1AR81

P1/mahoney poliovirus, mutant p1095s
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
283
structure length
283
Chain Sequence
b'AATSRDALPNTEASGPTHSKEIPALTAVETGATNPLVPSDTVQTRHVVQHRSRSESSIESFFARGACVTIMTVDNSASTTNKDKLFAVWKITYKDTVQLRRKLEFFTYSRFDMELTFVVTANFTETNNGHALNQVYQIMYVPPGAPVPEKWDDYTWQTSSNPSIFYTYGTAPARISVPYVGISNAYSHFYDGFSKVPLKDQSAALGDSLYGAASLNDFGILAVRVVNDHNPTKVTSKIRVYLKPKHIRVWCPRPPRAVAYYGPGVDYKDGTLTPLSTKDLTTY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords P1/MAHONEY POLIOVIRUS
molecule tags Virus
source organism Human poliovirus 1
publication title Structural studies of poliovirus mutants that overcome receptor defects.
pubmed doi rcsb
total genus 46
structure length 283
sequence length 283
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1997-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ar8100
4Q4V1 5AC91 1COV2 1E57A 4Q4Y3 1AR61 4GB31 1RUI3 1NCQC 2RM21 4QPGA 1OOPC 4BCUA 3VBOA 4YVSB 3VBSB 1HXS2 1VBD2 1EV11 1VBA3 2FZ2A 1RUG1 1R091 5ABJB 5J96B 4LLFA 2RS33 1B35B 1QJX2 2WS93 3VBRC 4NWWA 3CJIB 1TME3 3LOBA 1FMD2 4WM7A 1ZBE3 1AR93 1VBC1 2RR13 5J98B 2GSYA 1B35C 5CFDB 1A6CA 1NCQB 5A32B 3CJIC 4CDWB 4FTEA 4JGZA 3ZFEC 4RR3C 1NA1A 1BEV3 2FZ1A 1RMU2 1VBE3 2R072 4EJRA 3VBSC 4RR3A 5FMOL 1PO11 2Y26A 4JGZC 1VBD1 3NAPC 4CDXA 4RHV1 2HWC3 4RS5B 3FBMA 1QJU3 4GMP3 1AR62 1AR63 1HQNA 5C9AA 1PIV2 5DDJ2 1ND3A 2WZR1 1ND2B 4GB32 1R081 1ASJ3 3JB8A 2WLPA 1PVC3 2R073 4JGYB 3VBUB 1RUF2 2BBVA 3TN92 1ND3C 4YVSA 3ZFGA 1POV0 1TMF2 2MEV1 2HWF3 5ACA1 1FMD3 3VBHA 3JBG1 1VBB1 4CDQC 1ZBE1 1X36A 1HRV3 1F2NA 2R041 1R1A2 3JD71 1VBD3 1C8M2 3ZFFC 3IDEA 1RUJ3 4AEDB 1HRI1 3ZFGB 1QJU1 2IZWA 1W39A 4CEWA 4CEYC 1PIV3 2RMU3 2GH8A 1IHMA 2DF7A 4CDQA 2WZR3 2RM23 1RUH3 1VRH3 5BNPC 1AUYA 1QJU2 2HWD2 1VAKA 1OOPB 1D4M3 1RUG2 1RUD1 4N53A 3JD72 1AYM1 1NCRB 4Q4V3 1PO21 1QQP1 2XBO3 1QQP2 1M06G 1CJDA 1FPN2 1RMU3 1VBE2 2BPA2 5ACA3 3J8F1 3DPRB 2BFUS 1RUI1 5L7OB 4IV1C 2TBVA 5AC92 3VBSA 1EV13 4YVWA 2HWB3 1QJX3 1VBB3 1QQP3 5BNOB 1PGW2 3HAGA 3NAPA 2WFF2 1HRI3 4CDXC 1HX6A 2XBO2 2RS53 1MEC2 1R1A1 1Z7S3 3JD73 4RS5C 5D8AA 5BNNA 5JZGC 2PLV3 1ND3B 4GH4A 4PDWC 5ABJA 1AR72 2WS91 2HWD3 4IV1B 1BBT3 2RMU2 4FSJA 1VRH2 2X5IB 2RS13 5FMOS 1F8VA 3JBG2 3CJIA 4YVWB 1VBE1 1COV3 1PO23 4Q4Y2 3ZFEB 3ZFGC 1MQTC 2R071 4CDWA 4RFT0 4CDWC 1R1A3 5A32A 4Y5Z0 4N53C 5C4WA 3VBHB 1C8M3 4PDWB 1AR83 3VBFC 1QJY3 1VB4A 3DPRC 5BNPB 1VBC2 5DDJ1 1NCRA 2HWC1 2BUKA 4RS5A 4Y4YA 2X5IA 5D8AC 4CDUB 1H8TC 3VBOC 1TMF3 2R062 3J8F2 1R092 1AR82 5CFCC 5CFDA 2R042 1HXS1 4JGYA 2HWB1 1PVC2 4GH4C 1H8TA 4PDWA 3VBRB 4CEWB 1PO22 1RUF3 1AYN3 1NOVA 2BFUL 3VBUA 3VBUC 1PGL1 4IV3B 4CEYB 3JBG3 4GB33 5CFCA 2PLV1 1EAH3 4CDUA 1RVF3 1RUH1 1COV1 1EAH2 2HWC2 4QPIC 2RS52 4FTSA 4Q4X3 1AYM3 1SMVA 1VBA1 1RUJ1 3S6PA 5C8CA 4N43B 1R082 1R093 4N43C 4WM8B 4IV3C 4AEDA 1EV12 1BEV2 4RHV3 1RUE2 1AL0G 1TME2 2RR12 4QPGC 1VBC3 2RR11 1FOD1 3NAPB 1VRH1 4N53B 5BNPA 1RUE1 2WS92 5BNNB 2RS32 5JZGA 1BEV1 1K5MA 1K5MC 5C8CB 5ABJC 1PO13 2RS51 5BNNC 2HWE2 1V9U3 1HXS3 1VBA2 1RUH2 3VBHC 2WZR2 4RQPA 1H8TB 3VBRA 2WWSA 5C4WB 1C8NA 1BBT2 2PLV2 5L7OA 4IV3A 1RUI2 5K0UC 1AR73 4Q4W1 1MEC3 1RB8G 1HRV1 1OHFA 1PVC1 1OPOA 5A33B 1V9U2 2XPJA 1V9U1 5K0UA 1VB2A 1PO12 1RUC3 3VBFB 4GH4B 1HRV2 4YVSC 2HWB2 4WM7B 5C9AC 1BBT1 1RUD2 1NCQA 5D8AB 2HWD1 2R061 3VBOB 5FOJB 1RUE3 5BNOC 2ZTNA 1GFF2 4QPGB 4CEYA 1RUD3 4CEWC 2QQPA 4QPIB 1AL23 1QJY1 5CFCB 1X33A 4GMP0 4Q4X2 3ZFEA 1C8M1 5BNOA 4WM8C 3ZFFA 1B35A 1D4M2 1FOD2 1RUG3 3ZXAC 4Q4Y1 1TME1 2X5IC 4YVWC 1RHI3 4N43A 2VQ0A 2RM22 4NWVA 4IV1A 1DDLA 1AL21 1AR91 1CD3G 1RUJ2 1AYN2 1MQTB 1MEC1 2WFF1 2HWE3 1NG0A 2XBO1 4CDXB 1Z7S1 1AYN1 1BMV2 2R063 1PGW1 1EAH1 1RVF1 1RHI1 3J8F3 1AR92 5LK7B 1PIV1 1ZBA3 1ZBA2 3JB4C 2HWF2 5L7OC 4JGYC 4GMP1 1PGL2 4RHV2 1FPN1 3TN93 2ZAHA 1NY72 4CDUC 1D4M1 4RQPC 1POV1 4WM8A 5GKAC 4RQPB 1AR81 1R083 2ZZQA 1NA1B 1RMU1 3VDDB 1AYM2 4WM7C 1ASJ2 1WCDJ 5DDJ3 2HWF1 1NA1C 4SBVA 2RS12 1RHI2 2RS11 3VBFA 1RVF2 1FOD3 1ND2C 5K0UB 4FTBA 1FMD1 1POV3 1K5MB 5C8CC 1Z7S2 2HWE1 1QJX1 4Z92B 5C4WC 1ASJ1 1NCRC 3M8LA 1HRI2 4AEDC 5C9AB 2RS31 3DPRA 5JZGB 1AL22 3VDDC 2R043 3VDDA 2WFF3 1ND2A 4JGZB 1VBB2 1NY71 1ZBE2 4Q4W2 2RMU1 1MQTA 2MEV2 2MEV3 4CDQB 5AC93 1AR71 4Q4W3 4RR3B 4QPIA 5A33A 1ZBA1 5ACA2 1TMF1 1OOPA 3ZFFB 5CFDC 4Q4X1 4Q4V2 1QJY2 1BMV1 1FPN3 1QJZA 3TN91 1RUC2 1RUC1 1RUF1
chains in the Genus database with same CATH superfamily
