5F1RA

The transcriptional regulator prfa from listeria monocytogenes in complex with a ring-fused 2-pyridone (c10)
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
236
structure length
229
Chain Sequence
b'NAQAEEFKKYLETNGIKPKQFHKKELIFNQWDPQEYCIFLYDGITKLTSISENGTIMNLQYYKGAFVIMSGFIDTETSVGYYNLEVISEQATAYVIKINELKELLSKNLTHFFYVFQTLQKQVSYSLAKFNDFSINGKLGSICGQLLILTYVYGKETPDGIKITLDNLTMQELGSSAVSRIISKLKQEKVIVYKNSCFYVQNLDYLKRYAPKLDEWFYLACPATWGKLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Listeriolysin regulatory protein
publication title Attenuating Listeria monocytogenes Virulence by Targeting the Regulatory Protein PrfA.
pubmed doi rcsb
source organism Listeria monocytogenes serovar 1/2a (strain atcc baa-679 / egd-e)
molecule tags Dna binding protein
total genus 74
structure length 229
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5f1rA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5f1rA01
2JRTA 2FRHA 1O5LA 1FBQA 3QP5A 3DV8A 2RC4A 3BOQA 4A12A 1CAVA 2XL9A 3R61A 4YARA 1JHHA 4HSLA 2ETEA 1Z6RA 1CAWA 4LA2A 4OIRF 2KIFA 3ZMVA 1LR5A 5AIQA 1ZH5A 5LGNA 1GXPA 3HIFA 3EBRA 2UYAA 2ZKZA 4U88A 1IUYA 1BI1A 3RTRA 3BDDA 2CAUA 2XVCA 3KP6A 3TO9A 2B5HA 4Q0PA 5LGTA 2STWA 2OA2A 1MJAA 5J48A 3I58A 3KFWX 3ETQA 3N97A 4RAYA 2XLFA 3F22A 1UHWA 2ET1A 1YFUA 2ZJ2A 3WTTC 4D0PA 2O03A 3TDUC 2JPCA 1TTYA 4O3MA 4HYEA 3H9AA 1I1SA 4XFGA 4G7ZF 1EPZA 3IKTA 3BY6A 1G6NA 1V4RA 3D82A 2EV5A 1SEFA 1R58A 5FPZA 2LKPA 4ASNA 1XDUA 1QPMA 3KSCA 2FBIA 3WE2A 1ZRCA 1QXRA 1HW2A 1FYLA 3AAFA 5FB2A 1YYVA 1LRHA 2OZUA 2BGCA 2ISZA 2ET7A 2XAJA 3ABTA 5I8TA 4GGGA 3DPLC 1FPQA 2IA1A 5HLIA 2MLKA 1J0RA 3H8UA 2HKOA 1LVAA 3E5UA 4Q29A 2EV6A 2DW4A 5H6RA 2XRNA 5F6FA 1KU2A 4RD7A 3C1DA 4EGZA 1W7PA 3LOIA 1RC6A 3U2RA 1FYMA 1T6SA 4U0WA 3JSOA 3WTSC 1BN5A 3R4KA 4RB2C 3LA2A 1QXJA 4A6DA 4KN4X 2GU9A 2OAZA 1B59A 2HYGD 3ISPA 4Q5SF 4P5OA 1XGSA 1J2XA 5D5VB 5K5OA 1XRUA 2QUFA 4PCQA 5DEQA 1WKMA 3GFJA 5ICFA 4Z82A 1Y3TA 2FA5A 1EH6A 1DPRA 1Q5OA 4Q48A 5KHIA 2GA2A 3JTGA 3QACA 4JVAA 2J5OA 1CF7A 5DCMA 2VT3A 1IN5A 2M5WA 5CVJA 5ERIA 1S7AA 1KYWA 1XSXA 4UHTA 5KHGA 2IP2A 2XGXA 1FSHA 5JSOA 2VXZA 1O7FA 1YQAA 5J8FA 1IRGA 3KEQA 4I3PA 2IXJA 2G7UA 4GXOA 1GVJA 2OD5A 2LNBA 1S3JA 1BI2A 4PIXA 5I8SA 1LEAA 2P5VA 3RPQA 4OFGA 1FBSA 2CAVA 1T2KA 3QP6A 3DKWA 3TQNA 3CUQB 4N9HA 1EP0A 1MJ9A 5AONA 4LK0F 2L02A 1SD4A 3CUQC 4AIJA 3KP4A 5LGUA 4L0ZB 3DN7A 3CL1A 5D5XB 1YLFA 1P92A 1OMIA 5D5WB 3TOAA 2CG4A 3MWMA 1R22A 1R1VA 2OU2A 3V7RA 4XFAA 2VE8A 3L7WA 4KU7A 2GA1A 1IF1A 3HYIA 1HSTA 3Q9VA 1TNSA 2BE5F 4MEYF 3OTFA 1FP1D 3D0SA 3FMSA 5C6CA 3O3KA 4EM1A 3H3ZA 1RGSA 3H7YA 2VN2A 2ZKLA 3KLOA 3M7GA 5FCCA 3F8NA 3KLNA 3NSTA 2VBWA 2B9UA 2PAKA 4KDPA 3CO7C 3ML6A 4QX5A 3I59B 4EWAA 1FNNA 2K7LA 4L9VA 5DD8A 3CJNA 3K1MA 4NQWA 3BPZA 1CAUA 4XFCA 5JR3A 1H0MA 4MZUA 2PJPA 3JSPA 3G73A 5E16A 3FJSA 1JUHA 4BHBA 5D8KB 4LG0B 2EAAA 2G7HA 4Q0UA 4OIPF 4IEQA 3N4MA 5HDKA 1R5GA 4HVOA 2P7VB 2YPRA 4AQ2A 4ONUA 3RYKA 4TLFA 4G7OF 1Q43A 1L0OC 3J81Z 2PAEA 3DXJF 2EFPA 3D0JA 4P96A 1CAXA 2UY8A 3HT2A 2XAFA 5KHHA 1FYKA 2Z5UA 3FM3A 2PA7A 2H94A 3U9GA 1S8NA 5IT3A 3CEWA 4P55A 4Q47A 3HHHA 3C3WA 2XAGA 2EK5A 2WV0A 4MTDA 5H6QA 1GQHA 2O1QA 2OZ6A 1B9MA 2FBKA 5I8YA 4PGHA 4GYIA 3KP3A 4LFUA 2HJIA 2M45A 1ZVFA 2K86A 1UPIA 5CADA 3DPTA 1MDMA 2BNMA 4XSZF 4LEJA 4MV2A 2O6GE 4QGLA 3WU0A 1YS7A 4ZU7A 1LDDA 3OD0A 3ERED 1ZGAA 2Z99A 1WLTA 5BS6A 3SCFA 1CAVB 3FF5A 1U3EM 3BJ6A 2Q1ZB 3E97A 3LAJA 1F5TA 4Z2YA 1OFNA 4EV0A 1ZZCA 4K8FA 1P6RA 2Z3YA 1IN7A 4XFIA 1CAWB 1U6GA 3UKVA 3DL3A 3S7IA 3R6SA 4NHJA 1IPJA 4PDKA 3KP5A 2XASA 1S7OA 2IVMA 3ELNA 2HDCA 4IRGA 2CWEA 5AVPA 2PN6A 3H3UA 1J9IA 4PIYA 1XD7A 2DLLA 1LEBA 1BBYA 4LTAA 2DO7A 1PUEE 3FXRA 4UNOA 4WZCA 4LLLA 1QY4A 4JTNA 2D5FA 4QWQA 3GXOA 1OYWA 2XIGA 1YLLA 2ZFWA 3GFMA 3HOTA 5HLGA 1ZLKA 4BHPA 3ULQB 4UV8A 3T1BA 5A2QZ 1B9NA 4KWLA 1U8RA 2K02A 1G3TA 1LDKB 3LQQA 3K9TA 3BPVA 4LK1F 1USSA 3FMRA 3Q5FA 4IRHA 3HOSA 2B0LA 3V4GA 1IRFA 3UKTA 2A69F 2LSOA 3O14A 4IF4A 5E8GA 4OINF 1D8KA 5HS8A 2W25A 2FNAA 2QBYA 5IT9Z 1X82A 1WRJA 1Q3EA 4L5IA 3IIAA 3M3IA 5F1RA 5JAXA 2KIMA 4N0BA 3BZ6A 4A0XA 5ED4A 4JBAA 1W7PB 1O57A 1SFEA 3HRMA 3MZHA 5E20A 1FP2A 1GHCA 4I98B 2Z33A 2A5YB 4HQEA 5DDGA 1BJAA 4OOIA 4HLXA 2W57A 2IRFG 2PQQA 1Y0UA 4HZFA 1X3UA 1RUOA 4EQQA 1YG2A 4HOBA 5FGMA 3I64A 3WODF 1PP8F 1FZPB 3QU6A 5BMZA 4KN7X 2XV4S 4BAYA 4I7HA 3FM5A 2EA4A 2PTMA 5FDBA 2EA2A 3HRTA 5I0RA 2VONA 1CF7B 5DCMB 2PHDA 2Z9OA 1H1MA 2VE9A 4MGKE 1ZRRA 5L3DA 3Q9SA 2P8TA 4LD5A 3F6VA 3JW4A 1OYIA 1YW8A 3E6CC 2L4AA 2IXHA 2L4MA 6PAXA 2V09A 4BH9A 1G3WA 1G3YA 2UWMA 1LJ9A 1YS6A 4HLYA 1IPKA 3WTWC 5DUIA 1TW2A 3PQKA 1LKNA 4MH0E 2ZCWA 3NJZA 2EV0A 2KIUA 4LULA 2PMHA 4J1WA 3KETA 1G4DA 4LUMA 3S0MA 4I01A 1OD5A 2ZNYA 4M72A 1O3SA 1ZRFA 3ZN0A 3MQ0A 2GZWA 1UD1A 1XB4A 2HKXA 2NAZA 5I0UA 4IHTA 4B29A 1Q1HA 1IAWA 2XKOA 2TDXA 3J7AO 3ECHA 3VHRA 4Q0SA 5BUVA 5I91A 5CJ9A 1KYZA 4RS8A 2QQBA 3S2WA 2HQNA 1R00A 5ILVA 4AWXB 4FBFA 4E2QA 4LLGF 1J3QA 3K0LA 1E2XA 4EJWA 1JHFA 1JGSA 4GULA 1CAUB 4B8XA 2RNJA 5LEKA 4X6QB 1XGMA 4AXOA 2M87A 2VOPA 5EZWA 3WW1A 2NRAC 3GFIA 1DGRA 5EFUA 3WTVC 2A61A 4BXUA 3SHRA 1QZYA 2XLAA 2ZO4A 3U1DA 3H7JA 