1AR81

P1/mahoney poliovirus, mutant p1095s
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
283
structure length
283
Chain Sequence
AATSRDALPNTEASGPTHSKEIPALTAVETGATNPLVPSDTVQTRHVVQHRSRSESSIESFFARGACVTIMTVDNSASTTNKDKLFAVWKITYKDTVQLRRKLEFFTYSRFDMELTFVVTANFTETNNGHALNQVYQIMYVPPGAPVPEKWDDYTWQTSSNPSIFYTYGTAPARISVPYVGISNAYSHFYDGFSKVPLKDQSAALGDSLYGAASLNDFGILAVRVVNDHNPTKVTSKIRVYLKPKHIRVWCPRPPRAVAYYGPGVDYKDGTLTPLSTKDLTTY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords P1/MAHONEY POLIOVIRUS
publication title Structural studies of poliovirus mutants that overcome receptor defects.
pubmed doi rcsb
source organism Human poliovirus 1
total genus 46
structure length 283
sequence length 283
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1997-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ar8100
1PO23 3J8F2 5BNOC 2HWF1 3NAPC 1QJY3 4NWVA 1D4M1 1HQNA 3ZFEC 2RM22 1V9U2 1RB8G 2WFF1 4FTSA 3JD72 3VBOA 1R1A2 1R082 1EV13 2HWD1 3VBUB 2PLV3 2QQPA 5DDJ2 1RUJ2 1VRH3 1FOD1 1RMU1 1RUD2 5D8AA 5C9AC 1PIV2 3IDEA 5ABJC 1RHI1 1ZBA3 1FPN2 2RS13 1PO22 2DF7A 5C8CA 1QJY2 1AL21 3VBOB 2FZ1A 2WZR1 1R091 4SBVA 1EV12 1W39A 5ACA1 3JBG3 2PLV2 5D8AB 4CDXB 4Q4X3 1VRH2 5A32A 1TME3 4YVSA 4GH4C 1ASJ1 1ZBA2 1NCRA 3FBMA 2RS12 5C8CB 1ZBE1 3VBRC 1F2NA 1IHMA 2FZ2A 3VBSC 4RHV3 4AEDA 4RR3C 1NCQB 4GMP0 4CEWC 1SMVA 1HRI1 1AYN3 4CDWC 4CDQA 4RS5A 4AEDC 5CFDC 1RUF3 5K0UA 1VBE3 1RUG3 3JBG2 5A32B 4Q4X2 4YVSB 1TME2 4RQPC 1BBT1 3ZFGA 1NCRB 1QQP3 1NY72 3ZXAC 1PGL2 1B35A 3S6PA 3DPRA 4Q4W1 4RHV2 4GB33 1OOPA 1PO13 5BNNC 1NA1A 5FMOS 1C8M1 4CDQB 4RS5B 3J8F1 4JGZC 1VBC3 1AYN2 5K0UB 1Z7S3 4CDUC 1RUF2 1NA1C 1VBE2 2RM21 1RUG2 2RS53 4IV3C 3JD71 1COV3 1R1A1 1R081 1PGW2 4N43C 3VBFC 1C8NA 4GMP3 1QQP2 1RUJ1 1B35B 5J96B 2HWE3 2WS93 1PVC1 2R073 1AYM1 3DPRB 1PIV1 1OOPB 4GB32 1PO12 1POV1 3JB4C 1PO21 1QJY1 4PDWA 1Z7S2 4LLFA 2RMU3 1VAKA 3CJIC 2GH8A 4CEYC 2RS52 4N53B 1ND2A 1COV2 1RUH3 5BNOA 1EV11 3NAPA 5C4WC 5J98B 2PLV1 4WM7C 3ZFEA 1EAH3 1WCDJ 2HWE2 1VRH1 2WS92 2BBVA 2R072 1H8TC 1OPOA 1M06G 1ZBA1 1E57A 1HRV3 3VBHC 4PDWB 5C9AA 1AR93 5FOJB 1AR83 5ABJA 2BFUL 2RMU2 1ND2B 1NOVA 1VBA3 5BNOB 3NAPB 1RUH2 5JZGC 3ZFEB 1VBD3 2TBVA 3JBG1 1BEV3 1A6CA 1BMV2 1EAH2 4Q4X1 1TME1 2XPJA 1GFF2 1NY71 5C9AB 1HRV2 1PGL1 1FMD3 5ABJB 5AC93 2HWF3 4RHV1 1AR92 1AR82 1POV3 2RS33 4GH4A 1RUE3 2X5IC 1D4M3 1AR73 1AR63 1VBA2 1AYN1 2XBO3 3VBRA 2R061 4CDXC 1RUF1 3VBSA 1VBE1 1VBD2 4RR3A 1BEV2 2VQ0A 1RVF3 4CEWA 1MQTC 4CDWA 1RMU3 5CFDA 1QQP1 2WWSA 1RHI3 4WM8C 2HWC3 4Q4Y3 1NCQC 1K5MC 1FMD2 4RQPA 4GH4B 4QPIC 5AC92 2HWF2 4IV1C 1AL0G 1PO11 3M8LA 2RS32 1RUE2 1D4M2 2R043 1AR72 3VBRB 1AR62 1VBC1 1CD3G 3VBSB 4RR3B 5L7OC 2XBO2 1Z7S1 4CEWB 1VB4A 3ZFFC 1TMF3 2RS51 5BNNA 2IZWA 1RVF2 1COV1 4AEDB 4JGZA 1VBB3 5CFDB 1HXS3 1RMU2 1RUI3 1VB2A 4QPGC 4CDUA 4GMP1 1NG0A 1RHI2 4IV3A 2WS91 2HWC2 4Q4Y2 4RQPB 2R071 1QJU3 4N43A 3VBFA 1CJDA 1V9U1 5A33A 4Z92B 2R042 3ZFGB 4YVWC 5DDJ1 2RMU1 5BNNB 1RUD1 4JGZB 1TMF2 5BNPC 1POV0 1RUH1 2BPA2 4CDUB 1VBB2 1HXS2 1NA1B 1RUI2 1FPN1 1BMV1 4JGYC 3CJIA 1HX6A 1EAH1 4CEYA 4N43B 3VBFB 1QJX3 1QJU2 5A33B 5C4WA 4Q4V3 2GSYA 4WM7A 1HRV1 4FTBA 2HWB3 1ND3C 2ZAHA 4FTEA 5CFCC 3VDDC 3TN93 1H8TA 4N53C 2ZZQA 1AR91 1AR81 5GKAC 1VBA1 3VBHA 2RR13 3CJIB 1VBD1 2RS11 4CEYB 1BEV1 3LOBA 3VBUA 5C4WB 1PVC3 1RUC3 1QJX2 5JZGA 1AYM3 4WM7B 4Q4V2 3VBUC 4EJRA 1H8TB 5LK7B 1FMD1 2HWB2 1C8M2 5AC91 3TN92 2RS31 1RUE1 3VBHB 1AR71 1AR61 4BCUA 2RR12 2XBO1 2MEV3 1MEC3 2X5IA 1RVF1 3VBOC 5JZGB 1PVC2 1RUC2 1AYM2 4CDXA 4Y5Z0 2HWC1 4Q4Y1 1OHFA 2WFF3 5D8AC 1MQTA 1RUG1 2HWD3 2WLPA 2R041 4WM8A 1PGW1 1FOD3 1NCQA 1K5MA 2BUKA 5C8CC 1X33A 4QPIA 2X5IB 2MEV2 4IV1A 1DDLA 1TMF1 1MEC2 1VBB1 1HXS1 1RUI1 5L7OA 4GB31 1AL23 3ZFFA 1MQTB 2WFF2 2WZR3 1QJU1 1R093 4QPGA 4YVSC 4Y4YA 4WM8B 5ACA3 2HWD2 1F8VA 4CDWB 1NCRC 1K5MB 1QJZA 1FOD2 4QPIB 4IV1B 3HAGA 2R063 4NWWA 1ASJ3 2HWE1 1ZBE3 5L7OB 4CDQC 4RS5C 4YVWA 5K0UC 3ZFFB 1AL22 1HRI3 5BNPA 4QPGB 1QJX1 2WZR2 1R092 4Q4V1 3ZFGC 5ACA2 4JGYA 2HWB1 1B35C 1BBT3 3TN91 4IV3B 4FSJA 3DPRC 1OOPC 2R062 4RFT0 1ASJ2 4YVWB 2BFUS 1ND3A 1ZBE2 2RR11 5CFCA 1AUYA 3VDDA 4N53A 4Q4W3 5BNPB 1C8M3 3J8F3 1HRI2 1RUC1 4JGYB 2RM23 1V9U3 3JD73 1R1A3 1R083 5FMOL 1VBC2 1BBT2 5DDJ3 1RUJ3 1ND3B 2ZTNA 1RUD3 5CFCB 3VDDB 1PIV3 4PDWC 3JB8A 2MEV1 1X36A 1FPN3 4Q4W2 1MEC1 2Y26A 1ND2C
chains in the Genus database with same CATH superfamily
