5F1RA

The transcriptional regulator prfa from listeria monocytogenes in complex with a ring-fused 2-pyridone (c10)
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
236
structure length
229
Chain Sequence
NAQAEEFKKYLETNGIKPKQFHKKELIFNQWDPQEYCIFLYDGITKLTSISENGTIMNLQYYKGAFVIMSGFIDTETSVGYYNLEVISEQATAYVIKINELKELLSKNLTHFFYVFQTLQKQVSYSLAKFNDFSINGKLGSICGQLLILTYVYGKETPDGIKITLDNLTMQELGSSAVSRIISKLKQEKVIVYKNSCFYVQNLDYLKRYAPKLDEWFYLACPATWGKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Attenuating Listeria monocytogenes Virulence by Targeting the Regulatory Protein PrfA.
pubmed doi rcsb
source organism Listeria monocytogenes serovar 1/2a (strain atcc baa-679 / egd-e)
molecule tags Dna binding protein
molecule keywords Listeriolysin regulatory protein
total genus 74
structure length 229
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5f1rA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5f1rA01
4L9TA 1SD5A 1TQMA 2G7HA 2HKXA 3VOEA 1U6GA 1X8EA 3I0TA 3I59A 5HLIA 1UPIA 5JAXA 2FQPA 3S2WA 1ZRCA 4S05A 1YO5C 1C0WA 1RC6A 3H1YA 2IP2A 1BI0A 4F7ZA 4HF2A 4MEXF 1OYYA 1WQ2A 1I6XA 2K0GA 5E18F 2VT3A 2IA0A 4MQ9F 1F4KA 1LEAA 1ZLKA 2E7XA 1S6LA 5I8TA 4IEZA 3E5QA 3I5UA 4HN1A 5FDBA 2RV8A 4Q0VA 1YFYA 4RGRA 2XLAA 4Q29A 4HV6A 2J5PA 4G6DA 4UBHA 5FLXZ 1O3TA 3BZ6A 2Q0AA 1HSJA 3O2PE 3IDCB 2IXHA 1Z91A 3BDDA 4EJUA 4Q0SA 3F3XA 4LLGF 1J58A 2UXXA 1MD0A 3C7JA 5J8FA 1ZVFA 1B59A 3RTRA 3P7NA 5FQ0B 3GZ5A 1RIOH 3KLOA 4XF9A 1YQAA 2OYZA 2HJIA 4G8XA 4PIXA 5C8WA 5E8IA 4XEZA 3D82A 4ZYEA 1RI7A 4BHBA 4R8HA 5A2QZ 3RI4A 2L54A 4MUVA 1XSDA 1Z7UA 2DTRA 3OD0A 3ZMZA 3H1MA 1NE4A 4HVOA 1BI2A 2A69F 3ELNA 3T8TA 3MQ0A 3WGGA 1G3SA 2DW4A 2XV4S 2O1QA 5AVPA 1CAXB 3MYXA 2OZUA 1Q5OA 4YARA 3F72A 1J59A 2FBHA 2HKOA 5H6QA 1ON2A 1OR7A 2DPDA 3SCGA 2Z99A 5HVQC 4IETA 3M3IA 1P4WA 1JXSA 2O03A 4A0YA 4XFAA 2GA2A 4I98B 1KU7A 1TNSA 5LRRA 2FA5A 4XF1A 2XUBA 2KRFA 3FM3A 1P4XA 3E6CC 1XN7A 3NJZA 3ERED 1R00A 3KFWX 4ENKA 4UBGA 1DP7P 4EWAA 1IXCA 4O3MA 2H09A 4HBLA 5D4RA 5KHGA 3S0MA 1FY7A 4UXNA 2XKPA 5FPZA 4MQVA 2HTJA 2PTMA 2QM3A 4A0XA 3BY6A 1DPUA 3L00A 4ZH4F 4NB5A 4E2GA 2FBIA 2ZMEB 4TLFA 3KP6A 1ZGAA 1O57A 1OKRA 1EV7A 2W25A 2Y48A 4GO1A 4AIJA 5D6FA 5IT9K 2EA4A 1HW2A 1H9TA 1GQGA 2LNBA 2P5KA 5DCFA 5JSOA 3TGNA 3UKTA 2V1XA 3H92A 4KWLA 2WTEA 1W7PA 4LK1F 3IDBB 3HRMA 3FXUA 1Z05A 4QLCU 3WTTC 4B29A 4KYWA 2GWRA 3ZMTA 3BU7A 1SD6A 5F64A 4XBFA 1W5SA 1GHCA 2ET1A 4ZU7A 3I64A 3WE3A 4KN7X 3QOPA 1A04A 3DEUA 3QAHA 4LD5A 3I54A 1BN5A 1OI6A 5H6RA 1RGSA 2UYBA 2IA2A 1R7JA 3U10A 1IN5A 4I2OA 4PGGA 1FXZA 4M74A 2PAMA 3O6BB 5FB2A 4A6EA 2DU9A 4WCGA 4I0BA 2YU3A 2LDUA 2XGXA 1UCXA 1QXRA 3EHKA 1QO0D 3HOTA 2OAZA 1LQ1A 1RZ4A 2ZBKA 2D45A 1J0RA 3HUGA 3ECOA 2BNNA 4S04A 1FOKA 3LAGA 2H94A 2HYFA 5ICCA 1STZA 2PA7A 1T39A 1B4AA 3TO7A 3KCCA 3FMQA 4OOIA 3W6KB 2H6BA 1EY2A 5JR3A 3JTHA 4IRIA 1FBQA 1H0MA 1OYIA 4LB6B 5CVRA 3BJOA 4RAYA 2HOEA 4M6XA 2E1NA 4LEJA 4Y17A 2HFHA 4KIBA 2KIMA 1HKTA 3BCWA 5KHHA 1OPCA 3RYPA 4LG0A 2CYYA 1IW7F 2WWYA 4ZU5A 2VE9A 3OF1A 4AD9A 4KFCA 2WC2A 1IN6A 3LA3A 1BC7C 4Z82A 1OYWA 3VODA 3GYHX 1P6RA 1X8MA 2IVMA 2PHLA 2EFNA 3HTSB 5D6EA 4YNIA 3GW2A 5HS9A 4N9HA 3I4PA 3HYIA 4X6RB 4ZYDA 4BIFA 2CAUA 5J7MA 1IRGA 1ZYRF 2EFOA 2RKHA 4AVPA 2CV6A 4O9GA 3HRUA 4CHUA 1KGSA 3SXWA 1RNLA 2O0YA 5AONA 2OBPA 3WE2A 4MTDA 4HA8A 1UHWA 3IWFA 1FP2A 5FCCA 1X82A 1G3TA 1AWCA 1K7AA 5FD5A 5FO5A 5L3GA 1PM7A 3M8EA 3NQOA 2V1DA 1R5HA 2HEOA 5K5QA 2G7UA 1XCVA 1HBXG 1B6AA 4AIHA 3FHZA 2ZNZA 5L3EA 4D7SA 5D8KB 4MGIE 1J2XA 1IPKA 1Y3TA 3ISPA 2EWNA 1FX7A 2M45A 2EV0A 3KP7A 3U1DA 4HMZA 3UKVA 3C18A 4CGZA 1IPJA 4WK8F 3S7IA 3VB2A 3WU1B 3LZZA 3ZMDA 1NE6A 2P6TA 1LVAA 1ONVA 2Q1ZB 2JT1A 2MBFA 1L3JA 4QM9A 1ZZ6A 3CTAA 2O6GE 1VP6A 2QWWA 2IA1A 2CW0F 5T3NA 3P9KA 3GZ6A 4XFIA 1ZZCA 4M6YA 5KHKA 2MLKA 2MC3A 3U2RA 4N9IA 2Z33A 1SFUA 5I91A 3KP4A 3C3WA 1PDNC 4E70A 4IRHA 2ZCWA 1T2KA 3HSEA 3HRSA 3CDHA 2OZ6A 2NNYA 2HDCA 4KICA 2AXLA 2DAOA 4XF0A 4YIFA 1J3RA 1SAXA 4BQAA 1MDMA 4FX0A 3K1MA 1ZZ7A 5LHHA 1HXDA 3MEXA 3SCFA 1E17A 1HKQA 2HWVA 3DPTA 2Z5UA 2CSOA 2F2EA 2UZKA 4B8XA 1SFXA 2FNAA 2K86A 1ZGJA 4NVPA 2K02A 1L3LA 2D5FA 3F8FA 4NQWA 1K79A 1UW8A 1EH7A 6PAXA 2Z9OA 1MZBA 4ENNA 4KWJA 1CX4A 2JRTA 5E8GA 4EJVA 4XFFA 1RUOA 1FNNA 1DDNA 3PQJA 3PLQA 2W84A 2H0VA 3G73A 4LLNA 2UYAA 4FAGA 2DO7A 1JE8A 2MLGA 2ETHA 3NL1A 1R1TA 4UV9A 1VJ2A 3UKNA 5LEJA 2Z3YA 1XE7A 4Q4ZF 4GCVA 3GLXA 1KU2A 1IN4A 1CAVA 3SCHA 3I53A 1CAWB 2XIGA 4ESBA 2QVSB 3J81K 4HVRA 3WTYC 2WV0A 1IAWA 1OMIA 2HYGD 5DUIA 1WSUA 2FOKA 1XGOA 2HZTA 1TQ5A 1YS7A 4PGHA 4MTEA 4DQ2A 2VC1A 1O7FA 3HT2A 3V4GA 1O3RA 1QXJA 2KKOA 4P9FA 3U9GA 4U0YA 3QACA 3QPHA 2XKOA 3OCPA 4BAYA 1WGPA 3KGZA 1S3JA 3CUQC 2BNMA 1UB9A 2MH2A 1UIJA 1YHFA 2QDRA 3F8BA 2Q30A 2DQRA 1IXRC 1BI3A 5E1XA 4MGZE 5KVRA 4ONUA 5FLIA 2RN7A 4JTOA 3OV8A 1ZG5A 2LSOA 2RNJA 3BWGA 2K27A 3KZZA 4HOBA 3F8MA 4BHCA 4WXCA 2IXCA 3MCZA 2VBZA 3SZPA 1UIKA 2GIVA 1SMTA 3V7RA 4L9JA 5BPDA 1YFHA 1Z9CA 3EETA 1ZG3A 4IVNA 5JHUA 2XAGA 5E17F 2IRFG 5ILVA 1KQ0A 3WW3A 3V7SA 5AIQA 1R36A 4QX5A 2GC1A 1U5TB 3W6JB 3FMSA 3EYYA 3LSTA 2NRAC 4FHTA 4RS8A 2MH9A 4HX7A 3ZN1A 3DQVC 1VTNC 2ZKZA 3TOBA 4XLNF 5JVTA 3VFZA 