2PHTA 5F39A 3WNLA 1GMMA 2ET7A 3POWA 1WMXA 1JHJA 3MDPA 4QDQA 4XZUG 2EXKA 4IE5A 4LO8A 1GR3A 3THPA 4AGGA 1SQ4A 4Q0VA 4DQAA 3RZJA 3GF6A 5A3OA 1SDDB 1X8EA 2RM21 1OOPC 2CTVA 5LZ6A 4DEQA 4YVSB 1JYVA 1GNYA 3MI8A 1TE1B 4QQPA 4R4XA 4HN0A 4XUTA 4AI3A 3VBSB 4UW3A 1HXS2 1HV0A 1VBD2 2JG8B 3J9SA 2VCAA 3K48A 3MEPA 4XQDA 3SITA 2FZ2A 3ZN5A 3N7MA 1FNYA 1OBNA 1I1EA 2WNUB 2WT2A 5J96B 1LNSA 1K45A 4BMEA 1GZCA 1J3PA 4FOQA 4I2OA 4XUOA 5FZOA 3POBA 4BLJA 2RDQA 4PBOA 4I0BA 3CJIB 1TME3 2BVBA 3ZKYA 4ZU7A 1VAVA 3S0MA 1YJLA 3F95A 3T4VA 1W8OA 2WJSA 5FAXA 4C1XA 1AR93 5J98B 1ZNPA 4FPCA 2WINB 5T52A 1B35C 3PUIA 1JBCA 3QH6A 4XJWA 4HL0A 5FPBA 4FPYA 5HI0A 2RDRA 4XAEA 4JHZA 5DAXA 3CIHA 2WZEA 4V2WA 3PIJA 3ZFEC 1F35A 1NA1A 2VW2A 2ORXA 2R072 2DCTA 4EWEA 5FMOL 1TVGA 2WZ8A 1PO11 3Q8EA 2YFZA 1G7YA 4JGZC 4L0PA 4Q29A 2UWAA 1VBD1 2WNVB 4LOTA 3ALQA 4LITA 4N7UA 1CAVB 2WNVC 2ZJCA 5FYZA 3MIGA 3C8XA 4OHZA 2Y38A 1QJU3 2RE9A 3IIIA 2DU0A 2VGDA 4QXCA 3K4AA 3TEZA 2VD7A 3LF7A 2YBSA 1O5UA 2E31A 3V65A 4Q1RA 4AWDA 5DDJ2 2WZR1 2CGPA 5A7OA 1ASJ3 2QQVA 2R073 4JGYB 1UL9A 4OZOA 3R0RA 3FL7A 1WGPA 2D6MA 3GNEA 4BU2A 4D3WA 2BBVA 3Q8AA 2IVIB 3P3PA 1UX6A 2E32A 4KBBA 3HPNA 3DYOA 2P2KA 2BNNA 1UYXA 1POV0 5JXIA 2BNMA 4FPLA 1TNFA 1WBFA 2VQTA 3J4UH 4UFIA 4DXZA 5L36A 4ORFA 1VBB1 1REDA 3WQ1A 4BPZA 4W4ZA 4GJYA 5ANNA 1X36A 3OY8B 3Q9OA 1O4ZA 1QXPA 1UY3A 1D2QA 1OQ1A 1ALYA 3C7EA 4P9WA 4YM3A 3BALA 2R041 1EPZA 2B5HA 1AX2A 1CAXB 2W1WA 1KJRA 2HBTA 3HR9A 1LB2A 4QU2A 2UYBA 4H55A 1K5JA 1DZRA 2IZWA 1W3XA 1BZWA 3O1PA 3BU0A 3OCPA 5DAVA 3MW3A 2EF6A 1DGWX 1DYKA 3QOPA 1UNBA 4PQQA 4YZ3A 1QDOA 5FPXA 5I8TA 4CDQA 2R32A 2GP3A 2SBAA 2DBIA 2GU9A 1QJU2 1JTZX 2B39A 2VMCA 3WDWA 2BQPA 1R64A 1RUG2 2QZ3A 1RUD1 4MV2A 1IPKA 1V00A 3JD72 1AYM1 4J1WA 3GBGA 1NCRB 1IPSA 1QH7A 3ZXLA 1PO21 1UMHA 5FUIA 1QQP2 2YROA 1CJDA 1FPN2 3D0JA 4D0QA 1WLWA 5FY8A 4CCCA 3WG1A 2BPA2 1JZ6A 3S30A 4DY5A 4FQ4A 4Q2FA 1YQ5A 2A6YA 1OH3A 3R6SA 1YI9A 4UT5A 5DXDA 5AFBA 1H9WA 1W6QB 4IQPA 1OUSA 4UF0A 3T09A 3VHOA 2ZMKA 3UGGA 1PM4A 2XWJB 3N35A 3I59B 4A42A 2HWB3 4UXAA 5IFPA 3W21A 2YXSA 3GBWA 3NAPA 1K12A 4OVEA 4A7KA 2YYOA 4WBBA 2AEZA 5FYIA 3U07A 1HX6A 3FHIB 1UPIA 4ZS3A 4LIVA 2OX0A 2QE3A 4HLTA 5GLTA 4LNVA 4BDVB 1KFUL 4BYYA 1MEC2 1R1A1 4Z8BA 1Z7S3 5BNNA 4W6WA 4UOJA 1ZX5A 3DF0A 3CJXA 3R05A 5LASA 1AR72 2WS91 5ABJA 4BMBA 2HWD3 3LD8A 4I3GA 4H7LA 4Q1PA 3O1VA 1N1YA 1BBT3 1WCSA 3N9QA 2QQOA 2DVAA 5FMOS 1IKPA 2JE7A 3WG3A 3I2KA 3JBG2 3DEMA 4FT8A 3J7MA 1F9KA 4OI1A 1QY4A 1WA6X 3GCWA 5ERLA 3UGFA 1W2UA 3A0NA 4CDWA 5A32A 5FPLA 3RYPA 3OTFA 1W8TA 4PDWB 1SDWA 1J1TA 1UU6A 3BIWE 2WN3A 4QX7A 1QJY3 1L7RA 4FAGA 4XBLA 4QGLA 3AZYA 1OA4A 2JDZA 3N9LA 4JDMA 4IESA 2GNBA 4KL1A 5F8PA 1GZWB 3ABZA 4Y4YA 1TG7A 2X5IA 5D8AC 3WZ1A 3ZN6A 4DB5A 1ULFA 4W6YA 5FXXA 5DPNA 1LCLA 3PVNA 4LPLA 3VBOC 5CZKA 1UO9A 3M2MA 2LW8A 5FJKA 5JPNB 1OFSA 3MLJA 3I2GA 3BTYA 1KS5A 3PUQA 3T2PA 2XKPA 1KFXL 3MO4A 1X9PA 2VTFA 5F37A 5G05L 3I3BA 2ZHLA 4PDWA 1NX9A 2Q1FA 3RZHA 1PZ9A 5DQ0A 3T3YA 1YFYA 1EY2A 1N1TA 1W2OA 3P5BA 1K3IA 5CKQA 5CVRA 3VBUC 3B94A 3WF4A 3WDVA 2XQXA 4UW5A 4FFGA 4GB33 1WZXA 5CKMA 4R4ZA 4LO6B 2WO2A 4NN0A 3FWEA 3BVCA 5DMYA 2QQMA 2X05A 4K1ZA 4LHNA 2CWSA 1AHSA 4OYUA 1XNBA 1EUUA 4AQ2A 4XEZA 3HD8B 1YHFA 2E51A 2HWC2 1IOAA 1YXWA 2K0GA 3N7KA 5DN2A 1UU4A 5FMDA 3E97A 4LHLA 4FTSA 4BOWA 5JWPA 5EPAA 4CU9A 1SMVA 2WN2A 1UOFA 3W58A 1IQAA 5HCFA 1CIYA 3NV2A 1R082 1LHVA 1UAIA 3D3AA 3BPZA 3PIGA 5I0TA 1ZVFA 4BH9A 5T3NA 4IV3C 4LQRA 1OI6A 4AEDA 3KF5A 2CGOA 4WVMA 4YGDA 2GMMA 1WA4A 4QD2A 5FXWA 1HDKA 1YFWA 3MF9A 1I3HA 1UIJA 4JV4A 1TME2 2PAMA 4L9BA 2X8KA 1UYYA 1VBC3 2RR11 2JIGA 4D6RA 3BTZA 4RN5A 1G86A 2RV9A 2VJXA 4N53B 4HBNA 5BNNB 4GQ7A 4DOUA 5APAA 1PVXA 4LKEA 4R52A 2IXIA 5C71A 4IDZA 3BKZA 1JYWA 1O59A 4QQLA 3BYWA 2NP0A 1Q8OA 1XE8A 4OI2A 1JUIA 3N7JA 3RZGA 1HXS3 3FUOA 3QACA 1H6XA 1CONA 3MW2A 3MIFA 2UY9A 2WBKA 4E4DX 1OKQA 1OPMA 4JDOA 3HJRA 5A3UA 1CAWB 1UU5A 4RQPA 3SEPA 3CO2A 5C4WB 4GWMA 5FZ6A 4EN9B 4LUMA 1RUOA 1BBT2 4D69A 1CX1A 3IWZA 4LBJA 3UT0A 1V6MA 1WMFA 3T4HB 2DUQA 1LU2A 3O0XA 3P6BA 4FXKB 4OULA 4P9XA 3I2IA 1W6OB 3UJOA 3VD4A 1BKZA 2TUNA 2ENRA 3PU8A 3S5QA 4M0NA 1V9U2 3W5NA 4NIDA 1V9U1 4TWTA 1V0AA 2CHHA 5FZEA 3AZZA 3S7EA 1RUC3 1JS9A 5KR7A 3AKSA 2HWB2 4KQ7A 3GZAA 4P9LA 2PQQA 2CU5A 5CISA 1BBT1 1DGRA 3ECQA 4EQVA 1WCUA 4NPMA 4JTNA 3CHXA 1W8WA 3R4SA 2E7AA 2ZZJA 2HWD1 5D8AB 5FXVA 2Q8OA 3TEXA 4E4ZA 1HB1A 4Y22A 2BP6A 3AZXA 3WF0A 1ZREA 2E33A 2DUOA 3U4XA 3C7OA 1JZ8A 5B4NA 3ACLA 1KQRA 2CAVA 2Q8DA 1HLCA 3RMXA 1RUD3 4AVVA 2QQPA 2R7EB 2WA3A 1JZ3A 1YYNA 2G1MA 5IAXA 4E4HA 3F2ZA 2BDRA 1J84A 1FI2A 3AK0A 2QQIA 4L8QA 5FJHA 3GZUC 1ZRRA 3BOWA 4GMP0 4Q4X2 3WF1A 1C8M1 3H42B 2XQRA 1W9WA 5BNOA 1VIWB 4C91A 5JSPA 4V1PA 2WKKA 3G7DA 4Q4Y1 5IVVA 4YW7A 1HB4A 1XNDA 4TN7A 3MLLA 2YV8A 2ZGOA 2DTWA 2NPIA 1S2BA 2V09A 3W20A 1LHUA 4IEZA 2VVEA 5FPVA 1H8VA 4A41A 4Q8LA 3T2QA 3AZVA 2VC9A 4OMDA 5EYXA 3WD5A 4IV1A 1YRZA 3D5OA 3KLSA 1AXZA 3PURA 1S0EA 3MPPG 3IPVA 1AYN2 1KDMA 4NO4A 4QHZA 1LEDA 4D6QA 3UJQA 2B8MA 1C1FA 4DXTA 1YQ8A 1NG0A 1LENA 2XBO1 3L2YA 4CDXB 5FYBA 5JPMB 3UESA 4AAXA 1JYCA 3KM5A 2R063 1OA3A 3PVOA 1PGW1 3V0BB 2BGOA 3I54A 1XOYA 1Y9MA 2P1BA 1ZBA3 3JB4C 4KU8A 4ZS2A 3UKTA 3VZKA 4YNIA 2NZ9A 3VDCA 4KU7A 2FBEA 2VZPA 3MV01 3FLRA 3UV9A 4RHV2 1W9TA 5FK8A 2V5YA 4TLGA 1FPN1 3SXWA 3TN93 3POSA 3W59A 2EAKA 4BQ5A 4D7TA 3ENRA 4NRPA 4BZ4A 4RQPC 4IERA 3NNLA 4GIQA 1YIPA 3TB0A 3GALA 4RQPB 5I8SA 5FYMA 5CBLA 1AR81 2JDUA 2PHUA 5C6CA 4JZRA 1NA1B 2VG9A 4AI8A 2A70A 4YARA 4P9YA 4IEPA 4DZGA 3WNOA 5BUVA 1GOGA 4R9DA 2VZSA 5DDJ3 4QQ2A 1I5ZA 3APBA 5IVYA 1HB2A 2VR4A 2HEYF 2RS12 5GZEA 2RS11 4AFAA 3Q8CA 4LULA 4B29A 3PMSA 1UCXA 3FHQA 3BTXA 1FMD1 1HV1A 4XJAA 4DFSA 5C8CC 4MG2A 1WLCA 2BU9A 4D7SA 4LTAA 4Z92B 1ZZBA 1NCRC 2W08A 2Y34A 5FZMA 2ID4A 2P6CA 3VZNA 3ZR6A 4AG4A 4EE2A 5KHKA 5E1RA 3ZXJA 5AFEA 2VZ1A 3DPRA 2HH9A 5FBJA 3AVSA 3DYPA 1AL22 5GZFA 