5F1RA

The transcriptional regulator prfa from listeria monocytogenes in complex with a ring-fused 2-pyridone (c10)
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
236
structure length
229
Chain Sequence
NAQAEEFKKYLETNGIKPKQFHKKELIFNQWDPQEYCIFLYDGITKLTSISENGTIMNLQYYKGAFVIMSGFIDTETSVGYYNLEVISEQATAYVIKINELKELLSKNLTHFFYVFQTLQKQVSYSLAKFNDFSINGKLGSICGQLLILTYVYGKETPDGIKITLDNLTMQELGSSAVSRIISKLKQEKVIVYKNSCFYVQNLDYLKRYAPKLDEWFYLACPATWGKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Attenuating Listeria monocytogenes Virulence by Targeting the Regulatory Protein PrfA.
pubmed doi rcsb
source organism Listeria monocytogenes serovar 1/2a (strain atcc baa-679 / egd-e)
molecule tags Dna binding protein
molecule keywords Listeriolysin regulatory protein
total genus 74
structure length 229
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5f1rA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5f1rA01
4YNIA 3QPHA 1LQ1A 2V1XA 5FO5A 1R00A 2Z99A 1K78A 3HTSB 2X0LA 1W7PA 1DPUA 1ZRFA 4HF2A 2D93A 5CVRA 1OMIA 4LTAA 5K8SA 3MWMA 3QRFF 3IRRA 1TQIA 4MGYE 4EM1A 1DUXC 4Q0UA 2VBZA 3J80K 2M8EA 3LA2A 3IWFA 1RUOA 5ICCA 5ILSA 4GYGA 4J1XA 4KL1A 5TRDA 5J7MA 2P8TA 1BJAA 3WGHA 2ZMEB 4ON0A 4HDUA 1J58A 1D5VA 1U5TB 1ZG1A 4G9YA 4UBGA 5JVTA 2EA7A 2UZKA 1TNTA 5BV6A 2VT2A 3C18A 2EFWA 5FLXK 3EYIA 2PMUA 1S7AA 1B4AA 1S3JA 1PP8F 2MC3A 4A0YA 3H9AA 3BJAA 3KP5A 3ZMSA 3I53A 1C0WA 2EK5A 2KIMA 1KU2A 3RKYA 1U5TC 4HLTA 1X8EA 1FX7A 4EV0A 3TOAA 4HQEA 5D1IA 3P9CA 3WTVC 4YRDA 2OBPA 3M8FA 1BBYA 1OR7A 2EV5A 4IHSA 5JHUA 2P17A 5FFXA 1F9NA 1D3YA 5CU1A 5JI6A 1KGSA 1IPKA 4X6RB 2ZFWA 1ZARA 4EGZA 4X6QB 2RVCA 3FHZA 4WF2A 1BC7C 2RKHA 3CTAA 5E1ZB 5HDNA 3JTGA 2DPUA 4RGRA 4OIRF 2QDRA 2IC1A 2COMA 2VONA 3SHFA 4O9GA 3LA7A 4ZYEA 3O2PE 5FGMA 1SQ4A 3I59B 4ONUA 5I93A 3F23A 1QXJA 3FMQA 4UHTA 3N97A 4IESA 3E5UA 1KU7A 5I8SA 1EH6A 3SQNA 4A12A 4ZH4F 4G7HF 4PIXA 5ICEA 1XCBA 2NNYA 5I8TA 3F8MA 1IXRC 3F8FA 1TQPA 3EQEA 1KQ9A 4BHPA 1CF7A 4M74A 3EETA 4WVZA 5A2QK 3GVAA 4EWAA 4R8HA 3G7DA 2UYAA 3J80Z 1WGPA 4KN4X 2VECA 4XFCA 3WGGA 4JV4A 1K78B 1ZYRF 1ZZ7A 2H0VA 1K7AA 3E6CC 2PG4A 1W7PB 1XMKA 2FQPA 3C3VA 5F6FA 4EM2A 1TQMA 4D7TA 2QNKA 3E6BA 3CL1A 2A69F 1I6XA 1J0RA 3TKYA 1FYKA 4MX3A 1BI1A 3DXJF 4ZZLA 4Q47A 4HVRA 2QQBA 2DBBA 3GO5A 4MZUA 4AQ2A 2AXLA 5I0RA 2MLKA 2EFNA 3W6KB 4GGGA 2BNMA 2HKOA 1B59A 