1AR81

P1/mahoney poliovirus, mutant p1095s
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
283
structure length
283
Chain Sequence
b'AATSRDALPNTEASGPTHSKEIPALTAVETGATNPLVPSDTVQTRHVVQHRSRSESSIESFFARGACVTIMTVDNSASTTNKDKLFAVWKITYKDTVQLRRKLEFFTYSRFDMELTFVVTANFTETNNGHALNQVYQIMYVPPGAPVPEKWDDYTWQTSSNPSIFYTYGTAPARISVPYVGISNAYSHFYDGFSKVPLKDQSAALGDSLYGAASLNDFGILAVRVVNDHNPTKVTSKIRVYLKPKHIRVWCPRPPRAVAYYGPGVDYKDGTLTPLSTKDLTTY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords P1/MAHONEY POLIOVIRUS
publication title Structural studies of poliovirus mutants that overcome receptor defects.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Virus
total genus 46
structure length 283
sequence length 283
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1997-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ar8100
5D8AC 4JGYB 5AC92 2HWB2 1NCQC 4Q4X2 3VBOA 1AYN2 4FTBA 1QJY1 1Z7S3 1R091 2RR13 4RHV2 1NCRB 3JBG1 4CDUB 1BBT3 5CFDB 1RUJ1 3ZXAC 1ND2B 1RUC3 1AR71 2MEV3 4CDWC 1OOPB 1C8M3 4GB31 4JGZA 4GH4B 2GSYA 1AL23 1K5MB 1AYM2 1H8TA 2VQ0A 1RUF2 2XBO3 1H8TC 1F2NA 4Q4V2 5GKAC 4IV3B 1NA1C 1RUD1 4JGYC 1TMF1 1NCRC 3ZFEA 2QQPA 1BEV1 4AEDA 4CEWB 3DPRB 4Y5Z0 4CDUC 5CFDC 2RM22 1ND2C 1BMV1 4AEDC 1AR81 1OOPC 1AR61 5C4WB 2R043 1ZBA1 1FOD3 3VBRA 4GH4C 5C9AA 3TN91 1FMD2 1RVF1 1R1A1 1K5MC 2WZR1 1PO11 2Y26A 4YVSA 1QJY2 1R092 5K0UB 2R072 4IV3C 1RUJ2 4Q4W1 1PIV3 1NY71 1AR72 1VB2A 4RS5B 5CFCA 4CEWC 3DPRC 3VDDB 2WS91 1RUH3 5CFCC 5L7OB 4N43A 1VAKA 1PGL1 1VBE1 5ABJB 2BFUL 1HRV1 1RUD2 1ZBE3 1TMF2 2R063 5BNPA 3NAPA 1X36A 5K0UC 1COV1 2X5IA 4IV1B 5AC93 2HWF1 4RHV3 5FMOL 1EAH1 1ZBA2 3VDDC 4Q4Y1 3TN92 3J8F1 1RVF2 1R1A2 5L7OC 4YVWB 2WZR2 1PO12 4Q4V1 4NWWA 5ABJC 1AYM3 1QJZA 4Q4W2 1NY72 1EV13 2RM21 1QQP3 4IV1C 2RS33 4CDXB 4LLFA 4CDQA 1RMU1 3FBMA 4CDQC 2RS51 1NCQA 1PO21 1HRV2 1R082 2WFF1 2PLV1 1VBA1 4YVWC 2R071 2BBVA 3S6PA 4CDWA 1COV2 1MEC1 4CEYB 5DDJ1 4WM7B 1OHFA 1QJY3 5FOJB 1R093 2HWF2 3JBG3 2RS11 1EAH2 3LOBA 1RUJ3 1AR73 1BBT1 4Q4Y2 4CDXC 2GH8A 3J8F2 1RHI3 4Y4YA 3VBUB 4GB33 1RUI1 1NA1A 4JGYA 1TME1 1HXS1 3JD71 4RR3B 1NCRA 1B35B 3ZFFB 4CDUA 5CFDA 1V9U2 1ND2A 1OOPA 5BNNB 1TMF3 1HX6A 5A33B 2FZ1A 4GH4A 4WM8B 1RMU2 1BEV3 1K5MA 5C8CB 2RS52 1AR83 1PO22 1AR63 2XPJA 1VBC1 3VBHB 2WFF2 1QJU3 2PLV2 4RQPB 4IV3A 3VBSB 1VBA2 2RMU1 4PDWB 3TN93 1R1A3 1MEC2 4QPIB 5DDJ2 4RR3C 1B35C 1PO13 4CEWA 3DPRA 2HWE3 4FTEA 4QPGB 2RS12 1SMVA 1A6CA 3IDEA 5C4WA 1BBT2 1RUE1 5BNNC 1RUG1 5C4WC 1OPOA 4SBVA 1PVC1 3CJIB 1RUI2 4GMP1 2WS93 1ND3B 1TME2 3VBHA 1HXS2 1R081 1VBB1 1RUH1 5ACA1 3JD72 5K0UA 3VBHC 1AL22 2WWSA 4RQPC 1VBE3 4PDWC 2HWB3 1HRV3 4Q4X3 1AYN3 2ZTNA 4QPIC 1PGW1 5JZGB 4RS5A 5A32B 3VDDA 4RS5C 1COV3 2HWC1 1AR91 5L7OA 1VBD1 5J98B 1ASJ1 2BFUS 1VBC2 5ABJA 1EAH3 3CJIC 1C8NA 2RMU2 5BNOB 4RFT0 4Z92B 1FPN1 1RUF3 1V9U1 2HWD1 4Q4V3 4IV1A 5FMOS 1HRI1 1WCDJ 1MQTB 1QJX1 4N53B 5D8AB 1RUE2 1VB4A 1PIV2 1RUG2 3ZFEB 3VBFB 2RM23 3VBOB 1PVC2 1VRH1 4GMP0 4YVWA 1E57A 1POV1 3ZFGB 1RB8G 1VBB2 1RUH2 5ACA2 1RMU3 1D4M1 1FMD3 1F8VA 2RS53 1PO23 5BNOC 4JGZB 2WFF3 1PGW2 1VBA3 1W39A 1Z7S1 2R073 2RR11 3M8LA 1H8TB 4CDXA 1MEC3 2HWC2 1AR92 1RUC1 1VBD2 4N53C 2MEV1 1ASJ2 3ZFEC 3VBFC 1C8M1 2RS13 2BUKA 3VBOC 3ZFGA 1NOVA 4AEDB 1AL21 3ZFGC 1FPN2 1RHI1 1RUI3 2HWD2 4CEYA 2XBO1 4WM7A 1TME3 1HXS3 1HRI2 1RUD3 3JD73 3VBRB 4CEYC 4WM7C 4JGZC 1QJX2 5C9AB 4EJRA 3JB8A 1EV12 1CJDA 4YVSB 1QQP2 3VBUA 1VRH2 2RS32 1ZBA3 4BCUA 3VBUC 1POV0 3HAGA 2R041 5J96B 1D4M2 1FOD1 1RVF3 4RR3A 1B35A 2ZAHA 3ZFFA 5CFCB 1AL0G 1VBC3 2WZR3 3ZFFC 1QJU1 1Z7S2 5BNNA 4FSJA 2RMU3 2RR12 2BPA2 1CD3G 4N43B 4Q4W3 5A33A 3VBRC 1PIV1 4WM8A 1RUC2 5C9AC 2MEV2 4WM8C 5C8CA 1C8M2 2HWE1 5BNPB 3JBG2 4YVSC 5C8CC 1RUE3 3NAPB 1RUG3 4RQPA 3VBSA 2TBVA 2X5IB 4PDWA 1PVC3 3VBSC 1RHI2 2WLPA 4GMP3 4QPIA 2XBO2 4GB32 1R083 1VBB3 5ACA3 1HQNA 4QPGA 1ZBE1 2R061 1IHMA 1AUYA 4QPGC 4FTSA 4N43C 5AC91 5LK7B 2HWB1 2HWF3 4Q4X1 1AYN1 3CJIA 4RHV1 1ND3A 2R042 2HWC3 4Q4Y3 1AR93 1FOD2 1BEV2 5BNPC 1VBD3 1ND3C 3J8F3 1M06G 1ASJ3 3NAPC 2FZ2A 1BMV2 2X5IC 1AR82 1AR62 1DDLA 1QJU2 4CDQB 2IZWA 5JZGA 5A32A 1AYM1 1FPN3 5JZGC 1NCQB 1V9U3 2ZZQA 2HWD3 1RUF1 1EV11 1NG0A 1HRI3 1X33A 2HWE2 1QQP1 1QJX3 2RS31 4CDWB 4NWVA 5BNOA 1GFF2 1VRH3 1POV3 2WS92 2PLV3 2DF7A 1D4M3 1ZBE2 2R062 1MQTA 4N53A 5D8AA 1FMD1 3JB4C 1PGL2 5DDJ3 1VBE2 1NA1B 1MQTC 3VBFA
chains in the Genus database with same CATH superfamily
