5F1RA

The transcriptional regulator prfa from listeria monocytogenes in complex with a ring-fused 2-pyridone (c10)
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
236
structure length
229
Chain Sequence
NAQAEEFKKYLETNGIKPKQFHKKELIFNQWDPQEYCIFLYDGITKLTSISENGTIMNLQYYKGAFVIMSGFIDTETSVGYYNLEVISEQATAYVIKINELKELLSKNLTHFFYVFQTLQKQVSYSLAKFNDFSINGKLGSICGQLLILTYVYGKETPDGIKITLDNLTMQELGSSAVSRIISKLKQEKVIVYKNSCFYVQNLDYLKRYAPKLDEWFYLACPATWGKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Listeriolysin regulatory protein
publication title Attenuating Listeria monocytogenes Virulence by Targeting the Regulatory Protein PrfA.
pubmed doi rcsb
source organism Listeria monocytogenes serovar 1/2a (strain atcc baa-679 / egd-e)
total genus 74
structure length 229
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5f1rA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5f1rA01
1FOKA 1FSHA 3SCGA 2UXXA 1WLTA 3CO7C 3TGNA 4HQMA 2GQQA 5HOOA 4M6XA 3NJZA 4MGZE 1J0RA 4KMFA 3C3VA 3J81Z 3JSOA 2Y75A 1WKMA 5I0TA 4BIFA 2BNMA 4MZUA 5CLSA 1B59A 1IRFA 3R4KA 1YW8A 2FF4A 4Q0PA 3WW1A 3F23A 2VPVA 4A12A 4XRFA 1CAUA 5JSPA 5FD5A 2F4PA 3V7CA 2E1CA 2FEZA 4G94A 3N97A 3SZPA 1J7KA 4M9SA 2P7VB 3K69A 5JHUA 2Z69A 3R61A 2IXIA 1J3QA 3H8UA 4RGXA 1XSXA 3FHIB 4ENKA 1SD5A 3IWZA 2JZYA 2FBIA 1YFYA 3RYRA 4P9GA 5HLHA 4Q4ZF 3CUQC 2XIGA 2E9QA 3JZVA 2BNNA 1FYKA 1ONVA 3IWFA 2CAUA 3O3KA 1UHWA 4WXDA 3SMHA 3WW3A 5D6FA 4AVBA 3ST7A 3SXWA 2EV6A 5K5RA 2PA7A 3FX3A 3TNQA 1ZAOA 2KJCA 2JT1A 4ETSA 5JAXA 3KETA 2L54A 1SEFA 2FNPA 3L2CA 3H9AA 3ES4A 4HSJA 4XF0A 1P92A 5E1XA 5J7MA 4Y13A 4YFKF 1RUOA 4CHUA 4ESFA 1R1TA 3MAJA 3QU3A 2RVCA 2ZNYA 3KP6A 4I01A 1VR3A 1YLLA 4CZZA 3P9IA 1UCRA 3HHGA 3JAMZ 4OFGA 4LA3A 3ES1A 1HKQA 1XGMA 1SMYF 1ZRDA 2VT2A 2KRFA 1XE8A 4I2OA 3P7NA 1FT9A 2OA4A 2C0ZA 4KWJA 2FRHA 3OF1A 4ESBA 1QPMA 4AQ2A 3NEUA 2A69F 1JE8A 1T38A 2PN6A 5BS6A 1OYWA 1ODDA 4LK1F 2FMYA 3CTAA 4OIRF 1YW9A 3QP5A 1O3TA 1VP6A 2UWMA 3KMHA 2QQBA 3L09A 1LDJA 2BE5F 1J59A 1W7PA 3LAGA 2JPBA 3M8EA 3BDDA 1QQIA 1HW2A 2ZCWA 2NAZA 2PAEA 1JHFA 2K0GA 3F6VA 2VONA 2EB7A 2XVCA 4I98B 5ICCA 4FAGA 5FQ0A 3SCFA 3NL1A 1Z6TA 2Q1ZB 1YHFA 3GZ6A 1R1VA 1QGPA 3WGGA 3MCZA 4FAHA 4LG0A 2GC1A 5E1WA 1ZG5A 2DQRA 4O6JA 2BGCA 3EO6A 3L9FA 3GO5A 3TQNA 2TDXA 4JBAA 1IPKA 2MPFA 2ESNA 2MBFA 4PCQA 3CJXA 4HQEA 5J6XA 2UZKA 4QM9A 4ZZDA 1OMIA 1H1IA 5FD6A 3DXJF 3I4PA 5HLGA 1IXCA 1B9MA 1IPJA 4BAYA 3VHRA 1LKNA 3RZZA 1LB2A 1ZN2A 2OQRA 1IN7A 4ONUA 5KK1A 5ICFA 3V7RA 4AXOA 4HOBA 2YPRA 2H94A 3HRMA 4IJAA 2VE9A 2L01A 4RS8A 3ML6A 4Y15A 3M9AA 1ZZ8A 5J48A 2HTSA 1Z91A 1Q3EA 3GYDA 4G8XA 4ENNA 4KN7X 2EA4A 3G73A 2VE8A 4M72A 1FNNA 1CAWB 5HDGA 1UHMA 5JSRA 1HQCA 4U88A 2HFHA 1BM9A 1ZZBA 4U7DA 3DP7A 2Y0OA 2BBYA 4U0YA 2ELHA 2PTMA 5D5UB 3J80Z 1NXMA 1X8MA 1UPIA 4AVAA 4A6DA 4MV2A 3E3VA 5EEHA 5H20A 4KDPA 3PNAA 4EGZA 4UNOA 1R23A 5HS7A 3EHKA 2BV6A 3NW4A 2ZJ2A 3FXRA 2W24A 2WFPA 3MFKA 3EJKA 1WRJA 4WX9A 2D5FA 2HR3A 5ICGA 3O6BB 5TRDA 1MGTA 1D8KA 4EM1A 1J2XA 3ETQA 2EWNA 3E5UA 1NE6A 1J75A 3QPTA 2FU4A 3ROUA 2G7UA 5IT9Z 1YS7A 3IDCB 2CFXA 3SHFA 1IZ1A 1X8EA 3MZHA 1V4RA 1AOYA 4KA4A 2XROA 3RYPA 3S0MA 4A6EA 1BIBA 1ZARA 4PIXA 2P7CB 4NB5A 3IL2A 2EJRA 5KHGA 1TLHB 1H0MA 4BYYA 1G6NA 1ZHFA 3GFJA 4I7HA 3CUQB 2UXNA 4BH9A 3WTSC 5D5WB 1DGWA 2IP2A 3F72A 5CVRA 5E20A 4WZCA 4U0WA 4IF4A 1OD5A 4A2UA 3K1NA 1FBQA 3MDPA 1WWXA 4JQFA 5K5QA 1IAWA 5DV5A 4KL1A 4HF2A 4HVOA 3ZDSA 3AAFA 4UUVA 3Q5FA 4D7TA 3U2RA 2KIFA 2HOEA 3BROA 4U0VA 5LEKA 4WF2A 1D5VA 5HLIA 3TOAA 2CV6A 1G3YA 2WWYA 2FQPA 1BJAA 2D1HA 2ZKLA 2A61A 3KE2A 5L3DA 3BPVA 4XSZF 1O5UA 4IEPA 4UVAA 4LLNA 5CVIA 5D6EA 1ON1A 3F8MA 4MHGA 3HRTA 5CJ9A 4WVZA 1MDMA 4XBFA 3Q9SA 4Q0SA 2IC1A 4IEQA 1PP8F 4A0YA 1ZH5A 4QWQA 1BI3A 5A2QK 5E8IA 1ZNPA 3BU7A 2GIVA 3GFMA 1IRGA 2DPDA 1H9TA 2UY8A 3KFWX 3RPQA 3VEPA 2HDCA 3L2HA 4L9TA 1J3RA 3LWCA 2HEOA 4TLFA 1R7JA 2H0VA 4MNUA 3M1EA 3V4GA 4UBHA 3F21A 3T8TA 1XN7A 3ELNA 3LWFA 2GC3A 1U5TB 1EH6A 3FWEA 5J8CA 2QDRA 2VQAA 2HKXA 3FF5A 5HS8A 3RKXA 4X6QB 2PG4A 3K2ZA 5DYMA 1W5TA 1XDUA 1RC6A 1CF7B 1JUHA 4HLYA 2V09A 5CVUA 1X3UA 1EH8A 4PGGA 3ULQB 5FPXA 3IKTA 2B0LA 3HOSA 2HJIA 4RB0A 2XAFA 1RUNA 1UW8A 1LVAA 2LNBA 2DT5A 2NRAC 4O9EA 1Y3TA 4OMYA 4LLGF 5DUIA 1K79A 1P4XA 4G7HF 2PHLA 5LHHA 1FP1D 4AVCA 2VBYA 1W5SA 3TOBA 2K9ZA 1RNLA 3ECOA 4UVBA 1FPQA 1P6RA 4M71A 1Z1DA 3GVAA 2XKPA 3I71A 3SXYA 3WTTC 4B09A 3K1PA 1OKRA 2PAMA 4ORFA 1IXSB 1UD1A 3WW2A 5K8SA 1DUXC 3G7DA 3LAPA 2PMHA 3JW4A 3MZYA 2P6TA 2QJVA 2OAZA 1WI9A 2M45A 3BWGA 3ZMUA 1TTYA 3I59B 2Q2EA 1QXJA 4LK0F 4P5OA 2FOKA 5BPDA 3OTFA 4ZYEA 1IN8A 3CF6E 1RI7A 2K27A 4Q0QA 5BUVA 1TQMA 2P6SA 1D8JA 1Y9QA 3J80K 3KGZA 1HW5A 1QBJA 2OA2A 4BHBA 1KYWA 3PLQA 2OQGA 5L3EA 2IXJA 4HX8A 4P96A 2VN2A 3O14A 1BOAA 3IHUA 3OV8A 1MZBA 1VTNC 1S3JA 4JTNA 1RIOH 4M6YA 3PQKA 2XKOA 2E7WA 4AIJA 1XGOA 1S6LA 4HA8A 1IUYA 1PDNC 1I1SA 3TNPB 1EY2A 3BJOA 3GXOA 2QUFA 3ECHA 5FGMA 3WU1B 4XFFA 2VODA 2GC0A 3UKVA 3LAJA 3WW4A 3HYIA 2EFWA 4JTOA 2D1VA 3FE5A 2DI3A 3H50A 4N0BA 1LEAA 1BI2A 2IJLA 1W7PD 3KP4A 4G7ZF 2ATFA 3H3UA 3E5XA 5DD4A 3P9CA 2Q0OA 4IEXA 5LRSA 3CJNA 4ZU5A 2OBPA 4LTAA 3IDBB 3HSEA 3H7JA 1B6AA 4Q0UA 2EV0A 