3SCHA 2DI3A 3C3VA 4KNYA 2OYZA 4Y15A 3ZDSA 4NB5A 3GLXA 2VODA 4PGGA 3EYIA 3VOEA 1CAXB 2W24A 3T8TA 4I0BA 3RKYA 1B1BA 4IPAA 1DP7P 3I5UA 1F4KA 2HFHA 3SQNA 5D1IA 2B8MA 4WXHA 4Y17A 1YW7A 1DDNA 3KMHA 3BP8A 4B09A 2KXLA 2F4PA 2MBFA 5FQ0A 2D40A 2DK8A 4IRIA 1U5TC 3V7SA 5ILSA 4YFNF 3QPHA 1EH8A 4DNCA 4RB3C 4YRDA 4CZZA 3TNQA 1UCRA 1T38A 4KUMA 1MDMB 4PIZA 2VBXA 2PFBA 5EEGA 2KRFA 3I53A 3CLPA 3RYRA 5LHGA 5BOXA 5E1WA 1O5UA 5LHIA 1R36A 2F5FA 2PBIA 2V1DA 4UXNA 3W6JB 2QJVA 2Q30A 5DV5A 3GYHX 5KHKA 5CVIA 4P9UA 2P7CB 3HTSB 3PVBB 2BBYA 3CO6C 3OF1A 3P9CA 3HTUA 2VOOA 4Q0QA 2MH9A 2NNNA 1FBUA 3ZP5A 2KKOA 3I54A 4I02A 2XLGA 5HVQC 3IL2A 2L01A 4LB5A 2M1BA 3C7JA 2NYXA 2YU3A 3CTAA 1RIOH 5CLSA 3DF8A 5BPIA 5DCFA 5IT9K 4DQ2A 5HS9A 2UY9A 2YX7A 3W6KB 5KK1A 5JCTA 2GC0A 3M9AA 5HLHA 3BB6A 4YG2F 4KIGA 4KT5C 1DZTA 2QLZA 5C8WA 3E6BA 2O61A 5JHUA 2F5CA 4WK8F 4L2NA 5CYVA 1J75A 2RQPA 5D6FA 1UW8A 4KFCA 2BNOA 3L2HA 2FMYA 4FAHA 2FXAA 4RGSA 4X6RB 5FLXK 2VQAA 3GYDA 2CSOA 4M6XA 4IEPA 4Y13A 3S7EA 3I71A 3GVAA 2ATFA 4EJTA 3REOA 1T0FA 3HSEA 2QBYB 4HAMA 4HF0A 1RNLA 2EFOA 3NVCA 2NS0A 4UUVA 3SCGA 3ELKA 4AVPA 5CVRA 3HSRA 1ZN2A 3IDCB 3EETA 3LWCA 1SFUA 1ONVA 2JT1A 4A6EA 4ZYGA 1GXQA 2FSWA 2VBYA 1XN7A 5BXXA 4LGWA 3E3VA 2V1UA 4ENJA 1YWKA 2LF8A 2DTRA 1D5VA 2JZYA 3J80K 4I09A 2MPFA 2JSCA 5BQTA 2D2WA 5JVTA 4XRFA 1O3RA 3O6BB 3OV8A 4BNCA 5FLJA 1TBXA 1QBJA 2XHKA 4M73A 5JSPA 1TNTA 2M30A 3H50A 3TO7A 2ZBKA 2O8XA 4IHSA 1YFHA 1FY7A 2A3SA 1V3FA 3RKXA 1IN8A 3EJKA 3R60A 4FAGA 2A6EF 2QQAA 3E5QA 1ZG3A 3SXWA 2F2EA 3LSTA 3UKNA 5L3EA 4RB0A 2QVSB 3EHKA 2FBHA 3QU3A 1J3PA 2K9ZA 4UVAA 4ENKA 2JTVA 4HBLA 3IDBB 1SD5A 4EMSA 1HXDA 1X8MA 4LJZF 4O6JA 3KGLA 1WQ2A 4EJOA 2FMLA 3P7NA 3L09A 3BALA 1QGPA 5EEHA 4HX8A 3KP2A 5K8SA 3RPUA 3U11A 4KIBA 3F8BA 1U5TA 3ROUA 3DFGA 1T39A 3LFKA 4XFFA 4WXCA 1BC7C 4P9GA 4XBFA 4OLLA 2XUBA 1BIBA 1SD6A 3EQLF 3DQVC 4RGXA 1FWZA 1RI7A 4A5NA 2OQRA 3MAJA 4ZYDA 3M8EA 5J8CA 1KU3A 2J5PA 2IA2A 3P9IA 4L11A 4ESBA 2KJBA 4ETSA 3VODA 4JQFA 3VFZA 4U0VA 4BHCA 1SQ4A 2P5KA 1ZZ8A 1LNWA 1JXSA 4YYOA 1UHMA 1DUXC 4KU8A 2LF7A 2BEOA 4HVQA 2QDRA 1NYWA 2PLYA 2FNPA 2Y0OA 3IBMA 1D3YA 5DYMA 3MPBA 3F8FA 4A0ZA 4FT8A 1XCVA 2G9WA 3GO5A 1HKTA 3L2CA 2EVXA 2D1VA 5D5UB 5I93A 4IEVA 2W84A 4AIHA 5FFZA 2Y0MA 1MZBA 1WWXA 5DUKA 2ISYA 2QENA 3FE5A 4HMZA 4OIQF 4J1XA 2BNNA 4EM2A 2MH2A 2XROA 2Q0OA 3CO2A 3GW2A 3L9FA 1ODDA 2XKPA 2I45A 1ZLJA 2CYYA 3LQRA 4H0EA 2D45A 4MGZE 1HKQA 1U12A 2YX4A 1WSUA 3IRRA 1WI9A 4MGRA 4IEOA 4QXKA 2QM3A 2DFIA 1ZHFA 5E17F 1TW3A 3GBFA 2R7FA 4ZZLA 3SHFA 3M8FA 2QNKA 1IZ1A 4G8XA 1EV7A 3F3XA 2MA3A 1NHAA 1EYBA 3BWGA 1B4AA 3KZZA 3FFQA 5HS7A 2P17A 1HW5A 2AXLA 3GZ6A 3C18A 1ZRDA 4YFKF 4OMYA 4MQ9F 4AQ6A 1IXCA 4XF0A 3P9KA 1PDNC 3DEUA 2Q8KA 3PQJA 4CO8A 4DINB 4A2UA 3LWFA 1T98A 3IWZA 3BCWA 5FQ0B 1LDJA 1S6LA 4CICA 1DPUA 4IXAA 3LA7A 1XSDA 2H0VA 3ZMUA 2WWYA 1H9TA 4MQVA 2RGVA 5H20A 1OPCA 2A68F 1SFNA 3RIRA 1FXZA 1XSVA 5LRSA 3E6DA 1NZCA 2FEZA 2BYVE 3RJPA 3WGHA 1TQIA 4MHGA 3ZPLA 4JV4A 1UIJA 1ZG1A 2RKHA 5LLQA 2IA0A 3NKTA 2Y48A 2P6TA 2Q4SA 5K5QA 5HI0A 1O4TA 1MKMA 4L9TA 3B02A 4M74A 3JZVA 1XE8A 1USTA 5D6EA 3RI4A 1XCBA 2ZMEA 4U7DA 4QGMA 2EJRA 4AVAA 4L0YB 1ZARA 3NL1A 3NQOA 4MEXF 2MLGA 3MDPA 4MNUA 1QZZA 1R5HA 2UXXA 1SMYF 2X4HA 1SMTA 2HTJA 1ZZ7A 1P2FA 2COMA 1GQGA 2EB7A 2FE3A 2KJCA 1CGPA 2FQ3A 2CO5A 2OQGA 4HF1A 4GCVA 2FQPA 4HV5A 1FSEA 3FXQA 3FZ3A 3CF6E 1RZ4A 4XEZA 3BPXA 4CHUA 2HWVA 2C0ZA 5D4SA 2ESHA 4G6QA 1AWCA 3BROA 4QGNA 5JSRA 1L3JA 1FC3A 3MZYA 4XSXF 5CVUA 1JE8A 3WG9A 3TNPB 1VJ2A 3GUDA 1IXRC 5D8LB 1VR3A 5I0SA 2GWRA 1J1LA 4L9NA 1XGNA 2IXCA 4IETA 4IEUA 4UVBA 3PLQA 4RAZA 1K78A 5E1RA 3NEUA 1OR7A 2HQRA 5ILUA 5ICEA 1K79A 1TLHB 1J3RA 1XDSA 1ZYRF 3LAPA 1R1TA 3RZZA 4A0YA 2PAMA 1O7LA 5T3NA 2HGCA 2GXGA 2XL7A 3BU7A 1EY2A 3HHGA 2GAUA 4YIFA 4Q4ZF 2MC3A 1UFMA 4YIIA 1MGTA 1YO5C 3J81K 4EVIA 2PQ8A 5BY5A 2R7DA 4N9IA 3K69A 4P9FA 2WFPA 1A04A 2D5HA 5E18F 1ZGJA 3U0ZA 5HDNA 2ACJA 4MX3A 2GQQA 2STTA 1HW1A 2BV6A 1HQCA 3ES4A 4G6DA 2A07F 2XAHA 5JI6A 4IEWA 1TQPA 4M6YA 4OMZA 2YR2A 2ZNZA 1RUNA 2E1CA 2OA4A 4XF9A 3H1WA 2D1HA 4MTEA 1ZZ6A 3QOPA 2A6HF 3KEOA 3V8JA 4ZYHA 1H9GA 3TDZC 2EA7A 4EM0B 4WBBA 1ON2A 2LDUA 2ESNA 1BI3A 4IVNA 1F1ZA 1S29A 3T8RA 4O9EA 4KMFA 1YHFA 1IXSB 3HQXA 5J3UA 4R1HA 4HA8A 3FWEA 3K1PA 2CW0F 4FX4A 4KICA 5ICCA 4QM8A 3MCZA 5LEJA 4HLTA 1HSJA 4LMYA 5FLHA 3ZQ7A 1W7PD 4GO1A 3KCCA 2FU4A 3LA3A 5FD5A 4KIFA 1OI6A 5BPDA 3L00A 1U5TB 3O2PE 2VC0A 3I0TA 4R79A 4U0YA 2FF4A 3ECOA 4QLCU 3SXYA 5FD6A 2HEOA 5JR7B 2K4BA 3V8KA 4JTOA 4XF3A 1DZRA 1X7NA 1QWRA 3HSFA 2QCSB 4D7SA 1E17A 3EUHA 4Z07A 5AIPA 1VTNC 3DP7A 1STZA 4HV6A 2CGPA 5I0TA 3I7DA 1BC8C 4MGYE 4L9JA 1V70A 5J7MA 1J5YA 2D93A 1XE7A 1MJBA 3F23A 1ON1A 2HYFA 3ES1A 3U10A 1REPC 4UBGA 2QQ9A 3TGNA 4HF2A 5F64A 3FHZA 3M70A 2V1XA 3HUGA 3COAC 4XF1A 2PYTA 2M8EA 3HT1A 4META 4R8HA 4S05A 5A2QK 3WTYC 2IXLA 3KGZA 2MD5A 1XMKA 1NE4A 3TO6A 2AS5F 2RV8A 5L3GA 4EWDA 2DAOA 2V79A 4QM9A 1G3SA 3WTXC 3PNAA 2HR3A 4HDVA 1RL3A 1W4MA 1BM9A 1P4AA 1SFXA 1ZX5A 4MGIE 5E1ZB 2VBZA 2HTSA 3CDHA 3EYYA 1UB9A 1KA8A 4GYGA 5E1XA 2UYBA 1LB2A 2Q2EA 2GH2A 1YW9A 3RKWA 4HSJA 4ZU5A 2ETHA 4I0AA 3GZ5A 3TOBA 2RDPA 4UBHA 5LBQA 3ZMZA 4XFHA 5DD4A 