3USSA 4Y1ZA 5D8AC 4JHZA 3ZVXA 1UOBA 2WBKA 5AC92 1LHWA 2HWB2 2LTNA 1DQ5A 2RR13 4RHV2 3OGVA 4IEOA 2ZJCA 3SH3A 1BBT3 3MFCA 3P3NA 4P5YA 1RUC3 3FL7A 4I3PA 3CHXA 3UGHA 3ON7A 2HEYF 1G6NA 1GSLA 3D5OA 1C8M3 4MHRA 2ORXA 3O0XA 3WCRA 3OJBA 3FFQA 4B7KA 2VZUA 3KVAA 1S2EA 3PTRB 5GZCA 3E5UA 4NO4A 2JIJA 1SBEA 1U5ZA 1U5YA 2GMEA 1KD7A 2XJUA 1GZWB 1XU2A 3BCWA 1F15A 1K5MB 1AYM2 1SEFA 2CDOA 3GHNA 3OGGA 4JC1A 3SH4A 1H8VA 1VAMA 2W9XA 1IPKA 1RUF2 3EXUA 5EPAA 1DQ0A 5EYXA 2H0BA 4E8DA 1F2NA 3LA3A 2VGDA 4AYUA 3WF1A 2GC3A 2OA2A 4IV3B 4LA2A 5DZGA 2RDRA 3MW4A 3I3MA 2WWUA 2OUHA 1UXZA 1F31A 2XJQA 5FZIA 3TBDA 2E26A 2PHDA 1JU3A 1IGOA 1JZ5A 2BGCA 1N3OA 2QQPA 3S57A 4OUMA 3DPRB 5F6KA 3KCYA 1O8SA 4QMAA 1EPWA 3SNMA 2BJSA 1ND2C 3M3QA 3W21A 4ASLA 4AHYA 4GZ9A 4N90A 2JWPA 1ZREA 1AR61 4MGIE 5C4WB 4FPGA 5C70A 3O5SA 1W04A 5C3PA 1FOD3 3VBRA 1JS9A 1UOFA 1YIFA 4HXCA 4GH4C 4LUMA 1WW4A 1R1A1 2IUWA 4COVA 1NQJA 4EZHA 5FTTC 1RUOA 2WZR1 1PO11 3GNEA 3ZDVA 4LUKA 1W8NA 2D98A 1CPMA 3KQRA 1AHSA 4OUEA 3VKFC 1H6YA 1RUJ2 2E7TA 3H9AA 3ZYGA 1H4HA 1DBNA 5A3UA 5FRAA 1VB2A 1MS1A 2R49A 3WOGA 4CU8A 4CEWC 1XBFA 4XEZA 1ENRA 5A7PA 5CFCC 5CZKA 1PMHX 1J3PA 1Y4WA 4YG6A 5LBBA 4B1MA 4YM2A 2BTVC 2PHRA 1VAKA 2W87A 3VZOA 4BXSV 2YV8A 2ORZA 5ABJB 1SLIA 2ZX0A 1S2KA 2HYKA 2QUOA 4HOOA 4AQ6A 4Q0PA 2A71A 1RUD2 4MXWA 1TMF2 5FMBA 1OURA 5HCAA 2ZAAA 1Q56A 1ENQA 3AMQA 3VB9A 5HV4A 1UU4A 5FZ4A 4C1XA 3AZZA 3N3HA 3I3DA 5AC93 1WKYA 4XMAA 2ADEA 2VXJA 3NL1A 2WNVB 4NPMA 4RHV3 3GHMA 4DUXA 5KHHA 1SBFA 1Q8OA 5FZ8A 5JOZA 5FY1A 3AFGA 4K6BA 3TN92 3S30A 3C7HA 3ZMOA 5FREA 5FYBA 5A6ZA 1CONA 4IQPA 3B5LB 2X53S 4P08A 1JZ6A 3WX5A 4MSVA 5FO7B 5FPLA 2V73A 5FXVA 1W3VA 3TYJA 4JHTA 5FZOA 2WZ8A 1I5PA 1KFUL 3MF6A 4JDMA 3WDVA 4JKLA 4LKDA 2D5HA 5FZFA 2ES3A 1AYM3 4HVOA 3EBRA 4ZXEA 5JXJA 4IE4A 4AEJA 3Q8BA 4QKDA 2WZPP 5E88A 1AJKA 1EV13 2JDYA 3LEKA 5JPMB 1YO8A 1PX3A 2DCYA 4I0BA 4Y22A 5G04L 1J83A 1UZ0A 2WNOA 3BB6A 4JZRA 5J37A 5FZ1A 4IV1C 2VMFA 2QQKA 4JTNA 5DAQA 2VOTA 4F8AA 4LEJA 4OQ8A 1RGSA 1IKQA 2C9KA 3E6DA 3UL2A 4AVAA 1QH6A 4LLFA 2ZKNA 2C24A 4JRLA 3ZXJA 4L2NA 2WSVA 1J84A 1JU4A 4JQTA 2WQ4A 4JTOA 4XFAA 5ERLA 1CZTA 1NXMA 4D0QA 1O5UA 1OA4A 3MPBA 1XE8A 4RSUA 1W6OA 2Y0OA 1HRV2 2VBBA 4HONA 1IPSA 1GU3A 1PK6B 4MGSA 1KQRA 1LU1A 3GBWA 5JSOA 1XRUA 3RZKA 2R071 4OI2A 1KDMA 2DDUA 5FKBA 5B4XA 3S6PA 4CP9B 4CDWA 1IKPA 2GNTA 2WNUB 1COV2 4HN1A 3H3LA 3N9MA 4XF4A 3WG4A 2C0ZA 1W0NA 4F3JA 1Q8SA 3ZYPA 2YC4A 5FZLA 3JBG3 3AKPA 3KF5A 2JD4A 5JCTA 1RUJ3 4U2AA 2WRAA 3X29B 3LEMA 1BBT1 2DYCA 3CDZB 2JEMA 3O14A 4CDXC 1ZYBA 3IDAA 2JJ6A 1YEWA 3MIEA 5T50A 3INAA 2PQQA 2ZHMA 3T2PA 3W9AA 3R4SA 3NV2A 4ITCA 5JR2A 5HCBA 2V4AA 2CGNA 3PJYA 3O0WA 2D3SA 4LQRA 3T0AA 4A44A 2P3KA 5IVEA 4ZU4A 1UOJA 1IPJA 2JENA 5FZCA 5FOBB 2D6PA 3E5QA 5EIYB 1QNWA 3HIFA 3POWA 3BU0A 1BJQA 1JBCA 1F5FA 2P6CA 3M70A 4CCMA 4XQWA 1RL3A 2OPWA 4LKSA 1TMF3 5JLVA 3JU9A 4Z82A 4B8EA 2K46A 2FZ1A 3GXUA 3HN1A 1ULGA 1BEV3 3A0NA 1GZWA 3WF2A 1K5MA 4QWNA 1GOFA 1UZYA 5C8CB 5EZWA 3OBZA 4LR4A 2WC2A 3MI8A 1UYZA 4S2DA 1H0BA 5DAVA 4LBNA 4Y1XA 4BM8A 4FBFA 1HV1A 2NMNA 2WFF2 3NJYA 2ID4A 2XWBB 4IV3A 1MPXA 1VBA2 1DGRN 4PBPA 5JIUA 3ATGA 3TN93 3ZR5A 3P3PA 3LQCA 2IFRA 4LBMA 4TLFA 3OBTA 5DDJ2 3WXPA 4RR3C 2NP0A 4BZ4A 3DPRA 4MUVA 2RVAA 2HWE3 3B94A 3AZXA 4ZU5A 2TEPA 1QXJA 4FPEA 4NUBA 3AP6A 1TQ5A 3OGJA 2CGOA 3POBA 4B1LA 3O1RA 5C4WA 3WQBA 4QB6A 2WWJA 1RUG1 4R9DA 1ZNPA 1V6LA 5FYHA 2DURA 4QX7A 5IUQA 3HT1A 2A6XA 5FZ0A 1PVC1 3OYWB 1H2NA 4GMP1 1KEXA 3AVSA 1ND3B 3SCFA 4BQ4A 3VBHA 1SG3A 1HXS2 2C9AA 4PLNA 1W8WA 4CXWA 4LIVA 4B7EA 3DCQA 2Y8KA 5FLJA 4GJZA 1NT0A 4RQPC 1XOYA 2JDMA 1VBE3 3NNJA 3QD6A 1ZZ7A 5FDBA 4PDWC 1YFXA 5IVYA 1O59A 1MVEA 2Y64A 1BLZA 2R0FA 4D8MA 1HRV3 2BV4A 2Y33A 2ZTNA 4Q4X3 4MXVA 5DZEA 5B2GB 4YFWA 4EWAA 2CAVA 4KWLA 2FMDA 3H7JA 2XOMA 4NHMA 4NHLA 4GJYA 3WG2A 1COV3 3FN9A 2HWC1 2XGXA 3ELNA 1GOGA 4TLGA 4AFCA 3WW2A 1QOTA 1QWRA 3EJKA 1ASJ1 2W2IA 4LNVA 3ZXGA 4OHZA 4HT1T 4Y24A 5FP3A 1HB1A 5ABJA 1KITA 5FJKA 3CJIC 4QQLA 3LE0A 1VRBA 5F8PA 4BJ0A 4WZCA 1YCIA 3M4FA 5CKQA 1Q5OA 3I3EA 4O7XA 3U0ZA 1TNFA 2HWD1 2ZGPA 4LO7A 1BZWA 4O65A 4Q4V3 4WVZA 2QQNA 4BMBA 5FMOS 3BI3A 1DQ4A 4LA3A 4NE9A 1WCDJ 1UOGA 1UMIA 2WNVA 3IDCB 1MQTB 3M7AA 5D8AB 3T4HB 4FOWA 2VVFA 4XDOA 1VB4A 3QH6A 5FYCA 1LOFC 3A22A 3IZOA 3SCHA 3FLTA 4COWA 1WMEA 1DG6A 1CAUA 2OS2A 1W8OA 2RM23 3VBOB 1YQ8A 3AP9A 2W68A 5FY4A 5IVJA 1GBGA 1VRH1 2PHUA 4G3YC 3KCCA 2LUWA 3ZFGB 3H1MA 3KWVA 1RB8G 1W0PA 2OIIA 2P6HA 4XF0A 1XJAA 2QCSB 3MICA 3ST7A 1FMD3 5FZAA 4AZZA 2GC0A 1F8VA 1Y9GA 2EXJA 5LBCA 4Q1PA 2YG0A 4NRMA 3N9PA 1QXRA 5T55A 4Q0UA 1SLBA 2YU2A 2WFF3 1LOBA 1PGW2 1MS9A 1GNHA 1VBA3 2ADDA 4QXKA 3RFRA 5IATA 5AVPA 4EE2A 2BYVE 1WMFA 2CYFA 1XYPA 4KG8A 5A3PA 5FZ3A 1EYBA 3LEGA 1AR92 3WT3A 2PHLA 2KM2A 1W0OA 5FPUA 2MEV1 1HW5A 3PVNA 2QNKA 3KCXA 4DB5A 5DQ0A 3ZFEC 5EP9A 3VBFC 2MHFA 1XNBA 3PUHA 1LAJA 2BUKA 3PMEA 5KXDA 4DFSA 2ZOEB 4UYBA 2A7AA 3B7MA 5CG9A 2H6CA 4Z8BA 1PK6A 3VGIA 2VQAA 4CP9A 1AL21 4CP0A 2VCCA 3A0KA 1FPN2 1UN1A 2WNUA 1JYNA 3IMMA 5LRSA 5FBJA 1XYNA 2ZHNA 3H42B 2Z79A 4LHNA 1HXS3 1HRI2 2D3PA 2QQOA 5FCCA 3DKQA 4CEYC 3MZHA 4D69A 4GKYA 5C9AB 2NZ9A 4C8DA 4CTEA 5FFOC 5KHGA 4LBQD 3DKWA 2WJSA 2FQPA 2B4KA 5FZKA 1ZBA3 3AVRA 1POV0 3VBUC 3FHAA 4BLJA 2R041 4RD7A 4K7JA 5C71A 2XLGA 5J96B 5FMCA 1STMA 2JD9A 1NQDA 2XJTA 2FDJA 4IE5A 4IEXA 5CFCB 3IN9A 3MYXA 2K9ZA 1AL0G 4XCAA 5J09A 4YGBA 5I93A 4JKKA 2G19A 4LBKA 1Z7S2 4LE4A 1JZ4A 2J1VA 1O7FA 2NMOA 3POEA 3BALA 5DUWA 3GJAA 5EWSA 5FPXA 1C4RA 2CDPA 1DQ6A 3PVOA 3NNFA 5C8CA 1UMHA 2HWE1 3W5MA 1OF3A 4LBQB 5BNPB 2EAAA 2E63A 1D0GA 1E5IA 3AX4A 4Y33A 2A6ZA 4PF5A 5CEHA 1G9CA 3NAPB 4PLMA 1NAEA 1HV0A 3FFZA 1YXWA 2QQJA 4OHYA 3ZSLA 2OYZA 3E5XA 3VBSC 1RHI2 3NV3A 5LBFA 5FQ0B 5L73A 2JG9C 4FPLA 2DCJA 2DUPA 3GZAA 1HQNA 1N3QA 5LCWL 2DFCA 4XZUG 1W8ZA 3CZJA 1AJOA 4FPKA 1AX2A 1ZBE1 2CAUA 1IHMA 3MUY1 5E6HA 4ZZ8A 4CCNA 3MV01 4QPGC 1HIXA 1N1SA 4BQYA 5CA6A 