OD4A 5J7MA 1R081 3N7LA 1R082 1VRH3 4N90A 4U36A 3OTFA 3AP5A 4XZUG 3LA3A 3OF1A 1C8M1 2B9UA 1NY71 3WOGA 1C8M2 2QDRA 4IUGA 5FK8A 4CXYA 5FMBA 3RMXA 2ZMNA 2UWAA 3ZX7A 1VBB1 2ZEWA 1ND3A 4IEWA 5GALA 3O1TA 2I45A 1VBB2 1W6PB 4K6BA 1OOPC 1PX4A 1PNGA 2VOXA 1AF9A 1XYNA 3A0KA 1PIV1 1XNAA 4HMZA 1UF2C 4Q4X1 3Q8CA 1PIV2 4XETA 3WG1A 4YGBA 1UU5A 4JAAA 4Q4X2 2VOTA 4EYUA 4KU7A 3I3QA 4XFIA 3ATGA 1UKRA 4C1WA 5LY2A 3VB9A 4IV3A 2X05A 2F17A 3INAA 5FPLA 1TE1B 4F83A 3R0RA 4R9DA 2XWJB 2O0OA 4XUQA 5FYMA 3TOJA 4BWOA 3AM2A 1DYKA 4LUMA 4DXZA 3VZOA 5C4WB 4KI5M 3AFGA 1CONA 2VNGA 2YU2A 1EAH3 2LUWA 1VAKA 1Y7BA 3ZFGC 3S7EA 5T52A 2DTWA 3NL1A 2E7AA 5TSWA 1OLRA 3I2JA 5K4LA 2WC2A 2UY8A 3KLSA 4GALA 4LBQA 4AAPA 4YFWA 4UI9L 1I6XA 1JU4A 3WW3A 5A6YA 3HEIA 4FPGA 4XXAA 4JRAA 1XU1A 4XW3A 1W2NA 1GNYA 2QQUA 3MF9A 5FUNA 2QCSB 2QQLA 2KXLA 4WVZA 2ZGRA 1BEV3 4K9SA 5FYZA 3U37A 5IK7A 3VD4A 5DG2A 2FMDA 1ENRA 4URAA 2HWC1 4ASLA 2YFUA 2HWC2 1AVBA 2JKXA 4OHWA 1W9TA 4QXBA 3E5UA 2C1FA 5IVFA 1GMMA 4Y1VA 3ZFEB 3LFIA 5J09A 5K8SA 2JDUA 4PJYA 1FOD3 3JBG1 1ZZ9A 3H0OA 4DY3A 2VMFA 2GC2A 5FRAA 1RUF3 4LK7A 5G05L 2WO1A 3LCPA 2JEMA 2RS32 2W3JA 5A70A 1DIWA 3BU7A 5IVVA 2VW2A 1NX9A 1PMIA 2VR4A 3GJAA 2Q8EA 5GJ6A 4ORFA 2XLAA 3PTRB 3HQXA 1RUD1 3TBDA 4CCLA 4EV0A 3H8RA 4FPFA 1AYN1 1POQA 3JB4C 1G8WA 1AYN2 5K7PA 2QDNA 5IK5A 1OD5A 1R1A2 1BQPA 2A3WA 4BK4A 1NQJA 3EJKA 4OHVA 4DO0A 4XFAA 4IE0A 1POV1 1WW4A 3AMPA 3VBSC 3RZMA 1GYKA 4GB31 4GB32 3UK9A 3M3CA 2ENRA 5JVVA 4LIVA 1W2OA 4JGZC 1D4M2 5JXJA 4MGIE 1PGL1 3QCWA 1PGL2 4CDWC 3ZPOA 1AR91 3POGA 4M3CA 3PMSA 1AR92 2Y33A 3N9NA 4XBQA 2GAUA 3J9SA 3VKMA 2DVBA 4B4PA 1WCUA 4XXPA 5BNNB 1LECA 3N36A 4CEYC 2RVAA 2BFUS 2HYKA 3VGIA 4NJ4A 4AFAA 1E5SA 2GMMA 5FZGA 4QHOA 4RN5A 5FDBA 1RUE1 4YVWA 1RUE2 4IEOA 5ABJA 4MUVA 1AL23 1BK0A 2E51A 1J83A 3BOWA 1W90A 1YXWA 2IWGB 3HIFA 5JSRA 3VKFC 4NN0A 1W3VA 3ZYIB 1YFYA 3NKGA 5IWFA 3ZIXA 5F2WA 5B2GB 1K42A 3THCA 2GC1A 4LBNA 3SH4A 4YM1A 5HV0A 3OUJA 1XNDA 2JG8A 5DUXA 1UOFA 1UYXA 2A6VA 3J7LA 2RR11 2MEV2 4QDRA 1YFWA 2RR12 4R9AA 2YXSA 2ZGPA 3HD8B 1NA1A 1PO21 4TN7A 1UWWA 2W46A 1PO22 5FXXA 3E5QA 5FYYA 1ODMA 1H8TA 1VRH1 5JOWA 5IVJA 3CHXA 1JYCA 1VRH2 2PAKA 2UY9A 4P9LA 4QKNA 1DQ4A 4BB3A 4M4PA 2QJVA 3D6EA 4N43A 4C0HA 4BQWA 3QACA 1UPIA 1UYZA 4RS5C 3VBRA 1OD3A 2BV4A 5JIAA 2EICA 3RVHA 1CAXA 1HB4A 2TUNA 2J1TA 2YY1A 1X33A 4KWJA 1YYNA 3EMRA 3MIEA 5JI7A 3ZLIA 2HBUA 3AMMA 5C3SA 3OPZA 4DUXA 4COUA 3W59A 5GLTA 1OT5A 2DBIA 1LB2A 4IEYA 5LCWL 4JC1A 3VUOA 3LEMA 4M0NA 4UFJA 4XHXA 5FYHA 2XMLA 2V4AA 5IVBA 3Q8FA 1JZ7A 1WW7A 2PELA 2WINB 1UZZA 3OBAA 5CNAA 1SQ4A 2EIDA 3IWZA 2H0BA 4YNIA 3WG3A 5KXDA 4JZRA 1O8PA 5LA0A 1KEXA 1YFXA 2D98A 2Z69A 2OPWA 4NE9A 2J1UA 2HWB3 2D7FA 2EA7A 1X9TA 1EAH1 2JB8A 2JENA 2ZGNA 3T0BA 4BQ5A 4HLTA 1EAH2 2XHNA 4D7SA 1T6BX 2WO2A 2W1QA 3PMEA 2ATFA 2HJIA 3N3HA 3QH7A 5FCCA 3S5QA 5DDJ1 3MDPA 5DDJ2 1Q8QA 3TEWA 1ZZ7A 4CDQC 4NROA 1W6OA 5LATA 1V00A 2ARBA 2DTYA 4DQAA 2HLEA 3DKQA 4FTEA 2GMPA 1ZRDA 3ZMNA 1HRV3 1XNTA 3HWJA 1GOHA 3A23A 4HOOA 4WM8C 2DBNA 4RR3C 2ZBJA 4F8AA 1BEV1 1WA4A 1BEV2 2UURA 2R0FA 2YGLA 1SG3A 1QJZA 2RDRA 3UJOA 1JU3A 3V0AB 1ULDA 3WF3A 3Q9OA 3CDZB 4CP1A 1FT9A 2R043 3HN3A 4B1LA 2JG9A 1QJU2 5ISLA 2GN7A 4IEXA 1RVF2 1O91A 2YPDA 1FOD1 3AYEA 3WQ1A 4XCAA 1FOD2 2JECA 4IW3A 2OXBA 5JI9A 3N9QA 5ERLA 1HDKA 2XOMA 3R4UA 5FY7A 3VZLA 1MQTC 4YARA 2GC0A 3JZVA 1W2UA 4FP2A 1OFNA 2DVDA 3UETA 2PXJA 4Q27A 2R063 3ME2A 3EBRA 2P37A 1W06A 2CGPA 3VDDB 4Q0SA 4UYBA 3LFMA 4Z2AA 1TME1 2JJ6A 3KT1A 1TME2 3U4XA 4NHKA 1PZ7A 3HR9A 4XJ8A 2D6MA 1V6KA 1RMU3 4PQQA 1DZTA 4XABA 5H9SA 4R8HA 5C8WA 3U10A 1X36A 2OUJA 4DZGA 5FWEA 3ZVXA 2VTFA 4LBJA 2B39A 4FT8A 1RUI2 1SFPA 4F7ZA 4Y4RA 4FPHA 1LAJA 1J59A 5C3PA 1FMD1 3PVEA 3BALA 1CAVB 4G4FA 2W94A 5JZGB 1FMD2 1UX7A 3ZYRA 1GQHA 5C6CA 1MZ5A 2XBO1 3UGHA 2JDMA 3MW3A 2XBO2 3BN6A 4Q4V2 5LBEA 3U1XA 3VD5A 4Y22B 4GH4C 3WUCA 1C5IA 2FDKA 4Z07A 1WLCA 2JDAA 2ZAHA 4DPNA 4I0WB 2BGCA 3LPGA 4QAWA 4CU9A 1C1LA 3PUQA 4QT6A 3I2DA 4BH9A 1QU0A 1NCRB 3FHAA 4EWDA 1A6CA 4JCKA 1HN0A 4FOWA 5CA6A 3JD73 1QF3A 1U5XA 2VCCA 4MLOA 3WT3A 2JDZA 3WW2A 2YU1A 5FYSA 2R1DA 5C4WC 3I2HA 3ILFA 4E9KA 2NYYA 4QPIA 3UGFA 3O1OA 3POBA 3CZUA 2WFF3 1WMXA 3HT1A 1VBC3 2Y6LA 4BIFA 4R4ZA 3EYPA 2ZPXA 3POSA 4S2GA 3LSDA 1NXD1 5C3RA 5FPAA 2W2IA 3MHZA 4LO7A 5LY1A 2DWRA 2HEWF 1W05A 4KG8A 1S2KA 2WQ4A 4GMP0 2JIGA 5E88A 5IFPA 1AXYA 1D7PM 4N8MA 4Y1UA 1JXNA 1OSGA 2OQ6A 3IAPA 3URFA 5L19A 2VMGA 2WNUA 2ZAAA 3DN7A 1ULOA 2R49A 1JS9A 3M7AA 3OYWB 4KL1A 4P9WA 4A2UA 2BOIA 1W9YA 1YCIA 2Z42A 3ZXKA 2BNOA 3LD8A 4OYUA 2W0XA 1W39A 1S0CA 2ES3A 2VTXJ 2IFRA 2XLFA 3SITA 1VJ2A 5FY9A 4BPZA 3K48A 4XTPA 5LRSA 5C70A 3H9AA 3ZFEC 4P5HA 2R16A 2BUKA 5DUVA 1N1SA 3FHQA 5EQUA 4FPYA 2WYFA 1NT0A 5D8AB 2HWB1 4F3JA 2HWB2 1QMJA 2X10A 3FUOA 5A3TA 2BZDA 2FZ1A 1WCDJ 1NCQB 5LBCA 2KR2A 3VHOA 4AVSA 2Y0IA 4ATEA 3PUIA 2X5IA 3THDA 1GSLA 1Q43A 2SBAA 4RHV3 4OMDA 5JOYA 2VZSA 3H50A 1IHMA 2ET7A 3SMHA 1SBFA 1HRV1 4XFHA
chains in the Genus database with same CATH topology
3RZKA 4NJ4A 3O1UA 4QHOA 2FDHA 2FDFA 3KHBA 4ZS2A 3LFMA 4IE7A 4CXYA 4ZHNA 3O1TA 3I2OA 4NPMA 3O1VA 3RZJA 3I3QA 4QKFA 4IE6A 4QKBA 4NIIA 4OCTA 4QKNA 2FDKA 2FD8A 4O7XA 5DABA 3O1MA 4MGTA 3H8OA 3RZHA 4NRMA 3BKZA 3O1OA 3BTZA 3BUCA 4MG2A 4O61A 4RFRB 3RZLA 4NIHA 4IE5A 4JHTA 3H8XA 3BTXA 3O1SA 5F8PA 4NRQA 4IDZA 4QKDA 3T4HB 3BIEA 3T4VA 4NROA 4CXWA 4NIGA 4ZS3A 3H8RA 3RZGA 2FDGA 3S57A 3I49A 3BTYA 2FDIA 3BI3A 4NRPA 4NPLA 4IE0A 4NIDA 3T3YA 4IE4A 3RZMA 3KHCA 2FDJA 3O1RA 4CXXA 2IUWA 3I3MA 3O1PA 3S5AA 3BU0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RZK A;  4NJ4 A;  3O1U A;  4QHO A;  2FDH A;  2FDF A;  3KHB A;  4ZS2 A;  3LFM A;  4IE7 A;  4CXY A;  4ZHN A;  3O1T A;  3I2O A;  4NPM A;  3O1V A;  3RZJ A;  3I3Q A;  4QKF A;  4IE6 A;  4QKB A;  4NII A;  4OCT A;  4QKN A;  2FDK A;  2FD8 A;  4O7X A;  5DAB A;  3O1M A;  4MGT A;  3H8O A;  3RZH A;  4NRM A;  3BKZ A;  3O1O A;  3BTZ A;  3BUC A;  4MG2 A;  4O61 A;  4RFR B;  3RZL A;  4NIH A;  4IE5 A;  4JHT A;  3H8X A;  3BTX A;  3O1S A;  5F8P A;  4NRQ A;  4IDZ A;  4QKD A;  3T4H B;  3BIE A;  3T4V A;  4NRO A;  4CXW A;  4NIG A;  4ZS3 A;  3H8R A;  3RZG A;  2FDG A;  3S57 A;  3I49 A;  3BTY A;  2FDI A;  3BI3 A;  4NRP A;  4NPL A;  4IE0 A;  4NID A;  3T3Y A;  4IE4 A;  3RZM A;  3KHC A;  2FDJ A;  3O1R A;  4CXX A;  2IUW A;  3I3M A;  3O1P A;  3S5A A;  3BU0 A; 