2E1NA 4PZJA 2K4JA 2P5LC 4RGRA 1SAXA 1R23A 5CVVA 2E7WA 3BJOA 3H1YA 4HN0A 2UXNA 4IEXA 3WW4A 4BIFA 3ABUA 5J6XA 3VEPA 4UVCA 4F7ZA 5L3BA 2Y75A 1WGPA 1PM7A 4FHTA 4HX4A 1O3TA 1F9NA 2JPBA 2C6YA 4KWKA 2NNYA 1KQ8A 2EFWA 2F5DA 1X8EA 1XGOA 3E5XA 2IJLA 4HW0A 3RYPA 2W85A 4R52A 4IEZA 3ZMTA 3USSA 4WVZA 3R0JA 4L18B 3LZZA 1Z1DA 2DBBA 2VECA 2EFQA 4IESA 1KU9A 2Z69A 3QPTA 3FZVA 1D8JA 3LAGA 3ST7A 3WTZA 4ZU4A 3H1MA 3GF2A 2O8QA 3JAMZ 3GWZA 3FMQA 2QWWA 3E6MA 3MFKA 5L3CA 4XLPF 2CFXA 4ON0A 1YFXA 4LLNA 1FT9A 2PHLA 4PJYA 2ZMEB 4ENMA 2DQRA 2GXBA 3FX3A 4CYDA 2OBPA 4FX0A 1BI0A 2K27A 2XAQA 1KQ9A 3F8MA 4S04A 2GC3A 2F5EA 4E2SA 2MNGA 1FOKA 2V9VA 4CXFA 2IXKA 3CJXA 3OOPA 3WGGA 4CDGA 1TQ5A 3GEZA 3NW4A 2WTEA 4E70A 4M9SA 3KE2A 3SMHA 3WU1B 4IEYA 2Z2SB 2O0YA 1UIKA 2EWNA 2VC1A 1B6AA 2P6SA 3V8LA 3BJAA 2HZTA 4JK1X 2PMUA 3HRSA 3EO6A 1W5SA 2H09A 3IC7A 4WXDA 4A5MA 2PFWA 5K1YA 4OIOF 4LUKA 2RVCA 3FXUA 1C0WA 5L3FA 2IXIA 5JFRA 2V6CA 1HBXG 1YFWA 2RN7A 3G7DA 5ICGA 3KZYA 1K78B 4LB6B 2DPDA 4F8AA 4EGYA 2HS5A 3QAHA 3GFLA 3HRUA 3IKVA 5FPXA 1AOYA 1QNTA 2GIVA 4BYYA 2YSRA 2R3SA 4UXAA 2ADUA 5KHJA 1ZREA 3F6OA 4D7TA 3V7CA 2GC1A 2PEXA 1W5TA 4AVCA 4AVBA 1Y9QA 4G9YA 1IN4A 1YUDA 5HDGA 4KA4A 4WF2A 5LRRA 3WGIA 4H7LA 3WE3A 3G3ZA 1P4XA 4ESFA 4HX7A 1L3LA 1R7JA 1EH7A 2ZXJA 4BQAA 4ESJA 4HDUA 1J58A 1U2WA 1RTVA 3ZMDA 4XFBA 1LQ1A 2DU9A 4XLNF 4AD9A 1O3QA 3F72A 1TQMA 1FI2A 4ENNA 1KU7A 1YTYA 3MYXA 1OYYA 2O3FA 3ACLA 5BPXA 5FO5A 2P4WA 1ZZBA 4LA3A 3F21A 1OKRA 2PG4A 1NE6A 1XMAA 4K2EA 4HBNA 1IN6A 1PMIA 3GX4X 3K1NA 3IWFA 4HVRA 4O9GA 2QYOA 3JTHA 3B73A 1Z91A 5KBFA 1Z9CA 4ZYEA 3RDIA 3SFZA 4TV7A 4AIKA 2IC1A 1ZG5A 1R1UA 1J7KA 3CUQA 2H27A 2QZ8A 2L3DA 4RGUA 4EJUA 2DQLA 4IERA 4KMUX 5BV6A 1YIOA 2HOEA 2CQKA 3CUOA 2FOKA 3QRFF 4LLOA 1J59A 2E7XA 2UZKA 4KL1A 3T5XA 1HKSA 3SZPA 4KWJA 4ZZDA 1DGWA 2VT2A 3IHUA 3MEXA 1MD0A 1CX4A 5HOOA 4IJAA 4WX9A 2N7GA 4WCGA 3FHIB 1KQ0A 4OU0A 2GC2A 2DCTA 4HQMA 1I6XA 3D5LA 5LHHA 4E2GA 5TRDA 1VP6A 1WA4A 2OPKA 4G94A 3I59A 4XF4A 4G7HF 1ZZ9A 2DPUA 2DT5A 4KYWA 2CV6A 5CU1A 1BOAA 1YFYA 4EWEA 2ELHA 5FLXZ 2Q0AA 4CGZA 1H1IA 3F8CA 2VPVA 3OCPA 2DK5A 2L54A 1I27A 4LG0A 1QQIA 5TJJA 3WTUC 3R0AA 1ULYA 1IW7F 1FX7A 5FFXA 4YFXF 4EROA 3CLOA 1ZNPA 3H92A 1K6OA 1U78A 3ZN1A 4XETA 4L5JA 3K2ZA 5E8IA 3T0YA 5K5RA 4M9ZA 1PP7U 4YNIA 1SD7A 4M71A 3I4PA 3EDPA 5KVRA 5D4RA 1I5ZA 1Z7UA 3PFIA 1KGSA 3KP7A 5FLIA 4YSFA 2MHFA 4I2OA 3J80Z 4M9XA 3WW2A 1ZAOA 4ZH4F 2PI0A 4WWCA 2H6CA 3WW3A 1P4WA 2IW5A 3M1EA 1QO0D 3JAMK 2K0GA 3IRQA 4ORFA 2H6BA 2IT0A 4UV9A 4NVPA 4MUVA 3NRVA 2WC2A 4U7BA 3OGJA 1I1GA 1NXMA 2X0LA 1Z6TA 2QVOA 3TKYA 1BIAA 2IPQX 2OZJA 2E9QA 4O5VA 4Q0VA 4EJVA 3SZTA 4QMAA 3VB2A 3EQEA 1FLIA 1K7AA 4RB1A 2EFNA 3ZMSA 1Z05A 1UCXA 3RNSA 4HN1A
chains in the Genus database with same CATH superfamily
4LMFA 1JOJA 1MBHA 2ARXA 4QX1A 3LSEA 3GTLJ 4BZ4A 1K5MA 1Z6RA 4OIRF 3ZMVA 4OQ9A 2X9DA 2VTFA 4NIAA 4IGQA 2UYAA 1Z21A 4HSTA 2E34A 4ZXKA 2VZQA 2CAUA 1D0HA 4W1UA 3TO9A 2B5HA 2STWA 2OA2A 2B42B 3CZJA 5J48A 2PELA 4B47A 3VYUB 1L7QA 1WMFA 2XLFA 5ACA3 5IVBA 4E27A 4AE2A 2W46A 4NR1A 4D0PA 3RZJA 2O03A 1A35A 2JPCA 4O3MA 4HYEA 1RUD2 3H9AA 1I1SA 3A22A 3OYWA 3IH4A 1O8SA 2X5IC 1V4RA 4AI8A 2W91A 5C8CB 1R58A 5FPZA 1OH4A 5FMCA 3W2WA 3WQ0A 2HWC3 2JDAA 1PIV2 2WYFA 2A6WA 1DYKA 2G9ZA 3KSCA 2FBIA 1FYLA 1NT0A 4JP0A 4HEA2 2CV2A 2BGCA 3ZYBA 2CWMA 4RQPA 4Y5TA 1K42A 3WY6A 1HF0A 3PU8A 4WM8B 2ZZQA 2CW8A 1FPQA 4FTEA 4QDSA 5A7WA 3WP5A 5HLIA 4JRAA 4Z6YA 3HQRA 2VNGA 4MVTA 5FMOS 1MIJA 5LA2A 5JZGB 2BRTA 3WZ1A 4EGZA 3LOIA 2WWJA 2R7WA 2CV1A 3FL7A 4CVUA 1VBB3 4XZUG 3LA2A 1JYCA 5LY2A 3NRUA 3G6JB 1AXKA 1ZBE1 1GLNA 3M1HA 2DVGA 1XGSA 2OPWA 3ERMA 4ET7A 4EN6B 4CTEA 3CQOA 5DEQA 4BGDA 2CTVA 5J1XA 1WKMA 5ICFA 3ZKYA 2JICA 1R5ID 1IC8A 2VQTA 2JD4A 1DPRA 1ZBE2 1Q5OA 4HANA 5KHIA 1W2NA 3QACA 2J5OA 1VQPI 1FNZA 3OYLA 1CF7A 2VT3A 4ZY9A 1IN5A 4QPOA 5ERIA 1S7AA 5IT6A 4P1WA 1XSXA 5KHGA 2XGXA 3MKLA 1O7FA 3POFA 2YC2A 5J8FA 3TBIA 3ZIWA 2YHJA 3JRIA 3ILRA 1WHUA 4Q4X1 4IXLA 3PMSA 2HVQA 1W0UA 4O65A 1GVJA 4RN5A 5JXJA 1S3JA 1BI2A 3B3QE 2VOWA 5IVYA 2P5VA 4OFGA 4CP2A 4BQYA 3TEZA 4UW6A 3DKWA 2ECBA 3CUQB 1Y6IA 2QQOA 1LESA 3H8OA 4N9HA 3W5MA 4XJUA 4LK0F 1ASJ3 1A36A 3KP4A 2D6NA 5LGUA 1H8VA 4L0ZB 3MD2A 5D5XB 3ILNA 2RG4A 3V7RA 2VE8A 3I2KA 2GA1A 2DWRA 1HSTA 3Q9VA 2LY1A 3AFHA 4MEYF 2CNAA 3A7QA 3D0SA 4KNCA 1E5RA 3FMSA 1W04A 4ZZ5A 3PUFA 3KLOA 3WHBA 3RMYA 3M7GA 3AMMA 3PTYA 4EWAA 1U0AA 3WLUA 2JX9A 3O1VA 3N35A 4JGZA 5C71A 4NQWA 3AP5A 2IAIA 1H0MA 3URFA 1BZWA 3DTIA 2NOGA 5EDNA 3FJSA 1OLME 1AJOA 3UR3C 3MFCA 2TNFA 1MSEC 5IVEA 4Q0UA 3TB0A 3O8HA 4CEYB 4Q2FA 2CH0A 1W6QA 3MW3A 4PBPA 1AR91 4I30A 3QPLA 3VBSC 4XICA 4G7OF 1OFSA 1Q43A 4E7HA 3FN9A 5FKMA 1Y8QB 3IH3A 2EFPA 3D0JA 4E8DA 1TME1 1CWPA 1GZWB 4Q47A 3HHHA 1YHQI 2XAGA 4U2AA 4IX7A 1XYOA 4CYCA 2HWE1 4UFIA 2NOJB 2VNRA 4CP9A 3DBHB 2ZGQA 3NV4A 1GQHA 2O1QA 1MPXA 1GZTA 1B9MA 2FBKA 1RHI2 1ULPA 4LO4B 2VJJA 4PGHA 5J96B 3SEPA 1HJGA 3PVNA 4OMCA 2WAOA 5CADA 2HWE2 3TEXA 4Z8BA 4YELA 2EIEA 2XPJA 4LEJA 1QDOA 1JOBA 3O1UA 3WU0A 2V4VA 1VQNI 1ZGAA 3JB4C 2R5ZB 5JUVA 1BVVA 1U3EM 3BJ6A 1F5TA 3B94A 3UNGC 4AWDA 1CAWB 1U6GA 3UKVA 1KDMA 5M5WJ 3DL3A 1WVRA 1OURA 3BQYA 