1A04A 5F1RA 3KEOA 2LDUA 2HYGD 4YRDA 1SMTA 5HVQC 4HBNA 2XUBA 3FFQA 1LDDA 1YLFA 5FLJA 3V7SA 2DW4A 2R7FA 3MQ0A 2HTJA 4HAMA 3KP5A 4EV0A 4PIYA 2QM3A 3I5UA 3QAHA 2DTRA 3SCHA 1NE4A 5BOXA 4D0PA 2EFQA 1YFUA 1H9GA 5FPZA 2K86A 4XSXF 1U3EM 1XSDA 1Q1HA 1LJ9A 1RL3A 5EEGA 4R79A 4H0EA 4HMZA 4G6DA 2Z99A 3WE3A 1L3LA 1QXRA 2P5VA 1K7AA 2Y0MA 4D7SA 4CYDA 3T0YA 5LGTA 4HN1A 3UKTA 3E6BA 4N9HA 1HSTA 2DK5A 1DGRA 1U5TA 4EWEA 2Q0AA 4GO1A 1O7LA 1YUDA 4WXHA 2DLLA 1XDSA 3K9TA 2XAGA 5JVTA 3QRFF 2M5WA 2GH2A 5ERIA 2ZNZA 4KN4X 1YYVA 4HF0A 2DQLA 4S04A 3ZPLA 4IEOA 4B8XA 1CF7A 3ABUA 2STTA 2A5YB 5HS9A 3S7EA 4KU7A 5E1ZB 2UY9A 2PJPA 1KGSA 1WA4A 1AWCA 4LUMA 3CLPA 5LHIA 4GCVA 3WG9A 3KEQA 5DCFA 1TNSA 1T0FA 2GAUA 2O8XA 3IIAA 3TO9A 1EV7A 3CUOA 1K6OA 2JPCA 5H6QA 1OR7A 4MEYF 3GZ5A 4RAYA 4O3MA 1YFWA 4YIIA 3F8FA 4MTEA 4JK1X 3GF2A 5FCCA 2FSWA 3ZN1A 4LB5A 4ZYHA 1R1UA 4HX4A 3HTSB 3D0SA 3I59A 3CL1A 4CXFA 1O3QA 2MNGA 5KVRA 2PLYA 4KWKA 5F64A 4ZYDA 4XFBA 4HV6A 2DBBA 2R7DA 3K0LA 2GXBA 1J9IA 1FSEA 4IERA 2H27A 2MH9A 4OMZA 4ZYGA 2Z2SB 1U2WA 5A2QZ 1MKMA 4ESJA 1CX4A 4E2GA 2VECA 3FMRA 5KHIA 1K78A 5I8SA 3B02A 1B4AA 4HVQA 3CLOA 1DZRA 2M30A 2QVOA 3H92A 2IRFG 5FLHA 1G3TA 3SQNA 2GU9A 4J1WA 2ACJA 1CGPA 4J1XA 4A0XA 1R36A 4XLPF 4PGHA 4OU0A 1BC8C 1SFXA 4GXOA 1SD7A 4MGRA 1OYYA 1CAVB 4GYIA 1XGSA 2QBYB 5ICEA 5EZWA 4E70A 4AD9A 1SD6A 1OPCA 3OOPA 4AVPA 1E2XA 1XCBA 3DPTA 4EROA 2K02A 2IXKA 2HZTA 2PBIA 2V1DA 3RI4A 4EM2A 3IRQA 1ZRCA 5I0SA 1T6SA 4M9ZA 4H7LA 3LOIA 5DD8A 4EWAA 3IC7A 4FHTA 2O8QA 4ENJA 1MJBA 2V9VA 1B1BA 4ZH4F 2VXZA 1I27A 1EH7A 4KMUX 2F5DA 4YFNF 4TV7A 4S05A 5JSOA 2VBZA 2B8MA 2FQ3A 2KKOA 2XAHA 4HLXA 5E16A 4YNIA 2Z5UA 4LFUA 2P5KA 2DFIA 5AIQA 4ZU7A 3DV8A 4EJVA 1G4DA 3VODA 4Q0VA 2X0LA 1TNTA 3P9KA 1UFMA 1ZGAA 1LRHA 2HKOA 2KJBA 4L2NA 4OLLA 4KWLA 2EA2A 1E17A 3EYIA 4F8AA 2XAQA 4Q5SF 2PHDA 2RV8A 4LJZF 4L9NA 5LHGA 2FE3A 4JV4A 1Z6RA 3HRSA 2GZWA 2IVMA 2IXHA 2KXLA 5LRRA 2Z33A 4DINB 4ASNA 3OD0A 4ENMA 5I91A 1J1LA 3GWZA 3SFZA 2FBHA 4Z2YA 4LB6B 1TQ5A 2B5HA 3ZMTA 1F1ZA 3H7YA 2A07F 4AWXB 4MX3A 2XRNA 2OPKA 2QYOA 3KP3A 3HT1A 2JTVA 4I09A 3FM3A 2M1BA 3HHHA 4MH0E 4BHCA 3OGJA 1XB4A 2FNAA 2FA5A 2HQNA 1GXPA 4R1HA 3RTRA 3H1WA 3TDUC 3TKYA 2LF7A 4FT8A 1STZA 1U78A 4XF4A 5BPIA 3U1DA 1SD4A 2Z9OA 2MLKA 3V8JA 4NVPA 1YG2A 4XF1A 1P4WA 1XGNA 4L5JA 1QZZA 2DPUA 2IW5A 2DCTA 5ED4A 1UIJA 5HI0A 4HF1A 1YIOA 2I45A 1FWZA 5CU1A 5I0UA 3ZN0A 5C8WA 1IF1A 4HYEA 1H1MA 2E1NA 1FYMA 3NQOA 4IXAA 3EYYA 2UYBA 3GFIA 3FM5A 3NRVA 4RB1A 2GXGA 2IXLA 2VC1A 2XLFA 1ZLKA 4A0ZA 4M74A 1ZGJA 5K1YA 3BALA 5KHKA 2VBXA 4CGZA 1DPUA 1U6GA 4AQ6A 1SFUA 5I0RA 1GXQA 2ZMEB 1MD0A 3FZVA 2HS5A 1LDKB 3ZMVA 1I5ZA 4I02A 5D8LB 2ZFWA 2O61A 1T2KA 4K2EA 4QM8A 3LFKA 3DFGA 4XETA 1J5YA 1ON2A 4AIKA 2AXLA 3WTVC 1TW2A 1YW7A 1FBSA 3WE2A 2O03A 4L9JA 5BV6A 2LSOA 3F6OA 3RKYA 1FLIA 2OZJA 4YG2F 3M7GA 1FC3A 1XE7A 1YFHA 2ADUA 1O57A 5FLXZ 3M3IA 1CAVA 2QBYA 5FFXA 5DUKA 2L02A 4KIGA 4QGLA 2O1QA 4IRGA 1P2FA 1S29A 4QMAA 2BNOA 1RZ4A 3D0JA 5L3CA 4IEWA 4QX5A 2D93A 5E18F 2F2EA 1TBXA 1LEBA 1PM7A 4I0AA 3WTXC 1R58A 4M9XA 2ISYA 1RTVA 1KYZA 2MC3A 3FXUA 3RNSA 2NYXA 2IXCA 1SFEA 2RNJA 3F8CA 4QLCU 4YYOA 1XMAA 3N4MA 4EWDA 2D2WA 3GFLA 4P9UA 4XFAA 2A6HF 2XASA 1IN5A 2L3DA 2LKPA 1XSVA 2C6YA 4UV8A 3JTHA 4IPAA 5JI6A 4MGKE 3F3XA 3CDHA 4B29A 1BI0A 4HLTA 2RC4A 2NS0A 2UYAA 2Q30A 2JRTA 3HUGA 4O9GA 3RJPA 1CAWA 5IT3A 4IEYA 1JGSA 4OIOF 4LLOA 2W85A 2A6EF 1Z9CA 4DQ2A 2P5LC 4YARA 5DEQA 3E6CC 2A68F 2YX4A 4RD7A 3EETA 4KT5C 1KU2A 4HDUA 2O0YA 3J7AO 1F4KA 3DF8A 1FXZA 4HSLA 4MGIE 3GLXA 3VOEA 1ZZ6A 1FBUA 4FX0A 2XV4S 4Q48A 3RKWA 3GX4X 3G3ZA 5CADA 1NHAA 5K5OA 5KBFA 2DK8A 3DL3A 4L11A 2DU9A 3EQLF 2XL7A 4GGGA 3BPZA 1WGPA 1Z7UA 3DKWA 2DO7A 4HZFA 2IA1A 1UB9A 2KIUA 5FO5A 4ON0A 3WTZA 5DDGA 1BI1A 2EK5A 1QNTA 4FX4A 3S7IA 3RIRA 1LQ1A 5LGUA 1R5GA 3U10A 3OCPA 4QXKA 3HSRA 1ZG1A 1W7PB 3CUQA 5HDKA 2VC0A 1MJAA 2M8EA 3HRUA 3GYHX 3BCWA 5TJJA 4WCGA 5JCTA 3LQQA 1FYLA 2XGXA 2QWWA 2RGVA 4P55A 5E17F 4F7ZA 3BB6A 2L4MA 5ILVA 3ACLA 4YIFA 4IETA 3RPUA 1LR5A 1ULYA 2NNYA 4X6RB 2PAKA 3I0TA 1O7FA 3U0ZA 1ZYRF 4GYGA 1ZZ7A 1JXSA 2IPQX 3FMSA 1W4MA 2J5OA 5ILSA 4EJWA 3KSCA 1SFNA 2AS5F 2V1UA 2VBWA 3H1YA 1KU9A 3I58A 2V1XA 3REOA 2E7XA 5D4SA 2ZMEA 1XCVA 4OOIA 4MQVA 3KZZA 4WK8F 1GQHA 1L0OC 1PMIA 2ETEA 5F6FA 3L7WA 3VFZA 3KP7A 1O3RA 4XLNF 3BZ6A 2QNKA 5CYVA 5BQTA 1MJ9A 3DN7A 1S7AA 1ZRRA 4HVRA 2FMLA 1KU7A 3I64A 4BQAA 2ZBKA 2EFPA 3E97A 4PJYA 1QWRA 3WTWC 1C0WA 2BYVE 1BC7C 3LZZA 3UKNA 1HW1A 3EQEA 1FY7A 3COAC 1KQ0A 2XL9A 3ZMZA 3BY6A 4WWCA 4UVCA 4EMSA 1B9NA 1ZG3A 2JSCA 5FLXK 3HIFA 4UXAA 1BN5A 3TDZC 5L3GA 3HOTA 5KHHA 3K1MA 1YS6A 4XF3A 4IEZA 3HSFA 3GW2A 4L0ZB 1FP2A 4LD5A 4EM0B 3I53A 3BP8A 4DNCA 3WGIA 3TO6A 5I8TA 5BY5A 3Q9VA 5C6CA 4OIPF 1O3SA 4HX7A 3QACA 3QOPA 1NZCA 4RGSA 3FHZA 2D5HA 1F5TA 1OI6A 2QVSB 3GBFA 4XFGA 4WXCA 3NVCA 4I3PA 3R6SA 2ISZA 3BOQA 2W84A 1OYIA 1REPC 3D5LA 4PIZA 4Z07A 4L0YB 3NSTA 3W6KB 2H09A 3R0AA 1KA8A 5L3FA 5FB2A 4KYWA 1HSJA 3H3ZA 2RDPA 2WC2A 4Q29A 5E8GA 4KIFA 4MGYE 3M70A 4BNCA 3FJSA 1PUEE 4HW0A 4KU8A 4N9IA 3ELKA 3KLOA 4L9VA 4JVAA 5EFUA 4BXUA 1KQ9A 1PP7U 3I7DA 2FXAA 4L18B 3NKTA 5D8KB 1GHCA 1WQ2A 2HGCA 3GEZA 4RGUA 4CO8A 