5F1RA

The transcriptional regulator prfa from listeria monocytogenes in complex with a ring-fused 2-pyridone (c10)
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
236
structure length
229
Chain Sequence
NAQAEEFKKYLETNGIKPKQFHKKELIFNQWDPQEYCIFLYDGITKLTSISENGTIMNLQYYKGAFVIMSGFIDTETSVGYYNLEVISEQATAYVIKINELKELLSKNLTHFFYVFQTLQKQVSYSLAKFNDFSINGKLGSICGQLLILTYVYGKETPDGIKITLDNLTMQELGSSAVSRIISKLKQEKVIVYKNSCFYVQNLDYLKRYAPKLDEWFYLACPATWGKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Listeriolysin regulatory protein
publication title Attenuating Listeria monocytogenes Virulence by Targeting the Regulatory Protein PrfA.
pubmed doi rcsb
source organism Listeria monocytogenes serovar 1/2a (strain atcc baa-679 / egd-e)
molecule tags Dna binding protein
total genus 74
structure length 229
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5f1rA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5f1rA01
2P6TA 2WC2A 3D5LA 1J2XA 2FA5A 4LB6B 5JR7B 4RB3C 2D93A 4LMYA 1LR5A 3S0MA 3TGNA 3IWZA 4YRDA 1CX4A 2P5LC 3S7IA 2FNAA 2V09A 4GULA 2OZJA 3GZ6A 2GA2A 3DPLC 1TQIA 1H9TA 2PMUA 5E1WA 1Y9QA 3J81K 1MGTA 1ZARA 3LOIA 3BWGA 4EGZA 4LEJA 5D5WB 5HDKA 2P4WA 3IL2A 3V8JA 2Z3YA 3ECOA 1Z6RA 2KRFA 2XHKA 3GLXA 4UVBA 3Q5FA 5D8LB 5ILVA 3NQOA 1JHHA 3FZ3A 4HLYA 3V7RA 3RJPA 4M6YA 4Y15A 5L3BA 4LG0B 4WVZA 4I0BA 1RTVA 4IEOA 4IEUA 1Z05A 1G3TA 3F22A 3ABTA 2XASA 3BJAA 5L3DA 4EM2A 3M70A 2KJCA 4LLLA 1O7LA 2RC4A 1R1UA 1VP6A 2HZTA 3C3VA 2XVCA 2QQ9A 3UKTA 2QBYB 3CJNA 3O3KA 2FQ3A 3OD0A 3SMHA 1IZ1A 2FBIA 3HTSB 5KK1A 3U2RA 5HOOA 1CAVA 1HW5A 3ZMTA 5JFRA 1XCVA 1W7PD 3ABUA 4QGNA 3E6BA 2DQRA 4AXOA 1IXRC 2Z9OA 3DL3A 1HW2A 1S7OA 3FMQA 3V4GA 2XROA 3O2PE 4S04A 1O5LA 1S6LA 4LLOA 5HVQC 2PQQA 1D8KA 5DYMA 3KP3A 2H6CA 1QXJA 3HYIA 1NYWA 2MH9A 3IDBB 3DN7A 1YW9A 2O3FA 3T1BA 3CUQB 3Q9VA 3L9FA 1B9NA 4HX7A 4S05A 2CAUA 2MLGA 1ZZ6A 2EV6A 3HTUA 1J3QA 1G3YA 3WTSC 4HF1A 1MKMA 2VODA 1UIJA 4G7OF 3SFZA 5CVRA 2FU4A 4IHSA 3VOEA 3F8NA 1SFEA 4JTNA 3NSTA 2PLYA 1EPZA 4L9JA 1FBUA 1QZZA 4MGZE 4U0YA 3UKNA 3NRVA 4HLXA 1OPCA 5KHIA 3SXYA 4ONUA 2DK8A 2HKXA 2NNYA 5LRSA 2CG4A 1XE8A 2IPQX 2CO5A 1IN5A 1DUXC 2MH2A 1WSUA 5I0TA 1JE8A 4Q4ZF 1S3JA 1J3RA 3N4MA 1G3WA 3AAFA 1ON2A 2ZKLA 3GF2A 5LBQA 1O3QA 1ZAOA 1IUYA 1YUDA 5CADA 4MGKE 2W84A 1RGSA 1O5UA 3SCHA 1FP1D 1EYBA 5ICEA 3LAJA 1XDSA 4G6DA 5EFUA 1ZYRF 2Q1ZB 1LDDA 1R1TA 4NQWA 4OIPF 1XE7A 1BJAA 2PEXA 4Z07A 5ILUA 3I7DA 1MJ9A 5JSOA 4IRGA 3OV8A 3MZHA 2MPFA 4K2EA 3H92A 3MPBA 4RAYA 1FWZA 2YX7A 5K5QA 3BJ6A 4KYWA 2E9QA 1Z1DA 2CSOA 4E2GA 4QLCU 1FZPB 1X3UA 2GH2A 5TRDA 1UFMA 2H0VA 2L4AA 2VC1A 4RAZA 3ZMSA 1HKQA 2Y75A 4RGUA 3CDHA 4HVOA 5JI6A 4EWEA 4A0ZA 4RGRA 4IEXA 4L18B 3FWEA 3OCPA 5T3NA 5J7MA 3DXJF 4Q0SA 2YR2A 4KNYA 4O9EA 1H0MA 1R22A 1HSJA 2HWVA 4ESJA 2VXZA 2EFOA 4FT8A 1KU3A 5CVIA 5CYVA 5FGMA 2BNNA 4IVNA 3QAHA 1YFWA 4EM0B 4LULA 5FLXZ 3BU7A 4AVPA 5JSRA 3U9GA 3L2HA 5I8SA 2F5DA 3K1MA 4N9IA 2GXGA 3ROUA 1U3EM 2PHDA 4HN1A 1P92A 3BDDA 4XFFA 1F9NA 1PMIA 2FE3A 1I1GA 5EEGA 2H94A 1DZRA 1B1BA 3ZMZA 1BI2A 2R7DA 3CL1A 4QGMA 5K5RA 2ZMEB 5JHUA 2K4JA 3HOTA 3RDIA 3U1DA 5LRRA 3EBRA 1ZGJA 3WTUC 2MC3A 4JV4A 1DP7P 1B6AA 4UBGA 1YQAA 3TNQA 1FX7A 2PQ8A 2VC0A 4ENMA 2L4MA 2K02A 1XD7A 1Q3EA 3C1DA 3WW2A 1H1IA 1JUHA 1BC8C 2Z69A 1YYVA 4NHJA 2CFXA 3TOBA 3FHZA 2X0LA 1FBQA 1GXQA 2DPDA 4EMSA 3I64A 4ESFA 4BYYA 3TQNA 1ZG5A 1CAWA 4EGYA 4FAHA 3DFGA 3NKTA 5BS6A 4YFKF 4U7BA 1KGSA 1H9GA 1RUNA 1IN8A 4EM1A 4IEYA 4KA4A 1ZZ8A 4YYOA 1LDJA 4CYDA 4XFBA 2BNOA 5F64A 3TOAA 1KQ8A 4N0BA 3MDPA 2OQRA 1HSTA 1ON1A 2B5HA 5DD8A 1ZGAA 3M7GA 2V9VA 2GQQA 2FEZA 2JRTA 2LKPA 5EEHA 3K0LA 1MDMB 2K4BA 4KT5C 3S7EA 3I71A 3K1PA 2HTJA 1FP2A 1F1ZA 5LGNA 1RZ4A 4KU8A 4QM9A 4GYIA 2GZWA 2TDXA 4RB2C 4BH9A 4G6QA 2W25A 1UHMA 3WW3A 4KN4X 3T8TA 1BI3A 3KMHA 4HF2A 1Q43A 1LB2A 2GC3A 5EZWA 3EUHA 5E1XA 2EFPA 3WGIA 1J75A 2G7UA 1FOKA 2VE9A 1QZYA 4H0EA 4LG0A 5K5OA 1FPQA 1OYYA 4UV8A 1QXRA 5L3GA 2IXJA 5DUIA 3RYPA 3VODA 4M72A 4FX4A 2OA4A 4HVQA 2ZNZA 1O3TA 3F8FA 2E1NA 4KWJA 5LHIA 3ML6A 3WU1B 2PFBA 3HRUA 1YWKA 2D1VA 3VHRA 5FLXK 5J6XA 1ZREA 5LHGA 3K1NA 3SZPA 2FF4A 4XEZA 1UB9A 2O61A 4E2SA 4CXFA 2KIUA 3FMRA 1K79A 1GQGA 3M3IA 4F7ZA 3FX3A 4R79A 2WFPA 2FQPA 2JPBA 3KP6A 5A2QZ 2XL7A 1P4WA 5FPZA 3WGHA 2M30A 2OZ6A 1QPMA 3JTHA 3WTVC 1ZZBA 3P7NA 1ZRRA 1P2FA 3JSOA 4XBFA 1C0WA 1IN4A 4ZYHA 5E17F 3BPVA 3RNSA 4Q0UA 2V1UA 2A5YB 1YG2A 5D4RA 5F6FA 5BMZA 2JZYA 3MQ0A 3G73A 3JW4A 4A12A 4GYGA 3VB2A 4L0ZB 4KN7X 2XAJA 1CF7B 4G94A 1ZLJA 1QY4A 2QVSB 4MX3A 4MGYE 4U7DA 5ICCA 1ONVA 5E16A 4O6JA 3I54A 5AIQA 1X8MA 4LA3A 2VBYA 1ZRCA 5C8WA 2XV4S 3EYYA 4XFCA 3R4KA 3U10A 5DCMB 2PAMA 1FC3A 1LDKB 5DUKA 3WTZA 1SD7A 1J59A 2V79A 3SQNA 1U6GA 4XF4A 3COAC 4QWQA 1F4KA 1Q5OA 5J3UA 1I27A 1IXCA 3GFIA 3T0YA 2B8MA 2P7CB 1J58A 4CHUA 1XN7A 2NS0A 2PAEA 2IT0A 3H7JA 1W7PB 4P9GA 1R58A 1VJ2A 4UXNA 1UIKA 4RGSA 3CO6C 1J5YA 1BI1A 1B9MA 2OA2A 5FD5A 3ERED 3HIFA 2A3SA 5JAXA 2DTRA 1STZA 5FLIA 3KETA 4K8FA 2D40A 1V3FA 2ETHA 4ZU5A 3WODF 2W85A 1J7KA 2E7XA 3KP4A 3WTTC 4HVRA 1QQIA 3MAJA 5CJ9A 3D0JA 1DPUA 2DCTA 3NW4A 1P4XA 2OU2A 2QVOA 3H7YA 3R0JA 3KZZA 3HRTA 3ZPLA 4XFHA 1OKRA 4F8AA 1OYWA 3KP5A 