2XASA 3KP5A 4ISRA 5F39A 2CWEA 1J9IA 1BK1A 4PIYA 3I2JA 1XD7A 1LEBA 1FPN2 4LTAA 2DO7A 4YVWC 4CZCA 4QB6A 3GXOA 4B1LA 5J37A 2W82A 1OYWA 4LKEA 1YLLA 2AUYA 3GFMA 3HOTA 5LY1A 3S5AA 2JDZA 3ATGA 3N7MA 3VDBA 4IL6C 3ZMNA 1D4M3 5A2QZ 2FZ2A 2K02A 2DBNA 2DFBA 3K9TA 3RVHA 5DABA 1CN1A 1WJEA 1MEC2 3NAPA 1GZ9A 2BWCA 4EYUA 5T5JA 2B0LA 1VQ5I 3UKTA 1FIAA 4IF4A 1E3HA 1AR61 1D8KA 2PHFA 5ANNA 1R49A 1X82A 4FSJA 2XF6A 2TRTA 4L5IA 2OTJI 3IIAA 1NA1C 1AR62 5JAXA 2KIMA 2BFUL 5FZFA 1XYNA 2O9LA 1W7PB 3HRMA 3I56I 4CUCA 2NYYA 1FOWA 5C3PA 4I98B 2CRGA 4OOIA 1OSGA 4HZFA 1RUD3 4BKXA 1IQAA 3GGLA 4CU6A 5B4NA 4I7HA 1ZRIA 2VTXJ 2ZTNA 4GALA 1S1AA 1W0NA 1PIV3 1R081 3ENRA 1D1AA 2NVXJ 2PHDA 5DCMB 3UJOA 1L7LA 4XNFA 5CFCC 2CU5A 3ZLIA 1ZRRA 2P8TA 2IVIB 3ZQIA 2WS91 3E6CC 2L4MA 2V09A 4N53B 2VCCA 2A5WA 1QOOA 4CDQA 1G3WA 5E79C 2HVRA 3E0JB 4NHYA 2UWMA 4NE9A 2RS11 2P81A 1MMSA 4HLYA 1IPKA 1PZ9A 1TW2A 4GWMA 3MW2A 1S9HA 2JECA 4K21A 3OOXA 2B9SA 5LA0A 4HK9A 3KV9A 4LUMA 2JVGA 3S0MA 4I01A 2ZNYA 2EIMH 2ZC2A 4MG2A 4WVMA 3MPPG 5BNPA 2GZWA 2FQ4A 2NAZA 5I0UA 4B29A 4YW1A 1IAWA 4GH4A 1ZBE3 1OHFA 3W21A 3B6AA 5CFDA 3GZUC 5BUVA 1WLCA 2E2HJ 2C5DA 2E7AA 4R9DA 3BR3A 4GB32 1T0FC 1A8MA 2M7AA 4D5FA 2XWBB 5C3OA 3S2WA 1N47A 1I9RA 1R00A 3HAGA 4LLGF 1J3QA 1LOAA 3ZFFB 3CMEI 5DUUA 4RM2A 2RAEA 4GULA 4FFHA 2RNJA 2ZJRF 1X4PA 3S1MJ 5EG0A 3WW1A 1FMVA 3GFIA 2D43A 4KMQA 4E7SA 2QF7A 3X29B 2BW3A 3WTVC 1QGLA 2A61A 1R9TJ 3LEIA 2DMUA 2ZO4A 1WA6X 2JDNA 3K46A 5F9TA 2XOMA 2X5IB 1MH4A 3H7JA 5FXXA 3GHMA 2QZ2A 4KNYA 3I2GA 3GLXA 2ZXQA 5LCWL 5F1JA 3VBOA 4M0HA 2RHPA 2XF5A 2W24A 3V0AB 2CUFA 1TWAJ 5FY0A 3SQNA 1GV9A 5JXIA 4JC1A 4R9BA 4WXHA 2H0BA 1N78A 2XJVA 2A70A 3CDIA 5EYYA 2DFEA 3Q8AA 4XMYA 4B09A 5M3FJ 4M3EA 2MBFA 2JDHA 4RS5C 4IRIA 1U5TC 3V7SA 3WHCA 4YFNF 2J1VA 1EH8A 3M2MA 3KVBA 5GTHC 3WCSA 3I4NJ 4KUMA 5SV8A 1MDMB 1S0IA 1B72A 3CLPA 3RYRA 5LHGA 4HXCA 4P02B 1F9KA 3PUAA 3POBA 3OS0A 1RJ8A 3QH6A 5C9AC 4IE6A 2IGMA 1QJU2 1JUMA 4AGGA 5DV5A 5KHKA 3HTSB 1R71A 1TMF2 5F32A 3KT4A 1UHSA 3A2KA 3M3EA 1JU3A 3HTUA 2VOOA 2NNNA 2ZHLA 1ENXA 4XAAA 3ZP5A 3WDVA 5LBEA 4I02A 5HVQC 3AG2H 3D5SC 4LB5A 1EUUA 3ZN6B 2NYXA 4YZ5A 5DAXA 3I3BA 1SLIA 3CTAA 1JJ6C 4XVHA 3DTKA 5BPIA 1C1FA 5IOZA 3PUQA 3TEYA 5C5UA 4ASLA 1O4ZA 3M9AA 1RHI3 1I1EA 4YG2F 5LBCA 3K4CA 1DZTA 2KHMA 2LR8A 2HWE3 2F5CA 4IHXA 2LS6A 1P9QC 2RQPA 2XB6C 4ATFA 4KFCA 4Y1UA 2TUNA 4LO8A 4RGSA 3C7OA 4X6RB 2R0QC 2VQAA 3GYDA 2CSOA 4IEPA 4Y13A 5CQGA 3TOJA 3NNGA 3VDCA 2ID6A 4PDWB 2Y6GA 3H5NA 1UZZA 1W2AX 1R64A 3HSEA 2MD0A 2VM9A 2QBYB 2AREA 3I3LA 1RNLA 1NY71 3ABZA 4QXCA 3AM2A 2KT0A 4UUVA 3BCAA 4D7YA 4QAWA 1PVEA 1DZQA 2J22A 2FSWA 2HZDA 2QGUA 2QEXI 1V9U2 2BGOA 1XN7A 4FPEA 2VW1A 1AL21 4ENJA 2O8KA 4XACA 4B7KA 1FPN3 5B5EC 2D2WA 4LBQA 4K8RB 3SITA 5JVTA 4RAGA 3O6BB 4BM8A 3D5OA 5FKLA 2ZAAA 1GP6A 4BNCA 2EH3A 2DA5A 4M73A 3RZKA 4IE5A 1OA4A 5ANQA 4IHSA 4B1RA 2W94A 4TN7A 2A3SA 2NZ9A 1UOBA 1DG6A 1IRXA 5B1BH 2A6EF 1ZG3A 1CJPA 2W1OA 1N1TA 2P34A 2QVSB 1RUI1 4BJ6C 1RUJ1 4C2MJ 1ZKGA 1W3XA 1SD5A 1X8MA 3B93A 1NQJA 4O6JA 3KGLA 1WLDA 4EJOA 3T2PA 3L09A 3KIOA 4JOMA 4II2A 1RUI2 4LBKA 1RUJ2 2DYSH 4FVVA 2L9LA 5K8SA 1W6MA 4MIMA 3F8BA 3ZXLA 3AKSA 1AR63 4XQFA 3Q8FA 4OLLA 1OC1A 3A23A 3DQVC 2BDRA 5JLVA 1FWZA 3M4OJ 1JUIA 4ZYDA 1JYWA 4DUVA 3M8EA 1KU3A 2CUJA 3VODA 1RINA 4XW3A 4BHCA 1W28A 4DXRA 3SFIA 2D6KA 1WW6A 4YYOA 3AYDA 4XONA 1B09A 4KU8A 2LF7A 2BEOA 4Y5Z0 1X58A 3SLIA 3FK6A 1D3YA 1PVXA 2R32A 4ZZ8A 1DLCA 5C3RA 2WZEA 2XDVA 1HKTA 2D1VA 5I93A 1YNAA 3Q9OA 1EV12 5FIXA 1O8PA 5FFZA 1X1BA 3KVAA 1W6PA 2Y0MA 4LHLA 1WWXA 3FE5A 4Y33A 3O5SA 2WN2A 4YVWB 2XHNA 2V9KA 2F4IA 3CO2A 3B01A 1X9TA 3TEDA 2YU1A 1MS5A 5FZAA 1BBT1 1ZLJA 2Z42A 2CYYA 4H0EA 2D45A 2DF7A 4MGZE 4UW3A 2VJIA 3NV3A 2WS93 1MVEA 2DOEA 4QKFA 4MGRA 2W87A 4IEOA 4QXKA 1QOTA 1GV2A 3GBFA 2R7FA 4BB3A 4QB2A 3SHFA 4S2DA 4G8XA 2BPA2 2NLRA 2VZUA 4ANJA 3EMRA 3P5BA 3FFQA 2D6PA 2VZTA 3DXTA 3ZYJB 5EZGA 1CJDA 3GZ6A 3GJBA 1B35A 1ZRDA 4B4RA 4TLGA 4OMYA 4AQ6A 1OA3A 4JX0A 3DEUA 2J1EA 2AZ5A 3B69A 3LWFA 3PIGA 5DAPA 4N8MA 1NA1B 1XS9A 5BNGA 4GB33 2LROA 3AZZA 1SDWA 1UMIA 1XSDA 2CS3A 2WWYA 4MQVA 1XSVA 2O8OA 5LRSA 1NZCA 1IG3A 3VWBA 1ZG1A 5LW9A 1GKBA 4YZ3A 3QYEA 1O59A 4DY3A 4FXKB 5K5QA 3R0RA 1UOGA 1MKMA 3JZVA 5D6EA 2XPWA 3LNQA 2ZMEA 3MICA 3OBZA 3OGGA 3EUAA 3S6PA 2PN5A 1X4OA 4L0YB 1ZARA 3SC7X 3ZR5A 1I50J 4OVEA 3V0BB 4AOCA 4BEHA 1R5HA 2UXXA 4P9JA 3AMNA 3VBHC 1BOBA 2YC0A 4IDZA 1AU7A 3GZAA 2LH9A 2WDBA 5GLWA 2LMDA 4PF1A 2EB7A 2FE3A 1CGPA 1XX5A 3UYJA 4AFMA 3HN1A 5CA6A 2X6YA 1ODMA 2FQPA 3U14A 2R7EB 3AP4A 1RUG1 3DYMA 3CF6E 1RZ4A 1ZTRA 3HNMA 3BPXA 2ZEZA 2HWVA 2GN3A 5JVGF 1HQNA 1ZA4A 2ESHA 3ZXSA 1AWCA 4BQ2A 5E88A 5JOYA 1L3JA 1FC3A 4NPLA 1XNAA 2WNVA 1RUG2 1IXRC 1KITA 4YW4A 3FXJA 1J1LA 3BIEA 3BZKA 1UMHA 4LG3A 1VLNA 4CDXB 3PO2J 3AKRA 3NEUA 1UELB 2FD8A 2GH8A 4CCDA 1XDSA 1ZYRF 3LAPA 1QJU3 3MF9A 2W00A 3UT0A 4IL7A 4Y22A 2PAMA 5A1LA 1ZQ3P 4DRRA 1TMF3 3HHGA 2GAUA 2W5FA 4Q4ZF 3DKYA 1IGNA 2FX0A 2VOTA 2MC3A 1MGTA 1UYZA 2HOAA 5D8AC 2PQ8A 1Q8QA 3FBYA 4CU8A 4N9IA 3K69A 1A04A 5E18F 4F52A 1W2TA 1ZGJA 2LLKA 3KZ4C 2IVJA 2Y8KA 4UF0B 1VQ6I 4L92A 2ACJA 4NC6A 4MX3A 3GTOJ 2TCTA 1HW1A 2R16A 2KD7A 4NIGA 3CHXA 4ARXA 