4N43C 3FJSA 2ZX1A 4XTMA 4MG2A 3ZO0B 2NYYA 1SFYA 4R4ZA 2HWF3 3N9OA 1UZVA 4Q4X1 1MVQA 2ZEZA 1HJGA 1OUXA 3OYWA 4HK8A 2AR6A 4UW3A 1ND3A 2Y0IA 4X8NA 1ZRRA 1BXHA 3WY6A 1AR93 3GZTB 4EN7B 5A3OA 4ZZ5A 4AAXA 1IG3A 2O1QA 1M06G 3KD4A 1WLCA 5GLWA 4FT8A 1FNYA 3DV8A 3RYRA 3UGGA 1NLSA 2YFUA 3ITQA 1AR62 1OLQA 2Q0AA 4E4DX 1DDLA 1W99A 3KV4A 2Y34A 3VHRA 1DQ1A 5I0SA 3O1OA 1V6KA 1OBNA 1ULDA 4M3CF 3BPSA 4P02B 4KWUA 3IAQA 1FPN3 1SFPA 2LS6A 5JZGC 1NCQB 1V9U3 2O14A 1OH4A 4DXZA 1VLNA 2C26A 1QJEA 1KXGA 1HRI3 1X33A 1ULOA 1QQP1 5T52A 2BQPA 2WLQA 2RS31 5GM0A 2J1SA 1O4YA 4P9IA 1O4ZA 5C3RA 3W5NA 4NWVA 4E2GA 2W47A 2W1UA 5CFDC 4BA6A 1US3A 2GN3A 4A2UA 4W6YA 4BXFA 5T54A 1H1AA 1GZCA 1POV3 3FWEA 3PJQA 2VZOA 4PJYA 5GLVA 2A5ZA 2PLV3 1W8TA 4NR1A 3T1MA 4TSVA 1SZBA 4FPCA 2EALA 2R062 3ZN6B 4CCOA 1SLLA 1MQTA 2TUNA 1FMD1 5D8AA 1G9DA 3RZMA 5CG8A 5IJRA 3ENRA 1NA1B 1C1FA 3LDRA 4ZS2A 1Q8VA 1CWPA 3OSDA 4AI9A 5CBLA 5J36A 3VBOA 2AH2A 1YFUA 1AYN2 1Z7S3 4XCBA 2VECA 1NCRB 1JOJA 2WIIB 4UW5A 1VMHA 1HB4A 1DU3D 4B4QA 4NHXA 1C28A 1UY0A 4HPKB 1NYWA 2EIEA 3VL9A 4H2AA 1J1LA 1N47A 1K45A 1OOPB 1ZVFA 5FBZA 1SBDA 3HNBM 2HJIA 1ENSA 4UFHA 2UWCA 5DN2A 4GB31 4EYUA 5LY2A 2D6LX 2Y60A 2ZGOA 3DUIA 3I59A 1VPHA 2I2SA 4YZ5A 2ZEWA 2ARAA 2GSYA 4GA9A 3ILFA 4QQHA 2QBXA 1OQ1A 5A3WA 4BB3A 3RI9A 4BWOA 5JOXA 2VQ0A 4XHBA 1UPSA 3B01A 3ACLA 1H8TC 2Y6FA 4QHZA 1T2XA 4CUGA 3KB5A 1EPZA 3C7EA 1VAVA 2YGMA 2ZGLA 4YM0A 5T5PA 2CGPA 1V6IA 2P17A 3HWJA 4JGYC 4XDPA 4TYSA 2WO1A 5DPNA 3ZN4A 5JOYA 4LIUA 3I2HA 3R4DB 3RJ2X 5FLHA 4YW7A 3N36A 3SEPA 3QACA 3R05A 4CDUC 4Y1UA 5HXMA 1R64A 4AEDC 4NHKA 1Q8PA 1AR81 2QKDA 4P9LA 4DINB 4G9SB 2VR4A 1JYCA 3JZVA 4HANA 3WUCA 4PLOA 5FZ6A 1PNFA 1X82A 1ZBA1 1CX4A 3TEXA 4LBJA 3DYPA 1S0DA 3DXUA 3U10A 3OPTA 2RJLA 4DQAA 5GZGA 5C9AA 1WD3A 3KT1A 4DOUA 3DECA 4OMDA 2QJVA 2B42B 2JECA 1OKOA 1YQ5A 2BP6A 3CKHA 4Y4RA 3LFMA 4CCJA 4IEYA 4QQPA 4YZ4A 2IXJA 4QGNA 1QJY2 2PHWA 3POJA 1QMJA 1R092 4MXWB 1UIKA 3GM8A 4FOVA 2R072 4CXYA 1PIV3 1NY71 3ZSKA 3FZ3A 1AR72 1GR3A 2WNEA 3GZEA 3PL0A 4Z2AA 1S1AA 5CFCA 2AEYA 4DPNA 5F2SA 3VDDB 2WL1A 2WS91 2H0VA 1RUH3 1W2AX 5C5TA 3U1XA 1V70A 5F32A 5FYYA 1A34A 2AUYA 3QBQA 5DUUA 3ORJA 5ANQA 3RRDA 2Q8EA 1EUUA 1YIPA 4Z2WA 4CVUA 4GIQA 4DY5A 4AL9A 1GZ9A 4L92A 2Q5TA 4HBNA 1RTVA 4W4ZA 2R063 2PHXA 1UMZA 4LBQA 5BNPA 1X9PA 1ZRFA 3RG0A 2WZEA 3NAPA 5JMOA 5K0UC 4FOQA 2R32A 1SHWB 2GH2A 2W46A 4KWJA 5KHIA 2RHPA 1Y3TA 3MEPA 3VD9A 2R7EB 5ISLA 2HWF1 5FMOL 3I3BA 1OFSA 5FQ0A 2YFZA 2ATFA 1GYKA 2NPIA 1J59A 2FHRA 1E5SA 1EAH1 4I02A 1AVBA 2C1FA 3AKSA 5FPZA 2XDVA 2X09A 3NSTA 3MBWA 3ZXDA 1RVF2 1IS5A 5J1XA 5LASA 2ILMA 3OBRA 4J25A 2UY9A 1VALA 3OEBA 4RGAA 5H9RA 3T4VA 5L7OC 1WCKA 3MUZ1 4YVWB 3H50A 4XBNA 4AQTA 1OXCA 2HYXA 1FV2A 4KG0A 3AK0A 4NWWA 2YUEA 3GDBA 1WBFA 4YM3A 2D6NA 4QAWA 5IVVA 3A21A 4META 2LRPA 2MNGA 4DXTA 4Q4W2 4XETA 2JDNA 5F1RA 4UOJA 2Y6JA 1EP0A 4XFBA 1PZ9A 1S55A 1QNYA 2V4VA 4AEMA 3AYEA 3EO6A 3WQ7A 4YWAA 3IT8A 4CZSA 5FO9B 2BU9A 2BGPA 5FZHA 2DV9A 1OFNA 5GLUA 4NAMA 3S7IA 3O1SA 4N9HA 4IERA 3WNMA 1JODA 4BIFA 4BMEA 4CDQC 2RS51 2V09A 1NCQA 1PO21 5F5AA 3H0OA 1G8WA 4HL0A 2BWAA 3OTFA 1TZOA 2YPJA 4FPFA 3ZYFA 1S0CA 2PHFA 2PLV1 1IS6A 3ZX7A 3T30A 4AI1A 2NN8A 1UU5A 3TRSB 3BGAA 1TG7A 3WR0A 3O1MA 3VZJA 3IB3A 4AFBA 2VZRA 2YROA 4CEYB 1RIRA 1IS4A 2UY8A 2FDIA 1OHFA 1SFNA 3WDYA 1OUSA 1QJY3 1UWWA 1R093 1O6UA 4IUGA 4ET7A 1I3HA 2VNRA 1W6PB 4AR2A 3ACGA 5C6CA 2WKKA 2ZX4A 4XUNA 1AR73 1DFQA 4Q4Y2 3OCPA 5I91A 3J8F2 2ENRA 3P1IA 4I0WB 3ZN6A 3ACIA 4IEWA 3VBUB 2AZ5A 2A3YA 1RUI1 1NA1A 1NXD1 1JXNA 3GBFA 1QXPA 3H3ZA 3THCA 5AFBA 1JYTA 1TME1 2Q30A 1HKDA 4LO8A 4UFKA 3RMYA 4DMIA 5JAXA 1NCRA 1E5HA 1B35B 4GAZA 4GXLA 2JXAA 3WHUA 1LGBA 5HI0A 2VBDA 4OHXA 2IC1A 1WMXA 4HPKA 2I45A 4N8MA 4NROA 2N7GA 3BTAA 4JVAA 4KGGA 4EN0A 5LZ6A 1OOPA 4XW3A 3FUQA 5FP4A 5BNNB 3AYDA 5IAXA 1HX6A 2RJKA 2XXZA 3MDPA 4LOTA 5LATA 2WABA 4W6WA 1RMU2 3I7DA 3ZDSA 3Q9OA 4YG3A 2VULA 3C7OA 1JOPA 1Y9MA 3HMYA 4ASMB 5IT6A 2DTYA 1DZRA 4KWKA 3VUOA 3L9JT 4QD2A 2W08A 1JUIA 1VBC1 3VBHB 2DU1A 1JTZX 5DAPA 3IWZA 3VBSB 5FWEA 3CEWA 3OD4A 1W9WA 1O3RA 1Z0HA 1X50A 2RMU1 2JDUA 3HVDA 4P9XA 4MX3A 2V5YA 4URAA 1MEC2 1UX7A 4QPIB 2P34A 4AVCA 3D4KA 1SDDB 3CIHA 1PMJX 5L9VA 1A8MA 4FO9A 1CVNA 1SQ4A 4PI0A 1LOCA 4FTEA 4QPGB 4R9BA 2BOJA 1IQAA 4I0AA 2RS12 1CR7A 3DN7A 1SACA 2XJRA 3CO2A 4BYYA 3UNPA 3OPZA 2ZMLA 1TVGA 1IS3A 2GP3A 1DCSA 4IE6A 2EXHA 2VCAA 2ZEYA 4QDQA 4SBVA 4JRAA 1VJ2A 4AFMA 1S4CA 1RYYA 2VD7A 3WF4A 5AVAA 1PM7A 3MO4A 2ZMNA 4EN8B 1R081 3KSCA 1VBB1 1RUH1 1WCUA 3JD72 4K1YA 4L9BA 4UXAA 3THPA 5ACA1 1XNTA 4W8JA 2PXJA 1AL22 3AB0A 3K75B 2DU0A 4DIQA 5I8YA 2A3WA 4AI2A 2BVVA 2DCTA 4FAGA 4ASKA 2VQUA 4AW7A 5JOWA 2XKPA 2HWB3 5FUPA 2JKBA 5JZGB 2GALA 3LAGA 4HSLA 3KHCA 2VC9A 2G9GA 1S2BA 2RJ2A 4RA0A 3VDDA 1HB2A 2X10A 3CF6E 4RS5C 1HN0A 2PQSA 1C1LA 2UURA 1CAUB 3A23A 5EQUA 3M3EA 1VBD1 1LCLA 1DQ2A 4XC9A 1G9BA 3MIFA 2BFUS 2VM9A 2VZ3A 4N7UA 5CISA 3SHRA 1JYIA 1BVVA 1C8NA 3AKQA 3KV6A 3I2KA 3D0SA 3Q8FA 5BNOB 1XNCA 1OQEA 1JYWA 1KFXL 1UF2C 1W06A 4RFT0 1RUF3 3Q8EA 3NKGA 4EWEA 3UT0A 4BIOA 5JMCA 3OY8B 3BPZA 1LOFA 1KJLA 5LWBA 1QJX1 3H3UA 4N53B 5IHRA 1RUE2 4HVRA 1MZFA 3NWKA 2EA7A 3POGA 2UYBA 