3WTSC 2E9QA 3MAJA 3D0SA 5EEHA 3TOAA 4LULA 5DCMB 3NW4A 1SD4A 1J7KA 1OD5A 2QQ9A 1QQIA 4L11A 4HSLA 4OINF 1U12A 1U2WA 4YYOA 3BOQA 2FE3A 1K6OA 2DFIA 2LF8A 2GQQA 4L0YB 4A12A 4YG2F 4A5NA 1UFMA 1EH6A 2MPFA 4IERA 4OMZA 4IEUA 4G6QA 4GGGA 3E6DA 4EROA 4IEOA 1O7LA 4YFXF 4ESFA 2QZ8A 3COAC 1XDSA 2PQQA 4LG0B 5EZWA 3QU6A 5CVVA 1W4MA 4IEYA 4YFKF 2EV6A 4UV8A 1MJAA 2A6EF 5LRSA 4J1XA 3IBMA 3IRRA 1LJ9A 4WXHA 3R0JA 5JCTA 2OA2A 4HVQA 5CVIA 4LUMA 2I45A 3GX4X 4PZJA 2GC2A 2F5DA 4IXAA 1XGNA 2LF7A 2F5FA 4RB3C 3KZYA 3O14A 3H3UA 4BH9A 3ML6A 2XAFA 4MEYF 2DK5A 4XFGA 3QPTA 1Z1DA 2QQBA 1FBUA 3SMHA 4P9UA 4EWDA 4XFBA 5JSPA 1X3UA 4O5VA 5CADA 2KXLA 4EGZA 4Y13A 1KQ9A 3CF6E 1HW5A 4KMFA 3LOIA 4BHPA 5TRDA 3EBRA 5ILUA 4AWXB 1RL3A 4I7HA 5HDKA 4XETA 1FSHA 2QENA 2UXNA 5E1RA 1JHHA 2PYTA 3WTUC 4KWKA 3HT1A 2XL7A 1PP7U 5ILSA 3JSPA 3H50A 4CO8A 4UNOA 2IJLA 3JAMZ 5BPXA 3B02A 3KEOA 4OU0A 5JSRA 2GH2A 4AQ6A 4EM1A 4KDPA 5HLGA 2PFWA 4M72A 1REPC 2O8QA 2XROA 1W7PB 4IJAA 2L4MA 1BC8C 4LJZF 4L18B 5D5XB 4LTAA 5LBQA 2JPBA 3FM5A 1MJ9A 3C3VA 1XE8A 1FPQA 3WG9A 2CO5A 2B5HA 1IRFA 5K5RA 3U0ZA 4G7OF 2D5HA 4FBFA 2RC4A 1J1LA 4UXAA 5CVUA 4HF0A 1R1UA 1ZN2A 1TQPA 1IUYA 1IF1A 1J3PA 5CU1A 4HZFA 1NZCA 2ADUA 4META 2DK8A 4MGRA 2FXAA 5LGUA 1YWKA 1DUXC 2VBXA 3NEUA 2FF4A 3GFJA 1VR3A 2K9ZA 2O3FA 4XFCA 3BP8A 2NS0A 1O5UA 1ZHFA 4A2UA 1CAXA 2A5YB 5A2QK 4JVAA 2STTA 2QVOA 4HQEA 2A68F 2GXGA 1MGTA 3CUOA 3DPLC 3DXJF 3LQQA 4Q48A 2VT2A 3L9FA 3ES1A 5DD8A 4RGXA 1ZX5A 4G7ZF 2C0ZA 4AQ2A 1KQ8A 3F6VA 1H1MA 3KEQA 2Y0OA 5LGNA 2XASA 2XAJA 4I09A 5D1IA 4WWCA 4GYIA 3KP2A 3FZVA 4KIFA 3T5XA 1U5TA 4BYYA 3DV8A 1G3WA 1TQIA 2PG4A 3F22A 2PLYA 2RQPA 3J80Z 1GQHA 3K1NA 3RIRA 5D5VB 4QMAA 1D8JA 1XMAA 4OIOF 3DN7A 2D93A 1B1BA 2ZKLA 2XL9A 1Z6RA 2MA3A 1LRHA 5DYMA 1YLLA 3TNQA 1DZTA 4B09A 4Q5SF 2QBYA 2R7FA 3I58A 3JZVA 4P9GA 2DPUA 2IT0A 4KA4A 3HTUA 4R52A 2FNPA 4L9VA 3H7JA 4EGYA 3MZHA 3T1BA 1FSEA 4EWEA 2P7VB 4HX4A 1TBXA 5I93A 1WI9A 5KHJA 3VHRA 2AS5F 2FU4A 1SD7A 5LHIA 4RGUA 5ERIA 3ZN0A 1Y0UA 3I59B 1QZZA 2ZXJA 2Q4SA 3MFKA 2NAZA 4J1WA 3VEPA 1T98A 4IEQA 2XRNA 1YW8A 2EB7A 3D0JA 4CDGA 2R3SA 3RDIA 2VECA 2ACJA 4CXFA 3DF8A 3J80K 2XLGA 1FYMA 1W5TA 4OMYA 4E2QA 3V8JA 4HN0A 3WTWC 3J7AO 4M73A 5IT3A 1NXMA 2F5CA 1Q3EA 2BEOA 5ICFA 1WA4A 4U0WA 2EFPA 2A07F 2K7LA 3LAJA 4YFNF 1IXSB 2V1UA 2PMUA 4Y15A 1CAUA 1JUHA 2BE5F 3ST7A 2O8XA 2VXZA 1CAVB 3EYIA 4HV5A 1IN7A 3P9IA 4U0VA 5HLHA 1BJAA 5BY5A 4MH0E 4IEWA 1USSA 3V8LA 1J5YA 5I8YA 2VN2A 3EQLF 1XB4A 4IHTA 2V9VA 1RUNA 3QP5A 2XHKA 3WU0A 3ZMVA 4GULA 2UY9A 2W85A 3EQEA 3GWZA 3L7WA 4QGNA 4UVBA 4D7TA 1Q43A 2K4JA 2CQKA 5J48A 3WGHA 5CYVA 5D5UB 2VBYA 2COMA 2MD5A 3KMHA 5H20A 4JTNA 3M9AA 4A6DA 3R0AA 3ZDSA 5DUKA 2HR3A 3LA2A 3ZQ7A 4QGLA 2HQRA 3GFIA 1USTA 1ZZ9A 3E6MA 3K1PA 5K5OA 2OPKA 3OTFA 1CGPA 3LQRA 1TW2A 2F5EA 1ULYA 4JBAA 4CZZA 2B0LA 1MJBA 2QQAA 3PFIA 4PJYA 1YUDA 3BJAA 1E2XA 3L2HA 2FMYA 3MZYA 3F8NA 2D1HA 2M30A 4PIZA 1HQCA 3F8CA 2EJRA 4KMUX 3H3ZA 4EQQA 3RKXA 3F6OA 3T8RA 3GYDA 1BI1A 3EDPA 1QZYA 3PNAA 1OFNA 5EFUA 4LK0F 3E3VA 1ZNPA 4KUMA 3FE5A 1IZ1A 3WW1A 2EA2A 2D2WA 2UY8A 4QWQA 2CG4A 4U7BA 2QLZA 5F6FA 3CLPA 4GYGA 1O3SA 1R23A 3HSFA 2GC0A 1I5ZA 3RJPA 3M70A 5JR7B 3IL2A 5LEKA 3H1WA 5I0TA 2DBBA 2OQRA 1FC3A 4UVCA 1FI2A 4YRDA 3MDPA 1P2FA 2B9UA 1ZARA 4MV2A 3RPUA 4WXDA 1NYWA 3DFGA 3HOSA 1BBYA 2XAQA 1KU3A 3ULQB 3BJ6A 3WTXC 3CO6C 3TDZC 5LHGA 1Q1HA 2Q2EA 2MNGA 4RB2C 1S8NA 3SXYA 1HW1A 3WODF 2V09A 2QNKA 2GAUA 5I0UA 3GFLA 1YFXA 3CUQB 3JW4A 1GXQA 1S7AA 4IRGA 1CAWA 4L2NA 3LFKA 1BIBA 4ENJA 1TNTA 2BBYA 2IC1A 1X7NA 2KJBA 3DP7A 4FX4A 3U11A 2YX4A 4HLXA 1NHAA 2OD5A 5CLSA 4ZYHA 4P55A 1XCBA 4MNUA 2Y0MA 5LGTA 4MZUA 1FP1D 1RTVA 2P5VA 5D8LB 1W7PD 3GVAA 1XGSA 1H1IA 2ET7A 3GEZA 3MPBA 3WTZA 3K2ZA 5E16A 1V3FA 2M1BA 3SZTA 3GO5A 4MGYE 5FQ0A 5FLJA 3CL1A 3R60A 3KE2A 5BS6A 1L0OC 5L3FA 3OGJA 2Y75A 3E6BA 3IKVA 3HSRA 5E20A 4EV0A 1ODDA 4WF2A 1XDUA 1UCRA 1QNTA 4ZYGA 4IHSA 5HI0A 4OIPF 5EEGA 2ISYA 3RZZA 3GF2A 4CICA 3HQXA 4M9ZA 2YPRA 3CEWA 4EJTA 1QBJA 2YR2A 3KETA 1LEBA 4ZZDA 4L5JA 3E5XA 2VONA 2OZJA 2EV5A 4Z2YA 1JHFA 1KA8A 1QY4A 2QJVA 4XF3A 2ZFWA 5DEQA 2Z2SB 1WLTA 1B9MA 3ETQA 1AOYA 1QGPA 2MHFA 3R61A 3ES4A 2PI0A 3FXQA 4I3PA 4PIYA 1O4TA 3P9CA 3FMRA 3BALA 3HHHA 5HS7A 2GZWA 1IN8A 1XRUA 4XSZF 2YSRA 3E97A 4D0PA 1R22A 3TKYA 4KT5C 4KNYA 2RDPA 3EJKA 3FFQA 3NKTA 3O3KA 3J81Z 1D8KA 1T38A 2CWEA 4EMSA 5HDNA 1F9NA 3K69A 4GXOA 2EAAA 3BPVA 3TDUC 3ZPLA 4G94A 2G9WA 4Q0UA 2VBWA 4FT8A 2FRHA 2EK5A 1ZH5A 4BNCA 3HRTA 2CFXA 1R1VA 3SHFA 3AAFA 2JZYA 3KP3A 2EA7A 2N7GA 3DL3A 3H7YA 2VE8A 1QWRA 2IW5A 2XAHA 4Z07A 2YX7A 1GVJA 1LNWA 2QYOA 4ON0A 4XFHA 5J8CA 4UVAA 2NNNA 3Q9VA 1D3YA 2L01A 4L9NA 1K78A 2X0LA 1J9IA 2OQGA 4TV7A 3R6SA 3LAPA 2RGVA 4HDVA 2STWA 3BROA 2PAEA 1U5TC 3SHRA 4A5MA 3LWFA 3KLNA 5BMZA 4HLYA 1SFNA 2ETEA 4Q0QA 1YFWA 4P5OA 5L3CA 1PUEE 2M8EA 1WWXA 3M1EA 4MGKE 3EUHA 5HOOA 4AVBA 1SMYF 2PQ8A 2O61A 1UD1A 4WBBA 5BOXA 2XLFA 4LA2A 2TDXA 5C6CA 5FD6A 3HIFA 1BOAA 4OIQF 5CJ9A 4WX9A 4O9EA 2P5LC 3I71A 2ESHA 4YIIA 5I0SA 3PQKA 3FX3A 2DLLA 4L5IA 1ZG1A 3BPXA 5DCMA 3ABTA 5KHIA 1FBSA 2CAVA 2EFQA 2ELHA 4HW0A 5CVJA 4JK1X 2BNOA 1YS6A 4EM2A 4G9YA 1P92A 3IIAA 2BYVE 1YG2A 5LLQA 5KBFA 