2A07F 1HA8A 4M3CA 2CUZA 5JI6A 3JR9A 1NCQC 1TQPA 4BQ5A 1XC5A 2ZNZA 2F6CA 2FUG2 2CYFA 3OEBA 2LREA 1Q56A 2YB7A 3BLYA 3TDZC 4EM0B 2QQVA 4ES9A 4A3CJ 5FZ8A 5BNNC 3FWEA 5E3LA 4JX6A 4E4SA 4KICA 4QM8A 3HPGA 5FZ3A 1H4GA 5FLHA 1HSJA 4RLQA 2QZ3A 3ZQ7A 4XKWA 3T0AA 2DUQA 3KCCA 4RS5B 1OI6A 3WCRA 1U5TB 2P5BA 3K2OA 2RMU2 3I0TA 4U0YA 1NZIA 5FD6A 1QNYA 2WZR1 4JTOA 1V9U3 1DZRA 3UNPA 3EUHA 3C2GA 4DEVA 4Z07A 3OSGA 3I7DA 4MGYE 1KRIA 1J5YA 3OPZA 5CIRA 2VD7A 1MJBA 2VKEA 5C9AB 2TEPA 5FUIA 1X2NA 3U10A 4Y7NJ 2XVGA 3ZYGA 3TGNA 3M70A 2I5UA 4HOOA 4LORA 3S14J 2YFZA 2W1SA 2XWJB 1C28A 1ZA7A 1JJ8C 3LEMA 3CDLA 4D3WA 4R8HA 4AYUA 3UGHA 1NE4A 2HDWA 3BQZA 2J42A 4EWDA 2W1UA 5E8AA 5L7OC 4HDVA 4NBQA 1QJEA 1RL3A 1ND2C 1RMU1 1GANA 1W4MA 1BM9A 1PGL2 4LXLA 1RUI3 1YI2I 1RUJ3 1P4AA 1WI3A 5GZCA 2OUMA 4QU1A 3OYMA 2YMZA 4YZ2A 5A33B 4F91B 3JQWA 3BKZA 1KA8A 3OIOA 2Q2EA 1QHGA 2JIGA 4HSJA 4ZU5A 1JOPA 2HVSA 2RDPA 4UUTA 3ZMZA 5LBQA 4XFHA 3I55I 4QXBA 1F4HA 1SAXA 2EXIA 5EEAA 1R23A 5SV5A 2E7WA 1F8VA 3Q8BA 3ACFA 3H9QA 3LOBA 5J6XA 3RZGA 3K4DA 5L3BA 3OMYA 3O1MA 1BYHA 4EE2A 4KWKA 1KQ8A 3BG7A 4DGWB 5J1RA 1EV13 3LSRA 3ASIA 4HKLA 4GD4A 3RI9A 1XGOA 3F95A 1MBFA 2IJLA 2JIJA 4URAA 2K46A 1WBLA 1OPMA 5EYXA 4L18B 3WNMA 4PJ0C 2Z69A 3ZFEC 3WTZA 2XPUA 3GWZA 3FMQA 2LBFB 1HC8A 2VUJA 1UYYA 3SH5A 4BXXJ 1IQDC 4CEWC 4ON0A 4LKDA 1BBT3 4H14A 3FX3A 1DGRN 4FX0A 1Z3XA 1BI0A 3O1OA 4UW5A 2QQ8A 2XAQA 4QDRA 3WEZA 2GC3A 3MIEA 5F3GA 2VI6A 3B9IA 2Y69H 4RA0A 3ABLH 2IXKA 1XYPA 4HPKB 4XLCA 4JKLA 3RQ0A 1TQ5A 3GEZA 4M9SA 3CMYA 5EZHA 4A6OA 3KE2A 1GFF2 2LM3A 3SMHA 5J1YA 2JDYA 2EWNA 3HBZA 2B39A 2Q8DA 2HWB1 4M0NA 2E1MC 2PMUA 1ZBA1 1UN1A 5F3CA 4A5MA 4AIDA 1EA3A 1A34A 4OULA 5DUXA 2KR2A 4Q4V2 5L3FA 4XKBA 5FMOL 4CRQA 2V6CA 3ZFGA 2DCZA 4QX2A 4F8AA 5KAIC 3BZCA 2JJ6A 3TN91 5A6XA 4NIDA 3IKVA 3UETA 3CC2I 1QNTA 3OB8A 2GIVA 5BYNA 1PMHX 2ADUA 3VZMA 5KHJA 2FCUA 2VULA 3F6OA 2GC1A 5GAEJ 4AVBA 3ABKH 4JGYB 1W8FA 1W8WA 1IN4A 5CISA 1OLQA 5HDGA 5GAHJ 4KA4A 5LRRA 4H7LA 3G3ZA 1P4XA 4ESFA 3U1XA 5HPOA 2WA0A 5HCBA 2ZXJA 5DPNA 4ESJA 2A6XA 2IS1A 3ZMDA 1LULA 2X1DA 4GKYA 3T1LA 1HCRA 1GP5A 5FZEA 4I3GA 1JT6A 1I5PA 4EN9B 5F2SA 1RUG3 1OYYA 3ACLA 2FDHA 2Q8CA 1YX3A 4DY5A 1OKRA 1NE6A 3J8F1 1NOVA 1IN6A 3GX4X 2OVUA 5FJHA 3IWFA 1HB3A 4A3FJ 4K40A 4MGQA 3B73A 1Z91A 4B48A 3IT8A 2YZ4A 3NNLA 2HOSA 3J8F2 1RB8G 2EQRA 3CCQI 2DFHA 5JMCA 1JU4A 2DVDA 3CDZB 3BTLA 3TEWA 4Q5OA 4CXWA 5BV6A 1YIOA 2HOEA 2DYRH 2V26A 2FOKA 4C3JJ 2DCJA 1E5IA 4B1MA 4XDPA 3GM8A 4K9SA 3T5XA 3IDEA 4QSHA 2W52A 3G1OA 1I3AA 4ZZDA 2YPDA 3O1RA 4OHYA 3IHUA 1VNDA 3MEXA 1CX4A 2OKXA 1YJKA 1QOSA 4IJAA 3CJTB 1KQ0A 2FCVA 3I2FA 5DG2A 4HQMA 5LHHA 1WA4A 2OPKA 1RR7A 2V4JC 1FOD1 3PVEA 4XF4A 4G7HF 2DPUA 2DT5A 4KYWA 2CV6A 1BOAA 3TRSB 3QBQA 1MS8A 1YFYA 4AAPA 3POIA 2R92J 4XJWA 4FPFA 2PHUA 1SLAA 1PUFB 5FLXZ 2Q0AA 3ONQA 1JZ7A 1IDYA 3VBHB 3OCPA 2CSGA 2L54A 4AFAA 4LG0A 5EGOA 1V55H 2ZSIB 3R0AA 3VBSA 3VHPA 4MFEA 4YFXF 3LB9A 2E5ZA 3H92A 1K6OA 2MG4A 3OIPA 2RMU3 2JJ7A 4JAAA 3WHTA 3WVJA 1LHWA 3QYFA 5K5RA 4XABA 3I2HA 2LOOA 4YNIA 5IYCJ 3EDPA 5L9VA 5H9RA 1Z7UA 1OQEA 4W8JA 3KP7A 3OS1A 3LEKA 4Q27A 4CDUB 3AKQA 1ZAOA 3SYTA 2A6YA 3OG2A 4ZH4F 5FRMA 3ZQCA 3HOBA 1MZFA 1OVPA 2PI0A 1WGXA 3WP6A 4WV8A 4C0BA 2IW5A 2JG9B 1QO0D 3JAMK 2K0GA 2PJRB 4ORFA 1US3A 2H6BA 2R062 1PZ8A 4MUVA 1QJFA 1NKGA 1QH7A 4LOCA 4FPCA 2QBXA 5FYYA 3ECQA 1YRNA 4N7IA 5ABJA 4QMAA 3VB2A 3K70D 3HOYJ 1FLIA 3RI8A 1SPPA 2WT2A 4G4FA 2F4MB 2FRHA 1O5LA 1ODNA 1FBQA 5IUQA 3LOCA 5IP6A 1V6IA 2RC4A 2XSDC 1RJ7A 2R7SA 4AEJA 3MV01 1NCQB 4LE3A 3ZSLA 3ZXDA 1DF0A 4HPQA 5HCAA 3NWKA 2EAKA 2KL4A 4IQ4A 1B8IA 5FZ9A 3CNAA 3ZX7A 3CBNA 3L2WA 3A4CA 2KRCA 4IV3A 2KIFA 2E33A 5AIQA 4YW3A 3IDAA 1GSLA 1ENQA 1GXPA 3UGGA 5BNNB 4LK6A 2E19A 1Y4WA 2P1BA 1BKZA 3RTRA 4Y20A 2R5YA 2XVCA 4LKSA 4RAFA 3VL9A 5LGTA 2E6VA 4Y24A 1MJAA 2VZRA 3KFWX 3ETQA 3N97A 1DQ6A 3F22A 1KJLA 2ET1A 1YFUA 2ZJ2A 4X0GA 2JMWA 2YY1A 1TTYA 4UYBA 2HQAA 4G7ZF 1HX6A 5FOBB 1G6NA 3ZR6A 1AYM1 1S2KA 2L9NA 1NH3A 4BJ5C 2W0XA 5A6YA 3WE2A 1QXRA 3CCLI 1HW2A 3AAFA 5FB2A 4CCMA 1LRHA 2G1MA 5B2GB 4BE3A 2OZUA 2ET7A 3Q0WA 3CP2A 4Y1VA 4GGGA 4LKFA 1HXS1 1F35A 1NLSA 2HKOA 1GWMA 1W9FA 3CMAI 4QQOA 4R4ZA 4RD7A 3C1DA 2OT7A 4BQ4A 1HXS2 3CJRB 3DF0A 1OCZH 1FYMA 3TL4X 1JKPC 4IO9F 1BN5A 3R4KA 2DDUA 4A6DA 1QJY1 1ND2B 1W1WE 4KN4X 1MNDA 2OJED 2QKDA 3UK9A 2OAZA 2DYCA 3DKXA 2JUGA 4P5OA 1BW5A 5IP7J 3SH3A 3V65A 4D1QA 5K5OA 4FCAA 3L2UA 1GQPA 1YRZA 1QJY2 1V5FA 1U5ZA 4AYBA 1JZ8A 2E7TA 3AYAA 3LSKA 4Q48A 2L7ZA 5CFCA 3JTGA 4JVAA 1W0OA 1IV8A 4ZTFA 1KYWA 1ULDA 2IP2A 4Q4W1 2P6CA 2BBVA 2VW2A 4AI9A 4DJAA 2DMQA 3VV1A 2WBKA 5C7GA 3OYKA 1VRH2 2KPMA 2R6QA 1N3PA 2VKHA 3T0BA 4CCCA 3U07A 4PIXA 3VBRA 2P6HA 4FOWA 4IEJA 3QP6A 5K7HA 1C1LA 1EP0A 1OQYA 1XNDA 1MJ9A 4AC0A 5AONA 2L02A 3VYRB 1SCSA 1BR4A 2V4AA 1NCRB 3DN7A 5FP8A 2W39A 1OMIA 4YFWA 2RS31 2CG4A 1C8M1 1W9WA 1R22A 4XFAA 4Q1RA 3L7WA 3ZFEB 3FLPA 4DBQA 1IF1A 4AI2A 5FZ6A 2BE5F 3H3VK 2HEVF 2LRPA 1W8OA 2ZGOA 5C6CA 3WG4A 3O3KA 4EM1A 3H7YA 2VN2A 5F5IA 3KLNA 3NSTA 1GZCA 3CO7C 1DQ2A 3NARA 4FETA 4TTGA 3ML6A 2QQKA 5DD8A 1H8AC 4MXWA 1QVTA 2LALA 4XFCA 2PJPA 3JSPA 1D0ZA 5E16A 1WBFA 3BTJA 4JQTA 1JUHA 1Y0NA 4B4PA 4DB5A 