#chains in the Genus database with same CATH topology
 4CP9 A;  3LQC A;  3RQ0 A;  3OSD A;  3SC7 X;  1L7Q A;  2LRO A;  5LAS A;  4M3C F;  3VZK A;  2VL4 A;  2X09 A;  1NAE A;  1OI6 A;  2ID4 A;  4CDU A;  3IPV B;  4IGO A;  4LBQ D;  5FJH A;  4NUB A;  1SCR A;  2ZAC A;  1DDL A;  3TN9 1;  4KGQ A;  1MS5 A;  1RIT A;  3I59 B;  3TN9 2;  2GU9 A;  5CEH A;  4QHB A;  2R04 1;  3FLT A;  1W0O A;  3K77 A;  2ETE A;  2WZR 3;  4ZXK A;  5A32 B;  1QXP A;  3RWK X;  4BLI A;  1O8S A;  1WME A;  2H6B A;  3MV1 1;  4Y20 A;  4FO9 A;  5BNN C;  3CNA A;  3RJR A;  4UOJ A;  4LA2 A;  1U0A A;  2W47 A;  4CA9 A;  3N35 A;  3R4D B;  5DQ0 A;  4QHZ A;  5JR2 A;  2OA2 A;  1LGC A;  3GBF A;  4WVM A;  4QKB A;  5EP9 A;  1VPH A;  4D94 A;  2R06 1;  3A0N A;  5FLI A;  3AP9 A;  2P6H A;  2R06 2;  3B94 A;  5I8Y A;  1DHK B;  1EUT A;  3IIA A;  3NRU A;  5SV8 A;  1CPN A;  1SPP B;  1OPM A;  1KIT A;  1IPK A;  2WNV A;  4K8F A;  1ZA7 A;  2WUH A;  4FOY A;  4CU6 A;  1ND2 A;  5FRE A;  1UZW A;  5FO9 B;  2VME A;  5KC6 A;  3MLL A;  3POY A;  1O4T A;  5FZM A;  2QQM A;  2ORZ A;  4AEK A;  1RMU 1;  3WF2 A;  3MF6 A;  2A75 A;  3WEZ A;  2LS6 A;  2PLV 3;  5KXC A;  4RSU A;  3DXT A;  4CP0 A;  4CRQ A;  4GZ9 A;  5LB6 A;  4YW5 A;  2B8M A;  2WA4 A;  4FP3 A;  5EJ3 A;  3W20 A;  4XF1 A;  3UKN A;  1OQE A;  1S0J A;  2XJQ A;  3VV1 A;  1LHU A;  3H8O A;  1LEN A;  3U07 A;  1HQN A;  2VMH A;  2GND A;  5A3W A;  1R64 A;  5F3I A;  4BQX A;  2JE7 A;  3GXU A;  4HFS A;  5T3N A;  5J3U A;  1ENQ A;  1FI2 A;  1AR8 3;  1SLT A;  4DNY A;  5GLV A;  4QWN A;  4OUE A;  2Q1F A;  3ACF A;  1W03 A;  1MVE A;  5DZF A;  2R07 3;  1UMH A;  4JHT A;  3P3P A;  4QQ2 A;  1O4Z A;  5F39 A;  1RUJ 3;  2E6V A;  1DP0 A;  2P17 A;  4BM8 A;  4CPB D;  3I97 A;  5FZ6 A;  2YUE A;  1WW5 A;  2B42 B;  4P9I A;  4ERO A;  2F6B A;  2WLP A;  5K0U B;  4AHX A;  4FQ4 A;  3WX5 A;  3JD7 1;  2C6S A;  3GGL A;  2QBX A;  3JD7 2;  1HKD A;  1GP6 A;  2AUY A;  4GD4 A;  4LK6 A;  4E4Z A;  2D6P A;  2WN3 A;  1SDD B;  3KCC A;  1WZX A;  1WMD A;  3RPQ A;  4AHZ A;  4BHP A;  1RYY A;  4OHX A;  3SCF A;  3OJB A;  3OG2 A;  1NG0 A;  1VBC 1;  1BBT 3;  1D2Q A;  2YZ4 A;  2JB4 A;  1VBC 2;  4NRP A;  2NZ9 A;  3WXP A;  3I8T A;  4NPL A;  1XNB A;  1JYX A;  1W8U A;  1MEC 3;  4KNC A;  5C9A A;  1G9D A;  4MGZ E;  3KHC A;  1JI6 A;  3GNE A;  3KV4 A;  2A73 B;  4MSV A;  1C3H A;  3AXD A;  4NHX A;  4H2A A;  3FL7 A;  5BNP A;  3DCQ A;  5EHD A;  4FSJ A;  2H0V A;  4KU8 A;  4OI2 A;  4CVU A;  1CES A;  3LEI A;  2B4K A;  5LA2 A;  4AI8 A;  4AE2 A;  4D6Q A;  1VB2 A;  2J42 A;  3LGR A;  1QDC A;  5CU1 A;  1J84 A;  4M4R A;  2DV9 A;  2WAO A;  2YG0 A;  5J36 A;  2K0G A;  4LIU A;  2VNR A;  4O65 A;  4LQR A;  3RI9 A;  1JOD A;  2P3K A;  3S7I A;  1OC1 A;  1RC6 A;  3BPS A;  3NNG A;  3AYC A;  1GZT A;  1ND3 B;  4FPC A;  1RB8 G;  3KF5 A;  2G9Z A;  4B7K A;  2ZMK A;  2Q30 A;  4CE8 A;  4I09 A;  4SBV A;  4ZHN A;  3Q8B A;  3LA2 A;  2JDY A;  4ZPI A;  4E2G A;  1F4A A;  4A42 A;  4LO4 B;  3KVB A;  5EPA A;  3DL3 A;  2BRT A;  3HBZ A;  3H7J A;  1PIV 3;  4LKD A;  1XNK A;  4PBO A;  5ACA 3;  4Y5Z 0;  2OUH A;  4ITC A;  4GWN A;  1H4G A;  4RHV 1;  5D1I A;  2RHP A;  4AHY A;  4IQP A;  1JMU B;  1ULE A;  1UZV A;  4LKS A;  4RHV 2;  5GZC A;  1YUD A;  2UYA A;  2JD4 A;  4IER A;  3V0B B;  1CZS A;  4GQ7 A;  3VDD C;  2AEY A;  3AP6 A;  4KWK A;  1SCS A;  1YIF A;  1QJF A;  1ST8 A;  3BPZ A;  1H9P A;  1E5R A;  3AVS A;  3H7Y A;  1ZM1 A;  3T30 A;  2WWS A;  1OH4 A;  3WZ1 A;  2B9V A;  4DMI A;  2VZO A;  4OCT A;  3GJB A;  3FLP A;  2WNE A;  4Y3O A;  3BTA A;  5DXD A;  3D0J A;  1H2M A;  4LHK A;  4UAP A;  5IVC A;  2WZR 1;  1NLS A;  5FZC A;  1QXR A;  2BW8 A;  2WZR 2;  1Q5O A;  1H9W A;  1W8W A;  3AZW A;  1V6L A;  1W9F A;  4ZU5 A;  3ROU A;  2VD7 A;  4QPW A;  4M00 A;  2OPK A;  2XON A;  4XAC A;  4BME A;  1X50 A;  2Z79 A;  1XYO A;  4EN7 B;  2B7Y A;  5JZG C;  4UF0 B;  1WD3 A;  1PM4 A;  1GLH A;  4JV4 A;  4W50 A;  1WA6 X;  2XPJ A;  1NZI A;  2CNA A;  4LBM A;  4P9J A;  4UWD A;  1GQG A;  1UO9 A;  4BE3 A;  4YG3 A;  3VBO B;  4P00 B;  5F6L B;  1TNF A;  1MAC A;  2YC0 A;  3GZE A;  1LHO A;  4A7Y A;  2ZHK A;  2A6W A;  2DCJ A;  1W8T A;  3RYK A;  3T09 A;  3O5S A;  3K3O A;  3CL1 A;  2ZGO A;  2WDB A;  4YM3 A;  4AQ2 A;  2Y60 A;  4ASM B;  4AVC A;  4Z92 B;  1NCR C;  1EUU A;  3SKV A;  1IS4 A;  4NAO A;  5FZI A;  4AI2 A;  1IKP A;  2D3P A;  2PQQ A;  5FPZ A;  2PLV 1;  2PHU A;  3KCY A;  5JUV A;  2RS3 3;  1ZRF A;  2QQW A;  2PLV 2;  4FTS A;  2VZT A;  4AI0 A;  1OOP A;  3N4M A;  2R7E B;  3UV9 A;  4DRV A;  1KFU L;  2Q4S A;  4PDW B;  3NW4 A;  4OHZ A;  4IEZ A;  1HV1 A;  1KS5 A;  1OPO A;  4DXR A;  1YJL A;  4R9C A;  1QNY A;  3WP6 A;  4TTG A;  2QQP A;  1R1A 3;  2BOJ A;  4L11 A;  1AR8 1;  1IG0 A;  4BJ0 A;  1AR8 2;  1DF0 A;  5A7O A;  2C4X A;  2O1Q A;  3WNN A;  4N53 B;  2YYO A;  3EXU A;  3POF A;  2JDN A;  5C7G A;  4AGG A;  4M3C B;  1XXN A;  3VL8 A;  1D4M 3;  2P5B A;  3AP4 A;  1VMF A;  1RUJ 1;  4PQ9 A;  1JZ5 A;  2XLG A;  2C24 A;  1J58 A;  1RUJ 2;  5DZE A;  3QBQ A;  1MS4 A;  5E89 A;  3TEY A;  4Q4W 1;  5KR7 A;  4Q2F A;  3ZFG A;  1YQC A;  4E2Q A;  4Q4W 2;  3ITQ A;  4EE2 A;  5F7U A;  2EIG A;  4A4A A;  1GP4 A;  2OQ7 A;  1LGN A;  2YBS A;  1O5U A;  4YLZ A;  5FQ0 A;  2QE3 A;  2WT1 A;  2VQA A;  4XQ4 A;  3RFR A;  4ARX A;  3POJ A;  5FUI A;  2PFW A;  5D8A C;  4YVS