1GXPA 3Q5FA 2M87A 1K78B 2IXLA 3N97A 1LB2A 3D5LA 4ENMA 4ESJA 1H9GA 1XMKA 4LFUA 1QPMA 1R5GA 2W57A 3WW2A 4H0EA 3C1DA 1P4AA 1G3YA 1XSXA 4LMYA 4RB0A 1XGMA 4LLOA 1EYBA 5BQTA 3RPQA 4RGSA 3TO6A 2KIUA 4PDKA 3NSTA 4M71A 3KP5A 1LDKB 4OIRF 2E1CA 4DINB 4HAMA 2B8MA 5HS8A 3ZP5A 2D40A 3I7DA 4HQMA 4N0BA 3H9AA 4R79A 1XSVA 3TQNA 5ICGA 3CLOA 1SQ4A 3CJNA 3MWMA 5E1WA 4K8FA 3FXRA 3KGLA 2PEXA 4M9SA 5HDGA 1LR5A 3IC7A 3QU3A 2ZMEA 3QRFF 1F5TA 2L02A 5JI6A 3BPZA 1PMIA 1TLHB 3N4MA 2VOOA 4XF4A 4Q47A 4H7LA 5J3UA 1DPRA 2DQLA 3IHUA 3RYRA 2ZNYA 4P96A 1V70A 4FAHA 4ZZLA 2XVCA 4EJOA 2GA1A 4A0ZA 5BXXA 3JTGA 2E7WA 2KJCA 4I02A 1I1GA 5K8SA 2R7DA 4KIGA 2GU9A 3RKYA 2DCTA 4WZCA 2H27A 2F4PA 4LLLA 4PCQA 5IT9Z 3LWCA 1U3EM 3K0LA 3H8UA 4U88A 1YYVA 2QUFA 3RKWA 2CGPA 4M9XA 3WGIA 4YSFA 4EVIA 3GUDA 2KIFA 3RNSA 3V8KA 2UWMA 2ISZA 3EO6A 3ZMUA 5I8SA 2DT5A 4K2EA 2D1VA 4JQFA 4HSJA 4RD7A 4HBNA 2W24A 3F23A 4R1HA 1J75A 2V79A 1ZAOA 4I0AA 5TJJA 4BXUA 1CF7B 5FPXA 2ESNA 4XSXF 2P8TA 4ZU4A 1DGRA 4IEVA 1V4RA 1I27A 3G3ZA 5FLXK 1S7OA 1G6NA 1FYLA 4Q0PA 4HYEA 2FMLA 4IF4A 4QGMA 2P17A 2VPVA 4G7HF 1U8RA 1KYWA 1BIAA 3FWEA 3ABUA 2PAKA 2M5WA 1JGSA 1T6SA 2FEZA 4AXOA 2JTVA 5I0RA 4XLPF 4RAZA 1CAUB 2K4BA 2PN6A 2JPCA 2L4AA 3CUQA 2HGCA 4E2SA 5KK1A 2VC0A 3L2CA 2HS5A 2PFBA 4CYDA 1DZRA 5D5WB 2P4WA 3JAMK 2EFWA 5DDGA 5ED4A 4HX8A 3M7GA 3IKTA 5FFXA 4AIKA 3ELKA 4EJWA 1UHMA 3FHIB 2VQAA 3QP6A 3FZ3A 1FT9A 2FBKA 1HKSA 3T0YA 2LKPA 5BUVA 2ZO4A 4DNCA 1HSTA 4O6JA 2BGCA 3V7CA 1F1ZA 1LDJA 4HDUA 4IPAA 3WTVC 5FLHA 3NRVA 4LB5A 3CO2A 1MKMA 1ZRFA 3JSOA 4KU7A 2Z69A 2DI3A 2GXBA 2Q8KA 3SQNA 2HTSA 1EP0A 4I01A 1Z6TA 2PBIA 3REOA 4HF1A 1PP8F 1YLFA 3G7DA 2GC3A 4ORFA 1ZLJA 1T0FA 3ROUA 1YW9A 5D4SA 3LA7A 5JFRA 2RVCA 4MHGA 3E5UA 1LDDA 3NVCA 2PHDA 1ZZBA 4F8AA 4KL1A 4JV4A 2A61A 1D5VA 1FZPB 1U78A 3CO7C 2IXJA 3GBFA 4QM8A 1WRJA 1YFUA 1B9NA 1WKMA 3K9TA 1O5LA 1ZRRA 1BM9A 1KYZA 4RB1A 2P7CB 2NYXA 1FWZA 5J6XA 2PMHA 2A3SA 5FGMA 3GFMA 2QBYB 1DGWA 1TW3A 3FF5A 2VOPA 4NHJA 3HHGA 2BV6A 3KSCA 4X6QB 3WW4A 3R4KA 3ZMSA 2PJPA 4LGWA 1EH8A 1ZRDA 4EM0B 1CF7A 5L3DA 5FFZA 2OA4A 2H6CA 4ETSA 1FYKA 3S7EA 1ZZ8A 4IEXA 1SEFA 3USSA 5DV5A 5L3BA 2IPQX 5DD4A 4KU8A 1SFEA 5E1ZB 3B73A 2V6CA 3DKWA 2HQNA 5K1YA 1I1SA 1ZREA 2FSWA 2J5OA 1FLIA 3GXOA 2C6YA 2OU2A 2EVXA 3M8FA 2ZJ2A 2X4HA 1EPZA 4LA3A 3L09A 3ACLA 2L3DA 3PVBB 4OFGA 1R58A 5F1RA 1O3QA 4WVZA 3IRQA 2WFPA 1XD7A 2A6HF 1TTYA 4ASNA 4HLTA 3RYKA 1S29A 4AVCA 3F21A 5BV6A 2Q0OA 3Q9SA 2IXKA 4UUVA 1MDMB 2FQ3A 4XRFA 3TO9A 1LKNA 4MX3A 2VODA 2QCSB 4AVAA 3OOPA 3ECHA 1YTYA 2ATFA 4IESA 4IEPA 1KU9A 5AIPA 4LUKA 1Y9QA 5ICEA 2P6SA 1G4DA 4OLLA 3TNPB 1YIOA 1YW7A 3FJSA 1ON1A 1J3QA 5BPIA 2JSCA 4U7DA 3CJXA 4UHTA 3IWZA 4KN4X 3SFZA 4QXKA 2IXIA 3BB6A 4L0ZB
chains in the Genus database with same CATH superfamily
2G7HA 4PT6A 3T2TA 2AEYA 5BNOA 2R30A 2VVDA 1C0WA 1NKGA 4AG4A 2V9KA 1BI0A 5DAXA 4S0HB 1WLWA 4MEXF 1JOJA 1T8IA 5H9RA 3LDRA 3UETA 2VT3A 2Q1FA 5CAZA 4AR2A 1AYN1 2WA3A 3PUQA 1N3PA 3H8XA 3D5SC 4YM2A 3E5QA 5FDBA 2RV8A 3RKQA 1PO12 4RGRA 2XLAA 5IOYA 2PHTA 1XPXA 4QDRA 4NR1A 4UBHA 3CQZJ 3BZ6A 1HSJA 2SLIA 2JDMA 2VKDA 2QZ2A 1Z91A 3G6JB 5DAQA 1T0FC 1ASJ1 1LESA 1QQP1 1CZTA 4TWTA 3C7JA 4B3XA 2ICWG 3M8JA 1RIOH 1NX9A 2CWSA 3IAS2 4FTHA 4PSXA 1R4NB 1ULGA 2R32A 1UO9A 2FUG2 3PFYA 1RHI2 5C33A 4XEZA 3AP5A 4BHBA 4ZYEA 3TN92 5GP9A 2VAUA 1XU1A 1XSDA 4GJYA 2BZDA 2JK3A 2HYXA 3OD0A 5J37A 4N53B 3H1MA 2D5VA 3ELNA 5A3WA 3WGGA 1GVDA 3BTZA 1G3SA 4HG6B 4YARA 1J59A 4V2FA 1ON2A 2YYOA 1OR7A 3ZOIA 2HYKA 1YJLA 5HVQC 1US3A 4IETA 3U75A 5FZ0A 2BVVA 1I3QJ 1HRV1 5B3SH 4G6TB 2YZ4A 4XF1A 1LPQA 2LS6A 4QXCA 3OYKA 4BXSV 2CV0A 4MXWB 3NJZA 4ANJA 4XDOA 2LY1A 4C30A 3MPPG 3F9KA 1VRH1 4A3DJ 2OX0A 4O3MA 2H09A 4HBLA 5D4RA 2W47A 3HOBA 3H0DA 5KHGA 3S0MA 2XKPA 1VBE3 4YFZA 5ACA1 5FFOC 2QM3A 4A0XA 2IS6A 2DUQA 4DOZA 4ZH4F 4NB5A 2FBIA 1V6IA 4XABA 1O57A 4GH4A 2W25A 3DCQA 2K85A 1UY4A 5IYYA 2JEMA 2HVQA 4XUNA 4NAMA 3PUFA 2WA4A 3UKTA 2VI6A 3VBSC 4G12A 2V1XA 3K46A 3ZGKA 4KWLA 2QQVA 4LK1F 1W7PA 1Z05A 2C24A 4Q4X1 4B29A 4QX2A 4BDYA 2GWRA 3BU7A 1JODA 1SD6A 5F64A 1W5SA 3NNFA 4ZU7A 3I64A 1SLTA 4AFBA 3JRDA 4LHLA 5JMCA 2ZGNA 1XNKA 3I54A 1OI6A 4JYKA 2QQMA 3ZYIB 2Q1MA 3U10A 2IA2A 1IN5A 1W39A 4RQPA 3THTA 4AVTA 3POFA 1GP6A 1OCRH 5CFDA 3ACHA 4I0BA 5HPOA 3BT9A 4FOWA 4DY5A 1H1AA 4D1QA 4NAOA 2EIBA 1RZ4A 1OOPA 5E6HA 1OLQA 3BCAA 2WO7A 1J0RA 3SC7X 3HUGA 2VQLA 2BNNA 3WHUA 1IZ3A 3IPVB 2V73A 4KG8A 1F4HA 2VTFA 2XGEA 5JR3A 5FPVA 4FSJA 2LYCA 3VHOA 1D4M2 3KB5A 3BJOA 4RAYA 1VQKI 3V65A 1UU4A 3CLQA 2WLQA 4BKXA 5HCAA 2WB1N 1VBB2 1WJEA 3Q0UA 3MIFA 2KIMA 5FYMA 1CESA 2R5ZB 2CYYA 5T54A 4HSRA 2VE9A 1XPWA 3OF1A 4KFCA 3LA3A 2E33A 3WINE 1BC7C 2OV7A 1RINA 3OBRA 3V64A 2XBO3 1XE0A 1V6OA 1DGRN 5JOYA 2OXBA 4BIFA 4BMBA 1AJOA 2NLRA 1ETVA 2CV6A 1K5MB 5FROA 3HRUA 4YW7A 3SXWA 1JUIA 2O0YA 4NRMA 2VMDA 2OBPA 2VVEA 5A80A 4HA8A 3KWVA 4L92A 4MVTA 2JWTA 1QJX1 4Q1RA 1JKRC 3A2KA 3ZSJA 3DKXA 4RMNA 2VCBA 2HPIA 3JR9A 5FD5A 2H0BA 4Q4Y1 3CCVI 1VF9A 2WO2A 2W46A 1Z3XA 2G7UA 4DBQA 1HBXG 3BN6A 5FIXA 4B4PA 1UX6A 4MG2A 3TN91 1IPKA 2WJSA 2ELJA 2YBSA 1FX7A 3HR9A 1BMV1 3DBRB 3CP8A 1X2MA 3U1DA 4HMZA 3UKVA 2DOEA 2TNFA 3RQ4A 1IPJA 3HGGA 1RUG1 