2F5EA 2ZXJA 2V6CA 3C3WA 3ERED 1WSUA 4M73A 2EFNA 3HQXA 1X82A 1USTA 5T3NA 1QZYA 1D3YA 2CW0F 4P9FA 1MDMB 1ZLJA 2PFWA 1BBYA 2PMUA 3F8BA 3QP6A 2PYTA 1Z05A 2B9UA 3EBRA 3MYXA 4FBFA 1U5TC 4UV9A 4XF9A 1R22A 1DZTA 5BXXA 2X4HA 5JR3A 4MUVA 4NQWA 2K4BA 5LLQA 2RKHA 1HKTA 1GQGA 1TQPA 3ZQ7A 5J8FA 1J3PA 3VB2A 3B73A 4PZJA 4IEVA 2YR2A 1O4TA 2IA0A 4MTDA 2HQRA 2P17A 2ET7A 4LULA 1IXRC 4RAZA 4EQQA 5BPXA 2D45A 3SHRA 1QO0D 3RYKA 2RQPA 1LNWA 3TO7A 2HYFA 2QCSB 1GVJA 2EA7A 1S8NA 2WV0A 4ZZLA 3CEWA 2PQQA 1EPZA 2VT3A 1XD7A 1YO5C 5D1IA 1YQAA 4IESA 3U9GA 5J3UA 4LMYA 2STWA 2GA2A 1HKSA 3RDIA 4R52A 2IT0A 3PQJA 4R8HA 1OFNA 5DCMB 4I0BA 2QQAA 2MLGA 4XFIA 3FZ3A 4MQ9F 3MEXA 5E1RA 3USSA 5JR7B 3J81K 1G3WA 1S7OA 3CO6C 2O6GE 4O5VA 3FMQA 3IBMA 2MD5A 1Q43A 2RN7A 1YFXA 6PAXA 2V79A 4HDVA 1XRUA 2YSRA 2CQKA 1KU3A 2VOOA 2Z3YA 1J58A 4LEJA 3DQVC 3F22A 1ZX5A 2GWRA 3MPBA 1R5HA 3T5XA 1USSA 2K4JA 3EDPA 1UIKA 1T98A 2CWEA 2XHKA 2Y48A 2FBKA 5AONA 1U8RA 4NHJA 4K8FA 4U7BA 4KIBA 5FLIA 1UCXA 1V70A 4UXNA 4G9YA 4CDGA 4QGMA 3WODF 2H6BA 3WTYC 3LA7A 2CYYA 2COMA 5D5VB 4OINF 1SAXA 3SZTA 2GA1A 4L5IA 4HV5A 5HDNA 4XEZA 3ZMSA 2MHFA 3V8KA 1TW3A 2OZUA 3KP2A 3CO2A 5I93A 3QU6A 1O5LA 2H6CA 3DPLC 1CAXB 2G7HA 4IHSA 4EJTA 3JSPA 3IRRA 4KFCA 3HTUA 4LLLA 1Q5OA 3LSTA 3LQRA 5FDBA 1IW7F 3IKVA 4EJOA 2BEOA 2ET1A 3E5QA 3WTUC 2QQ9A 3D82A 3ABTA 5AVPA 4LGWA 3JAMK 4KNYA 2R3SA 4OIQF 4LA2A 2OD5A 1DPRA 1ZRFA 1ZZCA 3MWMA 1YTYA 3H1MA 1TQIA 4Z82A 2F5FA 1ZREA 5BMZA 2P8TA 3ZP5A 1R00A 2W25A 4IRHA 4RB3C 1DP7P 2HWVA 1F9NA 4E2QA 1HXDA 2EVXA 1CAUB 2XLAA 2KIMA 1X7NA 2LF8A 2O3FA 4Q47A 4RGRA 5CVVA 2P4WA 3GUDA 3PFIA 1ZVFA 1I1GA 1G3SA 5LEJA 4BHPA 1P4AA 2CGPA 1I6XA 2F5CA 1YWKA 2J5PA 2MA3A 4XFHA 3LA2A 4META 3ZMDA 1RGSA 2ZO4A 2PI0A 2W57A 5D4RA 1T39A 4IHTA 4PDKA 4HN0A 3C18A 3EUHA 3HT2A 4AIHA 4UBGA 1L3JA 3BPXA 3ISPA 3DEUA 2VOPA 2QLZA 1Y0UA 5KHJA 3C7JA 1FZPB 3KGLA 1QY4A 2QZ8A 2PEXA 4E2SA 5DCMA 3BJ6A 1BIAA 1IN4A 2L4AA 1U12A 4CICA 1KQ8A 4IRIA 3T8RA 4UHTA 3QPHA 4MEXF 5ILUA 1XMKA 4EGYA 1EP0A 2XLGA 2EAAA 2IA2A 3I54A 5AIPA 4RB2C 4WBBA 2M87A 1NYWA 3L00A 1VJ2A 4ZU4A 4XFCA 2YU3A 3FXQA 4GULA 2CO5A 4A5MA 1V3FA 1EYBA 2PFBA 3LA3A 4IEUA 5FFZA 2OU2A 3R0JA 3WGHA 5LBQA 2NNNA 1SQ4A 1FI2A 3O2PE 4IVNA 2ZKZA 4LUKA 2GC2A 4HBLA 5L3BA 2ETHA 3BJAA 5H6RA 2OZ6A 1HBXG 1ZZ9A 2CAVA 1IN6A 3R60A 3S2WA 3KZYA 5I8YA 2YX7A 1K78B 3C1DA 2WTEA 5JFRA 2CG4A 5IT9K 2G9WA 2A3SA 1JHHA 2XAJA 2MH2A 3WU0A 5D5XB 1FX7A 3E6DA 3KCCA 4KUMA 4G6QA 2K7LA 2N7GA 2QENA 2ESHA 3T1BA 5FQ0B 4QGNA 4YSFA 5LGNA 5CVJA 3V8LA 1CAXA 3KLNA 4Y17A 3JTGA 4LG0B 3W6JB 4EVIA 3M8FA 2EFOA 4KICA 3PVBB 2Q8KA 2DAOA 4G7OF 2D40A 2CSOA 2PQ8A 4YFXF 3E6MA 3U11A 4EJUA 1DDNA 4A5NA 2Q4SA 2EV5A 3F8NA 2OYZA
chains in the Genus database with same CATH superfamily
1FOKA 4PF1A 1TMF2 3CO7C 4OHZA 4IE4A 1GWKA 4GMP0 4HPKA 5DQ0A 3J81Z 5C5TA 2Y75A 4MZUA 2A6VA 3W21A 4FXKB 3AZXA 3GF6A 3KT4A 2VPRA 3OYEA 2VPVA 3POJA 4XRFA 2W82A 2VPLA 5IK7A 3C7FA 5JSPA 3RZJA 4BMBA 4H2AA 4BQ5A 4CA0A 2F4PA 3CCRI 1W0PA 3N05A 3V7CA 1HV1A 1WVRA 3VDXA 1MIJA 3WP6A 3N97A 3LPFA 3SZPA 1TWAJ 1HQNA 2RR12 1J7KA 4M9SA 3T1LA 2P7VB 3A03A 3K69A 2EPFA 3CDIA 1S0GA 1X3WB 2EIDA 3IWZA 3LNQA 4YM0A 4Y4RA 2FBIA 1YFYA 3VPRA 4P9GA 3WG4A 3L1PA 5HLHA 2XIGA 1OF3A 3JZVA 1BQPA 2DMUA 2BNNA 5FYMA 3TN92 5BNNB 2PHTA 3USUA 2YUEA 1UHWA 4WXDA 4Q8LA 3SMHA 4HEA2 4AVBA 3ST7A 1QGLA 4NIAA 5LZ6A 3SXWA 1ULOA 5FP4A 4RN5A 1IV6A 1VQ5I 3H9AA 2WRAA 4AZZA 3ES4A 4HSJA 1P92A 5HCBA 3DBRB 3G1OA 3WG3A 2HWB2 4C1XA 3TEWA 3LOCA 3OYFA 4ESFA 1K4TA 2ZMEC 1OJLA 1JBCA 1W05A 1J84A 4I01A 5FYVA 1D1AA 1R081 2WFF3 3EUKL 2WA3A 2NN8A 2X48A 3MMYB 4OFGA 2VT2A 4OI1A 4A3FJ 2JD9A 4I2OA 1UG0A 2K9LA 4EYUA 2OA4A 2C0ZA 4KWJA 2PJRB 2IWGB 4WM8A 2A69F 3IZOA 4A6OA 2P81A 2XJPA 1RUH1 2YGMA 1ZBE2 4LK1F 1WJAA 1O3TA 1PO23 4Q8KA 1S7EA 1W7PA 4NIDA 2M9HA 4FTHA 3M8EA 2ZHLA 3LDBA 4Q1RA 4KG0A 4CUAA 4F93B 4XILA 2E1MB 2VONA 2EB7A 1AR73 3MFAA 3FHNA 2QQVA 1Z6TA 4JKLA 2HWC1 1JH5A 5DDJ1 1QGPA 1F43A 2ZMLA 3BG6A 4XUTA 5E1WA 4UT5A 1ZG5A 4O6JA 1LUJB 1OBNA 1WFXA 1R091 4OMCA 5ACA2 1Y6IA 2ESNA 3CJXA 5T50A 4ZXEA 4YGEA 2UZKA 4L0PA 1OMIA 5C4WA 4Q4Y3 4CVUA 3I3DA 3TOJA 1OOPA 1B9MA 1W99A 5A1LA 3B00A 1I3QJ 3H0DA 3ZFFC 1NCQC 1LB2A 4MSVA 3BZCA 2OQRA 4N90A 2VW2A 1IN7A 3PUAA 1TWGJ 1R1A1 4IJAA 2ADEA 4RS8A 2W87A 1Q3EA 2JDMA 3GYDA 3DPRB 4ITVA 4G8XA 2XAUA 5D8AC 2JN6A 2WT1A 3HUGB 4M72A 1FMVA 5HDGA 5JSRA 1EUTA 1T2XA 1BM9A 1ZZBA 2CW8A 1C8NA 1NA1B 5D5UB 1X8MA 1O8SA 1UPIA 1S9HA 4CXWA 1O4ZA 4M4RA 3VBHA 4EGZA 2BV6A 2E5ZA 2VJ4A 3HJRA 3MFKA 5EZHA 3O7OA 3CCUI 5TRDA 3ETQA 4EM1A 1J2XA 4JX5A 2FU4A 3O8GA 1YS7A 1JU4A 3V0AA 1X36A 2VCMA 5L73A 4A42A 1IZ1A 1HRV3 3PM1A 2K9QA 2BFUL 5AC92 4P9WA 1V4RA 2R32A 5IW0A 2XROA 3RYPA 3SLIA 3VZLA 3S0MA 5JDBA 5IOZA 4NB5A 3IL2A 2QGUA 2R7WA 2QSGX 2GN7A 4CA9A 4I7HA 3CUQB 1NCRB 2UXNA 2DA5A 5J1RA 4PSWA 4BDVB 1PO11 3K48A 1PGSA 1WWXA 3U4XA 2OIIA 2JDHA 3CD6I 1YXWA 3ACIA 5IVFA 1BZWA 3AAFA 4UUVA 3D5RC 4D7TA 5LWBA 2O14A 3BROA 1JHJA 1RUF3 3MLJA 5FYHA 2OJED 3U4SA 2EIBA 5EZGA 4HOOA 2R5YA 2A61A 3KE2A 4X1EA 4FO9A 5L3DA 4BPZA 4F3JA 1U9NA 4UVAA 5HNFA 4GWIA 4CDQB 4MHGA 1W2UA 4LKDA 1NG7A 3S57A 4Q0SA 3HBKA 3F9KA 4IEQA 3NKGA 5CAZA 