2VO5A 5GLTA 5I0UA 3E6CC 3I4IA 3KQ4B 1OPMA 3KLSA 3VZKA 1ONAA 2QFEA 4IE7A 2JG8C 4XBQA 4Y5TA 4YVWA 2ARXA 3AL5A 3UESA 3WD5A 1JW6A 3NMBA 1RMU3 2OVUA 1ZZBA 4Y1VA 1IQDC 1N1VA 3S5QA 5IVBA 4R52A 2UWBA 4CP1A 2HEVF 2FD8A 4XABA 5E89A 4ZY9A 4ZS3A 5IVCA 3RQ0A 1DLLA 1H1MA 4JGZB 4OI0A 1ODMA 2J7MA 1DF0A 3FX3A 4P9GA 3WCSA 1S0JA 5KC6A 2RR11 1DYPA 1VMJA 3M8LA 1H8TB 2VH9A 4BOWA 1S0FA 2OQ7A 1EY2A 1MEC3 4IEZA 1W8HA 3KHBA 1RUC1 4XFIA 1XQNA 1J3QA 2EVXA 3M3CA 1RXGA 3J7MA 2VPVA 1YC61 4ONUA 1C8M1 1RJ7A 3I2OA 4BE3A 2RS13 3OF1A 3PUQA 1DP0A 4PI2A 3MFAA 5LA1A 1NOVA 1J1TA 1RINA 3GF6A 4MGZE 4AEDB 4DRRA 1SLTA 1UKGA 4KBZA 3AL6A 5LY1A 4LHLA 4BQ2A 4TTGA 5FY7A 1DHKB 1TEIA 5T5JA 4B3NA 4CEYA 3NO8A 4JV4A 4MGQA 3V56A 2O0OA 4EN6B 1RUD3 3DYMA 3JD73 3LFIA 2BEOA 4WM7C 1WA6X 4Q8LA 1DYOA 3FC0A 1W6PA 4IW3A 5A3TA 4P9JA 3JB8A 3B93A 2GDFA 3I2IA 4HFSA 2BW8A 3OPWA 3WG3A 1UIJA 4YVSB 1KGYA 2IVJA 1QQP2 5EFUA 3PIGA 2W1SA 3VBUA 1OA3A 2JIGA 3MIDA 2RS32 1QEXA 5FY0A 4QQOA 4C0BA 4CCEA 2ZCWA 3C3VA 5F37A 3HAGA 3IDBB 3VDCA 4CU6A 1W3XA 4MZUA 1D4M2 1FOD1 1LHVA 1ULFA 4PIZA 2HLEA 1B35A 3WV6A 2ZAHA 1WZXA 5LRRA 4L0PA 1WW5A 3NKTA 3PLQA 5C3OA 5BV6A 1PGSA 1LKNA 2WO2A 3I2DA 4AI8A 1AX1A 5BNNA 4FSJA 4UFMA 3S7EA 1QJFA 1HQWA 2BPA2 4P5HA 3Q8CA 4I09A 5DAXA 2GNBA 4JX0A 3VBRC 2P3JA 4MVTA 3AXDA 5A6YA 1MR5A 4YG0A 1PNGA 5FLIA 3THTA 3WDWA 4WM8C 4Y3OA 3H8UA 4OUSA 2JDAA 4YW3A 4XQDA 4XQ4A 5F3CA 2LM3A 3ZKUA 3J26N 4KU8A 5FIXA 3PHMA 5HCHA 1RUE3 2EIBA 3AYCA 2W52A 3ZIWA 4BQ3A 1UU6A 4JAAA 1F35A 2VZVA 2X5IB 3VBSA 4DY3A 4L99A 4XF1A 2DVAA 1LOGA 2WLPA 4QPIA 2XBO2 1YQ6A 4GB32 3N7KA 5GZDA 2VCBA 2W3JA 5KHJA 1MZ5A 3ZXEA 3O1UA 4DEQA 4YZ1A 3ME2A 3IPVB 1ODNA 4K9SA 4QPGA 4V1PA 1PZ8A 3LA2A 5FP8A 3D0JA 2LALA 3VKNA 2RG4A 4FTSA 4FCAA 4UBHA 2Q8CA 1UXXX 5AC91 2HWB1 3N9NA 4IEVA 5K9YA 1H2MA 1U5XA 4RHV1 3IIIA 4XHXA 2VY0A 4AI0A 5FZBA 4FXGB 3UJOA 4OLLA 5A1AA 4YYOA 5A3NA 2CU5A 1AR82 5CAZA 4M01A 3RSJA 2DWRA 1WWYA 1ST8A 1QJU2 4CDQB 5CKNA 2WQ8A 3ACFA 3VZNA 4I3GA 5HCFA 5JZGA 3JUUA 2QTWB 4XF9A 5TSWA 3ZN5A 1AYM1 2AC1A 5A1LA 2TNFA 2ZZQA 3HR9A 5E1RA 1FNZA 1U12A 1RUF1 3FHQA 2JDKA 5FZ7A 1EV11 1URXA 2VOWA 1NG0A 1OLRA 4XJAA 4A4AA 5FXXA 5C8WA 2ET1A 1PM4A 2P2KA 3K2OA 5FY9A 4QX0A 5KHKA 4IESA 2WAOA 3IIAA 4XMIA 1YYNA 4LTAA 2A3XA 1DGWA 2ZGSA 5BNOA 2IFWA 5K4LA 5BYNA 1C57A 1OSGA 1PHMA 4XXPA 5CU1A 5JSRA 1H9PA 2WS92 3I59B 4K21A 4I30A 4YNIA 4SLIA 1GICA 5F5IA 2DF7A 2F6BA 3HNMA 5FYMA 4COYA 3OY8A 1D4M3 1BQPA 1DYKA 1LJ7A 2P37A 3AJZA 2B9UA 4N53A 4RYDA 3JB4C 4X6RB 5DDJ3 3UGFA 1BK0A 1AXYA 1CGPA 4BISA 4NIIA 5FK8A 3W20A 5FZMA 4CE8A 2Q4SA 4YZ3A 1LGCA 5IW0A 5F6LB 2ZBJA 3JBG1 4UW6A 3UV9A 2V5DA 4IL7A 4LO5B 4NIAA 5CFDB 1OT5A 1RUJ1 3AZYA 1ND2B 1W9SA 1BKZA 2A70A 5FYIA 4H3WA 4CDWC 4XFHA 4XAAA 3VHNA 4R9AA 4K1ZA 2A1XA 2GNDA 4LOSA 5LA0A 1BK1A 1GLHA 2D93A 1SPPB 3HNYM 4GH4B 4JGZA 5BPXA 4CCLA 1JUHA 2E53A 5APAA 4KU7A 1UY2A 1FT9A 2IWGB 3MIGA 4W50A 1H8TA 4HZFA 4AWDA 2FDFA 1JH5A 2X8KA 2XBO3 2JB4A 4FPYA 3I2FA 2YXSA 1PVXA 3ZIXA 5GKAC 4KMQA 3UKVA 1RUD1 2XVLA 3ZXLA 4IXLA 4A3XA 1TMF1 4IEQA 5IVFA 2PA7A 2Y38A 1WGPA 4QDSA 4LO6B 4XACA 4YW2A 1GQPA 5FYUA 1AF9A 5J7MA 4C1WA 1BEV1 4AEDA 4CEWB 2WFPA 2FDKA 1F4AA 2HBUA 3D3AA 3HQUA 1OF4A 4Y5Z0 5DXDA 5KWRA 1BMV1 2AACA 2CY6A 1JYVA 1DZTA 3PUIA 1UAIA 5JI7A 3T3YA 1UO9A 2XQXA 2O8OA 1CESA 2ZEXA 1W9FA 3TN91 1SCSA 4Q0SA 2VNVA 5FV3A 2L9LA 1K5MC 4BLIA 2GMPA 2CWMA 4YVSA 2Y26A 1XU1A 1REFA 3RNSA 4AHXA 3RWKX 1QHDA 2QVSB 2BNOA 2J1UA 2QE3A 1D0HA 4IV3C 3B69A 4C91A 3VD4A 3VZMA 3L2YA 1H4GA 3AFKA 4CCDA 4K20A 4H55A 2K2SA 2ETEA 2KXLA 2E7QA 2VQTA 4NPLA 3HBZA 1C5IA 2A6WA 4XIOA 2VMIA 4RS5B 3ZXFA 3AC0A 3DPRC 3OGRA 4K8RB 2CTVA 3ZLIA 1GKBA 1YLLA 4LLOA 4FFFA 3V64A 1XE7A 3ZSEA 3P6BA 3DF0A 3J7HA 3BTYA 3PU8A 1LHUA 5JIAA 3ES4A 1P8JA 4PBOA 3WSOA 1PGL1 1VBE1 4P9YA 3I3QA 1ZRIA 3PVEA 2BFUL 4Q0VA 1HRV1 4UFIA 3RDIA 2D43A 3WP5A 2UYAA 5EYYA 1A3KA 1OVSA 1WW6A 3UJQA 2OUJA 3VLBB 2WYFA 1UY1A 1COV1 2VTFA 2Z69A 2X5IA 2Z5WA 4HKWA 4IV1B 2CSGA 3GYDA 4QU2A 4YW4A 2PTMA 1ULCA 3TNPB 3WHTA 3HJRA 2Y6LA 4HK9A 4FVVA 1LRHA 3NNGA 3LPFA 3K4AA 5BXXA 1CZSA 2XKOA 3U37A 3RMXA 1F4HA 3ILRA 3IPVA 3RYKA 4ATFA 2VG9A 1Y43B 2RDQA 1R1A2 2DBIA 3WG1A 1L7LA 1LODA 2ZACA 1W90A 1T6BX 2WZR2 1PO12 4Q4V1 3K3NA 1LR5A 2K0GA 1F9KA 1XXNA 2D6OX 2ZGUA 3MLJA 5ABJC 1UQXA 2AREA 4BK5A 1QJZA 3GALA 1UW8A 2EXIA 3RZZA 1JZ7A 2DCKA 4GULA 4I2OA 5FXWA 4UAPA 4ZHNA 2RM21 3NNMA 5FR3A 1QF3A 1YWKA 4Y5SA 5EHDA 4CDXB 4DNYA 4YFZA 3C7GA 5DG1A 3MV11 1WCQA 2WO3A 4CDQA 5F9TA 3U78A 1LHNA 5GZFA 5SV8A 3FBMA 1VMFA 3J7NA 4Q27A 5J48A 2CV6A 2VUDA 3KMHA 3VD7A 1BCXA 3RGBA 1J3RA 3SMHA 1R082 2WFF1 5JVVA 1YHFA 2ZA9A 1MS0A 1VBA1 2GC2A 1LU2A 2YB7A 3WVJA 5JI9A 3RWNA 3SC7X 2OPKA 5DDJ1 2DBNA 4CU9A 4WM7B 1AXZA 3QLQA 2ZKLA 1GWMA 4CRQA 5FOJB 5IWFA 4YW1A 3LKJA 4OHWA 1LTEA 3RJRA 3LOBA 4NJ4A 4QKFA 3U4SA 1KS5A 4OMCA 3ZXKA 3R0RA 2GH8A 3ECQA 2X05A 4DXSA 4FPOB 5DMYA 1OLME 1RHI3 1WMDA 4Y4YA 5DG2A 4LE3A 2ZGKA 3CLPA 5C3SA 3OD0A 4WZFA 4IE0A 3SISA 1HXS1 3RI8A 4XUPA 4ORFA 2WUHA 3K51A 4RR3B 1W2OA 1LOAA 1VIWB 4FP3A 1PK6C 5CFDA 3AZWA 4EZ4A 1ND2A 5DUVA 1J58A 2VMDA 1YI9A 2DVDA 1GV9A 2WNUC 3AP7A 3AYAA 5FAXA 5AFEA 4L8QA 1LB2A 3WNPA 4CUAA 4GWNA 1EUTA 2R30A 