1WLCA 4LA3A 3B01A 5F5CA 4I01A 3HEIA 1N47A 2RM22 3N9PA 5FZHA 4XF1A 3URFA 1H2KA 2WFF1 2XVGA 2C24A 3WG3A 1OF4A 2ORXA 1IQDC 2D5FA 3LEKA 4JDNA 1YUDA 1LAJA 1ZNPA 2P6CA 2D5HA 4V2WA 2WBKA 2PLV3 2BQPA 2QQPA 2IWGB 4EN9B 1W03A 3H3ZA 3WNPA 4OMDA 1UN1A 4RD7A 5FYCA 3MGUA 5A70A 1MS0A 2ZX0A 3B94A 1SLIA 2ZCWA 2D6PA 3C7OA 1FPN2 4L11A 2VQTA 3OPZA 1KJRA 3HT1A 1JBCA 4CCDA 1F5JA 2H0VA 2QDNA 4MLOA 1W28A 1LESA 4GJYA 5C8CA 2VW0A 3MHZA 3POGA 5F7UA 1GZWA 2VTXA 4XCBA 3RRDA 1L7LA 1AL21 5FJKA 4Y20A 1J3PA 2ARCA 3K51A 3VBOB 3B7MA 1HQWA 5BXXA 3KZ4C 2C26A 2WZR1 2F4PA 2PHUA 4AGRA 2AUYA 3WY6A 2NMNA 2Q0AA 4SBVA 3S0MA 3I3EA 2BBAA 3LCPA 4XUQA 1RC6A 2VUCA 3VZOA 1RXFA 3I59B 5D8AB 1ENRA 2B42B 1VRH2 1TME3 5LA2A 2QE3A 3LDBA 2XONA 2IFRA 2BDRA 2XKOA 4LTAA 1IQAA 2ZX1A 3HNMA 1ASJ1 4QWNA 4CCLA 3FBMA 2RS12 2VMCA 4K20A 5HCAA 1CJPA 4AK3A 3BALA 5JI9A 1RINA 1F2NA 5F2WA 2ZA9A 1YI9A 2OVUA 3MIDA 3VBSC 4RHV3 4BJ0A 4RR3C 2YU1A 2W1UA 3OB8A 4EYUA 3WX5A 3LD8A 4BK5A 2AC1A 3SXWA 1AYN3 4CDWC 3ZXFA 3AK0A 2WKKA 1GV9A 4HL0A 4RS5A 2XHKA 2GMEA 3FC0A 3HNBM 3TEZA 1OLQA 3J9SA 2ZEXA 3LAGA 1UZYA 3POJA 5IK4A 1IS4A 2QNKA 2YROA 3K46A 5L73A 3FLPA 4DXSA 4HKWA 1GLHA 1GYKA 4RQPC 4P9IA 2BVBA 5G05L 3RDIA 1GNYA 1NCRB 4NAMA 4AEKA 1LOCA 4XJUA 1X50A 1QXJA 2JEMA 3RZHA 5J37A 3BOPA 4I3GA 3R05A 3UJQA 3LKJA 4O7XA 5JIAA 4CTEA 5GZGA 3PMEA 1Y4WA 4W65A 3RJ2X 4D7TA 4SLIA 4GB33 2ZOEB 1E5SA 1OOPA 2DV9A 2WINB 5EV7A 1NE4A 4LHNA 5BNNC 5FMOS 1RITA 1HB3A 1W8FA 2VW2A 2OYZA 3T08A 5K0UB 2PHTA 2ZABA 4YW2A 5JXIA 4MSVA 5A6QA 4IEQA 1YC61 1NA1C 3WCSA 2NZ9A 2C9KA 4XFCA 4FP2A 2VGDA 2TEPA 4A4AA 4DXZA 2GC0A 1VMFA 4BISA 2QQIA 1KQRA 2YG0A 3H9AA 1UYXA 4NHMA 3MV01 4QGNA 4UBHA 5FZIA 1B35B 1D0GA 2B9VA 4EROA 4HVQA 3NL1A 4ZY9A 1CGPA 3H3UA 1AYM1 4YW5A 3RFRA 4XFAA 1SLBA 4FFGA 1PO12 1UD1A 3OGJA 1JYCA 5GZCA 1AXKA 1PO21 3DXTA 3ZN6A 3ZM8A 1UOBA 3C2UA 2FDKA 2CGNA 1QJY1 2P3JA 2WNEA 3OGGA 4FPHA 3TBDA 1POQA 5A3PA 3BIWE 2EAKA 1VAKA 2ZGNA 3I2HA 4UW5A 3D0JA 4K6BA 4PLMA 2ERFA 1SLLA 4LOTA 1FNZA 4ATEA 3B00A 3UESA 5LBBA 1SFPA 5SV5A 4XAEA 1T6GC 3T4HB 2HYKA 5EJ1B 1WCDJ 2XUMA 2OZ6A 1VRBA 1NZCA 1DIWA 1ZZBA 2GMPA 1H8TC 1OPOA 1UW8A 2R072 3FUOA 1SHWB 5F2SA 1QMJA 5FY4A 5LY1A 1ZBA1 1VAVA 2VUAA 1MS4A 3CNAA 3AMPA 3WQ1A 3MIEA 4K8FA 3PLQA 1DGWX 3VBHC 4EZHA 2GN7A 4AQSA 1UPSA 2XL9A 4NMIA 4TWTA 4UYBA 1AR83 5FOJB 3ZSJA 3FFZA 3KVAA 3U37A 2P2KA 2RMU2 1ND2B 4INDA 2OKXA 1IPJA 3B02A 1GBGA 5FLHA 5KXEA 4P9YA 3NAPB 4AWDA 1OLMA 4YW7A 1RUH2 5JSOA 5JZGC 3SEEA 2VL4A 2GU9A 3OUIA 5A7SA 1H1AA 4ZHNA 1OC1A 2QQWA 3IBMA 4J25A 4BE3A 5CA6A 1EAH2 4PQ9A 4N7UA 4R52A 2VY0A 2ZHNA 1UKGA 3MV11 5DG1A 2XPJA 3AX4A 1VALA 1S0GA 3ACGA 1W6OB 2WA3A 4DINB 4PLNA 3H42B 5C9AB 1HRV2 2DTWA 4QXCA 1FMD3 3CBNA 3GZEA 5FZ0A 2FDGA 1O91A 3CL1A 1YIPA 1AR92 2RS33 5AVAA 3B93A 1TG7A 2GP3A 1D4M3 2VTXJ 5IUQA 2CV6A 2WNOA 1X9TA 1XE7A 4XETA 3UL2A 1T2XA 3IB3A 1ZRIA 4P5HA 1VR3A 2BWAA 1BVVA 4XAAA 5FIXA 1RUF1 3SITA 3VBSA 1VBE1 4AHWA 4CCEA 4RR3A 5JWPA 1V6LA 2RVAA 4V2VA 4CCNA 1BEV2 3WQ0A 2VQ0A 5A3MA 3CIHA 2DTYA 1JYNA 4B3NA 1A34A 2RE9A 4CDWA 4QQOA 3T2OA 2J42A 1QQP1 4IGQA 1QOSA 2Y0IA 4WM8C 1K5MC 2VG9A 3E1F1 2A1XA 2A3YA 5FZ8A 3WZ1A 3MI8A 4RQPA 5I0DA 2VQAA 4GH4B 4TLFA 3AZZA 4IE5A 1XNAA 4IV1C 3VLBB 5KBFA 1AL0G 2YB7A 2FD8A 2LW8A 3VZNA 5HBAA 5F32A 4HBNA 2WIIB 4LNVA 2LM3A 3VBRB 3W59A 1VBC1 5M0TA 4QQ2A 1Z7S1 1Q8PA 2XBO2 4GZ9A 4CCCA 5L7OC 2YY1A 2WSUA 4ZKTB 4HSLA 1KEXA 1HB1A 4LHKA 4CZSA 4HXCA 5FP8A 3USUA 5BNNA 3K3NA 4IE4A 3I3QA 3P5BA 4UWDA 3OCPA 1COV1 1LOFC 3UKTA 5JXHA 1ST8A 1RUI3 4WBBA 2Z5WA 4AL9A 4FAGA 3KSCA 3SKJE 1S2KA 5FXVA 3I2OA 1BYHA 1H4GA 4AVVA 2WS91 1JI6A 2RDRA 3NJYA 2Y38A 1O5LA 1OQDA 5FFOC 3RVHA 5KR7A 5FWJA 3A7QA 1GR3A 4CYDA 4Z92B 2JDNA 2X29A 5F37A 1P8JA 4YVWC 5CG9A 2CTVA 4H14A 2EXKA 1KFUL 5C33A 3K4ZA 1WD3A 4ITCA 4HG6B 4CDUB 2WO2A 3POEA 4NE9A 4DY3A 3U1XA 3ZYPA 4CP9B 1HN1A 5IVVA 2QVSB 1LOGA 4COVA 4I0WB 1SDWA 4RGAA 1QOTA 1I6XA 5A7WB 1LGCA 1O3RA 1H9PA 5FO9B 1VE0A 5FZ7A 4OLLA 1QJU2 2W0XA 1O8PA 1OT5A 2GSYA 2H0BA 3MICA 1IG3A 2V73A 4A44A 3O1OA 1C1FA 5K9YA 3SEPA 4B1MA 2HWB3 2Q8CA 5CFCC 4AW7A 1H8TA 4LIVA 4OHXA 2VBDA 4XMAA 2PA7A 4JX0A 1DQ6A 2VPVA 1DBNA 5BYNA 3VBHA 4AHZA 1VBD1 2GNTA 3PVNA 1PM7A 1PZ9A 3NJVA 5H9PA 3V64A 5IK5A 2D6KA 4CRQA 2A6ZA 1OPMA 1YFYA 4D6RA 2AR6A 1GZCA 2DDUA 3VBUA 1UXXX 1RUOA 1BVP1 2VBBA 3HQXA 1QJX2 1DQ0A 3GYDA 5JZGA 4JDOA 3K2OA 4TLGA 4WVMA 4XBQA 5BPXA 4BWOA 5LW9A 5A1FA 2ZHMA 2QDRA 4HFSA 4RGKA 4CUGA 3I2GA 5DUVA 1W6MB 1PNGA 2W68A 2DCZA 3C7HA 4QDQA 3AFKA 5FPAA 1XNDA 3TN92 3UGHA 3GZTB 3ROUA 3V0BA 1O4ZA 4DRRA 5C6CA 4M4RA 5ISLA 1AR71 2XLFA 2RR12 4Q1PA 5DQ0A 3GCWA 4BK4A 1C1LA 2OW4A 1X82A 3ILFA 1YLLA 3UT0A 2AGSA 1REEA 2HEWF 4IEZA 4XQWA 1WWYA 4JKKA 2V72A 3VHRA 3KCYA 4N7IA 3VBOC 2EXHA 2CGPA 4UOJA 3ZYFA 1XJAA 1AYM2 1HV1A 2C9AA 2VZVA 4U2AA 4Y5Z0 4BHPA 4Q4Y1 4XMIA 3MW2A 1H1MA 3FHQA 5D8AC 3WF0A 3H1WA 4B1LA 2VZQA 5FP3A 1XSRA 4MVTA 5LA1A 2HWD3 3SCHA 2R041 4WM8A 2PHLA 3WDTA 1V0AA 1K5MA 1EPWA 3OGSA 5JMCA 2ZGQA 5A3LA 2MEV2 4IV1A 3GZAA 2PAMA 5E16A 4EWEA 1UNBA 1TMF1 4P9LA 2JD9A 1L7QA 2C0ZA 2OT7A 2WT1A 3CZUA 3I7DA 3RMYA 1VBB1 5EHDA 1HXS1 1CAXB 5L7OA 2AENA 1B09A 3ZSMA 1XYPA 3VN4A 2GNMA 3PU3A 1DGWA 3OYWB 4QKFA 1JW6A 1LOFA 2D98A 5DMYA 3HVDA 4BXFA 3SCGA 1V6JA 2R49A 3POFA 4BB3A 1O8SA 1HW5A 1UY2A 5FMCA 3CDZB 4CDWB 3NMBA 1NCRC 1QJZA 3KHCA 1JHJA 2IXIA 4Q1RA 1XSQA 2CAVA 4BMEA 2ARBA 1FOD2 3R4UA 4QPIB 4CPBA 5IVFA 5FPBA 2ETEA 3LDKA 2PTMA 3CKHA 4PIYA 1CIYA 5FZ4A 2HWE1 1PM4A 3AVSA 1ZBE3 1GUIA 4YLZA 4S2FA 1W05A 1LHVA 2BNNA 4YVWA 1MS9A 2RJKA 5K0UC 3C3VA 2WNUB 3NNMA 3T2PA 4Q0SA 2DVFA 3U10A 4QPGB 1G6NA 1F4HA 1IS6A 1HDKA 1R092 4LBNA 4Q4V1 4XJWA 3CLPA 1NT0A 2O8OA 4FPLA 4M0HA 3OBAA 4URAA 3HPNA 2CHHA 1CIWA 2VM9A 3KV5A 1B35C 4BYYA 2OUHA 4TYSA 4COZA 3ZSKA 4JTOA 3IMNA 3LOIA 4E2QA 3I97A 3T3YA 4FSJA 5C3SA 5FWEA 4DZGA 2VO5A 5DG2A 4QQPA 4YSFA 2BFUS 2W39A 4ZPIA 1MS3A 3KT1A 3MLLA 1WW6A 3N7MA 1LHWA 4GWJA 1AUYA 4BQ2A 