B;  1BBT 1;  5L7O A;  1WGP A;  2WSU A;  4IEP A;  1G7Y A;  3BB6 A;  5M0T A;  2DUR A;  3KT4 A;  4SLI A;  4ZON A;  1NCQ C;  2MHF A;  3E1F 1;  2EIE A;  1B35 B;  5DMY A;  3KF3 A;  4HPK B;  1A34 A;  2GH8 A;  4XVH A;  1KFX L;  1OUX A;  1ULC A;  1NA1 B;  2D6O X;  2UWC A;  1QQP 1;  3NAP B;  4QB2 A;  2MEV 3;  4XMI A;  2HWE 3;  4XQW A;  1QQP 2;  5FTT C;  4P02 B;  5F5I A;  4QQL A;  1W6Q A;  2E63 A;  1N1Y A;  1VMJ A;  4FQZ A;  2XWB B;  4XDP A;  2Y6K A;  4AYU A;  1FV2 A;  1EYB A;  1QHD A;  4NHY A;  3L9J T;  1UU4 A;  3ZM8 A;  4AOC A;  1W6N A;  2LTN A;  5FYT A;  3BIW E;  3V65 A;  1OA4 A;  1K5M B;  4YZ5 A;  3UGG A;  1F5F A;  2XR4 A;  1UD1 A;  2W68 A;  3APB A;  1OQD A;  4JGY B;  2HEY F;  1IS3 A;  4RQP B;  5A1L A;  3DPR B;  4GH4 B;  3VD3 A;  5EV7 A;  1NQD A;  2ZKL A;  1H1I A;  1LGB A;  1PHM A;  3M2M A;  3IZO A;  4EJR A;  4MH0 E;  1GWL A;  1I1E A;  1K3I A;  3VBS A;  5ACA 1;  2ZXQ A;  5ACA 2;  3JB8 A;  1F9K A;  4FCA A;  2QTW B;  3LIH A;  4JGZ A;  3I4I A;  3RZH A;  3ALQ A;  3NQH A;  2V5D A;  4NRM A;  4CDW A;  5C33 A;  3WP5 A;  1RIR A;  4EN6 B;  3ZFF B;  1WMF A;  4XYX A;  2YBK A;  3BTZ A;  1OF3 A;  3HOB A;  1Q8O A;  2W52 A;  3DUI A;  4LO6 B;  3DYO A;  5A33 B;  4CEY A;  1V6O A;  4L9B A;  2GN3 A;  5CAZ A;  2WAB A;  5FO8 B;  5FZ1 A;  1FPN 3;  2HYX A;  4BU2 A;  3ENR A;  3T1L A;  1JYN A;  5BY5 A;  1ZNP A;  1UIJ A;  3LIG A;  3PIG A;  4CDX B;  1CD3 G;  1GZ9 A;  2FCV A;  3HMY A;  1MS8 A;  1EPZ A;  3O1S A;  5D21 A;  3WW1 A;  1H30 A;  3TEX A;  2VVD A;  4QXH A;  5DDJ 3;  4ZU4 A;  4BDV B;  5CBL A;  5H9P A;  3O0V A;  3BCW A;  1GZC A;  2NN8 A;  2PMW B;  3AJY A;  1LU1 A;  4DXT A;  2EIB A;  4XUN A;  2CTV A;  1W8N A;  4K21 A;  5JLV A;  1GZW B;  4QPY A;  5GM0 A;  1W2T A;  4OQ8 A;  4P9X A;  1CIY A;  1G86 A;  2W95 A;  1MS1 A;  1UZY A;  1UY2 A;  4I2O A;  1RJ7 A;  1Y43 B;  4QM8 A;  4I02 A;  1UXX X;  4LPL A;  3T0A A;  2P6C A;  5KWR A;  1J3P A;  3QH6 A;  4BOW A;  2BNM A;  1BJQ A;  4OUL A;  4IL7 A;  3WDV A;  1QJU 3;  1OF4 A;  1COV 1;  3KM5 A;  2XVL A;  2XKO A;  1RVF 3;  3MID A;  1COV 2;  4FOQ A;  4P9G A;  4UW3 A;  5FY1 A;  3USU B;  4B4Q A;  2C9A A;  3OUI A;  5K0U C;  4LUK A;  3GM8 A;  4CXX A;  3WQ0 A;  2XJU A;  4UW4 A;  4RS5 A;  3WQB A;  2RS3 1;  2RS1 1;  2NQY A;  3IMN A;  2B5H A;  1Y9M A;  2RS1 2;  1SLA A;  1UOB A;  1GOF A;  3KQ4 B;  5CZK A;  1RHI 3;  5DPN A;  4LKF A;  4XBL A;  4NIA A;  2AGS A;  3J7N A;  1YQ8 A;  4UW5 A;  3VKL A;  3WCS A;  2PHT A;  2CGN A;  2ZJC A;  4FVV A;  5GLU A;  4L2N A;  1R1A 1;  4ZS2 A;  2I07 B;  2OKX A;  3WNP A;  1DGW A;  2GAL A;  4NVP A;  4LHN A;  1TME 3;  2WQZ C;  4S2D A;  4AED B;  1YNA A;  1J1T A;  4GWI A;  3H3U A;  4D7T A;  3IMM A;  5DUW A;  2DCT A;  2VC9 A;  3JU9 A;  5I93 A;  1GAN A;  2RS5 3;  3QD6 A;  4XEZ A;  2G1M A;  1D4M 1;  4Q0U A;  4URT A;  1YJK A;  4YRD A;  5FMC A;  3VDC A;  1SEF A;  2ZGU A;  3IM0 A;  3KV5 A;  1RUI 3;  2ET1 A;  4JKK A;  1CJD A;  1W8F A;  2J1E A;  2GP5 A;  3I54 A;  4WM7 B;  3N7K A;  4WBB A;  1Q3E A;  3P5B A;  3NKT A;  3OGJ A;  4M3C E;  3ZN6 A;  3EO6 A;  1FMD 3;  3MYX A;  3ON7 A;  4YW6 A;  2Y64 A;  5FR3 A;  4ZXE A;  1ND3 C;  4CDQ A;  2IXH A;  5CG8 A;  4AWD A;  5CFC B;  2RDN A;  4Q4V 3;  2XBO 3;  1ZZ6 A;  5C5T A;  1CAU B;  5HCF A;  5A3N A;  4ISR A;  2XXZ A;  5FFO C;  2XQR A;  4HKW A;  2ZZQ A;  4A6S A;  1V6I A;  3III A;  1ULF A;  4CCD A;  4WM8 A;  4D69 A;  4RR3 A;  4HL0 A;  3SEP A;  4YGC A;  4LEJ A;  4UXA A;  4N9H A;  2ADE A;  4J1W A;  3FLR A;  3RG0 A;  4UFL A;  5FK7 A;  3NJZ A;  4FAH A;  5JIU A;  4QX1 A;  5DG1 A;  2MEV 1;  2HWE 1;  4G9S B;  4E8D A;  4ZZ5 A;  4Q8K A;  4KH9 A;  2HWE 2;  4COW A;  3QLQ A;  1F4H A;  1UYY A;  3IDB B;  4KG0 A;  4XDQ A;  5I0D A;  2HWF 3;  4XUO A;  1H1M A;  4FFG A;  3NWK A;  1MQT A;  1CZV A;  3WNX A;  1WLW A;  1YFU A;  1UAI A;  4KQ7 A;  2OII A;  1XE0 A;  1YQ5 A;  3JUU A;  1N3Q A;  3RZL A;  5EFU A;  5FY8 A;  3C3V A;  5L9B A;  3ZN5 A;  3KCX A;  1RTV A;  3TWI A;  1D0H A;  1IQD C;  3PUS A;  2FQP A;  4OMC A;  4BXF A;  5L9V A;  3GAL A;  5A1F A;  2PN5 A;  3VL9 A;  5JCT A;  1MS3 A;  4LE3 A;  5T5P A;  4ES8 A;  3HNM A;  3VBO C;  4XAA A;  4MXW B;  1XU2 A;  2W91 A;  2VPV A;  1W2A X;  3MBW A;  1OLM A;  2WL1 A;  3VZM A;  1LED A;  2E53 A;  3CJI A;  4Y4Y A;  2WZP P;  1FNZ A;  4XUT A;  3I2K A;  3KSC A;  3I49 A;  5IFT A;  3ZYF A;  5C3Q A;  4XPV A;  4EZH A;  1M4W A;  3BI3 A;  4TLF A;  2FMY A;  1FPN 1;  1F31 A;  4I3P A;  1V9U 1;  1FPN 2;  3AKP A;  2VQU A;  1V9U 2;  3OEA A;  4AL9 A;  2EAL A;  2IC1 A;  2CAU A;  3R05 A;  1W9W A;  3S6P A;  2X5I B;  3O1R A;  3OEB A;  4LOT A;  1W6P A;  1ENX A;  2QZ3 A;  1NOV A;  1ZBA 1;  3K4A A;  2ZX3 A;  3R6S A;  3T0D A;  1BHG A;  1ZBA 2;  4PDW C;  1MR5 A;  2CYF A;  5LK5 A;  1GNZ A;  2AEZ A;  2DU1 A;  2CDP A;  1CAW B;  2A5Z A;  4Q29 A;  1H0B A;  5CKQ A;  4NHL A;  4QGM A;  1UXZ A;  2E7T A;  1XOY A;  4GWJ A;  2VMI A;  3RZK A;  4CDU B;  4Y1Y A;  2PQS A;  4ET7 A;  1CQ9 A;  4KBB A;  4N53 C;  4QX7 A;  4NAM A;  3U14 A;  1CZT A;  2DCY A;  2DUQ A;  3DGT A;  2DCK A;  2A70 A;  3U78 A;  4B8E A;  4IE7 A;  3MIC A;  3SH5 A;  4FPJ A;  5C4W A;  4LT5 A;  2JE8 A;  4P9Y A;  2B46 X;  3TN9 3;  5A7W B;  1LTE A;  3I3B A;  3M3Q A;  4AVT A;  4CEW B;  1QJU 1;  1YQ6 A;  1YC6 1;  1RVF 1;  3KS7 A;  1FV3 A;  3PDQ A;  3AB0 A;  3W9A A;  4JRL A;  4AFM A;  5J1X A;  2VZ1 A;  1ZBE 3;  1SAC A;  1GKB A;  2VZQ A;  2VXJ A;  3MI8 A;  5A3O A;  4WVM B;  1IS5 A;  1ZRE A;  1HXS 3;  3PUA A;  2IXK A;  3T1M A;  3WNM A;  1E5I A;  1JTZ X;  1RHI 1;  4QM9 A;  5JOX A;  5IVY A;  1RHI 2;  4QKF A;  1KDK A;  1OHF A;  1QJY 2;  2VNV A;  5FYI A;  4YVS C;  3BGA A;  3ES1 A;  4YZ3 A;  4FXG B;  5JXG A;  3OGS A;  2WYS A;  4N9I A;  3C7G A;  5HBA A;  3CBN A;  1AHS A;  2YB7 A;  4U2A A;  1B35 C;  2D40 A;  5KHJ A;  1ALY A;  2K9Z A;  3HQU A;  