2FOKA 2YR2A 4BHBA 2PN6A 3LWCA 5E1RA 4L9JA 2PEXA 2ACJA 2EV6A 1ZLKA 1S8NA 1XCVA 3AAFA 1ZH5A 2MD5A 2ZNZA 1CAUA 2Q1ZB 1R58A 3Q9VA 1YS6A 2GC1A 1JUHA 4XLNF 2F5FA 3CO7C 1NZCA 3KMHA 4E2SA 2W85A 1IUYA 4UV8A 2IXHA 2IA2A 2I45A 4EWDA 1KU3A 2VE8A 5C8WA 3RKWA 4OOIA 3WTWC 4MTEA 4WXCA 1R36A 3KGLA 2O0YA 3WG9A 3GEZA 4ESJA 3H3UA 1ZG5A 3TGNA 4RS8A 3ZMDA 4OIQF 1GQGA 3HQXA 3GUDA 3M8EA 1SD7A 3BALA 2F2EA 3I59A 4HSLA 1IXCA 3M3IA 4HLXA 2XL7A 1H9GA 2CQKA 3HRMA 2D40A 3I58A 1YFWA 5EZWA 2M1BA 4EM0B 3BPZA 2WWYA 1LNWA 3ZMVA 4HOBA 3JAMZ 4Q5SF 4EJVA 2Q0OA 2ESNA 1ON2A 2P6TA 2M5WA 4IETA 3QAHA 5LGUA 2Q0AA 3J7AO 4IXAA 1P4XA 3PVBB 2K4JA 2ZKLA 3KZZA 4YFXF 2EAAA 1OYIA 1YFUA 1ZN2A 4JK1X 1IXSB 1R5GA 4OMZA 3VODA 1CX4A 5FQ0B 4MV2A 5JCTA 2F5DA 5FPXA 4BIFA 2EFPA 3HSEA 4HF0A 5LRSA 4QGLA 3KCCA 4IJAA 4L2NA 5J8FA 1I1GA 1RGSA 1XB4A 3GFMA 4I3PA 4XFAA 3HSFA 3I64A 3H92A 1SAXA 4YSFA 4FHTA 3EUHA 3FF5A 1U3EM 2Q4SA 2PAMA 2Q8KA 1R23A 4BNCA 4LD5A 2HYGD 4LK1F 1YFXA 1MJAA 1U78A 1FSHA 5CVUA 5FLXZ 4EQQA 3C7JA 3ZN0A 2B0LA 5L3DA 3DFGA 1FYLA 1PM7A 3ETQA 1IN4A 4Q0SA 1RC6A 4XF0A 3HT2A 5DCFA 1OD5A 4IEXA 3SFZA 3R0AA 2Z9OA 1BC8C 4G7ZF 4JTOA 2EA2A 2K4BA 2R3SA 3T8TA 4ENMA 4L0YB 1HXDA 2IA1A 2QCSB 5F1RA 4XFFA 1IW7F 1F4KA 1QO0D 4OINF 1YO5C 2DK8A 2HQNA 2FMYA 2QZ8A 1XN7A 4HV5A 1YFHA 4LUMA 3DKWA 1XGSA 2MA3A 2P4WA 1ZX5A 2DU9A 3HOSA 3TDUC 4ZYGA 1V4RA 5LRRA 2GU9A 2D1VA 2IVMA 4ETSA 5HS7A 1HSTA 1SD5A 1U5TA 4A5NA 4UVCA 3EBRA 2HFHA 5D5UB 4LGWA 5BXXA 1O57A 1B9NA 2AS5F 2PJPA 4MNUA 2QBYA 3NW4A 3LQQA 5L3GA 5LHGA 4DINB 4LULA 3BY6A 4QM9A 3NL1A 3L09A 2KIUA 4P9UA 3GF2A 3CLOA 1Z7UA 4Z82A 4I01A 3M70A 4GO1A 1QY4A 5DCMB 2XLFA 3F22A 2K27A 1SMTA 3CEWA 5E20A 3BWGA 1HSJA 2JTVA 2GWRA 2CFXA 5HOOA 3E6DA 1J7KA 2WFPA 3HHGA 1J59A 1IN6A 4P9FA 2D5HA 5JSRA 5HLGA 2HEOA 5K5OA 4MGRA 4U88A 3ABUA 4Z07A 2V1DA 1WSUA 4MQVA 2Q30A 4QLCU 4U0WA 2ISZA 4OMYA 4UXAA 2FEZA 3ZDSA 1Y3TA 5JSPA 1ZZ9A 4HV6A 4RAZA 3ZP5A 1CAVB 4CICA 2XAGA 2A6EF 3DV8A 3ISPA 1RNLA 1R1TA 1KA8A 2GZWA 3LWFA 1UCRA 2F5CA 3F8BA 4Q0VA 3SCFA 1J2XA 5J3UA 3UKTA 4Q0QA 4WBBA 2HOEA 1JXSA 4LFUA 4Y15A 4HMZA 5HI0A 2ISYA 3N4MA 1XSDA 3P9IA 1G3SA 2LF8A 3L9FA 2D1HA 1YQAA 3TO9A 4H0EA 1J9IA 4PIYA 3KZYA 3DN7A 5DD4A 5FQ0A 6PAXA 3W6JB 2XHKA 2FU4A 5T3NA 1VJ2A 1FNNA 2MH2A 5KHKA 4CO8A 2R7DA 2JT1A 3M7GA 3WTUC 3C3WA 4DNCA 3PLQA 1USSA 3KP4A 1YIOA 1W5SA 2IXJA 4HBNA 1TW3A 4HX8A 5DD8A 1XE8A 