4QWQA 3CBNA 3BU7A 1L7RA 3GFMA 5FP3A 1MBJA 5IATA 2DPDA 3IPVA 3RS6A 2VMCA 2H0BA 2Y33A 2DA4A 2HDCA 3LWCA 1V6OA 3W5MA 4JCKA 3MIGA 3VHOA 5EGOA 2LG4A 4P5YA 3V4GA 4N8MA 1MS3A 4LBOA 1W3XA 1VBC2 2LBFA 2AACA 3ELNA 1WW6A 5LCWL 3TP0A 3BIEA 3Q0VA 2VNOA 3OYAA 3QQAA 5DYMA 1F4AA 1W5TA 1XDUA 1RC6A 1CF7B 5JIAA 2VKHA 1HDPA 4QDQA 1MR5A 3IKTA 3ZPOA 3BR6A 4DW6A 2W48A 4GXLA 3MFCA 4UAPA 4NIHA 5LATA 3K4LA 4LLGF 1D4M1 3ZPYA 3GTOJ 3DBHB 2NVYJ 1T6BX 4K3UA 5LHHA 1FP1D 3LF7A 1VRH2 4C8DA 3WDXA 1KFUL 3VBOA 1FTZA 4LBLA 1IJWC 4DB5A 1P6RA 1Z1DA 1UF2C 4LO8A 3S2HJ 4BQNA 3SXYA 1SC7A 2PAMA 2HWD3 1IXSB 3WW2A 3G7DA 4L5EA 2XUMA 2QJVA 2OAZA 3ZMUA 2D5VA 3I59B 4LK0F 4P5OA 2VG9A 1K42A 4XLAA 2YG0A 2QKLB 4CZCA 1RI7A 5BUVA 1QQP1 1Y9QA 2ZX0A 1HW5A 1QBJA 4C2UA 4YGBA 3PLQA 3M3QA 5FPVA 2OQ7A 2QF7A 5F0FA 3UKGA 4HX8A 5GLTA 4Q4W3 3SH5A 3O1SA 4AI1A 2XRLA 2BJSA 4UW5A 2VBDA 1EUUA 2CUZA 1RIOH 4M6YA 3KCYA 1EKEA 1MEC1 1I3AA 5TSWA 4HA8A 1I1SA 4DXTA 2E60A 2WWUA 4QPIA 4AHYA 4XMYA 4LORA 5ABJB 1B8IB 3ZQHA 3LAJA 1ULDA 2EFWA 2A1XA 2XB5A 3PNTA 3TRSB 3TBDA 4LBMA 2W1UA 4AW7A 3KP4A 3H3UA 2WO3A 5IT6A 3P9CA 3RZDJ 1APNA 2P2KA 2OBPA 1B35B 3H7JA 5KC5A 1B6AA 3ON7A 1AJKA 1A04A 3KEOA 3WY6A 2HYGD 4CP9A 2HH9A 2VUDA 3K70D 4HBNA 5DG2A 1RESA 1T56A 1LDDA 4XAAA 4DZPA 1APLC 1YLFA 2GXAA 3V7SA 5CA6A 1UG2A 4CCCA 3BR2A 3KP5A 3E1F1 3I5UA 2R063 4XTPA 2Y6FA 4L99A 1NE4A 2VMDA 5JWPA 1YFUA 2VY0A 2VOTA 1H9GA 2K86A 4XSXF 4NC6A 1PYVA 1PGL2 1XSDA 4MHRA 1Q1HA 1JI8A 4JX6A 1UAIA 2D98A 1FOD2 2GALA 2F17A 4HMZA 3G2BA 4RQPA 3IKWA 4GRIA 1MQTC 1L3LA 4K1YA 5HODA 4D7SA 4CYDA 3G71I 3UKTA 4N9HA 1HSTA 1UO9A 4MO7A 2Y6HA 2ZGNA 2Y69H 1XB9A 2QSHX 1YX3A 1RKTA 1AR92 2WO2A 5ERIA 2GOXB 4KN4X 4S04A 4J6GA 3VBRA 2Z16A 2UY9A 4UUSB 2PJPA 4RHV2 3P5JA 3GTMJ 3LFMA 2JUCA 2ZZJA 3ZXJA 4FFHA 2H1KA 1TNSA 4WVMA 2WNVA 3I97A 2X6XA 1VQ7I 3S15J 4ES8A 2HOTA 4TZDA 2LYCA 1RUJ3 2D97A 4MEYF 3WNKA 5FO7B 4A3EJ 1F35A 3GZ5A 2VO5A 4QKDA 3KCXA 2V4JC 4JK1X 3OG2A 1SCRA 2VI6A 3ZN1A 4RHV1 4H7MA 1R1UA 1NLQA 4MFDA 4Y20B 2NXNB 2X6WA 3CL1A 1LPQA 4W65A 5H9RA 2WADA 3CNAA 4KWKA 2CQXA 3GMEA 2I8DA 1GOGA 3T30A 2ZEZA 2VZ3A 4HV6A 2DBBA 1JUSA 1H2KA 3MKZA 3CCMI 3LIHA 2H27A 2MH9A 4AFMA 4ZYGA 3ORJA 2LMDA 5A2QZ 5IP9J 3FLTA 2CSGA 2VQHA 3WOGA 1A3KA 1H89C 4M6VA 4E2GA 1X1PA 1JZ6A 1H2NA 3J7HA 2VECA 1PVC1 5KHIA 2LC2A 2HXIA 1B4AA 1RMU2 3ZXFA 4HVQA 4AEMA 3DECA 2IRFG 1G3TA 3ABLH 4J1WA 3JCIA 2ACJA 1HA8A 1BC8C 1D0HA 1RHI1 4GXOA 2DFBA 1CAVB 1K5MA 1XGSA 2E32A 2AC1A 1OPCA 1FMWA 1E2XA 4GH4C 4FE7A 1SLTA 2IXKA 2ARCA 2Z1DA 1WJCA 3RI4A 2PLV2 1RMU1 4EM2A 2J7MA 3LDKA 3IRQA 5I0SA 1T6SA 4PJLA 3IC7A 4XL9A 2QQ8A 4CDWA 4D94A 3CCLI 5A6XA 2LR8A 2XH6A 1SBDA 1EH7A 1S2KA 4BBSJ 4YFNF 4TV7A 2BQPA 3WUCA 4NIGA 5LD2C 2B63J 3HG9A 2B8MA 3K46A 5E16A 3OYCA 5JMCA 3VBFA 5E3MA 3VV1A 4LFUA 2P5KA 2B42B 4GB32 3L2QA 5FY0A 5AIQA 2ZEXA 3K4DA 3VL8A 4QDRA 3HNMA 1G4DA 4Q0VA 3A0HC 2X0LA 2AZ5A 2JXAA 3P9KA 1VQKI 2TNFA 2L9LA 1QF3A 1X2MA 2KJBA 5FZCA 1PZ7A 1GNZA 3JRCA 3EYIA 5IYYA 4COUA 2PHDA 2Y0SA 4XKCA 5FOBB 1U5YA 2LTNA 2RDNA 2YC4A 1ZYBA 4K8RB 2GZWA 1RVF3 4KWUA 2JG9A 2IXHA 4PHZA 3S1QJ 3OD0A 5I91A 1DIWA 2WS92 4ZZ5A 3SFZA 4BEHB 3ZMTA 3H7YA 2A07F 2D3SA 1VAKA 5T52A 2K40A 4XXPA 1V0AA 3GXUA 5T5JA 2QYOA 3KP3A 1K61A 3HT1A 4KISA 5DUUA 5JOWA 5FKMA 4BHCA 2KIQA 1PX3A 2FA5A 2E26A 4R1HA 1L7LA 4NHLA 3C7EA 3H1WA 4JDMA 4YM2A 3TDUC 5J47A 3S2DJ 4BDZA 2VULA 5GZGA 1AVBA 1XYOA 4YW2A 2Z9OA 2DBNA 2WS91 2YY1A 4NVPA 4UF0B 4XF1A 2BWCA 5J4VA 2QSFX 2DPUA 2HYKA 2DCTA 3W2WA 3GHNA 5ED4A 2FDHA 1PO22 1JZ5A 4A3KJ 1W04A 5CU1A 3O1RA 4HYEA 2RV9A 5FZAA 2VNVA 5CFDB 2ZKNA 5GM0A 3JBG1 2XJUA 1Y39A 4NNJA 4RGGA 4YM1A 5FR3A 1ZLKA 5K1YA 1VQNI 3ZIXA 1NQJA 4CGZA 2JB8A 1GXQA 4PDWA 5JOXA 3HBZA 3FZVA 3OIOA 4M0NA 1AR72 2DA7A 1LDKB 4RR3C 4Y5TA 5K7PA 4HKWA 2O61A 4K2EA 3RVHA 3DEWA 3M7AA 4YVWB 2DDAA 5H9PA 4A3ZA 1TW2A 4HKOA 3WE2A 1UPSA 3DEMA 4OWRB 2O03A 3GCXA 4EJRA 4DXRA 1I50J 3ZSKA 5DM6F 2JA8J 1FC3A 1MZ6A 1XE7A 4IV3B 3ZXKA 2ADUA 1XQNA 1O57A 3VDAA 1CIYA 1X33A 1Y1WJ 2A05A 4DXSA 1Y9GA 5FFXA 5DUKA 1YJKA 5EJ3A 3S93A 3QH7A 3MVPA 5LBBA 3HN3A 1S29A 3FXJA 1VBD3 4QMAA 1X9PA 5BNNC 4IE0A 5FJKA 5L3CA 4QX5A 4EZ4A 3M3YJ 4MIMA 2DV9A 4YLZA 5FBZA 3ZXLA 3E1SA 1ETKA 3GCWA 2ISYA 1RTVA 1YRZA 2MC3A 3FXUA 3J7ZI 3FXOA 5DAWA 5A7WA 2VU9A 5LA2A 1AXKA 3NV1A 2Y9ZA 5EYXA 2RNJA 4YYOA 4CU9A 5A80A 5GLUA 2D2WA 1KGYA 2XASA 3GTGJ 4EN6B 1Y1VJ 1BA5A 1AX2A 2C6YA 4UV8A 3JTHA 1AR82 2GNTA 3NMBA 1X58A 3F3XA 1JYIA 1WI3A 1BI0A 2XVKA 2ZB9A 2Q30A 2ZGLA 4XKVA 1F5FA 3HUGA 2WZR3 3RJPA 5IT3A 4CUGA 4OIOF 5FMOL 2W85A 2A6EF 1NA1A 4YARA 1VFCA 3E6CC 2A68F 1YQ2A 4K40A 3VBUA 1KU2A 3RWNA 4XCBA 1LFBA 4MOAA 1F4KA 4RLQA 3A4CA 4ZZ8A 3ZSEA 1AYN3 4FX0A 2XV4S 4XPVA 5FOJB 2WO7A 1AXYA 4O65A 2VZQA 5JXGA 2DK8A 5BNOB 5FZHA 3EQLF 2XL7A 1ZKGA 3BPZA 2R49A 1WGPA 1O8PA 3DKWA 1UB9A 5FO5A 2BTVC 4M3CB 1XNTA 1H2LA 3OCPA 3HSRA 1ZG1A 3CUQA 1NCRA 2VC0A 1MZFA 5IFPA 4CYCA 3MIEA 3ME2A 4F7ZA 3BB6A 4COWA 1V9U1 2K3FA 4YIFA 1Y43B 1OCZH 2VW1A 3MIHA 1LR5A 4X6RB 2PAKA 3I0TA 3U0ZA 4GYGA 3FLRA 4J25A 3WR0A 2IPQX 2WNUA 2JECA 2Y0SN 3MD2A 1PJRA 2J5OA 4MVTA 2C24A 3KSCA 3SEPA 3MIDA 2AS5F 1H8TB 4UUTA 3HKZA 2VKDA 3H1YA 3L2VA 5IVEA 5L19A 1KU9A 2V1XA 1D0ZA 