4GH4A 1SPPA 1UPIA 1S0EA 4RN5A 4WM8B 3LB9A 4COZA 3UKTA 4M0HA 3ZSJA 3ZPOA 3AMNA 3KGLA 4AVBA 4HVQA 2VU9A 4I01A 2GU9A 3UK9A 3W58A 1AR63 5FUNA 2XPJA 3ZR6A 5JDBA 4B4RA 3PMSA 4QB2A 3BTZA 4RQPB 1K3IA 5T5OA 4A6OA 2BOIA 4PDWB 4PF1A 3LWCA 2YMZA 1R1A3 1WBLA 3VKOA 1V6JA 1YFWA 1HLCA 1PO13 2GMMA 2VAUA 4KH9A 4CEWA 2QQMA 4DUWA 4OULA 2QQWA 2ERFA 3BOPA 1SMVA 2VMEA 3HT2A 3WNOA 1HB3A 5JPNB 1BBT2 4QX5A 4HN0A 4MHUA 4UF0B 3WLUA 3U11A 2ZX2A 2ZGNA 3J9SA 1ZA7A 1O3SA 1WW7A 3V0AB 4AVVA 3CJIB 1G9AA 4P00B 1GOHA 2HKXA 1LEMA 1H6XA 4MOAA 1OH3A 5GJ6A 4NIHA 3H8RA 1W6MB 3LA7A 2W95A 4PQ9A 1A78A 3PVBB 5A7WB 4NIDA 1JN2P 4XZPA 3SH5A 3FMGA 5IK8A 1LOEA 2WWSA 4GALA 3KGZA 3DL3A 5I8TA 4NMIA 1V6NA 1DIWA 1AYN3 1PGW1 5EXOA 4RS5A 1OD5A 3TNQA 2I74A 5CYYA 4X6QB 2FDGA 2ZX3A 3LOIA 5KXCA 4LITA 4AAPA 2OZ6A 3P5BA 1AR91 1QOSA 2W1WA 2VNGA 3EB7A 2Q8OA 3ROUA 2VW0A 3KF3A 3KM5A 1BHGA 2VZSA 5A6XA 1RITA 4O9EA 3V0BB 2WN3A 2NM1A 4QX3A 4OQ9A 2YU1A 3KV9A 5C7GA 1W6QB 2R6QA 5A7OA 2I07B 1FATA 2FBEA 5L9BA 2OXBA 1CQ9A 1ZX5A 2AENA 3NJZA 3KV5A 3UKNA 4LPLA 4LBOA 1FPN1 1V9U1 4IV1A 2VUCA 3ZYRA 5CIRA 1XNAA 4BHPA 1HRI1 4QXCA 2IXHA 1G9FA 1ZZCA 4MGYE 2WINB 3MF9A 2ZGQA 2R16A 4Q2FA 2J1RA 3AJYA 1T6GC 1X7NA 3FHIB 3T1LA 3WUDA 1RUG2 2GC1A 2MPFA 3OOXA 1UZZA 5GZEA 2PAEA 3VBFB 3ZFEB 3ZYIB 4AVTA 3ZYJB 3OUIA 3CMGA 3AKTA 5IAVA 1PVC2 3T2TA 4A45A 5BY5A 1QIQA 5M0TA 1MS4A 1W2UA 2QQIA 4FFGA 2OZJA 4GMP0 5A3LA 1POV1 1ZZ6A 4YW5A 1U0AA 3LDKA 1FI2A 1A8DA 4E27A 4KNCA 1QDCA 3PUSA 1X8EA 1LESA 4S2FA 3LD8A 1N1YA 4JDOA 2B46X 1W39A 2G9ZA 2RE9A 5LA9A 1Z7S1 2R073 1BVP1 4A41A 4CDXA 4XILA 1PX4A 3RZGA 2IXIA 2XR4A 2HWC2 4Y1YA 1YFYA 2ZGRA 1GMMA 2CHHA 5LA2A 3ASIA 4XUQA 2UU8A 5FZ9A 2PN5A 1YJLA 3OEAA 1ASJ2 4LO4B 3AMPA 3BN6A 3OB8A 4JCKA 2VOKA 4R9CA 4OCTA 1JHNA 1US2A 1YQ2A 3VBOC 5JXHA 1V0AA 4S2GA 4A7YA 2GN7A 3O7OA 4HG6B 4Q8KA 5IYYA 2WSUA 2A73B 4V2VA 3ZFGC 1KRIA 3PURA 4IGQA 2EF6A 1ALYA 1RHI1 3BYWA 4DS0A 4CUCA 2HWD2 3M3OA 4OHVA 3H8XA 1W6NB 4QHOA 4WM7A 5F7UA 4XVHA 1GUIA 2JE8A 3S0MA 2D3RA 2W91A 3EQEA 3RZHA 4MV2A 1JZ2A 2EXKA 3K48A 4EJRA 1CAXB 1R1ZA 2EICA 2KR2A 1GP5A 5IK4A 5IFTA 4D3WA 2D40A 3G6JB 5CNAA 1EV12 1CJDA 2SBAA 3IAPA 2XHNA 1ZRDA 4XFFA 1HN1A 3FLPA 3GBGA 3WP3A 1VRH2 4JDNA 3C2UA 2QQUA 3O1TA 2P1BA 4OZOA 1S0IA 3TEZA 4XJUA 2ZGMA 4B4PA 3IKWA 3QH7A 3WQ1A 5T5LA 4ZKTB 2G9FA 2JG9B 1OC1A 1RVF3 1D2QA 2G4IA 4RR3A 4W6XA 4YSFA 4LORA 5JSPA 2XUEA 4TXWA 4UWDA 4BDVB 3I2JA 4QM9A 4A42A 4YGCA 3HPNA 2XG3A 5ANNA 1XSRA 5FYZA 2V72A 3ZFFC 1UYXA 2D7FA 4D6RA 5EJZB 1L3JA 3N7JA 1YQCA 4NOTA 4N43B 2RV9A 4Q4W3 2YPDA 2E33A 4ZU7A 3BKZA 4EN9B 4LMFA 1PIV1 4WM8A 5C9AC 2MEV2 3AMHA 2C6SA 3BTXA 3RS6A 4LHSA 3HN3A 3HQRA 4D6QA 1L7RA 2F4LA 4CYDA 1N1TA 2Z4FA 3JBG2 1F5JA 2WN2A 1RUG3 4RQPA 2YYOA 2OT7A 2TBVA 2XLAA 4QDRA 1H2KA 5F5CA 1V6MA 4PDWA 1PVC3 4GMP3 3WNKA 5IK7A 2FCTA 4NRQA 1YNAA 4C0HA 3ILNA 1AXKA 1NX9A 5CADA 2R061 3WNNA 2ZABA 2JX9A 3W59A 4M00A 1ULPA 4PIYA 2OKXA 1JYXA 3CL1A 4UF0A 2Z42A 4QX1A 4V2WA 3E97A 4QQ2A 4OI1A 1W2TA 2XWJB 1AYN1 2Q1FA 3CJIA 1W28A 4IGPA 1O5LA 4GD4A 3V0AA 4XYXA 4PT6A 1G7YA 2R042 3PNAA 4XIKA 2HWC3 2DCZA 1W6MA 2GP5A 3JXSA 1BEV2 3POYA 1FV3A 3K3OA 3J8F3 4Q4Y3 1XYOA 4RL7A 5A7WA 4O9GA 3CNAA 4XPVA 5A70A 1ASJ3 1ZA4A 3AP4A 3BODA 3NAPC 1BMV2 1APNA 2JE9A 4K40A 1XB9A 1I9RA 2NLRA 4IEPA 1OKQA 2NQYA 2WT0A 4KL1A 1H30A 3GGLA 1H9WA 1I5ZA 2GNMA 4FFHA 1UD1A 4Q0QA 1W2NA 2C4XA 5DAWA 3N7LA 4HMZA 1W9YA 1H1IA 5F39A 2HWD3 4BPZA 4P9WA 5BUVA 4MGKE 2BERA 4RGKA 1NZCA 2HWE2 2VOVA 3LSEA 4XJ8A 3RZLA 4AGVA 2BRTA 3APBA 1SCRA 1XNDA 2KD7A 2W1QA 3N7MA 4FQZA 2Q8DA 3V0BA 1W6QA 4YGDA 3U07A 4EQVA 3OG2A 4J1XA 2VCMA 2CNAA 2PHTA 2XH6A 1MS5A 1N3PA 2YC2A 3H1WA 5FP7A 5I0DA 5FMDA 4AQ2A 4D7TA 1VRH3 2YDEA 1M4WA 2VE1A 1CAVB 1WCSA 2VUAA 5FP9A 4HETA 1YRZA 3EHKA 4CCCA 3CJXA 4XE9A 4E2SA 1ENXA 4OFGA 1ZM1A 2WA4A 1ZBE2 3HEIA 4HKOA 4TZDA 4FFIA 4NPRA 5A7QA 3A7QA 1PGL2 3EYPA 4QXBA 1VBE2 4A7ZA 3ZFEA 3VBFA 2BNMA 4JGYB 1WLWA 2W94A 1NCQC 3OUHA 4Q4X2 5EV7A 4FTBA 1QJY1 1CAWB 1R091 2J42A 4LULA 4M4RA 2QDNA 2JKXA 3TAYA 4AHWA 5LEKA 5DABA 5FZGA 4CDUB 2E31A 2DVBA 3POIA 3ZXAC 1AR71 2B45X 2MEV3 3ETQA 3J4UH 4PQQA 5A7SA 4LT5A 4E4HA 5FPBA 4MO3M 1UZWA 2J22A 5GALA 4BK4A 2HEWF 2XVKA 3I8TA 1ZRCA 5FYVA 1OI6A 1AL23 4QM8A 2DFBA 2C5DA 2FMYA 4F7ZA 4YLZA 3MW3A 2YBPA 1PMIA 1S0GA 4AE2A 4AI3A 3M3IA 5EJ3A 3WF3A 1LENA 4Q4V2 3C8XA 3TB0A 3VDBA 3N9QA 1NA1C 2QQVA 2ZPXA 3POSA 4Y20B 2D44A 3WW1A 4XJZA 3NRUA 5JWPA 3Q8AA 5IFPA 1GQHA 1NCRC 1V00A 4QPWA 5FPAA 4PIXA 4KI5M 1GNYA 3D6EA 3LF7A 3WW3A 2RM22 4BH9A 4BQ1A 3JQWA 2A75A 3B00A 4G4FA 1OOPC 1W6NA 2R043 3MLLA 1ZZ9A 4EV0A 1LNSA 1TE1B 4X8PA 1FMD2 2XMLA 1HDKA 1RVF1 1CAXA 2PMWB 2VTXJ 2YY1A 3I54A 4N9IA 2XJPA 4AFDA 4A7KA 2JE7A 4E9KA 5C3QA 3HOBA 2XJVA 4GKXA 4QX2A 3VZLA 1GP4A 5I0RA 5K0UB 2R1DA 1X9TA 5A80A 1QH7A 1CIYA 3H7YA 3D8CA 4Q4W1 3WP6A 3SKJE 2FDHA 2VOXA 3K46A 1JHJA 3FLRA 1SDWA 2JG9A 3SEEA 4DZGA 4AVSA 3WEZA 1SLAA 3UYJA 4QT6A 4LK6A 1FXZA 3QCWA 4XF3A 2E6VA 4XAEA 4QXHA 1XNKA 3AZVA 2VTXA 3M2MA 4BQXA 3BIWE 2VXRA 3OGSA 4YW6A 2ZZJA 3VKMA 1IZ3A 5L7OB 3F95A 1NLRA 4N43A 5SV5A 3ZM8A 1X8MA 4OYUA 3LCPA 3VL8A 2ZXQA 3T2QA 4Z1VA 4A3ZA 2B7YA 1UYPA 1ZBE3 3KS7A 1UL9A 4M4PA 3ZYHA 1NUKA 2LROA 