5KHJA 3P9CA 4YIFA 1PUEE 3CJXA 4QX5A 3USSA 5FLHA 2UWMA 2BE5F 5FFZA 2VONA 3EHKA 1XB4A 1VR3A 2GU9A 4WF2A 1LVAA 2H27A 4LFUA 4Q5SF 3WW1A 4EWAA 2UY9A 3RPUA 2EFNA 1SD5A 1XSXA 4I7HA 3H50A 4HW0A 2PG4A 4RGXA 1B59A 2NNNA 1K78A 1EH8A 3H1YA 5HS8A 4Q47A 1L3JA 4BQAA 4RB1A 3G7DA 4IPAA 4PDKA 1OR7A 3SCFA 1XGSA 2GC2A 3HSRA 5A2QK 1OD5A 3SHRA 5DEQA 1WRJA 4CICA 2C0ZA 1JXSA 1LEBA 2QJVA 3EDPA 2RV8A 4FAGA 2RNJA 4ORFA 3I53A 2O0YA 4RD7A 1WA4A 1NE4A 2IXKA 2VN2A 4HF0A 3SXWA 1U5TA 2Y0OA 1GVJA 2IA1A 2HS5A 3F8BA 5JVTA 2JT1A 1R00A 5KHGA 3FJSA 1QWRA 2ZXJA 4TLFA 1TBXA 4LGWA 4GO1A 3KGZA 4MV2A 2AXLA 4L2NA 2O1QA 2PA7A 1DGWA 5E1ZB 1D3YA 1YHFA 4B29A 2Y0MA 2KXLA 1XGMA 1YW8A 1IW7F 3SCGA 5BY5A 5BPIA 4IESA 2EWNA 1TQMA 2R7FA 3BY6A 4HAMA 4U0WA 2VBXA 4L9VA 1U78A 3F6OA 1TW3A 3I0TA 5HLHA 2ZJ2A 2W24A 4IRIA 2J5PA 2VPVA 3EQEA 4META 4KWLA 1JHFA 1RNLA 1W5SA 3GVAA 5D5XB 3KE2A 4P5OA 2DI3A 1X7NA 4XF0A 1MJBA 4HV6A 3PQJA 2BYVE 2JSCA 2ZNYA 1O7FA 1U5TC 3C18A 3L00A 4HN0A 5LGTA 1EH6A 3KLOA 2PAKA 2QLZA 2O8QA 1K7AA 3TDUC 3I58A 3ELKA 3ZN1A 3GBFA 4ZU4A 5BV6A 4M9XA 5AVPA 4G9YA 4ENJA 1BI0A 2O6GE 4XLNF 3GO5A 3KFWX 4O3MA 3DV8A 3KSCA 2H6BA 3O14A 3TNPB 1Y0UA 1ZNPA 3R6SA 1RL3A 2GXBA 4MTDA 3TO9A 5HDNA 1YS6A 1R1VA 2XLAA 4Z82A 2ESHA 4HX8A 4AQ6A 5D6FA 2IJLA 2HYGD 3RTRA 4LJZF 4HSLA 4KMUX 3ISPA 3QRFF 4AD9A 3TO6A 2NYXA 5I8TA 4LK1F 4EWDA 4UHTA 5D5UB 4E70A 4OMZA 2D5HA 3F8CA 2HYFA 2O8XA 2VE8A 1BC7C 5BXXA 3K69A 1U8RA 3HT2A 4MHGA 1IPJA 4MUVA 4EJUA 4XETA 5IT9Z 5I8YA 1DPRA 3B73A 2EA7A 1PP8F 1WGPA 4I2OA 1ZZ9A 1EV7A 4IJAA 1ZVFA 1XMAA 3BJOA 2CAVA 3E6CC 1T98A 3E6MA 1ODDA 1X82A 1V70A 1NE6A 2PHLA 3HT1A 1V4RA 2EJRA 2FNPA 3E5XA 5BPXA 3ZMVA 2HGCA 3RYRA 1GHCA 4IHTA 2OD5A 3GFJA 4RB0A 3ACLA 1XCBA 4BHPA 2BEOA 2VBZA 2MD5A 2KJBA 4DINB 3WGGA 5HS7A 2CW0F 1T6SA 3DEUA 1P4AA 4MEYF 1NXMA 1Z9CA 5L3CA 4IERA 4MH0E 5DCMA 2FOKA 2Y48A 3E5QA 4G7HF 1MD0A 3DP7A 4LTAA 3DF8A 3KEQA 2XKPA 4X6QB 4JQFA 1U12A 2NAZA 3CO2A 2QZ8A 4L5IA 4M9ZA 3RPQA 3ES4A 3I59B 4MNUA 2C6YA 4X6RB 4ZZDA 2DQLA 4I98B 4BNCA 5I93A 1W7PA 3BB6A 4U0VA 3RI4A 3GX4X 1TTYA 3E3VA 2ZFWA 4YFXF 2ACJA 2Z2SB 3NL1A 3WU0A 4BIFA 3FXUA 4IETA 2CQKA 2K0GA 3WE2A 1KA8A 5D1IA 1J3PA 4XLPF 3BPXA 3GWZA 1BIAA 3L09A 1XGOA 3IKTA 4LA2A 3P9IA 4PZJA 1OFNA 4UBHA 4XF3A 3F23A 2M45A 1D5VA 2Z5UA 5I0SA 5JR3A 4KFCA 3QU3A 2LSOA 4AVCA 5IT3A 3HHHA 2AS5F 3BCWA 3QPHA 2UYAA 2A6EF 3H3ZA 2ZBKA 3S2WA 2A07F 2FMLA 3TO7A 3H1WA 1WWXA 4PGHA 3NVCA 3M1EA 3JAMZ 3H8UA 5D8KB 1G3SA 1EY2A 1BBYA 5H20A 1ZRDA 2DPUA 4UVAA 3D0SA 2F4PA 3ZQ7A 4A6DA 4HQEA 2EA4A 2XUBA 3FXQA 5AIPA 4FBFA 3LQRA 1YFXA 5ERIA 3GEZA 4YG2F 2EAAA 1FI2A 5CVUA 4MQVA 1HW1A 2K86A 2M1BA 3WW4A 4ZYEA 2PI0A 1MZBA 4A2UA 3ULQB 5LGUA 4EROA 2PYTA 3ZMDA 5IT9K 1J9IA 3L7WA 4A5NA 2IRFG 1FYMA 3C7JA 2J5OA 2JTVA 1R7JA 4M71A 4G7ZF 3V7CA 3GXOA 3IKVA 1NZCA 1SFNA 2XAFA 3LSTA 3K2ZA 2WTEA 2OAZA 4WXHA 1CGPA 2VOPA 1HXDA 1EH7A 1FT9A 5F1RA 2ATFA 2QBYA 4XRFA 4XSXF 2E1CA 1UCXA 2P5KA 3CTAA 1Y3TA 4IEVA 2RDPA 3OGJA 3FE5A 3H9AA 4UV9A 4ON0A 4LLNA 2XAGA 4LUMA 1T38A 1I5ZA 1IRFA 2WV0A 1TQ5A 4BXUA 2FXAA 2D5FA 4WK8F 4OMYA 1I1SA 3PLQA 3ELNA 1ZLKA 2PBIA 3U11A 2QWWA 1IAWA 3IRQA 5FFXA 3QU6A 5LEJA 2BBYA 2KKOA 2ADUA 5E8IA 4LUKA 2OZUA 1YLLA 4ESBA 3J80Z 4XSZF 2XGXA 3CUQA 5KHKA 5CU1A 3ST7A 4HQMA 4LLGF 5KVRA 1GQHA 2XL9A 2DU9A 3LA2A 5ICGA 3IBMA 1L3LA 1WLTA 2Q30A 3QOPA 1WI9A 2BGCA 5JSPA 1CAXB 4AIKA 1YW7A 4B8XA 2MNGA 5HDGA 5FCCA 4L9NA 2MLKA 3ETQA 4Q0PA 3BROA 2PN6A 3WG9A 5E18F 1SQ4A 3CO7C 3H3UA 1BN5A 3BOQA 3T8RA 4P9FA 2P6SA 3HRMA 1USSA 1UCRA 3HHGA 2ISZA 4Q0QA 1DGRA 2FMYA 2DFIA 3SHFA 1LJ9A 4OLLA 4R8HA 3I4PA 1Q1HA 3BALA 1RUOA 1T2KA 3RKXA 4AVAA 2E7WA 2OBPA 1HKSA 2VOOA 2QNKA 1MJAA 3CUOA 5FPXA 2IP2A 4YIIA 3OOPA 2STWA 3LAPA 3JAMK 3RIRA 4L9TA 2Q8KA 2Q0AA 2F5FA 4L11A 3CUQC 1S29A 4YSFA 2XLFA 1K6OA 2Z33A 1U2WA 4Y13A 2UYBA 4WZCA 2QDRA 5BQTA 4R52A 3HOSA 3W6KB 4ETSA 2DBBA 2MBFA 4MGRA 4I3PA 4OINF 2M5WA 4WX9A 2BNMA 4KU7A 3ZMUA 5K1YA 3MWMA 3IHUA 2K9ZA 4I02A 1WQ2A 2QCSB 4GXOA 2EA2A 1PDNC 3CEWA 2LF8A 1KYZA 4QM8A 4AIJA 1XSDA 3M8EA 3PNAA 2GWRA 2H09A 2PMHA 4EJOA 2CGPA 3G3ZA 1SFXA 2FBKA 2YSRA 3HSEA 3HSFA 4MGIE 4WXDA 1KU2A 1O3SA 1LRHA 3HRSA 3D82A 4EJVA 4ZZLA 4PCQA 3BP8A 1ZHFA 2P5VA 4QGLA 4WWCA 4GGGA 2XIGA 2UXXA 3E5UA 4ENKA 3ZDSA 4UNOA 3PFIA 2L02A 4J1XA 2CWEA 3IDCB 4NB5A 5HLGA 2GA1A 2HFHA 2LDUA 2V6CA 1DDNA 3RKWA 2I45A 4M74A 3J80K 1ZG3A 5ICFA 1O3RA 4HZFA 1G4DA 4LB5A 1RI7A 4M9SA 2HJIA 4P9UA 3I5UA 1YO5C 4UUVA 4NVPA 1SFUA 1HQCA 1IXSB 5H6RA 3LQQA 2UZKA 1F5TA 4EV0A 4KL1A 1T39A 4A6EA 4PGGA 2F2EA 2ZMEA 2XRNA 3WTYC 4YARA 5J8FA 5FB2A 3LWFA 2GC0A 2EK5A 1YS7A 2QYOA 2IXLA 2IXHA 3T5XA 4AVBA 3KZYA 2Z99A 3WTXC 2D45A 4RS8A 3KP2A 2A61A 1REPC 3Q9SA 1OI6A 1FXZA 5DD4A 2CYYA 4P96A 1Z7UA 2OQGA 2Q2EA 2YPRA 6PAXA 1DZTA 3IRRA 3QP6A 4PJYA 3WE3A 1QGPA 3UKVA 4D0PA 3RKYA 3I59A 1QO0D 2B0LA 1PM7A 3F3XA 5CVJA 2P17A 3NJZA 2OYZA 1WKMA 1D8JA 2A68F 2IVMA 3E6DA 1HKTA 5D5VB 3BPZA 3HQXA 2ZKZA 2Q4SA 1KQ9A 2IA0A 4IF4A 3REOA 2HOEA 1FYLA 2M8EA 1LEAA 3O6BB 2EFWA 2RQPA 2EV0A 1SEFA 4Z2YA 2PFWA 2VT2A 4L5JA 4WCGA 1E17A 3E97A 3J7AO 1LNWA 3R60A 2YU3A 2GIVA 3M8FA 3VEPA 4OIOF 1BOAA 4KICA 3GYDA 1S7AA 2MHFA 2NRAC 1MDMA 5LLQA 1YFYA 4Q29A 2IW5A 