5GLTA 3WU1B 1HXS3 4QPIC 5JOXA 1JU4A 1BR2A 1RUD1 1ZZ6A 2O6GE 2E1MB 1VP6A 1LENA 5T3NA 1YIPA 3GZ6A 4QPYA 4XFIA 4FXKB 3VKFC 2ZHMA 3N35A 2XF7A 1G9FA 2Z33A 1SFUA 3KYLA 1MMGA 2D6MA 3HSEA 2CDPA 3VZOA 1JYWA 4KICA 3ASIA 3VBUA 2BDRA 3OPTA 1I5PA 2VJ4A 2DAOA 4YIFA 1MNDA 1T6BX 4B7KA 1W6OA 4AYBN 3K1MA 4NHXA 3MZ8A 4LQRA 1PVC3 5EQUA 1W6NA 1HKQA 4GWMA 1RUH1 1Q8VA 4OQ9A 2HWC3 2P6HA 3KVAA 2YY1A 2HXOA 3NV4A 3QH6A 1SFXA 4IKFA 5IFPA 2AYHA 1ZGJA 3MF6A 3OYHA 5FLVA 1NCRB 2Q8DA 1QA6A 1VIWB 3F8FA 3ZYRA 4NQWA 1Y8QB 4KGQA 5EEAA 3LEKA 4HNTA 1UOFA 4FFIA 1NLSA 6PAXA 4Z2WA 1JI8A 5J3LA 4ENNA 4KWJA 3HUGB 5JZGC 1RUOA 4NHMA 2G9FA 4SBVA 1XNTA 2ELKA 2GBYA 2UYAA 2DO7A 1JE8A 2MLGA 2ETHA 1EA3A 3NL1A 2VOXA 2IGKA 1VLNA 2GNTA 1KFXL 1IGOA 2DODA 4DEQA 4GCVA 1KU2A 2A6YA 1WMXA 5FYVA 1BCXA 4A4AA 1HDPA 4CDXA 2JE9A 1LHVA 1S0IA 2D6KA 2QVSB 2DFCA 2L7ZA 2KIQA 3WTYC 1G2HA 3RZGA 2XUMA 2JD4A 1QQP2 2HYGD 4E7ZA 2FOKA 2JDYA 3AFKA 5LD2C 3PUHA 2HZTA 1OFCX 2WABA 1JKOC 3TEWA 1O7FA 2AREA 4WM8B 4QX7A 2XQRA 4U0YA 3VSKA 4YELA 1ZA4A 2XKOA 1VBB3 2DVFA 4XICA 5J36A 1OH4A 2R073 3L1PA 1IXRC 3LSJA 1ZQ3P 1BI3A 4XHBA 3H9JA 2VCMA 1YO8A 5FLIA 2WKKA 3OPZA 2WNVC 5F9TA 3ZFEB 2R042 3KZZA 2RJLA 1UPSA 3F8MA 3A21A 3ZFEA 3MCZA 4CE8A 2VBZA 2VXRA 4MGSA 1VQMI 2A75A 2DMNA 1RETA 2GMEA 5JOWA 3V7RA 4L9JA 3EETA 3KYCB 1X1DA 1AHDP 4AIDA 1SLAA 2VW2A 4II2A 2VCAA 3CCQI 3DEMA 2IRFG 1TME2 1KQ0A 1S2EA 2DYCA 2IGOA 1R36A 2GC1A 2X05A 3W6JB 2RJ2A 3FMSA 5L19A 3W2WA 2DTYA 2ZGTA 1ALYA 2BGPA 2QF7A 3DQVC 1VTNC 2ZKZA 3TOBA 2L9NA 3K4AA 3D0SA 3T2QA 2RQQA 1ZA7A 1IPSA 3UV9A 4RA2A 3JRGA 4FO9A 1J7KA 2ARAA 1P9QC 1QQIA 3SKVA 4HSLA 4OINF 5F32A 1U12A 4X6AJ 3AMMA 1W8HA 2G4IA 2ZJQF 1XBFA 3OGRA 2FE3A 1ETKA 4D5FA 3VDXA 1PO22 1UFMA 1WFXA 1EH6A 4IERA 1MZ5A 2WO1A 1O7LA 2WZEA 2QZ8A 1NOVA 2XPVA 5EZWA 3BTXA 5EGOA 1W9TA 1MBEA 1BJQA 3IAQA 5CVVA 1W4MA 5C5UA 4W6XA 5C4WA 2HDDA 2J1AA 2CNAA 1UOBA 5FYSA 2VC9A 1VBD1 4J1XA 3IRRA 1LJ9A 4WXHA 5JCTA 4BQYA 2R7SA 3RFRA 3GX4X 3WF1A 3PU3A 2AH2A 2LF7A 4RB3C 3KZYA 4QKDA 2G9GA 4U87A 1OA4A 3HMYA 1WCMJ 4AEDB 3OYWA 3S8PA 3SMHA 3BG5A 1QDOA 3CF6E 1VRH3 3N05A 5DN2A 3EBRA 4JHTA 4CPBD 5ILUA 1LCLA 4I7HA 4XETA 4EN8B 1FSHA 2QENA 3K3NA 2PYTA 1UU5A 1GNHA 2Y6JA 4FP2A 2BXZA 4IGQA 2LUWA 2IVJA 3HT1A 2VQHA 4QPOA 3SKJE 2QQIA 2WQZC 2ZMEC 3TL4X 1JJ6C 2FD5A 3CBNA 2EIEA 2TUNA 4AQ6A 4KDPA 1AYM1 3TAYA 2NVTJ 2XROA 5LBEA 4IJAA 2WT1A 3H9QA 1BC8C 2WBKA 4LJZF 1S0CA 3CMGA 5AC91 3LEIA 1AX1A 4U2AA 4RYDA 1YXWA 3WP6A 3I3DA 2B5HA 2EH3A 5AVAA 4XIKA 5BNOC 3OY9A 3OBZA 5CVUA 3NRUA 5AC93 1TQPA 1CZSA 2I2SA 1J3PA 2BW3A 4BXFA 1F15A 1A6QA 2DK8A 3LQCA 3ME2A 1YWKA 1DUXC 3ZMNA 2FF4A 5FOJB 4A3CJ 3BP8A 2NS0A 3DF0A 3OSDA 1COV2 2Y6LA 2PHRA 1E3OC 1CAXA 2VBDA 2F4OB 2JN6A 4A41A 4JVAA 3PJRA 2STTA 2ZXHA 5DABA 5FZ9A 4Q5OA 4OUEA 2A68F 1GDTA 3O1MA 2G9ZA 3KV5A 3CUOA 1RUC3 4B4RA 3ES1A 1DYKA 1BJZA 5DD8A 2M8GX 5F0FA 2WV1A 3PIOF 1C57A 2LKXA 4RLQA 4I09A 3ZKYA 3M1HA 3KP2A 5A3NA 1U5TA 1KS4A 3PVEA 1TQIA 3D6EA 1S9HA 2RQPA 2K9QA 3J80Z 1H8TB 1SZBA 1X19A 3JRIA 1MVQA 4K3UA 4B1RA 4AZZA 1B1BA 2X29A 4IUGA 3FBMA 1OOPB 3AYEA 2BU9A 5DPNA 1VAVA 3LFUA 3OIQA 2QBYA 2JD9A 5F2WA 4RM2A 4M3FA 5T5JA 3RQIA 1EJ9A 4KA4A 4R52A 1YIFA 5JDBA 2FNPA 5FK8A 4L9VA 2UV1A 4QIWN 4ATFA 4HX4A 1TBXA 1S2KA 1LOFA 3OB8A 3LMMA 5EG0B 3O12A 2WAQA 1EV13 4FQ4A 2AS5F 5H9SA 3PNYA 5M5WJ 1SD7A 2P81A 2H8WA 1R093 3ZN0A 3VHPA 3I59B 1QZZA 2ZXJA 4LPLA 3MFKA 5LY1A 4GDFA 1ULDA 1YW8A 2KZGA 4V2GA 4LBQA 2EB7A 3D0JA 3HL2A 2R7ZJ 4CDGA 3RDIA 4F93B 3OYCA 2ACJA 1PMHX 4R4XA 4J25A 1W5TA 4N43C 1W36C 1F35A 1PNFA 2CDOA 3WTWC 3J7AO 2RS13 2CS3A 3JBG3 1NXMA 1QJZA 1WUVA 4DXZA 1TWCJ 1MIJA 1Q3EA 2BEOA 1WA4A 4U0WA 3UYJA 2VXDA 1R091 3HBZA 2A07F 2K7LA 3ZN4A 3DPRC 3A22A 3DPRB 3MV01 2VL4A 2QQLA 3P3PA 4C9YA 1CAUA 1JUHA 2J1SA 2BE5F 2C6SA 2O8XA 1RUE3 3EYIA 3VZMA 3DYMA 1AYN3 2WS93 2GOMA 1USSA 3QWLA 2DJNA 4E4HA 1A8MA 3V0AB 4FPEA 4PQ9A 3T1MA 4DRRA 2OS2A 1J84A 3VDDC 2P2KA 1YJNI 2W85A 3EQEA 3AG1H 2BY1A 5DZGA 5F6KA 4D7TA 1JZ5A 1UMQA 3N9LA 2WFF1 1Q43A 2CQKA 1H9WA 4LE4A 5D5UB 2VBYA 2COMA 3KMHA 1LNSA 3C7OA 4BIOA 4JTNA 1LJ7A 3R0AA 5GLVA 3LA2A 2WYSA 2KPMA 1VBB1 5ISLA 2J1VA 5TSWA 2YXSA 1G9CA 4QDQA 1RUJ1 3MO4A 3POIA 1DU6A 2BVMA 4JCKA 1BVVA 1YUDA 2VQGA 5KXBA 3CCJI 2FMYA 3AB0A 4RGGA 4PFPA 3K70C 1HQCA 4KMUX 5FWEA 1AX2A 3IAM2 3EDPA 1QEXA 2VZOA 5EJCA 1OFNA 5EFUA 5FXWA 2WNUC 5GM0A 1ZNPA 3FE5A 1I1EA 2UY8A 5B4NA 1W8FA 1HXS2 2QLZA 3CLPA 2LC2A 4GYGA 2YV8A 1O3SA 3HSFA 3M70A 2H8RA 3VYRB 3IL2A 5LEKA 4Q4X2 2DBBA 1E5HA 4XUPA 3HD8B 2JQ7A 2OQRA 1SFOJ 1FI2A 2ZS6B 1A6CA 1ZARA 3ZRGA 3WG7H 3HOSA 1TL8A 3ULQB 4OZXA 2G19A 4AWDA 3CO6C 3TDZC 2XJTA 2Q2EA 2MNGA 3SXYA 4UW3A 3HGYA 4EQVA 2QNKA 3SYTA 1VMFA 2WUHA 4B3AA 1X4PA 4L2NA 2A6TA 1TNTA 3HN1A 1R1ZA 1OVSA 3N3HA 1W06A 2YMZA 2ZKNA 2IC1A 1X7NA 4FX4A 5TGTA 2D98A 2ZJPF 5LBCA 1PUFB 5CLSA 4ZYHA 3W21A 1XCBA 4MNUA 5JPMB 2Y0MA 2QSFX 1GWKA 2LMDA 4OWRB 1RTVA 2R7EB 3FKIJ 5D8LB 1W7PD 3ACIA 3GVAA 3ZDVA 4ZZ8A 1H1IA 4F52A 1D4VB 1YQ6A 5E16A 5IP6A 1ZTRA 4FFFA 3HB9A 4DOUA 4XJ9A 5EWSA 1W6MA 1QF3A 2XJPA 4PDWC 1MZ6A 3KE2A 1WMDA 3IKVA 3HSRA 5FUPA 5FZEA 2WB1A 1DGWY 5A32A 1WW7A 2YPJA 4AEDC 3RZZA 2R4GA 3GF2A 3V0AA 3HQXA 4IE0A 3ZQQA 5FJ8J 