2E7XA 1TWFJ 2XBO3 4LO6B 3VD9A 4CDQA 1R64A 1XCVA 2V9PA 2XSJC 5C3PA 4WK8F 2YU9J 1VBA3 1L0OC 3DPRC 3UGGA 2QNKA 5BQTA 5A7NA 3DN7A 2EZIA 3BTIA 2H8RA 2V1NA 4BQAA 2NPIA 4E4SA 1WGXA 4XE9A 2EFPA 3PUHA 4JKKA 1LENA 4NN0A 4K6BA 1C0WA 1BC7C 4XN0A 2PQSA 2GN3A 3C8XA 1RRJA 3ZMZA 5FUNA 4UVCA 4FTSA 1W9WA 2VKVA 4OI0A 4LHKA 2OCEA 4CCJA 5L3GA 3A2KA 2K2SA 2YBSA 3GNEA 5FZKA 5JUVA 2IFRA 1XS9A 1TME1 4B1LA 4UW6A 1IS3A 3HSFA 3GW2A 4AYUA 2E53A 1PZ8A 5J1UA 4DNCA 2OPWA 5TGTA 2F5VA 4BY7J 4QB1A 2X8KA 1PUFA 3WDTA 1O3SA 4LHNA 3N3HA 2FD8A 4A93J 4GA9A 5FYIA 1WH5A 3NVCA 3R6SA 3RMXA 2ISZA 5C5UA 2W84A 2P3IA 1REPC 1QHDA 4UFHA 5IVYA 4Z07A 1UMQA 1WPKA 4NAOA 4XUNA 1QJU1 3W6KB 4Q4W2 2ZA9A 5FPBA 2WC2A 4R4ZA 1D4VB 1US2A 5CKNA 3FHAA 1PUEE 3WXPA 1QNWA 1JUPA 4N9IA 3KLOA 5JOZA 3D5OA 2NP0A 1V54H 3BQZA 4JVAA 1WBFA 2DJNA 2CGOA 1T95A 3NKTA 1WQ2A 2NVUB 3GEZA 4PI2A 2HWE1 3WF3A 2AENA 5F27A 2YYOA 3SH3A 4MYEA 3T4HB 3C3WA 3RI9A 1WSUA 1QPIA 3PHMA 1X82A 5B4XA 1QZYA 4OI4A 4P9FA 1OCTC 1UOFA 4EN9B 1H6YA 2RJKA 3M2MA 1WW5A 5HXVA 3WNXA 1ULPA 3BGAA 3F8BA 2B9UA 3QWLA 2R7RA 1R22A 1DZTA 5ABJA 1B8IA 3J7AY 2M0MA 2K4BA 4TN7A 2F6CA 4Y4YA 5FIXA 5FMBA 1GQGA 1P8JA 3AXEA 3JUUA 4D69A 1LOBA 4IEVA 4Y52J 5BNGA 2YR2A 1ND3B 1VRBA 5FO8B 1PX4A 3K6GA 4MTDA 1B35A 4AVSA 4LULA 1IXRC 3O8HA 4RAZA 4EQQA 1T0FC 3S3MA 2CUEA 3IAPA 2DMNA 1TG7A 1GVJA 3G6JB 2M2EA 3D8CA 2WY8Q 2LM3A 3NV4A 2PQQA 1BJZA 5D1IA 1MNEA 3U9GA 4HL0A 4LMYA 4ASMB 3INAA 3PSIA 4AI0A 4QX8A 1LFPA 3RDIA 4R8HA 5GALA 1SDDB 3NNGA 4P1WA 2R7QA 3MEXA 1RUD1 3J81K 3JD73 1S7OA 3CO6C 4O5VA 1OLRA 5FZDA 4LE3A 5FLMJ 4IXLA 2RN7A 1YFXA 2BOIA 1OF4A 3RSNA 4CE8A 1FOWA 3ZQFA 1WCSA 2I74A 2Z3YA 1EA3A 2QKDA 4FTEA 4QPGB 3QPSA 5LB6A 1OURA 2ZX2A 3Q8FA 1ZX5A 1TP4A 3MPBA 1R5HA 2X51A 3HBLA 5C4JJ 5EV7A 3EDPA 3OBTA 2IS1A 1T98A 2FBKA 5AONA 3VLBB 4UFIA 4QU1A 4DQAA 3IV5A 2XGCA 1XOYA 1HDDC 3NWKA 4XUQA 3O0XA 3HKZN 1MBEA 4AI8A 2DF7A 3B93A 1S0IA 2CYYA 2EIMH 4J00A 2UWCA 5F6KA 4XVHA 5FZBA 3FLPA 2ZHMA 4HK9A 2GA1A 5HDNA 2XONA 3ZMOA 2WAEA 1UNBA 1WWYA 5K7ZA 1JYNA 3QU6A 1D2QA 2CV0A 1F2NA 2RREA 2WAQA 3V42A 3DPLC 2WAOA 2LVSA 2X6YA 4FASD 4XLHA 4BQYA 4IOAF 2ZJCA 3IRRA 3LSKA 1ASJ3 2B7EA 1CQ9A 1Q5OA 2EAKA 5A6QA 1IW7F 4LIVA 3N9QA 3IKVA 3PIPF 4II3A 3ABTA 5AVPA 3RPUD 2EXIA 1NQDA 1YC61 4FFFA 1DP0A 1MMSA 4XLFA 4LA2A 2B39A 1UZWA 1ZRFA 2DTYA 3POSA 4JX4A 1YTYA 2A5ZA 4BBRJ 2AH2A 1Y8QB 4B43A 2F5FA 1XNKA 1AX0A 1BR1A 4EN8B 5BMZA 4EN7B 3ZP5A 1R00A 1JYVA 4ZXKA 1Z7S1 1DP7P 2VB6A 2A3XA 5HV4A 3PJQA 1F9NA 1HXDA 2EVXA 3WCRA 2KIMA 1X7NA 2E31A 4IHWA 4E6KG 3T4VA 1YRNA 1OISA 3H9JA 2P4WA 1GWMA 1PGW2 5L9BA 2FDKA 2ORZA 2BRTA 3ZFGB 3VDDC 3LEKA 2BY2A 1POV3 1W8UA 3D1NI 4JRAA 3JXSA 3Q8AA 1YWKA 2J5PA 1H8VA 2RS33 3QYFA 1HKDA 3LA2A 2WN3A 5C8CA 2PI0A 5F2SA 1T39A 5FYTA 1RVF2 5C9AB 4HN0A 3C18A 3OPZA 4AIHA 1WJEA 3SQOA 3AG4H 3ISPA 3M8JA 4LO4B 4KJZA 4R9AA 1QY4A 5J4YA 5FUIA 2PEXA 3QYBA 4AYBA 3TEDA 3BKZA 1BMV1 1F15A 2IBDA 2DWRA 2VE1A 5FRAA 4R9BA 2VZPA 4UHTA 1AL23 1HOMA 2J42A 1XMKA 3H0OA 1IDYA 1EP0A 1LHWA 2XJTA 3AG1H 2XLGA 1IRXA 3I54A 2A71A 2M87A 3L00A 1Q8QA 3WEZA 1VF9A 4HANA 1GP5A 4P00B 4CCMA 2PFBA 4CXXA 2X10A 2OU2A 1VALA 2J1EA 1QDCA 1W8ZA 3PU3A 5F32A 1Z7LA 4QQLA 2GC2A 1U5ZA 1IHMA 3BJAA 2OZ6A 3AMQA 3PVEA 2CQ7A 4BLJA 2R93J 5I8YA 2YX7A 1K78B 4JGYC 1GWLA 3C1DA 5JFRA 3LMMA 1US3A 4YM3A 1AR63 3WU0A 1N47A 3HDDA 2DMTA 1FX7A 4INDA 4AC0A 1Z78A 2K7LA 2ESHA 4XW3A 2FBEA 5L36A 2O8KA 4Y1VA 4O7XA 3CQZJ 3O0VA 3HC7A 3V8LA 4LG0B 3BT9A 3W6JB 4X8PA 3H8OA 2EFOA 2UURA 4FPHA 2EALA 1IUFA 4AFAA 4LK7A 2W46A 1LHOA 4LK6A 2R5ZB 2P3KA 2P6CA 4BDYA 4EJUA 4A5NA 2EV5A 3F8NA 4IW3A 2HQ5A 2UXXA 1WLTA 2PHXA 3L9JT 4IUGA 4YVWA 4HQMA 2GQQA 3NJZA 1J0RA 3C3VA 4ZS3A 4F91B 3JSOA 2VCCA 4BIFA 3T0DA 3ZKYA 3CDZB 1B59A 1FV2A 4Q0PA 3I3BA 1C8M3 2J1TA 2R7EB 3VYUB 2WR9A 3LEIA 1Q8VA 4BIOA 1I9RA 1MSEC 2E1CA 2R92J 2FEZA 4G94A 4N7IA 4Y26A 2ARBA 1YQ8A 3WDYA 3JRAA 4ZDLA 5JR2A 1SVLA 1J3QA 3H8UA 3FHIB 1SD5A 1NXD1 4Q4X3 2E36A 1GYKA 2I5UA 2WAQN 3VBSB 5A3MA 3PU8A 3RYRA 1GZWA 3SH4A 1UZ0A 1LGNA 3DLAA 2V7FA 1BVP1 1CX1A 1ONVA 3IWFA 1UHSA 3O3KA 5FROA 3O0WA 2FX0A 1HJFA 4QX1A 2FCTA 1YI7A 1LTEA 1MS1A 3BTJA 3MIBA 1UELB 2EV6A 5K5RA 3K4AA 4QX3A 4ASLA 2PA7A 3FX3A 1V6IA 2KJCA 1W2TA 5CFDC 3AKSA 5JAXA 5A32B 2FNPA 3ESWB 3PJRA 2WZ8A 2XPJA 2NZ9A 3MICA 3VHNA 5KHDA 3ZFEB 1RUE3 5K7FA 2A6ZA 2GLOA 4Y3OA 4M3DA 1REEA 3S14J 2WKKA 2YB7A 3A02A 4Y13A 3JRIA 3I2DA 3MAJA 4DXZA 3H9GA 1AA7A 4KNCA 3DU6A 1DQ4A 1LOFA 1VR3A 4BB3A 5EYRA 4CCEA 2C9AA 3WUDA 3P9IA 1YOVB 3CMAI 4LA3A 1HKQA 1XGMA 3RG0A 1SMYF 1ZRDA 5DAVA 1H2MA 5CFCC 1XE8A 3I2HA 3BI3A 2LS6A 4QB6A 3P7NA 4PQ9A 1FT9A 3K51A 4NRPA 5BNOA 2ID3A 3ZGKA 2RMU1 2QTWB 3FK7A 3KYLA 1JE8A 4IV3C 3RZMA 5FYBA 5GKAC 3I8TA 5IK4A 2BERA 3DU5A 2A70A 1VNDA 3CTAA 4OIRF 3PTRB 3ZYRA 2F48A 3RZHA 2H1LA 2VC9A 3KMHA 3VD3A 2QQBA 4TSVA 2ZFUA 4HONA 3LAGA 5F5IA 2MGQA 1LOCA 1QOTA 2ZCWA 1K5JA 3J4UH 3F6VA 2XWJB 1QRYA 1W9SA 3BODA 3N7LA 3M4OJ 1PIV2 4AYBN 3UETA 2KFDA 4A3IJ 3ZSMA 2RAEA 3GZ6A 1R1VA 4FAHA 5BNPB 1UYPA 2GC1A 1FIAA 2DQRA 4IV1B 1ZR2A 2BGCA 2P3YA 4E27A 3GO5A 4Z2WA 2J1RA 2MPFA 2PELA 4HQEA 4X8NA 4IGOA 2Y8KA 4J19A 3ZXGA 2W47A 2ZGQA 2PMWB 4ZZDA 3PMEA 5EJCA 3BUCA 2W1SA 