3SNMA 4J1XA 3I49A 3FUQA 3OPWA 4FFIA 4PQ9A 1F5FA 2DUPA 2QKDA 1VBB2 2WIIB 4XBNA 3I3QA 4YGBA 5FY4A 5G04L 4MO3M 1MR5A 1CX4A 2W94A 1ZBE2 4EROA 1NZCA 4CPBA 5FOBB 2WSUA 2Q4SA 5AC93 2YUEA 1UXZA 1QJFA 3NMBA 2J1AA 1UYZA 2DDUA 5DG2A 2QQNA 1TMF1 4CP9A 1CESA 4I3PA 1TQ5A 2JE8A 5FDBA 4CU8A 2C24A 4O61A 5CFDC 2P3JA 3N4MA 2FDGA 2GDFA 2WNEA 2XXZA 4Q4V2 1MS9A 3DGTA 1BMV1 3TAYA 4AVTA 3B02A 1D4VB 1VMJA 3MV11 3ZSEA 1S0FA 4FPHA 2ZGRA 4MGQA 3ZXKA 2R6QA 3HT1A 1MS4A 3I3DA 2L9LA 3WINE 2JENA 4DY3A 1E57A 3B9IA 1RUI3 2Z69A 4C8DA 5J36A 2F4LA 1A3KA 2ZHNA 2ZXQA 3LZZA 2HEVF 1N1SA 4QPGA 4BCUA 2QTWB 3VBOA 5FLHA 4HSLA 4D7YA 2GNTA 4LHKA 3NJZA 4YG3A 4XXAA 1XJAA 3JQXA 2ZX2A 3N9PA 4YW4A 3DUIA 1UY4A 1BCXA 4HFSA 4Q8KA 5JXGA 4IEUA 1YIFA 4RYDA 4HVOA 1U12A 4XAAA 3TEWA 1YLLA 3VUOA 5LY2A 3E6CC 5ABJB 4CCOA 2CYFA 3AKRA 2K46A 3IDBB 1B35B 1HB3A 1PMJX 4CDWC 3SKVA 3RZKA 4NWWA 3ZO0B 1VLNA 5F5CA 2UWCA 5T5JA 1XB9A 3TYJA 1UMZA 4WM7A 4XACA 4YZ4A 1ZBE3 2XKOA 4NMIA 1SLIA 1ODMA 5F3IA 1UZ0A 3IDCB 4QHOA 1GOHA 2AACA 3PNAA 1F5JA 3KVBA 3NV4A 4QMAA 5A32B 3UETA 4CDWB 4B8EA 4DUXA 5FMCA 4N7IA 3VKMA 4CXXA 3ELNA 2YPDA 5LK5A 1BEV3 1NUKA 2FZ1A 4AGRA 4WVWA 2EALA 2ZX0A 1ZYBA 1RMU2 3OOXA 1QKQA 2GNMA 4CCEA 4YM2A 4EJRA 1PHMA 3VBSC 2XLAA 4RR3A 1ZZ9A 4CVUA 2VOWA 3MW4A 3NJXA 2IUWA 3KGLA 4EZ4A 3SEEA 4QHBA 5A3PA 4CCNA 1JYXA 4FP2A 4FI9A 3PLQA 4RHV1 4X6QB 4RS5B 4NHLA 1W90A 2WYFA 1AR62 2XDVA 4FVVA 1HQNA 2D3RA 1QMJA 3OGVA 3PUHA 4FPGA 2BZDA 5C9AA 2ZHMA 5GLVA 1GKBA 4GB32 1KDKA 3TNQA 5L19A 4G3YC 2VCBA 4IXLA 1R081 1KS4A 1PVC3 1JYIA 5C3OA 2CNAA 5JMOA 3ZXDA 1RUF2 1UXXX 2J1EA 2P5BA 3AP4A 5KWRA 2XJSA 2D6OX 4MUVA 3VHNA 4Q26A 2ZOEB 3TN92 1ND3C 5FZCA 4QKNA 5FUPA 1GANA 2WR9A 4WZFA 1X8MA 4HVRA 4BQ3A 2QCSB 4FXGB 4NIGA 2VMFA 1QIQA 3A4UA 1U0AA 2HWF3 1PNGA 3DECA 3MICA 1FMD3 3RDIA 5IHRA 4CCMA 2VVDA 2VU9A 3AM2A 1PK6B 1TNRA 2A3WA 4MHUA 4RGAA 2RVAA 2VMGA 4XVHA 3UKVA 3I4IA 3VZMA 1ULEA 5KXEA 3C3VA 2WAOA 4GKXA 1HRV3 1QF3A 1UN1A 3IDAA 4XABA 3ZMNA 1OQDA 5FZHA 3WDXA 2D44A 2C6SA 1NT0A 1R1A2 3JD71 4CU7A 3HNMA 4LBLA 3ZSKA 1NAEA 4BQWA 5DZFA 4Z07A 4UFMA 3J7HA 3AYDA 2AENA 5T50A 2ILMA 1QJU1 2WT1A 3DYMA 3MIBA 4CEWA 4ISQA 2OPKA 3AFGA 4OHVA 4EWAA 4BHPA 3U37A 2LM3A 2RMU3 3WW3A 1V6OA 2WZR3 5JOXA 2JE9A 3AMQA 3B7MA 1VRH3 1LOEA 1GZ9A 4IEXA 2JG8A 4HVQA 5KXCA 5KXDA 4PIZA 2HWD2 4BJ0A 1VAKA 2YG0A 2QQUA 1UZWA 4HKWA 2W3JA 3NWKA 3MYXA 2X29A 1D4M3 3OUIA 3RYRA 3USUB 2LRPA 3WOGA 3ZXEA 5LCWL 2D98A 4HMZA 4CP9B 2NMNA 1Q8VA 2CWMA 1S2EA 2XUMA 2VM9A 3GZEA 5FYSA 1QQP1 2XBO3 1V70A 2VPVA 3OJBA 1VBE2 4NOTA 3Q8FA 3POIA 2IXJA 4BQ4A 2FDIA 5KBFA 4UFLA 4IV1C 1IG3A 5J7MA 3KZ4C 2ZPXA 1HN1A 1XYNA 2VOTA 2GMPA 5AC92 3AP7A 2PHXA 1SBEA 1OSGA 4JX0A 2FD8A 1SCSA 1EV13 2QQLA 4LXLA 4O65A 1RL3A 1OQEA 1W9YA 3ES4A 3WDUA 2H6BA 1QJX3 1VBB3 4R9AA 1LODA 2HYXA 1QQP3 5FLIA 5I0SA 1ZRCA 5BNOB 1PGW2 2WO1A 1XRUA 2WFF2 3LFMA 1HRI3 2OW4A 3GHNA 4LA3A 2Y8KA 2A71A 4R8HA 2XBO2 1DQ0A 4XDQA 5J48A 2XR4A 3T1LA 5JI9A 2JB4A 5F5QA 5LATA 3UGHA 1YUDA 3H7YA 3QD6A 4NR1A 5HPOA 4AHZA 4GWNA 2AC1A 5T54A 5JZGC 2PLV3 4OQ9A 2JDPA 4PDWC 3WVJA 2Y0IA 3E5QA 4Y1UA 3KS7A 3WV6A 2RS13 1F8VA 3RQ0A 3AL6A 3MGUA 2KA3A 4HPKB 1GWKA 1GLHA 4YSFA 4XF9A 4DXRA 3W5MA 1US2A 5FR3A 1LRHA 4Y5TA 1HIXA 2R071 1IS6A 1R1A3 1AZDA 3H8OA 2B9VA 4N53C 2W47A 5C4WA 3WDTA 4AR2A 2PTMA 2VULA 3VZOA 1AR83 2D7FA 1IPJA 4YGEA 3VBFC 4S2GA 5JSRA 4BK5A 1VB4A 4UYBA 1NZIA 4YZ5A 2P3YA 4M4PA 1KGYA 1QHDA 3MHZA 4LK7A 4CZSA 1O5LA 4O9GA 5DDJ1 1A78A 2ZGTA 4RS5A 4B7KA 2VCCA 1GU3A 1PK6C 2CL2A 2Z5WA 4QT6A 1ZM1A 2VTXJ 2Q8EA 4QGMA 2D6PA 3EO6A 1APNA 1H8TC 4GWJA 1TMF3 2R062 4Y4RA 2VZ3A 3IPVB 2ZBJA 5CU1A 1X9TA 1V6IA 2IXHA 4GWIA 5I0UA 2QQWA 2JD4A 5A7NA 4CUBA 5GZCA 4L97A 1UZZA 2VMEA 5FZ9A 4BQXA 4DNYA 5A1LA 1FAYA 2HWB1 3VHPA 3VBRB 3ZYFA 3V0BA 4OQ8A 1PO22 1W6PA 1AYN3 1NOVA 5JOWA 1PGL1 1NLQA 2VZRA 2R0HA 3J7LA 2XG3A 3B3QE 4S2DA 3FX3A 4QAWA 2ZHKA 2Q1MA 3RRDA 2DVDA 3KMHA 4XE9A 2PAEA 2BTVC 1OXCA 3O1OA 3O1TA 5CFCA 3MF6A 2HKXA 5EZWA 4TZDA 4O9EA 1IZ3A 1GQGA 4M3CB 3ZYGA 4HOOA 1OKOA 1ZZ6A 2DFCA 3ZSJA 4P08A 3JCIA 4IUGA 4QPIC 2WC2A 1W6MB 2J42A 5HCAA 1BK1A 5JOZA 1CWPA 1JN2P 1AYM3 2ZMLA 4QKBA 2ZACA 1JZ2A 2DU1A 2VUJA 1DG6A 2ORZA 3S6PA 3ZM8A 5SV8A 1OMIA 2G9FA 1R093 3HMYA 2YC2A 5TSWA 2ADEA 1SPPB 3J26N 4WM8B 2Z79A 4A2UA 5F3CA 1O6UA 1GWLA 5DZEA 2XJUA 4TSVA 1W99A 3C7GA 2Q8CA 3BB6A 3U1XA 4JTOA 3NV3A 4RHV3 5SV5A 1TZOA 3NKTA 3OF1A 2UWBA 3ILFA 1YEWA 2RR12 4AI9A 3VHRA 3EQEA 4LKDA 4Y5SA 4E2SA 1GP5A 1QOOA 3SLIA 4ZKTB 4AHWA 1JUHA 1US3A 2KD7A 2I07B 2RS32 1OC1A 2DTYA 5IVJA 1L3JA 5FV3A 5A3LA 3PTYA 1PO13 4DEVA 4B3NA 2WT0A 5LBEA 3PUAA 4BQ1A 5LBCA 1ENQA 3M4FA 5LB6A 5AVPA 1G8WA 3SKJE 1IKQA 2LALA 1H4GA 1NKGA 1ST8A 2WWJA 3KGZA 3O0WA 4IEVA 4NHKA 4PLOA 3G6JB 1JW6A 1XNKA 5A6ZA 1WCKA 3VBRA 2WWSA 3AP9A 1C1LA 1CZVA 1C5HA 3PJQA 4UBHA 4XMAA 1OH4A 1OD5A 1W6NB 1RUI2 4CCDA 1NE4A 1PMIA 1MEC3 1ZZ7A 1OLMA 1XE0A 2EICA 2ZGPA 1HRV1 3AKTA 3AKPA 4N9HA 3WR0A 3ZX7A 5LRSA 1PVC1 1OPOA 1W2NA 5F3GA 1S55A 5A33B 4R9CA 3RJRA 4N8MA 1T2XA 4DIQA 4ASLA 4A3ZA 1DF0A 1PO12 3VBFB 2E53A 1HRV2 3IIAA 4OUEA 4OI0A 3FBYA 4K7JA 4PIYA 5C9AC 2WA4A 2NN8A 1RUD2 1NXMA 4LEJA 1DGRN 4BK4A 3JU9A 2VBBA 3VBOB 4HKOA 3SCFA 3I2FA 4XOGA 