4ZDLA 4DYQA 4BEHB 1JMUB 4W65A 4YGEA 5B4XA 5JUVA 4WM7C 3N9QA 1JHFA 5FZ8A 1XNAA 3WHBA 4F55A 3BR3A 3QBQA 4IHYA 3DUIA 1B9MA 3ETQA 1DZQA 1UYZA 4CCNA 4LE3A 4MO7A 4EATA 2PJRA 4GXLA 5A3OA 3FMRA 2AGSA 4XKVA 5HS7A 3HOXJ 2EXIA 4D94A 1IN8A 2X51A 2YSRA 1OKQA 3SITA 4ZHNA 2VPLA 3DXTA 2RDPA 2E1MC 3NKTA 1WKYA 1D8KA 3ILNA 3PUAA 4JX0A 4CCCA 3I2DA 2EAAA 3EUAA 1FTZA 1V6MA 3TDUC 2BFUS 2G9WA 2VBWA 1VI0A 4FT8A 1ZH5A 1D0GA 3ZSKA 1S72I 4HKLA 1VBA1 2CFXA 1X33A 3AAFA 1CR7A 2QKMB 3KP3A 4H7MA 4ITVA 2VE8A 5J09A 2YX7A 1SBEA 2QDNA 4P9LA 2L01A 1D2SA 5BNNC 3KCXA 1ND3B 1Z0HA 4L9NA 1K78A 2X0LA 3CU7A 1J9IA 4Q1PA 5CISA 4TV7A 3DGTA 1PZ7A 2RGVA 2STWA 2C5DA 1W2UA 2LTNA 2DU0A 1NAEA 4A5MA 3LWFA 3MKYB 4Q0QA 4ZY9A 5JXJA 3BU0A 4MGKE 2NOGA 3VKNA 2HWE3 2O61A 1UD1A 5BOXA 1U5ZA 2HZDA 4H2AA 1FV2A 4A3ZA 3SH4A 2OC6A 2A1XA 1BOAA 2DDAA 3OYIA 5FZHA 2H1KA 4S2HA 1WH5A 2RDSA 3K4CA 1Q8PA 3I71A 2DA6A 4BDZA 4QX3A 2K40A 4M3CF 4OAYA 5DCMA 5KAIC 1OJLA 3WU2C 2HWB2 2YGMA 5LLQA 5J96B 1UMIA 5IY5H 1YJWI 4WM8C 3BG3A 4Z6YA 2M87A 2IXLA 1LHOA 1ND3A 1IJWC 1UOGA 4LITA 5HLTA 2DMTA 3K6GA 2BW3B 4H0EA 3BR1A 1G3YA 1XSXA 4CTEA 1C8NA 4XCBA 2BP6A 2KIUA 3NSTA 3KP5A 4OIRF 5ABJB 1RIRA 4PLMA 3HKZN 4KISA 2F4MB 3BZCA 4N0BA 3THPA 4R79A 1XSVA 1XMXA 4BY1J 3TQNA 5ICGA 3CLOA 1SQ4A 3MWMA 1V0AA 3FXRA 1VRBA 5ANNA 3H3LA 2LY9A 3MHZA 3VYTB 3QU3A 4ISRA 3CIHA 1HXS1 4XQFA 2VOOA 4QWNA 4Q47A 1G8XA 5DS9A 1W04A 3INAA 1JN2P 1UX7A 2WL1A 3IHUA 2QQPA 2I8DA 2ZNYA 3RMXA 1A6IA 4ZZLA 4PHZA 4BZ4A 2GA1A 1AKHB 2E7WA 3H35A 2KZVA 2PHFA 3M3QA 3H1CA 4KIGA 2GU9A 3RKYA 4K1YA 2DCTA 4WZCA 3FBYA 5DZEA 5F39A 1U9NA 4PCQA 4CXWA 4CZCA 2B7EA 1VMJA 1ACCA 5GKAC 3CCYA 1UAIA 3SFIA 3WF3A 1MS5A 4QPQA 3RKWA 2CGPA 3PTRB 5IWFA 3JRBA 3E0JB 3GUDA 1PGW1 4XKWA 2CQ7A 5HNFA 2LBFA 1BMV2 2DCYA 2UWMA 4IL6C 1TT0A 2VQTA 4ASMB 3UT0A 2D1VA 3RMYA 4IHXA 1S2BA 2GDFA 4HBNA 1A78A 4COZA 3F23A 1QNWA 4R1HA 4UUSB 1V5EA 2V79A 1ZAOA 3PVOA 5C3OA 2YU9J 4XSXF 4QPGB 3GCMA 1G6NA 4Q0PA 1WD3A 3QPLA 2JG9B 1VBD2 1POV3 1TME1 5H9PA 1U8RA 5F5CA 3EUHC 1BIAA 4F83A 3FWEA 3IMNA 2BERA 2WQ8A 1NG7A 5K0UB 2WT2A 4BGDA 2FEZA 2JTVA 2W4SA 4RAZA 5LA1A 3AL6A 2IZWA 4GB31 4LO5B 3AZVA 2L4AA 3OL3A 2WO3A 1J1TA 2HGCA 4RAFA 2DVDA 4TZDA 3L2CA 2HS5A 4KBZA 1JZ4A 4ATEA 3CZUA 1MBFA 4BQNA 4UFHA 4MYEA 2EFWA 3ZXFA 4HX8A 3M7GA 4AL9A 3U21A 1WMEA 2MW8A 4EJWA 1UHMA 1HKSA 3CCEI 1QJU1 4KI5M 1HSTA 1FX5A 3JCUC 4KNCA 4UOJA 4IPAA 5FLHA 3NRVA 1W0UA 2VKEA 3RZLA 2WWJA 4NHYA 3SQNA 3V0BB 3WUDA 1ETQA 1EP0A 3CZ6A 2GIZA 1JOPA 3T30A 4M00A 1Z6TA 1WLCA 4OVEA 2GC3A 4IQJA 4XACA 4BB3A 2KM2A 3ROUA 3CJRB 5BYNA 5JFRA 1LDDA 4XZPA 3GMEA 3OUJA 4GMP3 4AI0A 3BR0A 1AR92 5LWBA 1WA6X 2UWCA 4DXSA 1WVRA 5GJ6A 2W82A 1FZPB 4XN0A 1MMAA 4OI0A 5FPLA 2LP0A 4N4NB 1BM9A 1HRI2 1IDZA 1MW7A 1D4M3 2A3SA 4HPKA 1HV0A 3GFMA 5FTTC 5FMBA 3V42A 3BTCA 2VOPA 3SH3A 3HHGA 3TEZA 1D0YA 3WW4A 4LJHA 2KD7A 3ZSMA 1W0OA 5L3DA 2NXNB 2KDOA 1IG7A 2YFZA 2H6CA 5M0TA 5JVGF 3S30A 3A4CA 2W39A 2WAQN 1SFYA 4IEXA 1NUKA 3ZYFA 2DA1A 4AF9A 4YZ4A 1V5GA 2E7QA 1O8SA 2ZX2A 4HNVA 3FLPA 5K1YA 4QB1A 1BK1A 3J8F1 2UUZA 3WSOA 3GXOA 2VBPA 5DXDA 3FLTA 3H42B 2ZJ2A 2X4HA 1EPZA 1RUE2 1ETWA 3AKSA 4WVZA 5IVBA 2BOIA 1Y1WJ 1XD7A 5IYBJ 2GP3A 3E7LA 2PMWB 5C3RA 1RVF2 2Q0OA 3Q9SA 4FOYA 4NIGA 5FZOA 3T4HB 3FXKA 1ETXA 3VBRA 1GV2A 4WVVA 1KDKA 4AVAA 3K77A 2L2OA 3ECHA 4IESA 1DQ5A 3CJIA 1UJ8A 2WSVA 2HOSA 1H4HA 1EAH1 4LUKA 1Y9QA 3H8OA 5ICEA 2P6SA 1G4DA 3OUHA 1HRV2 4OLLA 4OZOA 3TNPB 1YIOA 3W6VA 1ON1A 2EILH 2QQJA 4XAEA 5F27A 4U7DA 3CJXA 5EV7A 2EF6A 2F5VA 2ZFUA 2O0OA 4L0ZB 3N9MA 4BLJA 2AEZA 5F3EA 1SD5A 2HKXA 1U6GA 1FEXA 2P0WA 4MFDA 2BQPA 3KV9A 3RWKX 4GQ7A 2FQPA 3S2WA 4S05A 4L5EA 1YO5C 3H1YA 2IP2A 4HF2A 4MADA 1OYYA 3FHNA 1DFQA 2YGLA 1WQ2A 1I6XA 1BR4A 1NG0A 2IA0A 1CIWA 1BOBA 2WAOA 2E2HJ 4BQ2A 4AAXA 3FN9A 2P5BA 3PUBA 5FKLA 1B35C 1S6LA 4W6YA 1GT0C 4YM0A 1GNZA 4IEZA 5LA0A 3WDXA 4AVSA 1GR3A 2RAEA 5LA9A 3I5UA 2Y30A 1K5JA 1YFYA 4GAZA 3I4IA 2HVSA 4HV6A 3AZZA 4AI8A 1APNA 5BNPB 3AYAA 3IDCB 2WLPA 1YNAA 1E57A 2R5ZA 4EJUA 4Q0SA 1W8ZA 4S2GA 2V4AA 5DUUA 1WZXA 4Q4X3 4MGTA 2UXXA 4CP2A 1MD0A 1ITYA 1B59A 5FY8A 3CMYA 1JT0A 5A3UA 5M3FJ 3GZ5A 5TISC 1LECA 3KLOA 2BRTA 2GMMA 4XF9A 1YQAA 1SLIA 5F37A 2HJIA 1HQLA 3BTAA 4G8XA 4PIXA 5FWJA 4HG2A 1OHFA 3N36A 1AA7A 3UNGC 4XL9A 1F5JA 5A2QZ 3RI4A 2W7NA 1Z7UA 2DTRA 1IRXA 1B72A 1AR63 4ASKA 4NIAA 4OI1A 5BNGA 2LRDA 1FOWA 3DTKA 2NQYA 2DW4A 2XV4S 3CDLA 4PUSA 5DAVA 3TB0A 3ZYGA 5H6QA 1WJDA 3LD8A 3ECQA 5FMCA 2DPDA 3SCGA 5DG1A 3AJYA 2O8KA 1FATA 1NH3A 4J6GA 1RXFA 4N8MA 4XFAA 3T2PA 2C9AA 2VOTA 1Y9GA 5LRRA 4HSTA 4X8NA 2KRFA 1YE9A 5FP3A 3FM3A 5C9AB 1IO2A 3NNLA 3IN9A 4UFMA 3OYDA 3ERED 1R00A 1QHDA 5D8AA 2Y6GA 1DP7P 5HODA 4XRMA 4UXNA 2GMPA 5A1LA 4LOCA 2PTMA 1Q1VA 4PJLA 4CP9A 2VZVA 1W8NA 1UXZA 3L00A 2OTJI 2RS32 4TLFA 2ZGRA 1ZGAA 1JTXA 5FY4A 5F04A 1LUJB 3BR6A 5D6FA 4HPQA 2LD5A 2EA4A 5EF6A 2QSGX 2VY0A 5DCFA 3KZ4C 5FLMJ 5CPRB 5JSOA 2BUKA 5IJRA 4AK3A 3VYSB 3TP3A 2QZ3A 1NCQC 4TN7A 3IDBB 1AJKA 4CEWA 5J1RA 2PHWA 3FXUA 2PHXA 3I3BA 4RSUA 2L9LA 4W6WA 3ZMTA 1HCRA 4FVVA 4XBFA 1RHI1 5EJ3A 2K9NA 4KN7X 2X48A 3DEUA 3QAHA 1QJY1 5H6RA 2UYBA 3VBRB 4I2OA 4PGGA 1FXZA 3ZCOA 3POYA 1FAYA 2BZTA 4RM3A 5FB2A 3F95A 