2GNMA 2G9ZA 1XU1A 3ACGA 3ATGA 5HLGA 4CTEA 1IXCA 4BAYA 1LKNA 4GJYA 4GDFA 3TMOA 3RZZA 3VGIA 2HWF3 3RZKA 5KK1A 5FO9B 4G4FA 3V7RA 4V2WA 1MS5A 2H94A 3HRMA 1UMHA 2L01A 5K7HA 1QKQA 3M9AA 1IS4A 1ZZ8A 2HTSA 1JUIA 3WF2A 5C3EJ 1VBB1 1Z91A 4ENNA 1ND2B 4AEKA 5A70A 3VYRB 1UHMA 1HQCA 2HFHA 4BJ5C 3BN6A 1FMD3 2DU1A 4YRVA 2YXSA 2Y0OA 4ET7A 2LP0A 2VZVA 4TXWA 2Z5WA 3D5SC 3WNMA 4AVAA 3OS1A 4MGQA 2QQUA 2K46A 4KDPA 3H42B 2RS53 4XUOA 3LFIA 5JXHA 4H4KC 2ZJ2A 2WLPA 3FXRA 2W24A 2WFPA 4QHOA 4G9SB 2AQEA 2DCEA 3E5UA 2AQFA 2R073 3SHFA 4ZONA 1X8EA 4V1PA 4QXHA 3CZ6A 4QT6A 1BIBA 4Q4V3 3ZR6A 4A3JJ 1WD3A 1X1CA 4YZ2A 2EJRA 4Z2AA 1H0MA 4BYYA 1TVGA 1W1WE 1KITA 2OT7A 4RGAA 4EZHA 4BH9A 2WFF1 4ABZA 2E2HJ 5LA9A 5CVRA 1H8TC 3AKPA 1PNGA 4BE0A 4AQTA 4U0WA 2W3JA 5A1AA 5J1XA 3MDPA 4JQFA 5K5QA 5DV5A 4KL1A 3G1MA 4HVOA 3ZDSA 2VMIA 2LLKA 2YROA 3IMNA 1JZ2A 3AYAA 1LULA 2KIFA 2BW8A 1VB4A 5A1FA 5LEKA 3RZLA 2OF7A 1LHVA 1HJGA 1BJAA 3CMMA 1EAH2 4W50A 3ETPA 1X3ZB 3LD8A 4XSZF 4IEPA 4LLNA 2YU2A 4HK8A 1OKQA 2VQCA 1CPNA 1W6QB 1VBE3 3OYKA 4HSTA 5EG0A 2VTFA 1PP8F 4A0YA 2VZUA 1RUC3 3WV6A 1BI3A 5A2QK 1YHQI 3ZKUA 1UOJA 3OR2C 1ZNPA 2W1OA 4A7ZA 2JVGA 2F4MB 3HQRA 1H9TA 5IFTA 1YCIA 3RPQA 3VEPA 3TBIA 1L7QA 3L2HA 4L9TA 1J3RA 2XOMA 3O1TA 3ACFA 4YEJA 2HEOA 4P9IA 4TLFA 4CEWB 4DZJA 1MBFA 2OUHA 3M1EA 4UBHA 3T8TA 2UV1A 3LWFA 3J8F3 2DA6A 5FPUA 2QDRA 4CH7A 2VVDA 3TW6A 3RKXA 3ZOIA 2IVIB 3K2ZA 4FOVA 3UL2A 3L2YA 4QSHA 3LPGA 1TMF3 5LBEA 3JD72 3H9QA 3AFHA 2WAAA 1MNDA 1X3UA 4XMIA 3POIA 1LOAA 5FPXA 3F95A 2B0LA 1HRI2 2NOGA 1QMJA 1FYUA 1UW8A 1LVAA 2MD0A 1VMJA 2NRAC 1Y3TA 3P6BA 3DTKA 1NG0A 1K79A 3T2OA 2BZTA 3M3OA 1BXHA 1HC8A 4FQ4A 1V6MA 1W5SA 3TOBA 2K9ZA 3ZXAC 3ECOA 2IAIA 2OVUA 4AF9A 1RINA 3GVAA 2XKPA 3UR3C 3K1PA 4QX0A 1OKRA 4RAFA 4ORFA 1UD1A 5K8SA 3LAPA 2P6TA 1BVVA 5IVJA 3AMPA 2DUOA 4KGQA 1TTYA 4UYBA 1HRI1 5EEAA 1QXJA 4D6QA 3ZFFB 1N25A 4ZYEA 3OGRA 1IKPA 1JZ8A 1KDKA 2K27A 4QPGA 5JZGB 2IGNA 3QCWA 1W8WA 1D8JA 3TN93 3J80K 2QQOA 3ZYIB 3HEFA 1HRV1 2GP3A 1RUG2 1MS4A 2W08A 4HKLA 5HPOA 4HETA 2VMGA 4P96A 2DUQA 1AX1A 2JIJA 1BOAA 3IHUA 2QZ2A 1WMXA 3A4UA 1MZBA 4COZA 4Y1XA 4JTNA 2Z4FA 1E3HA 3PQKA 2IZWA 3BR1A 1RUH3 1ND3C 3TNPB 3ZCOA 3POBA 1E57A 2QUFA 3ECHA 2D6KA 1NG6A 2JDUA 3WU1B 4XFFA 2VODA 1KONA 3PUQA 3HYIA 2JG8A 4JTOA 1S0DA 5APAA 2DI3A 1RUF1 3OYNA 1WMDA 3H50A 4N0BA 5FZOA 1UYZA 2JDPA 2IJLA 4FI9A 4G7ZF 2ATFA 2GNDA 2M3AA 4GALA 5DD4A 4IEXA 2VTXJ 2LRDA 3WDVA 3KV9A 4XJ9A 5FY9A 1LHUA 3IDBB 3HSEA 3CJIA 1HQWA 2HWC3 3BZKA 1WLCA 5GZEA 1UZCA 5F1RA 1W3VA 1ZBE3 1VB2A 3FFQA 1OC1A 5T5OA 2ZTNA 3L2WA 2R7FA 3MQ0A 2HTJA 4HAMA 2JJ6A 3DF0A 2VMEA 2ZEYA 1MVQA 4D0PA 1T6GC 1C28A 2R041 1U3EM 2CJJA 1NLSA 3Q9OA 3Q3SA 1LJ9A 5FZFA 1W8OA 3OOXA 3MEPA 1JTXA 2P5VA 4AFBA 2DCYA 2Y0MA 5ACA3 2A3WA 3ZFGA 3A01A 2DK5A 1DGRA 4DUWA 1U5TA 1CN1A 4EWEA 5CG8A 2Q0AA 1DCSA 3K9TA 2HBTA 5FKLA 1YYVA 1COV1 1X1DA 2DQLA 4A3XA 1W6NB 5F3CA 3PNYA 3WG7H 2STTA 4B1RA 2MFZA 1PK6A 5HS9A 5FJHA 4NOTA 3S7EA 4KU7A 2VQLA 1W5CC 4W97A 2MC4A 4OQ8A 1AHSA 1WA4A 1AWCA 2IVJA 1HLCA 3KEQA 4RM2A 5B5EC 4HRIA 4OUMA 1F8VA 3IT8A 4C0HA 4BQQA 5B3SH 3T08A 3AJZA 3FKJA 2GAUA 3CP2A 2XJVA 1GDTA 3IIAA 2HWD1 5F3GA 3CUOA 1HF0A 1IQDC 1BJQA 3WVJA 3S5AA 5H6QA 4N53B 3NARA 2IS4A 4CU6A 4RAYA 1S4CA 2KRHA 1YFWA 2ZAHA 4MTEA 4Q1PA 3FKIJ 2FSWA 4BQ1A 2M7AA 2WBKA 3J26N 4D0QA 1GR3A 2NS8A 4HX4A 2C1FA 3D0SA 2MW8A 4BXXJ 1OFCX 2VOXA 4CXFA 1GLHA 1O3QA 2KD7A 3JQWA 2PLYA 4XOGA 4AVZA 3H8XA 5ANQA 4AUXA 5F64A 1JOPA 1ORKA 3Q0WA 3K0LA 2GXBA 3B3QE 5AC93 4M3CE 2BVLA 5A3TA 2DDBA 1U2WA 1SVMA 3PO2J 2JWTA 1JKRC 1K78A 1AUYA 4CU8A 1UZZA 1ETOA 3CLOA 1DZRA 5EQUA 2QVOA 1ODMA 1PNFA 2GU9A 4AFDA 1Z67A 1VQ4I 2M4KA 2BWAA 3GZAA 4S2GA 4MLOA 5DZGA 2QBYB 4ZC3A 5KXDA 4AD9A 3DPTA 2OQ6A 5F8PA 5JOYA 1DQ0A 1A5JA 2K02A 5CPRB 2O5RA 2PBIA 2V1DA 5C9AC 1MS9A 2W91A 3WP4A 3OYGA 3N7KA 2LALA 2ZXIA 3SFIA 4UFKA 2R061 4QHBA 2JX9A 4XQWA 4FHTA 3JRBA 1OLME 5B66C 2R5ZA 3JRHA 1YJNI 3RWKX 4ENJA 1MJBA 4WM7A 4FQGA 3N36A 3MF9A 1UYYA 3UJOA 1I27A 4S05A 3A21A 4RYDA 5JSOA 2EILH 3AMHA 4ARYA 2XAHA 2M8GX 2Z5UA 4BMEA 3F2ZA 4Q4X2 3CIHA 5FXVA 1G9FA 2EIGA 3V56A 1D1BA 1VBC3 4AEDA 2P4EA 5IVBA 2HKOA 4L2NA 1OCCH 1S0EA 3S8PA 4OLLA 1BEV2 5EXOA 2FZ2A 1E17A 3K4BA 1JOJA 3CP8A 2XAQA 1KXGA 2D6OX 4BCUA 4G12A 4Y1UA 1Z6RA 2VW0A 3WQBA 2IVMA 1PVXA 1JYCA 1KQRA 1JMUB 4CPBD 1W9TA 2Z33A 1GP6A 3HAGA 3HOYJ 4DINB 4ENMA 2LK2A 4LBJA 3I3EA 2FBHA 4LB6B 3BYWA 3KX2A 2J1SA 4FCAA 1TQ5A 2B5HA 2W2IA 1F1ZA 4R4XA 3VUOA 1QQP3 1VRH3 5D2AA 2B46X 4MX3A 2EZKA 1RUJ1 3DCQA 4QQPA 1GP4A 5F08A 2M1BA 1QJY2 5FYUA 3BTAA 1D0GA 3HHHA 1XB4A 1YQCA 5IUQA 2AGSA 5A32A 4FT8A 2KDOA 4C30A 2ORXA 2O8OA 3K2OA 5KWRA 4RL7A 3V8JA 3NQHA 1YG2A 3CJRB 1P4WA 1XGNA 1ENQA 2FQ4A 1UIJA 4G3YC 3N7JA 1UY0A 1YIOA 1WCQA 2CHHA 2I45A 3U07A 3WHTA 3DWLE 3ZN0A 1H1MA 1QJY1 1FYMA 1ST8A 3NQOA 4IXAA 1FPN2 4RB1A 2GXGA 2HDDA 2IXLA 2VXRA 3BALA 5GZDA 1E5IA 4YGCA 2VBXA 3AC0A 1DGRN 3BCAA 1W6MB 1SFUA 3IAS2 4JGZC 5CIRA 1MD0A 3ZMVA 1G59A 3OWTA 5LASA 1D5YA 5L7OC 1T2KA 4QM8A 3POGA 3LFKA 4A7YA 1J5YA 4BOWA 3IP4B 1UOGA 1YW7A 4Y5Z0 5HCFA 5G04L 3W58A 3BIWE 2N8GA 2OZJA 3D4KA 1WMEA 3M7GA 3KHCA 4HG6B 4BKXA 2D3RA 4OAYA 3VBSC 2L02A 4KIGA 1QH7A 1YJ9I 