5CFCA 4RA0A 1DZTA 1S0FA 1UCXA 4E4SA 2ATFA 3WG4A 1H6YA 4KBZA 4FQZA 5BNPB 1ONAA 3U07A 3AKQA 1HRI2 2BV4A 2ZHKA 5B4NA 1J58A 4MGSA 1WA6X 4XBLA 4AI1A 5BUVA 4JC1A 2RM23 4MGYE 3AJYA 2HBTA 1YQ5A 2SBAA 3HOBA 5LZ6A 3WLUA 3MIGA 1PGSA 4FVVA 1VBC2 1BBT2 2J1AA 2MPFA 3WUCA 1H0BA 3NQHA 4H2AA 5IWFA 1ND3B 4OVEA 1CAUA 2YPDA 4LKSA 4QX5A 1TNRA 2VZUA 3S57A 3MUZ1 1YFUA 3U11A 2JICA 2ZX2A 4P5YA 1JU3A 2D93A 2WO1A 2Y6LA 1FPN3 4Q4W2 4OULA 4LR4A 3K3OA 2Y26A 5AFEA 4J6GA 4XW3A 1ND2C 3ACHA 1OUXA 1D0HA 2HWF1 3NAPC 3OSDA 3ZMNA 1BXHA 4HMZA 4R9DA 4BQYA 2VMHA 4KU7A 4NWVA 5EJ3A 4OI0A 5H9RA 3B3QE 4AHXA 3O14A 3VUOA 1GWMA 3KGZA 3ZIXA 1NAEA 3ZR5A 5JPNB 2DVGA 3NRUA 3JD72 1WGPA 3VBOA 1R1A2 1R082 2ET7A 3ZOIA 4EE2A 1R64A 3MBWA 1SBEA 1LEDA 2ADEA 3VBUB 4PBOA 3O5SA 2PQQA 1FV3A 3TWIA 1X7NA 1WA4A 1VRH3 1RMU1 3I59A 5C9AC 5D8AA 3CO2A 4E9KA 2FQPA 1IGOA 3AKTA 1PIV2 4HETA 5HXVA 1RHI1 1X8MA 5FYVA 4S2HA 2RS13 3J7HA 4YGCA 4FFFA 3BKZA 4Y4RA 1E5HA 1W2UA 3POBA 3KV4A 1OA2A 1AX1A 4KGGA 3WP6A 4UBGA 3MZHA 5GLUA 2JE8A 4Q0VA 4IGOA 2OQ6A 2VU9A 2YDEA 2DCJA 4OQ9A 4XF4A 3IAPA 4BZ4A 4CSWA 2FZ1A 1DG6A 1DYOA 1YEWA 4A7ZA 5K8SA 2DFBA 1KS5A 4KH9A 2OPKA 1EV12 4HZFA 3ZXEA 3OUHA 1H2MA 2EALA 5ACA1 1O3SA 1UWWA 4XUOA 4NHYA 3S7IA 4Y1UA 4AHYA 2Y8KA 3N9OA 3RYRA 1WMFA 4FXKB 3O1RA 4GH4C 3V65A 1MS1A 1DQ4A 3CQOA 1RUNA 2I45A 1NCRA 2DBIA 4K3UA 2GNDA 2A3XA 1ENSA 5DAPA 1SACA 3Q8CA 1TE1B 2W91A 3VBRC 2QJVA 2VXRA 3PURA 1H6XA 4AEDA 3GHNA 5KC6A 2RJ2A 2VMIA 3WNNA 5FMBA 2ENRA 3IPVA 1KFXL 4XFIA 4CU8A 3TEWA 3VKFC 3FLRA 1U5ZA 4GIQA 4I0AA 4TXWA 4LBQB 5FY1A 2VD7A 5FY7A 5K0UA 4Z2AA 3JBG2 4IETA 3ELNA 1RYYA 1QWRA 2ZGPA 4Q4X2 1XPWA 3D5OA 4S2GA 1SCSA 4YVSB 4QB6A 3AL6A 3J4UH 4KI5M 2H6CA 4YM0A 3A0KA 5FZDA 3N4MA 2NPIA 3ZXLA 4WVVA 2QQNA 1PGL2 1B35A 1H8VA 1ULOA 4QM9A 4ZZ5A 3WDVA 1CN1A 4XILA 4JHZA 2B5HA 1GOFA 2J1VA 4FPFA 1PO13 4HSJA 4BQXA 5I93A 5IFTA 2VZSA 2JJ6A 4CDQB 3PIGA 3J8F1 3VDAA 5FO8B 1IS3A 3PIJA 4ARXA 1V6IA 2G1MA 4IEVA 5IJRA 4Z1VA 3PTRB 3MIHA 3F2ZA 2A7AA 4CDUC 4DIQA 2YFUA 1GQHA 4L9BA 3D6EA 3OBTA 4FPYA 3SNMA 4CCMA 5JLVA 1O4TA 1UZWA 2AH2A 4XIOA 5LEJA 5FQ0B 3Q8BA 2YU2A 2E26A 4YM2A 4GMP3 1MS5A 3RNSA 4AQTA 4AAPA 3HIFA 1RUJ1 1DYPA 1W99A 3JZVA 2J7MA 2W1SA 5J96B 1MS8A 2QQUA 1PK6B 1S0JA 1N1SA 1C5IA 2R073 3N35A 5LBEA 2GZWA 3HD8B 4HKOA 3L2YA 4JAAA 4V1PA 1W8HA 1MACA 5EPAA 2KA3A 4CXXA 3PUSA 3TRSB 4B29A 3A4UA 2WT2A 4QGMA 3WDUA 4LLFA 2RMU3 2Q8DA 1Y9GA 3FN9A 3O7OA 2GC2A 3NJXA 2RS52 1ND2A 2EIEA 1RUH3 1Z78A 4R4XA 2ZEZA 3NAPA 1YQ2A 3AYEA 1WMDA 4M00A 2PLV1 3B5LB 2BGOA 5F39A 1EAH3 2JDYA 4BPZA 2HWE2 1BKZA 3U4SA 2VW1A 2O1QA 1XNTA 1ULFA 4GALA 1WMEA 4HK8A 4Z8BA 2ZHLA 2YBPA 4XVHA 4I02A 4AGVA 4C91A 4D6SA 1JXNA 1HRV3 2FCTA 2XL7A 1W6OA 1C4RA 1CAVB 1PZ7A 2JE9A 4PDWB 5T50A 5C9AA 3IZOA 4ZZ8A 1JU4A 2C6SA 1CAUB 1AR93 3UKNA 3WXPA 2XOMA 2BFUL 3RG0A 2EVXA 2RDQA 4Q0QA 1W0NA 1Y9MA 4XF9A 1GOGA 4P9XA 4LHLA 4KWKA 4QX2A 4L0PA 4OUMA 4UF0B 1JZ3A 5FYIA 3LWCA 5EWSA 1BEV3 2ES3A 3RS6A 5LWBA 4LK7A 1A6CA 1BMV2 3DKWA 3ZN5A 1F31A 5B4XA 4CCOA 3KS7A 1TME1 4AVAA 1LU1A 2VOXA 5DZEA 1JS9A 1GFF2 3T2TA 3H8RA 1NY71 3GJBA 2PHFA 3DYMA 5F5AA 4ZXEA 1EP0A 2PMWB 1N1YA 3VZKA 4COYA 3M3EA 1I3HA 2OZJA 4DEQA 3T0BA 2GNBA 4P9JA 4FO9A 4RHV1 3GBFA 2WNVC 3THPA 4GH4A 1DCSA 2VCAA 2VZPA 2YFZA 5F8PA 4B4RA 4WVZA 1FYUA 3LFMA 1VBA2 2DWRA 1AYN1 4XUTA 4MHRA 4MXWA 2XBO3 3VBRA 1LOBA 1VMJA 4KGQA 3UK9A 2JDPA 4C1WA 2AEZA 1CPNA 3ATGA 3OF1A 3BB6A 3I3MA 1TEIA 2OX0A 1AXYA 5DAVA 2UWBA 2ZGOA 4BQ1A 3C7EA 1ZREA 2JDHA 3PMSA 3I2IA 1Q3EA 2WWSA 4R9BA 4F3JA 1W2OA 2VCMA 2E53A 4LORA 1KDKA 4J1WA 4D0QA 3OGRA 1NCQC 3BPZA 2D97A 3OJBA 1VLNA 3LA3A 2JDUA 4QPIC 5AC92 3DKQA 5IVEA 2HWF2 1UZVA 3OY8B 1LULA 1O3TA 1RUE2 2FHRA 1FNYA 2XGXA 1AR62 3FFQA 1CD3G 1GZ9A 5A1AA 4C0HA 4QKNA 4XXPA 5FZGA 1QU0A 4DFSA 4YM1A 2B9UA 1N1TA 1ZA4A 2IZWA 2WNUC 4XJZA 3WVJA 5KHKA 1RVF2 5LEKA 3AVRA 1W9WA 4I0BA 4AEDB 5CFDB 4TZDA 4NIGA 2FDHA 1RMU2 3LEMA 1CZSA 4QPGC 5FZ1A 2Q30A 5A7PA 4CDUA 4Q26A 3IPVB 3EO6A 2IVJA 4CP9A 3OBZA 4RYDA 4CP2A 1RHI2 1J84A 2HWC2 5APAA 1KITA 1W3VA 2W95A 3RSJA 1HLCA 5FZCA 5C3QA 1QJU3 4OUSA 5A7WA 4ISRA 3GF6A 1QHDA 4QB1A 1Q8QA 3EBRA 5EXOA 5I8TA 3ACLA 4YGEA 3NNJA 3MFAA 4RGGA 1W8WA 3WHTA 5DDJ1 4DY5A 3AMNA 3W20A 5FYZA 1RUD1 1YQ8A 3U4XA 3ES4A 5BNPC 1POV0 1NLRA 2W52A 4IUGA 4LIUA 4NPRA 3WG1A 4AAXA 1JYTA 1OQEA 3PUIA 3ZX7A 2IXCA 2W08A 1CESA 3BTXA 5FZ9A 2YBSA 1HX6A 4N43B 4A7KA 1QJX3 3LFIA 1XNCA 4ATFA 1PX4A 5A33B 5CAZA 1QIQA 4R9AA 1PX3A 5L36A 1G9AA 5JIUA 4JRLA 1OLRA 3ZPOA 2J1RA 3D82A 4G9SB 3LA2A 4CXWA 4IEUA 2BNMA 1ND3C 3J7LA 3O1PA 4FTEA 5F6KA 5ERLA 3TN93 2QCSB 2ZZQA 1AR81 1BJQA 5JMOA 3FX3A 5GKAC 2W1QA 1W6MA 5FY9A 4DUXA 1QNWA 3AP4A 1WCKA 3LQCA 2C4XA 4LPLA 3USSA 3WG2A 3WF2A 3H50A 3M3CA 2WT0A 1JZ4A 1Q56A 3RZZA 3QH6A 2RR13 2IVIB 2ZS6B 3SC7X 2XWJB 1U5IA 4UW6A 4EN0A 1O5UA 3CJIB 5HI0A 3FE5A 1XU2A 5JR2A 2P3YA 1BK1A 2Q8EA 4I09A 5FOBB 1OFNA 3LOBA 3IDBB 5C4WB 1BHGA 4FPOB 5D1IA 1UF2C 2DVAA 3IKWA 5FUPA 3THDA 1AYM3 4WM7B 2Q8OA 4Y1ZA 4BXSV 2EAAA 3EYPA 3NV4A 2PXJA 2VMGA 3VBUC 1NXD1 3RZJA 4XFBA 2G19A 2EA7A 3AXDA 1FMD1 4LUMA 3I3BA 1ZRRA 2MNGA 5C7GA 3KM5A 3T1LA 5LK7B 2XJSA 2R1BA 3RYPA 4HLTA 2RS31 2JD4A 3P6BA 4MGZE 2VXJA 2DBNA 2KXLA 