2ERFA 1G6NA 2ZTNA 3IAPA 3BOPA 2Y6GA 2O14A 3H0OA 4Z2AA 3K4ZA 4FOYA 4A7YA 1J3QA 2VY0A 3A7QA 1MS0A 3ZN4A 1HW5A 1YFUA 4PBPA 1JMUB 2EXIA 4I01A 2WNUA 4XQ4A 1PGSA 2VUAA 4XF4A 2X10A 2ZAAA 4MZUA 4RSUA 5CFCB 5FZ3A 4NRMA 5T5OA 2XH6A 2W46A 4GD4A 1JHNA 3LPGA 4LKSA 2JXAA 1CIWA 2ZEYA 1JXNA 5HCHA 3NSTA 3ZFFA 2W5FA 2VNOA 3OUHA 4FFFA 4JAAA 1FOD2 2KM2A 4MOAA 5FFOC 5LBFA 4AF9A 4AOCA 1G9AA 5J09A 2JG9B 3WQ0A 5FZ7A 1A8MA 1U5YA 3DV8A 5A6QA 5C33A 2VH9A 3LGRA 1GWMA 2RM22 1N1VA 4QKFA 2ET1A 3KT4A 3TNPB 4JVAA 2K9ZA 4LBQB 1SG3A 5JR7B 2VZTA 3ZIWA 4I0WB 1GNZA 4GA9A 1EYBA 1WW5A 2P6HA 1N3OA 4LBKA 4CSWA 4AAPA 5FYUA 5H9SA 1MQTB 1QNYA 2HWE3 5IATA 1REEA 4CXWA 3AJZA 2FCTA 4QX0A 5FWEA 4BA6A 1DZQA 4M3CE 5LWBA 3OBZA 1ZRIA 1SLLA 1TEIA 4HXCA 5HV0A 4AGVA 5DZGA 1F4HA 1H1AA 4KWUA 1DHKB 3OGGA 5LEJA 1Q5OA 4URAA 2HWF2 1MS8A 5KC5A 4SLIA 3PDQA 5L7OC 1XQNA 3FMGA 1NYWA 4MGIE 4Y1VA 1PGL2 2CAUA 1KRIA 4E9KA 3LEGA 1QDCA 2ZAHA 1NY72 3GBFA 3KVAA 3LA3A 4W6XA 3U14A 1D4M1 4CDUC 1Q56A 3GHMA 3EB7A 3IMMA 4NAOA 4WM8A 3MZHA 4NRQA 3H1YA 3I2JA 1RB8G 1YJKA 1T6GC 1R083 4E8CA 2XVGA 5LBBA 5LW9A 4FFHA 1B09A 1CAUA 1H4HA 1XNAA 3VDDB 1AYM2 1Q8QA 3ASIA 3VV1A 2XJRA 4KI5M 2C4XA 4NPRA 2RG4A 5EHDA 3TRSB 2D6LX 4LO4B 3NNJA 3WP5A 5H9PA 5FZIA 2GN7A 3LCPA 1NLRA 2XJPA 1RHI2 4JHTA 2NLRA 4F8AA 3U11A 1UD1A 3N36A 5K0UB 3KQ4B 1K5MB 1VMHA 1Z7S2 1O3SA 4HETA 1LOFA 4JCKA 1YI7A 1WCQA 2YBPA 3AB0A 1QJX1 4ZONA 5FZOB 5FZAA 4O7XA 4HANA 3P3NA 3LEIA 3M8LA 4AEDC 3H3ZA 4MGSA 3GJBA 2RS31 2DYCA 2QQKA 4ASMB 1YQCA 4Q0PA 3RPQA 1RINA 1WMEA 2D5FA 2ETEA 1N3QA 3VDDA 2WFF3 2WL1A 2ZEXA 1PZ8A 3D8CA 1NE6A 3X29B 4JGZB 3LA2A 3LFIA 4XJ9A 2XLGA 2CSGA 4RL7A 1MQTA 4EYUA 1RYYA 4XF3A 2MEV3 4AEJA 3PTRB 5KHJA 4Q4W3 1WUVA 4QXHA 1MACA 4PCRA 3WCRA 3H8RA 2AREA 4Y33A 3H50A 4RGGA 5LEKA 3ZPOA 4HSJA 5DUUA 5FIXA 1W9SA 5C5TA 2B45X 1Y9GA 2ZGMA 1JZ7A 1D0GA 1FPN3 1MVEA 2FMYA 1GZTA 2V72A 2VZOA 1H1IA 4CRQA 1RUC2 2VW1A 1RUC1 2VE1A 1H30A 4Q0SA 4R9BA 4FAHA 2F17A 4A45A 2ZCWA 1XU2A 4LHSA 1UMIA 2Q5TA 4YW5A 5AC91 1COV2 4QB1A 1AR61 3JZVA 1JU4A 3Q8BA 5FZ4A 5JOYA 3SHRA 1Y7BA 1NCQC 1CJPA 2ZKLA 4K8FA 4PHZA 5BNQA 4QQHA 3I7DA 3H7JA 3KSCA 3LDRA 4XJZA 4QM8A 2PXJA 1EV11 4S2FA 3OPTA 4ARYA 3KT7A 4XDPA 3AYAA 3WQBA 2LUWA 3RI8A 4BIOA 2W9XA 3E6BA 3LQCA 5KHHA 3T0BA 3THTA 3USUA 4M0HA 1GUIA 4MADA 1OUXA 1I5PA 4P5YA 1W3VA 3AX4A 4LLFA 1UY0A 2JEMA 4KG8A 1S2KA 2VMHA 1QJX2 3O1UA 1O8SA 4DINB 1S0IA 3CEWA 4K6BA 4UFKA 4AI2A 2SLIA 1WLDA 4BXSV 2DURA 4FPFA 4ES9A 5ANQA 1YO8A 2DCJA 2ZX4A 4XFHA 2X53S 1VBC1 2RR13 2UURA 4LT5A 3ACFA 3POFA 3WSOA 5CFDB 1A6CA 2XGXA 1GP4A 2VUCA 1U5ZA 1UPSA 1V6NA 2BVVA 2Q1ZB 3AYCA 4QWNA 3C2UA 5FP8A 4A3XA 4FTEA 4RR3C 2GZWA 3MUY1 3ETQA 1W6PB 5LY1A 2I74A 5KHGA 2E6VA 5T55A 3WNPA 2WABA 3MUZ1 2X09A 1V6JA 4J6GA 1XSRA 4B1LA 4LMFA 3FJSA 2AYHA 4QU1A 2Y26A 4GZ9A 5C3QA 1POQA 5FP3A 2BOIA 2AGSA 3NAPC 5I8YA 2A7AA 2P37A 4CDXA 1AXKA 1FV2A 1N47A 3IN9A 5FPZA 5JIUA 1OT5A 2HWC3 5FYTA 2R30A 3FBMA 3THCA 3O1RA 4META 3A0KA 3N9OA 3WY6A 3ZYIB 2QUOA 2W91A 4RGKA 3IMNA 5A7WA 1KXGA 5FKCA 1N3PA 4LBNA 4P5HA 3HQUA 4INDA 4AFBA 1ND2B 1UKRA 4X8NA 5I91A 5IVCA 5IFTA 4Q0QA 2WLPA 1ONAA 5J3UA 2YU2A 3KHBA 4AVAA 2WWUA 2B7YA 1NLSA 1W05A 4IEYA 4FCAA 2MPFA 3USSA 1BXHA 4FP3A 3ZFGA 1LECA 1WW7A 5GZGA 4DXSA 4P9GA 3MLKA 5BYNA 2FDFA 5IK5A 4Q5OA 5ACA1 3HQXA 4PJYA 2D3SA 3TBDA 2PHWA 2XL9A 3AFKA 2NQYA 4CDQC 3PL0A 4QX2A 2A73B 2C5DA 2Z2SB 1OURA 3OGJA 1F2NA 3EMRA 1VBD3 1CZSA 3IB3A 1XYOA 2QFEA 1SACA 3ZFFC 5CAZA 4PI2A 5A1FA 3IDEA 1PX4A 4P02B 2PHLA 1IS5A 4FOWA 3ST7A 3HOBA 4CEYC 4AVBA 4GXLA 1SPPA 1PIV3 4YZ1A 1NQJA 2GP5A 4PLMA 2GH8A 2WQ4A 4RD7A 2Q0AA 1W6QA 4AQTA 1GNHA 2RM23 4P9JA 3K3NA 1LOAA 1RUH3 3VZJA 1UY1A 3PVBB 3AVRA 1WD3A 4PI0A 5L9VA 4V2VA 1GV9A 5GLZA 2Q30A 5LRRA 5CG9A 5CG8A 3HVDA 4E2GA 4KBZA 2BWCA 2FCVA 3NNGA 1XBFA 2UY8A 3U10A 2CDOA 3C7FA 1M06G 3ZYBA 1QXJA 4M3CF 1X82A 2YHJA 3LA7A 3J8F1 3DPRB 5L73A 1RUI1 4XFGA 2BNOA 2D93A 5L7OB 1OLME 2PAKA 2TBVA 2C9KA 1BHGA 3BGAA 3LKJA 1FATA 3M70A 3E5XA 4PT6A 2J7MA 3VBSA 4XIOA 3O7OA 1SLCA 5FZFA 5E89A 2XMLA 5E8AA 4YVWA 2WNVA 2VMIA 1W6OA 2C26A 3K51A 3HAGA 3K2OA 1HQWA 4MXVA 3I2DA 4XXPA 4OLLA 4XILA 4YM1A 3NL1A 1OFNA 2W0XA 4L2NA 3RS6A 1OVSA 3H8XA 2JX9A 2W87A 1RUNA 2D5HA 2PN5A 2RS53 3WHTA 1VPHA 1Y9QA 4NVPA 1MZEA 3KQRA 4RS5C 4ZZ8A 5C70A 1G9BA 4YGCA 4UWDA 2PMWB 5A1AA 1FX5A 4P14A 2X5IB 5T5PA 4B4QA 3CJIA 3VKFC 4OCTA 4Y20A 4E4SA 1PM7A 1AJOA 4YVWB 1VBE1 1LHNA 1U5IA 4LBOA 4BE3A 1COV3 1PO23 1D7PM 4LK6A 5FZLA 1IS4A 2EA7A 1GBGA 1UZVA 2GN3A 2O1QA 4JC1A 1MQTC 3ZFGC 3ZFEB 2ZGUA 4KWJA 4M00A 1LGCA 1YWKA 2IXLA 3OEAA 4NJ4A 3CU7A 2J1SA 4Y5Z0 3RGBA 1ODNA 1QXRA 2P3KA 3U78A 5H9RA 3VBHB 5B2GB 3GZTB 2VZUA 1LOFC 4AYUA 3WCSA 1C4RA 5FY5A 3QLQA 3NRUA 1QWRA 4F3JA 4XMIA 3AP5A 1R1ZA 3POJA 3I97A 5BNPB 1DIWA 2WDBA 2RDNA 3DKQA 3P1IA 1ENRA 4A6SA 5IK4A 2R1BA 1VRBA 2BUKA 1LU1A 2QZ2A 5FCCA 1UKGA 5JLVA 4CDUB 2XB6C 3ILRA 3OB8A 5LA2A 1BVVA 1CAVA 1RXGA 2GC3A 2Y0OA 1JH5A 2YC0A 4FQZA 5A3WA 4ET7A 2VZQA 3HEIA 4W50A 3B00A 3IM0A 1R092 4RA0A 1AR82 5CFCC 2BERA 1NXD1 2DWRA 4MLOA 4U36A 3LAGA 4M01A 5CFDA 3WF2A 3FC0A 4JGYA 5JUVA 4GH4C 4CEWB 1UQXA 2FDJA 4BQYA 2OS2A 1MS1A 1DZTA 4LJHA 2BFUL 3JUUA 1UOJA 4QM9A 3VD9A 