4IV1 B;  4LBL A;  2WNO A;  4LHL A;  1NA1 C;  1TEI A;  3NAP C;  2Q8C A;  4ZU7 A;  2RS5 1;  4CCK A;  4HVO A;  4N7I A;  4K40 A;  2RS5 2;  5FAX A;  3MIG A;  4FPE A;  2ZGK A;  2C5D A;  4LO8 A;  4YW2 A;  1RUI 1;  1VRB A;  5LZ6 A;  1LJ7 A;  1PGS A;  5FZO B;  3N9O A;  3VD7 A;  4LHS A;  3C7E A;  1LNS A;  2N7G A;  5DUU A;  1K5M C;  3FC0 A;  1ASJ 1;  4DRR A;  1NZC A;  4Q4V 1;  1ASJ 2;  2EXH A;  4GA9 A;  4JGY C;  4RQP C;  5IW0 A;  4DUV A;  3B3Q E;  2W1U A;  4M01 A;  4O61 A;  4C90 A;  3DPR C;  3OPW A;  4MYE A;  3RDI A;  3WQ7 A;  1HRI 1;  2RDS A;  1QOS A;  3E6C C;  1HRI 2;  5FY5 A;  1JZ8 A;  1HLC A;  1RUC 3;  4UFK A;  2E9Q A;  4MVT A;  3H8X A;  2VBP A;  3K75 B;  4R9B A;  2VH9 A;  2DVG A;  2BGO A;  2D44 A;  3PJY A;  1V0A A;  4P5Y A;  5ANN A;  5H9R A;  2FBE A;  5LEJ A;  2TNF A;  3OCP A;  5IJR A;  2XQX A;  2A7A A;  2YFZ A;  2E31 A;  3ZFF C;  3M3O A;  1KGY A;  5FXZ A;  3ELN A;  1V6M A;  5BNN A;  2HWF 1;  2BWA A;  4NIG A;  2R6Q A;  1X82 A;  1GQP A;  2HWF 2;  2YV8 A;  2QQI A;  3N9L A;  3PLQ A;  5LEK A;  4FPL A;  4RFT 0;  3AKR A;  3PVO A;  3I2F A;  1TG7 A;  5JWP A;  5CG9 A;  4CDX C;  2NPI A;  3PVN A;  4LLF A;  2GP3 A;  1BLZ A;  1OUS A;  1O3S A;  4L97 A;  1OXC A;  1WCK A;  4IE4 A;  1FNY A;  4UFI A;  2VCB A;  3EB7 A;  1WD4 A;  1MZE A;  3KMH A;  3T2P A;  5BNP B;  2QQJ A;  3CZJ A;  1IS6 A;  5HCA A;  3LF7 A;  2CL2 A;  1NE4 A;  4BIO A;  3L2Y A;  2J1R A;  3CU7 A;  2MNG A;  1RXF A;  3VBH B;  2IVJ A;  1WKY A;  5LBF A;  1W6M B;  2VZV A;  1LOF C;  3S30 A;  4Y24 A;  3O1P A;  1DG6 A;  1VP6 A;  4H3W A;  3WVJ A;  3ETQ A;  1I5P A;  4Y5T A;  4D6R A;  2YRO A;  2ARA A;  3P3N A;  1KXG A;  4JDO A;  3AX4 A;  2DFC A;  1JYW A;  2VOK A;  2WS9 3;  3OY8 B;  1W0N A;  1YRZ A;  4NR1 A;  1SFN A;  3V56 A;  1J3R A;  1BVP 1;  1BK1 A;  2CHH A;  2WA3 A;  3Q8E A;  3HNY M;  3H42 B;  3B00 A;  3GYD A;  2HWD 2;  5EYY A;  5BNO B;  1LUL A;  5JMC A;  1OKO A;  3RYR A;  1O7F A;  5HI0 A;  1VLN A;  3MV0 1;  4Y5S A;  1N3P A;  3E5X A;  4IXL A;  2BBV A;  4PT6 A;  2Q8D A;  2JX9 A;  2VW1 A;  5A7N A;  4XUP A;  3DKW A;  5FP7 A;  1JHN A;  2R30 A;  4JHZ A;  1UN1 A;  1PK6 B;  1RUG 2;  4AED C;  1H4H A;  5E6H A;  4NII A;  3HN1 A;  3WNO A;  2ORX A;  1G9C A;  4L99 A;  3VBU B;  3ETP A;  1KQR A;  2ZX4 A;  4G3Y C;  2E32 A;  4HBN A;  1JYI A;  2BVV A;  2Q0A A;  1I9R A;  3WNL A;  1S0I A;  1RL3 A;  1WCS A;  2XJV A;  4MO3 M;  5A80 A;  2WBK A;  4CCN A;  1WW6 A;  1ENS A;  2V72 A;  1OQ1 A;  2JKB A;  4GAZ A;  1ZBE 1;  3MO4 A;  2K2S A;  4Q0V A;  3PU8 A;  4J6G A;  4WM7 C;  1ZBE 2;  3VBF B;  4AEJ A;  3RS6 A;  2VE1 A;  4BYY A;  4P08 A;  1HXS 1;  4AFD A;  2NM1 A;  2Q8O A;  5CFC C;  1HXS 2;  1V6N A;  1RUH 3;  3K46 A;  4QQO A;  1A8M A;  1HJF A;  1UQX A;  2PHR A;  2D6N A;  1LHN A;  1S1A A;  3FFZ A;  3LKJ A;  4XF3 A;  4XFG A;  5DN2 A;  3WHT A;  1QXJ A;  4MG2 A;  2TBV A;  1CX1 A;  5AVP A;  2V09 A;  4RFR B;  1K12 A;  1XPW A;  1H2L A;  5DAX A;  3V0A A;  2YPJ A;  4XC9 A;  4XIK A;  5FV3 A;  5JPN B;  5E1R A;  5FBZ A;  2ARX A;  3ZDV A;  2ZGS A;  5J37 A;  3FWE A;  5FZ0 A;  4NRQ A;  5HCB A;  1JYT A;  2WO3 A;  1XJA A;  2A6Z A;  4HVR A;  4KGG A;  2BFU L;  2XH6 A;  1BXH A;  1VE0 A;  4DFS A;  2Y26 A;  4EN8 B;  5FYU A;  2VU9 A;  2G9G A;  1QGL A;  1UL9 A;  3NMB A;  1TQ5 A;  2JDH A;  2O14 A;  3NVC A;  4I0A A;  4Q4Y 3;  4CXW A;  1AR6 3;  1NLQ A;  4PLO A;  4GMP 3;  1X8M A;  4CCO A;  2D97 A;  3AZV A;  1SMV A;  1WCQ A;  1PZ8 A;  2BTV C;  5FKC A;  4COY A;  4Q8L A;  1AX1 A;  1Q8V A;  3VDD A;  3UNP A;  2CGO A;  4NID A;  2NP0 A;  1P8J A;  2DUO A;  2PHW A;  1RUC 1;  3S0M A;  3FFQ A;  4YG6 A;  4A45 A;  1RUC 2;  1ZZB A;  2ZEZ A;  1APN A;  1URX A;  5DAW A;  1W0P A;  4MGY E;  5JDB A;  3FX3 A;  3KD4 A;  3NNJ A;  5LRR A;  1R09 3;  5F5C A;  3WSO A;  2IUW A;  5GLZ A;  1GWM A;  4QB1 A;  4TSV A;  4Q4W 3;  3USS A;  2O8O A;  1S0G A;  4UFM A;  3ZR6 A;  1Y9G A;  3AK0 A;  4ATF A;  4D6S A;  4W65 A;  1VBA 3;  2FCT A;  5FZA A;  1YQ2 A;  2IXL A;  1OBN A;  1XNC A;  3GF6 A;  4CUA A;  3EQE A;  4MX3 A;  1CAV A;  1E5H A;  3SH3 A;  5JZG A;  5L7O B;  4HON A;  2J22 A;  4MAD A;  2FDH A;  2WKK A;  3GHM A;  5GLW A;  1MPX A;  3SQO A;  5HPO A;  2QQO A;  4YSF A;  5GZD A;  4OHY A;  2X5I C;  4Y22 A;  4AF9 A;  3WDT A;  4QPG B;  3I2O A;  3DYP A;  1WBL A;  5EJ1 B;  5T55 A;  4W4Z A;  2C9K A;  1W6Q B;  4ARY A;  3KV6 A;  1Q8P A;  4DS0 A;  1QQP 3;  1NCR A;  4GKY A;  1AX2 A;  4IEQ A;  4CDU C;  5C8C B;  4QU1 A;  2OVU A;  3RI8 A;  3TAY A;  4YW3 A;  1JW6 A;  4IGP A;  4COZ A;  3NJY A;  4YW4 A;  3TEZ A;  2OS2 A;  5F2S A;  3ORJ A;  4XCB A;  1BVV A;  2WS9 1;  1NKG A;  1T6G C;  4CEW C;  5HXV A;  5BV6 A;  2WS9 2;  4AGV A;  4TZD A;  1IPJ A;  2ZGL A;  4DEQ A;  4XJ9 A;  3PUR A;  3CKH A;  4OI1 A;  4BQ1 A;  5DAB A;  3LOB A;  2Y0O A;  3MFA A;  4I30 A;  2ZS6 B;  3RZZ A;  3T2T A;  1TZO A;  2W5F A;  4CCE A;  1BMV 1;  1DZQ A;  4DOU A;  1BMV 2;  1U5Y A;  1ZYB A;  4IV3 B;  4E4H A;  2BVB A;  1LU2 A;  2AZ5 A;  3WDY A;  5BUV A;  4YZ4 A;  3THT A;  2IVI B;  2UWB A;  3VDA A;  1GP5 A;  1Y9Q A;  4Q1R A;  3OYW A;  4XJA A;  4A6O A;  2PHD A;  2Y6H A;  1QNW A;  1MS0 A;  4AHW A;  4BQ2 A;  2YGM A;  3U11 A;  5A6Q A;  4EWA A;  5JSP A;  5B4X A;  2RE9 A;  2XUM A;  4IV1 C;  5J48 A;  2VZ3 A;  2OT7 A;  1AZD A;  3IDC B;  2VMD A;  4HN1 A;  4FXK B;  3ZYJ B;  4GXL A;  2HH9 A;  4KMQ A;  2Y8K A;  1XE8 A;  5D8A A;  3KGL A;  2VCM A;  2ZEY A;  2VUD A;  3SNM A;  3SXW A;  4LBQ B;  3POE A;  4LE4 A;  1F8V A;  4NWV A;  1QJE A;  3W21 A;  4MXV A;  2JIJ A;  2VBB A;  4XHB A;  1DYO A;  5F5Q A;  5B4N A;  2EAK A;  4V1P A;  1NCQ A;  4Q0P A;  5DAP A;  2WII B;  4QB6 A;  1VAM A;  2OZ6 A;  5FP3 A;  1X9P A;  2D43 A;  1RUH 1;  2Y6G A;  4XAE A;  3T08 A;  2GNB A;  1RUH 2;  2Z4F A;  5GZE A;  1QDO A;  1UOG A;  5CFD A;  3UJQ A;  2FDG A;  1OKQ A;  1GFF 