1NQDA 2R0HA 2X53S 5IATA 4W6YA 1UY1A 2ZACA 2WSVA 2H6BA 1S0BA 1OKQA 3J26N 4D69A 4E2GA 2MEV3 1ZRDA 4IEYA 3SH5A 1DQ5A 2VZTA 2WNVA 5DABA 5T3NA 4MUVA 3AYCA 3GM8A 2FMDA 1AXZA 2OXBA 5FZLA 5J3UA 4Q5OA 1W2AX 2E51A 4QD2A 1LHOA 4PT6A 1RUC2 2ZGTA 3ZPYA 4CU7A 5F5QA 3EXUA 1G9CA 1CAXA 1I1EA 3I2JA 2JG9C 1UYZA 5T5JA 3WD5A 1RJ8A 3NV1A 4Y33A 1UU5A 1JODA 3OYWA 4IQPA 4AFMA 4DOUA 4DUWA 1RUG1 1F5FA 1VIWB 1N1VA 1HQLA 5CKQA 5JVVA 5LBFA 3WW3A 2VECA 3ETQA 2EF6A 4OHYA 3JXSA 1PGW1 5HV4A 1V6OA 1FOD3 1NCQA 1VMHA 1XE0A 3EMRA 4HVOA 1HB4A 4LK6A 5FZMA 1PNFA 1X33A 2HLEA 2VVEA 2P5BA 2ADDA 5EZWA 5A7QA 4QPIA 2X5IB 3R6SA 4A3XA 2PFWA 3ZXJA 1GWKA 1MEC2 4E2SA 4LLOA 1C57A 2XJUA 2G4IA 4AG4A 4XFFA 1RUI1 5JI7A 3PVOA 2Y6JA 4PIXA 3O1UA 5DZGA 3RGBA 1VJ2A 4MXWB 1ZVFA 5J1XA 3MLKA 1MQTB 2QQOA 1GZTA 1XNBA 2WNUA 4W6XA 3VKMA 3ZN4A 2WFF2 3MW3A 2A6WA 2DCYA 1WZXA 3ZSLA 1H4HA 1R093 5T5LA 2RV9A 4QPGA 1H9WA 4YVSC 2QQLA 3CZJA 4OI4A 1W2TA 1QGLA 5FZOB 2BOJA 1OD5A 4META 2Z2SB 3TNPB 2AYHA 4D3WA 4LBJA 2NLRA 3TEYA 2OIIA 2XG3A 3KLSA 3ZDVA 1W9TA 3KF3A 3RI9A 4YG0A 1S55A 2V5YA 5L9BA 3VD4A 4LBQD 2UURA 1DF0A 2GALA 4MYEA 4CDQC 3WP4A 2CGOA 4B4PA 1MZ6A 1ODNA 4GA9A 2D7FA 3MYXA 3VD3A 4FPGA 5FYTA 3GHMA 1IKPA 4HT1T 1AL22 3K4DA 3LPFA 1HRI3 5BNPA 2NQYA 1JOBA 2WZR2 1RJ7A 3A23A 3VKNA 5FXWA 2WFPA 5FMDA 3KV9A 4X6RB 3SH4A 1JHNA 2XH6A 3I54A 2XJTA 5JXJA 5FY8A 5IAVA 2JIGA 2HWB1 1IPSA 2E63A 1BBT3 2WC2A 1PK6C 4IXLA 4XE9A 5TSWA 2JIJA 5A6ZA 3SMHA 2ARXA 1OSGA 4JKLA 4PI2A 4RFT0 1ASJ2 3ZMOA 2ZGRA 3N7JA 3W5MA 4OQ8A 2P34A 4Q29A 1ND3A 4XJ9A 3ES1A 5JR7B 2JB8A 3FL7A 5C71A 4LULA 3VD5A 2DU0A 4MGQA 1HKDA 4Q4W3 3HNYM 1GMMA 3N36A 1LHUA 1W04A 1WLTA 2PHRA 1J83A 1OUSA 1UOGA 2O0OA 2W92A 3EQEA 1C8M3 4P00B 4PI0A 4Y1YA 3JQXA 1ULGA 4M3CB 4XZPA 4CUBA 2D3PA 3HQUA 2AZ5A 3VZJA 2YGLA 3RJRA 1NUKA 4JGYB 4QX7A 5FRAA 4E4DX 3V0AB 3SH3A 2BZDA 3EHKA 4C1XA 2KR2A 3JD73 1R1A3 2F17A 1R083 2NMOA 1OXCA 1ULPA 2VH9A 5FMOL 3OBRA 4OCTA 1UMZA 1YXWA 2DUOA 5BV6A 3WINE 1ZA7A 1FT9A 4XBNA 3N9LA 2ZTNA 2WN2A 5DUWA 3RQ0A 3VDDB 4ASKA 5EP9A 1PIV3 4PDWC 3JB8A 4DO0A 1W8OA 1FATA 2WN3A 3FWEA 3NO8A 5FPLA 2BOIA 4XUPA 1POV3 1VPHA 2YV8A 4JDMA 1SZBA 1UYPA 3LA7A 4K7JA 4LO6B 3CMGA 3MIFA 4PIZA 3TNQA 4AFCA 2WA4A 5FLJA 4CU9A 2QZ2A 4NN0A 4WZFA 5IVCA 5A1LA 1HQNA 1PHMA 2PQSA 1SEFA 3Q8AA 1CPMA 3MDPA 4FTSA 3U0ZA 2XVKA 4XHXA 4GAZA 1CAWB 3VL8A 2VMEA 1EV13 4M4PA 1YJLA 3RZGA 2HWD1 2WL1A 1XU1A 3ZKYA 5DDJ2 2ZGUA 2JG9A 4QKDA 5FZFA 4ET7A 1RUD2 2G9FA 3E5XA 4D7YA 5D21A 1NQJA 1PMHX 4DEVA 3IDEA 4UFJA 1OKOA 2VUJA 4XDQA 5I0SA 3D8CA 1ENXA 1FI2A 5GZFA 2LTNA 1PO22 2DF7A 1AF9A 1W0OA 5LB6A 2VNRA 2CWMA 1QJY2 3T09A 2Y33A 5KHHA 2VCBA 4E27A 1E5RA 1KD7A 3ABZA 3WV6A 5CKNA 4QM8A 2WNVB 3G7DA 3H7YA 4QHBA 3K75B 4L2NA 5JOWA 3JBG3 4OHZA 2BJSA 4YZ1A 1MR5A 2D3SA 4LBQA 1NKGA 4KQ7A 4XC9A 2JE7A 3MFCA 2HYXA 4MXVA 4Q4X3 3CU7A 4IGPA 5IVBA 2PELA 4YVSA 2V5DA 1YRZA 4COWA 1ZBA2 3NW4A 3Q9OA 4XQ4A 3PHMA 4BMBA 1ZBE1 4AZZA 1GNZA 1IHMA 1SFYA 2DCTA 4YZ4A 2DUQA 1NCQB 1Q8OA 3O1TA 3KGLA 4GMP0 1W6PB 2BU9A 4AEJA 2FBEA 5IT6A 5FCCA 2XJQA 1SMVA 4YG6A 3OEAA 2ET1A 3IM0A 5A3WA 3K4AA 4CDQA 1LR5A 4AEDC 5CFDC 4XF3A 2CDOA 4FOWA 4Y1XA 5GZEA 2FDJA 3PJYA 4NR1A 1PMIA 2A6XA 2JENA 2ZGLA 4JQRA 5DAXA 5A32B 2O8QA 1W3XA 2VZ1A 2BERA 2YC0A 4MX3A 3X29B 2RDNA 2CU5A 1IKQA 3I3DA 5EJZB 3CHXA 5FQ0A 2Y60A 3GDBA 3ZYRA 3JCIA 1RL3A 2OS2A 1IOAA 3DYOA 4QXBA 5FO7B 4UFMA 1LTEA 2FCVA 4GKXA 3ZXAC 3ACIA 2XKPA 1US3A 4IEPA 3M7AA 5LASA 2P37A 1PK6A 1H1IA 3L2HA 2BGCA 2W87A 3Q8EA 5AVPA 5KXCA 1O3QA 2B7YA 2ZXQA 2R1DA 4YW6A 5EYYA 4LJHA 1ZRCA 2K0GA 4XF0A 1RUF2 1VBE2 2RM21 1RUG2 5FYYA 3Q8FA 3LSEA 4ES9A 2RS53 1OA3A 2NYYA 1ZZ6A 4AI2A 3VKOA 2DCKA 3N9QA 4WVWA 2WQ4A 3AB0A 1PGW2 1UZZA 4N43C 5FR3A 3MIBA 2VE1A 1C8NA 1QQP2 1OH4A 4H7LA 5HCBA 1HJGA 3N7KA 2HWE3 2W2IA 1YI7A 5T5OA 1PVC1 3AJZA 3DPRB 4LBOA 4MH0E 5KHIA 1S0EA 4CA9A 3L9JT 2XVLA 4M0NA 1V6KA 5IFPA 3WNKA 1JYIA 3POIA 4QDRA 2IXHA 4JRAA 5LBCA 4BA6A 4QAWA 4HONA 1QOOA 1CAVA 4PLOA 4PDWA 1YWKA 1Z7S2 2I74A 3CJIC 1QH7A 3ITQA 4P08A 2A6VA 4CVUA 1Q8VA 3KV6A 5IAXA 1COV2 1JOPA 4JHTA 2A71A 2Q1ZB 5C4WC 5KXDA 5J98B 4NVPA 3E6CC 1SFNA 4WM7C 4UF0A 1DZQA 1D2SA 1GU3A 3POWA 4YW4A 5F3CA 1VRH1 1XC6A 1QXPA 2WS92 3ZSEA 4QU1A 1QDCA 4YGDA 3ON7A 3WHUA 5H9QA 4COUA 1AVBA 3EJKA 1M06G 3LF7A 3VHOA 4KWLA 1H30A 1OVSA 4Q0UA 1K42A 1E57A 2LALA 4AR2A 3UJOA 3BYWA 2VTFA 3MUY1 4GULA 5A7NA 2Z69A 1OURA 3WOGA 1S4CA 2Z4FA 4PHZA 5C5UA 5C3RA 3ZXGA 2E7TA 3NKTA 5LY2A 5A3TA 4IW3A 2J1UA 1JZ2A 1MZ5A 1VBA3 5BNOB 2E32A 3ZR6A 4U36A 3OD4A 4NHLA 3ZFEB 1ZZCA 1ZYBA 3I2FA 1FXZA 2VOTA 3A21A 2XDVA 3M1HA 4W6WA 3K48A 3HWJA 2QKDA 4XXAA 1OH3A 3JUUA 1MZEA 4HN0A 4A7YA 3PNAA 4XFHA 1ZRFA 2BWCA 1WKYA 3BU0A 1UY0A 2GMMA 4LE4A 4UT5A 5FUNA 1F35A 3T0AA 2D44A 4HPKB 2D3RA 3APBA 4KU8A 4ES8A 1JZ5A 1AX2A 1WCUA 1WUVA 3VHPA 5JOXA 5GLZA 4ZS3A 1L7RA 1U12A 4K9SA 5AC93 2JG9B 2HWF3 5ABJB 5IVYA 4HVRA 2VZ3A 4XUNA 3UV9A 3WF3A 1RUE3 2X5IC 4UFLA 3OY8A 1NLQA 3POYA 1AR63 1I5ZA 1QDOA 3LIHA 4L8QA 3SHRA 3AZVA 1QJEA 1YFWA 4NPMA 3BU7A 2R061 2D43A 4LOSA 4CDXC 1FV2A 2BYVE 3T30A 4E4ZA 1VBD2 4JV4A 3BI3A 1GP4A 1RVF3 3FBYA 5FK7A 1UU6A 3W58A 1MQTC 1RMU3 3AZWA 4R8HA 5KWRA 5CFDA 2YPJA 5E6HA 1DGLA 1V70A 