5LD2C 3PSFA 5D8KB 3J8F3 4RBOA 2HNHA 4FPJA 4EATA 1RPWA 5HDKA 4A3BJ 1HRI1 1FV2A 4HVOA 2P7VB 4AQ2A 3AP6A 1ULOA 1FNYA 4LT5A 3RYKA 4TLFA 1D2SA 3S16J 4AVTA 2E1MB 5I0DA 1L0OC 4YM3A 3DXJF 1Z77A 1CAXA 3CJIA 4WVVA 1DU0A 1HRI2 1WW5A 5J4VA 1JHJA 5FOJB 2XAFA 1FYKA 2Z5UA 4AVSA 4XE9A 4XQWA 4BL0B 4IV1B 2JKBA 2UURA 2P3YA 5K7FA 2SLIA 2XJRA 3U9GA 3FXLA 1S8NA 3CEWA 4P55A 3OL4A 1N1YA 2EK5A 4CE8A 4MTDA 3HKZN 5C4JJ 2YGMA 5J09A 5LWBA 5J47A 2YFUA 3S3MA 2E53A 2PLV1 3VZJA 1PVC2 1DGWY 4OUSA 3VZOA 4HNTA 3ACHA 3G71I 3DPTA 1VZ0A 5DAWA 2XR4A 5A7SA 2N8GA 4MV2A 3K4AA 2O6GE 2V72A 4P08A 2PLV2 4QXHA 2B45X 3SQOA 2XMLA 3SCFA 4FOVA 3RS6A 3TBDA 3C2HA 4M3FA 4CUGA 3N7LA 3LAJA 4Z2YA 5DZFA 1ZZCA 1XQNA 4GH4C 3DWLE 1PK6A 1K5MB 1TEIA 3CKHA 3I3MA 2VTXA 1IPJA 4PDKA 3CMMA 2L0KA 4NJ4A 1WCQA 2D44A 3R05A 1GUIA 2PN6A 2DLLA 1FIPA 5DS9A 2VE1A 3KV5A 3PJYA 4JTNA 2D5FA 2A71A 2J1RA 3G4SI 1S5LC 1JODA 4AGVA 2WQ8A 2IBDA 4BHPA 3ULQB 1URXA 5A1AA 5A7OA 3WP4A 4DQAA 4UV8A 3PURA 5FKKA 4LBLA 1B9NA 3OYWB 3AKTA 4GWIA 4GZ9A 1YYNA 3BPVA 4E7ZA 4V2VA 3VBOC 3J7ZI 1IRFA 2A69F 4IQPA 4RQPB 2MFZA 1DP0A 2FNAA 4C2UA 1WRJA 1Q3EA 3WDXA 3M3OA 5A7WB 5IAXA 3CIHA 5EJ3A 2AYHA 3BZ6A 5F3EA 2RM21 3I2DA 5GLZA 3FDYA 1GV5A 3C7HA 2K9SA 5ED4A 4JBAA 2OTLI 5LB6A 2ERFA 1R091 1SFEA 2FMDA 3MZHA 3M4FA 1APLC 3J4UH 2VXRA 1VAMA 1XE0A 2A5YB 3AZWA 3HQUA 2DVBA 4HLXA 4TZDA 2VZPA 2PQQA 3D5RC 2Z1DA 2OF7A 2VMCA 3W9AA 1X3UA 2J1SA 2K3FA 3I64A 1ONAA 3WD5A 1PP8F 2YG0A 2FD5A 3JRDA 3FM5A 4DRVA 1YQ5A 2Y60A 5FBJA 2R7QA 3OUHA 4M4PA 2VONA 1AX0A 1CF7B 3BR6A 2VE9A 5LK5A 2R7TA 4E4ZA 1MH3A 3Q9SA 1OYIA 1YW8A 4F3QA 5IK4A 2L4AA 6PAXA 1H2NA 3HJRA 4XBQA 4AFDA 4C90A 5JOXA 1LJ9A 3HEFA 2DJIA 2R041 3HGYA 4E7LA 2VCBA 4A6SA 1HXS3 4MH0E 5KCMA 3SH4A 3GZTB 1OVSA 2XF7A 4ATEA 2XB0X 4LULA 2QQNA 4J1WA 4R4XA 5GZGA 2R042 5C3EJ 1OD5A 2Q1FA 4XQ4A 1ZRFA 3ZVXA 4P00B 1V00A 5FYBA 4QQPA 2HKXA 3UKGA 1QJY3 4W6WA 2TDXA 3J7AO 1GMMA 3WSOA 3OPWA 3ECHA 1OF3A 1V5GA 2EZLA 4Q0SA 5I91A 4QPYA 2DURA 1DHKB 4EN0A 1KYZA 1KJRA 2VL4A 5FAXA 4C1WA 2GNBA 5LATA 1HDPA 4E2QA 3DEWA 1YITI 4EJWA 4JGZB 4NQWB 5LEKA 5IHRA 1UY1A 4AXOA 4D7NA 1UAAA 2BERA 5E6HA 5H9SA 4BWOA 2YV8A 4E9KA 2JWTA 1VRH3 3S17J 3K4NA 3ACIA 1AX1A 2XQXA 1ZELA 4DUWA 1UMZA 3SHRA 2W9XA 1QZYA 3P1IA 3T30A 3EYPA 4YRVA 1W6QB 3AJYA 2CW7A 3U1DA 5J1UA 1G8XA 2DI3A 2MW8A 4Y15A 3ZDSA 3POJA 4NPRA 3EYIA 1S0DA 5E3OA 2ZHMA 3I2OA 4IPAA 1DP7P 4AHZA 4FPOB 2F4LA 2RS52 2HFHA 1SLBA 3P3PA 3POGA 1QH6A 4CCKA 2PHXA 1V6NA 2D6LX 4QPGA 4W97A 5IK8A 3BP8A 2KXLA 1LAJA 2F4PA 3KD4A 1AX2A 4CYCB 2D40A 3IAS2 3RSJA 3PSIA 2GNTA 2ZGNA 4TWTA 1WCMJ 4CP9B 3O1PA 5ILSA 1LUJB 4DNCA 4YRDA 3SEQA 4CZZA 3LL7A 4FPYA 1UCRA 1P7IA 1W9TA 1S2BA 4PIZA 2VBXA 3J7AY 4COYA 3N3HA 2GLOA 2M7BA 3O12A 4FPKA 1YXWA 2D5VA 5FPVA 5DMYA 5GZDA 3K48A 5E1WA 1GP4A 1OQDA 5LHIA 4PK4A 2ARAA 2PBIA 1UYPA 1H30A 3W6JB 2QJVA 3K4ZA 3BTIA 1OFCX 4P9UA 3S30A 2BBYA 2BGPA 3FHNA 1NAEA 3P9CA 2V1NA 1HRI3 4FOQA 1F36A 3KCXA 1FBUA 4FISA 2KKOA 4EZ4A 1W8HA 4GA9A 5A1FA 2M1BA 5CKNA 4XXPA 5A80A 2YU3A 4F3JA 1RIOH 1RXGA 3VLBB 5HXVA 3WR0A 3DF8A 2I10A 4TSVA 5DCFA 5IT9K 2UY9A 4ARYA 3W6KB 3JRAA 5KK1A 1MS4A 3ZRGA 2GC0A 1P8JA 5HLHA 5APAA 4LOSA 1PVC3 4KT5C 2GMPA 3BTYA 1KONA 5LASA 3ZXJA 1WCUA 3UV9A 5C8WA 1WCDJ 3WQ7A 1E5HA 3FHAA 4OHZA 5JHFA 4WK8F 3CCJI 1J75A 1VB4A 1S0CA 2Y6HA 4BBSJ 5IY5H 2PLV3 4FAHA 2RV9A 2FXAA 4INDA 3NAPB 4LO6B 3S7EA 3I71A 4M3BA 1ST8A 4H55A 1B35C 4BE2A 4EJTA 2HWC1 3VD4A 5D8AA 2WRAA 3HDDA 4JKMA 2GOMA 4RFRB 3Q8EA 2PMWB 5G05L 5JMOA 3HSRA 1ZN2A 3C7GA 4E7IA 1AVBA 1LHVA 1GXQA 3NNJA 3DEMA 3QCWA 2VBYA 5BXXA 2IFRA 4FE4A 4XRMA 2JA7J 2UWCA 5GZFA 3X2QH 4DS0A 1E3PA 5FLJA 4YW5A 4XC9A 5JSPA 2WUHA 3WHUA 2M30A 1VBB1 3H50A 3K3OA 2WT1A 4Z92B 4FAGA 2QQAA 4OI1A 3A0BC 2F2EA 2NM1A 3UKNA 5L3EA 2ZMEC 4RB0A 2FBHA 3QU3A 1J3PA 4ENKA 2A3YA 2QSFX 1YJNI 5JLWA 1KS5A 1HXDA 4C30A 4LJZF 2FMLA 3BALA 4B3XA 2W48A 4HX8A 3MMYB 1RKWA 1J83A 2GALA 3AZYA 3ROUA 4CDQB 4Y1ZA 3LFKA 4WXCA 2OIIA 3WF3A 2ZXIA 4P9GA 4XBFA 4YGDA 5GP9A 1MZEA 1BIBA 4G9SB 1SD6A 4AHXA 4C3HJ 4ZC3A 4A5NA 1YIJI 1IO2A 4PJMA 2XB5A 3L1PA 2JA2A 4DPNA 1KEXA 1AKHA 4XZPA 3T0DA 2FDFA 4LE4A 3P9IA 4ESBA 5HXMA 2WNVC 1YQ6A 4ETSA 5FK8A 2Y31A 2VPLA 2BVLA 1ZGWA 4K6BA 4U0VA 3OIQA 4WM7A 2DA2A 3PO3J 1UZCA 2HBTA 2VNOA 4WVMB 5BNPB 3F0CA 1K4SA 1JXSA 1ASJ1 4F93B 1JI6A 4HVQA 4GH4B 3UESA 1NYWA 2VMIA 3IBMA 2ELKA 1F43A 4FT8A 5CFDB 3OBRA 1XCVA 5L7OA 1JKQC 3L2CA 1RVF1 2EVXA 5D5UB 3M8JA 3NKGA 5FKBA 4X8PA 5FZLA 3BOPA 2BTVC 1IGOA 1MZBA 4XN3A 2QENA 2B46X 2VJ5A 4OIQF 4J1XA 1RVF2 2BNNA 2MH2A 2ZMKA 5EG0B 4P14A 2XBO2 1DDLA 3L9FA 3WF1A 2YC4A 1ODDA 3MIGA 2BHYA 2XKPA 2BW3B 4KJZA 3LQRA 2WNEA 3POWA 2BBAA 1U12A 2IS6A 1JZ2A 1A6IA 5E17F 2QUOA 1TW3A 1SEUA 5L19A 4RMNA 2R043 1EYBA 3VBOB 4FTHA 5EIYB 4Q8LA 4LLFA 3K51A 5HS7A 2P17A 2AXLA 3WDYA 1SLLA 4YFKF 1YI7A 2Y33A 4MQ9F 1PDNC 1C3HA 3PQJA 4DINB 1UMQA 1QZEA 1W39A 3IWZA 3BTCA 3BCWA 2W68A 4OHXA 2X53S 3PNVA 1JZ5A 4KITB 3J9SA 2H0VA 3ZMUA 1H9TA 3OY9A 2RGVA 1BHGA 5H20A 4FPGA 3PUHA 2RJLA 1PJRA 3GJAA 3GCXA 1J1TA 1UU5A 2Y0SA 4MHGA 2IGKA 1UIJA 1B72B 4XTMA 4LR4A 4PLNA 1GNHA 3NKTA 4CEWA 4CCOA 2Y48A 2J7MA 3VPRA 2P6TA 2Q4SA 3IAM2 5FWEA 1EJ9A 1USTA 2ZHNA 2Y6FA 4XIOA 