1ZBA1 4IRGA 1Y0NA 4IV1A 1CVNA 1LKXA 1UYXA 3BVCA 4BQ2A 3ZYBA 1PM7A 3WTXC 2SLIA 5FYSA 1OPMA 4QQ2A 3WF4A 4TWTA 1FMD2 3DYPA 2XPVA 3KT1A 1SFEA 3I4MJ 2IS2A 5DTDA 2VVEA 2DVGA 2L5QA 4GWJA 4AAPA 3ZFEC 4YW1A 4CEYA 1C4RA 2JJ7A 5F39A 1BKZA 1FOD3 3GFLA 2G9FA 4XFAA 2RM22 1PZ9A 1CPMA 2LKPA 4UFJA 2VLAA 4MGKE 4B29A 2W7NA 2DFEA 2RC4A 2UYAA 3H0GJ 2JRTA 4XXAA 3CJTB 3P1IA 4O9GA 1VE0A 4C3IJ 3FL7A 1B72B 1JXNA 4IEYA 1JGSA 1CZTA 4LLOA 5F9TA 3KM5A 3VSLA 4DQ2A 4YG6A 5DEQA 1VLNA 1GNYA 4RD7A 4KT5C 4IL6C 2YC2A 4RHV3 1AYM2 2CUFA 1MBKA 3DF8A 1FXZA 2RM21 4HSLA 3GLXA 4LHSA 3OYHA 4MGIE 3VOEA 1SBEA 1IV8A 2GM4A 3ZR5A 1MPXA 3RKWA 1RB8G 2VMFA 1FNZA 3G3ZA 5K5OA 2Z42A 3A22A 4HPQA 4D6SA 3DL3A 4CU7A 4S2HA 2DU9A 3A0KA 1UY4A 1YI9A 2DO7A 2KIUA 5DDGA 4CDUB 1NKGA 4LBQD 4RA2A 2E7QA 3CCEI 4NQWB 4P9YA 1GZ9A 4UFLA 2HXOA 5HDKA 1GV5A 3LDRA 5BNPC 1MJAA 1JODA 3B9CA 4WCGA 1NY71 5JCTA 2R7SA 3LQQA 1A35A 2XGXA 5JI9A 1XXNA 5E17F 2L4MA 5ILVA 3ACLA 3RPUA 3PVOA 1ULYA 1O7FA 3M1HA 3CC7I 2KLOA 2BBAA 5ILSA 5HBAA 2VBWA 4A44A 1V00A 1D1CA 4A7KA 1RMU3 1RETA 4N43C 5A3LA 2IFWA 1RUI2 2ZMEA 4OOIA 4MQVA 3KZZA 5LK5A 5DG1A 5F6FA 4RSUA 3KP7A 1O3RA 4XLNF 2B9SA 1ND2C 4QX7A 3FXLA 3BZ6A 4TLGA 1Z0XA 2ZGOA 4UI9L 3GTPJ 1T08B 3NJYA 1A8DA 5F3IA 4HVRA 2FMLA 3I64A 1SPPB 5FYYA 3OS0A 1ACIA 3E97A 1M06G 1QWRA 1JU3A 2BYVE 1ETQA 5GADJ 3LZZA 4RR3B 3UKNA 1HW1A 3COAC 1KQ0A 2PLV3 3BY6A 4WWCA 1RUI1 3K7AJ 1S0JA 1ALYA 3H1CA 5FLXK 4UXAA 4D3WA 1BBT1 3TDZC 1UY2A 3HOTA 5KHHA 1YS6A 4XF3A 4IEZA 1ONAA 1W0NA 4L0ZB 4IQ4A 4I30A 1Q8OA 4AI3A 1U5IA 1O6UA 4GB33 1IG3A 1SCSA 1W8FA 3Q9VA 1J83A 2LUWA 2XVLA 1QJZA 1NZCA 3WSOA 4CP1A 2D5HA 4Y1YA 4OI2A 4XFGA 1HN0A 1R082 2ZC2A 1W6PA 5A3OA 1OYIA 5GLVA 4YVSB 4L0YB 4DYCA 2MEV1 2HI3A 2KZVA 5FB2A 1IKQA 3K4CA 4KYWA 1HSJA 3KB5A 1N1YA 3MBWA 3H3ZA 3WX5A 2RDPA 5JMOA 3QYEA 4AOCA 2DURA 3HOVJ 2DOAA 3FJSA 3ZFFA 1NCQA 2WS93 2B7YA 3LEMA 1SLAA 4KU8A 1RUH2 2BOJA 1LE8B 3M07A 5EFUA 5EHDA 4BXUA 4PT6A 3TB0A 4PSXA 1JJ8C 3I7DA 4RFRB 2VCAA 5D8AA 1FATA 1S55A 2AXTC 1N1VA 1OT5A 2GP5A 2V6CA 2D7FA 2JDKA 2R30A 2JUGA 4A41A 1GMMA 2E6VA 4FP3A 4CUBA 2EFNA 1FJLA 1USTA 2CW0F 1UN1A 4U87A 4LIUA 4CEWC 4QPYA 4LG3A 1MDMB 1ZLJA 2PFWA 1MMNA 2HWC2 3THPA 5CB7A 3AYCA 5DDJ2 3WF1A 3MYXA 4LXLA 1EV11 2KPMA 2X4HA 4TYSA 3U21A 4YPJA 3OPWA 5GZFA 1R092 1MACA 3CF2A 5LLQA 1EPWA 2XC7A 1CZVA 1QJX2 2VZOA 3CCYA 2H8WA 3ZQ7A 1J3PA 4OYUA 3B73A 4PZJA 3MKWB 4IHVA 1O4TA 5KXEA 2X1CA 2XBO1 2ET7A 1ZR4A 1ULCA 1A6CA 3RMYA 3T09A 1VBA1 4QKNA 2RQPA 3HGGA 1R1A2 2HYFA 1SG3A 1ZM1A 2YC0A 1OR7C 1W8NA 1XPWA 2QCSB 4Q27A 3NAPB 2WV0A 2WIIB 5CKQA 1LFUP 1QJX1 1FIPA 1UMIA 2R7TA 1OLTA 1XD7A 2VT3A 5F5QA 3U1XA 1YQAA 5J3UA 2A6WA 3CC2I 3DKQA 2AHQA 1XPXA 2C6SA 5C3RA 4FQZA 1V6JA 4KMQA 4I0BA 2QQAA 2MLGA 4XFIA 3KV5A 2RDQA 2IGOA 5JZGC 2BV4A 2O6GE 2WLQA 1PHMA 1FEXA 5FY5A 3AMNA 5FK8A 6PAXA 2V79A 5IVCA 2Q2EB 2P0WA 2YSRA 1QOOA 1F36A 2VOOA 1X4PA 2JKBA 4B4QA 4CDXB 1LEMA 2PN5A 3GZNB 2DT6A 5DAXA 3ZOBA 4XQ4A 3I3MA 1DYKA 1AR83 2CWEA 2VJJA 4NHJA 4K8FA 4QKBA 3V0BA 4KIBA 1PO12 5FLIA 1V70A 2X1EA 4QGMA 2L7KA 3UGFA 3E0JB 2H6BA 3THTA 3GJBA 1LVKA 1REDA 3WCSA 5IHRA 1A36A 4MXWB 1HN1A 2EBIA 1C5HA 3B6CA 3LSPA 4Z8BA 1YQ6A 3B69A 3V8KA 5FZ1A 2LKXA 1TW3A 3CO2A 3R0RA 5I93A 4XBNA 3H3VK 1RPWA 3OR1C 4W1UA 1CAXB 4BJ0A 2G7HA 4E7JA 4D6RA 3VZNA 3R4UA 4OQ9A 1QHHD 2ZAAA 4KFCA 1Z3YA 3HTUA 4XNFA 4LLLA 2HYXA 2Q8OA 2E2JJ 2BEOA 2ET1A 2KM2A 3WTUC 4FCYA 2EZLA 4KNYA 2R3SA 5IAXA 3IUOA 3PJYA 3HD8B 2WAFA 4HPKB 1KD7A 3AK0A 3TEYA 3I3LA 5F0CA 4C2TA 3N9NA 1HB4A 2VUCA 1QH6A 2AR6A 3RI8A 5FZ6A 1AJOA 5M5XJ 4E2QA 2EICA 5CQGA 1JKPC 2XLAA 1CJPA 2O3FA 1DLCA 3CHXA 4Q47A 1QNYA 2W00A 2ARAA 2JA5J 3D3AA 4LBNA 2X9DA 2LTPA 1ZVFA 1D4M2 2GOMA 2DVBA 4XABA 1G3SA 4CCNA 5LEJA 4BHPA 5LW9A 4XDQA 2F5CA 2MA3A 3V65A 3ZN6B 1I39A 1K4SA 4N53C 1Q8PA 1ULGA 1ULEA 2HEWF 3BC8A 1LGCA 3I55I 5D4RA 4IHTA 4ATEA 3N35A 3HT2A 4GJZA 5FZ7A 3SYTA 2E33A 2OUJA 3BPXA 4C9YA 1FZPB 4AIDA 3GTJJ 2QZ8A 1QQP2 3KEYA 4URTA 5DCMA 3WNLA 3BJ6A 4BQOA 2QE3A 4BISA 1XE0A 3T8RA 3ZVXA 2K9SA 4EQVA 4MEXF 2BFUS 5FBJA 5M5YJ 5IK8A 4TTGA 2E5NA 2GDFA 3KVBA 4IE7A 3OS2A 2V9KA 4BS9A 4YW6A 1Q1VA 3OYWB 2JK3A 2XR4A 2MYSA 1MEC2 3BR5A 1NYWA 4ZU4A 3LCPA 2DBIA 4XFCA 3FXQA 4GULA 4PCRA 3LA3A 1MQTA 5FFZA 5LBQA 2BVMA 5FZ0A 2NNNA 3CZUA 4D5FA 1SQ4A 1R9TJ 3KV6A 4WM8B 4LBQB 2HWE3 2W9XA 4XORA 3WINE 5L3BA 1R49A 3EPZA 2ETHA 4MXVA 2BY3A 2CAVA 1IN6A 1YIPA 1RC9A 5DPNA 3R60A 3S2WA 3KZYA 2Y0IA 4E7KA 2VOWA 4DOZA 3CCSI 1ETWA 2A3SA 2DTZA 1D0XA 2XAJA 1N78A 5D5XB 1NAEA 1TZOA 3FHQA 4FETA 5FWEA 4OHVA 5FV3A 2JDAA 4KUMA 4DNYA 1LESA 3BPSA 2FZ1A 2N7GA 4YW7A 1T8IA 3GZEA 1WCKA 4YSFA 1MMGA 3A7QA 2PXJA 1GBGA 3I49A 5CVJA 1ODNA 1IQAA 4BE3A 4UOJA 2X5IC 4P08A 1LCLA 3LEGA 2ZJPF 3GTKJ 4KICA 2Q8KA 1IG0A 2E63A 2RS11 2IS6A 2X85A 2PQ8A 4YFXF 3BG7A 3VDCA 1ZA4A 2Y34A 4XZUG 1H9PA 1Y8RB 2IXSA 2OYZA 4IZZA 3SDGA 1JJ6C 3SCGA 3ABZA 3OYBA 3IM0A 3TGNA 3UT0A 1YQ5A 4M6XA 4MGZE 4FOQA 3G1LA 3HGYA 5I0TA 2DYSH 4OHYA 3CKHA 5CLSA 1C3HA 3K77A 3KHBA 3PO3J 3T0BA 2FF4A 2Y6GA 3F23A 3AZVA 4A12A 1POV1 1CAUA 3WQ0A 4BM8A 1X2NA 1VQPI 1I6HJ 2D6NA 5CQEA 2RS31 1RUD3 3W3CA 2UUZA 5FY1A 5JHUA 3CCVI 2ID4A 1DGRM 5JPMB 3ZQLA 2Q8EA 1QJEA 3VBHB 