2P4EA 2MHFA 2RJLA 5GZDA 3MF9A 1O4YA 3PVBB 1RHI3 2HWC3 5FYHA 3OOXA 1M4WA 3JU9A 4IEOA 5FZKA 1DQ2A 4UFHA 5FZ3A 1LENA 3BGAA 1OI6A 1DFQA 1XYNA 3THCA 1PO11 3M8LA 4YRDA 4QX3A 3RMXA 3ACFA 1DLLA 1AR72 4A6SA 4Y5SA 3AMHA 1GQPA 4LBLA 5I8SA 3U14A 2A6YA 4DS0A 4CEWB 2DVBA 1VB4A 3NNGA 2B8MA 1RGSA 3KT4A 4AVCA 3PUAA 1UAIA 2XWBB 2PN5A 3T1MA 5FLIA 1VB2A 4O9EA 4ONUA 3WF1A 3T0DA 3D4KA 1Q5OA 5LRSA 2E6VA 2XB6C 4GMP1 1APNA 2CYFA 2D6LX 4QPYA 5FBZA 2X10A 1IPKA 4DMIA 1DZRA 1RXGA 5JAXA 4CCKA 3H0OA 4Q4Y2 4YPJA 2IXJA 2R071 5DUXA 4N43A 1LECA 2JG8B 2UY8A 4OHVA 5DN2A 3N7LA 3VD9A 1V9U1 5A33A 3WW4A 1US2A 4FP3A 2I07B 4O61A 3RZLA 2XLGA 5F5IA 5I0TA 1SDDB 2R042 3AZYA 5DAWA 2Y6GA 4M01A 4LEJA 4O65A 2UYAA 3DGTA 3MPBA 1LODA 1PZ8A 2CWSA 2RMU1 2ARAA 5EYXA 2ZPXA 4JGZB 1TMF2 1W8NA 1K12A 1RUH1 2JDZA 4WV8A 1VBB2 5CBLA 3ILRA 4AVBA 2BPA2 3O12A 1HXS2 4MG2A 1D4VB 3AMMA 1S2BA 1K3IA 4JGYC 4HK9A 3CJIA 4BLJA 3I8TA 4I3PA 1EAH1 2DVDA 4W8JA 5FPVA 5L9RA 2D6OX 5BY5A 3I49A 3VBFB 2WABA 5CG8A 3OUJA 3I2KA 5C4WA 5LATA 3ZYBA 3AP6A 1EUUA 2YGMA 3QLQA 5DAQA 4WM7A 2QUOA 1GNHA 2HBUA 1HRV1 4MGIE 1HJFA 2G9ZA 3K77A 1CX1A 4XYXA 4W4ZA 1Q8SA 5FBJA 1JZ7A 2GDFA 2PHDA 2B4KA 3VDDC 4N53C 2HH9A 1AR91 3GNEA 4I2OA 2HJIA 1DYKA 2RHPA 2IFWA 4AEMA 1XQNA 5KC5A 4Q27A 4BIOA 2HKXA 5GLTA 1CWPA 3RPQA 2R7EB 2J1EA 1UU4A 2Y6HA 3HQRA 5EQUA 4K1ZA 4CEYB 1BEV1 4YFWA 1C5HA 5I0UA 2VVFA 2IUWA 4PCRA 1RUC3 1NX9A 5K4LA 4MGKE 4NIDA 4Q4V2 3BTZA 2N7GA 3QH7A 4Y22B 3KCCA 1QNYA 4EJRA 1BCXA 5ANQA 2VCCA 5FP9A 1ULCA 5H9SA 1KGYA 2VBPA 3A22A 4B8EA 1JZ6A 3TOJA 4DXRA 5L9VA 3NNFA 2P3IA 4X8NA 4QQHA 4S2DA 5FY5A 3WDYA 4LO8A 4R4ZA 5FXZA 2XBO1 2JXAA 5FPZA 3R4SA 2XR4A 1VP6A 1MEC3 2X5IA 1C28A 1W6QA 1YQ6A 2XJRA 2ZGMA 3HR9A 4JKMA 2X05A 2CSGA 3ZKUA 4BU2A 2WQ8A 2LRPA 2ZEYA 3AMQA 1PVC2 2QQJA 1DHKB 2R16A 4L92A 4LKEA 3UYJA 2XUEA 4CDXA 4XURA 2YUEA 1OVPA 2L9LA 5FP7A 1SPPB 3S5AA 1LJ7A 2WFF3 5I8YA 1QY4A 2EXJA 3ZXDA 4AYUA 1MQTA 3M3OA 5FZAA 1CZTA 5T5PA 4KL1A 3J7NA 3M2MA 3NV2A 4FAHA 1J1LA 4K40A 1JUHA 3DCQA 4IERA 5FZOA 4D8MA 2O14A 3GCXA 4Z82A 3H1MA 2HEVF 1TZOA 2VOVA 3DL3A 4ZS2A 1DDLA 1OF3A 4GXLA 5E88A 1QF3A 3OG2A 4FOQA 1UX6A 4UI9L 2K9ZA 2OA2A 2XXZA 1YFXA 1AJOA 4XABA 3GBGA 2J1SA 2WO7A 4IE6A 2B45X 4NROA 4UW4A 1LHNA 4GB31 4BOWA 1SLAA 3WF4A 4RN5A 1AL23 3DN7A 4IDZA 4XJAA 5DZFA 3N9MA 3WCRA 2ZAAA 4B7EA 2QQMA 2WZR3 1G9FA 4ZU7A 2WZEA 1QJU1 4RFRB 3AKRA 3KMHA 3AYAA 2EXIA 4M3CE 2B46X 4B4QA 5CADA 3UKVA 1BK0A 3V56A 3JQWA 4ASMB 2AEYA 4H3WA 3ILNA 3HAGA 2G9GA 3NSTA 4OZXA 5JXGA 5T54A 1SBDA 3WT3A 4C0BA 1ASJ3 4EWAA 4EN6B 3VDBA 5J7MA 2J1TA 4NRPA 1UXZA 5FV3A 3O1MA 3AP5A 1XYOA 5FKBA 3W9AA 4W50A 3ZFFB 1LOAA 1STMA 5JPMB 5LCWL 3LDRA 2FDIA 4QXKA 3OTFA 2PYTA 3DUIA 3BOWA 4RL7A 4X8PA 1CX4A 1KDMA 3HN3A 1JH5A 1QJX1 2PAKA 4Z2WA 4Y3OA 4M3CA 1DP0A 1A78A 4JZRA 3ZFGC 5FYUA 1W6NB 5ACA2 4JGYA 4YARA 1UY3A 3V0AA 2DU1A 1X8EA 3N3HA 1Z0HA 2DUPA 3HJRA 5FY0A 3ZDSA 3PL0A 1Y3TA 4C90A 3TN91 2BTVC 4Q8LA 3VZLA 3DPRC 2RDSA 1W0PA 2R062 2VZOA 2YYOA 2P17A 1VAMA 2FCUA 1N3OA 3FMGA 2QQKA 3O0WA 1CVNA 2RR11 2QZ3A 4J1XA 1REFA 3AFGA 3VDDA 4N53A 4XHBA 1YYNA 1A3KA 1AHSA 3WP3A 2YBKA 1GP6A 1GSLA 5C3PA 4YW3A 1GWLA 4DPNA 4PF5A 4Q2FA 1XXNA 2ZMLA 2QBXA 5FZEA 5JUVA 1ULEA 4K1YA 3SLIA 4DXTA 2VNGA 3AXEA 1SCRA 1N3PA 2QTWB 1CAWA 3ZO0B 1FAYA 1ZX5A 2X09A 5DDJ3 2R32A 2P1BA 1UKRA 4CUCA 1V6NA 4E4HA 1N3QA 1RUD3 1WBFA 2SLIA 3E5UA 3PVEA 4CP0A 3KB5A 4HKLA 1S0DA 4QXHA 5GLVA 2MEV1 3P3NA 1SQ4A 1OLME 2AREA 4NO4A 4QGLA 5CIRA 2CNAA 2WRAA 4LT5A 1S0IA 1UMHA 3VB9A 2WLQA 1GOHA 5CB7A 1PO23 3WP5A 5B2GB 1HV0A 2B39A 3J8F2 1JYVA 5BNOC 1QH6A 2WWUA 1QJY3 1SLCA 3NNLA 1D4M1 1QJFA 3ZFEC 1ODMA 1V9U2 1NE6A 1RB8G 5JCTA 4A41A 4FFIA 5FYBA 3BIEA 2PAEA 2VVDA 4D6QA 1T6BX 4AFAA 1RUJ2 3GALA 4YNIA 4XOGA 3G6JB 1FOD1 1AZDA 2EIGA 4CUAA 1DQ1A 2C5DA 5GM0A 2EIBA 4QDSA 5ABJC 1GQGA 1GICA 1ZBA3 5FKCA 3O1SA 3N9NA 3SISA 3QD6A 4LO7A 2JECA 1REDA 3O0VA 3CEWA 2OUJA 3NWKA 3RYKA 5FREA 3ZIWA 2OPWA 3H8XA 4LA2A 3LSDA 4BIFA 3FUQA 1W6PA 1W9SA 3UGGA 1J59A 1R091 4NOTA 3H7JA 1W6QB 1W39A 3MPPG 5LA9A 1F9KA 4FOVA 4EWDA 2JDMA 3H8UA 2PLV2 1BLZA 2R0FA 5FYSA 4KNCA 2XMLA 2JDAA 4CDXB 5A32A 2WO3A 1NYWA 1IZ3A 1CZVA 1TNFA 3WSOA 2K46A 2LUWA 3AZXA 2WZPP 2WJSA 3NVCA 5C8CB 1K45A 2A75A 3H1YA 4QU2A 1XBFA 3PUQA 2BNOA 3MW4A 1GZWB 1OQ1A 4QHZA 2TUNA 4L97A 3LZZA 4LUKA 5CKMA 4Y20B 2FZ2A 1D7PM 4N9HA 1V00A 4JQTA 2PHWA 3I4IA 2Q1MA 4CEWC 3W5NA 3LIGA 1HRI1 1ALYA 2TNFA 3DEMA 4EZ4A 1AX0A 3POSA 2Y0OA 1RUF3 3WNXA 1VBE3 2E33A 3HMYA 1CONA 1RUG3 5BNQA 4N8MA 2ZBJA 5LRRA 4TSVA 5KHJA 1LCLA 3KWVA 1R1ZA 1KRIA 5FXXA 4CE8A 3QCWA 1TME2 1BBT1 4N90A 3E5QA 1G8WA 3WUDA 1JN2P 2V09A 1LRHA 1QQP3 2YC4A 2JG8C 3ZFGA 2X8KA 1ZZ7A 3U75A 1JZ8A 4FOYA 1NY72 1G7YA 1TQ5A 3GBWA 2BEOA 3T2QA 3VL9A 4NAOA 4YZ2A 4D94A 1NZIA 3LB9A 4BH9A 2UWCA 1WCSA 3S6PA 3SQOA 3BPSA 3UNPA 3DPRA 1H2NA 4MHUA 1J3RA 4Q4W1 4RHV2 4AI3A 3MF6A 1A8MA 1LOEA 1NA1A 4NPLA 1C8M1 2VOWA 4RS5B 4XDPA 5FP4A 2W94A 4JGZC 1O59A 1VBC3 1JTZX 1AYN2 4AF9A 5E8AA 3E6DA 5JDBA 1Z7S3 3FHIB 1YJKA 4QKBA 4FPJA 1BZWA 4Y5TA 3CF6E 1O7FA 2P3KA 3ZYJB 1LNSA 4IV3C 4GWIA 3JD71 2XJVA 3ASIA 1COV3 1R1A1 3W21A 1R081 3LGRA 3P1IA 3VBFC 3UGFA 2DFCA 3B69A 2ORZA 4GD4A 2ZKNA 4AVSA 