4IV3B 2A6XA 1SLTA 1RC6A 4ONUA 4CEYB 5C3SA 1GOFA 4QPWA 2WFPA 3SQOA 1VR3A 3BCWA 2VOVA 2P17A 2PLV1 4CDUA 1RVF3 1JZ4A 3AC0A 5JVVA 2DBNA 2V4VA 1EAH2 3AZWA 4ZPIA 3KD4A 3M3EA 3WP3A 1AX0A 4BQ2A 2E7TA 4Y1YA 3A21A 1PK6A 5IT6A 1URXA 1W0OA 4Q4X3 4A6OA 1ZRDA 1EPWA 1VBA1 1RUJ1 4IEWA 2WLQA 5C8CA 4N43B 4XFCA 5FKBA 1VJ2A 2W1UA 4D6SA 5A3MA 1Q43A 2B4KA 4IE6A 3T0DA 3RMYA 4N43C 1GSLA 1LJ7A 4DMIA 3DXTA 5A3NA 4PLNA 5A70A 1BEV2 4OFGA 1OF3A 5K9YA 4I30A 4IEQA 2VNRA 4IGQA 4IE0A 3KCXA 3VL8A 4AVSA 5FBZA 5KC6A 4WZCA 4BWOA 4I02A 1AL0G 4QPYA 5CA6A 5M0TA 5FLJA 1GQPA 3LWCA 4L92A 2IWGB 4YW6A 3RG0A 1J3RA 1O4TA 1WMDA 2DVGA 3VB9A 3NAPB 3V64A 1I6XA 2VQUA 1VRH1 5FYYA 3LE0A 1W0PA 5BNPA 1RUE1 1SFNA 4HG6B 2ZABA 4ATEA 2YZ4A 3CDZB 3V0AB 2PHDA 3HQRA 5F9TA 2ZS6B 1GZWA 5C8CB 2B9UA 3ITQA 1L7QA 3RWNA 4EV0A 5C7GA 2HWE2 3ETPA 2E26A 3O14A 4QB2A 3CZUA 4XUPA 2R1DA 3AXDA 3OD0A 2DVBA 4Y20B 2J1RA 3VZLA 2IFRA 3D6EA 1O7FA 3N9NA 4CP1A 3O1MA 2JECA 3KF3A 5HCBA 3HN1A 1S0CA 1H1MA 1CR7A 1QU0A 2JICA 3NVCA 1Q8PA 1C8NA 3N3HA 4KG0A 4EN7B 3WW4A 1O91A 5FP7A 4IV3A 3IT8A 4Q4W1 2PHRA 2GALA 1JOJA 2VVFA 2IFWA 3BN6A 5FZ8A 3EYPA 3GYDA 5JMCA 2PQSA 4NUBA 5LA1A 2XPJA 5FQ0A 1PMHX 3GM8A 1VB2A 4LIUA 4C90A 1OLQA 3OEBA 3NV1A 3BIEA 4YVSC 5F32A 1JI6A 2A3YA 2RJKA 3PVEA 4IGOA 4WM7B 3WLUA 1JOBA 2ZGQA 2PYTA 4LE3A 3E6DA 4HK8A 3VDBA 1C57A 4CUGA 1FNZA 1NCQA 1DQ5A 2BWAA 2GH2A 2VXJA 3AKQA 2R061 1BVP1 1JYTA 5FOJB 4UBGA 3T30A 5BNOC 5F2SA 2RJ2A 3ZR5A 2XJQA 2ZA9A 3E5UA 1QH6A 1H6YA 3AMMA 2KXLA 5EXOA 4QPGB 4ATFA 3UKNA 4CEYA 1X7NA 2AH2A 3M3QA 3E1F1 4K21A 3T2OA 4F83A 5FO8B 3PMEA 2FMDA 5F3EA 1AL23 5H9QA 5FZDA 4OZXA 2OA2A 3H3LA 3I8TA 3AP6A 3K4DA 1LOBA 3ZFEA 2VCMA 2ARAA 1VAMA 1NQDA 4ISRA 4WM8C 4XYXA 3POYA 2ZKNA 4M4RA 1B35A 5IUQA 3UL2A 1RUG3 2EAAA 3DCQA 4KGGA 4LR4A 4CUAA 1TME1 1LULA 2X5IC 3UYJA 3QCWA 1QNWA 4ZXKA 2ATFA 2G9GA 1UX7A 4MGYE 1YNAA 4OUSA 4N43A 5FMBA 1BK0A 1SHWB 2HYKA 2YDEA 4XFFA 2WAAA 5GZDA 2D97A 5FREA 2ZGSA 3B9CA 2OT7A 2YGMA 3D4KA 3LEMA 3ZKUA 5FZ1A 1AL21 3QH7A 4DRRA 5GLUA 1CD3G 1DQ6A 1H2NA 4QQOA 1J58A 4CTEA 5C5UA 1RUJ2 2H0VA 4ZXEA 1OD3A 1L7LA 5EV7A 3RJ2X 4MH0E 2OZJA 1OVPA 3WQ7A 4UFJA 4S2HA 2G19A 1MZ6A 1AYN1 2JKBA 2XONA 3WXPA 4AHYA 1BMV2 2J1TA 3UNPA 1EAH1 1RVF1 1Q8SA 2VO5A 3J8F3 2QJVA 5FZKA 2NYYA 2Y64A 5FK7A 4YW1A 1PIV1 1XC6A 5LK7B 1ZBA2 5IAVA 3I2OA 4FPEA 3CZJA 3ZMOA 2B46X 4TYSA 4JGYC 4GMP1 4E2QA 4X6RB 1ULDA 1BLZA 1DFQA 1ULGA 3NQHA 3ZYPA 3U0ZA 5J1XA 3VD3A 2I45A 2A3XA 5BY5A 5K0UC 3WF3A 4UW4A 1H0BA 4WVVA 4FBFA 2WUHA 2VBDA 3GCXA 3WUCA 2VOKA 4COVA 4TTGA 2ZZQA 1CPNA 5GJ6A 2HJIA 1LHWA 3WG4A 4IEOA 1CPMA 2Y6HA 1RMU1 3URFA 4D94A 1ASJ2 1W8UA 3RYKA 4X8PA 1WCDJ 2OZ6A 1H2KA 2AEYA 3B93A 2JDYA 5FY1A 1IG0A 4QGNA 5FYHA 1MS5A 4SBVA 3B69A 3ZXGA 1RVF2 1ND2C 4UW6A 1SBDA 5FP9A 3SISA 3B5LB 3DN7A 3VKOA 2HWE1 2JD9A 2Y60A 2IC1A 3M3CA 5C4WC 1ASJ1 3CL1A 5EJ1B 5GALA 3HT2A 1O3QA 1HRI2 5DAQA 4COZA 5C9AB 2W68A 4AEMA 5EJ3A 4IW3A 2QBXA 1BYHA 1WLTA 3EXUA 2XVLA 4Q27A 3ZXFA 3FLPA 1DQ4A 1S0JA 1XE7A 2YFUA 1SCRA 4KWLA 5A6YA 1Y43B 2I2SA 2OXBA 3AMNA 2D6NA 4PIXA 4A44A 2BEOA 2V73A 5ISLA 4Q4W2 3LB9A 1SFPA 2GAUA 2JG9C 4XJUA 1K42A 4CDQB 3INAA 1AR71 3ZYRA 2IXCA 3O0VA 1PX3A 3I3EA 3MBWA 4RR3B 5FY7A 2FDHA 4MGTA 4AVCA 1DCSA 4C0HA 2A5ZA 3SCHA 1ZBA1 1W8ZA 2XJTA 4I0AA 4Q4X1 3NKGA 2JJ6A 3M7AA 3SH3A 2BOJA 3SC7X 1QOTA 3HN3A 3EJKA 3HWJA 1QJZA 2O0OA 4JQTA 3TN91 5C8WA 2WO3A 3LDBA 1ACCA 3K46A 4EN6B 1LAJA 4EZHA 2CDPA 1YFXA 1RUF1 4ZHNA 2JKXA 3VKNA 5JIAA 4AW7A 4Q4V1 3CMGA 1LTEA 2WZPP 4Q4Y3 3D82A 3T0AA 3RWKX 4GB31 3CLPA 5D21A 1XSQA 2P34A 4MVTA 2FCUA 2RJLA 2VNVA 4TXWA 1S0GA 3DL3A 1SEFA 4AFCA 3S5AA 3FFZA 2GNDA 4K3UA 5KXBA 3T08A 4EN8B 2Y6FA 4N9IA 4MXWA 3NO8A 3OGSA 2ARXA 2W52A 2IXKA 1FT9A 1VBA3 4AHXA 3ZDSA 3WX5A 4XJ8A 3D0SA 1KD7A 4QDRA 1W06A 1ZA4A 1RUG1 1R091 5EP9A 4IE4A 1FYUA 4QX8A 3BUCA 2G9ZA 5C3RA 4XUQA 5JR2A 3OBTA 2RS33 1LR5A 2JG8C 3BPSA 1ULCA 5A6XA 2PHFA 3CKHA 3WW1A 2WS93 3VBRC 2UU8A 1DQ2A 4XCAA 3LOBA 1FMD2 4HPKA 3ACIA 3L9JT 3SH4A 1CAXA 2GSYA 2Z42A 4JKLA 5F2WA 3SCGA 4CU6A 1WW4A 1NCQB 1LGNA 3AMPA 4ASKA 3CJIC 4JGZA 3GJAA 2O8OA 3THDA 4AK3A 3WP4A 4YLZA 4C0BA 3B01A 5DAPA 3EHKA 1BJQA 1O3RA 4NE9A 2DFBA 5FY0A 3PHMA 1VBE3 2YU1A 3CF6E 3OUJA 2JDKA 5F6KA 5IW0A 3ZSLA 1V6LA 3T2TA 1XXNA 2EXHA 3OSDA 4JKMA 5J37A 1WBLA 2ZEWA 5IJRA 1W28A 3JQWA 5KHIA 2C0ZA 2JWPA 1QJEA 4Y24A 4AZZA 1UZYA 2LROA 3NJVA 3BODA 2D6KA 4XC9A 2XWBB 2ZGKA 1XPWA 4KNCA 3C7HA 4GAZA 5EYYA 4AI1A 1SBFA 3ZN6B 4GMP3 3OGRA 1GP6A 1LGBA 1AF9A 1AR63 4IGPA 1DQ1A 1HJGA 2VZVA 3NNFA 3FZ3A 2JG9A 1PIV2 3W9AA 1DU3D 3ZVXA 1ND3A 2HLEA 4OUMA 4Y1ZA 3WT3A 3K77A 1DYOA 1RITA 2XHKA 4YG6A 2NM1A 3MPBA 3JB8A 4DS0A 2OQ6A 4B4RA 4BIFA 1C5IA 1RIRA 3VBUB 4Y26A 1V6KA 3H1WA 1S4CA 1MZFA 1RTVA 2BGCA 1OLRA 1F31A 2VL4A 3BU7A 5LA9A 4WVZA 3JXSA 3H3UA 4YVSA 1XNCA 3ZSMA 3LOIA 1WWYA 2YC4A 2VNGA 1SFYA 3ROUA 4COYA 1J1LA 4IETA 4QX1A 1TMF2 2MEV1 1H9PA 1WKYA 3VBHA 2D40A 3JBG1 5I0RA 3A23A 4ZZ5A 1ZZ8A 4K8RB 5FYCA 2R16A 5E16A 4H3WA 4HK9A 2O8QA 2YB7A 4U2AA 1ZBE1 2ARBA 2DCZA 2A1XA 5A7QA 2BJSA 3WW2A 2OIIA 2CV6A 4HZFA 4YYOA 3AYEA 3ME2A 4NIHA 1AVBA 4Z1VA 1C8M2 4LORA 3CBNA 4UI9L 4XDOA 1CAWA 3J7NA 4NIAA 1RUJ3 4AEDB 1HRI1 3KV9A 3HBKA 3TWIA 