2SLIA 2BGOA 5LB6A 1X36A 4GWJA 3RVHA 1LGNA 4Q1RA 5JXGA 2XL7A 3NW4A 2ZHKA 2DUOA 4OZXA 4LK7A 4CXXA 1MZ6A 4COUA 3B02A 1L7QA 1HQLA 1ZBA2 5I8SA 3DGTA 2XB6C 5FY5A 2CWSA 3JQXA 3VDDC 4Q4Y1 3CZUA 3O1VA 3J8F1 3B9IA 3ZYBA 4E2QA 3E1F1 3VHOA 2VMGA 1KS4A 2WA3A 4FI9A 5F5QA 2WT1A 1RJ8A 1VP6A 3AMMA 2JB8A 2IVIB 4A6SA 2B39A 3ZKYA 3ZPYA 4CUBA 1GWLA 4K8FA 3SLIA 4WVMB 1NY72 1O8PA 4K3UA 3K77A 3BIEA 2VVDA 3WW4A 3ALQA 3AKRA 5FZEA 1S0BA 3LEIA 1Y7BA 4ZPIA 1QQP3 2JICA 4UFLA 2RS33 2W5FA 4QB1A 3LZZA 2FCVA 2YGLA 2YC0A 3GZUC 5L19A 4EROA 1FAYA 3KZ4C 3E6BA 1RMU1 4AGGA 2VVEA 4L97A 4XFCA 4UBGA 4YGEA 3ZSMA 5A3MA 1QDOA 1O3QA 4BQ5A 3MIBA 4BU2A 1W03A 4JKMA 4MLOA 2E32A 4OVEA 5CB7A 3HD8B 5H9SA 3QOPA 5BNQA 2LW8A 2AYHA 3OBAA 2ARCA 1WLTA 2GZWA 3WZ1A 2WQZC 4YVWC 3B3QE 5E8AA 4UW4A 2BBVA 2JDPA 3NV1A 1GP6A 1MEC1 3GJBA 3TOJA 4XBLA 3FE5A 3PTYA 2R1BA 4C90A 2HWF2 5FJHA 4B29A 1DGLA 1I6XA 2RS11 1EAH2 1CAVA 1RC6A 4AGRA 2P3YA 1NZIA 1HJFA 4ISRA 1KDKA 1QU0A 2GAUA 4GWMA 2X29A 5FY8A 2VZ1A 1OMIA 3OUJA 2E51A 1NE6A 2PYTA 4GB33 4YZ2A 3POFA 1O4TA 1TNRA 4JGYA 4H7MA 3VD5A 3T0DA 3NJXA 5C5UA 2Q1MA 3JD71 1CAWA 3CBNA 2BWCA 2W92A 1KJRA 3WDUA 1Q43A 1O3TA 4HLTA 4CPBD 1C3HA 3ZFFB 4CDUA 1CPNA 5F3GA 5I0TA 1V9U2 2ZMKA 2A6YA 4FOYA 4LJHA 1DZQA 4R4XA 2VUJA 2XVGA 4QX8A 4E8CA 3GCXA 4AOCA 4QPYA 1YUDA 2F4PA 4GQ7A 2OW4A 4QHBA 5A33B 4QU1A 1ZZ8A 3LIGA 3UETA 1JI6A 3MIHA 3TEWA 1GANA 3MLKA 5CKMA 1DLCA 3G7DA 1DGRA 3IM0A 2RS52 1AR83 1PO22 3IBMA 3I2GA 1UX6A 5CVRA 1GZTA 4XOGA 1LHOA 1QJU3 1C5HA 2PLV2 3KT7A 4CA9A 2DVFA 2IXKA 4Y20A 5F2WA 2AEZA 5FZDA 5K8SA 3RZJA 2IXCA 1WLDA 1B35C 3U4XA 3MHZA 2ZGTA 4XTPA 2AGSA 1CJPA 2H6BA 3NV4A 4YPJA 1IOAA 2Y6GA 2VJXA 2JDHA 2B5HA 4IDZA 1NE4A 4LKFA 2VBPA 1A6CA 3T09A 3IDEA 4M3CB 5BNNC 1RUE1 3O0VA 5C33A 4FQ4A 5T3NA 2E9QA 2R0HA 5C4WC 1OPOA 4ES8A 2QZ3A 1RUI2 5H9PA 2WS93 1WUVA 1TME2 1POQA 2PFWA 3O12A 5KXBA 4UFJA 3I97A 2KA3A 5K0UA 3TEYA 4H7LA 4IEUA 2J1AA 2EIDA 3VBHC 3BUCA 1FYUA 3R4UA 1XSQA 4XFGA 2ZHLA 4YM1A 2EIGA 3H8OA 1CX1A 4QGLA 4QPIC 4XUTA 3KVBA 5FK7A 4ISQA 3ZMNA 1ULEA 2Y6KA 2JDZA 3PIJA 4HSJA 1LECA 5A32B 3NQHA 5LBEA 1I1EA 3AM2A 4GWIA 3L2HA 5JXIA 5D1IA 4NHYA 1OA2A 3AP5A 5L7OA 4CU7A 2JG8B 3RYPA 5HXVA 3TWIA 4YARA 2XQRA 1YI7A 5J98B 2YBKA 2BZDA 3K4ZA 4KGQA 1VBC2 1EAH3 1W05A 1DGWX 5DZFA 4N7IA 4INDA 5D2AA 2RMU2 4D7YA 5A6QA 2WDBA 4BQWA 5FWJA 3LPGA 4ARXA 1JZ3A 1JZ8A 4Z92B 3USUB 1UKRA 5KBFA 2ET7A 4RFRB 1RUNA 2XUMA 3EMRA 1XPWA 4PCRA 1Y9QA 4CCKA 1VR3A 4J6GA 1LULA 4AHZA 2OX0A 4NAOA 5DUXA 4ZXKA 2QDRA 3GCWA 1OLMA 4FXKB 1BYHA 1PIV2 2WNVC 2WYSA 4URTA 4WVWA 3F2ZA 4M0NA 4IGOA 4AQSA 2BNNA 4WBBA 3LDBA 3KT4A 3FBYA 3BVCA 4RGGA 3URFA 2D6MA 1QY4A 1QGLA 2P5BA 1E57A 2WR9A 1VBB2 1RUH2 4LHKA 4S2HA 3U75A 5ACA2 3SITA 1D4M1 4AG4A 1Q3EA 2J1TA 3NNLA 3SCGA 2RS53 2G1MA 4WVMA 5KXEA 1PO23 5JR7B 5HPOA 3WQ0A 5BNOC 4DXRA 4MYEA 3VD3A 1GQGA 4XJWA 1K5JA 3M1HA 1AZDA 5FXZA 5A1FA 3BOWA 3VV1A 1K42A 1D2SA 5FKCA 2D6KA 4ZONA 1XC6A 3PUAA 3JCIA 3DYOA 3WNLA 1XE0A 2DTWA 2YZ4A 5LW9A 1VBD2 4N53C 5D21A 2VZTA 1GWKA 2RDNA 3N35A 4CSWA 1JOBA 3N9LA 2D5FA 3ZFGA 4CP2A 4DRVA 4J1WA 4QGMA 5FYSA 1CN1A 5G05L 4KBBA 1RUI3 1SLCA 3VHPA 1G86A 3MW2A 5LEJA 2XBO1 2ARBA 4R8HA 1TME3 3LSDA 1UNBA 4JQRA 4XDQA 1UY4A 3VBRB 3CQOA 4JGZC 1QJX2 4WV8A 4NRPA 3B9CA 4ARYA 4FAHA 4DUVA 4TWTA 3ACHA 2XL9A 5GLZA 3N4MA 3LIHA 1Q8QA 2DUQA 2YBSA 4Q26A 1W8UA 1W9TA 2Y6HA 4Q29A 3I49A 4UI9L 4Q5OA 1MACA 1ACCA 1CIWA 3DXTA 3NJVA 3WDXA 4AFAA 5A7NA 3HQXA 2O8QA 1REEA 2RDSA 2OQ6A 4U36A 2W39A 4BCUA 5B4NA 3MPPG 3AXEA 3T2OA 2XLFA 4QKBA 1E5RA 3BU7A 3ZFFA 4IETA 4XXAA 1OQDA 1K12A 2QZ2A 1VBC3 2E7AA 2WZR3 2PAKA 4PHZA 2WAAA 1NLQA 2A6VA 1JMUB 4D6SA 1QJU1 1RXFA 2DVGA 3S5AA 2RMU3 2RR12 3PU3A 1CD3G 1NKGA 1YJKA 3V65A 5A33A 4ES9A 4TN7A 4E4SA 2HBTA 4NIGA 1RUC2 3RPQA 1REDA 3LGRA 2VW1A 4XJ9A 5K7PA 1WD4A 4AF9A 1C8M2 2EAKA 2PAMA 1PZ7A 3DEMA 5BNPC 4UT5A 2PELA 3J7LA 4YVSC 5F3EA 5HV0A 5C8CC 4OI4A 4QKNA 5H9QA 1UYYA 5FO8B 3CU7A 2HH9A 1OD3A 3ABZA 3T0BA 3WINE 2FCUA 3SKVA 3WDTA 2B9VA 1MZEA 2QQLA 1CZVA 1Z78A 1B09A 2YHJA 4Y26A 4H14A 4DO0A 5J3UA 3C7FA 2UWAA 4FP2A 4CPBA 1R083 5FYTA 4DEVA 1VBB3 5ACA3 5KR7A 3IMNA 5IK5A 4AXOA 2ZS6B 1D4VB 4LKEA 3VKLA 4EWDA 1QKQA 4LXLA 1AUYA 4M3CA 1IG0A 4Z07A 2B8MA 3ZOIA 5HBAA 2P4EA 3H1YA 5FZOB 4D94A 5LK7B 1W8FA 3A4UA 2BDRA 2VW2A 3MGUA 4W65A 3U14A 4F83A 1WA4A 1VE0A 5FUIA 1FOD2 2WT2A 3FUOA 4L11A 1VBD3 1ND3C 3R6SA 4Y22B 3T08A 5L36A 4AEKA 4AK3A 2FZ2A 1GNZA 5L9RA 2X5IC 1U5IA 3NVCA 1D7PM 2XJSA 2BVBA 5E16A 2VL4A 4NN0A 4YRDA 1O91A 5EJ1B 1H2LA 2BBAA 4LBLA 4ATEA 2Z2SB 4D7SA 2IZWA 2VZPA 3VDAA 5A32A 4XURA 2D97A 3HBKA 2J1EA 5FPVA 2IXLA 3O1PA 4MGTA 5JUVA 4KQ7A 1W6OB 4MH0E 5LK5A 1LEDA 4XUOA 2JG8A 4M3CE 4FPJA 1AX0A 1QJX3 3ES1A 4CDWB 4FPHA 4MADA 1V6OA 3ETPA 4WVVA 1MS8A 3WNXA 3WF0A 3PDQA 2VZQA 2VMCA 3VN4A 2VMHA 1GFF2 5KC5A 1UCXA 4HKLA 5F3IA 2XHKA 3USUA 2WO7A 3K4DA 3SXWA 4NVPA 1MS3A 2XONA 2P3IA 3SQOA 3D82A 2W0XA 1FX5A 2VNOA 1QOOA 4O61A 2CL2A 3THDA 1OVPA 2Q1ZB 1UY3A 4P14A 4E4ZA 3WP4A 2F17A 1MQTC
chains in the Genus database with same CATH topology