4RSUA 2CAUA 1F15A 1GKBA 1Y7BA 3ST7A 4GQ7A 1MZFA 4DB5A 2WS93 1C3HA 3TB0A 3S30A 1ACCA 4BM8A 1G9BA 1PIV1 2W47A 1WD4A 1OOPB 2YZ4A 3OD0A 5HCFA 4CPBD 1EUTA 3ETPA 3ORJA 4EN8B 1UOFA 2DYCA 5CU1A 3WNOA 4GB32 4DNYA 1POV1 3JB4C 3KHBA 1IG0A 5G04L 5A6XA 4P9GA 4A3ZA 1S0CA 4NHXA 2GC3A 4OI1A 5GLWA 5I91A 2PHXA 3FJSA 3IIIA 1DLCA 2WAOA 3OEBA 3RI8A 2GH8A 1OFSA 1WMXA 2HEYF 4N53B 3B9CA 4CEYC 4KWJA 4QB2A 5CYYA 1KS4A 5BNOA 5KHGA 1EV11 5F3GA 3PUHA 1W2NA 3WQBA 3C7FA 3BTYA 5FYMA 3GGLA 4ZU5A 4X6QB 3ZFEA 2W1WA 1OD3A 4OYUA 4R9CA 2BBVA 3J7MA 1X9PA 3D0SA 1JYWA 4GJZA 4UXAA 3WNMA 2UYBA 4C8DA 3ZVXA 3VDCA 3HBZA 3ZN6B 2UWAA 4YG3A 2WYSA 3WW1A 2ID4A 4HPKA 1UPIA 2UU8A 2Q4SA 4HN1A 3RWKX 3D3AA 3O0XA 5ABJA 3VHNA 3GJAA 3BODA 5C5TA 1QXRA 2Q1FA 2JDKA 1NOVA 4NJ4A 3MO4A 4Y24A 3HBKA 5FTTC 4Q8KA 2ILMA 4NIAA 1W06A 1VBD3 2TBVA 2VNVA 4LKFA 2GC1A 3JBG1 2F6BA 1NXMA 3WEZA 4BQ3A 4CP1A 5A7OA 3RWNA 3ZYHA 3RZKA 2W3JA 3BCWA 4YZ3A 4Q4X1 4GWNA 4QHOA 4XPVA 3WDWA 4AI9A 4NRQA 4ARYA 1J1TA 3PDQA 1L3JA 4XQDA 5HCHA 3BN6A 2WYFA 1PGL1 4ZU4A 4AFDA 3AP7A 4HOOA 4YWAA 2IXKA 4KBBA 5FPUA 5HPOA 1AR82 2IC1A 2ZEWA 4OUEA 2VNOA 1AR73 4NRMA 4FPCA 2WWJA 1JMUB 1XNKA 3GZUC 5C3OA 2P6HA 3B9IA 4AI8A 4NIIA 1XRUA 3ALQA 1UMIA 2C1FA 3FZ3A 1JOJA 4XCAA 5FZ6A 4CEWA 1PMJX 3O1VA 2WZ8A 4LXLA 2XQRA 5FUIA 3AKPA 1PVXA 2YHJA 4CU6A 1RTVA 5C70A 4BQ4A 5F1RA 4P9WA 4K21A 4MZUA 1KXGA 4Q4Y3 3BVCA 4XTMA 1XE8A 4TN7A 2FDFA 1FMD2 2VULA 1LKNA 2ZX4A 4FXGB 2QQVA 2CDPA 2EICA 2BVVA 2JG8A 3T4VA 2RS32 1LGNA 1I5PA 1UL9A 5SV8A 1D4M2 2R043 1J3QA 4PBPA 2XHNA 4MV2A 3ZYGA 3VBSB 1ZM1A 2KD7A 1Y9QA 4RR3B 4B7KA 3WNLA 1WW5A 5F3IA 3ZFFC 5A3NA 1DGRN 1TMF3 2RS51 5F6LB 4JGZA 1VBB3 1HXS3 4LQRA 1QEXA 1WCQA 3NJZA 3DXUA 1NG0A 4IV3A 5T55A 5F9TA 3I2DA 4RQPB 2BRTA 2RG4A 3P3PA 4YW1A 1TVGA 4P14A 3DF0A 3LPGA 4QT6A 3VBFA 1CJDA 4O9GA 4OZOA 3LEIA 4CXYA 5GJ6A 4IESA 5DPNA 1U0AA 1UY4A 2WQZC 2BGPA 3ZFGB 5T52A 2V4AA 1IS5A 1EYBA 2VZRA 3USUB 5BNNB 4M3CF 4KMQA 3WQ7A 5J48A 4QQLA 3PJQA 4ZXKA 3IIAA 1JYXA 4LO5B 1OA4A 2ZX3A 2XLAA 5IVJA 4GKYA 4LMFA 5I0RA 1NA1B 1RUI2 2JX9A 2R30A 5E1RA 1FPN1 4ISQA 2J22A 2Y6FA 4AQ2A 4DQAA 1BMV1 4XEZA 4AFBA 4CEYA 4EV0A 1YO8A 2VJXA 4G4FA 4QX8A 5GALA 3ENRA 4Q4V3 3IAQA 2FMYA 5CNAA 3ZYIB 2ZJCA 2W5FA 4XACA 4A45A 1ZZ9A 1QKQA 5DUUA 3UETA 5CISA 3M70A 3VD7A 4FTBA 3SKVA 1ENQA 2E7QA 2A5ZA 3IDAA 3LEGA 2ZAHA 3R4DB 4LHSA 4Y22A 3AM2A 2NP0A 5FK8A 1MVQA 4MO3M 5K7PA 1D2QA 4XDOA 1URXA 1W9FA 2Y34A 1EY2A 4Q0PA 3TEXA 1VBA1 3WDXA 5CZKA 2YMZA 2OQ7A 4MADA 5CVRA 2BP6A 2JB4A 2R6QA 4KG8A 2ZZJA 1UIKA 4QX0A 3ZLIA 1U5XA 5DXDA 3RZMA 2RS11 1YHFA 1GP5A 1SBFA 3H8OA 1UYYA 2IXLA 4MGTA 4PF1A 4OMCA 4EN7B 1PVC3 4D7SA 5JSRA 1V6MA 3FHAA 5CEHA 2QFEA 5C8WA 2VAUA 3E97A 3AKSA 1G9DA 4FCAA 3AYDA 3HT2A 1H8TB 1SPPA 2HWB2 3IDCB 3IT8A 1C8M2 3PTYA 3TAYA 1LGBA 1YQCA 3M3QA 4QPWA 5AC91 3BTAA 3INAA 1ZZ8A 1KJLA 3WR0A 2I2SA 4FBFA 1JUIA 1RUE1 4H7MA 4OI2A 3VBHB 1MVEA 2WAAA 2YC2A 1AR61 5FDBA 1UOJA 4BCUA 1H2LA 4XZUG 5J09A 4ASLA 2VR4A 2VC9A 4FFHA 3M4FA 1F4AA 2NN8A 2A73B 3QOPA 4H55A 3CJXA 1S2EA 3EB7A 3S5QA 1W90A 4AE2A 5ANNA 4BDVB 1RVF1 4P02B 1DGRA 5JZGB 4NUBA 4FT8A 4OFGA 3ZXKA 5IYYA 5JOZA 1DU3D 2GN3A 2ZGSA 3OPTA 4WVMB 1CQ9A 1K5JA 3QBQA 5F3EA 4NHKA 3KQ4B 4Y26A 2HWC1 1OHFA 3V0BB 4OHWA 2YXSA 1BQPA 1O6UA 2VQUA 3PU8A 2WLPA 3VV1A 4LKDA 4MOAA 4FPEA 4Z07A 3NKGA 2JKXA 1YCIA 2BUKA 4URTA 5C8CC 5FJHA 4F83A 1W8TA 4UFKA 3FLTA 2Z42A 1XB9A 4WZCA 5KXBA 2V4VA 1FX5A 4YYOA 4LO4B 1I9RA 2DURA 5IK7A 5IHRA 3WW2A 2F4LA 2JWPA 5IK8A 2ZKLA 3AL5A 4FQ4A 2NM1A 1ULDA 1XOYA 1UO9A 2VUDA 2Y64A 3NV3A 4QMAA 4QX1A 4YGBA 5FZBA 3KCXA 3KQRA 3ZFFA 4AVTA 1S1AA 1W9YA 4PJYA 2GH2A 1LB2A 5IW0A 2D6MA 4IE7A 1SG3A 1YNAA 1CR7A 3LE0A 4Y4YA 4JCKA 3KD4A 4WM8B 2GAUA 4YZ5A 2HWD2 5ACA3 1F8VA 5JSPA 1K5MB 4A42A 4F8AA 1W6NA 3MEPA 4FPKA 1WLWA 4XTPA 4IE0A 1EPZA 1LU2A 4IV1B 4XJ8A 5LA0A 1LEMA 3DYPA 1RIRA 2R063 2W9XA 1AJKA 4N9IA 4NWWA 4IL7A 2WR9A 2ZGKA 4LBMA 2D6NA 1UIJA 5FAXA 3U78A 3F95A 5L7OB 3A0NA 4FI9A 4ZONA 3VGIA 4RS5C 5JOYA 3ECQA 4LITA 4F7ZA 4YFZA 4XFGA 5EFUA 1W8ZA 1HB2A 1A8DA 1WBLA 4NIHA 4BQ5A 4KWUA 4CCJA 5FPXA 4IEWA 1G86A 3C7GA 3VKLA 1UZ0A 3KF5A 1HN0A 3IN9A 4KG0A 3TYJA 4Y1VA 1OBNA 1E5IA 1HIXA 2ZMKA 5J36A 3MLJA 5A80A 1W8UA 3KT7A 3M3IA 3GXUA 2VMFA 2XQXA 4A2UA 4DRVA 5EIYB 4IV3B 3H3LA 4A6OA 4BQWA 4EQVA 1WLDA 5L19A 1OOPC 4BLIA 3AC0A 2EIDA 3THTA 4K8RB 4YVWB 1WW7A 1ZBE2 4JTNA 4LE3A 1SLTA 4AQ6A 5A3UA 1WW4A 2E31A 2E9QA 1OMIA 2KM2A 3C8XA 4XIKA 5E89A 4AGGA 1YIFA 4AXOA 4ORFA 4YM3A 3J8F3 2A70A 3BUCA 2D40A 3ME2A 2Z79A 4GWMA 1RUC1 2Y6KA 3OPWA 4E8CA 2XJPA 2AACA 2WUHA 4LBKA 1U5YA 4UFIA 1NLSA 4G3YC 4PQQA 2BW8A 1V9U3 3R0RA 3DECA 2UY9A 4UW3A 4JVAA 3KVBA 3IWZA 2A3WA 3QACA 2LROA 1Q43A 1MPXA 2GP5A 4UAPA 2LS6A 4DUVA 4L99A 1UQXA 2VOKA 4HANA 5LK5A 3VZMA 1Y43B 1RUJ3 2JKBA 3IMMA 2Q5TA 2VMDA 2ZMNA 3OGVA 1UX7A 2WDBA 5A6YA 5D2AA 5CFCB 3AP9A 5A3OA 3DV8A 4AI0A 3HN1A 4E8DA 2W46A 3S7EA 3SCFA 4TTGA 3E6BA 2K2SA 4AOCA 4I30A 1X36A 2E7AA 4IEXA 5HV0A 5HXMA 1GANA 2CL2A 1MEC1 5AFBA 2CY6A
chains in the Genus database with same CATH topology