3BDDA 3LA3A 3DF8A 3OGJA 2BBYA 3RPUA 3SCHA 5D6FA 3KLNA 3MYXA 3QOPA 3FZVA 5LEJA 2LNBA 4HF1A 2O3FA 1GVJA 3LAPA 1OPCA 4OU0A 3WE3A 3KP6A 2FMLA 3FXRA 1STZA 1LEAA 4EJOA 2D45A 5A2QZ 1ZRDA 1O5LA 4AIJA 4LB6B 2A6HF 1R5HA 2OA4A 2XV4S 3J81Z 4I09A 3F6VA 1UIJA 2MNGA 4NB5A 1OYWA 4ESBA 2HS5A 1UCXA 3FMSA 3KLOA 2FQ3A 3ELKA 2O6GE 1RL3A 4LLGF 2H09A 4GCVA 2YX4A 2M87A 2KIFA 1YTYA 3CO6C 1FPQA 3BOQA 5IT9Z 3JTHA 2P5KA 3FFQA 4AVBA 3BROA 3M9AA 1FOKA 3F8NA 3ST7A 2RNJA 2CG4A 2O8QA 1PMIA 4EWEA 1BOAA 2P5VA 1Y0UA 5DCMA 1ZGAA 4FAGA 4I02A 2QQAA 3WU1B 5FPZA 3G3ZA 2ESHA 2ADUA 3WTZA 4CZZA 2VC0A 4CHUA 3LAJA 1F5TA 3MCZA 3ERED 3FE5A 2HKXA 2DTRA 2QWWA 5BS6A 4HVOA 3S7IA 2HTJA 3WTSC 3DP7A 3GBFA 4KUMA 3GWZA 3FX3A 4AWXB 2DCTA 2Y75A 3RNSA 4EJTA 4R52A 4QGNA 5I8YA 5LGNA 1FC3A 3U2RA 5E8IA 5D5XB 1HW1A 1XDSA 4MH0E 3L00A 1TBXA 2LSOA 4LEJA 4HN1A 1Z9CA 1ON1A 1FWZA 1OYYA 2VPVA 5LLQA 3GXOA 1SD6A 3MZHA 1DZRA 2XROA 2PBIA 4GXOA 4I0BA 4YFNF 4XFBA 2IA0A 2B9UA 4TV7A 3QP5A 4MQ9F 1FZPB 2VOOA 1NXMA 4KIFA 3R61A 1OKRA 5HLHA 4D0PA 2PAEA 1UIKA 2E7WA 3HUGA 3R4KA 4KNYA 3EYYA 2WV0A 2GC2A 3PQJA 5HVQC 1DZTA 4M9SA 4UV9A 2DAOA 1CGPA 1L0OC 3USSA 1FBUA 2FNAA 1PP7U 1TNSA 1NYWA 1XMAA 2ZKZA 5H20A 3VHRA 3V8KA 1AWCA 4LJZF 4ZYDA 4PGGA 3H7YA 2VN2A 3PFIA 1RIOH 4LLNA 1EPZA 4ORFA 3FJSA 2FSWA 5IT3A 4WXDA 3JSPA 2G7UA 4Q0PA 3QP6A 1Q1HA 2GXBA 4LK0F 1U12A 3GYDA 3WW1A 3EHKA 2O8XA 5J8CA 3SMHA 3CUOA 4QM8A 2XAJA 3JSOA 4EMSA 5FLHA 3ULQB 3S0MA 1TLHB 2V6CA 1G3TA 4YFKF 3BJ6A 4B8XA 1H0MA 3SXWA 1LDDA 2QVOA 5I0TA 3MAJA 2P5LC 2H6BA 1EH7A 3IDCB 1BIBA 1P6RA 3HT1A 3LFKA 4MGIE 1DGRA 2O1QA 4L5IA 2Y0MA 1LVAA 3DL3A 4QX5A 3H3ZA 1I1SA 1O3SA 2C0ZA 3S7EA 5FCCA 2PFBA 4A5MA 3HIFA 2XVCA 3ZQ7A 3KFWX 1P4AA 1DP7P 4UBHA 2PQ8A 1BI0A 1WWXA 1WLTA 4WCGA 5DEQA 2NYXA 4U7DA 4ENKA 1XD7A 2ETHA 4MEXF 2VODA 5I0SA 4IEOA 5E17F 2DPDA 2UXXA 2QVSB 2W25A 2OD5A 3EQLF 4HX7A 4PGHA 4AIKA 5DYMA 3T8RA 3H1YA 1USTA 1EY2A 4YIIA 4UVAA 4YARA 1LEBA 2DFIA 4HQMA 3OOPA 2GC0A 5E16A 3ZPLA 3G73A 2IXCA 4I2OA 5ICFA 3L7WA 4IRIA 5JR7B 3U9GA 3HRTA 2Z69A 1Z91A 1J3RA 3KEQA 4L5JA 4PZJA 1ZAOA 1NE6A 2CGPA 3QU3A 2F4PA 3IWZA 1OI6A 1G4DA 3F6OA 3O14A 1BN5A 5FD6A 3CUQB 4RGSA 4G6DA 1T0FA 4I98B 3NSTA 2FBKA 4IPAA 2KXLA 3COAC 3DQVC 1ZHFA 3RKXA 1KQ0A 2J5PA 4UNOA 3IRQA 4LLOA 2A61A 4IEPA 3DPLC 1XGOA 3LAGA 1B1BA 1K6OA 2XASA 4RGXA 2FBIA 3K1MA 1Z6TA 2ZXJA 4MTDA 2L01A 4NHJA 2W57A 2PHLA 2NS0A 