3USSA 4Y1ZA 5D8AC 3ZVXA 5AC92 1LHWA 2HWB2 2LTNA 1DQ5A 2RR13 4RHV2 4IEOA 2ZJCA 3SH3A 1BBT3 3MFCA 3P3NA 1RUC3 4I3PA 2HEYF 1G6NA 1GSLA 3D5OA 1C8M3 3O0XA 3WCRA 3OJBA 3FFQA 4B7KA 5GZCA 3E5UA 4NO4A 4PLOA 1SBEA 1U5ZA 1U5YA 2GMEA 1KD7A 2XJUA 1GZWB 1XU2A 3BCWA 1SEFA 1K5MB 1AYM2 3OGGA 4JC1A 3GHNA 3SH4A 1H8VA 1VAMA 1IPKA 1RUF2 3EXUA 1DQ0A 5EYXA 2H0BA 1F2NA 3LA3A 2VGDA 4AYUA 2GC3A 2OA2A 4IV3B 4LA2A 5DZGA 3MW4A 2OUHA 1F31A 2XJQA 3TBDA 2PHDA 1IGOA 2BGCA 1N3OA 2QQPA 4OUMA 3DPRB 5F6KA 3KCYA 3SNMA 4QMAA 1EPWA 4ASLA 5CFDC 1ND2C 3M3QA 4AHYA 4N90A 1ZREA 1AR61 4MGIE 5C4WB 4FPGA 3O5SA 1FOD3 3VBRA 1YIFA 4LUMA 4GH4C 1WW4A 1R1A1 4COVA 1NQJA 5FTTC 1RUOA 2WZR1 1PO11 3GNEA 4LUKA 3VKFC 2D98A 1CPMA 3KQRA 1AHSA 3ZYGA 1RUJ2 2E7TA 3H9AA 1H4HA 1DBNA 5FRAA 1VB2A 1MS1A 2R49A 3WOGA 4CEWC 4XEZA 1ENRA 5CFCC 1J3PA 4YG6A 4YM2A 2BTVC 2PHRA 1VAKA 3VZOA 2YV8A 5ABJB 1SLIA 2ZX0A 1S2KA 2HYKA 2QUOA 4AQ6A 4Q0PA 2A71A 1RUD2 4MXWA 1TMF2 5HCAA 2ZAAA 1Q56A 1ENQA 3AMQA 1UU4A 4C1XA 3AZZA 3N3HA 5AC93 4XMAA 3NL1A 2WNVB 4RHV3 3GHMA 5KHHA 1SBFA 1Q8OA 5JOZA 3AFGA 4K6BA 3TN92 3S30A 3ZMOA 5FREA 1CONA 4IQPA 3B5LB 2X53S 3WX5A 4MSVA 5FO7B 2V73A 3TYJA 3MF6A 1KFUL 4JDMA 3WDVA 2D5HA 2ES3A 1AYM3 4HVOA 3EBRA 4AEJA 2WZPP 5E88A 1AJKA 1EV13 5JPMB 1YO8A 2DCYA 4I0BA 4Y22A 5J37A 3BB6A 4IV1C 4JTNA 4F8AA 4LEJA 1RGSA 1IKQA 3E6DA 3UL2A 4AVAA 1QH6A 4LLFA 2ZKNA 4JRLA 3ZXJA 4L2NA 2WSVA 4JTOA 2WQ4A 4XFAA 1NXMA 1O5UA 1OA4A 3MPBA 1XE8A 4RSUA 1W6OA 2Y0OA 1HRV2 1PK6B 1KQRA 1LU1A 3GBWA 5JSOA 1XRUA 2R071 4OI2A 1KDMA 3S6PA 4CDWA 1IKPA 2GNTA 2WNUB 1COV2 4HN1A 4XF4A 3WG4A 2C0ZA 4F3JA 1Q8SA 3ZYPA 3JBG3 3AKPA 2JD4A 5JCTA 1RUJ3 4U2AA 3X29B 1BBT1 2DYCA 3O14A 2JEMA 4CDXC 1ZYBA 2JJ6A 3MIEA 5T50A 3INAA 2PQQA 2ZHMA 3W9AA 3R4SA 3NV2A 4ITCA 5HCBA 2CGNA 3PJYA 3O0WA 2D3SA 2P3KA 4ZU4A 1IPJA 2JENA 5FOBB 2D6PA 3E5QA 1QNWA 3HIFA 3POWA 1BJQA 1JBCA 1F5FA 3M70A 4XQWA 1RL3A 1TMF3 5JLVA 3JU9A 4Z82A 4B8EA 2FZ1A 3HN1A 1ULGA 1BEV3 3A0NA 1GZWA 1K5MA 1UZYA 5C8CB 5EZWA 4LR4A 2WC2A 3MI8A 4S2DA 1H0BA 4LBNA 4Y1XA 4BM8A 4FBFA 1HV1A 2NMNA 2WFF2 2XWBB 4IV3A 1VBA2 1DGRN 4PBPA 5JIUA 3ATGA 3TN93 3P3PA 2IFRA 4LBMA 4TLFA 3OBTA 5DDJ2 3WXPA 4RR3C 2NP0A 4BZ4A 3DPRA 4MUVA 3B94A 2HWE3 3AZXA 4ZU5A 2TEPA 1QXJA 4FPEA 3AP6A 1TQ5A 3OGJA 2CGOA 5C4WA 1RUG1 4R9DA 1ZNPA 1V6LA 2DURA 5IUQA 3HT1A 2A6XA 1PVC1 3OYWB 1H2NA 4GMP1 1ND3B 3SCFA 3VBHA 1HXS2 2C9AA 4PLNA 4B7EA 5FLJA 4RQPC 1VBE3 3QD6A 1ZZ7A 5FDBA 4PDWC 1YFXA 1MVEA 2R0FA 1HRV3 4Q4X3 5DZEA 2ZTNA 5B2GB 4MXVA 4YFWA 4EWAA 2CAVA 4KWLA 2FMDA 3H7JA 4NHMA 4NHLA 3WG2A 1COV3 2HWC1 2XGXA 3ELNA 4AFCA 3WW2A 1QOTA 1QWRA 3EJKA 1ASJ1 4LNVA 3ZXGA 4OHZA 4HT1T 4Y24A 5ABJA 1KITA 3CJIC 4QQLA 4WZCA 1YCIA 3M4FA 1Q5OA 3U0ZA 1TNFA 2HWD1 2ZGPA 4LO7A 1BZWA 4Q4V3 4WVZA 4BMBA 5FMOS 1DQ4A 4LA3A 1WCDJ 2WNVA 3IDCB 1MQTB 3M7AA 5D8AB 4FOWA 2VVFA 1VB4A 3QH6A 3SCHA 1LOFC 3FLTA 4COWA 1WMEA 1DG6A 1CAUA 2RM23 3VBOB 3AP9A 2W68A 1GBGA 1VRH1 2PHUA 4G3YC 3KCCA 2LUWA 3ZFGB 3H1MA 1RB8G 1W0PA 2OIIA 4XF0A 2QCSB 3MICA 3ST7A 1FMD3 1F8VA 2GC0A 2EXJA 4Q1PA 1QXRA 5T55A 4Q0UA 1SLBA 2WFF3 1LOBA 1PGW2 1MS9A 1GNHA 1VBA3 4QXKA 5AVPA 2BYVE 1WMFA 2CYFA 1XYPA 4KG8A 1EYBA 1AR92 3WT3A 2PHLA 2KM2A 1W0OA 2MEV1 1HW5A 3PVNA 2QNKA 3KCXA 4DB5A 3ZFEC 3VBFC 2MHFA 1XNBA 2BUKA 3PMEA 5KXDA 4DFSA 2ZOEB 2A7AA 3B7MA 5CG9A 2H6CA 4Z8BA 1PK6A 3VGIA 2VQAA 1AL21 4CP0A 3A0KA 1FPN2 1UN1A 2WNUA 1XYNA 2ZHNA 2Z79A 4LHNA 1HXS3 1HRI2 2D3PA 5FCCA 4CEYC 3MZHA 4D69A 4GKYA 5C9AB 2NZ9A 4CTEA 5FFOC 5KHGA 4LBQD 3DKWA 2WJSA 2FQPA 1ZBA3 3VBUC 1POV0 4BLJA 2R041 4RD7A 4K7JA 2XLGA 5J96B 2XJTA 1NQDA 4IEXA 5CFCB 3IN9A 3MYXA 2K9ZA 1AL0G 5J09A 4YGBA 5I93A 4LBKA 1Z7S2 4LE4A 2NMOA 1O7FA 3BALA 5DUWA 5EWSA 5FPXA 1C4RA 1DQ6A 3PVOA 5C8CA 2HWE1 4LBQB 5BNPB 2EAAA 2E63A 1D0GA 3AX4A 1G9CA 2A6ZA 4PF5A 3NAPB 4PLMA 1HV0A 3FFZA 1YXWA 4OHYA 3ZSLA 2OYZA 3E5XA 3VBSC 1RHI2 3NV3A 5FQ0B 5L73A 2JG9C 4FPLA 2DCJA 2DUPA 3GZAA 1HQNA 1N3QA 2DFCA 4FPKA 1AJOA 1AX2A 1ZBE1 2CAUA 1IHMA 4QPGC 1HIXA 1N1SA 5CA6A 4N43C 3FJSA 2ZX1A 4XTMA 3ZO0B 2NYYA 1SFYA 4R4ZA 2HWF3 4Q4X1 1MVQA 4HK8A 3OYWA 4X8NA 2AR6A 4UW3A 1ND3A 2Y0IA 1ZRRA 1BXHA 3WY6A 1AR93 3GZTB 4EN7B 2O1QA 1M06G 3KD4A 1WLCA 5GLWA 4FT8A 1FNYA 3DV8A 3RYRA 1NLSA 1AR62 1OLQA 2Q0AA 4E4DX 1DDLA 3VHRA 1DQ1A 5I0SA 1V6KA 4M3CF 1ULDA 1FPN3 5JZGC 1NCQB 1V9U3 4DXZA 1VLNA 1KXGA 1HRI3 1X33A 1QQP1 5T52A 2BQPA 2WLQA 2RS31 5GM0A 1O4YA 4P9IA 1O4ZA 4NWVA 4E2GA 4BA6A 2GN3A 4A2UA 4W6YA 5T54A 1H1AA 1GZCA 1POV3 3FWEA 3PJQA 4PJYA 5GLVA 2A5ZA 2PLV3 4NR1A 3T1MA 4TSVA 4FPCA 2EALA 2R062 3ZN6B 1SLLA 1MQTA 2TUNA 1FMD1 5D8AA 1G9DA 5CG8A 3ENRA 1NA1B 1C1FA 1Q8VA 5CBLA 5J36A 3VBOA 2AH2A 1YFUA 1AYN2 1Z7S3 2VECA 1NCRB 1JOJA 2WIIB 4UW5A 1DU3D 4B4QA 1C28A 4HPKB 1NYWA 3VL9A 1J1LA 1N47A 1OOPB 1ZVFA 5FBZA 1SBDA 2HJIA 1ENSA 2UWCA 4GB31 2D6LX 2ZGOA 3DUIA 3I59A 4YZ5A 2I2SA 2GSYA 4GA9A 3ILFA 4QQHA 1OQ1A 5JOXA 4BWOA 3RI9A 2VQ0A 4XHBA 1UPSA 3B01A 3ACLA 1H8TC 3KB5A 1EPZA 1VAVA 2YGMA 2ZGLA 4YM0A 5T5PA 2CGPA 1V6IA 2P17A 3HWJA 4JGYC 4TYSA 3ZN4A 5JOYA 3R4DB 3RJ2X 5FLHA 3N36A 3QACA 3R05A 4CDUC 4Y1UA 4AEDC 4NHKA 1Q8PA 1AR81 2QKDA 4P9LA 4DINB 4G9SB 1JYCA 3JZVA 4HANA 3WUCA 1PNFA 1X82A 1ZBA1 1CX4A 3U10A 4LBJA 1S0DA 2RJLA 4DQAA 5GZGA 5C9AA 1WD3A 3KT1A 4DOUA 2QJVA 2B42B 2JECA 4IEYA 4QQPA 4YZ4A 2IXJA 4QGNA 1QJY2 2PHWA 1QMJA 