1WLCA 4LA3A 3B01A 4I01A 1N47A 2RM22 4XF1A 3URFA 1H2KA 2WFF1 2XVGA 3WG3A 2D5FA 4JDNA 1YUDA 1ZNPA 2D5HA 2PLV3 2BQPA 2QQPA 2IWGB 4EN9B 3H3ZA 1UN1A 4RD7A 3MGUA 1MS0A 2ZX0A 3B94A 1SLIA 2ZCWA 2D6PA 4L11A 1FPN2 3OPZA 1KJRA 3HT1A 1JBCA 1F5JA 2H0VA 2QDNA 4MLOA 1LESA 5C8CA 2VW0A 1GZWA 3RRDA 1AL21 4Y20A 1J3PA 3VBOB 3K51A 3B7MA 1HQWA 5BXXA 3KZ4C 2WZR1 2F4PA 2PHUA 4AGRA 2AUYA 3WY6A 2NMNA 2Q0AA 4SBVA 3S0MA 3LCPA 3VZOA 1RC6A 3I59B 5D8AB 1ENRA 2B42B 1VRH2 1TME3 2QE3A 4LTAA 2IFRA 2XKOA 1IQAA 2ZX1A 1ASJ1 3FBMA 2RS12 4K20A 5HCAA 1CJPA 4AK3A 3BALA 5JI9A 1RINA 1F2NA 2ZA9A 1YI9A 2OVUA 3MIDA 3VBSC 4RHV3 4RR3C 3WX5A 3SXWA 1AYN3 4CDWC 3ZXFA 3AK0A 2WKKA 1GV9A 4HL0A 4RS5A 2XHKA 2GMEA 3FC0A 1OLQA 3J9SA 3LAGA 1UZYA 5IK4A 1IS4A 2QNKA 2YROA 5L73A 3FLPA 4HKWA 1GLHA 1GYKA 4RQPC 4P9IA 2BVBA 3RDIA 1NCRB 4AEKA 1LOCA 4XJUA 1X50A 1QXJA 2JEMA 5J37A 3BOPA 4I3GA 3R05A 3UJQA 3LKJA 4CTEA 5JIAA 5GZGA 3PMEA 4W65A 3RJ2X 4D7TA 4SLIA 4GB33 2ZOEB 1OOPA 2DV9A 2WINB 5EV7A 1NE4A 4LHNA 5BNNC 5FMOS 1RITA 2VW2A 2OYZA 5K0UB 2PHTA 2ZABA 4YW2A 4MSVA 4IEQA 1NA1C 3WCSA 2NZ9A 4XFCA 4FP2A 2VGDA 2TEPA 4DXZA 2GC0A 1KQRA 3H9AA 4NHMA 4QGNA 4UBHA 1B35B 1D0GA 4EROA 4HVQA 3NL1A 1CGPA 3H3UA 1AYM1 4YW5A 4XFAA 1SLBA 1PO12 1UD1A 3OGJA 1JYCA 5GZCA 1AXKA 1PO21 3ZN6A 3C2UA 2CGNA 1QJY1 2P3JA 2WNEA 3OGGA 4FPHA 3TBDA 3BIWE 2EAKA 1VAKA 2ZGNA 4UW5A 3D0JA 4K6BA 4PLMA 2ERFA 1SLLA 1FNZA 4ATEA 3B00A 5SV5A 1T6GC 2HYKA 1WCDJ 2XUMA 2OZ6A 1NZCA 1DIWA 1ZZBA 2GMPA 1H8TC 1OPOA 1UW8A 2R072 3FUOA 1QMJA 1ZBA1 1VAVA 2VUAA 1MS4A 3CNAA 3AMPA 3WQ1A 3MIEA 4K8FA 3PLQA 1DGWX 3VBHC 2GN7A 4AQSA 1UPSA 2XL9A 4TWTA 5FOJB 1AR83 3ZSJA 3FFZA 2P2KA 2RMU2 1ND2B 4INDA 1IPJA 3B02A 1GBGA 5FLHA 5KXEA 4P9YA 3NAPB 4AWDA 1RUH2 5JSOA 5JZGC 2GU9A 1H1AA 3IBMA 4BE3A 5CA6A 1EAH2 4PQ9A 4N7UA 4R52A 2VY0A 2ZHNA 1UKGA 2XPJA 5DG1A 3AX4A 1VALA 1S0GA 1W6OB 2WA3A 4DINB 4PLNA 5C9AB 1HRV2 2DTWA 1FMD3 1O91A 3CL1A 1YIPA 1AR92 2RS33 5AVAA 3B93A 1D4M3 5IUQA 2CV6A 4XETA 1XE7A 3UL2A 3SITA 4P5HA 1VR3A 2BWAA 1BVVA 1RUF1 3VBSA 4AHWA 1VBE1 5JWPA 4RR3A 1V6LA 1BEV2 3WQ0A 2VQ0A 5A3MA 2DTYA 4B3NA 2RE9A 4CDWA 4QQOA 1QQP1 1QOSA 2Y0IA 4WM8C 1K5MC 2VG9A 2A3YA 3WZ1A 3MI8A 4RQPA 2VQAA 4GH4B 4TLFA 3AZZA 5KBFA 4IV1C 3VLBB 1AL0G 5HBAA 4HBNA 2WIIB 4LNVA 2LM3A 3VBRB 3W59A 1VBC1 4QQ2A 1Z7S1 1Q8PA 2XBO2 5L7OC 2YY1A 2WSUA 4ZKTB 4HSLA 4LHKA 4CZSA 3USUA 5BNNA 3OCPA 1COV1 1LOFC 3UKTA 1RUI3 4WBBA 2Z5WA 4FAGA 3KSCA 1S2KA 1BYHA 1H4GA 4AVVA 2WS91 5FFOC 2Y38A 1O5LA 1OQDA 4CYDA 1GR3A 4Z92B 2X29A 4YVWC 5CG9A 2CTVA 4H14A 2EXKA 1KFUL 5C33A 1WD3A 4ITCA 4CDUB 4DY3A 3ZYPA 2QVSB 1LOGA 4COVA 4I0WB 1SDWA 4RGAA 1QOTA 1I6XA 1LGCA 1O3RA 1H9PA 5FO9B 4OLLA 1QJU2 2W0XA 2GSYA 2H0BA 3MICA 2V73A 1C1FA 5K9YA 2HWB3 5CFCC 4AW7A 1H8TA 4OHXA 4XMAA 2PA7A 1DQ6A 2VPVA 1DBNA 5BYNA 3VBHA 4AHZA 1VBD1 2GNTA 3PVNA 1PM7A 1PZ9A 5H9PA 3V64A 5IK5A 2D6KA 4CRQA 2A6ZA 1OPMA 1YFYA 2AR6A 1GZCA 3VBUA 1RUOA 1BVP1 3HQXA 1QJX2 1DQ0A 3GYDA 5JZGA 4JDOA 4WVMA 4XBQA 5BPXA 4BWOA 2ZHMA 2QDRA 4HFSA 5DUVA 1W6MB 1PNGA 2W68A 2DCZA 3TN92 3V0BA 3AFKA 1XNDA 3GZTB 3ROUA 1O4ZA 4DRRA 5C6CA 1AR71 2XLFA 2RR12 4Q1PA 1C1LA 2OW4A 1X82A 3ILFA 1YLLA 2AGSA 1REEA 2HEWF 4IEZA 4XQWA 3VHRA 3KCYA 4N7IA 3VBOC 2EXHA 2CGPA 1AYM2 1HV1A 2C9AA 4U2AA 4Y5Z0 4BHPA 4Q4Y1 4XMIA 3MW2A 1H1MA 5D8AC 3H1WA 4MVTA 2HWD3 3SCHA 2R041 4WM8A 2PHLA 3WDTA 1K5MA 1EPWA 5JMCA 2ZGQA 5A3LA 2MEV2 4IV1A 3GZAA 2PAMA 5E16A 4EWEA 1TMF1 4P9LA 2WT1A 2C0ZA 3I7DA 3RMYA 1VBB1 1HXS1 1CAXB 5L7OA 2AENA 1B09A 3ZSMA 1XYPA 3VN4A 2GNMA 1DGWA 3OYWB 1JW6A 1LOFA 2D98A 3SCGA 1V6JA 2R49A 1HW5A 4CDWB 1NCRC 1QJZA 4Q1RA 2IXIA 2CAVA 4BMEA 2ARBA 1FOD2 3R4UA 4QPIB 2ETEA 2PTMA 4PIYA 2HWE1 1ZBE3 4YLZA 4S2FA 2BNNA 1LHVA 4YVWA 1MS9A 2RJKA 5K0UC 3C3VA 2WNUB 4Q0SA 2DVFA 3U10A 4QPGB 1G6NA 1IS6A 1HDKA 1R092 4LBNA 4Q4V1 4XJWA 3CLPA 2O8OA 4FPLA 4M0HA 1CIWA 4BYYA 1B35C 2OUHA 4TYSA 4COZA 3ZSKA 4JTOA 3IMNA 3LOIA 4E2QA 4FSJA 4DZGA 5DG2A 4QQPA 4YSFA 2BFUS 2W39A 1MS3A 3KT1A 3MLLA 1WW6A 3N7MA 1LHWA 5CFCA 1AUYA 4RA0A 1DZTA 1S0FA 1UCXA 4E4SA 2ATFA 3WG4A 4FQZA 5BNPB 1ONAA 3U07A 3AKQA 1HRI2 2ZHKA 1J58A 4XBLA 4AI1A 5BUVA 4JC1A 2RM23 4MGYE 3AJYA 2SBAA 3WLUA 3MIGA 1PGSA 4FVVA 1VBC2 1BBT2 2MPFA 3WUCA 1H0BA 1ND3B 4OVEA 1CAUA 4QX5A 1TNRA 1YFUA 3U11A 2JICA 2ZX2A 3VZNA 2D93A 1FPN3 4Q4W2 4OULA 4LR4A 5AFEA 2Y26A 4J6GA 4XW3A 1ND2C 1D0HA 2HWF1 3NAPC 3ZMNA 1BXHA 4HMZA 4R9DA 2VMHA 4KU7A 4NWVA 5EJ3A 4OI0A 5H9RA 3B3QE 4AHXA 3O14A 3VUOA 3KGZA 3ZIXA 5JPNB 2DVGA 3JD72 1WGPA 3VBOA 1R1A2 1R082 2ET7A 1SBEA 1LEDA 3VBUB 4PBOA 3O5SA 2PQQA 1FV3A 3TWIA 1X7NA 1WA4A 1VRH3 1RMU1 3I59A 5C9AC 5D8AA 3CO2A 4E9KA 2FQPA 1IGOA 3AKTA 1PIV2 4HETA 5HXVA 1RHI1 1X8MA 4S2HA 2RS13 4YGCA 1W2UA 4KGGA 1OA2A 1AX1A 3WP6A 3MZHA 4UBGA 5GLUA 4Q0VA 2VU9A 2YDEA 2DCJA 4XF4A 4BZ4A 2FZ1A 1DG6A 4A7ZA 5K8SA 2DFBA 1KS5A 4KH9A 2OPKA 1EV12 4HZFA 3ZXEA 1H2MA 2EALA 5ACA1 1O3SA 3S7IA 4Y1UA 4AHYA 3RYRA 1WMFA 4FXKB 4GH4C 3V65A 1MS1A 1DQ4A 1RUNA 2I45A 1NCRA 4K3UA 2GNDA 2A3XA 1ENSA 1SACA 1TE1B 3VBRC 2QJVA 2VXRA 4AEDA 3GHNA 5KC6A 2VMIA 2ENRA 3IPVA 1KFXL 4XFIA 3VKFC 3FLRA 1U5ZA 4GIQA 4I0AA 5K0UA 4LBQB 3JBG2 4IETA 3ELNA 1QWRA 2ZGPA 4Q4X2 4S2GA 3D5OA 4YVSB 1SCSA 3J4UH 2H6CA 4YM0A 3A0KA 3N4MA 2NPIA 3ZXLA 4WVVA 1PGL2 1B35A 1H8VA 4QM9A 3WDVA 1CN1A 4XILA 2B5HA 4HSJA 4FPFA 5I93A 1PO13 