1J3PA 4F7ZA 4MEYF 1ZVFA 1E17A 3NVCA 3T0YA 2PI0A 3V7RA 1A04A 1O5UA 2FBHA 2LDUA 2IRFG 4WZCA 4YG2F 1MKMA 2FNPA 3ML6A 2KJCA 3BJOA 4IEWA 4KWLA 2E1NA 4META 4TLFA 2K0GA 3VEPA 1R7JA 4PIZA 1GQHA 3GFLA 2D5FA 4IRGA 5DUIA 2OPKA 1YYVA 5IT9K 4XF4A 4LMYA 1P4WA 3GW2A 3CF6E 3B02A 3K1NA 4CXFA 3TO6A 3ZMUA 3R6SA 1IPJA 3RYPA 4ZU5A 1HKTA 4QWQA 3WE2A 5BQTA 5AIQA 4RGUA 2FXAA 5HDKA 2GIVA 3HSRA 4DQ2A 3WTYC 4WK8F 5F64A 5CVJA 1S29A 3B73A 2Z2SB 2W84A 3E97A 1B6AA 2V9VA 4BQAA 1MD0A 2KRFA 2GXGA 3BP8A 5I0UA 3I5UA 2BEOA 3FWEA 4G6QA 4HW0A 1O3TA 3MQ0A 3FZ3A 3J81K 3JAMK 5ILVA 5KHGA 3K2ZA 3SHRA 4P96A 2VC1A 5JR3A 4LG0B 2E9QA 4N9IA 5ERIA 1Q3EA 1FP1D 4O5VA 2N7GA 2XLAA 1QXRA 3RI4A 4M6YA 2EFOA 4AQ6A 2DO7A 4WXHA 3GFIA 4M9XA 4KN7X 1LKNA 1HW5A 5HLIA 3EO6A 3ECOA 2HWVA 3D0SA 3OF1A 1FP2A 3C1DA 1IZ1A 5BPIA 4QMAA 2XUBA 1QZYA 3GZ6A 3L2HA 2EA4A 2OYZA 4PDKA 5D8KB 3ES1A 1XSXA 2P7CB 1Z6RA 2EVXA 2PFWA 1VTNC 4KA4A 2DW4A 2IW5A 4XLPF 3BB6A 2OQGA 2HJIA 1J3QA 3E5QA 3V7CA 5HDGA 4KFCA 2PLYA 4UXNA 3GZ5A 5BY5A 2VE9A 2J5OA 2Y0OA 1FLIA 4NVPA 4IRHA 4K8FA 2M30A 4MHGA 4XEZA 2MPFA 5I91A 2STTA 1EH8A 1IF1A 3ZMZA 1J75A 4XETA 4KWJA 2ZBKA 4KMFA 3V7SA 4XFIA 3P7NA 4FX4A 1X3UA 5E1XA 3HYIA 2BGCA 3BPVA 1UD1A 1X82A 3KSCA 1IN5A 2Z5UA 4P55A 3U1DA 2HYFA 1CAXB 1FT9A 2QYOA 1EYBA 3QPTA 2ZMEA 1SFXA 4WX9A 4GULA 4G94A 5CVVA 4B29A 1H1MA 5JAXA 1ZZBA 4JTNA 3KP2A 1WRJA 1DGWA 2OZ6A 3OCPA 4XFHA 3P9KA 3JZVA 3H50A 3KP7A 1VP6A 2CAVA 2XIGA 1FYMA 1ZZ8A 1G3WA 2EV0A 4HSJA 2R7FA 3WW3A 5AONA 2OA2A 4N0BA 4A0XA 3VFZA 5BPDA 4NQWA 2IXKA 1CAXA 2XL9A 1R1UA 3HRUA 3RPQA 1SEFA 3CDHA 1Q5OA 2CO5A 1ZLJA 2QQ9A 4R1HA 1W5TA 2STWA 1AOYA 2BNNA 4BAYA 1WI9A 4G7OF 2VBXA 2E7XA 2EFQA 1W7PD 2XAFA 3I4PA 1XGMA 4RB3C 5EFUA 3RYKA 3LSTA 4IERA 3RIRA 1JGSA 1IRFA 1L3LA 1XRUA 5EEGA 5AIPA 2OQRA 4QXKA 3F8CA 2L4MA 5TJJA 2FRHA 2FE3A 3RYRA 3ES4A 3ELNA 3TOBA 1WA4A 1D8JA 1LDKB 2Y48A 4OIPF 2X4HA 3NQOA 3D0JA 4FX0A 3R0JA 2XKPA 4XFGA 3MEXA 4RB1A 3BZ6A 2OZJA 1O4TA 3TO7A 5LHHA 3MFKA 4KU8A 3VOEA 2KKOA 3PQKA 1Z05A 1X8MA 1LDJA 3EDPA 3ZN1A 2IJLA 1IRGA 5ICGA 2QJVA 3H1MA 4XF1A 4EROA 5FD5A 4WWCA 4JQFA 2G9WA 5CLSA 1ZZCA 3I7DA 2V79A 2DQRA 1YFYA 3FHIB 1V70A 3UKVA 2K86A 1H9TA 1Y9QA 4XSZF 4U7BA 2GAUA 1YWKA 3MPBA 2ZJ2A 3K69A 1FSEA 2XRNA 3K0LA 4FT8A 4KIGA 4A6EA 3HHHA 5L3FA 3F21A 3KGZA 4IF4A 3T1BA 4AVAA 2DLLA 2A3SA 5ED4A 2K9ZA 2FA5A 2ET7A 4LUKA 3OTFA 1BM9A 2OU2A 4HLYA 