3DQVC 1EP0A 2V1DA 1SD6A 4MEXF 1CAUB 3M9AA 3KGLA 1TW2A 3K9TA 4ZYDA 5FQ0B 1XGNA 5LEKA 3MCZA 2HEOA 2FRHA 1A04A 5E1RA 4CO8A 4XF1A 2Q0OA 2DT5A 2EV5A 4IRHA 1Z6TA 3EO6A 1ZN2A 3IIAA 2EFQA 4M73A 2IXIA 5L3EA 4G8XA 2VQAA 4O5VA 4O9GA 2B9UA 2YX4A 3F8MA 4HA8A 2R3SA 4JVAA 2MA3A 1SAXA 4PIXA 2ZO4A 3JZVA 2N7GA 1O57A 1KYWA 4AIHA 4CZZA 4HLTA 4FX0A 5FO5A 4OIRF 4HV5A 4JBAA 4UXAA 3SZTA 3CLOA 4IEQA 2IA2A 5HLIA 5D4SA 4OIQF 1YFHA 1ZRFA 1ZZ7A 2XAQA 4AWXB 1YIOA 2L54A 4XFIA 1SD4A 1K78B 4TV7A 2P8TA 2ZCWA 1P6RA 2QQBA 1B4AA 5H6QA 3EETA 4YNIA 2QUFA 1KQ0A 4LD5A 3FHIB 5I0UA 1L0OC 4XFAA 5ED4A 4JK1X 2ELHA 2FBHA 3W6JB 1KU9A 3LWCA 3KP7A 1ZH5A 1KU7A 3MFKA 1ZX5A 5AONA 4JTOA 2QQAA 3KEOA 3MEXA 2QM3A 3CLPA 5I91A 1CF7A 3RZZA 3V8LA 2LNBA 3TKYA 2DO7A 4FHTA 4BHBA 4P55A 3L2CA 2VECA 1R23A 3WTWC 4KWKA 1U5TB 1CAVB 4IEZA 1W4MA 3DPTA 1IN7A 5FDBA 1ZZCA 4XF9A 4BAYA 2XKOA 1TNTA 2ESNA 1CAXA 4HBNA 5L3FA 2ET7A 2X4HA 5CVVA 3EQLF 4OOIA 2D2WA 2L01A 1IRGA 5D6EA 4U88A 3FXRA 1ZG1A 2UXNA 4WXCA 3N97A 1QBJA 4MTEA 3HUGA 4HYEA 3GYHX 4BHCA 4AQ2A 1H1MA 4UVCA 1BM9A 1FY7A 2HTSA 3QACA 1O4TA 2HDCA 5BPDA 4LK0F 2VT3A 1J1LA 3LA7A 4D7SA 3ES1A 3EYIA 4CGZA 3R0AA 3ZP5A 3OF1A 2COMA 3ECHA 1RIOH 4I0AA 1S8NA 1UW8A 3ZN0A 4WBBA 4M6XA 2LF7A 1R5HA 3GZ5A 3KLNA 2G9WA 1AOYA 1G6NA 3PQKA 2EVXA 5I0RA 1TQPA 5FD6A 4R1HA 1FSEA 5HS9A 1SMYF 3GW2A 1E2XA 2G7HA 4A0XA 3FMSA 5FLJA 4KIFA 3IWFA 4QXKA 3LFKA 4HDVA 4EQQA 1I6XA 1R5GA 3JTGA 3QP5A 3KCCA 3VFZA 1GXPA 4QMAA 2W57A 3FZVA 1UPIA 5DDGA 2D1HA 3FFQA 2RKHA 3LZZA 1T0FA 1XDUA 2V1XA 4PIYA 4PIZA 2F5CA 1NHAA 2KIMA 2ET1A 1VTNC 5BOXA 3GUDA 1FBSA 4XFGA 4ZU7A 5ILSA 2HQRA 2ISYA 3OTFA 1UD1A 2RGVA 5DCFA 4I09A 4I01A 3RYKA 4D7TA 4DQ2A 1YFUA 2EB7A 4ASNA 5CLSA 5LHHA 3J81Z 5KHHA 1PP7U 1SMTA 5E20A 1BIBA 4ZH4F 2HKOA 3C3WA 4HBLA 4ENNA 4HSJA 2VBWA 3MZYA 4KUMA 2P7VB 4A5MA 2XLGA 2DAOA 5C6CA 2DW4A 2K7LA 4HDUA 2ETEA 2DLLA 5JCTA 2OPKA 3GFMA 3BZ6A 4KMFA 3IC7A 4CDGA 3V8KA 4YFNF 4EVIA 4KDPA 1AWCA 2F5EA 1W5TA 4L0YB 2BV6A 2IC1A 1USTA 3JSPA 5HI0A 4GCVA 3F72A 2A6HF 3PVBB 2RN7A 1IPKA 5DV5A 3B02A 2PJPA 1XRUA 3F6VA 2WWYA 3EJKA 2FSWA 4OFGA 1TNSA 3FF5A 1HBXG 3GFLA 3V7SA 2GC1A 4J1WA 4H7LA 1ULYA 2PTMA 4KIBA 5E8GA 2QENA 2O03A 1XSVA 1IF1A 1RC6A 1XMKA 1FSHA 1X8EA 1OYIA 1FNNA 4N9HA 3R61A 3QPTA 1Z91A 1YTYA 3P9KA 3CF6E 4ZYGA 2GAUA 4E2QA 4IXAA 1FLIA 1LQ1A 3F21A 3U0ZA 5K8SA 3LA3A 1OMIA 4EJTA 4Q48A 4B09A 4IEPA 3DKWA 5J8CA 2RVCA 5BUVA 3FM5A 4HOBA 5J48A 5KBFA 2DK5A 2HR3A 1LKNA 1J0RA 2HQNA 2STTA 1FYKA 2IXCA 2KIFA 5TJJA 2M87A 1TLHB 2K27A 4HMZA 1R36A 1YLFA 3FM3A 4MQ9F 4OU0A 4EJWA 2XAHA 3NEUA 2UY8A 4A0YA 4Y17A 4Q0VA 3H1MA 4IEWA 2L3DA 1CAWB 4MZUA 4KIGA 4DNCA 2JPCA 3LAGA 1IN6A 1JGSA 1CAUA 3MYXA 1UHWA 2A69F 4HX4A 5FQ0A 2CV6A 3TDZC 1QNTA
chains in the Genus database with same CATH superfamily
4RQPB 5C4WC 2ZXHA 1J2XA 5CKQA 5L7OA 2WNEA 2XUMA 4N4OB 1LHNA 3MUZ1 1IV8A 5FZ4A 1TWCJ 3OL3A 4C2UA 3WDXA 2GP3A 2DUQA 1NG0A 2VMEA 1RITA 3ATGA 4C8DA 2XGEA 4DW6A 1CX4A 1OF4A 4R9AA 1KRIA 3KHCA 2OZJA 1W6OA 3DPLC 1TQIA 5KXDA 1H9TA 5E1WA 1MGTA 4S2DA 3I56I 3LOIA 3BWGA 1VAKA 3CMYA 5HDKA 4AIDA 2Z3YA 4CCDA 4X1EA 3NNJA 5D8LB 5HCBA 5FUPA 5FV3A 1VQ7I 4OI4A 4M6YA 3FISA 2HWF1 4CDQA 1GU3A 1RTVA 2P1BA 1FOD3 3POEA 3SEPA 1XS9A 2PLV2 2CY6A 3HZJA 5LB6A 2V5YA 5GAGJ 4CDUC 2AR6A 3BU0A 1X1BA 3OY9A 5IVJA 4S2HA 5JLVA 2WY8Q 2LMDA 2DYCA 4BIOA 4P9LA 2GIZA 2Y30A 2LTPA 3RZLA 1PJRA 1WZXA 5GADJ 3UKTA 3CJNA 5L73A 3BQYA 1S0IA 3OD0A 1MSEC 3VBUB 1IZ1A 2KZVA 1TEIA 5KAFC 5KK1A 3ZFFC 3AMQA 2ZEWA 1DFQA 5JFRA 1IXRC 4AQTA 1OCTC 3DL3A 2VKHA 1S7OA 5FRMA 4S04A 1AYM2 3FLPA 5DYMA 2XF5A 3GALA 3KM5A 2O3FA 4XORA 2Y60A 3K70D 2DMTA 1R092 3WP4A 1B9NA 4A7YA 3C7HA 1YX5A 4S05A 1NCQB 1OLTA 2QQVA 1GNZA 2O5RA 4WM7A 2QUOA 1MKMA 2UU8A 1HDKA 4EZHA 2FU4A 3I4MJ 3JBG3 3F8NA 1MZ5A 1SFEA 5FBZA 3ILNA 2PLYA 1EPZA 4L9JA 1TT5B 2VNRA 1QZZA 4U0YA 3AG1H 1OPCA 3MF6A 5KHIA 5EZGA 3SXYA 4ONUA 2CL2A 2NNYA 1YOVB 5LRSA 3KWVA 1IN5A 2MH2A 3J7LA 4LQRA 1WSUA 1OA4A 1OISA 5F3EA 4CA9A 4DUWA 5FPUA 1JE8A 1PK6B 5LA1A 4N8MA 1G3WA 4FVVA 1JI6A 2ZKLA 1ASJ3 2DODA 1O3QA 3OD4A 5JI9A 3TEWA 1IQDC 5B3SH 2EZLA 5L9VA 2W84A 1RGSA 3LFMA 2R7VA 1FTTA 5ICEA 4CEWA 4CDWB 4RN5A 3LAJA 2VKEA 2W7NA 1XDSA 3G1MA 2CWSA 4MHRA 4DMIA 2YYOA 1NLSA 1VBC3 1BJAA 2HQ5A 1F5JA 3T09A 5ILUA 3I7DA 1MJ9A 4N43C 1XYOA 3MZHA 4BWOA 3CBNA 2L5QA 2K9LA 3JD72 4YGEA 1T33A 4XILA 3UYJA 1JT0A 4EZ4A 2PLV1 1KJRA 1Q8PA 1MBFA 3BJ6A 1LGNA 1ZM1A 3ZOIA 2EIBA 4E2GA 4D5FA 5GP9A 1A6CA 3U1XA 1X3UA 5FKNA 2GH2A 3IAPA 1UFMA 3O0WA 3RI9A 2H0VA 2VC1A 2LY2A 4K3UA 3CKHA 4G9SB 3S93A 1CQ9A 2VL4A 3AZYA 2F17A 4MGSA 4MG2A 5DAXA 2GXAA 5JI6A 4A3CJ 2ZGLA 5T3NA 3FK6A 3K2AA 4Q0SA 2R042 2JA2A 3MW3A 5GLTA 4KNYA 2L2OA 1R22A 2WB1A 4CU8A 1E3PA 4IQPA 1KU3A 1ULOA 4XZUG 4EM0B 2FZ1A 3N9LA 5FLXZ 3A2KA 1S0BA 2J1RA 2NQYA 3K1MA 1R091 2N8GA 2WZR2 2EIGA 2GXGA 1U3EM 2PHDA 3F9KA 3PTRB 5JI7A 2OC6A 3ZMZA 3CL1A 4MXWA 4FPKA 5JHUA 2K4JA 4NHLA 3PUHA 1LNSA 4ISQA 4WM8B 4LO4B 1NAEA 4UBGA 3H35A 1FX7A 3QBQA 2VZVA 3ZXDA 1OC1A 2DA7A 2VQUA 5J4YA 5K7FA 3THPA 2EXJA 4AI3A 1GLHA 4ITCA 3S57A 4QQ2A 2CFXA 2HWD3 4AQSA 3POYA 5A7QA 3WF2A 1REDA 1DQ2A 1FV3A 1ZG5A 1UY1A 3CP2A 3K4DA 3WDTA 2HYJA 4P9IA 2D6KA 1H9GA 5FOBB 