3VBFA 3NNFA 1XCBA 4UT5A 4U7DA 1MMAA 1RITA 1MVQA 1TZLA 2ORXA 4AL9A 1VBD1 3NQOA 4MEXF 3MDPA 5FKNA 2RS53 4MNUA 3IUOA 2DA3A 2X4HA 4LIVA 4BPZA 1P2FA 2COMA 1GQGA 4PI0A 3VHOA 2OQGA 1WH5A 3FXQA 1V6OA 1DFQA 3CQZJ 1XXNA 4CHUA 4UFMA 5FZOA 2C0ZA 1AR81 3KYCB 2FJ1A 3BROA 1EUTA 2Z5WA 1QQP2 4XSXF 4L5EA 3WG9A 3ZYFA 5D8LB 1VR3A 5I0SA 4A3MJ 2ID3A 1U5IA 2VNVA 4L9NA 2VASA 1V6LA 1VIWB 1AR82 2IXCA 4A7KA 1V54H 4KH9A 3PLQA 4XUPA 1K78A 5E1RA 2WR9A 2GN7A 4KQ7A 4Q4Y2 2M4KA 1JKRC 3RZZA 1R1TA 1TC3C 4QD2A 3BG9A 2YBKA 2ZZJA 5T3NA 5HBAA 1UU4A 2GXGA 3JD71 2XL7A 4CP0A 2X29A 2HYJA 3VD9A 1YO5C 3ZOBA 1OCCH 4EQVA 3JD72 5BY5A 2R7DA 4GFBA 3HPNA 4P9FA 2JG8A 4LHNA 2R071 5CZKA 1LHNA 1X1PA 3HD8B 1LHOA 1IS6A 2W2IA 3ITQA 4J25A 4OUMA 4LBQB 4IEWA 4OMZA 4HNVA 3U75A 2YR2A 2R072 4XL9A 1ACCA 4CDWA 1Q8VA 4XF9A 3U37A 3H1WA 2G19A 1ZZ6A 1T08B 3QOPA 3KEOA 3MEPA 2JB8A 4ZYHA 4JRLA 1Q1VA 2EA7A 2ZXWH 3K7AJ 5M3MJ 4WBBA 1ON2A 4D0QA 1WZXA 4KGGA 2LDUA 3FXMA 3S15J 2ESNA 1RUD1 1S29A 4MGTA 4O9EA 4YZ1A 3V42A 1YHFA 1IXSB 3HQXA 5J3UA 4R1HA 1A78A 2IEKA 1MSFC 2CW0F 1S4CA 5LZ6A 1W05A 3OD4A 3JRGA 3BR1A 3DPUA 3PFYA 2P3IA 2G9GA 1REEA 1PIV1 3RFRA 1S0JA 2EALA 5FD5A 4KIFA 5BPDA 3L00A 4DIQA 3O2PE 1W8NA 4R79A 5L9RA 4QLCU 3G6EI 3NNMA 3ZSKA 2EXKA 3ZO0B 3RQIA 1R1A1 3HMYA 2K4BA 3V8KA 3OBAA 2QCSB 3RZMA 3E7LA 1ENRA 1FJLA 3OYIA 5IVFA 5AIPA 2VL8A 2CGPA 3QD6A 1BC8C 3DKQA 4L9JA 4NDLA 3KX2A 3OYFA 1R1A2 2D93A 2EZKA 2HWF2 2HYKA 3R4DB 4NHMA 3ZFGC 3WNOA 1WKYA 1LKXA 3FHZA 5CB7A 2V1XA 3WUDA 2ZX2A 3HUGA 3GXUA 3VL8A 1X3ZB 3OUJA 4XF1A 1S0FA 2M8EA 1EAH1 3HT1A 1HRV2 1IPSA 2BVMA 5A2QK 3WTYC 2IXLA 1XMKA 4KBZA 3CCEI 2R1DA 3BTXA 2AS5F 2R7ZJ 5L3GA 2DAOA 2V79A 4GWNA 4QM9A 5K0UC 1S0GA 3PNAA 2HR3A 1PX3A 1W6PB 3OYNA 1EAH2 4Y3OA 1S0BA 3AJZA 1IS5A 5FY7A 1SFXA 1ZX5A 1XOYA 4XRSG 1MQTC 3POYA 2NVYJ 4OYUA 2JD9A 3CCSI 1PMJX 5FO7B 4GYGA 5E1XA 2XJTA 3Q3SA 2VMHA 2GH2A 1YW9A 2ETHA 5FWJA 4FOYA 4I0AA 4CCNA 3TOBA 4UBHA 2H1LA 1X3WB 5DD4A 2YYOA 3AYCA 3CC7I 2P5LC 4ISQA 2D7FA 1YQCA 2FOWA 5CVVA 3CMGA 3BJOA 1B35B 1IDZA 3H1YA 3VKNA 2AEZA 2A1XA 4IEXA 1F31A 4NROA 2SBAA 2W92A 1VQ9I 1O3TA 1C57A 1CZTA 4KGQA 3FKIJ 5GADJ 1MS0A 1OUSA 4ASMB 5CPRB 5FP9A 1RYYA 3RYPA 3OGSA 1RVF3 2WB1A 3VGIA 3OUIA 2K40A 3USSA 3R0JA 1HLVA 3S1QJ 3LZZA 2F5VA 2H8RA 1JXNA 2VECA 2XBO3 4A44A 3QPTA 2BFUS 5KXDA 1WMDA 3N7JA 2WSVA 4LIUA 3JAMZ 4MLOA 2ZBJA 5EV7A 3VKMA 3OL3A 5L3CA 5T5OA 1YOVB 4XLPF 3AYEA 4KISA 2RJ2A 4TYSA 4LLNA 1POV0 3ZSMA 1FT9A 2ZMEB 4CYDA 2OBPA 1KQ9A 4CZSA 2F5EA 3QPSA 3ZPYA 4E2SA 1PNFA 1FOKA 1VMHA 4UAPA 4A3KJ 4BEHB 3CJXA 5CG8A 4UB8C 3OOPA 3WGGA 2DVFA 3NQHA 3DU6A 4NWVA 5JOWA 5DUWA 2HLEA 4R9AA 5BNOA 2HXIA 1OCPA 3S1NJ 2OC6A 1LFPA 3GTMJ 2GDFA 1SVOA 3WU1B 4IEYA 1UIKA 5A3NA 4NRMA 2YXSA 4UFLA 5EWSA 3LD8A 1B6AA 1UKGA 2HZTA 3VZKA 5C5TA 2H09A 4D9JA 3IC7A 2WNVB 2V5DA 2WV1A 1JYVA 5K1YA 4N90A 2E2JJ 5F6KA 5J36A 3ON7A 3BG3A 1RHI1 2IZWA 2BV4A 2K5CA 3LGRA 1W6OA 4SBVA 1CQTA 1YFWA 2RN7A 2OPTA 2XSJC 2XVLA 4H4KC 2VOVA 2DPDA 4BQ1A 2J1AA 3ZOIA 3ZQLA 2GBYA 3QAHA 3GFLA 5IYYA 3A01A 4Y22B 5C3QA 3WG7H 3HN3A 3A03A 1AOYA 4RYDA 4BQWA 1A6CA 2YSRA 1YE9A 4FPHA 1D2QA 4XRSA 2CV0A 5FUPA 3AL0C 1BW6A 2L9VA 4D7TA 4IE0A 3ZIXA 2PEXA 1W5TA 1NK2P 3H8XA 5ABJC 3B5LB 2X09A 4AQTA 5C3SA 4XR6A 4IW3A 2EXJA 4HRIA 3IP4B 3KHCA 1VBD3 4QX0A 2MC4A 1R7JA 2M0CA 2E5NA 4M3CB 1UY4A 1RTVA 5KNLA 4XFBA 1TWCJ 4AD9A 1FPN1 4CCLA 1QQP3 2K9QA 3F72A 1EPWA 3WNKA 1TQMA 4UFKA 4ENNA 1YTYA 3MYXA 3MIBA 4IV3C 4QPIA 5GTIC 2O3FA 4RGAA 5FO5A 1LOFA 4DNYA 1ZZBA 1AR83 1XPWA 4L8QA 5FKOA 1XMAA 1A5JA 4M3CE 3AP7A 5FZ1A 2VQUA 2ZGUA 4Q4Y3 3O8GA 4HVRA 2DFCA 2QYOA 1ITYA 4E4DX 5KBFA 1Z9CA 1QF3A 3RDIA 2L2OA 2YPJA 3SFZA 5FY1A 2IC1A 1ZG5A 1MEC1 1UG0A 3ZYPA 1QEXA 1R1UA 1J7KA 3JUUA 5LFAA 1ETQA 2H27A 2VMDA 4RGUA 4IERA 4A3XA 3K4BA 1FX5A 3JD73 3OR2C 1NG0A 5GPCA 5JOZA 4S2FA 5FR3A 3VZNA 3C7FA 3H9GA 3N9MA 1QDCA 3VDDC 4KL1A 4HG6B 4RR3A 1HKSA 3SZPA 3BYWA 5B3SH 1J09A 3LSMA 4BBRJ 3CCVI 3MUY1 2DJNA 1DBNA 2R073 4BXFA 1AYN2 1JYIA 3T4HB 3FHIB 4IE7A 2LBFA 4DXZA 4WZFA 1I6XA 3D5LA 5C4WC 4NRPA 4JDOA 5TRDA 3O1SA 1VP6A 5K4LA 3I59A 1ZZ9A 3AZVA 5FXZA 3LFMA 4FPLA 2MGQA 3ZN4A 1WH7A 2VPVA 4BK4A 2IWGB 1WJCA 1K4TA 1OD3A 4QQHA 1ULYA 1E57A 2VPRA 2VC9A 3SDGA 2PXJA 1GICA 3T09A 4XETA 3ZN1A 3K2ZA 3D8CA 1W6NA 2XGEA 4UOJA 3MFAA 4XMAA 1AF9A 5FO8B 3VB9A 4FXGB 5F2WA 3KYLA 1PP7U 1BEV2 1XC6A 1UZ0A 2WABA 3I4PA 2KIQA 5D4RA 2Q2EB 4XHXA 3WF4A 1W99A 3AC0A 3GTGJ 5FLIA 3N9OA 3J80Z 1C5IA 1Z7S2 2O5RA 1OKOA 1UG2A 3KEYA 1R1A3 1OOPA 1U5XA 1S7EA 2HWF3 4TXWA 4WWCA 1P4WA 3GNEA 3IRQA 4UV9A 1OT5A 1W9SA 4ITCA 2GMEA 5IWFA 1NXMA 4KG8A 3N36A 3TKYA 1BIAA 2IPQX 1HRV3 3VBRC 4EJVA 1HN1A 2OS2A 1WWYA 5ISLA 3EQEA 3DECA 2LP0A 1K7AA 4RB1A 1RESA 1EAH3 2XPVA 1ND3A 4XHBA 4GB31 3OEAA 4A3EJ 3ZPOA 1VI0A 3BOQA 1SZBA 1TWFJ 4PT6A 3IM0A 1CAVA 3ME2A 4PJNA 2XL9A 4HONA 1JHHA 4PUSA 2QDNA 4HSLA 5A3TA 3HR9A 4PQ9A 4LA2A 3QOEA 1KGYA 1LR5A 5IOYA 2Q5TA 1UAIA 5LGNA 2ZGKA 5A7QA 3EBRA 4U88A 2L7FP 4KT6A 1HIXA 5EQUA 3BDDA 3I49A 4YGBA 2ZA9A 3KP6A 2NVUB 1CVNA 5JWPA 1XNTA 4PSXA 1H88C 2ZJPF 1LECA 4XAEA 2UWAA 3I58A 5GM0A 4N43A 4RAYA 4CPBD 3TDUC 4QKDA 4XFGA 4LBMA 1EPZA 2VCMA 3BY6A 3D82A 1OPOA 5IYBJ 1WUVA 2KZVA 2UWBA 2LKPA 2JENA 