2;  3I7D A;  4UBH A;  4CCM A;  1JBC A;  3MLJ A;  4XFF A;  4B1M A;  2XGX A;  3VHP A;  4H7L A;  3IPV A;  3W5M A;  2V5Y A;  4E2S A;  4BK5 A;  3MZH A;  4QX0 A;  3I59 A;  1COV 3;  1VBD 2;  2FDJ A;  4FFH A;  3SLI A;  4CUG A;  5J96 B;  2QKD A;  5A32 A;  1JZ3 A;  4O9G A;  3SKJ E;  2XL9 A;  1J1L A;  2BBA A;  4WZC A;  1SLI A;  3PJQ A;  1H6Y A;  4WVV A;  4OLL A;  2RS1 3;  1CIW A;  2AAC A;  3ES4 A;  3LA7 A;  3MPP G;  4OZX A;  1V6J A;  2Q1Z B;  3H1W A;  1GOG A;  2ZA9 A;  3BU0 A;  3RYP A;  3CMG A;  2Y34 A;  4Q4Y 1;  3B7M A;  4RYD A;  4A41 A;  1AUY A;  1AR6 1;  1JUH A;  4Q4Y 2;  4GMP 1;  1N1T A;  1AR6 2;  4CZS A;  1C1F A;  1AR7 3;  2OZJ A;  3HVD A;  1DQ2 A;  1TMF 2;  2BEO A;  2ZHN A;  5BNP C;  2CWS A;  2VGD A;  1SPP A;  2Y6F A;  4OFG A;  3GCW A;  4RA0 A;  4GKX A;  3E97 A;  1BKZ A;  1PVC 3;  2X53 S;  5FPU A;  1ZVF A;  2CWM A;  1EV1 1;  3VBH C;  2BYV E;  5I8T A;  1EV1 2;  2JIC A;  2IXJ A;  1IOA A;  2WAA A;  4NPR A;  4PI2 A;  4BIS A;  1O59 A;  1CX4 A;  4YGD A;  3B02 A;  3TNQ A;  1R09 1;  2BU9 A;  4P14 A;  1R09 2;  5C5U A;  2PHL A;  5FPX A;  2A6X A;  4AFC A;  3LZZ A;  1VBA 1;  1RUN A;  2WQ8 A;  4YVW B;  1VBA 2;  1JYV A;  2QVS B;  5ABJ B;  5HV4 A;  1OMI A;  1BZW A;  3K3N A;  3LAG A;  1C8N A;  4H14 A;  1G9A A;  2VJX A;  5F5A A;  5DAQ A;  5BNO C;  1U5Z A;  4HKL A;  4Q26 A;  4BCU A;  2GSY A;  4X8N A;  2FD8 A;  1Q8S A;  3HNB M;  4FAG A;  3AZZ A;  4QX3 A;  1L7R A;  2PTM A;  2HKX A;  1OUR A;  3WUD A;  4C0B A;  1F5J A;  2JG8 B;  2VUC A;  4PF5 A;  2W1S A;  1VAL A;  1UCX A;  3B93 A;  1BYH A;  5JAX A;  4B4R A;  3IDE A;  1AXK A;  4W6X A;  1NUK A;  4MGT A;  3C7H A;  5K0U A;  4OUM A;  3RMY A;  1PK6 C;  5EZW A;  1VMH A;  2DDU A;  1H8T B;  3VBU C;  5AFB A;  1PZ9 A;  2XKP A;  4YM2 A;  3M4F A;  4LMF A;  3RNS A;  4N43 B;  2RV9 A;  4QX5 A;  3VBR B;  1LES A;  2PHF A;  1CAX B;  2XL7 A;  5FZ3 A;  2PHX A;  3C7F A;  3AL5 A;  4MOA A;  4BZ4 A;  2J1A A;  1PVX A;  3H3L A;  4JTO A;  3VBF C;  3F2Z A;  5F8P A;  2WFP A;  4QKD A;  5E16 A;  5JMO A;  3J4U H;  3B9C A;  4OQ9 A;  5APA A;  3I2I A;  1MVQ A;  4AI9 A;  1PMH X;  3CJI B;  1FYU A;  2JDK A;  5GKA C;  1OLQ A;  3U4S A;  3WF1 A;  3MIH A;  4FFF A;  3VZN A;  3AJZ A;  3NJV A;  2VQT A;  4QMA A;  4XDO A;  2PAE A;  3T2O A;  1JOP A;  5CIR A;  2RM2 3;  2DYC A;  1NY7 2;  3F95 A;  1H2N A;  1G6N A;  3SCG A;  5H9Q A;  3EHK A;  1V9U 3;  4E8C A;  5KHK A;  4KWU A;  4AFB A;  2JXA A;  3UL2 A;  3MLK A;  2EXI A;  2FZ2 A;  5FYC A;  1CR7 A;  2A3X A;  4PIX A;  4W6Y A;  1UKG A;  3A22 A;  3H1M A;  5KBF A;  1LOC A;  1W6O B;  1ZBA 3;  3WR0 A;  3SCH A;  5AC9 1;  4DXS A;  1GU3 A;  5AC9 2;  3J26 N;  1QJX 3;  1STM A;  1A8D A;  1TVG A;  2IXI A;  3D0S A;  3HJR A;  2D5H A;  4XMA A;  5FMO L;  3ACL A;  4R52 A;  1UY3 A;  2VBD A;  1U5I A;  5KHH A;  4DY5 A;  3ZN4 A;  3Q8A A;  2EAA A;  1DGR A;  3FUQ A;  4QX8 A;  3VZJ A;  2VOW A;  4OI4 A;  4YW1 A;  4HAN A;  3V0B A;  1F15 A;  2EF6 A;  4V2V A;  5F37 A;  3NV3 A;  5CKN A;  2QZ2 A;  1ZRC A;  1IZ3 A;  1G9B A;  2XUE A;  4M0H A;  5LA9 A;  2VAU A;  3WF4 A;  2DVA A;  2JG9 B;  2ZKN A;  3ZKY A;  1ZRR A;  4CUC A;  3NST A;  4JQT A;  2RJL A;  4S2H A;  1S2B A;  2A71 A;  3AFK A;  5IK8 A;  3AP7 A;  2VCA A;  2XG3 A;  4PIY A;  1I3H A;  4MET A;  3MUZ 1;  2VOV A;  5C71 A;  1S0D A;  4X6R B;  4A44 A;  1VBE 1;  2AC1 A;  1VBE 2;  2VVF A;  5L7O C;  4YZ1 A;  5IT6 A;  1QIQ A;  4UF0 A;  3THP A;  2Z5W A;  4MV2 A;  5FBJ A;  1QJY 3;  5KXB A;  5LW9 A;  1DU3 D;  3GZA A;  5IVE A;  4LTA A;  2ZEX A;  3P1I A;  3PU3 A;  1KJL A;  4GJY A;  3VBO A;  4HVQ A;  1AR7 1;  3OGR A;  5L9R A;  3WDU A;  1AR7 2;  1ULP A;  4QPG C;  1PMJ X;  1S0E A;  4FPK A;  1O5L A;  4EN0 A;  3H3Z A;  1DCS A;  1GBG A;  5T5J A;  1PVC 1;  2WZ8 A;  4MGQ A;  4JVA A;  5FZH A;  1PVC 2;  3JBG 2;  4YPJ A;  3RJ2 X;  1KJR A;  1HV0 A;  3FE5 A;  3SHR A;  3ZXG A;  5C8C C;  5IAT A;  1G9F A;  2VUJ A;  2RJK A;  1DYP A;  3IKW A;  5EXO A;  4IEV A;  4Y33 A;  5JPM B;  2E33 A;  1H6X A;  1SBD A;  2D6L X;  2ZGM A;  1RUD 2;  3GHN A;  3O14 A;  3PHM A;  4YG0 A;  4CUB A;  3BKZ A;  4PDW A;  2OX0 A;  3GBG A;  1QOO A;  3P6B A;  1ZZC A;  3IT8 A;  1ASJ 3;  3I3E A;  3FJS A;  3POW A;  3VKN A;  4AI1 A;  4A7K A;  4CP2 A;  2ARE A;  3IN9 A;  1W8O A;  5LBB A;  2WT2 A;  3ZYP A;  5I8S A;  4Q5O A;  4N7U A;  1HRI 3;  3BOP A;  3BYW A;  4LOS A;  3ZXF A;  4IE5 A;  5JR7 B;  4N53 A;  2VTX A;  1SHW B;  3AC0 A;  4PBP A;  1L3J A;  1CGP A;  2WT0 A;  4W8J A;  4IV3 C;  4LA3 A;  3ZPY A;  1LHV A;  2P1B A;  4B7E A;  1UIK A;  1GV9 A;  4QDQ A;  4I0B A;  4HSJ A;  4RL7 A;  1Y3T A;  3JQW A;  4QPI B;  3CEW A;  5IYY A;  5FLJ A;  4XJZ A;  4AW7 A;  4CPB A;  3RZG A;  4ISQ A;  3I2G A;  4MGK E;  5JOZ A;  1BCX A;  2XHK A;  2TEP A;  4V2W A;  3TRS B;  2WWJ A;  2CV6 A;  3M3E A;  2IFW A;  4YVS A;  4I3G A;  5CVR A;  3NNL A;  3C7O A;  5JXH A;  5AFE A;  2GNM A;  3AZX A;  2IXC A;  3ACG A;  4YM0 A;  2HBT A;  2YHJ A;  4XFB A;  2WO7 A;  4O9E A;  1B35 A;  1DGL A;  4HPK A;  4KBZ A;  4MZU A;  1AX0 A;  4QDS A;  2WZE A;  3C2U A;  3ZXJ A;  2WNU B;  2VY0 A;  3MIF A;  2ZHM A;  3OBR A;  3I3M A;  3NAP A;  1RGS A;  4C8D A;  1DZR A;  2DU0 A;  2CSG A;  2W92 A;  4JQR A;  3ZOI A;  1Z7S 1;  4BQ3 A;  1H1A A;  2A6Y A;  4H55 A;  1XSR A;  1Z7S 2;  3O1U A;  4D3W A;  3ACI A;  1LOG A;  3VDB A;  1CJP A;  1US2 A;  2RM2 1;  4YYO A;  1LEM A;  5FPB A;  1OLM E;  2RM2 2;  1CWP A;  3O12 A;  2X29 A;  2F4P A;  2GH2 A;  4Y1X A;  1K5J A;  2W87 A;  3FZ3 A;  2HWD 3;  4LJH A;  4RD7 A;  4AGR A;  1K5M A;  1ZRI A;  3M70 A;  5IK4 A;  5J98 B;  2X8K A;  2AYH A;  3OB8 A;  4JGY A;  4RQP A;  4L92 A;  4NPM A;  3ZSE A;  4JDN A;  5CAD A;  3B69 A;  2EXK A;  3DPR A;  4GH4 A;  4EN9 B;  1S0F A;  4AI3 A;  3FBM A;  3O0W A;  3WDX A;  2RMU 3;  4A3Z A;  4IGQ A;  1QJX 1;  4L0P A;  1SFY A;  5FZ8 A;  4H7M A;  