1IN8A 4KA4A 1ZZ8A 5F37A 3H9GA 2W1OA 4CU7A 3TOAA 1SVLA 1E5HA 3WDUA 4R4ZA 3MDPA 4Z8BA 2BU9A 2B5HA 5DD8A 1ZGAA 3M7GA 2X05A 1ND2A 3ZKYA 2GQQA 1REFA 3AL5A 2W1SA 2R5YA 5A6XA 2JRTA 4PT6A 3I71A 3K1PA 2HTJA 5F08A 3J7YJ 1WW4A 1FP2A 1F1ZA 3SZGA 1IGOA 4G6TB 3JD71 4IW3A 4OYUA 5C3RA 1AR73 3EUHA 3MZ8A 1PVXA 3GTKJ 3KQRA 3L9JT 1BZWA 4H0EA 5K5OA 4P00B 1OYYA 1QXRA 1UOJA 4QXCA 2M7AA 1VQPI 1AX2A 5EGOA 3IP4B 4M72A 3DLLF 2LY1A 1QGLA 4FX4A 2CTVA 2BHZA 2XWJB 2R041 4XR6A 1IS3A 3J7HA 5JPNB 1W99A 4KWJA 5A1LA 3M4FA 2R0FA 5LW9A 4KISA 3O7OA 5I0DA 1SLIA 5GTIC 4KGQA 3K1NA 3SZPA 4YW6A 4XEZA 4Q4Y2 4E4SA 4CXFA 2KIUA 3T0BA 3FMRA 1SZBA 3CCMI 1LE8B 3M3IA 4F7ZA 1HKDA 5FZ6A 2P3YA 4R79A 3ZFGB 4AFDA 1R5ID 1UQXA 3LIHA 3VZNA 5A2QZ 3HOWJ 1P4WA 3WGHA 2VZUA 1JYCA 1QPMA 3JTHA 1VBD3 1XXNA 1S0EA 2VGDA 4AU7A 4K21A 1IN4A 3RNSA 2Y0SA 3C2BA 4Q0UA 4O61A 1OCPA 4CP9B 5F6FA 1U0AA 4Q8LA 3TMOA 2XAJA 5FUIA 1ZLJA 5E16A 1ZRCA 5C8WA 4DZJA 1HRV2 4AEJA 4ZS2A 5E79C 4ARXA 1JKOC 3TEDA 1SD7A 1J59A 1U6GA 4IL6C 3G1OA 1KDKA 2G9FA 1N3OA 4QWNA 3B93A 5K0UC 4OHXA 1IXCA 3DWLE 4JX6A 1R71A 4E7IA 2ZX3A 3A0BC 3H7JA 5FAXA 4BK5A 1W7PB 4P9GA 4E27A 1Z0HA 4RGSA 4D7NA 1PMHX 2ME0A 4P9JA 4QPGB 2OA2A 5FD5A 2A3SA 1DF0A 1STZA 5FLIA 3A22A 3KETA 4C0HA 1P7IA 2AREA 3AMNA 2VD7A 4W4ZA 3WODF 1ZBA2 5F6LB 4BJ0A 3SDBA 2WO3A 5FK8A 2E7XA 3MW4A 4NE9A 4XJUA 5IW0A 1WPKA 4YZ2A 2ZXIA 1QA6A 4CEYC 1GV2A 1WH7A 1DPUA 2DCTA 1Q8QA 2WFF2 2WYFA 3DYOA 1UYXA 1H0BA 1VBB2 3KZZA 4DPNA 3ZPLA 3ZN5A 2YFUA 4CPBA 3VBFC 2C9KA 3USSA 2CH0A 3W2AA 2VXJA 3EHKA 3RI8A 2NVYJ 1C5HA 4JHZA 2H27A 3CD6I 5CB7A 5IFTA 4C9YA 3RPUA 2CDPA 1K4TA 1SHWB 4NPLA 3H50A 4HW0A 1BVP1 4C30A 2VQCA 1EH8A 4KBBA 5HS8A 4Q4Y1 4HPKA 3ZX7A 2VJ5A 3G7DA 2H8RA 3SCFA 4RYDA 1LESA 2GC2A 4GB31 5FBJA 2R7TA 4ZPIA 5DEQA 4OQ9A 1C57A 3RFRA 2W9XA 4AFMA 2WNUA 2YMZA 3W59A 2RV8A 1AYM3 2BUKA 4FAGA 2RNJA 4CDXC 1GMMA 1NXD1 3N9MA 3CMGA 4RD7A 1WA4A 3VV1A 1VBA2 4QXBA 4HF0A 3KEYA 5AFBA 2LKSA 1U5TA 3SXWA 4JKLA 2OVUA 2HS5A 5C9AB 1ZBE3 1DYKA 2JT1A 1R00A 5KHGA 4BQXA 1QWRA 3ZFEB 2VU9A 1TBXA 1HRV1 1GYKA 1V5EA 3KGZA 4GWNA 4G3YC 3VB9A 3AYAA 1NLRA 2PA7A 5EJZB 1PX3A 5E1ZB 5JLXA 2WQZC 4B29A 1UZ0A 1VAMA 5JR2A 3UETA 1WD4A 2XJUA 1XGMA 1YW8A 4BGDA 1UOFA 5BPIA 4CCEA 4FFHA 3CMEI 2ECBA 1SBDA 4YM2A 2JXAA 1PO12 1XJAA 2R7FA 4HAMA 4RR3B 3A03A 4DRRA 3USUB 5CIRA 1E0EA 1SLLA 1JZ4A 4EYUA 2J5PA 3WU2C 1AX0A 4KWLA 1ZBA1 3BG5A 3EPZA 1W5SA 3VKLA 5D5XB 5C3EJ 1AR83 2DI3A 4XF0A 1JTZX 4FFGA 4BK4A 2B9SA 2BYVE 2F48A 4NC8A 1AL23 2WFF1 3C18A 3L00A 1VBB1 5LGTA 3L2YA 1XPXA 1EH6A 3KLOA 1G8WA 4QHZA 4DO0A 1WBLA 2JUCA 2QLZA 4XLAA 3I58A 3ZN1A 1GANA 1B8IA 5G04L 3PU3A 5A70A 4M9XA 1Z0XA 2VW2A 4LBMA 2Q8OA 2WIIB 4IE7A 1IV6A 4JQRA 1FAYA 1Y0UA 1FOYA 1NA1A 1QJY3 1VRBA 1ZNPA 3IKWA 4XMAA 2NMNA 4W6YA 2VOTA 2VZ3A 2DA1A 5CISA 2ZTNA 2HI3A 2R16A 3BPSA 2LYCA 1OCCH 1EF4A 4LK1F 3WNNA 3UK9A 3WR0A 5FY7A 1ETYA 5KC6A 1OHFA 4BEHA 2HYFA 3W58A 2NXNB 4M4PA 3NKGA 4LJHA 3HT2A 3M3EA 3M1HA 2DVAA 1IPJA 2YG0A 3LSGA 2JG8B 1VBA1 5IT9Z 3B73A 2EA7A 3JRHA 1ZZ9A 1QKQA 2VOXA 2MGQA 2CAVA 1YRNB 4KG8A 1T98A 1S9HA 4DXTA 3QLQA 2WBKA 4IL7A 2ZC2A 4ZZ8A 2HGCA 2VQ0A 2OPTA 4FTBA 1RUJ3 3AP6A 5KCMA 2JDUA 1LOEA 3AKRA 3NNLA 4RB0A 3C2GA 2XVKA 1B72A 4DINB 3WG7H 3NMBA 5IJRA 1T6SA 1P4AA 1NXMA 1Z9CA 1WVRA 2RS13 1YX3A 3WHTA 2FOKA 3E5QA 4G7HF 1MD0A 2RR12 4DIQA 2FCUA 2Q2EB 1PGW1 4L5IA 1Y0NA 4M9ZA 5DM6F 3ES4A 4MNUA 4BQ1A 3X2QH 1CR7A 3GX4X 3AJZA 1POV0 3E3VA 4UW6A 4LHSA 4AC0A 5M0TA 3OYMA 3PU8A 3CLQA 5GZDA 2CV1A 2RS53 1KA8A 2O7OA 2VNOA 1YE9A 3WY6A 4XLPF 4XE9A 3CDIA 3L09A 4LA2A 3P9IA 4FQ4A 1OFNA 4QX8A 4UBHA 3F23A 5EV7A 3BC8A 5GALA 2OTJI 4KFCA 4LHNA 3FXJA 2K9NA 2K85A 3S2WA 2ZBKA 4BMEA 2FMLA 1V9U3 2RVAA 4D5CA 1QNYA 1EY2A 3S30A 5FLMJ 2A3XA 4XTMA 4UVAA 5A33A 2F4PA 3MF9A 2EA4A 3E1SA 2MYSA 4LITA 1UF2C 1PX4A 5AIPA 4OMDA 4C3JJ 5BNPB 1JZ2A 4M3EA 1Q8VA 1FI2A 4QQLA 1ETQA 2E5NA 4PLMA 2K86A 2M1BA 4XZPA 2MC4A 4A2UA 2L7ZA 3B9CA 4CCLA 2E2HJ 3KYCB 4EROA 1JJ6C 2LBFA 3DLAA 1IPSA 1H2KA 1FMD2 2JTVA 3WNMA 4RQPC 2JK3A 4M71A 3INAA 2Q5TA 5KHDA 3IKVA 1NZCA 4GRIA 1ZKGA 1GR3A 1X36A 4Z6YA 1CGPA 2BW3B 1VQ5I 3OY8A 2ARCA 3OYFA 1FT9A 2DYSH 2QBYA 1LEMA 3T3YA 3LPGA 3K7AJ 3LEMA 1UCXA 1Y3TA 2RJLA 4IEVA 3ABKH 3ZCOA 2XAGA 4LUMA 3VZLA 1IS5A 3RJRA 1T38A 5EJ1B 1IRFA 2ZX1A 5CBLA 1I1SA 3PLQA 3IRQA 5DPNA 2QZ3A 1MZ6A 2KKOA 1MS1A 4PJMA 1WJCA 1FYUA 2ZA9A 1YLLA 1T95A 1ZA4A 2Y69H 2ZOEB 2RR11 3ST7A 2K5CA 3B6CA 2DU9A 3IBMA 4COUA 1RHI3 1FX5A 2W94A 2VXDA 2YUSA 4GJYA 3MVPA 3MIBA 2MG4A 2BGCA 2CW7A 4AVVA 2E32A 1CAXB 2BWAA 1YW7A 4B8XA 2MNGA 5HDGA 5FCCA 3OYCA 3O8HA 3WF1A 2PN6A 1UJ8A 5FKOA 1J09A 5HNFA 3H3UA 5JOWA 3BOQA 3OYGA 1YJLA 3IPVB 4EJRA 2P6SA 4PF1A 1UCRA 4BE0A 3J7ZI 2K3FA 3VDXA 1TMF2 1MBKA 3VKNA 2DFIA 3LB9A 2VE1A 4BE3A 4OLLA 3I4PA 1X33A 4LNVA 4BLJA 5ABJA 4UB8C 2BY2A 3BALA 2IZWA 1D1CA 3ZQHA 2E7WA 2VOOA 4FPJA 4K6BA 3P3NA 3HWJA 3HN3A 1S0FA 4YIIA 1G9DA 4K40A 1F4AA 1UY3A 2GNBA 3ZN4A 2XLFA 3NJXA 2Z33A 4Y13A 2UYBA 1JGGA 4ATEA 4AHZA 1IKQA 1NCQC 1CPNA 3URFA 3VBHA 4CCCA 3HOSA 3W6KB 1U5XA 3K4CA 4ETSA 1JMUB 2R32A 4OHWA 5FXXA 4MGRA 4OINF 4WX9A 4MSVA 3ZMUA 3MWMA 4ANJA 1W6MB 1WQ2A 4DUVA 4FPYA 2VUMJ 4DS0A 1MMSA 4BACA 4S2FA 1FMD1 3HN1A 1V55H 1XBFA 2LF8A 4AIJA 3RJ2X 2GBYA 4XNFA 3T0DA 2H09A 2QQUA 2WR9A 3G3ZA 2FBKA 1VFCA 2GNDA 1E3HA 3HSFA 4MGIE 4BKXA 5M5WJ 5FXZA 1KU2A 1VI0A 1LRHA 1I50J 2AO9A 1PK6C 3AL6A 3BP8A 1ZHFA 4RM3A 4WWCA 4GGGA 2UXXA 4H3WA 4ENKA 2W91A 2LH9A 5AC92 4UNOA 4NR1A 3LL7A 2EH3A 3ON7A 3PUIA 1R082 4CDWC 2L02A 4J1XA 4HKOA 2WT2A 4QDSA 2YBSA 3HB9A 3OBZA 4LBJA 2CHHA 1MEC3 3KF3A 4DB5A 3J80K 1VIWB 3FKIJ 3ACHA 4H7MA 4NRPA 3OGSA 2DDUA 2HJIA 4NVPA 1HIXA 4A3DJ 2OX0A 1F5TA 4A4AA 4KL1A 2F5VA 4PGGA 4QSHA 2BWCA 2FD5A 2XRNA 3WTYC 2QSHX 3OPWA 3A7QA 2EK5A 1YS7A 3T5XA 4PJ0C 1G2HA 1WKYA 3D4KA 2C6SA 2Z99A 1Y56A 3W2WA 2D45A 1K3IA 2A61A 3HPGA 3Q9SA 2PHWA 1SEUA 1FXZA 4MADA 4P96A 2FDIA 1HCRA 1Z7UA 2JJ7A 1NK3P 3C7FA 3QP6A 1OR7C 3WE3A 2VOWA 4Y3OA 3SC7X 4FI9A 3BCBA 1TMF1 5HCHA 5J1RA 2XSJC 5EEAA 5CVJA 2JRMA 1E3OC 1Y9MA 2OYZA 1D8JA 2IVMA 3E6DA 4CH7A 2H0BA 4LLFA 3RZDJ 4IKFA 3O6BB 4XAEA 2F4MB 2PFWA 4MYEA 4L5JA 2BOJA 1E17A 5KXBA 3R60A 1H8TA 1ENXA 1PNGA 2WV1A 2XBO3 3AC0A 4IOCF 4Y5SA 2ZEZA 1S7AA 4LOTA 4XACA 4YWAA 4G4FA 2HDDA 3I3MA 1RUF2 2DVDA 4BBSJ 4MO3M 2NYYA 4KWUA 4GWJA 1OFSA 4WM8C 4AEMA 3HQRA 4YVSA 5FQ0B 5LATA 1XGNA 4XMIA 5LEKA 5GZEA 3MCZA 3SLIA 1IGNA 2XPWA 3KLSA 4JRLA 2EV5A 3ITQA 4LBOA 3PNTA 2XUEA 5L7OB 3EO6A 3IIAA 2EFQA 2VVFA 2HOSA 4AFAA 2ZGKA 4AHWA 4O9GA 4P5HA 1XMXA 3TN92 2R3SA 3F95A 2P81A 3RGBA 3ZSKA 1SAXA 5F2WA 4PIXA 3HOVJ 4BLIA 2FCTA 3HAGA 5AC91 5FMBA 3BT9A 1W04A 1KYWA 4D69A 1JI8A 1R081 2DBNA 5FO5A 3OGVA 4HV5A 2VMDA 4XPVA 2WZ8A 3SZTA 1MNDA 2QQ8A 4PSWA 1RMU2 4HG2A 2J1TA 1BBT2 2IA2A 4B8EA 3WINE 1BJQA 4OIQF 1ZYBA 1YFHA 1YIJI 3HD8B 4CDQB 3LSRA 4XFIA 1TE1B 2E1MB 1W9YA 4TXWA 1STMA 2P8TA 4YZ5A 1X58A 3TEZA 2WLPA 3ZKUA 2QQBA 3VPRA 1E57A 3HPHA 1B4AA 1MS4A 1JTXA 1KITA 4LD5A 3POGA 5E3MA 4OULA 3CJRB 3S2DJ 3VBRA 2FJ1A 2B4KA 1XU2A 3VDDA 2GALA 3OPZA 5JDBA 4W65A 1VQKI 3B3QE 2YDEA 4ZY9A 2QDNA 3CLPA 2BP6A 1DG6A 1DZQA 3TKYA 1LGBA 4BHBA 3L2CA 1VRH2 4KWKA 3THTA 3IIIA 4IEZA 2R7ZJ 2D6LX 2DF7A 1IN7A 5FDBA 5KXCA 1NUKA 4BAYA 2ESNA 1JKQC 1LFBA 1TG7A 3THDA 3CZ6A 1V6OA 1IRGA 1X4PA 3FXRA 1H8AC 3OB8A 4Q4V3 1ZG1A 4WXCA 3HUGA 2BPA2 2JDPA 4ZKTB 2NP0A 3VHOA 3IMMA 5JMOA 2HNHA 2HTSA 3ZFGC 1TWHJ 1RUF1 3AZZA 2J1UA 1W0PA 4B4CA 1J1TA 3ES1A 3GGLA 1Y9GA 3VHPA 1LOCA 3R0AA 1Z7LA 3LSEA 3I2KA 2COMA 3I2FA 1S8NA 1UW8A 4WBBA 4QDRA 5EJ3A 5DDJ2 1VQ4I 1CQTA 1X1DA 4B4QA 1R5HA 5DG1A 2G9WA 3PQKA 2Z1DA 3O1UA 1WJAA 2AEYA 4YVWB 1SMYF 3O0VA 1E2XA 1ZK8A 4XQWA 3OYLA 1RIRA 3T2PA 2VJJA 1ZQ3P 5FYSA 4KIFA 2DCJA 3WQ7A 4HDVA 3TN91 5IP7J 1I6XA 1R5GA 3JTGA 1GZ9A 3KCCA 4QMAA 1EV11 3OYWA 3RMYA 1RUE2 2E7QA 1I5PA 3P5JA 4CEWB 4QKFA 4GKXA 5IVEA 3LZZA 1T0FA 4FPEA 4PIYA 4BL0B 3ZXAC 3L2RA 5BOXA 1RMU1 1BBT1 4HG6B 5ILSA 3OTFA 2M3AA 1S72I 4YM1A 2V4AA 4I0WB 5CLSA 5LHHA 1PP7U 4XABA 5E20A 3BR0A 4ZH4F 3AYDA 4HBLA 2R0HA 2RDNA 2JA6J 2VJIA 1LVKA 4HOOA 3ZYFA 4QAWA 1Y1VJ 1N25A 4QIWN 5FZOA 5FXVA 5C6CA 3WLUA 3VYUB 4NIIA 3GFMA 2Y33A 1Z67A 3IC7A 3LFUA 4YW3A 4UWDA 3GF6A 4YFNF 2RMU2 4EVIA 1TME3 1OLME 1WHUA 3AKZA 2V9PA 3TOJA 1E5SA 2BV6A 1FJLA 3HR9A 4CE8A 4HNUA 2Y64A 3F72A 1VRH1 2A6HF 3MN2A 3F6VA 2OXBA 3M3CA 2KL4A 5H9QA 3FF5A 3BTLA 1DHKB 3GFLA 1RJ7A 2JVHA 3V7SA 1PIV3 4H7LA 1JU3A 1SBFA 5IOYA 5E8GA 4AHXA 1BEV3 3VBOA 3FUQA 1FOWA 3NV4A 3L2VA 1MS5A 5FRAA 1FNNA 3QPTA 1WW6A 3P9KA 2R7SA 3DYMA 5FKKA 3KV9A 5F5AA 4IXAA 4RDUA 3KT1A 4I30A 2R49A 4QD2A 4ITVA 5FY0A 3SYTA 3VDBA 2R7RA 2VJXA 3LA3A 1OMIA 4FXGB 5FZGA 4MXWB 4EJTA 3OMYA 4Q48A 4PLOA 5APAA 4YM3A 4B09A 4IEPA 1UZCA 3DXTA 3I3EA 3WUCA 5M3FJ 1UXXX 5DDJ1 1J0RA 1FYKA 2KIFA 2RAEA 2M87A 5C3OA 3QYFA 1MMAA 2OQ7A 1YLFA 3FM3A 3ZQCA 1YQ8A 4Q27A 2X29A 1UZYA 5DAPA 5C9AC 4XRSA 2BBVA 3K6GA 2BFUL 5F9TA 2L3DA 2RS51 3GCWA 4CRQA 1GWLA 3ZFEC 1UU6A 4CA0A 3OUHA 1AVBA 1F8VA 4FTEA 1XYNA 1IN6A 1SACA 3L1PA 3IM0A 3AYEA 1RUE1 4CDUA 4YIRX 3PUFA 1I9RA 2GDFA 2X9DA 3U07A 2WC2A 1WBFA 3WP6A 4TTGA 4LO5B 5DM7F 2FA5A 1ONAA 4LBQB 2D93A 2R5YB 5DTDA 1W8ZA 4NDLA 5HXMA 4FFIA 3S0MA 3TGNA 4RR3C 3JB4C 4JHTA 2FNAA 4GULA 2GA2A 2DFEA 3ZFFA 4YW1A 3J81K 2GOMA 4OCTA 5KR7A 1ZARA 2VBPA 3S1NJ 1V6NA 5FYCA 4EGZA 2JUGA 2HWE1 4LEJA 4XCBA 3Q8CA 3LDKA 2E60A 1Z6RA 5EPAA 2BOIA 4JAAA 2V9KA 3Q5FA 5H9SA 2FCVA 1Q8OA 2W68A 1JHHA 3FZ3A 4HLYA 3RJPA 2RMU1 4XQDA 1O8SA 3R4DB 5EGOB 4IEUA 1Z05A 5FFOC 2IGOA 3IDAA 4Y20A 3ASOH 5T5JA 3ABTA 1MS0A 3BJAA 3QWLA 5L3DA 1Y6IA 2ZX2A 3K4JA 3ONQA 1F31A 1QQP3 5DAVA 1QEXA 3CJTB 1D0HA 2RC4A 3T4HB 4XUNA 2HZTA 1V6IA 3S17J 4PQ9A 2QQ9A 3O3KA 1QRYA 1HXS3 2VUCA 3OYBA 2R063 1LHUA 3BG3A 3A4UA 3D5OA 1HW5A 1XCVA 2WQ4A 1O4ZA 4QGNA 2DQRA 2JWPA 1HW2A 1YQCA 3O2PE 1S6LA 1GNYA 3C2HA 2K9QA 2Y9ZA 2DTYA 1JT6A 2H6CA 5FJ8J 1HJGA 3IDBB 3S8PA 4COYA 5ISLA 2KD7A 2IAIA 3CUQB 2M0CA 5FK7A 3Q9VA 3L9FA 1F43A 2JG8C 4Q5OA 1MR5A 4IGPA 3O1MA 4HPQA 4ZTJA 2DYRH 2CAUA 2L9VA 1JS9A 2Y6KA 4N43A 1ZGWA 1G3YA 4YW5A 4XN0A 5GAHJ 5J47A 3WTSC 4HF1A 1LEDA 2V4VA 3R4SA 1GV9A 3PUSA 2VODA 4HKWA 1UIJA 3SFZA 5CVRA 4IHWA 1D2SA 3VOEA 3DU5A 1AJKA 4JTNA 2QEXI 4Q4X3 5A3NA 3POBA 3NRVA 3MBWA 2PHTA 1UZZA 1U5ZA 1XYPA 5LASA 4AVTA 1JHJA 3J8F2 3ENRA 2DWRA 2ZEYA 2DFCA 3EB7A 1KJLA 1S3JA 3ASNH 1J3RA 3G1LA 3N4MA 1ND3B 4GH4A 4ZDOA 1ON2A 1IDYA 3GF2A 5LBQA 4UW3A 5IAVA 1YUDA 1SFYA 1O5UA 