3ZPOA 4A6EA 5H2FC 1TG7A 2YU3A 1XC6A 3ZYJB 1HB1A 3WCSA 2XGXA 1UCXA 4C91A 5FYCA 3EHKA 4LKSA 1QO0D 5EJZB 4CDUB 2OAZA 3LEMA 1IQDC 5GLZA 2PA7A 2R0QC 1T39A 4XKCA 3TO7A 5JXIA 3KCCA 2LH9A 4URAA 5J47A 1VQ6I 1H0MA 1V9U1 1OYIA 4LB6B 3WHCA 1CX1A 2PQSA 2X5IB 5I0DA 4M6XA 1Y8RB 5C7GA 1VRH2 1MNMC 2W0XA 3N9PA 4LEJA 3IAPA 2R93J 4KIBA 1W99A 1HKTA 4RS5C 3BCWA 4XAAA 1COV3 4P5YA 5KXDA 1UZWA 2ZGOA 4ZU5A 4AEJA 3EMRA 1Q56A 2ZB9A 2WC2A 1IN6A 1ZKGA 4CSWA 1W03A 3VBFB 3DLAA 3VODA 3GYHX 1X8MA 2IVMA 2PHLA 2EFNA 1DF0A 3VUOA 1MSFC 4A3JJ 1BR1A 4IE4A 2D7FA 4YVSA 3HYIA 1WI3A 5HCFA 2WAEA 3AZXA 2B7YA 1GLHA 5J7MA 2RKHA 4AVPA 4PSWA 2MG4A 4NIIA 3JU9A 4CHUA 3HNBM 3MLLA 3I2JA 5AONA 3J9SA 3KYDB 1R082 3WE2A 3S14J 4Q27A 4AU7A 3H8RA 3CQOA 1K61A 3BQZA 1IS5A 2XB6C 5FO5A 1F43A 3M8EA 2RS53 2V1DA 3VYUB 1B6AA 3WX5A 2ZNZA 5L3EA 5FY1A 5D8KB 1RMU1 4FPCA 4CP0A 2LG4A 2VUMJ 1Y3TA 4Y7NJ 2EV0A 3KP7A 3OR1C 4GIQA 3C18A 3Q8CA 4M4PA 3LZZA 1NE6A 5CYYA 1ULFA 2MBFA 1RUC2 4QM9A 4UFLA 3DEWA 4PF1A 2CW0F 3P9KA 4JDNA 5FZ3A 1Q8OA 4FOVA 4M6YA 5KHKA 4NIDA 4BE3A 3U2RA 1FOXA 1OOPC 1ERDA 4II3A 4WM8A 1SFPA 3W2VA 2X6OA 3RJRA 3HRSA 2DUOA 3UJQA 5FZAA 2ZAAA 2W1UA 4UW4A 2AQFA 2QQOA 1MDMA 2WWUA 1ZZ7A 5LHHA 1BHGA 2VMGA 3IH2A 4WM7A 1TVGA 2HWVA 2Z5UA 3LIGA 4W4ZA 4B8XA 2JENA 2DDUA 2J1TA 1O8PA 4NVPA 1L3LA 2D5FA 3QCWA 4MSVA 2VZQA 5CFDC 4EN6B 1OLRA 5CG9A 3OD4A 3ZQCA 4AFDA 1F5FA 1CX4A 3MW3A 2JRTA 4DIQA 1TP4A 5E8GA 4EJVA 1FNNA 1DDNA 3PLQA 4IV3C 3G73A 2DFBA 4FAGA 3O1TA 4AFCA 1XX5A 4UV9A 1F4AA 1JHNA 2B9VA 2KLOA 3CC7I 1LFPA 5A6YA 3S6PA 1P8JA 4C90A 1ZK8A 2WNUA 1CAWB 5D21A 1GP5A 2XIGA 3A01A 4UW6A 3VBHA 2VUAA 3I2FA 4OMCA 3CF5F 3ZR5A 1OR7C 1IAWA 3O1PA 1AXZA 4P00B 2TRTA 2BHYA 1URXA 1XYOA 2D43A 1WSUA 1GV5A 1XGOA 3GTLJ 3PUSA 3HT2A 2D3SA 4IE5A 5JLXA 1T56A 3NJXA 3OCPA 4BAYA 4AI1A 1UIJA 4N7IA 4UWDA 4FPLA 2GSYA 2DMUA 5A6ZA 2DQRA 4XDQA 3OGSA 1IG3A 4DYRA 1ASJ3 3OV8A 2ZAHA 1ZG5A 1NZIA 1RITA 3BWGA 4B7EA 3CP2A 1JT6A 3JUUA 1GICA 1GSLA 4QPIB 1FOD2 5JLVA 5FYIA 1UIKA 2EQRA 2GIVA 1ULEA 5E88A 1SMTA 4CP9B 1ZG3A 4IVNA 2R072 2WA0A 1EUUA 5IHRA 2BPA2 3FL7A 3BPSA 1IUFA 2D44A 2R041 3CMAI 2O14A 4YWAA 3OEBA 5AIQA 1PNGA 3PL8A 3J7YJ 4XLEA 2C9KA 4QX5A 1U5TB 3EYYA 4EZ4A 4FHTA 1YQCA 4HX7A 3MI8A 4NC6A 2ZPXA 1MQTA 2DA3A 4L9BA 5JVTA 3VFZA 4P14A 3NNMA 3TOAA 3A01B 2A3YA 3KV4A 2LFBA 5FXZA 4RA0A 1SD4A 3WZ1A 2WNUB 3RVHA 2DCEA 1HB3A 4XOGA 3CCLI 4YYOA 1VQOI 4PBPA 4L99A 4ZXEA 2LF8A 2X09A 4L0YB 4YG2F 2HNHA 4IEUA 3JRHA 3WF4A 5A33A 2PQQA 2XWBB 3ZIWA 4FFGA 2R0FA 4BQ5A 2D6NA 4IEYA 2JXAA 4YFKF 4UV8A 1PVEA 1FNZA 2Y33A 1QVUA 1MPXA 2CU5A 1OLMA 4AVVA 2HVRA 4LUMA 2I45A 1JKQC 2GC2A 1ND2A 2F5DA 4IXAA 2VNOA 2UWBA 4XC9A 3M7AA 2UURA 3O14A 4QKFA 3H3UA 4DNYA 5FV3A 4BH9A 3ML6A 3MIBA 2TCTA 2NVYJ 2QQBA 1FBUA 1C8M1 2WIIB 2WT0A 4EWDA 3JQXA 2VJXA 1KQ9A 1I50J 3LOIA 2A5WA 4BHPA 4LKFA 5C8CB 5IVCA 2Y38A 4GZ9A 4HRIA 3LSHA 1RL3A 5HDKA 3LPFA 4X0GA 4XORA 5E1RA 3R4SA 4WVWA 5IVEA 3ZFEC 3LIHA 1DU0A 4IO9F 2P1BA 5ILSA 3H50A 4CO8A 3JXSA 3ABKH 4UNOA 3JAMZ 1ZBA3 3ZFFC 5JSRA 5F5IA 1BYHA 4EM1A 4CU9A 3FXLA 5HLGA 5FY5A 2PFWA 4M72A 2ZOEB 2ZABA 2VMHA 1QH7A 4C0BA 4FPJA 4GALA 3EYPA 3PL0A 1LGCA 4NO4A 5D5XB 2R7VA 3VHNA 2Y9YA 3FM5A 1MJ9A 2MC4A 3C3VA 1AR61 3WG9A 3JB8A 5K5RA 2CQQA 2O8OA 3ZFGC 2Y0SN 2CUFA 2RC4A 1J1LA 3ZQIA 3KPHA 4KJZA 1ZN2A 3DYOA 5FRAA 2PJRB 1MACA 5E3NA 4XILA 2E6VA 4LBJA 4AW7A 5LGUA 2JDKA 1S0DA 4AI3A 3NEUA 3GFJA 3Q3SA 1UOJA 4NNJA 2WS91 4NHLA 1O5UA 1QNYA 1ZHFA 4A2UA 1POV0 1TZOA 3G1OA 1N3OA 1BBT2 2VR4A 1TNRA 4GWIA 5IUQA 4N4OB 4BEHA 5ANQA 3J8F2 4HQEA 2GXGA 2ID3A 3DXJF 5BNQA 2VT2A 4LORA 4GMP0 5EHDA 2GN3A 1NQDA 4RGXA 3JD73 4XNFA 2MGQA 2Y0OA 1H1MA 3I2HA 4XJZA 2GOXB 5J1XA 2XASA 2L0KA 5B1AH 3PU8A 4NC7A 4KIFA 2VKHA 4LBLA 4DPNA 4Y4RA 4N43B 1G3WA 4AHXA 5IAXA 2PG4A 3WF2A 2CYFA 3NMBA 1JU3A 3K1NA 4QMAA 1B8IB 1D8JA 1QGLA 4JRAA 4XJAA 1BEV2 3DN7A 2D93A 2ZKLA 3MW2A 5J40A 2DJIA 4Y52J 2XL9A 1RKWA 4OQ8A 1XB9A 4B09A 3ALQA 1PGW2 2R7FA 2DPUA 2IT0A 3M3YJ 1SACA 3A0NA 4Q26A 1O59A 4CA0A 5DQ0A 3Q9OA 3THDA 4EGYA 3MZHA 3T1BA 1PHMA 1IS6A 1FSEA 3NKGA 2RR11 3EXUA 1WI9A 2GH8A 2VLAA 1DG6A 2FU4A 3RRDA 4COYA 3GZNB 5LHIA 4NIHA 1OQYA 2Y6HA 4IGPA 3K4NA 1YQ8A 2XJUA 1SBFA 4Q8LA 5FP9A 4F91B 5HXVA 5KXCA 5A7WB 2A3XA 2O7OA 3VEPA 5CFCB 2VJ5A 4JQTA 5EDNA 4M3CA 3J80K 1MEC1 1XTAA 4XBQA 4AQSA 3F0CA 2XLGA 1N47A 2MEV2 5KAFC 2FJ1A 4PJNA 4OMYA 2XVKA 2M0CA 2FDKA 5IT3A 5KXEA 5JXGA 2EXKA 2Y26A 5A1FA 4NWVA 2KDZA 4INDA 2JG8B 2DFEA 5E3LA 2VIXA 1W0NA 3ZO0B 1NY71 3L2UA 4YFNF 1WCDJ 4LO8A 1IXSB 2QKLB 1AHSA 3PTYA 5KR7A 3ST7A 3ZMOA 2VXZA 5FXXA 4Q4Y2 3QLQA 2P34A 1BJAA 3LFIA 1AR81 4MFEA 2XWJB 4IEWA 5CZKA 4Z2AA 1LU2A 1UNBA 2AUYA 4V1PA 3BR5A 4IEJA 2V9VA 3WU0A 2KT0A 1FPN2 3TW6A 3ZMVA 4GULA 4A3XA 4CXYA 1HQWA 2XJRA 4KH9A 3GWZA 9ANTA 1PO11 2YUEA 1D2QA 3KT1A 3LSGA 2OJED 1N75A 2RDRA 1FMVA 5A3MA 4BXXJ 1QKQA 1AYN2 2RR13 2E2JJ 3SEPA 3GTQJ 2AXTC 4ZKTB 3M9AA 5B1BH 3ZDSA 1AX0A 1QJU3 4BLIA 3RZDJ 3WCRA 3J7MA 4YGDA 3DCFA 1PVXA 5GZEA 4IQ4A 3WNMA 2OCCH 1ETOA 2R92J 2X85A 2WNOA 5K5OA 3FHQA 2XJSA 2OPKA 1CGPA 3AXDA 4AYUA 4BE2A 4ZS2A 4DS0A 2DCZA 3G4SI 2B0LA 5EYXA 3EB7A 5H9QA 3VBUB 5HV0A 1MJBA 2QQAA 4E8CA 2W1QA 4PJYA 1YEWA 2QGUA 1W6QA 2VZ1A 