4EJUA 1O3RA 1QWRA 3REOA 4UUVA 4KIBA 4HN0A 2PHDA 5K1YA 1LJ9A 4M6XA 4AVPA 5FDBA 3D5LA 1QPMA 3GFJA 1HW2A 3GLXA 4E70A 3D82A 1PDNC 2KJBA 1X7NA 2YU3A 1MDMA 2M45A 4QGMA 3H8UA 4HBLA 1CAUB 1IN7A 2PMHA 1FBSA 4L11A 3KEOA 4AXOA 1YHFA 1UW8A 3SCGA 4ENNA 3LOIA 1ULYA 1HQCA 4M73A 5K5RA 4H7LA 5BUVA 1ZRRA 5D6EA 4ESFA 2DQLA 5KHHA 2E1CA 3IKTA 1ZZ6A 2K7LA 2VXZA 1YLFA 3EJKA 1WQ2A 5DDGA 4B09A 3WODF 1HKQA 2IXIA 3ACLA 1TTYA 3NKTA 3F3XA 2IP2A 4XBFA 1XSVA 4KYWA 5KHJA 5D5VB 1GXPA 4KICA 5FLJA 1T39A 3V8JA 5D8LB 3WU0A 5JSOA 4ZYHA 3V4GA 1FY7A 3SXYA 5L3EA 4D7SA 4JBAA 4MGKE 4KT5C 2LKPA 2CSOA 2RC4A 3CJXA 2H94A 1FBQA 3U10A 3SZTA 3OD0A 3IBMA 2UY8A 3BPXA 1YS7A 3DPTA 4MUVA 2BYVE 3OV8A 2V1UA 3L2CA 3BU7A 1ODDA 4HZFA 3IHUA 3WW2A 4AIHA 4HYEA 5HS8A 3PNAA 1CF7B 4P5OA 3ROUA 5CVIA 2UWMA 1EV7A 3RTRA 2F5EA 5CJ9A 3SZPA 3IKVA 4LLLA 3KP3A 3RZZA 4LG0A 4BYYA 4KMUX 3R60A 3TQNA 4J1WA 4HX4A 1SD4A 3O3KA 5KHIA 1QZZA 1IAWA 4E2QA 2CV6A 2UXNA 3WTXC 4P9GA 4Y17A 1YW8A 1T6SA 4FBFA 3I0TA 3CLPA 5EEHA 1F1ZA 2VQAA 2A5YB 4Q29A 2FF4A 4EJWA 3IL2A 2ELHA 2MH9A 2BNOA 2GH2A 2BV6A 2RV8A 4YYOA 2XKOA 1NHAA 1H1IA 5L3BA 1UHWA 2L02A 2JSCA 2XAHA 1QGPA 2QLZA 5KVRA 4Q48A 1IN8A 2CWEA 1KYWA 5C6CA 2RN7A 3H1WA 1TQ5A 4L9TA 2NRAC 4IEQA 1W4MA 1QNTA 3FXQA 4M71A 3MDPA 4RD7A 5FB2A 2HR3A 4BH9A 2JRTA 2Z33A 3WTTC 1LR5A 2PYTA 2WTEA 1CAWB 4Z2YA 4I7HA 1T38A 1UFMA 4RB2C 2HDCA 4IEZA 1KU9A 4HVQA 1J1LA 2O61A 1EP0A 5D4RA 2UY9A 3I71A 4RB0A 3QACA 4LA2A 1Q43A 2Z3YA 1R1VA 2TDXA 2GQQA 3V8LA 2HQRA 2WC2A 2A68F 5DUKA 5JFRA 1UPIA 4O9EA 3IC7A 2QENA 4CYDA 2PQQA 4MGZE 2QBYB 2XGXA 3O6BB 3ZMTA 1O7FA 2PAKA 2H27A 1NE4A 2OAZA 1L3JA 1RI7A 2XAQA 3E3VA 4ZU4A 1YW9A 2HZTA 1MDMB 4OLLA 1R22A 3TNQA 3CO2A 3FM5A 5H6QA 2B5HA 4R79A 2EB7A 4A0ZA 5LEKA 3K9TA 2NAZA 4XF9A 5FLIA 1JE8A 3HOTA 4ZZDA 1YG2A 4HDVA 4YIFA 4EVIA 2W24A 4XSXF 1JHHA 4N9HA 3E6MA 5J48A 3ECHA 1YUDA 2IXLA 5E8GA 1G3YA 3UKNA 1I27A 2D2WA 2VBYA 4BXUA 2UYBA 4XF3A 5KK1A 5BOXA 4EGYA 1YLLA 3Q9SA 5H6RA 4L9NA 1UHMA 3CUQC 4A6DA 1WKMA 3NEUA 1Z1DA 2O03A 1RTVA 1UB9A 3MZYA 4HAMA 4CGZA 4GYIA 2VOPA 3FMRA 3U11A 4IEVA 1XDUA 4A2UA 1REPC 1O7LA 2ETEA 1S6LA 5DV5A 1HKSA 2P7VB 4O6JA 3WGIA 1KYZA 5CYVA 2CAUA 1KQ8A 1U6GA 4S04A 1CAWA 3NRVA 2DI3A 5KBFA 3I54A 2DK5A 2ZCWA 4Y13A 1SFUA 3JW4A 2EJRA 2XLGA 5L3CA 5BMZA 2ET1A 2YX7A 4XRFA 2G7HA 2PTMA 2RQPA 3CJNA 1V3FA 2OZUA 2RDPA 2VT3A 3E5XA 3IDBB 2L54A 4U0VA 1HBXG 5LGTA 