2C1FA 3SCHA 3AVRA 1EYBA 3W3CA 3AVSA 2VJ4A 2Y8KA 3J7NA 1ZYRF 2Q1ZB 3SITA 2BOLA 2OKXA 2V1NA 5EZHA 1K5MA 4OIPF 4KJZA 3FBYA 1DDLA 3WNKA 3ZXFA 1H2NA 5JSOA 1WCQA 3OV8A 3T2TA 2DDBA 1RVF2 4RAYA 4C1WA 4W1UA 5CG9A 4LO7A 2R7WA 1PZ8A 2E9QA 1Z1DA 2CSOA 1UNBA 1JOBA 1MBJA 2G1MA 2L4AA 3S1MJ 4RAZA 4QB1A 2L9RA 1JOPA 3G4SI 4NWWA 1H9PA 4QX1A 4RGUA 3S2HJ 4HVOA 3WEZA 1GKBA 2VTXJ 2WZPP 4IEXA 4XXPA 4A6SA 5CFCC 3VKFC 5IK7A 1HSJA 1XNTA 4UW4A 1IKPA 2WNUB 1AYN3 5FGMA 3QAHA 1OLQA 2I07B 3RZKA 5FYBA 4NNJA 3BU7A 3W20A 5BNPC 5JSRA 4RHV3 5CYYA 5EHDA 2A6VA 2F5DA 5FO9B 4M00A 2QSFX 1UX6A 4HN1A 5HV0A 2ZGUA 2MW8A 3H0OA 2VOKA 4W97A 2D97A 4OI2A 2ZMEB 3BIWE 3RDIA 5LRRA 3EBRA 3WTUC 3OYDA 3AP4A 1B6AA 2PMWB 1T8IA 3LEKA 3FUOA 4ENMA 1LODA 4JX0A 2K02A 1Q3EA 5E89A 4YGCA 4QPOA 1H1IA 3D8CA 1JUHA 4NHJA 3NJVA 3TOBA 1GQPA 1DQ1A 2YZ4A 1N75A 4EMSA 3J8F1 3JCIA 3PHMA 4BYYA 5IP9J 1AXKA 1BLZA 4EGYA 3PIOF 3ZR5A 1OQYA 4U7BA 1RYYA 1YRZA 3HXLA 3T0AA 1SLCA 4EM1A 3HBLA 4IEYA 3DEEA 2CGOA 1RUD2 2BTVC 3UJOA 1PO22 2BNOA 5F64A 3KHBA 1RUC3 5FZEA 3BOWA 2OQRA 1D7PM 3HKZN 3JRBA 3O5SA 1GV5A 4LKDA 2HWB3 1S7EA 2FEZA 2WSUA 3UGGA 1XC5A 1MDMB 4AGVA 3OYKA 4KT5C 4PJNA 1V00A 5LGNA 1DP3A 4QM9A 1RVF1 2I10A 5B2GB 3N7JA 4RB2C 1DGLA 1BKZA 4IXLA 1CJDA 1XPWA 3V56A 4XYXA 2W39A 3T8TA 4AI8A 1NA1B 2E35A 4HF2A 2DU0A 5EZWA 2EFPA 2IEKA 4AEKA 1S4CA 1TWAJ 1FOKA 5SV8A 5K4LA 2VE9A 2XONA 1FPQA 3JRGA 4DOZA 4UV8A 2VASA 3O1VA 4Y5TA 3K4BA 3RYPA 2VNVA 5E3OA 3PUBA 5CNAA 3VD7A 2NVQJ 2OA4A 4W6WA 2Z42A 4HVQA 4E8CA 2ZNZA 4BEHB 3AMHA 2QFEA 1V6KA 5LHIA 5GLVA 3ML6A 3B00A 1U0JA 2JDAA 2RM23 1N1SA 1UPSA 4GALA 1Z21A 1YWKA 3AM2A 5FLXK 5J6XA 5LHGA 4DZPA 4V2FA 3FMGA 1K79A 3FXLA 3K75B 3FX3A 4B3XA 3IAM2 4Y24A 2FQPA 2JPBA 3KP6A 2R7EB 3G6JB 4CYCA 3LCPA 4Q4W3 1MQTC 2XPVA 4YW7A 4NRQA 1C0WA 5E17F 1VMFA 2DT6A 2V1UA 1BVVA 1D4M2 3DPRA 4IE6A 1PUFB 4GYGA 5B5EC 2WBMA 3RWKX 2KQRA 4UYBA 2HYXA 1CF7B 4G94A 1B72B 2V6EA 1OVPA 3ZYGA 2WNVA 4MGYE 4U7DA 5ICCA 3M8JA 4LBKA 4LA3A 2XV4S 1GOFA 3EYYA 1KZHA 4IE0A 4XFCA 4AI0A 1GNHA 1FC3A 1C3HA 2V79A 4YPJA 1B35A 4N53B 1F4KA 2PHFA 1RUD1 1PO21 2YFZA 4D9JA 1RUG3 2B8MA 1J58A 2NS0A 2IGNA 3WOGA 3EXUA 2HH9A 4UXNA 2XQXA 1B9MA 1S2BA 3FBIB 3WF0A 2D40A 1V3FA 1LKXA 4X0GA 3VDAA 2ETHA 1WGXA 1RUI3 3PVNA 3ZRGA 5T5OA 3WTTC 4HVRA 1POQA 2R92J 3CF2A 3NRUA 2IGMA 3H7YA 2IS6A 1WA6X 1WCDJ 2CV2A 2QF7A 1GLNA 4QQHA 4KI5M 4W50A 1OKRA 3PL0A 4YZ3A 3S5QA 1W2AX 1Q1VA 5KHJA 1U5IA 1PUEE 3VBSA 4QX5A 3G6EI 4PSXA 4RGGA 5LBCA 2XAUA 3AJYA 3WP3A 1W03A 5A33B 1BXHA 1DQ4A 1WI3A 1XB4A 2GU9A 3OWTA 1POV3 4LFUA 3GTLJ 3H42B 1BK1A 3DPUA 4ZS3A 2UY9A 4L0PA 4I7HA 2PG4A 5BNOB 4RGXA 1Z7S2 4Q47A 1L3JA 4BQAA 4RB1A 3U14A 2XPJA 3BUCA 4UT5A 4IPAA 3L2WA 2LBFB 1QDCA 3LEGA 4YFZA 5A2QK 1OD5A 5A3UA 1WRJA 5L7OC 2NPIA 1LOFA 5CKMA 2RJ2A 3OY8B 1JXSA 3DBHB 3QQAA 1K42A 1SLTA 5JVVA 2E71A 1D4M1 4Y1YA 3I53A 2O0YA 3L2UA 2DA2A 4JX5A 4HK9A 1NE4A 2IXKA 3RG0A 5C71A 2Y0OA 2LRPA 1GVJA 3DCQA 5K0UB 1UELB 3LOCA 2JE7A 4EEFG 3F8BA 5JVTA 4FO9A 3A0KA 3K3OA 1X1CA 4TLFA 1RESA 4LGWA 1VQ8I 4UAPA 4ZJZA 3J4UH 2AXLA 3UV9A 4L2NA 5C3PA 3LNQA 2QCOA 1YHFA 2K2SA 4MXVA 1AR63 5LA9A 3IH4A 4CDQC 4M3GA 2AH2A 2EXKA 5BY5A 2E1MC 1XG1A 1S5LC 2OIIA 4DUXA 2WO2A 3LPFA 5F3IA 4BE2A 1HRI3 3BY6A 3ZDVA 1ST8A 2LFBA 1QJX3 3F6OA 4AFBA 1TW3A 4NBQA 1OOPB 4AZZA 1K4SA 4FETA 5HLHA 2W24A 1YITI 3NWTA 4IEJA 2KR2A 1XNKA 4B3AA 5FIXA 4OHYA 3GVAA 4AF9A 4P5OA 1X7NA 2R5ZB 2VW0A 3MO4A 2JSCA 3M2MA 1O7FA 5D8AA 5KNLA 1AR93 2KFDA 1HOMA 4QB2A 3PM1A 2XSDC 2W1WA 2O8QA 1K7AA 3T1MA 2VTXA 2BY3A 1DYOA 4B43A 4BM8A 1R6RA 1WJBA 4M3CE 2HWC2 4XCAA 4L92A 4ENJA 1BI0A 3ZQGA 5B1BH 4PI2A 4XLNF 1W3VA 2E34A 3TNPB 3VYTB 3MGUA 3R6SA 3P6BA 5T55A 3VBHB 1JZ8A 2V72A 5DQ0A 2XLAA 3VHNA 2ESHA 4JCKA 2I8DA 3HJEA 1X2NA 3DEWA 4HEA2 3KYLA 1NQDA 1Z7S1 4WM7C 4HX8A 2EICA 3J26N 4N4NB 2WAFA 2HYGD 1NG6A 2WL1A 4LJZF 4HSLA 4AUXA 4AVSA 3ISPA 3ZPYA 2FOWA 4AD9A 3TO6A 5EG0A 1TNRA 5I8TA 4K9SA 3TWIA 4YVWC 4CU6A 4MFDA 1COV2 1BC7C 5BXXA 4H2AA 1R1A2 4MHGA 1EPWA 5I8YA 3RSNA 4J25A 1PP8F 4I2OA 4QKDA 4IJAA 1XMAA 1X9TA 4CEWC 3WF4A 1F5FA 2A71A 1H88C 4ZHNA 3E6MA 1X82A 1POGA 2YB7A 3HT1A 1W8TA 1V4RA 2XJVA 3E5XA 5BPXA 1GHCA 4IHTA 2Z4FA 1GUUA 2D98A 1YQ6A 5E6HA 1M4WA 4BHPA 2BEOA 2VBZA 1JZ5A 4NIGA 1LFPA 2DMUA 5HS7A 5L9RA 3S5AA 3DEUA 2WWUA 4XIKA 2WAOA 3WVJA 2RS32 5LK5A 1VBE3 3ETPA 4IERA 5DCMA 4AWDA 2Y48A 2JJ6A 4QHBA 2ZX0A 5H9RA 3KCYA 1IO2A 3DP7A 3KEQA 4X6QB 3M07A 4JQFA 2NAZA 1H89C 2OUHA 4A3GJ 3CO2A 5HPOA 2EZIA 3OSFA 2C6YA 4X6RB 4ZZDA 2DQLA 1FPN3 4URAA 4BNCA 3MKZA 3I55I 1TTYA 3A0HC 1DGWY 2JA5J 4A3ZA 2JA7J 5LBFA 3WU0A 3IV5A 2HWC1 3FXUA 4G12A 4IETA 2O8KA 1R49A 3WE2A 3RCOA 1JW6A 1R4NB 5D1IA 1J3PA 1OJLA 2WLQA 1BIAA 2E53A 3NARA 4IOAF 4UUTA 1DCSA 2M45A 1QJU2 3EUAA 2WADA 1SVMA 5B4XA 2LSOA 2G9ZA 3CCLI 5IT3A 4HSTA 1UMIA 2AS5F 4YVSB 3O8GA 3QPHA 1OQ1A 3RZOJ 4XKVA 3TO7A 3GTQJ 1WWXA 4PGHA 4CUBA 4PUSA 3JAMZ 3H8UA 1W28A 1SG3A 1W36D 1BBYA 2E2IJ 1ZRDA 2DPUA 3D0SA 3ZQ7A 4HQEA 2V7FA 3FXQA 1COV1 3U4XA 3PVEA 5ERIA 3GEZA 4YG2F 1GBGA 2J1EA 1R1A1 1W05A 1C8M3 4NWVA 1WMDA 3POIA 1US2A 3WW4A 4NROA 2PI0A 1MZBA 1NOVA 2ZSHB 4EN9B 1SBEA 1NCRB 3ZMDA 5IT9K 1J9IA 3Q8BA 4A5NA 2IRFG 2WS93 5F6KA 4FQGA 2FD8A 