1NK3P 4CEYC 1JZ8A 3MZYA 3F8NA 4FXGB 3GF6A 1G9DA 3M3EA 4PIZA 2FDIA 2VBBA 3F8CA 2EJRA 4EQQA 1V6LA 4ZDPA 3AP6A 3S2DJ 3GM8A 1KDMA 4E4DX 3UGGA 2VMIA 1GUIA 1PIV1 2EA2A 1PO13 2D2WA 4C1XA 5KNLA 4UFIA 4CYCA 3VLBB 3TBDA 4PDWB 1X1CA 3RJPA 4RFT0 5FKMA 1D7PM 5AFBA 2XH6A 4RDUA 2FMDA 5I0TA 2ES3A 4E27A 2JG9C 3PO3J 4UVCA 3N9NA 4CEYA 3RPUD 3CESA 3RPUA 2A05A 3C2HA 1QJY3 3BJ6A 1VB4A 4UI9L 2VL8A 1Q1HA 4RB2C 3W59A 1S8NA 3FUOA 1HW1A 1VBA2 3WP3A 2V09A 3FIWA 5I0UA 3GFLA 1YFXA 5JZGB 1R71A 1RUF1 2F48A 2RS52 1CAWA 4D6SA 2R16A 3D5OA 2KJBA 2VQ0A 3U11A 4AE2A 2YX4A 3L2WA 3ZLIA 2Y64A 3FK7A 3ILFA 3BG9A 5CKMA 2R7WA 2R0HA 4BU2A 4MZUA 3AX4A 4OI4A 2P5VA 1ZBA1 3K51A 1QU3A 5A7SA 3L2YA 1DYOA 3ZOBA 1E3PA 4JQRA 2EINH 1QHHD 4GWJA 1JGGA 3J7LA 3K4MA 3KEYA 3DTEA 1LODA 2HI3A 3GEZA 3C7FA 3K2ZA 1V3FA 3AMQA 3U37A 3GO5A 2F6CA 2EXHA 5FQ0A 5FZ4A 5FLJA 4M3EA 1NQJA 2E32A 3CL1A 4ARYA 5K7HA 3OGJA 5IT6A 3CHXA 2HBUA 2BHZA 3E6BA 5E20A 2NM1A 4EV0A 1OQ1A 1PX3A 1U5YA 1QVTA 1UCRA 2I5UA 4OHXA 4CDXC 4OIPF 1EAH2 1XQNA 2VZTA 4ZONA 2DFFA 4MGQA 2L9RA 3U1KA 2YPRA 2IAIA 3FISA 3PIPF 1BVP1 1ULPA 4ISQA 1LEBA 1ZBE1 2VONA 1R083 5M3MJ 3HJRA 2R7UA 5FAXA 1JYNA 2ZFWA 5DEQA 2Z2SB 5E3MA 2WY7Q 5FKNA 1IDYA 2MHFA 3AVRA 1AR93 3GCXA 3O0WA 1L7RA 1C4RA 4IXLA 1COV1 3IDAA 5FZCA 5CKNA 1MH4A 2FQ4A 4PJMA 2GZWA 2MFZA 4E7KA 1I6HJ 3HQUA 4XSZF 4BE0A 2BWAA 4D0PA 3TKYA 4KNYA 4XJUA 3EJKA 4UAPA 2FDHA 4XLHA 2CWEA 4EMSA 5HDNA 2FZ1A 4P5HA 5T55A 4Y20B 3ZPLA 3LCPA 4Q0UA 1AXYA 3U1XA 4I3GA 2P6CA 4BNCA 4AUXA 1DQ1A 1O4YA 5C4WC 3H7YA 3P3NA 1H9PA 1ORKA 4X1EA 4C2MJ 2R7RA 1LNWA 2QYOA 4GJZA 5J8CA 4XFHA 2NNNA 3RG0A 2IUWA 3WQ7A 1QXPA 1MEC2 4NOTA 2OQGA 1RUH3 2HWE1 4YW2A 3R6SA 1QH6A 2DBNA 4IQPA 3GTOJ 4GA9A 5F0HA 1RXGA 4CUBA 4XCAA 2A3WA 3KLNA 5L3CA 1PUEE 1B35A 2HYJA 1WWXA 3M1EA 4S2FA 5HOOA 2PQ8A 4PJJA 4RGKA 4N53C 4OAZA 4PLNA 4LA2A 1HJFA 4BS9A 4QHOA 5IVVA 5FD6A 2QCOA 5F6LB 2KP6A 5CJ9A 1POQA 3OYEA 3LNQA 3PQKA 3NNJA 1VBA3 3FX3A 4L5IA 1ZG1A 4C1WA 3BPXA 2G0EA 1FBSA 2EXJA 4QPGA 4HW0A 2WFF2 4LMFA 4NDLA 2VZ3A 3TBIA 2W52A 3WR0A 1YG2A 3Q5FA 2VCCA 3TWIA 2OIIA 2GXAA 4UY8I 2DVAA 3VZNA 3N97A 4JGZA 3D5LA 4BJ6C 1GMMA 4NRPA 5FYTA 1RRJA 1QJX3 2D6OX 2E5ZA 2GNMA 3WVJA 1RUF2 2EZHA 1Z21A 1NLRA 1WW6A 4Y5TA 1N1SA 5FJHA 2GP5A 4A7YA 2C26A 3VDBA 3AG3H 4LG3A 3NV3A 4HAMA 4DINB 5J1UA 2P3JA 1HLCA 3ZQGA 4AGVA 2D40A 1AKHA 4LKDA 4HQMA 1VZ0A 2YU1A 3BQYA 1ND2C 1W6PA 3S57A 5E1WA 4AVZA 3DXUA 1GWLA 1YJ9I 4M9SA 4Q4W3 3IC7A 4YVWB 3QRFF 1F5TA 2L02A 3BPZA 4XF4A 3ZN5A 2LLKA 3A23A 1DPRA 4Y22A 1X2NA 3RYRA 3KD4A 4EJOA 1N77A 1REDA 4XHXA 4AHZA 2HWB1 3CCRI 4COVA 1UN1A 2IFWA 2KJCA 2R7DA 3CMMA 1FMWA 1BBT3 2Z42A 4LLLA 5EPAA 1GZCA 3LWCA 5A3TA 3FKJA 1FYUA 3U4SA 4V2WA 5C71A 3BVCA 1YYVA 4M9XA 3WGIA 1K3IA 3MKZA 4YSFA 3GTMJ 1BA5A 1G9AA 2W92A 1R64A 1F9KA 1V6NA 3J26N 1S5LC 1FTTA 3VN4A 2QA4I 3MICA 3ZFGB 4R9CA 2DT5A 5LBBA 4RD7A 2ARXA 4A93J 3PDQA 4K7JA 3ZM8A 5TJJA 3JCIA 4BXUA 3MD2A 2JECA 2IGNA 2IXSA 4BY7J 2P8TA 2JE7A 4MOAA 4IEVA 1V4RA 5FLXK 4XOPA 5A33B 4IF4A 3SISA 3SDGA 2ARCA 2VPVA 2AO9A 5K7ZA 2PAKA 2M5WA 2R071 1JGSA 1JYTA 1DQ0A 1GOHA 4XLPF 3HPNA 1GV9A 1VQPI 4HETA 2ZEWA 3MEPA 1Y39A 4E2SA 3PIGA 5F1JA 1UZVA 2PFBA 4CYDA 4LBQB 1DZRA 1EUTA 5D5WB 5GALA 2JJ7A 3HAGA 1CD3G 2W00A 1BKZA 2BGOA 4DO0A 5ED4A 5FUNA 2VASA 3IKTA 5FFXA 2W1OA 3HM5A 4AIKA 4BCUA 1YOVB 4QKNA 2ZEYA 3ELKA 5J1YA 3FHIB 2VQAA 3VD5A 5FBZA 2BVLA 4QB6A 4YGCA 1X58A 3N7KA 2LKPA 2DURA 2ZO4A 3V7CA 4QT6A 1PGL2 3POWA 2R7OA 2W08A 4Y5SA 4CYCB 3PJYA 3WTVC 4LB5A 1ZRFA 5EIYB 4KU7A 2W91A 5CQEA 3KT4A 1W3XA 2ZSHB 2DI3A 2GXBA 3ZR6A 3POSA 5IK8A 4I01A 1HRV3 1GBGA 4IGOA 1T0FA 4JX5A 4IX7A 1YW9A 5D4SA 1YHQI 2RVCA 4MHGA 4CXXA 3NVCA 3VBOC 4KL1A 4RAGA 2A61A 2X8KA 4DUWA 4W97A 3CO7C 2IXJA 3OUIA 4QM8A 1WRJA 1B9NA 3K9TA 1VPHA 1KYZA 2DOFA 1NA1A 1FWZA 2PLV2 5J6XA 1JYCA 2R5YA 2QBYB 3ILRA 3T09A 1OF3A 2JB8A 3FF5A 4XTMA 1OBNA 2BV6A 3H5AA 2WQ4A 2HOTA 4AC0A 4C3HJ 1ZRDA 1Y6IA 3VBSB 4EM0B 4UT5A 5FFZA 2OA4A 4B48A 3ZYHA 3WDVA 4YM3A 1HRI3 3S7EA 3CJIB 2HXIA 2DMQA 1U5IA 3USSA 1OSGA 4WM7B 3R05A 1WJAA 2VJIA 3NWTA 2ZSIB 3B73A 2HWE2 1ZREA 2FSWA 1Y9MA 2R063 1SCSA 2C6YA 2OU2A 2EVXA 4DZPA 2JX9A 3DLLF 3A02A 4LA3A 4NC8A 3MFAA 3IH4A 5F1RA 3IRQA 4WV8A 2DA4A 3KX2A 3BIWE 3JRCA 1R49A 1DP0A 3ON7A 2XRLA 1S29A 1DGLA 4K20A 5BV6A 4XOTA 4M3CB 1PMJX 3HXLA 2QE3A 3R4UA 1JZ7A 1UKGA 2B9SA 3ONQA 4XRFA 3TO9A 4MX3A 5HXMA 4W8JA 1O6UA 3OYGA 3OOPA 2ATFA 4HPKB 2QQKA 3I49A 3AKQA 3VBFC 4LO7A 5AIPA 2ZGQA 4B8EA 3OMYA 5B2GB 2UU8A 5A70A 3VV1A 3FJSA 1H8VA 3ACGA 3E1F1 5BPIA 2JSCA 3URFA 4TTGA 2DN0A 2WZ8A 4KN4X 4LR4A 4QXKA 3GLLA 4NE9A 3BB6A 3AP9A 1PJRA 4L9TA 3A1YA 3ITQA 1X8EA 5HLIA 4GH4B 5JAXA 1ZRCA 1RUJ3 4GH4C 3H9GA 2CL2A 5IP7J 3MIDA 4QXBA 5KCMA 2DA7A 4A6SA 1E0EA 5ABJC 4M4RA 1DYPA 1WMFA 2E35A 1QU0A 3ZXDA 1Y43B 4MQ9F 2WINB 2VMFA 1F4KA 1LEAA 4CDWC 2E7XA 4GFBA 3T1LA 3WNNA 5I8TA 4NPRA 2VZSA 3VD9A 4HN1A 4COWA 4XLFA 4LIVA 4Q29A 2NMNA 1SLCA 4G3YC 3WT3A 4G6DA 5FLXZ 2AENA 3VSLA 2W3JA 2ECBA 2QBXA 4YW1A 4YZ2A 3VBHC 3ERMA 2IXHA 3ZYPA 1LOAA 1ZR2A 2K3PA 2EALA 1W0TA 4LLGF 3R4DB 1LEMA 1J58A 4FCAA 1MS3A 3BZKA 5J8FA 5JHFA 1ZVFA 2VW0A 3A03A 4CU6A 3RTRA 3P7NA 1PVC1 5ACA2 1AXKA 3I2IA 3CJQB 1QJY2 1X3WB 3POBA 