4ZU7A 2L4AA 3GX4X 5LBQA 4UVBA 1BIAA 1ZG3A 4ENJA 4HA8A 3NJZA 1LB2A 2VBWA 1XE7A 3U0ZA 4AD9A 5ILUA 4M9ZA 4ASNA 2YPRA 3RDIA 3VB2A 1MZBA 2HTSA 1P92A 2ZO4A 4O3MA 4AVCA 1TW2A 3BCWA 1RUNA 4FAHA 4L9VA 2CYYA 1GXQA 1ONVA 2JPCA 4IVNA 2MBFA 4IEUA 1B9MA 4M72A 3ABTA 2CW0F 5FFZA 2QUFA 1XGNA 1MJBA 3Q5FA 1ZNPA 4LA3A 4L18B 3HTUA 3IIAA 4K2EA 2K02A 1U2WA 4KDPA 4OIOF 4I0AA 4S05A 2A07F 2GC3A 5E1WA 3WW4A 4PJYA 4PCQA 1OFNA 1SMYF 3S2WA 1G6NA 1MJ9A 1FXZA 4G8XA 2LF7A 1RZ4A 3FXUA 3KETA 2H6CA 1SFNA 3KE2A 3GYHX 3HRSA 3TNPB 1BI3A 2DT5A 3LZZA 4L0ZB 2L3DA 1T98A 4U0YA 1D8KA 2IPQX 3DEUA 1ZRCA 1BI2A 2NNNA 2JZYA 4IEYA 4F8AA 1GHCA 1E2XA 5HS9A 2HGCA 1VR3A 5D5WB 2P6SA 5CADA 2MHFA 2GA2A 5K5QA 1YW7A 2ATFA 3TDZC 4LB5A 4KU7A 3LQRA 2RGVA 4E2GA 2BE5F 3M1EA 2V09A 5AVPA 1T2KA 5LHIA 1JHFA 2GA1A 4IHTA 1I5ZA 3FM3A 1LRHA 4BHCA 3F72A 5E18F 1K79A 2Q2EA 3H7JA 4CDGA 1J5YA 1S7OA 2YSRA 5D4SA 2C6YA 2IT0A 3RJPA 3CUQA 1MGTA 2MLGA 1P2FA 3T5XA 2ZNYA 4OFGA 1CAVA 1PUEE 1ZGJA 1DPRA 2EWNA 1ZREA 3K1PA 2B8MA 1DDNA 1SFEA 1U8RA 5J6XA 4RAYA 2PA7A 4JVAA 2QM3A 1QBJA 2JPBA 4KWKA 1O3QA 3QU6A 5BPXA 1FI2A 1QQIA 4Q4ZF
chains in the Genus database with same CATH superfamily
1V5EA 3HTSB 3N7KA 4YGBA 1AL22 2D93A 4RFRB 1W6PA 1F15A 5K8SA 3MWMA 2I74A 4NN0A 2XF6A 3IRRA 4N43B 3GTJJ 1UU6A 2FMDA 4Q2FA 1DUXC 1SG3A 4QU1A 5ILSA 5JDBA 4GYGA 1R1A1 3WGHA 2ZMEB 4ON0A 5F3CA 4L92A 1ZG1A 4UBGA 5JVTA 3BTXA 2GIZA 5FKOA 4BMEA 1VQ9I 2Q1MA 3IMMA 4XUNA 3C18A 2PMZN 5FLXK 1B4AA 5J1YA 1TWFJ 4YG0A 4Y20B 3M2MA 1VRBA 4A0YA 2YFZA 4P5HA 1KU2A 5FP8A 1W5CC 3VBRA 1W9WA 5CKTA 1PX3A 4I3GA 1M06G 1KDMA 3TOAA 1H6YA 3B69A 1X4PA 5D1IA 1WCMJ 1ZGWA 4AFBA 3ZXLA 4HKWA 2WSUA 2XSDC 3AL0B 1BW5A 5CU1A 1D1AA 1LOFA 3J26N 4F52A 3LSDA 2BVMA 2DUQA 3AKQA 1ZARA 1AHSA 4X6QB 2RVCA 3FHZA 3C2UA 2R041 1UY2A 4XN3A 1V9U2 5HDNA 3JTGA 3I3DA 2KQRA 1US2A 3ERMA 2QDRA 3N9QA 3AZZA 2GALA 4CVUA 2FDGA 2X6OA 5I93A 3I59B 3F23A 2DJNA 3DCQA 4BWOA 2VCBA 4DGWB 1E3HA 2HWF1 3SQNA 1LOAA 3KHBA 2VXDA 3OJBA 2YDEA 4HPKB 5ICEA 2YZ4A 2G9GA 5CKQA 4C3IJ 1H8AC 1MSEC 2BVLA 2B42B 1OVSA 1S9HA 4BHPA 3LNQA 1CF7A 1IGOA 1ULGA 2F6CA 3BQZA 3TL4X 4M74A 4XLHA 2C1FA 4WVZA 3S15J 2VZPA 3GVAA 4RHV2 2W82A 1J84A 1WMDA 4XMIA 4KN4X 3ZN4A 3IV5A 4RR3A 1R49A 3KZ4C 2XGCA 2H0VA 1ND3A 1B8IA 4XLEA 2M8GX 1W7PB 2WZEA 1XMKA 3C3VA 5F6FA 3FLTA 3BKZA 3M3YJ 1MQTA 4MVTA 1I6XA 1J0RA 2JA8J 4Q47A 2QQBA 2DBBA 4AQ2A 