1JOJA 1R7JA 1OQEA 1BW5A 1SFNA 3AMPA 4FP3A 4WVMB 3WCSA 2WTEA 2R072 1VMJA 3DUIA 2L9SA 2X5IA 2ZXQA 3S15J 5F1RA 2ATFA 1WW5A 3IUOA 1FEXA 5A32A 3SFIA 5T50A 3CTAA 2DCYA 3VBUA 3FE5A 4ZDPA 4UV9A 4ON0A 3S16J 2JDZA 3K4LA 1QDOA 2RDSA 1I5ZA 1TQ5A 5DXDA 1K6YA 4IO9F 3I97A 4CU9A 2NS8A 4OMYA 3W9AA 5GPAA 3EUHC 1XNDA 5C5TA 2QWWA 1IAWA 2RS31 2XB5A 3QU6A 3B01A 4BU2A 2XQRA 5IVVA 5D21A 3VSLA 3BQZA 4B44A 1ETXA 3I2IA 5KHKA 4Y7NJ 2YU1A 2NS7A 3CJIA 1AUYA 3POJA 3FHAA 4HQMA 4LLGF 1GQHA 1W0UA 2XL9A 3H9QA 1O8PA 5FZ9A 2B42B 2VMHA 5C4JJ 1L3LA 1WLTA 4F83A 1WI9A 5FY1A 4EQVA 3JQXA 5JSPA 4AIKA 4U87A 3ALQA 1X1PA 5EYXA 4L9NA 3HG9A 5E18F 5BNGA 1N3PA 3WQ0A 4O7XA 3K77A 2D6NA 2JSPA 2EF6A 3ILRA 2D3PA 4W6XA 3HHGA 1QJU1 2KDOA 2RDQA 5FKCA 1WH5A 4V2GA 3WDVA 2G9GA 3DF0A 2OUJA 1T2KA 3CF5F 2LLKA 3RKXA 2OQ6A 2OBPA 1UKGA 2EIJH 1LPQA 1HKSA 1MJAA 3I4NJ 5FPXA 2IP2A 4IE5A 3OOPA 3LAPA 1J84A 4E7JA 2Q0AA 2F5FA 1CPMA 3CUQC 2IUWA 1K6OA 2B45X 2MFZA 2QDRA 5FZCA 4R4XA 2FBEA 1PGL1 1D1AA 2DCZA 4LKEA 2DBBA 3BR6A 4I3PA 2BNMA 2M5WA 1PVC3 2K9ZA 3HC7A 5K1YA 1HB3A 3D5SC 4Y4RA 1VQOI 3OYWB 2QCSB 3CQOA 4GXOA 2A73B 3M1CA 2EA2A 4LXLA 2CW8A 5GAEJ 1OCRH 3IDEA 4IV3A 3M8EA 4KBZA 3VYSB 3FXOA 1BCXA 4D94A 3IMNA 2R071 1LHWA 4WXDA 1VLNA 3PVOA 4ZZLA 2AC1A 5FKLA 3VYRB 1APLC 3V0AB 1BL0A 1ND3C 1U5YA 1X4OA 2HVRA 5HXVA 2EXHA 3HGGA 3ZDSA 1TP4A 1SFKA 4HRIA 3BTJA 2P3JA 2BVMA 1AXZA 3SH5A 5F5IA 5HLGA 2E1OA 2LDUA 1DDNA 4U36A 2ELKA 4M74A 1ZG3A 2L7FP 5ICFA 1O3RA 3H3LA 1G4DA 1UYPA 4KG0A 1YO5C 1C8NA 5FYYA 1QPIA 4GFBA 1X3WB 2WWJA 1T39A 3MEPA 2LROA 3MIEA 4YARA 5FB2A 4NOTA 1TZLA 2W87A 1MNEA 4IHYA 4AEDA 3BTXA 4AVBA 3RKQA 1WUVA 3VBOB 3KPHA 1FTZA 4RS8A 3MLJA 3KP2A 1REPC 2CU7A 5A7NA 2YPRA 3IRRA 1ENSA 1W6PB 4DBQA 1C28A 3DU6A 4L8QA 3RKYA 1UY2A 3B7MA 5HLTA 3BN6A 2CQNA 1RUH2 2E19A 3N7KA 3ZPOA 3UJQA 2I2SA 3K2OA 2A68F 2WNUC 3HQXA 2Q4SA 1KQ9A 2HOEA 2M8EA 1LEAA 5L9BA 1FMWA 5A6ZA 4Z2YA 4DXZA 2EIKH 3MPPG 4FTSA 2YU3A 2AACA 3M8FA 3LOBA 2CS3A 4OIOF 3ZXLA 4KICA 2I74A 2NRAC 1X2MA 3S3OA 4A69C 2WAQN 5LLQA 4YG3A 5BYNA 2IW5A 2OTLI 3H5AA 4QX0A 3SKVA 1SD6A 4MEXF 2ZMEC 4RFRB 3GZEA 3IB3A 4FPLA 4AFCA 1TW2A 5JZGA 3Q0VA 4CO8A 2W82A 4IRHA 4CUGA 3AZVA 2QE3A 3AP9A 3VGIA 5L3EA 2CQXA 1BOBA 1D1BA 2VQAA 2E7AA 1XX5A 4IV1A 2PELA 4A7ZA 2YX4A 1T08B 5FZAA 2MA3A 2ZAHA 2WSVA 3PUAA 2HEVF 4MFEA 2FUG2 2ZGRA 1LHOA 4UFMA 4AIHA 4OZOA 4CZZA 2QQLA 1NG7A 1W9SA 5A3OA 3C7EA 4RAGA 1AKHA 4A3FJ 2UURA 1URXA 2X85A 1YEWA 3GZNB 2WO1A 5C8CB 3NAPB 3OEBA 1AXYA 5CEHA 3LSIA 3N05A 4COZA 2KISA 3B94A 5FROA 1ZRFA 1ZZ7A 2XAQA 4AWXB 5FZ0A 1T2XA 4Y20B 4DXRA 1K78B 2QQKA 3PFYA 4LIVA 1P6RA 2QKLB 2VMFA 2CFOA 3GTOJ 4YNIA 2QUFA 1KQ0A 1NA1C 4A3IJ 4KQ7A 4XFAA 3IAS2 1US3A 5ED4A 3T08A 4HANA 3KP7A 5K7HA 4OHVA 1S0CA 2R7XA 3MFKA 4JTOA 3KEOA 3S14J 1VB2A 2P5BA 4L99A 5GJ6A 1DGRN 5I91A 3V8LA 2VH9A 1GUIA 2DO7A 1XE0A 1A8DA 4AW7A 3VZOA 1RUH1 4M0HA 2M4GA 5A3TA 3DPTA 5FMOS 3W6VA 1ZZCA 2VZ1A 4XF9A 4LHKA 2QZ2A 4D6QA 4HBNA 2ET7A 1QHHD 3NNGA 2ZJCA 5CVVA 3EQLF 1MZFA 1GICA 4UF0A 5D6EA 2AHQA 1UHSA 1QBJA 4MTEA 2Q8EA 4IGQA 3TEYA 1OKQA 2ECCA 3MIDA 4BHCA 3OIQA 1H1MA 4UY8I 1YC61 1KQRA 1EAH2 1Q56A 4CXYA 2RE9A 4LK0F 3KVAA 1QOSA 2LW8A 4QPGA 3U75A 3ZP5A 4AK3A 4GMP1 3CCQI 4PLNA 4I0AA 4UUSB 1JYVA 3H8XA 1I6HJ 5A3PA 2MEV2 2LF7A 5JOYA 3PURA 3GZ5A 2Y38A 1G6NA 2YXSA 3GJBA 3C2UA 3VSKA 1JZ6A 4Z92B 3DYPA 4EE2A 1OSGA 3ACGA 1FSEA 5HS9A 1YQ2A 3GW2A 4ASMB 3T1LA 2CWMA 1G86A 1LFUP 3FMSA 1WJFA 1OUSA 4Y26A 4GH4B 3IWFA 3LFKA 3ORJA 1LAJA 3QP5A 3GBGA 3MKLA 2JX9A 1X19A 4AHYA 2D1HA 2VZOA 3ZXGA 4N53C 1UU5A 5FMCA 2XDVA 2RKHA 2YBKA 4XRSG 1H9WA 4XBQA 1WCMJ 4BDZA 1SFPA 1UL9A 3N9QA 3ZVXA 2F5CA 2CMPA 4BQNA 1K5MB 1VTNC 1FBSA 4XC9A 4ZU7A 2HQRA 3FHQA 1UD1A 2RGVA 5DCFA 1X1AA 4I09A 3ZQIA 3Q0WA 4I01A 1KEXA 5JPMB 4DQ2A 3Q8EA 3TRSB 3PO3J 2HWF3 3I4IA 5F27A 5F0HA 4HSJA 2VBWA 3MZYA 3BR2A 4KUMA 1O91A 4A5MA 3HL2A 5EYRA 3QPLA 2K7LA 3BG6A 3QCWA 1UG2A 2Q8CA 4QPQA 4LR4A 4NPMA 1JTYA 5EIYB 5FJKA 4KDPA 5A1AA 2F5EA 2DCKA 3ZM8A 2FDGA 1QXPA 3ZR6A 3LF7A 5C9AA 3WG2A 2W00A 4AI2A 2RG4A 3LSDA 3WDWA 3LE0A 1Y8RB 2XF7A 3ZFEA 5DMYA 1XRUA 2WWYA 4OVEA 1DU6A 3EJKA 5FP9A 4OFGA 1KD7A 1TNSA 2VCBA 5ACA2 2NVTJ 2QQOA 4GB32 2YC2A 4EN0A 2O03A 1XSVA 2FX0A 2LG4A 1FSHA 2W48A 5BNOC 1OYIA 2FDKA 1Z91A 1YTYA 4A3MJ 1BYHA 3CF6E 5IVYA 1I1EA 4ZYGA 4E2QA 2DA4A 2XJSA 1EAH1 2O9LA 4DXSA 1IG3A 3WSOA 4XLFA 1Z78A 5IK5A 4JX4A 1WMEA 3USUA 5GZCA 2HVQA 4R9DA 3ZSJA 3GLLA 3DEMA 5CKNA 5J8CA 2WINB 2RVCA 2R4GA 4HOBA 4E7SA 2MEV1 3P1IA 5KBFA 2HR3A 4P9WA 1JUSA 2W08A 3ZO0B 1LKNA 3HOYJ 2HQNA 2STTA 1IOAA 2QSGX 1W9TA 2EALA 1X50A 4FFFA 3FKJA 2K27A 3S1QJ 4MQ9F 4EJWA 4BA6A 3NEUA 2E2JJ 2UY8A 2LTNA 4RA0A 4A0YA 2IS2A 1IUFA 4Q0VA 4Y52J 3H1MA 1FMVA 3GZTB 2GNMA 4MZUA 2B7YA 4KIGA 2IGKA 3LAGA 3MYXA 3KB5A 1UZVA 4DYQA 4GA9A 3D6EA 4AGRA 3TDZC 2K40A 3I3BA 1WMFA 2P6TA 1CZSA 4LK7A 2XB0X 2EAKA 5JR7B 4RB3C 2TRTA 5B66C 4LMYA 4B4RA 4RS5B 1NZIA 2O0OA 5EXOA 3IWZA 1OOPC 5DZGA 1MS3A 4M3CA 2P5LC 3S7IA 4ATFA 3GZ6A 1HN1A 2J42A 2PMUA 1Y9QA 2ZJRF 3WHBA 1H4HA 1O59A 4L97A 2SLIA 4ZONA 5D5WB 2P4WA 3V8JA 3ECOA 2PLV3 3GLXA 2WS91 2IBDA 2OW4A 2D44A 3HKZA 2A05A 2BXZA 4WVZA 5L3BA 4Y15A 5ABJC 2JG8A 1XOYA 2VUJA 3CC2I 3S32A 1XTAA 4IEOA 