5FO7 B;  1QJX 2;  1ZX5 A;  2Y6J A;  2DUP A;  5FZL A;  2PYT A;  4CP9 B;  1JHJ A;  5FP9 A;  2VMC A;  2G19 A;  4GJZ A;  1IKQ A;  4QXK A;  5FJK A;  5A6Z A;  3WP3 A;  1UW8 A;  1RUG 3;  1A78 A;  3JCI A;  4JTN A;  1UNB A;  3CLP A;  4NHM A;  3G7D A;  1C4R A;  2D5F A;  1SBE A;  3ZFF A;  3WG4 A;  1IG3 A;  4LR4 A;  3U75 A;  1DLL A;  5A33 A;  4C1X A;  2GDF A;  3L2H A;  4XBN A;  3WCR A;  4DIN B;  4ES9 A;  2Y38 A;  3C8X A;  3M3I A;  1S4C A;  4XF9 A;  1I5Z A;  3J8F 3;  3PTY A;  5HXM A;  4Y20 B;  1MS9 A;  1HQL A;  4KWL A;  1D0G A;  2YDE A;  4E4D X;  3LB9 A;  4CDX A;  3AKS A;  1KRI A;  3PNA A;  1CPM A;  4PIZ A;  4XJU A;  1ACC A;  4AEM A;  2Z2S B;  1DBN A;  1LOA A;  1UOJ A;  4YVW C;  2CU5 A;  3B01 A;  1W04 A;  2R1B A;  3DYM A;  4QQH A;  3UES A;  2RG4 A;  5ABJ C;  1ZZ8 A;  1M06 G;  5EWS A;  2XDV A;  1N1V A;  4DIQ A;  1ULG A;  1GZW A;  1QJY 1;  3KWV A;  4IEU A;  2WNV B;  1QKQ A;  1LOF A;  1X8E A;  4D0Q A;  4LXL A;  1ND2 B;  5FIX A;  5L36 A;  2LRP A;  3HT2 A;  3D3A A;  3ILR A;  3VN4 A;  1SLB A;  4WZF A;  2DFB A;  2JG8 C;  3RRD A;  1DQ5 A;  2P3J A;  4TXW A;  1PGW 1;  3I3D A;  2BWC A;  5CYY A;  5LWB A;  3KQR A;  1PGW 2;  3LDR A;  4I01 A;  4LOR A;  3ZFE A;  4C91 A;  2XVG A;  4FPO B;  2WR9 A;  1RUF 1;  2D93 A;  2Q5T A;  3USU A;  4AZZ A;  4BQ4 A;  1HIX A;  1RUF 2;  2VZP A;  3T4V A;  2V4V A;  5BXX A;  3ZYG A;  2BNN A;  1LKN A;  4WV8 A;  1H8T C;  1QWR A;  3DF0 A;  1S2E A;  4N43 C;  4Q0Q A;  4LLO A;  1QH7 A;  4TWT A;  1JZ2 A;  3VBR C;  4FBF A;  4AVA A;  1C57 A;  3SIS A;  3HBK A;  2YC4 A;  1FX5 A;  1NE6 A;  3LDB A;  4K20 A;  4OVE A;  3S57 A;  1A3K A;  3O0X A;  3QOP A;  5LA1 A;  1XSQ A;  4A3X A;  1NLR A;  3ZDS A;  4K1Y A;  4XUR A;  1IPS A;  4AK3 A;  1N3O A;  1KDM A;  4AED A;  3BVC A;  4A7Z A;  3NV2 A;  1XBF A;  2VUA A;  1PO1 3;  4UT5 A;  5F6K A;  5IAX A;  5A6X A;  2ZTN A;  3D82 A;  1RXG A;  3B5L B;  4FTB A;  3AYA A;  3VKO A;  3CJI C;  5A7Q A;  2GC3 A;  2FCU A;  5FZB A;  5JSO A;  5T50 A;  2D6K A;  5CB7 A;  3S5A A;  4HN0 A;  5A7P A;  1O3Q A;  3HAG A;  1LOD A;  1UY0 A;  4AG4 A;  4CDW B;  4WM7 A;  1SZB A;  5EIY B;  5F1R A;  2J1S A;  4RGA A;  2J1V A;  4AR2 A;  4PCR A;  3VLB B;  1YLL A;  2AH2 A;  2QQV A;  1NYW A;  3KHB A;  5CFC A;  3BOD A;  5DZG A;  1AL2 1;  1CAU A;  5C9A B;  1AL2 2;  2H6C A;  5FOJ B;  3ZYB A;  2BER A;  2AR6 A;  1WBF A;  2PA7 A;  1PM7 A;  3VHR A;  2Q1M A;  4BQY A;  2GZW A;  2L9L A;  3OBZ A;  2MPF A;  4JX0 A;  2GME A;  3ZXD A;  1S55 A;  4QQP A;  3OPT A;  2JWP A;  5I0S A;  4Z82 A;  5FZD A;  3N7M A;  2HEV F;  1L7L A;  5A3U A;  1YEW A;  3KZ4 C;  3UKV A;  2J7M A;  2A3Y A;  4PF1 A;  3ZXA C;  1LHW A;  3WIN E;  1AYM 3;  4AAX A;  2JG9 C;  4OZO A;  2KD7 A;  2QUO A;  4CSW A;  2V73 A;  5I0U A;  3JXS A;  3DXU A;  4CTE A;  5T5L A;  3NV1 A;  2LW8 A;  4HK8 A;  2LAL A;  1QY4 A;  4DB5 A;  2HWD 1;  1VB4 A;  2ZHL A;  5D2A A;  4O7X A;  4YGE A;  1EPW A;  3M8L A;  3AL6 A;  2ERF A;  3TYJ A;  2ZX0 A;  5AVA A;  4CU7 A;  3KVA A;  4HG6 B;  3HQR A;  3FHI B;  2ZAB A;  3AMH A;  4IND A;  1EY2 A;  2RMU 1;  3GDB A;  4UW6 A;  2RMU 2;  4MGS A;  3J7M A;  2CY6 A;  1R1Z A;  4YFZ A;  5I91 A;  1N47 A;  5FY0 A;  4OI0 A;  4QX2 A;  1XRU A;  4MXW A;  3UKT A;  4FFI A;  4IET A;  1SDW A;  1E57 A;  3TB0 A;  1LOE A;  5FZE A;  3ZKU A;  1RUG 1;  4XIL A;  4D7Y A;  2DF7 A;  4LBK A;  2VQ0 A;  2VXR A;  1YIP A;  1YWK A;  1W8H A;  2DVF A;  3K2O A;  4HZF A;  3J8F 1;  1FXZ A;  4UBG A;  3J8F 2;  3LWC A;  4LIT A;  4X6Q B;  1LRH A;  4RGG A;  2BPA 2;  5FZ9 A;  3WDW A;  1O6U A;  2BDR A;  1RUO A;  4K8R B;  4FI9 A;  4LNV A;  3ZMO A;  3IDA A;  3FMG A;  5KHI A;  4Q1P A;  3ZSL A;  5C3O A;  3ZSK A;  1HRV 2;  1XC6 A;  5GZF A;  1CAW A;  5CFD B;  3OGV A;  3ZO0 B;  3DV8 A;  3ZR5 A;  1JOJ A;  3WV6 A;  2BQP A;  4TLG A;  3ECQ A;  1YHF A;  2NMN A;  5FLH A;  3BTY A;  3LE0 A;  2ZX2 A;  3M1H A;  3W5N A;  1AXZ A;  1ODN A;  1DGW X;  3T3Y A;  1UPS A;  2R04 2;  4COV A;  2C26 A;  1X7N A;  1UYP A;  2NLR A;  1VBD 3;  3KT7 A;  3MEP A;  4GIQ A;  4MHR A;  5A7W A;  5F9T A;  4CEW A;  3W58 A;  1JH5 A;  4AVV A;  4MHU A;  3R4S A;  4TYS A;  1US3 A;  3WP4 A;  4EQV A;  1OOP B;  4QPI C;  1D2S A;  4XOG A;  5A3P A;  5FZF A;  5GZG A;  2W9X A;  5F3G A;  2PAM A;  1VIW B;  4ZKT B;  1FAT A;  5FMO S;  4LBO A;  4K1Z A;  3OBT A;  3FN9 A;  1HX6 A;  3JQX A;  4Y26 A;  1TMF 3;  2P34 A;  2G9F A;  3AXE A;  2LM3 A;  4GUL A;  3LEG A;  1GR3 A;  1Z78 A;  3J7H A;  2O8Q A;  5A3M A;  2I2S A;  3E6B A;  1KD7 A;  2VVE A;  3POI A;  3VD9 A;  1D4V B;  1Y4W A;  3ILN A;  3AYD A;  5LK7 B;  4XF0 A;  5IAV A;  1RMU 2;  1EV1 3;  1LR5 A;  2WNU C;  2UYB A;  2XJS A;  1PO1 1;  1V70 A;  4IV1 A;  2VO5 A;  4X8P A;  4XFC A;  1PO1 2;  2F4L A;  2VNO A;  3ZFG B;  1OFS A;  2D3R A;  5FXW A;  4EWE A;  3ZYH A;  2EVX A;  3GCX A;  1C28 A;  2EXJ A;  5FZ7 A;  3RZJ A;  3AKQ A;  2KA3 A;  2RJ2 A;  3AZY A;  5EYX A;  5FQ0 B;  5IHR A;  2ZGT A;  5BNQ A;  3ZXL A;  2W08 A;  4IE6 A;  2ZCW A;  4OUS A;  5FZO A;  3N7J A;  1QOT A;  1O4Y A;  1UY4 A;  4CYD A;  5FUP A;  4HSL A;  4HK9 A;  3DEC A;  4HET A;  3AMQ A;  5A1A A;  1RED A;  1DFQ A;  2XB6 C;  5F32 A;  3VHN A;  1OA3 A;  4R4X A;  4DEV A;  4IES A;  1LCL A;  1HB3 A;  2QFE A;  2YBP A;  2XJR A;  2ZZJ A;  2RDQ A;  1WLD A;  4XZP A;  1JN2 P;  4S2F A;  2QQN A;  4LUL A;  5A7S A;  4NOT A;  3DEM A;  3ST7 A;  1W28 A;  3LDK A;  3GZT B;  3D8C A;  3PUH A;  3X29 B;  2K46 A;  1CN1 A;  1WUV A;  3ZXE A;  2UU8 A;  4GWM A;  4J25 A;  5T5O A;  4DUW A;  4QXC A;  4BLJ A;  1UMI A;  2QNK A;  3UT0 A;  1FAY A;  2YC2 A;  2P3I A;  4XQD A;  1W6N B;  4XE9 A;  1Q56 A;  3LEK A;  4PLM A;  3WD5 A;  4ZY9 A;  1AYM 1;  2WFF 1;  4AQT A;  1AYM 2;  2WFF 2;  5DAV A;  1DLC A;  3MPB A;  1WLT A;  2XVK A;  2KM2 A;  2SLI A;  3RSJ A;  3B9I A;  1IQA A;  4NIH A;  1PNF A;  2CDO A;  2P3Y A;  5IUQ A;  3IAQ A;  1HQW A;  1AJO A;  1AL0 G;  2W1W A;  3CIH A;  3D4K A;  1GUI A;  2VW0 A;  3H1Y A;  3KV9 A;  4JKM A;  1OA2 A;  1LOB A;  4IDZ A;  4WVW A;  2DCZ A;  3VBS B;  2P4E A;  3T4H B;  1YI9 A;  3WF0 A;  3BIE A;  2WLQ A;  3A4U A;  3KB5 A;  1QH6 A;  5L73 A;  4YZ2 A;  4JGZ B;  5ANQ A;  4JDM A;  3VBH A;  3G6J B;  3RWN A;  2WNV C;  1W99 A;  4L8Q A;  1W6M A;  1XE7 A;  4UFH A;  4AQS A;  3OUH A;  1POV 0;  4QD2 A;  1ND2 C;  3CO2 A;  1R08 3;  4ZS3 A;  3RGB A;  2FHR A;  3GZU C;  2B45 X;  4CEY B;  2BJS A;  3PL0 A;  4LO5 B;  2NMO A;  1SLL A;  3WNK A;  1C8M 3;  4PHZ A;  1IGO A;  4FOV A;  2C0Z A;  1MZF A;  5F3E A;  3OY8 A;  5FP8 A;  4B29 A;  3TNP B;  1XB9 A;  2ZOE B;  3CF6 E;  2P2K A;  1VBB 3;  4PI0 A;  3MW2 A;  1W3X A;  4HT1 T;  5FOB B;  4HKO A;  4NMI A;  4XTM A;  1DQ1 A;  5BNO A;  4QGN A;  1UZ0 A;  4CCC A;  4Q4X 3;  1T2X A;  1ONA A;  1UMZ A;  2I74 A;  5I0R A;  5AC9 3;  1RIN A;  1UU6 A;  1H2K A;  1DQ0 A;  1K45 A;  2WRA A;  5G04 L;  3ZSM A;  4XF4 A;  2WJS A;  5EJZ B;  1CVN A;  3NO8 A;  3OGG A;  3AKT A;  5KC5 A;  1JOB A;  5KHG A;  1KS4 A;  4ZZ8 A;  4E4S A;  1GWK A;  4BMB A;  3AVR A;  4Z8B A;  2FDF A;  1WWY A;  2ILM A;  1PK6 A;  4BA6 A;  4RGK A;  1F35 A;  2ADD A;  2VG9 A;  3OOX A;  5FMD A;  4BXS V;  2A1X A;  3VBU A;  3CJX A;  5K9Y A;  2JDP A;  3IBM A;  5T54 A;  1VBD 1;  1RJ8 A;  1AJK A;  2WWU A;  4RS5 B;  1HW5 A;  1MZ6 A;  3ASI A;  5FYV A;  1HB2 A;  2JD9 A;  1C5H A;  3O1V A;  1JZ4 A;  1J3Q A;  1U12 A;  3A21 A;  1VBE 3;  2YMZ A;  2BGP A;  4NWW A;  3VBF A;  3U0Z A;  4D8M A;  4K3U A;  2D3S A;  2VUL A;  5FPV A;  3HPN A;  2WN2 A;  4AVB A;  2ARC A;  3GBW A;  4AQ6 A;  3KGZ A;  1REE A;  5C9A C;  4ASK A;  3WG2 A;  2HWC 3;  5F3C A;  2VZR A;  3SEE A;  1TMF 1;  2E26 A;  4QGL A;  3MFC A;  5BPX A;  2GNT A;  2ZML A;  2OYZ A;  1F2N A;  5A3L A;  1Z0H A;  3WW4 A;  1ZA4 A;  3WHU A;  5JXI A;  4YW7 A;  3O7O A;  1JUI A;  1VR3 A;  1XQN A;  2CAV A;  4CCJ A;  1YI7 A;  3PIJ A;  5FY4 A;  3JBG 3;  5FKB A;  4Z1V A;  2VM9 A;  3ACH A;  4JKL A;  4Y1Z A;  1DQ6 A;  3N9P A;  5FYB A;  1XYP A;  3LSE A;  4HXC A;  4ONU A;  4QU2 A;  3CQO A;  1DGR N;  2QQK A;  5E8A A;  3O1M A;  3V64 A;  3ZN6 B;  4E27 A;  2BP6 A;  2XJT A;  3A7Q A;  4CDQ B;  1RUD 3;  1QEX A;  3MIB A;  1AYN 3;  2G4I A;  3LPF A;  1GIC A;  4W6W A;  3PVB B;  2WSV A;  3BUC A;  1EP0 A;  5FZ4 A;  1HB1 A;  3ZIW A;  4WM8 B;  4XJW A;  4RR3 B;  3E6D A;  5BYN A;  1POV 3;  3WLU A;  1OVS A;  1PX3 A;  1SLC A;  4GB3 3;  2R07 1;  1O3T A;  2R07 2;  4AXO A;  1S0B A;  4PLN A;  3T2Q A;  3BTX A;  1W9S A;  3ABZ A;  2E7Q A;  3D5O A;  3NNF A;  1TNR A;  3ZSJ A;  1AR9 3;  3H8U A;  3K51 A;  1OVP A;  5FZK A;  1HJG A;  4CU8 A;  5FWJ A;  1OH3 A;  4K7J A;  1HN1 A;  2VZU A;  1REF A;  4NO4 A;  4Z2W A;  1O3R A;  2IZW A;  5FXV A;  1MQT B;  1JZ6 A;  3MW4 A;  5SV5 A;  2JE9 A;  3NJX A;  3LOI A;  1RUE 3;  4B3N A;  2OW4 A;  1B09 A;  3WY6 A;  2FDI A;  1UX6 A;  1YO8 A;  1BBT 2;  1NXM A;  2AEN A;  1MEC 1;  3IB3 A;  3K4Z A;  3K4D A;  2R32 A;  2VEC A;  4XIO A;  1MEC 2;  2XJP A;  1W8Z A;  1UY1 A;  2R0H A;  2ZX1 A;  3AMN A;  4EZ4 A;  1VAV A;  4QPG A;  5CKM A;  5HCH A;  3UYJ A;  4YWA A;  2RR1 3;  3FBY A;  5I0T A;  5CFD C;  3NV4 A;  5KXE A;  1PO2 3;  2W39 A;  3NNM A;  3N9M A;  3OD0 A;  1GNH A;  5CIS A;  1H8V A;  2ZGQ A;  5FP4 A;  5C8C A;  4LKE A;  1Z7S 3;  4J1X A;  3MUY 1;  3MGU A;  3OD4 A;  5J7M A;  1R08 1;  3N7L A;  1R08 2;  1VRH 3;  4N90 A;  4U36 A;  3OTF A;  3AP5 A;  4XZU G;  3LA3 A;  3OF1 A;  1C8M 1;  2B9U A;  1NY7 1;  3WOG A;  1C8M 2;  2QDR A;  4IUG A;  5FK8 A;  4CXY A;  5FMB A;  3RMX A;  2ZMN A;  2UWA A;  3ZX7 A;  1VBB 1;  2ZEW A;  1ND3 A;  4IEW A;  5GAL A;  3O1T A;  2I45 A;  1VBB 2;  1W6P B;  4K6B A;  1OOP C;  1PX4 A;  1PNG A;  2VOX A;  1AF9 A;  1XYN A;  3A0K A;  1PIV 1;  1XNA A;  4HMZ A;  1UF2 C;  4Q4X 1;  3Q8C A;  1PIV 2;  4XET A;  3WG1 A;  4YGB A;  1UU5 A;  4JAA A;  4Q4X 2;  2VOT A;  4EYU A;  4KU7 A;  3I3Q A;  4XFI A;  3ATG A;  1UKR A;  4C1W A;  5LY2 A;  3VB9 A;  4IV3 A;  2X05 A;  2F17 A;  3INA A;  5FPL A;  1TE1 B;  4F83 A;  3R0R A;  4R9D A;  2XWJ B;  2O0O A;  4XUQ A;  5FYM A;  3TOJ A;  4BWO A;  3AM2 A;  1DYK A;  4LUM A;  4DXZ A;  3VZO A;  5C4W B;  4KI5 M;  3AFG A;  1CON A;  2VNG A;  2YU2 A;  1EAH 3;  2LUW A;  1VAK A;  1Y7B A;  3ZFG C;  3S7E A;  5T52 A;  2DTW A;  3NL1 A;  2E7A A;  5TSW A;  1OLR A;  3I2J A;  5K4L A;  2WC2 A;  2UY8 A;  3KLS A;  4GAL A;  4LBQ A;  4AAP A;  4YFW A;  4UI9 L;  1I6X A;  1JU4 A;  3WW3 A;  5A6Y A;  3HEI A;  4FPG A;  4XXA A;  4JRA A;  1XU1 A;  4XW3 A;  1W2N A;  1GNY A;  2QQU A;  3MF9 A;  5FUN A;  2QCS B;  2QQL A;  2KXL A;  4WVZ A;  2ZGR A;  1BEV 3;  4K9S A;  5FYZ A;  3U37 A;  5IK7 A;  3VD4 A;  5DG2 A;  2FMD A;  1ENR A;  4URA A;  2HWC 1;  4ASL A;  2YFU A;  2HWC 2;  1AVB A;  2JKX A;  4OHW A;  1W9T A;  4QXB A;  3E5U A;  2C1F A;  5IVF A;  1GMM A;  4Y1V A;  3ZFE B;  3LFI A;  5J09 A;  5K8S A;  2JDU A;  4PJY A;  1FOD 3;  3JBG 1;  1ZZ9 A;  3H0O A;  4DY3 A;  2VMF A;  2GC2 A;  5FRA A;  1RUF 3;  4LK7 A;  5G05 L;  2WO1 A;  3LCP A;  2JEM A;  2RS3 2;  2W3J A;  5A70 A;  1DIW A;  3BU7 A;  5IVV A;  2VW2 A;  1NX9 A;  1PMI A;  2VR4 A;  3GJA A;  2Q8E A;  5GJ6 A;  4ORF A;  2XLA A;  3PTR B;  3HQX A;  1RUD 1;  3TBD A;  4CCL A;  4EV0 A;  3H8R A;  4FPF A;  1AYN 1;  1POQ A;  3JB4 C;  1G8W A;  1AYN 2;  5K7P A;  2QDN A;  5IK5 A;  1OD5 A;  1R1A 2;  1BQP A;  2A3W A;  4BK4 A;  1NQJ A;  3EJK A;  4OHV A;  4DO0 A;  4XFA A;  4IE0 A;  1POV 1;  1WW4 A;  3AMP A;  3VBS C;  3RZM A;  1GYK A;  4GB3 1;  4GB3 2;  3UK9 A;  3M3C A;  2ENR A;  5JVV A;  4LIV A;  1W2O A;  4JGZ C;  1D4M 2;  5JXJ A;  4MGI E;  1PGL 1;  3QCW A;  1PGL 2;  4CDW C;  3ZPO A;  1AR9 1;  3POG A;  4M3C A;  3PMS A;  1AR9 2;  2Y33 A;  3N9N A;  4XBQ A;  2GAU A;  3J9S A;  3VKM A;  2DVB A;  4B4P A;  