3JUUA 1TC3C 2MLKA 2QQOA 4XOGA 1YI9A 2DVDA 3MD2A 2RAEA 3GTLJ 2FOKA 4XK4A 2PEXA 3DTKA 2DF7A 3AAFA 4DXTA 1CAUA 1ENHA 2Q1ZB 3NV3A 2C9KA 1YS6A 2BJSA 1JUHA 4CDQC 3HVDA 4KWUA 1AR72 4W6WA 3AL0C 2WA3A 2W85A 3W20A 3S17J 2PLV1 4IGQA 2ZGLA 3K4BA 2QF7A 2DOEA 1TVGA 4EWDA 3B94A 2FX0A 1DDLA 4XLCA 3G1MA 3RKWA 1AYN1 1HKDA 1RUF2 2F6BA 3WTWC 3B9IA 3S30A 2W4SA 2R30A 1Z21A 3OBTA 3O12A 1QJX3 4GB31 1GMMA 1Z7LA 4XCAA 1T33A 4YZ5A 2A6WA 2IFWA 5EXOA 4OIQF 3LDRA 4XURA 1GQGA 3GUDA 1E3PA 3RVHA 3S14J 3BALA 5LBFA 5FIXA 3I55I 1A6CA 3T09A 5J09A 4XORA 2CQKA 1PNFA 2D40A 2DU0A 2R061 3G6EI 5EZWA 2M1BA 3AZYA 4FTBA 3ZMVA 3PUHA 2WAEA 1T0FC 3FXMA 5AC92 1ON2A 1JTZX 4ATEA 4IETA 3OYEA 4A3KJ 1W36C 2IBDA 3FUOA 2E32A 2K4JA 1COV3 2Z16A 3KZZA 1YFUA 1ZN2A 4JK1X 2QA4I 1ETKA 3VODA 3IKWA 5F2SA 5GJ6A 4MV2A 3VHOA 2BPA2 1EAH1 2COBA 4E8CA 3HSEA 1YXWA 1YRNB 3SYTA 3IT8A 3N7LA 5J8FA 3GFMA 4XFAA 5FMOL 3I64A 3HNBM 2R7OA 2A3WA 5B66C 1SAXA 2WO3A 3GZTB 4FHTA 1A3KA 3JB4C 5H9QA 2JE9A 3PUAA 1R23A 1F5JA 4LD5A 1UOGA 2HYGD 4LK1F 4Q4Y2 5CVUA 3C7JA 3MUY1 2B0LA 5L3DA 1FYLA 1PM7A 3ETQA 4DS0A 4LMFA 3ZVXA 4BE0A 4XF0A 3HT2A 2EZKA 2Z9OA 1JZ4A 1H8VA 1D7PM 4JTOA 3POJA 4NIHA 2K4BA 2ZHMA 4QAWA 2F17A 2R3SA 2OXBA 5FROA 5DDJ2 1JZ3A 4XFFA 1MQTB 1F4KA 4UF0A 1QO0D 3QWLA 2NN8A 4OINF 1KONA 1ULPA 1YFHA 3ZO0B 3JCIA 2P4WA 2WYSA 1GLHA 3P1IA 2L0KA 3HOSA 3MIDA 3FBIB 2DUOA 5DPNA 1U0JA 5GPAA 1F4HA 5IFTA 1WJCA 5HS7A 1HSTA 1U5TA 3PUQA 1LVKA 2HFHA 2ZABA 1MH3A 1EJ9A 5A7WA 2R93J 5GLTA 2QBYA 1IOAA 4GJZA 3LQQA 5C9AC 1YIPA 4Y1VA 1RUJ2 4XBLA 5EP9A 1JKOC 4LULA 3AKRA 1TWCJ 1RKTA 4QM9A 4DYRA 3S2DJ 2E63A 4PDWB 3HGYA 2W9XA 1POV3 3POWA 3KZIC 4GO1A 1XNCA 1CPMA 1PYVA 2XLFA 3F22A 1UAIA 1OT5A 1NQJA 3CMMA 4AEKA 5E20A 3BWGA 3L2WA 1HSJA 3NNJA 1WCKA 3OOUA 2CFXA 3Q8FA 4C2UA 2WABA 1W05A 5F0CA 5HLGA 1ZRIA 3U75A 3BIEA 4MGRA 5A1FA 4U88A 4CCNA 3RQIA 2WZPP 2JDKA 3Q0WA 4U0WA 1DU0A 1COV1 1DQ5A 4Q4V3 3HZJA 1FPN1 4OHYA 5JSPA 2WWJA 1ITYA 1UHSA 3CBNA 1FV3A 3BR5A 4AF9A 1VIWB 1RNLA 1BBT3 1MW7A 4TLGA 1JN2P 3LWFA 5D21A 3J7NA 4Y33A 4ZS2A 4AK3A 3DXUA 2F5CA 3F8BA 3OUIA 4HNUA 3O1SA 2OCEA 3SCFA 2LR8A 2HNHA 3CJIA 1SMVA 2Y31A 1NLSA 2D43A 4BLIA 3PTYA 2CUEA 2D1HA 3TO9A 1Z77A 2DA1A 4NC8A 1MBKA 6PAXA 4GDFA 2FU4A 5T3NA 3H3VK 1PZ7A 1U5IA 3RRDA 3IAM2 3C3WA 1MMDA 2VTFA 2FDIA 2XRLA 3ZFEC 1YIOA 4HX8A 2DA7A 4AI2A 3OYIA 4KH9A 1XE8A 2RDNA 3NKGA 3OBZA 1CIWA 1U9NA 3LA3A 