4COWA 2XRLA 3IH2A 3LSMA 2H8WA 1YRNA 4EM2A 2QQWA 4D6SA 3PIJA 1MMNA 2KJCA 3T2OA 1OURA 2XWBB 4DNYA 2QGUA 4Y22A 2KRHA 3EMRA 5ACA1 2X1CA 3RS6A 3FHNA 1VP6A 3VBHC 1FOD2 3C3VA 1L7RA 2ORZA 1MACA 2A5ZA 5IVBA 4JGYA 3SMHA 4FTHA 2W1QA 3HTSB 1VMHA 2K3PA 3U2RA 4CYCB 2AEZA 1R093 1W7PD 4AXOA 1YYNA 3FMQA 2XROA 3V4GA 1O5LA 4LLOA 3DPRB 2C24A 1UY0A 1D8KA 4DBRA 2LY9A 3JRDA 1W90A 2VKDA 3KP3A 4L5EA 1NYWA 2MH9A 3DN7A 4MGTA 3T1BA 2L7KA 5HNHA 4RLQA 4F52A 1YJKA 4AE2A 2MLGA 2WNVB 3VUOA 2L9NA 4RA2A 2C26A 5FZIA 2EV6A 1J3QA 1W36C 1PM4A 1R4MB 4IHSA 4XLHA 2BHYA 3BTAA 4HETA 3M7AA 1FBUA 4MGZE 4JP0A 4DFSA 2Z16A 2VI6A 1OF3A 1WCUA 2DK8A 4HL0A 3TW6A 2CG4A 2RDRA 2IPQX 5H2FC 2J22A 1PGW2 3LD8A 3JBG2 1N77A 2VZSA 2VPRA 4Q4ZF 3NV2A 2XGCA 3NV1A 3ACFA 4LO8A 5BNNB 3BI3A 2W2IA 3ABMH 1IUYA 1HV0A 5CADA 2YS9A 2D3RA 1FP1D 4QPWA 5CFDA 5EQUA 3OIOA 2A6WA 3TAYA 3JD73 4IUGA 4GIQA 5DAWA 2DOFA 5F8PA 3RZGA 4G6DA 5EFUA 1LDDA 4PK4A 1R1TA 5BNPA 5FRNA 1DBNA 4NQWA 1ASJ2 1XE7A 2PEXA 4P1WA 3MI8A 1BR2A 4LOCA 4IRGA 1G7YA 1A35A 2MPFA 4K2EA 3OBRA 3H92A 4ZTFA 2G19A 4Q1RA 5E3NA 3SEQA 3CU7A 4BISA 5JXGA 5FZ7A 2EIDA 2YX7A 2JEMA 1VBC2 2GNTA 1ENRA 2ELJA 3WZ1A 2BW3A 1A31A 3OBAA 3DTIA 5TRDA 3T30A 2R043 9ANTA 1FOD1 3I8TA 5FP3A 3ZMSA 5IHRA 3OYEA 1QVTA 2Y75A 4FPCA 2HPIA 4YVSC 2JB4A 3MMYB 3WCRA 4EWEA 2KM2A 4RGRA 3FWEA 2MABA 5J7MA 3DXJF 2WZR3 3VL8A 4O9EA 4I76A 4JDMA 1LU1A 2HWVA 1JUIA 1BJZA 2EFOA 4FT8A 4CCJA 2ARAA 5CVIA 5CYVA 2JIJA 1M06G 2NVXJ 2BNNA 3OUJA 4NHMA 1YFWA 1UWWA 2QKDA 5I8SA 2LP0A 5IK8A 4B3NA 1H4GA 2JE9A 3BDDA 1NCRC 2XH6A 1F9NA 2FE3A 1I1GA 2V5DA 4QPIA 1MH3A 5M5YJ 1B1BA 5M3MJ 1BI2A 2JG9B 3QYBA 2R7DA 2JD4A 5K5RA 4PBPA 1OCOH 3HOTA 3U1DA 3K46A 2MC3A 3QH7A 5GLZA 2H1LA 1DP7P 2IS4A 3HQUA 3AYCA 1YQAA 4D7MA 4XQFA 2ZEXA 5J1YA 1MPXA 4PF5A 4EN7B 1BC8C 1Y43B 2Z69A 3FHZA 2X0LA 1FBQA 1GXQA 3OSGA 2QQIA 4QHOA 2HVSA 2XG3A 3JBG1 2Y26A 3JRFA 3HOZJ 3ZN6B 4FAHA 3VDDC 2IFRA 1FATA 3OUIA 3HM5A 3UNGC 2NLRA 1GZWA 1HA8A 2B39A 2HWD2 4YYOA 1YJ9I 1YI2I 2ID3A 1F35A 1MVQA 3WNPA 3DECA 4BUPA 4CYDA 4BOWA 4Q2FA 2CSGA 3RQ4A 4EATA 4URTA 3A01A 1UOBA 1HSTA 4ABZA 5D8AB 2V9VA 3H5NA 1X9PA 4BQ2A 1ASJ1 2V73A 3LGRA 2NN8A 3K0LA 1QNWA 1ULDA 3ZSEA 1W6MA 5FYVA 1OLRA 4KU8A 4GYIA 3P5BA 4MO7A 1CWPA 2GZWA 2P4EA 2TDXA 1A78A 4YM0A 1VZ0A 4G6QA 4M3DA 3I2GA 3CHXA 3I2JA 1VBC1 3WW3A 2P0WA 5CFCB 3KMHA 4C3HJ 4E7HA 4SBVA 4CVUA 5E1XA 2UWCA 3WD5A 3WGIA 1P9QC 2G7UA 1W8WA 1GT0C 2CDOA 3LEIA 2E33A 4LG0A 1AR72 5L3GA 1H6XA 3ECQA 4GXLA 4XHBA 2QQNA 5EG0B 3IH3A 4KGGA 1ETVA 5K7PA 4Q4Y3 3H8OA 2A3WA 3BVCA 1O3TA 3F8FA 2E1NA 3KZIC 2WABA 1DQ6A 2J1VA 3WU1B 2PFBA 3HRUA 4GB33 2D6OX 3CESA 2D1VA 3VHRA 1UMQA 4NN0A 2FF4A 1QIQA 2O61A 3AB0A 4E2SA 4QTRA 4FXKB 2WFPA 3KV4A 1P7JA 3DCFA 2XL7A 5FPZA 2M30A 2OZ6A 4C2MJ 1SFOJ 3WTVC 1T0FC 3Q8AA 2ZGQA 1ZZBA 1ZRRA 4PDWB 2ZBJA 4XBFA 3EYPA 5CZKA 4FPHA 2VG9A 3A02A 3BPVA 2QQPA 1W06A 2JN6A 4MIMA 1YG2A 1W9WA 1V5GA 2JZYA 1HRV3 3MQ0A 1W6NA 3HOXJ 2GOXB 5A7WA 3VB2A 1VBD2 3ZXKA 2AQEA 3C7OA 3CDLA 2ZX4A 1HB4A 3SEZA 2QVSB 4MX3A 2CU5A 1ONVA 5CQGA 2DA3A 4O6JA 5AIQA 2VBYA 1XU1A 3U10A 5DCMB 2PAMA 1LDKB 1KFXL 3WTZA 2HWD1 4LKSA 4FOQA 4XF4A 3COAC 1Q5OA 3D1NI 3GNEA 3GFIA 1XN7A 1ZBA3 3O0XA 4I3GA 3KQ4B 2X6WA 2DT7B 2KP6A 1R58A 2WJSA 3CO6C 2DUPA 1BI1A 5B4NA 5JAXA 2DTRA 3AG2H 1BK0A 2WFF3 2HEYF 4K8FA 4FOYA 1TNFA 3VBOC 3J7AY 1VBB3 4XJ8A 4DYRA 4E8DA 1W9FA 3FXMA 2W85A 1V0AA 3U37A 3H36A 3LSPA 4DY3A 3E1F1 5EDNA 3DBLB 5CJ9A 3SNMA 5FO8B 3D0JA 1MMGA 5FYMA 1P4XA 2YU2A 3ZYPA 3R0JA 3HRTA 3PNVA 4HSRA 2WRAA 1AR71 4FISA 3SEEA 3KP5A 3BZKA 4CTEA 4YW2A 3ZYRA 3D3AA 3P9CA 4YIFA 2VQGA 1LECA 2UWMA 4BQQA 5FFZA 1N3QA 2C5DA 3ZXSA 2ZXWH 3MKYB 1MQTB 3WW1A 2L0KA 2EFNA 1UU4A 4QPYA 1SD5A 1XSXA 2EXIA 3H1YA 3FN9A 2X09A 1HDDC 2CUEA 1XGSA 3THCA 2BJSA 1KXGA 5F7UA 3HSRA 1QJEA 1VBA3 3SHRA 4CICA 2R7OA 1JN2P 2X5IB 3W21A 2J1AA 5A32B 5KC5A 1UMHA 1UG0A 2X10A 1VBD1 2IA1A 1FNZA 1ULPA 4DJAA 5FZBA 4CSWA 3FJSA 2ZXJA 2ZFUA 4GO1A 5CA6A 1PO13 2O1QA 1OPOA 1DGWA 5C8CC 1D3YA 3NAPC 5M5XJ 3JXSA 4NJ4A 3ZIXA 1V6LA 2LUWA 2KXLA 4Q8KA 3CJIB 1ZBE2 1D0GA 3WG4A 4JGZB 4IESA 5HCAA 2Y9YA 5CKTA 3H8RA 2R30A 3MKWB 4XXAA 1U78A 2OUMA 4J6GA 3BZCA 4IRIA 3FDYA 2VPVA 2ZMNA 1UMZA 1JHFA 2YC4A 1OXCA 3N9OA 1RNLA 3KE2A 2R7UA 1JKPC 1MJBA 4YVWA 1G9BA 3OR1C 1CONA 1VALA 2I5UA 4Q26A 2YGMA 3JB8A 2B7EA 5FPLA 3TDUC 3ELKA 2Q8DA 3JREA 3GBFA 1AR82 2BERA 1YQ5A 2VULA 3QYEA 1HLCA 5BV6A 4G9YA 3MFAA 2O6GE 2DFFA 2KT0A 4PFOA 1AL22 5A80A 3GO5A 3WT3A 3KFWX 5A3MA 2XPUA 3DV8A 3KSCA 3CJQB 3O14A 1D4VB 5D2AA 4Y1UA 3LSJA 4MTDA 1WJDA 3WUDA 5HDNA 1YS6A 1R1VA 3E0JB 4Z82A 4XUTA 1GVDA 2ZGSA 5D6FA 2IJLA 3RTRA 5DUUA 1FOXA 1DIWA 4KMUX 2E6VA 2OPWA 3DXUA 1LOGA 3QRFF 1QJY2 5C4XJ 1W6OB 2F4LA 4IV3B 4XTPA 3PJYA 4EWDA 1EV12 4E70A 5CQEA 4BQYA 2O8XA 2VW1A 4UI9L 3PSIA 1U8RA 4GH4C 4PJJA 4MUVA 4NO4A 1JODA 4EJUA 1A8MA 4XETA 4BQ4A 2RQQA 3LSHA 4NMIA 1ZVFA 3BJOA 4QDQA 5L36A 1AYM1 1QU0A 3PIGA 1V70A 3UR3C 2PHLA 1BR1A 3PO2J 3DKXA 2XR4A 1JYIA 5FY5A 1K5MC 3C7GA 3AL0B 4CP2A 5JXHA 3ZMVA 4BY1J 3RYRA 4PFPA 1G8XA 1ZBE1 3BR5A 2HOAA 4L9BA 3GM8A 5TSWA 3UKGA 4ARYA 4N90A 3ACLA 2RR13 3AKPA 3BTCA 2WDBA 2KJBA 3H0DA 2OCEA 1N1TA 4MEYF 2ZZJA 4AEDB 4O65A 1RUJ2 5L3CA 4J00A