1MZEA 3LOBA 1JXNA 2GM4A 3D82A 1RI7A 4R8HA 2G1MA 3JBG1 2XONA 2RS11 1NE4A 4HVOA 1BI2A 3AM2A 4D6RA 3T8TA 1UELB 2YHJA 3VB9A 3IM0A 1XSRA 4XLCA 3I2GA 2A7AA 2OZUA 4CUCA 3AKPA 1E5RA 3F72A 4ZC3A 4OMDA 2Z99A 4DXTA 1RR8C 4YW5A 2CTVA 1X1AA 1JXSA 1RUG3 2PELA 1Z7S3 2O03A 4A0YA 4XJWA 2PXJA 4A42A 2GA2A 4I98B 1N25A 3Q0VA 3V56A 2FA5A 1X9PA 3VKLA 2XUBA 3I2KA 1UHSA 2VB6A 1P4XA 3E6CC 4DUVA 3AG2H 3RCOA 3KFWX 4QPGC 5KC6A 4BL0B 4ENKA 2YS9A 4UBGA 1IXCA 2JA5J 2E1OA 1SMVA 1K42A 5FPZA 2ZA9A 1O4ZA 2ZMKA 4XMIA 3BY6A 1DPUA 4E2GA 2ZMEB 5CA6A 3WLUA 3KP6A 2B46X 2RV9A 1IV6A 1GZTA 5HCHA 1EV7A 4CUAA 4GO1A 4AIJA 5A3LA 1JZ3A 1HW2A 4Y4YA 1H9TA 4JAAA 2LNBA 2P5KA 1UF2C 4C8DA 4NBQA 3TGNA 1QZEA 2K2SA 4CUGA 3H92A 1JTYA 1W28A 3HRMA 2MEV1 3USUB 1UYXA 3B9CA 4KYWA 2WS92 2LTPA 5APAA 2ET1A 3WE3A 4XUTA 1A04A 5E79C 1W1WE 2JDNA 4Y20A 1BN5A 4H55A 2XSDC 5DTDA 1RGSA 1R7JA 3B01A 3MVPA 1DGRM 5LB6A 4CDXB 3AFHA 3I56I 3O6BB 5IVFA 3RZMA 2L9SA 3UESA 3IP4B 4CCDA 3GHNA 1NCRC 3RZKA 3ORJA 1H2LA 3HOTA 1LQ1A 1SLLA 1K12A 5C8CC 2ZBKA 3DTIA 1HB4A 1UY0A 2D45A 3Q8AA 4QHZA 1QPIA 1YQ5A 2XR4A 4S04A 1FOKA 2FDGA 4BQ1A 1QOSA 2QQ8A 1B4AA 3W6KB 4NQWB 2H6BA 1EY2A 1RUH2 3JTHA 1RJ7A 1FBQA 4LHSA 2VH9A 2VTXJ 2HOEA 1JBCA 4J01A 4AI9A 4Y17A 5JZGA 5J98B 2HFHA 4FPYA 5KHHA 3AMHA 2RM22 4JKKA 1VBE2 1N1TA 1IW7F 2WWYA 5LZ6A 1MQTB 2QKDA 3FC0A 4EE2A 5CKTA 4Q2FA 4P9XA 4AD9A 5C3SA 1HJGA 1P6RA 2VZUA 4YW3A 3HTSB 4NUBA 5D6EA 1D0HA 1WW5A 4YNIA 1QHGA 2M4GA 3GW2A 5HS9A 4N9HA 3I4PA 1IG0A 1W5CC 1SLBA 3FBIB 4ZYDA 3PMEA 1H30A 2Z79A 1ZYRF 2EFOA 1M1EB 4O9GA 1HB2A 1W8TA 5T50A 1RNLA 3LSKA 4A7ZA 4MHUA 1WJBA 4PJ0C 3IWFA 2Y60A 1Z7S1 1U9OA 1X82A 5DUXA 2NVXJ 1AWCA 3M1CA 5C5TA 3I8TA 5GZDA 3RZOJ 1NTCA 1NCQB 5DDJ3 3HOYJ 5KC5A 1CPMA 1RUE1 5FMDA 3NQOA 2D3PA 2HEOA 4AIHA 3H5RA 3KF3A 2YDEA 4MGIE 3U4XA 2FHRA 1KJLA 4WVMB 2EWNA 1RVF1 4Y5Z0 1NY72 2QUOA 2JA8J 1A5JA 2CV1A 3NAPB 4WK8F 2JE8A 3SJMA 3VB2A 2P6TA 2R1DA 3C2GA 1ONVA 3VBHB 2F4LA 1HN0A 2QWWA 3HNYM 1LFUP 4U36A 1ZZCA 4L8QA 4HOOA 2MLKA 2MC3A 2RMU1 1NK2P 1HIXA 2AZ5A 5GZFA 2CW8A 3K2OA 4JGYA 1RC9A 3CDHA 3L2VA 1MNEA 2DF7A 1ZRIA 4XF0A 3FXJA 2Z4FA 3M4OJ 1J3RA 1SAXA 4BQAA 3OL4A 4JOMA 4LBMA 2CUEA 3WG4A 1KGYA 1HXDA 2OF7A 1QOOA 3SCFA 1E17A 4C2UA 2PMZA 3QYFA 2FNAA 3I97A 5FRNA 2LR8A 2J1UA 2K86A 4JX6A 2F6BA 1W9YA 1GKBA 3VKMA 1MZBA 4UF0A 1GQPA 4IZZA 1AL23 4XFFA 2DXIA 4LT5A 2W84A 2BBAA 4C3IJ 3AL0C 4LLNA 1PK6A 4MXVA 4ZZ5A 1VJ2A 4LHKA 5DDJ1 3UKNA 5GZCA 5LEJA 2M2EA 1XE7A 5HBAA 3GLXA 2X53S 3USUA 4E7JA 2J22A 4L97A 4CCOA 1GNYA 4ESBA 1OCCH 5EP9A 4XBLA 3KV6A 4QKBA 4HVRA 2WV0A 2WWSA 1RJ8A 1TE1B 1WZ2A 3POJA 5DUIA 3S3NA 3MIEA 5T5LA 1TQ5A 1YS7A 2IS1A 3V0BA 4PGHA 4MTEA 4DQ2A 2VC1A 3C8XA 2WADA 1O3RA 3T0BA 1QXJA 4P9FA 3KF5A 1SAUA 4UB8C 3CUQC 1QJFA 2I07B 3VDCA 2BNMA 1UB9A 2MH2A 1C8M2 2QDRA 2PHUA 1R081 5E1XA 1OH3A 2WZR2 4MGZE 2YC2A 5KVRA 2RN7A 4K8RB 4XBNA 3HN3A 2ZGPA 4G9SB 5A7WA 2RNJA 2XSJC 2K27A 5FZIA 4HOBA 4WXCA 2IXCA 4HKOA 3NV1A 2HQAA 1AYM2 5GPAA 1W6PB 5JHUA 3WG3A 4RR3C 5E17F 4XK4A 1FOD1 3PJQA 4ABZA 2F4IA 2AHQA 3N7JA 4YG0A 5ILVA 2RJKA 1OUSA 3DU6A 3K48A 4A3GJ 1A8DA 2RR12 3N7MA 4RS8A 3MN2A 3GGLA 5DZFA 1WCUA 2MH9A 4AEMA 1UG2A 1CONA 2WBMA 1UY1A 1RUD3 1H2MA 2VOKA 4MHRA 4XLNF 4HNUA 3WTSC 2E9QA 3BGAA 3MAJA 2JG9A 5BNNA 4N53A 1I3HA 3W9AA 1BQPA 2W68A 4PK4A 1VFCA 4L11A 5M5YJ 2X5IA 2JKBA 1XU2A 4UUSA 4E8DA 3THCA 1E3HA 1U2WA 1EV11 3P1IA 3BOQA 1W2OA 3M8LA 1YCIA 2RS12 2VKVA 1IC8A 4A12A 1REFA 2JDPA 5T5PA 4A5NA 1HOMA 1PK6B 1E5SA 4G6QA 4GGGA 1PK6C 3E6DA 1ZM1A 5G05L 4IEOA 4ESFA 3COAC 1XDSA 4LG0B 1ZGWA 4OHZA 3U78A 2OQ7A 1K5MC 2R1BA 1KITA 4YW4A 1UYYA 1XJAA 3VDAA 5CNAA 2A6EF 5LRSA 2OTLI 3I3MA 3IBMA 3ZXLA 3CJIC 2OA2A 4HVQA 2E5NA 4B4CA 5F5AA 3X29B 3S3MA 4PCRA 4PZJA 4CH7A 2E53A 1RESA 1XGNA 5IK4A 4HKWA 2X6WA 3SEEA 4DZGA 2XAFA 4MEYF 2DK5A 1VBC2 2WAAA 3QPTA 4XN3A 1Z1DA 4XQ4A 1DDLA 1R092 2RG4A 4P9UA 3OR2C 5CADA 2RS33 4Y13A 3MF9A 1HW5A 4QQOA 3MIHA 1FMD1 5JMOA 5TRDA 1LGNA 1R1A2 1TWGJ 3VWBA 2BWCA 4LO6B 1JHHA 2VQUA 4LOSA 4OHVA 1OPOA 2LREA 5FUIA 3JSPA 1UXXX 2IJLA 4YZ1A 3KEOA 4OU0A 1WJFA 1X36A 3DBLB 3T0DA 3RZJA 1GANA 2O8QA 5JIAA 3PURA 3E1SA 1A35A 2VZPA 3CC2I 3ZR8X 4L18B 3ZXAC 4CU8A 1XG1A 2V26A 2IFRA 1JHJA 1XE8A 2CUJA 1FPQA 2CO5A 2HWC2 3AG4H 5EZHA 1UZYA 2D5HA 4BA6A 2K9LA 1HF0A 2V1NA 1ENSA 5FZLA 4UXAA 3O8GA 5GPCA 1R1UA 4XR6A 3S93A 2DVGA 1IF1A 1N1YA 5CU1A 4HZFA 1NZCA 2ADUA 4MGRA 3MIGA 1OCPA 3W2AA 4URTA 1FOYA 1R5ID 2K9ZA 2O3FA 2ZACA 4XFCA 2B4KA 1AR83 2RMU2 2A5YB 3VZJA 2VU9A 2AC1A 1B09A 2D6LX 5A2QK 2P4EA 5FZFA 2IWGB 2QVOA 2VGDA 5L9BA 2XB0X 1V00A 1MGTA 3OBTA 2X1EA 3DPLC 1B72B 1OCZH 1Z7S2 1AYM3 3C2UA 4B47A 5LA2A 1YC61 5T5OA 1ZX5A 2C0ZA 1US2A 4AQ2A 2L7FP 1KQ8A 2ZBJA 3KEQA 2XF5A 1BBT1 2XAJA 4GYIA 3T5XA 1LU1A 1ZELA 2YUSA 4P1WA 3C7HA 1UY3A 2TBVA 2Y8KA 3BYWA 1IKQA 3K4LA 4IE6A 5DUWA 2HH9A 3GTJJ 5FY9A 5BNPA 1Z6RA 1YLLA 3C7EA 3TNQA 4Q5SF 3BTYA 5LATA 4I30A 1CVNA 1VBE1 3JZVA 1RUJ2 4P9GA 3ZFFB 2ZZQA 2Y69H 3HTUA 3I4NJ 2CQNA 4GRIA 5A7OA 2VJJA 2DU1A 3H7JA 2ZXQA 2CW7A 4EWEA 2P7VB 2HWC1 4W1UA 1Y56A 1GU3A 2WFF3 3VHRA 1JUSA 1MBHA 2JDAA 4QX8A 4LK7A 1NA1C 5JI7A 1TZLA 5ERIA 1Y0UA 3DYPA 3IDEA 5L36A 5A6QA 5JR2A 1CN1A 3G71I 4D0QA 4RHV2 4IEQA