2JJ6A 4CDQB 5FO8B 3J8F1 1IS3A 1V6IA 4IEVA 4Z1VA 3MIHA 4CDUC 2A7AA 1GQHA 4L9BA 3D6EA 3OBTA 4FPYA 3SNMA 5JLVA 1O4TA 4XIOA 2AH2A 5LEJA 5FQ0B 4YM2A 4GMP3 1MS5A 3RNSA 4AQTA 3HIFA 1RUJ1 1DYPA 3JZVA 5J96B 1MS8A 1PK6B 1S0JA 1N1SA 1C5IA 2R073 3N35A 2GZWA 3HD8B 4HKOA 3L2YA 4JAAA 4V1PA 1MACA 2KA3A 3TRSB 4B29A 3A4UA 2WT2A 4QGMA 3WDUA 4LLFA 2RMU3 3O7OA 2GC2A 2RS52 1ND2A 1RUH3 1Z78A 4R4XA 3NAPA 3AYEA 1WMDA 4M00A 2PLV1 3B5LB 1EAH3 4BPZA 2HWE2 1BKZA 2VW1A 2O1QA 1ULFA 4GALA 1WMEA 4HK8A 4Z8BA 2ZHLA 4I02A 4AGVA 4C91A 1JXNA 1HRV3 2XL7A 1W6OA 1C4RA 1CAVB 1PZ7A 2JE9A 4PDWB 5T50A 5C9AA 1CAUB 1AR93 3UKNA 3WXPA 2BFUL 3RG0A 2EVXA 4Q0QA 4XF9A 4P9XA 4LHLA 4KWKA 4OUMA 3LWCA 5EWSA 1BEV3 2ES3A 3RS6A 1A6CA 1BMV2 3DKWA 3ZN5A 1F31A 3KS7A 1TME1 4AVAA 1LU1A 2VOXA 5DZEA 1GFF2 3T2TA 1NY71 2PHFA 1EP0A 1N1YA 3VZKA 4COYA 3M3EA 1I3HA 2OZJA 2GNBA 4P9JA 4FO9A 4RHV1 3GBFA 2WNVC 3THPA 4GH4A 4B4RA 4WVZA 1FYUA 1VBA2 2DWRA 1AYN1 4MXWA 2XBO3 3VBRA 1LOBA 4KGQA 3UK9A 4C1WA 1CPNA 3ATGA 3OF1A 3BB6A 1TEIA 1AXYA 2UWBA 2ZGOA 4BQ1A 1ZREA 3PMSA 4F3JA 1Q3EA 2WWSA 4R9BA 2E53A 1KDKA 4J1WA 1NCQC 3BPZA 2D97A 3OJBA 1VLNA 3LA3A 4QPIC 5AC92 2HWF2 3OY8B 1LULA 1O3TA 1RUE2 2FHRA 1FNYA 2XGXA 1AR62 3FFQA 1CD3G 1GZ9A 4C0HA 4XXPA 1QU0A 4DFSA 4YM1A 2B9UA 2WNUC 1N1TA 1ZA4A 2IZWA 4XJZA 3WVJA 5KHKA 1RVF2 5LEKA 4I0BA 4AEDB 5CFDB 4TZDA 1RMU2 4QPGC 2Q30A 4CDUA 4Q26A 3IPVB 3EO6A 4CP2A 1RHI2 2HWC2 3RSJA 1KITA 1HLCA 1QJU3 4OUSA 4ISRA 3GF6A 1QHDA 1Q8QA 3EBRA 5EXOA 5I8TA 3ACLA 4YGEA 3MFAA 4RGGA 3WHTA 5DDJ1 4DY5A 3AMNA 1RUD1 3U4XA 3ES4A 5BNPC 1POV0 1NLRA 2W52A 4NPRA 3WG1A 1OQEA 3ZX7A 2IXCA 2W08A 1CESA 1HX6A 4N43B 4A7KA 1QJX3 1XNCA 4ATFA 5CAZA 5A33B 5L36A 4R9AA 1G9AA 5JIUA 4JRLA 1OLRA 3D82A 4G9SB 3LA2A 4IEUA 2BNMA 1ND3C 4FTEA 5F6KA 3TN93 2QCSB 2ZZQA 1AR81 1BJQA 3FX3A 5GKAC 1W6MA 1QNWA 3AP4A 1WCKA 3USSA 3WG2A 3H50A 3M3CA 2WT0A 1Q56A 3RZZA 3QH6A 2RR13 2ZS6B 2XWJB 1U5IA 4UW6A 4EN0A 1O5UA 3CJIB 5HI0A 3FE5A 1XU2A 1BK1A 5FOBB 4I09A 1OFNA 3LOBA 3IDBB 5C4WB 4FPOB 5D1IA 1UF2C 2DVAA 3IKWA 1AYM3 4WM7B 2Q8OA 4Y1ZA 2EAAA 3NV4A 2VMGA 3VBUC 1NXD1 4XFBA 2EA7A 3AXDA 1FMD1 4LUMA 5LK7B 1ZRRA 2MNGA 3KM5A 3T1LA 2XJSA 2R1BA 3RYPA 4HLTA 2RS31 2JD4A 4MGZE 2KXLA 1NQDA 2R0HA 2X53S 4W6YA 2ZACA 2WSVA 2H6BA 1S0BA 1OKQA 3J26N 4D69A 4E2GA 2MEV3 1ZRDA 4IEYA 3SH5A 1DQ5A 2WNVA 5T3NA 4MUVA 3AYCA 2FMDA 1AXZA 5J3UA 2E51A 4QD2A 1LHOA 3ZPYA 1RUC2 2ZGTA 5F5QA 3EXUA 1G9CA 1CAXA 1I1EA 2JG9C 5T5JA 3WD5A 1RJ8A 3NV1A 1UU5A 3OYWA 4IQPA 4AFMA 4DOUA 1RUG1 1F5FA 1VIWB 1N1VA 1HQLA 5JVVA 3WW3A 2VECA 3ETQA 2EF6A 4OHYA 1PGW1 1V6OA 1FOD3 1NCQA 4HVOA 1PNFA 1X33A 2VVEA 5EZWA 4QPIA 2X5IB 3R6SA 4A3XA 2PFWA 3ZXJA 1MEC2 4E2SA 4LLOA 1C57A 2XJUA 2G4IA 4AG4A 4XFFA 1RUI1 5JI7A 3PVOA 4PIXA 5DZGA 1VJ2A 4MXWB 1ZVFA 3MLKA 1MQTB 3VKMA 1XNBA 2WNUA 4W6XA 3ZN4A 2WFF2 3MW3A 2A6WA 2DCYA 3ZSLA 1H4HA 1R093 5T5LA 4QPGA 1H9WA 4YVSC 4OI4A 1QGLA 1OD5A 4META 2Z2SB 3TNPB 2AYHA 4D3WA 4LBJA 2NLRA 2OIIA 2XG3A 3KLSA 3RI9A 4YG0A 1S55A 2V5YA 4LBQD 2UURA 1DF0A 2GALA 4MYEA 4CDQC 3WP4A 2CGOA 4B4PA 1MZ6A 4GA9A 2D7FA 3MYXA 4FPGA 3GHMA 1IKPA 4HT1T 1AL22 1HRI3 5BNPA 2NQYA 2WZR2 1RJ7A 3VKNA 2WFPA 4X6RB 3SH4A 1JHNA 2XH6A 3I54A 2XJTA 2HWB1 2E63A 1BBT3 2WC2A 1PK6C 4IXLA 4XE9A 5TSWA 3SMHA 2ARXA 1OSGA 4RFT0 3ZMOA 1ASJ2 2ZGRA 3N7JA 2P34A 4Q29A 1ND3A 4XJ9A 3ES1A 5JR7B 4LULA 2DU0A 1HKDA 4Q4W3 3N36A 1LHUA 1WLTA 2PHRA 2O0OA 4Y1YA 3EQEA 4XZPA 1C8M3 3JQXA 1ULGA 4M3CB 2D3PA 2AZ5A 3VZJA 2YGLA 3RJRA 4JGYB 5FRAA 4E4DX 3V0AB 3SH3A 3EHKA 4C1XA 3JD73 1R1A3 1R083 2NMOA 5FMOL 2VH9A 3OBRA 1UMZA 1YXWA 2DUOA 5BV6A 3WINE 1FT9A 4XBNA 2ZTNA 5DUWA 3RQ0A 3VDDB 1PIV3 4PDWC 3JB8A 1FATA 3FWEA 3NO8A 2YV8A 1POV3 4JDMA 4K7JA 3LA7A 4LO6B 3MIFA 4PIZA 3TNQA 4AFCA 2WA4A 5FLJA 2QZ2A 4NN0A 4WZFA 1HQNA 1PHMA 1SEFA 4FTSA 1CPMA 3MDPA 3U0ZA 2XVKA 4XHXA 3VL8A 1CAWB 1EV13 1YJLA 2HWD1 2WL1A 1XU1A 5DDJ2 2ZGUA 2JG9A 1RUD2 2G9FA 3E5XA 4D7YA 1NQJA 3IDEA 4XDQA 2VUJA 5I0SA 3D8CA 1ENXA 1FI2A 5GZFA 2LTNA 1PO22 2DF7A 1AF9A 1W0OA 2VNRA 2CWMA 1QJY2 5KHHA 4E27A 1KD7A 3WV6A 4QM8A 2WNVB 3G7DA 3H7YA 4QHBA 4L2NA 5JOWA 3JBG3 4OHZA 4YZ1A 1MR5A 2D3SA 4LBQA 4KQ7A 2JE7A 3MFCA 4MXVA 4Q4X3 3CU7A 2PELA 4YVSA 1YRZA 4COWA 1ZBA2 3NW4A 3Q9OA 4XQ4A 3PHMA 4BMBA 1ZBE1 1GNZA 1IHMA 1SFYA 2DCTA 4YZ4A 2DUQA 1NCQB 1Q8OA 3KGLA 4GMP0 1W6PB 4AEJA 5IT6A 2FBEA 5FCCA 2XJQA 1SMVA 4YG6A 2ET1A 3IM0A 4CDQA 1LR5A 4AEDC 5CFDC 4XF3A 4FOWA 4Y1XA 5GZEA 3PJYA 4NR1A 1PMIA 2A6XA 2JENA 2ZGLA 4JQRA 5A32B 2O8QA 3X29B 4MX3A 2YC0A 1IKQA 5FQ0A 3ZYRA 3JCIA 1RL3A 1IOAA 5FO7B 1LTEA 4GKXA 3ZXAC 2XKPA 4IEPA 3M7AA 2P37A 1PK6A 1H1IA 3L2HA 2BGCA 5AVPA 5KXCA 1O3QA 2B7YA 2R1DA 5EYYA 1ZRCA 2K0GA 4XF0A 1RUF2 1VBE2 2RM21 1RUG2 4ES9A 3LSEA 2RS53 1OA3A 2NYYA 1ZZ6A 4AI2A 3VKOA 2DCKA 4WVWA 2WQ4A 3AB0A 1PGW2 1UZZA 4N43C 3MIBA 1C8NA 1QQP2 5HCBA 4H7LA 3N7KA 5T5OA 2HWE3 1YI7A 1PVC1 3AJZA 3DPRB 4LBOA 4MH0E 1S0EA 3L9JT 2XVLA 4M0NA 1V6KA 1JYIA 2IXHA 4JRAA 4BA6A 1QOOA 1CAVA 4PLOA 4PDWA 1YWKA 1Z7S2 2I74A 3CJIC 1QH7A 2A6VA 1Q8VA 1COV2 2A71A 2Q1ZB 5C4WC 5KXDA 5J98B 4NVPA 3E6CC 1SFNA 4WM7C 1DZQA 1D2SA 3POWA 4YW4A 1VRH1 2WS92 1QXPA 3ZSEA 4COUA 4YGDA 1QDCA 3WHUA 5H9QA 1M06G 1AVBA 3EJKA