1WCU A;  4XXP A;  5BNN B;  1LEC A;  3N36 A;  4CEY C;  2RVA A;  2BFU S;  2HYK A;  3VGI A;  4NJ4 A;  4AFA A;  1E5S A;  2GMM A;  5FZG A;  4QHO A;  4RN5 A;  5FDB A;  1RUE 1;  4YVW A;  1RUE 2;  4IEO A;  5ABJ A;  4MUV A;  1AL2 3;  1BK0 A;  2E51 A;  1J83 A;  3BOW A;  1W90 A;  1YXW A;  2IWG B;  3HIF A;  5JSR A;  3VKF C;  4NN0 A;  1W3V A;  3ZYI B;  1YFY A;  3NKG A;  5IWF A;  3ZIX A;  5F2W A;  5B2G B;  1K42 A;  3THC A;  2GC1 A;  4LBN A;  3SH4 A;  4YM1 A;  5HV0 A;  3OUJ A;  1XND A;  2JG8 A;  5DUX A;  1UOF A;  1UYX A;  2A6V A;  3J7L A;  2RR1 1;  2MEV 2;  4QDR A;  1YFW A;  2RR1 2;  4R9A A;  2YXS A;  2ZGP A;  3HD8 B;  1NA1 A;  1PO2 1;  4TN7 A;  1UWW A;  2W46 A;  1PO2 2;  5FXX A;  3E5Q A;  5FYY A;  1ODM A;  1H8T A;  1VRH 1;  5JOW A;  5IVJ A;  3CHX A;  1JYC A;  1VRH 2;  2PAK A;  2UY9 A;  4P9L A;  4QKN A;  1DQ4 A;  4BB3 A;  4M4P A;  2QJV A;  3D6E A;  4N43 A;  4C0H A;  4BQW A;  3QAC A;  1UPI A;  1UYZ A;  4RS5 C;  3VBR A;  1OD3 A;  2BV4 A;  5JIA A;  2EIC A;  3RVH A;  1CAX A;  1HB4 A;  2TUN A;  2J1T A;  2YY1 A;  1X33 A;  4KWJ A;  1YYN A;  3EMR A;  3MIE A;  5JI7 A;  3ZLI A;  2HBU A;  3AMM A;  5C3S A;  3OPZ A;  4DUX A;  4COU A;  3W59 A;  5GLT A;  1OT5 A;  2DBI A;  1LB2 A;  4IEY A;  5LCW L;  4JC1 A;  3VUO A;  3LEM A;  4M0N A;  4UFJ A;  4XHX A;  5FYH A;  2XML A;  2V4A A;  5IVB A;  3Q8F A;  1JZ7 A;  1WW7 A;  2PEL A;  2WIN B;  1UZZ A;  3OBA A;  5CNA A;  1SQ4 A;  2EID A;  3IWZ A;  2H0B A;  4YNI A;  3WG3 A;  5KXD A;  4JZR A;  1O8P A;  5LA0 A;  1KEX A;  1YFX A;  2D98 A;  2Z69 A;  2OPW A;  4NE9 A;  2J1U A;  2HWB 3;  2D7F A;  2EA7 A;  1X9T A;  1EAH 1;  2JB8 A;  2JEN A;  2ZGN A;  3T0B A;  4BQ5 A;  4HLT A;  1EAH 2;  2XHN A;  4D7S A;  1T6B X;  2WO2 A;  2W1Q A;  3PME A;  2ATF A;  2HJI A;  3N3H A;  3QH7 A;  5FCC A;  3S5Q A;  5DDJ 1;  3MDP A;  5DDJ 2;  1Q8Q A;  3TEW A;  1ZZ7 A;  4CDQ C;  4NRO A;  1W6O A;  5LAT A;  1V00 A;  2ARB A;  2DTY A;  4DQA A;  2HLE A;  3DKQ A;  4FTE A;  2GMP A;  1ZRD A;  3ZMN A;  1HRV 3;  1XNT A;  3HWJ A;  1GOH A;  3A23 A;  4HOO A;  4WM8 C;  2DBN A;  4RR3 C;  2ZBJ A;  4F8A A;  1BEV 1;  1WA4 A;  1BEV 2;  2UUR A;  2R0F A;  2YGL A;  1SG3 A;  1QJZ A;  2RDR A;  3UJO A;  1JU3 A;  3V0A B;  1ULD A;  3WF3 A;  3Q9O A;  3CDZ B;  4CP1 A;  1FT9 A;  2R04 3;  3HN3 A;  4B1L A;  2JG9 A;  1QJU 2;  5ISL A;  2GN7 A;  4IEX A;  1RVF 2;  1O91 A;  2YPD A;  1FOD 1;  3AYE A;  3WQ1 A;  4XCA A;  1FOD 2;  2JEC A;  4IW3 A;  2OXB A;  5JI9 A;  3N9Q A;  5ERL A;  1HDK A;  2XOM A;  3R4U A;  5FY7 A;  3VZL A;  1MQT C;  4YAR A;  2GC0 A;  3JZV A;  1W2U A;  4FP2 A;  1OFN A;  2DVD A;  3UET A;  2PXJ A;  4Q27 A;  2R06 3;  3ME2 A;  3EBR A;  2P37 A;  1W06 A;  2CGP A;  3VDD B;  4Q0S A;  4UYB A;  3LFM A;  4Z2A A;  1TME 1;  2JJ6 A;  3KT1 A;  1TME 2;  3U4X A;  4NHK A;  1PZ7 A;  3HR9 A;  4XJ8 A;  2D6M A;  1V6K A;  1RMU 3;  4PQQ A;  1DZT A;  4XAB A;  5H9S A;  4R8H A;  5C8W A;  3U10 A;  1X36 A;  2OUJ A;  4DZG A;  5FWE A;  3ZVX A;  2VTF A;  4LBJ A;  2B39 A;  4FT8 A;  1RUI 2;  1SFP A;  4F7Z A;  4Y4R A;  4FPH A;  1LAJ A;  1J59 A;  5C3P A;  1FMD 1;  3PVE A;  3BAL A;  1CAV B;  4G4F A;  2W94 A;  5JZG B;  1FMD 2;  1UX7 A;  3ZYR A;  1GQH A;  5C6C A;  1MZ5 A;  2XBO 1;  3UGH A;  2JDM A;  3MW3 A;  2XBO 2;  3BN6 A;  4Q4V 2;  5LBE A;  3U1X A;  3VD5 A;  4Y22 B;  4GH4 C;  3WUC A;  1C5I A;  2FDK A;  4Z07 A;  1WLC A;  2JDA A;  2ZAH A;  4DPN A;  4I0W B;  2BGC A;  3LPG A;  4QAW A;  4CU9 A;  1C1L A;  3PUQ A;  4QT6 A;  3I2D A;  4BH9 A;  1QU0 A;  1NCR B;  3FHA A;  4EWD A;  1A6C A;  4JCK A;  1HN0 A;  4FOW A;  5CA6 A;  3JD7 3;  1QF3 A;  1U5X A;  2VCC A;  4MLO A;  3WT3 A;  2JDZ A;  3WW2 A;  2YU1 A;  5FYS A;  2R1D A;  5C4W C;  3I2H A;  3ILF A;  4E9K A;  2NYY A;  4QPI A;  3UGF A;  3O1O A;  3POB A;  3CZU A;  2WFF 3;  1WMX A;  3HT1 A;  1VBC 3;  2Y6L A;  4BIF A;  4R4Z A;  3EYP A;  2ZPX A;  3POS A;  4S2G A;  3LSD A;  1NXD 1;  5C3R A;  5FPA A;  2W2I A;  3MHZ A;  4LO7 A;  5LY1 A;  2DWR A;  2HEW F;  1W05 A;  4KG8 A;  1S2K A;  2WQ4 A;  4GMP 0;  2JIG A;  5E88 A;  5IFP A;  1AXY A;  1D7P M;  4N8M A;  4Y1U A;  1JXN A;  1OSG A;  2OQ6 A;  3IAP A;  3URF A;  5L19 A;  2VMG A;  2WNU A;  2ZAA A;  3DN7 A;  1ULO A;  2R49 A;  1JS9 A;  3M7A A;  3OYW B;  4KL1 A;  4P9W A;  4A2U A;  2BOI A;  1W9Y A;  1YCI A;  2Z42 A;  3ZXK A;  2BNO A;  3LD8 A;  4OYU A;  2W0X A;  1W39 A;  1S0C A;  2ES3 A;  2VTX J;  2IFR A;  2XLF A;  3SIT A;  1VJ2 A;  5FY9 A;  4BPZ A;  3K48 A;  4XTP A;  5LRS A;  5C70 A;  3H9A A;  3ZFE C;  4P5H A;  2R16 A;  2BUK A;  5DUV A;  1N1S A;  3FHQ A;  5EQU A;  4FPY A;  2WYF A;  1NT0 A;  5D8A B;  2HWB 1;  4F3J A;  2HWB 2;  1QMJ A;  2X10 A;  3FUO A;  5A3T A;  2BZD A;  2FZ1 A;  1WCD J;  1NCQ B;  5LBC A;  2KR2 A;  3VHO A;  4AVS A;  2Y0I A;  4ATE A;  3PUI A;  2X5I A;  3THD A;  1GSL A;  1Q43 A;  2SBA A;  4RHV 3;  4OMD A;  5JOY A;  2VZS A;  3H50 A;  1IHM A;  2ET7 A;  3SMH A;  1SBF A;  1HRV 1;  4XFH A; 
#chains in the Genus database with same CATH homology
 3RZK A;  4NJ4 A;  3O1U A;  4QHO A;  2FDH A;  2FDF A;  3KHB A;  4ZS2 A;  3LFM A;  4IE7 A;  4CXY A;  4ZHN A;  3O1T A;  3I2O A;  4NPM A;  3O1V A;  3RZJ A;  3I3Q A;  4QKF A;  4IE6 A;  4QKB A;  4NII A;  4OCT A;  4QKN A;  2FDK A;  2FD8 A;  4O7X A;  5DAB A;  3O1M A;  4MGT A;  3H8O A;  3RZH A;  4NRM A;  3BKZ A;  3O1O A;  3BTZ A;  3BUC A;  4MG2 A;  4O61 A;  4RFR B;  3RZL A;  4NIH A;  4IE5 A;  4JHT A;  3H8X A;  3BTX A;  3O1S A;  5F8P A;  4NRQ A;  4IDZ A;  4QKD A;  3T4H B;  3BIE A;  3T4V A;  4NRO A;  4CXW A;  4NIG A;  4ZS3 A;  3H8R A;  3RZG A;  2FDG A;  3S57 A;  3I49 A;  3BTY A;  2FDI A;  3BI3 A;  4NRP A;  4NPL A;  4IE0 A;  4NID A;  3T3Y A;  4IE4 A;  3RZM A;  3KHC A;  2FDJ A;  3O1R A;  4CXX A;  2IUW A;  3I3M A;  3O1P A;  3S5A A;  3BU0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...