3CJIC 2DOFA 4UB6C 2DTYA 3POEA 3JBG2 4FP3A 2ISZA 4QPQA 3ZYIB 4BJTA 2XAJA 1GT0C 2VR4A 3ABTA 3ZFGB 5I8TA 3DPLC 3VBUA 2IA1A 4DZJA 3H8UA 1LVAA 3N9QA 1MS3A 2X6OA 2XAUA 2KMUA 3CCYA 3LMMA 5EF6A 3PVOA 5F37A 2DW4A 5F6FA 1FTTA 2VOXA 1VQOI 1KD7A 2NVQJ 1QJU1 3U2RA 2G9FA 1T6SA 4ZPIA 3L9JT 3WTSC 4RB2C 3A0HC 4X6AJ 3THDA 1TMF1 4AUXA 4M01A 2GU9A 5A3LA 2WNOA 2NQYA 5F27A 1B59A 3ISPA 4Q5SF 5T50A 2R30A 3NO8A 1DLLA 1LGBA 3H5AA 4K3UA 1CIYA 3GFJA 3LDBA 2EF6A 4ITVA 1Q8PA 3GMEA 1JZ3A 2K85A 2AH2A 4D6RA 1REDA 1UQXA 5GJ6A 3VN4A 1DP3A 2ZX3A 1PK6C 5JIAA 4DXSA 2M5WA 4UHTA 1SAUA 4OWRB 5JSOA 2W4SA 1VFCA 2CFOA 3KEQA 4I3PA 1ULCA 2FHRA 1PZ7A 1C4RA 1A31A 4PBOA 2G7UA 1QU0A 4GXOA 1VQLI 1UYXA 3BPSA 4OI4A 2OD5A 1HOMA 1ZR4A 3R4SA 5I8SA 1BMV2 1LEAA 2WAQA 2CAVA 4SLIA 1D4VB 3TQNA 4AZZA 3H9JA 4S2GA 3KS7A 4V2GA 3CUQC 1YLFA 1P92A 3AVSA 4ZHNA 5D5WB 3TOAA 3MWMA 2OU2A 2D98A 3OGVA 1BR2A 2G4IA 1CESA 1QMJA 4QDQA 1OISA 1V9U1 4B43A 2PQSA 3GF6A 5IAVA 2I2SA 1FP1D 2VZVA 3USUA 2ZKLA 3PUBA 2VBWA 3OBTA 3PJRA 1HLCA 4CCEA 4QX5A 3RZOJ 3LQCA 1FNNA 4YFZA 4QX7A 5CG9A 3BIWE 3K1MA 3N9PA 2JK3A 1CAUA 3WU2C 3FUQA 4YM2A 1D7PM 2YGLA 3G73A 3AG1H 3QQAA 1JZ6A 1G2HA 4BHBA 4LG0B 5EGOB 2G7HA 4P9IA 3VBSB 2C26A 3N4MA 1R5GA 2F4OB 1LJ7A 4CEYC 5F0FA 1V6KA 3MUZ1 2K9LA 2ZGLA 4JKKA 3E1F1 3DU5A 2PAEA 3J81Z 3JRHA 1MEC3 3HOZJ 1ULEA 1TT5B 3MVPA 5IK7A 4P96A 1MS9A 3HT2A 4L97A 3VSLA 2WLQA 1H4HA 3FM3A 2M9HA 5A6QA 2H94A 2XGCA 4UUSB 1JBCA 1AYN3 4ES8A 3C7EA 4AG4A 3MHZA 3UJQA 3HNBM 2COBA 5I8YA 3VKFC 4ZS2A 1YRNB 1KS4A 5ABJB 2WSUA 1W36C 1WD4A 2ZGMA 4HSRA 1HJFA 5A3OA 2DU0A 3DYPA 4QGLA 1SPPB 2CMPA 4ZU7A 3C8XA 2DCKA 1IZ3A 4OCTA 1COV1 3LF7A 2Z99A 1K61A 1WLTA 5DDJ1 4MSVA 4XK4A 1ERDA 1EV11 1F2NA 1TWHJ 5FY8A 2NVTJ 2RREA 4K8FA 1HB4A 1B8IB 1COV2 1P6RA 2Z3YA 1IN7A 2JDUA 1BEV3 2A6ZA 4XFIA 5DDJ2 2VXJA 4IV3B 3L2YA 4IHYA 5AVAA 4H2AA 2LW8A 3S7IA 1NX9A 1PO11 3R6SA 4NHJA 4V1PA 1Z7S3 1POQA 3ELNA 4L0PA 2HDCA 2KP6A 1H9WA 2R5YB 3IV5A 1NLQA 4NIHA 2DMTA 2X1CA 2PHWA 1BBYA 3EPZA 1PO12 1PUEE 4UNOA 1C8NA 4WZCA 4LLLA 1QY4A 2Y26A 3CZUA 4Y4RA 1UKRA 4QWQA 2ELJA 2ZFWA 1ZLKA 4BQQA 4FO9A 4IZZA 1IS4A 2LC2A 2JA5J 3AK0A 3I4IA 2WL1A 3DXUA 1X36A 3T1BA 1RXFA 1U8RA 4AM3A 3BC8A 4XKVA 1VBC2 1LDKB 3PDQA 3LQQA 4Y52J 3D4KA 3M07A 1USSA 4LK1F 3Q5FA 4IRHA 4B3NA 2OXBA 3HOSA 2DT6A 3O14A 5E8GA 1H2KA 4MHUA 4OINF 3U4SA 2XUEA 2BOIA 5IT9Z 4GAZA 4NHKA 3F2ZA 1DGRM 2QSHX 4QPGC 2WLPA 2P37A 3M3IA 2MYSA 4CCJA 3MLJA 3KHBA 3CCRI 3HPHA 3DPRA 3S5QA 1O57A 5G04L 3DLAA 2JXAA 1FP2A 1Q8OA 4RSUA 3ABMH 3BCBA 1GHCA 2Z33A 2JB4A 1BJAA 2L9SA 1QHHD 3TW6A 3LKJA 4OZOA 2JQ7A 1MMDA 2CQXA 1YG2A 4MXVA 4HOBA 5FGMA 3JQXA 1CZSA 3OOUA 4DEQA 4OZXA 1FZPB 3QU6A 2ENRA 1XJAA 1G7YA 4BAYA 5KAFC 4N4NB 4UFHA 4RFT0 5CFCB 1PM4A 4IUGA 1K12A 1W8ZA 3JBG3 2OQ6A 5L3DA 2R7RA 2CDPA 1JTZX 3JW4A 4P5HA 3P3NA 2W1QA 5EYRA 2CL2A 1STMA 1G3YA 4UFJA 2XGDA 3VBRB 3WTWC 2IGOA 1LKNA 1O4XA 1YQ8A 5FROA 1WMEA 2EV0A 2KIUA 4YGEA 3BUCA 4IKFA 3KETA 1D4M2 4W4ZA 1O3SA 1RETA 2Q1MA 5CKTA 3KV6A 4KBBA 3ZN0A 4GRIA 3MQ0A 2PMZA 5FREA 1UD1A 1XB4A 3GBWA 3FHQA 1Q1HA 2GOXB 2OUHA 2XKOA 2IS2A 3KT1A 2CU7A 5FY5A 3MGUA 3APBA 5FZIA 2LFBA 5CJ9A 3LIGA 5FPAA 2UU8A 1IRZA 2HQNA 2ADDA 3ZMOA 4FBFA 3LSIA 1SLTA 3AMHA 4ZDOA 4MXWB 1YJLA 4UY8I 4B8XA 5DM6F 1OUXA 2VOPA 2QE3A 1JMUB 3ZFFC 2ZB9A 1XSQA 3ZXKA 4DYCA 1YIPA 2D97A 3RQ4A 1JN2P 4JHTA 3SCHA 2DTZA 1TE1B 4IQJA 4E4HA 3C3VA 2WO3A 2OYZA 2WWSA 2VODA 4PGGA 3NV2A 4B44A 1WZ2A 3VOEA 3UGFA 4HL0A 1CAXB 3CJIB 3ZN5A 3T8TA 4I0BA 3RKYA 1B1BA 2RMU1 3KQRA 2NMNA 4AFBA 4Q1PA 4RA2A 5D1IA 3VYSB 2B8MA 4PF5A 1DDNA 2J1UA 1H1AA 2VZOA 1PNGA 1QXPA 1LU2A 2AGSA 4HK8A 5FQ0A 2VBPA 4OMDA 2HPIA 1W3VA 3FLTA 3QPHA 5JPNB 5JXHA 5A3UA 4GXLA 4B4CA 4A42A 3RRDA 2F48A 2PFBA 1JUPA 5EEGA 3KV4A 2QA4I 1WPKA 2KRFA 3I53A 3J7YJ 4BDYA 3OSDA 5BOXA 1OLTA 1X1DA 2F5FA 4WM7C 2V1DA 1QVUA 3J7LA 3U4XA 4NUBA 2P7CB 3PVBB 1PGL1 2WY8Q 3ZKUA 2VZSA 1CPNA 1AR71 1PK6B 3RKQA 2ZGRA 2MH9A 1QIQA 3I54A 2VLAA 3AMQA 2XLGA 3IL2A 4XOTA 1MBJA 5IATA 2L01A 1AR72 3FMGA 3EUKL 5CLSA 5FK7A 4NAOA 1BLZA 2C6SA 1EF4A 3S3NA 2YX7A 2K9NA 1UZWA 5AFBA 2D3PA 4XORA 4JDMA 4KIGA 2MEV1 4MYEA 3CJQB 2O61A 3KM5A 2XJUA 3LSDA 1YC61 4Q4X2 4L2NA 4CH7A 5CYVA 4YG6A 1UWWA 3B7MA 2PX9A 2MEV2 2WFF1 5FLXK 1SACA 1ENSA 2UV1A 3ZR8X 1G9AA 4C9YA 1GBGA 1YCIA 2CUEA 4JQRA 4NPMA 3REOA 1COV3 2WFF2 1T8IA 1OCRH 3LEGA 4HAMA 4PDWC 4HF0A 5FJKA 1IG0A 2EFOA 3NVCA 5K7ZA 5DDJ3 2BWAA 4DUXA 3S57A 5EP9A 5GZEA 3G1LA 3SCGA 3WP3A 4FE7A 4AVPA 1JTXA 5CVRA 2B4KA 1W5CC 3LWCA 2ZEXA 1SFUA 1ONVA 2WJSA 2WNUA 3LPFA 3FXKA 2M2EA 4A6EA 5FO9B 5DM7F 5HV4A 4ZJZA 3N7KA 4ZDPA 3KF3A 2E7QA 2V1UA 5DN2A 2Z79A 1YWKA 1D5VA 2DTRA 4W6XA 2ARBA 1PO13 3VD7A 4OI2A 5BQTA 3PIOF 3HZJA 2LVSA 4XRFA 5TGTA 5FYHA 2WINB 3OV8A 2ADEA 3ZM8A 1TBXA 2C9AA 1XTAA 1QBJA 4GDFA 3TO7A 5FXWA 2ZBKA 2O8XA 2VZ1A 3EJKA 1LU1A 1X50A 1VBC3 3VBFC 3SXWA 2NXNB 3ESWB 1ETVA 3IMMA 3EHKA 2K9ZA 4UVAA 3H36A 2JTVA 4HBLA 3IDBB 5C44J 3POSA 3T3YA 5B1AH 1AR92 5DXDA 1YIFA 1WQ2A 3P7NA 4NMIA 1QGPA 5EEHA 4BUPA 2LKXA 3SJMA 1VMJA 5AFEA 1FEXA 3KP2A 5TISC 1UY3A 3RPUA 1GU3A 1WJBA 3FKJA 1BR1A 3U11A 2X6XA 4XLHA 4COZA 3I97A 1T39A 4M3CF 2AXTC 1M4WA 4Q4V1 3H0GJ 1LFUP 2E35A 1TME2 2XUBA 3EQLF