3ZFGB 4OHYA 3AJYA 2A6WA 3MIEA 4DRVA 3DXUA 3HIFA 1W39A 1ULOA 3QBQA 2H6CA 3K75B 1LOGA 3IAQA 3H1MA 3WG2A 2BRTA 1IHMA 2XOMA 4ZU5A 2DF7A 4LE4A 2XHNA 4J25A 1LKNA 2JIJA 4LBMA 1XNTA 3S7IA 5BNPC 1AUYA 4XURA 2GC0A 3IZOA 1HQLA 4IE7A 3LSDA 1OOPB 5FZGA 1HJFA 4N53A 5EQUA 2FHRA 2LTNA 2W95A 1JOPA 3H9AA 4Q4V3 1F4AA 1QGLA 4AL9A 4EN0A 5FXZA 1RMU3 2XUEA 4LOSA 2OKXA 1O8PA 2WO7A 2QNKA 4QXKA 4GALA 5ACA3 4ITCA 4COWA 2J1VA 2BFUS 3LDKA 1A8DA 3TOJA 2JB8A 5BPXA 3N9MA 3KV6A 4XW3A 4F7ZA 4CA9A 5FO9B 1ULPA 3AMHA 4EWDA 1Y4WA 2RDSA 4NHYA 1SZBA 3RNSA 4MXWB 3ZYJB 5JXHA 3ZOIA 5T5LA 2DVFA 4CDXC 4UAPA 3A22A 5FTTC 2JDNA 2VQAA 4GULA 2OYZA 2GMEA 1IGOA 5JI7A 4Q0UA 1J59A 4MYEA 3JD73 3VGIA 5D8AA 3WDYA 5HV4A 3OY8A 2ZGLA 1ND3B 4GH4A 2Y6JA 4YFWA 4IV1B 4Y3OA 2ES3A 3FN9A 1UYPA 4FSJA 2RMU2 1VRH2 3UK9A 3HNYM 2K2SA 4FPJA 2BBAA 1UOGA 2AZ5A 1MVQA 2XVKA 2ZGNA 3VKLA 3O12A 3TEYA 1E5HA 3I59A 4JDNA 3VD7A 1AX1A 2JDAA 1UIKA 4DO0A 2MHFA 4Q4Y2 1W2TA 4HKLA 2VAUA 2V5DA 3SMHA 2JDHA 2V4AA 4P00B 4RFT0 4DPNA 3K3OA 3SH5A 3NJYA 1C8M3 4N90A 2GC1A 1ENSA 2VBPA 3KCCA 2RHPA 3VLBB 4AE2A 5BV6A 3POEA 1JYNA 1G9DA 2W1QA 3KHCA 4PF1A 5EWSA 3DPRC 5K4LA 4NHXA 3LPFA 1LOCA 1Q3EA 1VBC2 4QB6A 3LEKA 1P8JA 1NCRA 1OF4A 2HWC1 4LBQA 2LS6A 1XYPA 5DUVA 5IVBA 2YPJA 4OHWA 5DABA 5JXJA 4E8DA 1CVNA 3ATGA 3OG2A 4BISA 1W8HA 3PJYA 3OPZA 1DLLA 2EXJA 2UYAA 1VMFA 5D1IA 3ZYHA 4AQ6A 1CGPA 4XFBA 3KT1A 2QDNA 3J8F2 5FZ0A 3NNMA 5IK8A 3OYWB 5CYYA 2H0BA 3KB5A 2R042 3EBRA 4UF0B 4XIKA 3RFRA 4XPVA 1HXS1 2VTXA 3LIHA 4XQWA 5GLWA 1PVC2 2QDRA 1S0BA 1H8TA 2ZEZA 3POGA 4GJZA 2WYSA 4CCKA 5JAXA 4TLFA 1RUF3 4MX3A 3OBAA 4G4FA 4K1YA 5FUNA 3VBUA 1LHOA 1RJ7A 5DUWA 1GICA 1W6NA 4A4AA 4BXFA 2YY1A 3ACHA 3JBG3 4XHXA 1ZA7A 4AQSA 2WQZC 3O1SA 4HT1T 5HBAA 4H7MA 1EAH3 1W2AX 1RUH1 1COV1 4C1WA 3IBMA 4ZY9A 1KJLA 4QX3A 1Z78A 3R4UA 2J22A 1ZRFA 2RS52 4LO7A 3OYWA 3BTAA 2B42B 1T6BX 1E5IA 5CEHA 2VW0A 4YM0A 1M4WA 5F1RA 1UY2A 2XJVA 4H2AA 1DP0A 3RI9A 4BB3A 4QXBA 3RVHA 5EJZB 1EV12 1D0HA 5C3PA 3MFCA 2VUDA 5FO7B 1CZTA 4L99A 1MZ5A 1RJ8A 5FPAA 1RUE2 3LIGA 2EIEA 4I09A 4AXOA 2P4EA 2HBUA 1CN1A 1REFA 2WSVA 4QPGC 1FOD1 2WNOA 4KMQA 3VN4A 3I3MA 2FDKA 1DYPA 2OUHA 4P9IA 4LBQD 4QX5A 1DGWA 2WS92 2WNUC 4XF1A 5F5IA 4ARXA 2EIGA 1E5RA 4G9SB 1EP0A 2VXRA 4JRAA 1BEV1 5JZGA 4LUKA 1K5MA 1K5MC 5CB7A 5ABJC 5CADA 2OPWA 3OBRA 4CUCA 2XLFA 5EFUA 3MFAA 2RS51 4YFZA 3RSJA 5BNNC 1AJKA 1S0DA 3S57A 3ZDVA 1V9U3 1VBA2 5CIRA 5JSOA 1WW6A 4BLIA 5JDBA 1QEXA 3GXUA 4YWAA 5HXMA 2QVSB 1RUH2 1WD4A 3VBHC 4KGQA 2WZR2 3ON7A 2D43A 4E27A 4DUWA 1CAUB 2WRAA 4NPLA 2PFWA 1H8TB 4Y22B 2E63A 1UF2C 2BW8A 1O3TA 3MIHA 2A75A 4XZPA 4GKYA 2Y33A 1JZ5A 1CQ9A 2PLV2 3H8UA 5L7OA 1AXYA 4CPBD 1G9FA 4JQRA 1AR73 2R49A 3KWVA 3T1MA 1DBNA 4K9SA 5B4XA 3V0AA 1OHFA 4D8MA 2GC2A 4ZU4A 5K0UA 4CE8A 2A6VA 4ES8A 1PZ7A 4GH4B 4H14A 2OUJA 4LLOA 3U75A 2JDMA 4Y1XA 3WNKA 5D2AA 3KCYA 5FRAA 4CXYA 1HN0A 1W8FA 1W6MA 3ORJA 1C28A 1VE0A 1I9RA 3AL5A 1JODA 2TEPA 4XHBA 5DAWA 1RUE3 2C1FA 3CNAA 1RGSA 4CYDA 2PELA 3WNMA 1GFF2 2BV4A 2W92A 3VDAA 4YPJA 1F15A 4K40A 3KV5A 4WVMB 1KEXA 1UWWA 1EUTA 5F6LB 4CEWC 3RZZA 4CP0A 4QPIB 4XTMA 4Z82A 1QJY1 2DV9A 4OHXA 1X33A 1KITA 5IYYA 4MGKE 4NIIA 4AFDA 3RZLA 3KV4A 5F5AA 2YBKA 3ACGA 3GGLA 5F7UA 1MPXA 2ADDA 1DLCA 1J83A 2F6BA 1D4M2 3ZXAC 4FOVA 2EIBA 2R0FA 4YVWC 2BGPA 3ZIXA 3FE5A 5AVAA 4MGZE 5FPUA 4YG0A 2P3IA 3R4DB 1QOSA 5K7PA 1RHI3 1LESA 2VQ0A 3IKWA 2A6ZA 4KH9A 5I0DA 1MS3A 5IWFA 3CQOA 2OQ7A 4NWVA 5L9RA 2W1SA 1W0NA 4JRLA 4A7ZA 5EIYB 1DDLA 1AR91 4B7EA 5JCTA 3I2HA 3BI3A 2E7QA 4W8JA 2NMOA 2VMDA 1H2MA 3VL9A 4YZ2A 2VOXA 3OD4A 1H2LA 1MEC1 2WFF1 5DUXA 3N7LA 5A7SA 2HEWF 2ZX3A 3WEZA 4LO5B 4Z2WA 4FO9A 1DGLA 1Z7S1 3NW4A 2DCYA 3HBZA 4LKFA 1D2SA 2EIDA 3O5SA 4HN1A 5HXVA 2Y6KA 5CKNA 2Y6LA 3ZLIA 1RHI1 2YGLA 3WP6A 5L9BA 1AR92 4OI4A 1UW8A 5A7WB 1PNFA 4LA2A 2Z4FA 2ZX1A 3DKWA 3FLTA 4NROA 4CCLA 4DUVA 5I93A 3WHUA 4URTA 3ZPYA 3U4SA 2QQJA 1GQHA 4NHMA 1X50A 2EVXA 2AR6A 3MIDA 1C3HA 3PUSA 1Y3TA 4RFRB 4YRDA 4FPOB 5FP4A 1XU1A 3M3OA 4COUA 2W39A 1YCIA 1POV1 4YW3A 2G4IA 5GKAC 5A7PA 1ZZCA 2KR2A 2ZMNA 2IVJA 4XFAA 1YC61 4YW2A 3GDBA 5E88A 3LSEA 4MHRA 1FXZA 4XUNA 4FPKA 1LEMA 2VECA 4XBQA 4WM7C 4AI0A 2D3PA 4NAMA 5LA0A 3V56A 3M3IA 4B1MA 1A34A 3PU3A 1E5SA 2BYVE 4HONA 2CY6A 2HWF1 2W2IA 1NA1C 3HNBM 4KWKA 1GYKA 5DG1A 1UOBA 3FFQA 5FWJA 3ES1A 4L11A 1IQDC 5CNAA 5FYVA 3VBFA 1FOD3 2J1UA 3WNNA 1HKDA 4MSVA 2DCKA 4FTBA 4PF5A 5A3TA 1POV3 5IK7A 1YQ2A 1W04A 1FV3A 5IVFA 5FZBA 4WV8A 5A80A 5FY9A 1Z0HA 2CGNA 1W03A 4M3CA 5GM0A 2PA7A 1ENXA 2OVUA 1O4YA 2FQPA 2YMZA 2E9QA 3ILNA 4XF0A 1W9FA 4CP2A 4AFMA 1VALA 5JZGB 3VD5A 2ARCA 3VDDC 2C9AA 2R043 3FHAA 4XFIA 1G9CA 4JKKA 1ND2A 4OMCA 2F4PA 4K20A 1NY71 4B4PA 4AEKA 1STMA 2RMU1 3M1HA 5K8SA 2MEV2 1RXFA 4XCBA 4BM8A 4QPIA 4XTPA 1JU3A 1S1AA 5A33A 5ACA2 4QKDA 2MNGA 1OOPA 1SLAA 3AXEA 1U5XA 3ZFFB 3L2HA 3RZMA 1BQPA 2WQ8A 3WUDA 1YQ6A 2XL7A 1OA2A 1SLBA 2TNFA 1QJY2 1IS3A 4QDSA 4CCJA 1W8NA 2N7GA 4W65A 4XETA 5FQ0B 5BXXA 4IL7A 5IVEA 1VP6A 5E6HA 2AUYA 4UFHA 3WNXA
chains in the Genus database with same CATH topology