1R092 4MXWB 1UIKA 4FOVA 2R072 1PIV3 1NY71 3ZSKA 3FZ3A 1AR72 1GR3A 2WNEA 1S1AA 5CFCA 4DPNA 3VDDB 2WL1A 2WS91 2H0VA 1RUH3 1V70A 2AUYA 3QBQA 5DUUA 3RRDA 1YIPA 4Z2WA 4GIQA 4DY5A 1GZ9A 4L92A 2Q5TA 4HBNA 1RTVA 2R063 2PHXA 1UMZA 4LBQA 5BNPA 1ZRFA 3RG0A 3NAPA 5K0UC 4FOQA 2R32A 2GH2A 4KWJA 5KHIA 2RHPA 1Y3TA 3MEPA 2HWF1 5FMOL 1OFSA 5FQ0A 2ATFA 1GYKA 2NPIA 1J59A 2FHRA 1EAH1 4I02A 1AVBA 2C1FA 3AKSA 5FPZA 3NSTA 3ZXDA 1RVF2 1IS5A 2ILMA 3OBRA 2UY9A 1VALA 5H9RA 4RGAA 5L7OC 1WCKA 4YVWB 3H50A 4XBNA 4AQTA 1FV2A 4KG0A 3AK0A 4NWWA 2YUEA 1WBFA 4YM3A 2D6NA 4META 2MNGA 4Q4W2 4XETA 5F1RA 1EP0A 4XFBA 1PZ9A 1S55A 1QNYA 4AEMA 3AYEA 3EO6A 3WQ7A 3IT8A 4CZSA 5FO9B 2DV9A 1OFNA 5GLUA 3S7IA 4N9HA 4IERA 4BMEA 4BIFA 4CDQC 2RS51 2V09A 1NCQA 1PO21 3H0OA 1G8WA 4HL0A 2BWAA 3OTFA 2YPJA 4FPFA 1S0CA 2PHFA 2PLV1 1IS6A 3ZX7A 4AI1A 2NN8A 1UU5A 3TRSB 3WR0A 3VZJA 4AFBA 2YROA 4CEYB 1RIRA 1IS4A 2UY8A 1OHFA 1SFNA 3WDYA 1QJY3 1R093 1I3HA 2VNRA 1W6PB 5C6CA 2WKKA 2ZX4A 1AR73 1DFQA 4Q4Y2 3OCPA 5I91A 3J8F2 2ENRA 4I0WB 3ZN6A 4IEWA 3VBUB 2AZ5A 2A3YA 1RUI1 1NA1A 1NXD1 1JXNA 3GBFA 1QXPA 3H3ZA 5AFBA 1TME1 2Q30A 1HKDA 4LO8A 3RMYA 4DMIA 5JAXA 1NCRA 1B35B 3WHUA 4GXLA 2JXAA 1LGBA 5HI0A 4OHXA 2IC1A 4HPKA 4EN0A 2I45A 2N7GA 3BTAA 4JVAA 4KGGA 1OOPA 4XW3A 3FUQA 5BNNB 3AYDA 1HX6A 2RJKA 3MDPA 4W6WA 1RMU2 3I7DA 3ZDSA 3Q9OA 4YG3A 2VULA 3HMYA 4ASMB 5IT6A 2DTYA 1DZRA 4KWKA 3VUOA 3L9JT 4QD2A 2W08A 1JUIA 1VBC1 3VBHB 2DU1A 1JTZX 3IWZA 3VBSB 3CEWA 3OD4A 1O3RA 1Z0HA 1X50A 2RMU1 4P9XA 4MX3A 2V5YA 1MEC2 4QPIB 4AVCA 2P34A 3D4KA 1A8MA 4FO9A 1CVNA 1SQ4A 1LOCA 4FTEA 4QPGB 4R9BA 4I0AA 1IQAA 2RS12 1CR7A 3DN7A 1SACA 2XJRA 3CO2A 4BYYA 3OPZA 2ZMLA 1IS3A 2EXHA 4SBVA 4JRAA 1VJ2A 4AFMA 5AVAA 1PM7A 2ZMNA 4EN8B 1R081 3KSCA 1VBB1 1RUH1 4K1YA 3JD72 4L9BA 4UXAA 3THPA 5ACA1 1AL22 3AB0A 2DU0A 5I8YA 2A3WA 4AI2A 2BVVA 2DCTA 4FAGA 4AW7A 5JOWA 2XKPA 2HWB3 2JKBA 5JZGB 2GALA 3LAGA 4HSLA 2G9GA 1S2BA 4RA0A 3VDDA 3CF6E 4RS5C 2UURA 1C1LA 1CAUB 3M3EA 1VBD1 1LCLA 1DQ2A 1G9BA 3MIFA 2BFUS 4N7UA 3SHRA 1JYIA 1BVVA 1C8NA 3AKQA 3D0SA 5BNOB 1XNCA 1OQEA 1KFXL 1UF2C 4RFT0 1RUF3 3NKGA 4EWEA 4BIOA 5JMCA 3OY8B 3BPZA 1LOFA 1KJLA 1QJX1 3H3UA 4N53B 1RUE2 4HVRA 1MZFA 3NWKA 2EA7A 2UYBA 5GLTA 5I0UA 3E6CC 3I4IA 1OPMA 3KLSA 3VZKA 1ONAA 2QFEA 4XBQA 2JG8C 3WD5A 4YVWA 2ARXA 1JW6A 1RMU3 2OVUA 1ZZBA 4Y1VA 1N1VA 4R52A 2UWBA 4CP1A 2HEVF 5E89A 3RQ0A 1DLLA 1H1MA 4JGZB 4OI0A 1DF0A 3FX3A 4P9GA 3WCSA 1S0JA 5KC6A 2RR11 1DYPA 3M8LA 1H8TB 2VH9A 4BOWA 1S0FA 1EY2A 1MEC3 4IEZA 1RUC1 4XFIA 1XQNA 1J3QA 2EVXA 3M3CA 2VPVA 4ONUA 1C8M1 1RJ7A 4BE3A 2RS13 3OF1A 3MFAA 1NOVA 1J1TA 1RINA 3GF6A 4MGZE 4AEDB 4DRRA 1SLTA 1UKGA 4LHLA 1DHKB 1TEIA 5T5JA 4B3NA 4CEYA 3NO8A 4JV4A 3V56A 2O0OA 4EN6B 1RUD3 3JD73 2BEOA 4WM7C 4Q8LA 3FC0A 1W6PA 4P9JA 3JB8A 3B93A 2GDFA 4HFSA 2BW8A 3WG3A 1UIJA 4YVSB 1QQP2 5EFUA 3VBUA 1OA3A 3MIDA 2RS32 4QQOA 4C0BA 2ZCWA 3C3VA 3HAGA 3IDBB 4MZUA 1D4M2 1FOD1 1LHVA 1ULFA 4PIZA 1B35A 3WV6A 2ZAHA 5LRRA 1WW5A 3NKTA 3PLQA 5BV6A 1PGSA 1LKNA 3I2DA 4AI8A 1AX1A 5BNNA 4FSJA 3S7EA 1HQWA 2BPA2 4P5HA 4I09A 2GNBA 3VBRC 2P3JA 4MVTA 3AXDA 1MR5A 4YG0A 1PNGA 5FLIA 3THTA 3WDWA 4WM8C 3H8UA 4OUSA 4YW3A 4XQDA 4XQ4A 2LM3A 3J26N 4KU8A 3PHMA 1RUE3 3AYCA 2W52A 3ZIWA 1UU6A 4JAAA 3VBSA 2X5IB 4DY3A 4L99A 4XF1A 2DVAA 1LOGA 2WLPA 4QPIA 2XBO2 4GB32 3N7KA 5GZDA 5KHJA 1MZ5A 3ZXEA 4YZ1A 3ME2A 3IPVB 4K9SA 4QPGA 4V1PA 1PZ8A 3LA2A 3D0JA 2LALA 3VKNA 4FTSA 4FCAA 4UBHA 5AC91 2HWB1 4IEVA 5K9YA 1H2MA 1U5XA 4RHV1 4XHXA 2VY0A 4AI0A 4FXGB 3UJOA 4OLLA 4YYOA 1AR82 5CAZA 4M01A 3RSJA 2DWRA 1QJU2 4CDQB 3VZNA 5JZGA 4I3GA 5HCFA 3JUUA 4XF9A 5TSWA 3ZN5A 1AYM1 2TNFA 2ZZQA 3HR9A 5E1RA 1FNZA 1U12A 1RUF1 1EV11 1URXA 2VOWA 1NG0A 1OLRA 4XJAA 5C8WA 2ET1A 2P2KA 5KHKA 4IESA 3IIAA 4XMIA 1YYNA 4LTAA 2A3XA 1DGWA 2ZGSA 5BNOA 2IFWA 5BYNA 1C57A 1OSGA 1PHMA 4XXPA 5CU1A 5JSRA 2WS92 1H9PA 3I59B 4K21A 4I30A 4YNIA 4SLIA 1GICA 4COYA 2DF7A 2F6BA 3OY8A 1D4M3 1BQPA 1DYKA 1LJ7A 2P37A 3AJZA 2B9UA 4N53A 3JB4C 4X6RB 5DDJ3 1AXYA 1CGPA 2Q4SA 4YZ3A 1LGCA 5F6LB 2ZBJA 3JBG1 4UW6A 3UV9A 4IL7A 4LO5B 5CFDB 1RUJ1 3AZYA 1ND2B 1BKZA 2A70A 4H3WA 4CDWC 4XFHA 3VHNA 4R9AA 4K1ZA 2GNDA 1BK1A 1GLHA 2D93A 4GH4B 4JGZA 5BPXA 1JUHA 2E53A 4KU7A 2IWGB 1FT9A 3MIGA 1H8TA 4HZFA 4AWDA 1JH5A 2X8KA 2XBO3 4FPYA 2YXSA 1PVXA 3ZIXA 5GKAC 3UKVA 1RUD1 2XVLA 3ZXLA 4IXLA 4A3XA 1TMF1 4IEQA 2PA7A 2Y38A 1WGPA 4YW2A 4LO6B 1AF9A 5J7MA 4C1WA 1BEV1 4AEDA 4CEWB 2WFPA 4Y5Z0 5DXDA 5KWRA 1BMV1 2CY6A 1DZTA 1UAIA 5JI7A 2O8OA 1CESA 3TN91 1SCSA 4Q0SA 1K5MC 4BLIA 2GMPA 2CWMA 4YVSA 2Y26A 1XU1A 1REFA 3RNSA 4AHXA 1QHDA 2QVSB 2BNOA 4IV3C 2QE3A 1D0HA 3B69A 4C91A 3VZMA 3L2YA 1H4GA 3AFKA 4K20A 4H55A 2K2SA 2ETEA 2KXLA 2E7QA 3HBZA 1C5IA 2A6WA 4XIOA 2VMIA 4RS5B 3ZXFA 3DPRC 2CTVA 1GKBA 1YLLA 4LLOA 3V64A 1XE7A 3ZSEA 3DF0A 1LHUA 5JIAA 3ES4A 4PBOA 1PGL1 1VBE1 4P9YA 3PVEA 2BFUL 4Q0VA 1HRV1 3WP5A 3RDIA 2D43A 2UYAA 5EYYA 1A3KA 1WW6A 3UJQA 2OUJA 3VLBB 1COV1 4HKWA 2Z69A 2X5IA 2Z5WA 4IV1B 3GYDA 4QU2A 4YW4A 2PTMA 1ULCA 3TNPB 3WHTA 4HK9A 4FVVA 1LRHA 5BXXA 2XKOA 3RMXA 3IPVA 3ILRA 4ATFA 3RYKA 2VG9A 1Y43B 1R1A2 3WG1A 1LODA 2ZACA 2WZR2 1PO12 4Q4V1 1LR5A 2K0GA 1F9KA 1XXNA 2D6OX