5GZCA 2DA1A 4RGXA 4ENKA 2X53S 4NROA 4D8MA 1X9TA 5F0HA 4IO9F 3CCQI 4E7HA 4A3CJ 2Q1MA 3U78A 4LR4A 5FAXA 4GH4A 2E9QA 2XG3A 3ACHA 1VPHA 1FYKA 2CAUA 4ATFA 4XJAA 5F1JA 2R0FA 3U37A 3VDDB 5D6FA 1FTTA 4NR1A 3DBLB 1NUKA 3TNQA 1ZAOA 2EF6A 1ZELA 2JT1A 3N9MA 1FX5A 2G1MA 1SEFA 1FOYA 1W36D 3WNPA 1POGA 1N1TA 4AHWA 4XF0A 2ZGUA 2BVVA 2Y6JA 1RUOA 2K9MA 2V4AA 4Q2FA 4CHUA 3OIPA 2V5DA 1FV3A 3B94A 1V5EA 1R1TA 1V5FA 1TZLA 3QU3A 4KITB 2LOOA 2ZNYA 1PVC2 3KP6A 3ASIA 1QU0A 1U0JA 2OV7A 1UXZA 4NUBA 3HHGA 3JAMZ 1NX9A 1I3HA 3ES1A 1D7PM 3DXUA 2KRFA 3ZYHA 2R5YB 2WT0A 3DXTA 1YE9A 1RHI2 1RYYA 3CZJA 1CONA 1YJWI 3NEUA 2R7UA 1HLVA 2PN6A 5BS6A 1OYWA 4DBQA 1R5ID 4C3JJ 1YW9A 1VP6A 3L09A 5KAFC 1LDJA 3CJQB 2BE5F 3BU0A 3LSGA 1J59A 3OUJA 4B48A 2ZGKA 4K7JA 3HL2A 2TBVA 1IS5A 5EGOB 1QQIA 1XC5A 1HW2A 1P7IA 2PAEA 2XJRA 2WV1A 2TCTA 2XVCA 3SC7X 2BBVA 4I98B 5FQ0A 3IH4A 3NL1A 4JGYB 2F4LA 2Q1ZB 2XDVA 3WGGA 3I2JA 3RGBA 1FOXA 3OOUA 5FUPA 1QHGA 1Z77A 1QIQA 5CG9A 4AVTA 3EO6A 3BTLA 1GUIA 3TQNA 3PDQA 1S1AA 4JBAA 1IPKA 5HLTA 1GVDA 4LLFA 4ZDPA 4QM9A 2O0OA 3VKOA 2KHMA 4D7MA 4RA0A 4ZS2A 4XAEA 1WCMJ 5FD6A 3DXJF 3I4PA 1QA6A 5A7OA 1IPJA 3KYCB 4E4DX 4GIQA 3VHRA 4W6XA 5I0DA 1C8M1 1ZN2A 4RMNA 3VBOB 3BG9A 4FFIA 2VE9A 4HSRA 2CYFA 4Y15A 5J48A 1BOBA 4RR3A 3HMYA 3OYDA 4KGGA 4KN7X 3K10A 1FNNA 5F7UA 1CAWB 2M7BA 4U88A 4II2A 5IP6A 3DP7A 1CWPA 2PTMA 3J80Z 1NXMA 3FC0A 4RM3A 2CS3A 3E3VA 4XURA 2L7ZA 2AO9A 4CDUC 3WHCA 1R23A 5HS7A 3EHKA 1JW6A 1OQ1A 3EJKA 4WX9A 2HR3A 3I56I 3O6BB 3ZYGA 4WZFA 3VSKA 1MGTA 1D8KA 1KFXL 1NE6A 3THCA 3QPTA 3ROUA 2UU8A 2CFXA 5BNNA 2FDGA 2BY0A 1JYTA 4O61A 1BHGA 5FZ8A 1ZARA 4PIXA 2P7CB 2JKXA 3JBG2 5M0TA 5IVVA 2WYFA 1BW5A 1ETYA 5KHGA 3S30A 4PQQA 1G6NA 3GFJA 2D6MA 2BPA2 3MKYB 1KS4A 4JHZA 3WTSC 5D5WB 1DGWA 2IP2A 3KF5A 2E7TA 3F72A 4WZCA 3I9V2 2J1AA 4IF4A 1RIRA 1OD5A 2K85A 4M3BA 1IAWA 3J7NA 1LE8A 1IZ3A 4ES9A 4HF2A 3Q5FA 3U2RA 2FD5A 3B01A 2LFBA 1Q56A 2EXJA 4D7YA 2RDRA 4U0VA 1C5IA 1E3OC 2ZXQA 4WF2A 3HOBA 5HLIA 4DRRA 2CV6A 3OJBA 1G3YA 2GSYA 3BQYA 2WWYA 2W4SA 4XIDA 1JOBA 5F2WA 3AFKA 3BPVA 5FK7A 5FY7A 3VD4A 4F55A 4IEJA 5CVIA 5D6EA 2PJRA 3F8MA 5CJ9A 1MDMA 5FY8A 4XBFA 2X29A 2IC1A 5F37A 4NHYA 4CCDA 2ZGMA 2KDZA 4DY5A 2DU0A 3AX4A 5E8IA 1FAYA 2GIVA 1IRGA 2M34A 5SV8A 5KC6A 2OCCH 5CFCB 3KFWX 3CLQA 1S2BA 3LSIA 4B44A 5EJZB 2HVSA 4BQ3A 2G19A 4MNUA 3LSRA 3F21A 4XIOA 2FUG2 2ZJRF 2KISA 3RKQA 3APBA 5J8CA 5HCHA 1R4MB 4XYXA 2VQAA 2HKXA 3FF5A 5HS8A 2YV8A 1GOFA 2PG4A 1JTYA 2VNGA 2JA2A 2E51A 3VBRB 1JUHA 4D1QA 2V09A 4DJAA 2DCZA 3SKJE 3AP4A 3THDA 4GMP3 1VQLI 3QLQA 2HWF1 4B3XA 4BL0B 2HJIA 3AYEA 4RB0A 2W1WA 5E6HA 2XAFA 4YVSC 2WA4A 2W0XA 4WVMB 2WNVB 2DT5A 2VZTA 4O9EA 2W68A 3O1OA 5DUIA 3GM8A 2GMMA 2LRPA 5FKNA 4AVCA 2VBYA 5DAQA 1RNLA 4A6SA 4C2MJ 1FPQA 1O59A 4M71A 1HB1A 4FXGB 2FCUA 5ANNA 1QU3A 2OS2A 4CPBA 4QPOA 3I2GA 3DPRA 3H35A 3JW4A 2RS51 3E7LA 2VASA 1XJAA 2Q2EA 2FOKA 5BPDA 3PUFA 3CF6E 1JZ7A 3ZN5A 2X6OA 2JE9A 1H8AC 1C57A 2R071 4BHBA 1KYWA 3WG2A 3OGVA 1DG6A 2OQGA 3AB0A 3H36A 5A7PA 2IXJA 2BVBA 1HDKA 1OHFA 4Q4V1 4LOSA 2VN2A 4MADA 2RVAA 3OV8A 2VL8A 1VTNC 1V9U2 4NHMA 3RZOJ 1CD3G 1ZRIA 1XMXA 1IUYA 1PDNC 1EY2A 2ZABA 3GXOA 4LOTA 2NMOA 4UWDA 5FGMA 3CDLA 2GC0A 3UKVA 2WQZC 3WW4A 3SZGA 3G6EI 4DRVA 2D1VA 3FE5A 3W5NA 5FKKA 2G9GA 3GGLA 4XUPA 1BI2A 2FDJA 1BK1A 3NAPC 1WUVA 3HPHA 3ZQQA 3J7YJ 2Q0OA 5LRSA 1W9YA 4OVEA 3EUHC 4ZU5A 5IYDJ 1SFOJ 4ITCA 2R0HA 4LTAA 1M4WA 4Q0UA 2EV0A 1VBE1 4YZ4A 4CDWB 4XOPA 2LDUA 2ZX4A 1SMTA 1LNSA 4DYRA 2PHUA 1RUC1 2WABA 3IDEA 4UB6C 4Q26A 1E5HA 3FUQA 2EIJH 2XUBA 5FYZA 3T2TA 4GFBA 4XKWA 5E79C 3CCJI 1MMAA 5M3MJ 1Y9MA 4AG4A 4W6WA 2DW4A 4JAAA 4EV0A 3VD7A 1XNDA 3VBFB 2DTRA 3SCHA 3WQ7A 5BOXA 2EFQA 4DFSA 5FPZA 1TME2 3JQXA 1PIV3 3J8F1 4M3CF 3POWA 4R79A 3KQRA 2VM9A 5C44J 4G6DA 4CDXC 3WE3A 5E3OA 2CDPA 1TMF1 4DZGA 4OAZA 4B4CA 2ZSHB 1VBB3 5AFBA 1PM4A 5LGTA 3VKMA 1BYHA 4B7EA 2JG9B 5JLWA 1SAUA 1XC6A 5EP9A 4GO1A 1O7LA 4WXHA 2R0QC 3ZSLA 2DLLA 5JLXA 3C7OA 4I3GA 2XAGA 3QRFF 2M5WA 1WH7A 4XBQA 4COVA 3ZN6A 1WD4A 3ZPLA 1K6YA 2A73B 4BUPA 1CF7A 5FMOS 1QJU2 3ABUA 1JHNA 2VL4A 5E1ZB 1KGSA 4RS5C 4BQ4A 2Y64A 3O12A 3CLPA 3Q8BA 1S72I 1MH3A 1C1LA 2BXYA 2RR11 5FREA 2RNGA 1T0FA 2VZSA 3SEQA 2ZJQF 3UV9A 3TO9A 3AVRA 1K6OA 2JPCA 4S0HB 5FKCA 4NO4A 3C2UA 5FZEA 3X29B 5E88A 1W2OA 2XXZA 2M4GA 1VQ9I 2HWE2 1GV9A 3F8FA 2DODA 5FCCA 4EN0A 3TAYA 2RE9A 3LSMA 4XMAA 3IMMA 3TN91 4LB5A 1GFF2 3ZIWA 3B5LB 4XDPA 1GUUA 4UW3A 3OYWA 3I59A 5GAHJ 5KVRA 1H88C 4AU7A 2EZHA 2DVDA 2Y6KA 4ZYDA 1QJFA 3U1KA 4XFBA 3MGUA 5C71A 4PDWB 3EYPA 2R7DA 1J9IA 4LBQA 1VMHA 4KBZA 2HWB1 1MKMA 2R1DA 4ESJA 5B1AH 1CX4A 1HXS2 5A3WA 3POYA 5KCMA 5JHFA 4HXCA 1UZVA 5I8SA 3B02A 2DA2A 4BQWA 3ZN4A 1S0BA 2ME6A 2LY1A 3SQNA 1OQYA 4X6AJ 4QD2A 2P37A 4BZ4A 2XGEA 3I3QA 4XJ8A 2VCBA 4J1XA 3SITA 2ZBJA 4XLPF 4PGHA 4AHZA 5A7QA 2UWBA 4GYIA 4AM3A 2RJLA 1VAMA 5JVGF 1SD6A 1V5GA 4AVPA 3LB9A 1XCBA 4EROA 1ZBE1 3W9AA 3FFZA 1HXS1 4JQRA 1DBNA 1EAH3 2Q5TA 4RAGA 3WT3A 3H5AA 1AKHB 3MW3A 2HYJA 2ZACA 1G2HA 2ZGRA 1OQEA 1AU7A 4NPLA 1ZRCA 5DD8A 1B09A 3HZJA 2O8QA 5BYNA 5A7WB 2DCJA 1B1BA 4ZH4F 1LU2A 4N7UA 1RUD2 4KMUX 3VDBA 2F5DA 9ANTA 4P9JA 2VBZA 1DQ6A 3WLUA 1XNAA 1DZQA 3ILFA 2KKOA 1H6X