2PHTA 2ET7A 3POWA 3MDPA 3THPA 2EXKA 4LO8A 1GR3A 4AGGA 1SQ4A 4Q0VA 4DQAA 3GF6A 2RM21 1X8EA 1OOPC 2CTVA 4YVSB 3MI8A 4QQPA 1TE1B 4R4XA 4HN0A 4AI3A 3VBSB 4UW3A 1HXS2 1HV0A 1VBD2 2JG8B 3J9SA 3K48A 3MEPA 4XQDA 2FZ2A 3SITA 3ZN5A 3N7MA 1FNYA 1I1EA 2WNUB 2WT2A 5J96B 4BMEA 1GZCA 1J3PA 4FOQA 4I2OA 4PBOA 4I0BA 3CJIB 1TME3 2BVBA 4ZU7A 1VAVA 3S0MA 1YJLA 2WJSA 5FAXA 4C1XA 1AR93 5J98B 1ZNPA 4FPCA 2WINB 5T52A 1B35C 1JBCA 3QH6A 4XJWA 4HL0A 4FPYA 5HI0A 3ZFEC 1NA1A 2VW2A 2R072 2DCTA 4EWEA 5FMOL 1PO11 1G7YA 4JGZC 4Q29A 2UWAA 1VBD1 2WNVB 3ALQA 4N7UA 1CAVB 2WNVC 2ZJCA 3MIGA 4OHZA 2Y38A 1QJU3 2RE9A 2DU0A 2VGDA 1O5UA 3V65A 4Q1RA 4AWDA 5DDJ2 2WZR1 2CGPA 1ASJ3 2R073 4JGYB 1UL9A 3R0RA 1WGPA 2D6MA 3GNEA 4D3WA 2BBVA 3P3PA 1UX6A 4KBBA 2P2KA 2BNNA 1POV0 2BNMA 4FPLA 1TNFA 1WBFA 3J4UH 4DXZA 5L36A 4ORFA 1VBB1 1REDA 3WQ1A 4BPZA 1X36A 3OY8B 3Q9OA 1O4ZA 1QXPA 1D2QA 1OQ1A 1ALYA 4P9WA 4YM3A 3BALA 2R041 1EPZA 2B5HA 1AX2A 1CAXB 1KJRA 3HR9A 1LB2A 4QU2A 2UYBA 4H55A 2IZWA 1DZRA 1BZWA 3OCPA 3MW3A 2EF6A 1DGWX 1DYKA 3QOPA 5I8TA 4YZ3A 1QDOA 5FPXA 4CDQA 2R32A 2SBAA 2GU9A 1QJU2 1JTZX 2B39A 3WDWA 2BQPA 1RUG2 2QZ3A 1RUD1 4MV2A 1IPKA 1V00A 3JD72 1AYM1 4J1WA 3GBGA 1NCRB 1QH7A 3ZXLA 1PO21 1QQP2 2YROA 1CJDA 1FPN2 3D0JA 1WLWA 3WG1A 2BPA2 3S30A 4DY5A 4FQ4A 4Q2FA 2A6YA 3R6SA 1YI9A 5DXDA 1H9WA 1W6QB 4IQPA 3VHOA 2ZMKA 2XWJB 3N35A 3I59B 2HWB3 4UXAA 2YXSA 3GBWA 3NAPA 4OVEA 4A7KA 2YYOA 4WBBA 3U07A 1HX6A 3FHIB 1UPIA 5GLTA 2QE3A 4HLTA 4LNVA 1KFUL 4BYYA 1MEC2 1R1A1 4Z8BA 1Z7S3 5BNNA 4W6WA 1ZX5A 3DF0A 3CJXA 3R05A 5ABJA 1AR72 2WS91 4BMBA 2HWD3 4I3GA 4H7LA 4Q1PA 1N1YA 1BBT3 1WCSA 2DVAA 5FMOS 1IKPA 2JE7A 3WG3A 3JBG2 4FT8A 1F9KA 4OI1A 1QY4A 1W2UA 3A0NA 4CDWA 5A32A 3RYPA 3OTFA 4PDWB 1SDWA 1J1TA 1UU6A 3BIWE 1QJY3 4XBLA 4QGLA 3AZYA 1OA4A 2JDZA 4JDMA 4IESA 2GNBA 4KL1A 1GZWB 5D8AC 4Y4YA 2X5IA 3WZ1A 4DB5A 3ZN6A 1ULFA 4W6YA 1LCLA 3PVNA 3VBOC 3M2MA 5JPNB 1OFSA 3MLJA 1KS5A 2XKPA 1KFXL 4PDWA 2ZHLA 1PZ9A 1YFYA 1EY2A 1N1TA 5CVRA 3VBUC 3B94A 3WDVA 4UW5A 4GB33 4R4ZA 4LO6B 4NN0A 3FWEA 4K1ZA 4LHNA 2CWSA 1AHSA 1XNBA 4AQ2A 4XEZA 3HD8B 1YHFA 2E51A 2HWC2 1IOAA 1YXWA 2K0GA 3N7KA 1UU4A 3E97A 4LHLA 4FTSA 4BOWA 5JWPA 1SMVA 3W58A 1IQAA 5HCFA 3NV2A 1R082 1LHVA 1UAIA 3BPZA 4BH9A 5I0TA 1ZVFA 5T3NA 4IV3C 1OI6A 4AEDA 2CGOA 4WVMA 4YGDA 2GMMA 1WA4A 4QD2A 1HDKA 1YFWA 3MF9A 1I3HA 1UIJA 4JV4A 1TME2 2PAMA 4L9BA 2X8KA 1VBC3 2RR11 1G86A 4N53B 4HBNA 5BNNB 4GQ7A 4DOUA 1PVXA 4R52A 2IXIA 4QQLA 2NP0A 1Q8OA 1XE8A 4OI2A 1JUIA 3N7JA 1HXS3 3FUOA 3QACA 1CONA 3MW2A 3MIFA 2UY9A 4E4DX 1OKQA 1OPMA 4JDOA 1CAWB 1UU5A 4RQPA 3CO2A 5C4WB 4GWMA 4EN9B 1RUOA 4LUMA 1BBT2 4D69A 3IWZA 4LBJA 1V6MA 1WMFA 2DUQA 1LU2A 3O0XA 4FXKB 4OULA 4P9XA 3UJOA 1W6OB 1BKZA 2TUNA 2ENRA 4M0NA 1V9U2 1V9U1 4TWTA 3AZZA 3S7EA 1RUC3 3AKSA 2HWB2 4KQ7A 3GZAA 4P9LA 2PQQA 1BBT1 1DGRA 3ECQA 4JTNA 3R4SA 2E7AA 2ZZJA 2HWD1 5D8AB 2Q8OA 4E4ZA 4Y22A 3AZXA 1ZREA 2DUOA 3U4XA 3ACLA 1KQRA 2CAVA 1HLCA 3RMXA 1RUD3 4AVVA 2QQPA 2WA3A 1YYNA 1FI2A 3AK0A 4L8QA 3GZUC 1ZRRA 3BOWA 4GMP0 4Q4X2 1C8M1 5BNOA 1VIWB 4C91A 5JSPA 4V1PA 2WKKA 3G7DA 4Q4Y1 1XNDA 3MLLA 2YV8A 2ZGOA 2DTWA 2NPIA 1S2BA 2V09A 1LHUA 4IEZA 2VVEA 1H8VA 4Q8LA 3AZVA 5EYXA 3WD5A 4IV1A 1YRZA 3D5OA 3KLSA 1AXZA 1S0EA 3MPPG 3IPVA 1AYN2 1KDMA 4NO4A 1LEDA 3UJQA 2B8MA 1C1FA 3L2YA 1NG0A 1LENA 2XBO1 4CDXB 5JPMB 1JYCA 3KM5A 2R063 1OA3A 3PVOA 1PGW1 3V0BB 3I54A 1ZBA3 3JB4C 4KU8A 3UKTA 3VZKA 4YNIA 2NZ9A 4KU7A 2FBEA 3UV9A 3FLRA 4RHV2 3SXWA 2V5YA 1FPN1 3W59A 3TN93 3POSA 2EAKA 3ENRA 4BZ4A 4RQPC 4IERA 4GIQA 1YIPA 3TB0A 3GALA 4RQPB 5I8SA 5CBLA 1AR81 2PHUA 5C6CA 1NA1B 2VG9A 4AI8A 2A70A 4YARA 4P9YA 4IEPA 4DZGA 5BUVA 4R9DA 5DDJ3 4QQ2A 1I5ZA 3APBA 2HEYF 2RS12 5GZEA 2RS11 4AFAA 4LULA 4B29A 3PMSA 1UCXA 1FMD1 1HV1A 4XJAA 4DFSA 5C8CC 1WLCA 4D7SA 4LTAA 4Z92B 1ZZBA 1NCRC 2W08A 3VZNA 4AG4A 5KHKA 5E1RA 3ZXJA 5AFEA 3DPRA 5GZFA 1AL22 3SNMA 4J1XA 3FUQA 4PQ9A 1F5FA 2DUPA 2QKDA 1VBB2 2WIIB 4XBNA 4YGBA 1MR5A 1CX4A 1ZBE2 4EROA 1NZCA 5FOBB 2WSUA 2Q4SA 5AC93 2YUEA 5DG2A 1TMF1 1CESA 4I3PA 1TQ5A 3N4MA 5FDBA 5CFDC 2P3JA 2GDFA 2WNEA 4Q4V2 1MS9A 3DGTA 1BMV1 3TAYA 4AVTA 3B02A 1D4VB 3ZSEA 3ZXKA 1S0FA 4FPHA 2ZGRA 2R6QA 3HT1A 1MS4A 3WINE 2JENA 4DY3A 1E57A 3B9IA 1RUI3 2Z69A 5J36A 1A3KA 2ZHNA 3LZZA 2HEVF 1N1SA 4QPGA 4BCUA 3VBOA 5FLHA 4HSLA 2GNTA 4LHKA 3NJZA 4YG3A 4XXAA 5JIUA 3JQXA 2ZX2A 4YW4A 3DUIA 1BCXA 4HFSA 4Q8KA 4IEUA 1YIFA 4HVOA 1U12A 1YLLA 3VUOA 3E6CC 5ABJB 2CYFA 3AKRA 3IDBB 1B35B 4NWWA 3ZO0B 1VLNA 5T5JA 2UWCA 3TYJA 1UMZA 4WM7A 4YZ4A 1ZBE3 2XKOA 1SLIA 3IDCB 3PNAA 1F5JA 4QMAA 3NV4A 5A32B 4CDWB 4B8EA 4N7IA 3VKMA 3ELNA 5LK5A 1BEV3 2FZ1A 4AGRA 4WVWA 2EALA 2ZX0A 1ZYBA 1RMU2 1QKQA 2GNMA 4YM2A 4EJRA 1PHMA 3VBSC 2XLAA 4RR3A 1ZZ9A 2VOWA 3MW4A 3KGLA 4QHBA 4FP2A 3PLQA 4RHV1 4X6QB 4RS5B 4NHLA 1AR62 4FVVA 1HQNA 2D3RA 1QMJA 4FPGA 5C9AA 2ZHMA 5GLVA 1GKBA 4GB32 1KDKA 3TNQA 5L19A 4G3YC 4IXLA 1R081 1KS4A 1PVC3 1JYIA 2CNAA 3ZXDA 1RUF2 3AP4A 5KWRA 2XJSA 2D6OX 4MUVA 3VHNA 4Q26A 2ZOEB 3TN92 1ND3C 1GANA 4WZFA 1X8MA 4HVRA 2QCSB 4FXGB 3A4UA 1U0AA 2HWF3 1PNGA 3RDIA 3MICA 1FMD3 2VVDA 2VU9A 3AM2A 1PK6B 1TNRA 2A3WA 4RGAA 2VMGA 3UKVA 3VZMA 3I4IA 1ULEA 5KXEA 3C3VA 4GKXA 1HRV3 1QF3A 1UN1A 3ZMNA 1OQDA 3WDXA 2D44A 1R1A2 3JD71 4LBLA 3ZSKA 5DZFA 4Z07A 3AYDA 2AENA 5T50A 2ILMA 1QJU1 2WT1A 3MIBA 4CEWA 4ISQA 2OPKA 3AFGA 4OHVA 4EWAA 4BHPA 2LM3A 2RMU3 3WW3A 1V6OA 2WZR3 5JOXA 2JE9A 3B7MA 3AMQA 1VRH3 1LOEA 1GZ9A 4IEXA 2JG8A 4HVQA 5KXCA 5KXDA 4PIZA 2HWD2 1VAKA 4HKWA 3NWKA 3MYXA 2X29A 1D4M3 3RYRA 3USUB 3WOGA 3ZXEA 2D98A 4HMZA 2NMNA 1Q8VA 2CWMA 2XUMA 1QQP1 2XBO3 1V70A 2VPVA 3OJBA 1VBE2 4NOTA 2IXJA 5KBFA 4IV1C 5J7MA 3KZ4C 2ZPXA 1XYNA 2GMPA 5AC92 3AP7A 2PHXA 1SBEA 1OSGA 1SCSA 1EV13 1RL3A 1OQEA 3ES4A 3WDUA 2H6BA 1QJX3 1VBB3 4R9AA 1LODA 5FLIA 1QQP3 5I0SA 1ZRCA 5BNOB 1PGW2 1XRUA 2WFF2 1HRI3 2OW4A 3GHNA 4LA3A 4R8HA 2A71A 5J48A 2XBO2 1DQ0A 4XDQA 5JI9A 3T1LA 5F5QA 1YUDA 3H7YA 3QD6A 4NR1A 4AHZA 4GWNA 5T54A 5JZGC 2PLV3 4PDWC 3WVJA 2Y0IA 3E5QA 4Y1UA 3KS7A 3WV6A 2RS13 1F8VA 3RQ0A 3MGUA 2KA3A 4HPKB 1GLHA 4YSFA 4XF9A 1LRHA 1HIXA 2R071 1IS6A 1R1A3 1AZDA 4N53C 5C4WA 3WDTA 2PTMA 2VULA 3VZOA 1AR83 2D7FA 1IPJA 4YGEA 3VBFC 4S2GA 5JSRA 1VB4A 4YZ5A 1QHDA 4CZSA 1O5LA 4O9GA 5DDJ1 1A78A 2ZGTA 4RS5A 4B7KA 4QT6A 1PK6C 2CL2A 2Z5WA 1ZM1A 4QGMA 2D6PA 3EO6A 1APNA 1H8TC 1TMF3 2R062 5CU1A 3IPVB 2ZBJA 1V6IA 2IXHA 5I0UA 2JD4A 5GZCA 4L97A 1UZZA 4DNYA 1FAYA 2HWB1 3VHPA 3VBRB 3V0BA 1PO22 1W6PA 1AYN3 1NOVA 5JOWA 1PGL1 2R0HA 2XG3A 3B3QE 4S2DA 3FX3A 2ZHKA 2Q1MA 3RRDA 2DVDA 3KMHA 4XE9A 2PAEA 2BTVC 5CFCA 3MF6A 2HKXA 5EZWA 4TZDA 4O9EA 1IZ3A 1GQGA 4M3CB 3ZYGA 2DFCA 1ZZ6A 3ZSJA 3JCIA 4QPIC 2WC2A 1W6MB 5HCAA 1BK1A 5JOZA 1JN2P 1AYM3 2ZMLA 2ZACA 2DU1A 2VUJA 1DG6A 3S6PA 5SV8A 1OMIA 2G9FA 1R093 3HMYA 5TSWA 4WM8B 4A2UA 3J26N 2Z79A 5DZEA 2XJUA 4TSVA 3BB6A 4JTOA 3NV3A 4RHV3 5SV5A 3OF1A 3NKTA 2UWBA 3ILFA 2RR12 3VHRA 3EQEA 4E2SA 1QOOA 3SLIA 4ZKTB 4AHWA 1JUHA 2I07B 2RS32 2DTYA 1L3JA 5A3LA 3PTYA 1PO13 4B3NA 2WT0A 4BQ1A 1ENQA 3M4FA 5AVPA 1G8WA 1IKQA 1H4GA 2LALA 4PLOA 3O0WA 3KGZA 4IEVA 4NHKA 3G6JB 1JW6A 1XNKA 1WCKA 3VBRA 2WWSA 3AP9A 1C1LA 1C5HA 3PJQA 4UBHA 4XMAA 1OD5A 1W6NB 1RUI2 4D7TA 2ZGPA 1NE4A 1MEC3 3AKTA 1PMIA 3AKPA 1ZZ7A 4N9HA 1HRV1 3WR0A 3ZX7A 1RB8G 5LRSA 1PVC1 1OPOA 5A33B 1S55A 4R9CA 3RJRA 4ASLA 1DF0A 1PO12 3VBFB 2E53A 1HRV2 3IIAA 4OI0A 3FBYA 4K7JA 4PIYA 5C9AC 2WA4A 2NN8A 1RUD2 1NXMA 4LEJA 1DGRN 3JU9A 3VBOB 4HKOA 3SCFA 4XOGA 2ERFA 1G6NA 2ZTNA 3BOPA 3H0OA 4FOYA 4A7YA 1J3QA 2VY0A 1MS0A 3ZN4A 1HW5A 1YFUA 4PBPA 2EXIA 4I01A 2WNUA 4XQ4A 1PGSA 2VUAA 4XF4A 2ZAAA 4MZUA 4RSUA 5CFCB 5T5OA 2XH6A 1JHNA 2JXAA 1CIWA 1JXNA 3NSTA 3ZFFA 4JAAA 2VNOA 5FFOC 1FOD2 2KM2A 4AF9A 1G9AA 5J09A 2JG9B 3WQ0A 1A8MA 1U5YA 3DV8A 5C33A 2VH9A 3LGRA 2RM22 1N1VA 2ET1A 3KT4A 3TNPB 4JVAA 2K9ZA 4LBQB 5JR7B 3ZIWA 4I0WB 1GNZA 4GA9A 1EYBA 1WW5A 4LBKA 1N3OA 5H9SA 1MQTB 1QNYA 2HWE3 1REEA 3AJZA 4BA6A 1DZQA 4M3CE 1SLLA 1TEIA 4AGVA 5DZGA 1H1AA 1DHKB 3OGGA 5LEJA 1Q5OA 2HWF2 1MS8A 5KC5A 4SLIA 5L7OC 1XQNA 3FMGA 1NYWA 4MGIE 4Y1VA 1PGL2 2CAUA 1KRIA 4E9KA 1QDCA 2ZAHA 1NY72 3GBFA 3LA3A 4W6XA 4CDUC 1D4M1 1Q56A 3GHMA 4WM8A 3MZHA 3H1YA 1YJKA 1T6GC 1R083 2XVGA 1B09A 1CAUA 1H4HA 3VDDB 3VV1A 1AYM2 1Q8QA 3ASIA 2XJRA 4NPRA 3TRSB 2D6LX 4LO4B 3WP5A 5H9PA 2GN7A 3LCPA 1NLRA 2XJPA 1RHI2 2NLRA 4F8AA 3U11A 1UD1A 3N36A 5K0UB 1O3SA 1K5MB 1Z7S2 4HETA 1LOFA 4JCKA 1YI7A 3AB0A 1QJX1 4HANA 3P3NA 3M8LA 4AEDC 3H3ZA 2RS31 2DYCA 4ASMB 4Q0PA 3RPQA 1RINA 1WMEA 2D5FA 2ETEA 1N3QA 3VDDA 2WFF3 2WL1A 1PZ8A 3D8CA 1NE6A 3X29B 4JGZB 3LA2A 4XJ9A 2XLGA 4RL7A 1MQTA 4XF3A 2MEV3 4AEJA 5KHJA 4Q4W3 1WUVA 1MACA 4PCRA 3WCRA 2AREA 3H50A 4RGGA 5LEKA 4HSJA 5DUUA 2B45X 2ZGMA 1D0GA 1FPN3 1MVEA 2FMYA 4CRQA 1H1IA 1RUC2 2VW1A 1RUC1 1H30A 4Q0SA 4R9BA 4FAHA 2ZCWA 1XU2A 2Q5TA 4YW5A 5AC91 1COV2 1AR61 3JZVA 5JOYA 3SHRA 1Y7BA 1NCQC 1CJPA 2ZKLA 4K8FA 5BNQA 4QQHA 3I7DA 3H7JA 3KSCA 4XJZA 4QM8A 4DPNA 1EV11 4S2FA 3KT7A 3AYAA 2LUWA 3RI8A 4BIOA 3THTA 3E6BA 5KHHA 3USUA 4M0HA 4LLFA 3AX4A 2JEMA 4KG8A 1S2KA 2VMHA 1QJX2 4DINB 1S0IA 3CEWA 4K6BA 4AI2A 2SLIA 1WLDA 4ES9A 2DURA 4FPFA 1YO8A 2DCJA 2ZX4A 4XFHA 2X53S 1VBC1 2RR13 2UURA 4LT5A 5CFDB 1A6CA 2XGXA 1U5ZA 1UPSA 1V6NA 2BVVA 2Q1ZB 3AYCA 4FTEA 3C2UA 4A3XA 4RR3C 2GZWA 3ETQA 1W6PB 2I74A 5KHGA 2E6VA 5T55A 1V6JA 4J6GA 3FJSA 2AYHA 2Y26A 2AGSA 3NAPC 5I8YA 2A7AA 2P37A 4CDXA 1AXKA 1FV2A 1N47A 3IN9A 5FPZA 2HWC3 2R30A 3FBMA 4META 3A0KA 3WY6A 3ZYIB 2QUOA 3IMNA 1KXGA 1N3PA 4LBNA 4P5HA 4INDA 4AFBA 1ND2B 1UKRA 4X8NA 5I91A 4Q0QA 2WLPA 1ONAA 5J3UA 4AVAA 2B7YA 1NLSA 4IEYA 4FCAA 2MPFA 3USSA 1BXHA 4FP3A 3ZFGA 1LECA 1WW7A 5GZGA 4P9GA 3MLKA 5BYNA 5IK5A 5ACA1 3HQXA 4PJYA 2D3SA 3TBDA 2PHWA 2XL9A 3AFKA 2NQYA 4CDQC 2A73B 2C5DA 2Z2SB 3OGJA 1F2NA 1VBD3 1XYOA 2QFEA 1SACA 3ZFFC 5CAZA 3IDEA 2PHLA 1IS5A 4FOWA 3ST7A 4CEYC 4AVBA 4GXLA 1PIV3 4YZ1A 1NQJA 4PLMA 4RD7A 2GH8A 2WQ4A 2Q0AA 1W6QA 4AQTA 1GNHA 2RM23 4P9JA 1LOAA 1RUH3 3VZJA 3PVBB 1WD3A 1GV9A 5GLZA 2Q30A 5LRRA 5CG9A 5CG8A 4E2GA 2BWCA 2UY8A 3U10A 1M06G 1QXJA 4M3CF 1X82A 2YHJA 3LA7A 3J8F1 3DPRB 5L73A 1RUI1 4XFGA 2BNOA 2D93A 5L7OB 2PAKA 2TBVA 3LKJA 1FATA 3M70A 3E5XA 3VBSA 4XIOA 3O7OA 1SLCA 5E89A 5E8AA 4YVWA 2WNVA 2VMIA 1W6OA 3K51A 3HAGA 1HQWA 4MXVA 3I2DA 4XXPA 4OLLA 4XILA 4YM1A 3NL1A 1OFNA 2W0XA 4L2NA 3RS6A 2JX9A 1RUNA 2D5HA 2PN5A 2RS53 3WHTA 1Y9QA 1G9BA 4NVPA 1MZEA 3KQRA 4RS5C 4YGCA 1FX5A 4P14A 2X5IB 5T5PA 4B4QA 3CJIA 3VKFC 4E4SA 4Y20A 1PM7A 1AJOA 4YVWB 1VBE1 1LHNA 1U5IA 4LBOA