3M1HA 4XKWA 2DFHA 3ILNA 3CJTB 3DWLE 2IFRA 4COVA 4AI8A 3KLNA 3VSLA 5DUVA 2HQAA 4QPIA 1NH3A 3QOPA 3RZOJ 1NOVA 4RS5A 1MMAA 2WIIB 1VQ7I 5M0TA 2HWB2 2O3FA 1HJGA 4U2AA 4AEDC 4FASD 3U07A 4A42A 3LAPA 1OPCA 2VBBA 2JUCA 1LEAA 1SEUA 2D45A 5A2QZ 5FPLA 2CV1A 1O5LA 4LB6B 4A3CJ 1R5HA 4AAXA 2ECCA 4BACA 2XV4S 3J81Z 3QH6A 2VAUA 4P08A 3K75B 3HBZA 3CC7I 4XJAA 1OYWA 2A70A 1XYOA 2PLV2 3DTIA 2HOAA 2HS5A 3C7FA 1SANA 2O6GE 3QYEA 1JYXA 1N1TA 1JYVA 4GCVA 3VB9A 2M87A 2KIFA 5ANNA 1N75A 1YTYA 4BK4A 2W1QA 5C9AA 3FN9A 4XICA 3ACHA 3LGRA 4HPQA 5F3IA 2KRCA 2D3SA 5FMDA 3BOQA 3HNMA 1VMHA 1W0OA 4PJMA 2Y0SN 3FFQA 1FOKA 4YG6A 2RNJA 2CG4A 2O8QA 4CDUC 5FRMA 5F39A 5ABJA 3GLLA 1QHHD 4I02A 2VW2A 5GLVA 1LE8A 2ADUA 4CHUA 3LAJA 5DDJ3 1HV1A 2ME0A 3ERED 3JU9A 1G7YA 2DTRA 5BS6A 2RG4A 3S7IA 4AWDA 3OD4A 4JKMA 2CY6A 2QKLB 1OPMA 4LO4B 5I8YA 5LGNA 4MH0E 1HW1A 1TBXA 3FHAA 4BKXA 1DGWY 5KXEA 2R7ZJ 1ON1A 2DFCA 3BTZA 1EAH2 3TN92 4FE7A 1DZRA 3PURA 4CCCA 2XROA 4RDUA 4I0BA 3CNAA 2AHQA 1V5GA 2IA0A 1VZ0A 2G1MA 2VOOA 1NXMA 1YJ9I 4W97A 2FD8A 2VVEA 3R61A 1OKRA 1LEMA 3FXJA 2ZAAA 4AFMA 2HVQA 4FETA 2E7WA 1LHUA 5HVQC 3HOUJ 3V56A 2QQPA 1YX3A 4UV9A 2DAOA 4DZPA 4AEMA 1CGPA 1L0OC 4NC7A 1NYWA 4CXWA 3LSGA 1XPWA 3VHRA 2NYYA 1AWCA 4AQTA 4XILA 2DWRA 1JGGA 2VQHA 1APNA 4LLNA 3M4FA 5CQGA 5C4WA 3HPNA 5IT3A 3JSPA 4IW3A 3QP6A 4ZDOA 1R1A2 4NPLA 4JGZC 3GYDA 3PM1A 2EIJH 2O8XA 3DEWA 1BXHA 4CEYB 5C5UA 5JXGA 4LKFA 3AP7A 4EMSA 1D0YA 5FLHA 3KQRA 3K48A 5FYTA 1G3TA 4K1ZA 1SACA 4B8XA 3OG2A 2Y26A 2ZMLA 1AU7A 1GUIA 4Z2AA 5I0TA 3LPFA 3R0RA 2JUGA 1BZWA 3MAJA 2H6BA 1EH7A 1BIBA 2VMHA 3LFKA 3WNMA 1MPXA 2O1QA 3VV1A 3CF2A 2Y9YA 3DL3A 1RUI3 3JRBA 1I1SA 4PT6A 1BVVA 5FCCA 1VB2A 4EN0A 3L2VA 3S2HJ 1UY4A 1MS0A 3K10A 4E7JA 4GIQA 2PQ8A 1ZR4A 3VL8A 1BI0A 2GNTA 2XSJC 5IATA 3GZUC 4C90A 1RINA 2PN5A 4ENKA 4B3NA 2ETHA 2VODA 5JIUA 4F55A 4YM2A 2Y6JA 1XNBA 3NV2A 2OD5A 2HWE2 4AIKA 3WP6A 3H1YA 1EY2A 3ZSJA 3I2OA 4UVAA 4B8EA 2DJIA 2GC0A 4A93J 4K3UA 1DYOA 4FPEA 4B44A 1TME1 5GZCA 5ICFA 3ZFFC 1FAYA 2LALA 1AL23 2O8KA 2RDRA 4LOSA 4ASMB 3WLUA 1J3RA 2PXJA 1FTZA 2CGPA 4D7NA 4NWVA 4FO9A 2BOLA 1W0PA 3O1OA 1P9QC 5A3UA 4XXPA 1JUPA 1JHNA 3DQVC 1H2MA 1KQ0A 2J5PA 4LLOA 1W04A 1XGOA 3MKWB 1B1BA 1ODNA 1VBE2 5KXBA 3CDZB 3K1MA 4A44A 2RS51 2PHLA 3GTMJ 4A3ZA 5FP7A 1ZVFA 4IHXA 1BEV3 3L2RA 2WBKA 4AVTA 4M00A 4WZCA 4YG2F 2FNPA 4IO9F 4C1WA 3BJOA 4TLFA 5A3PA 1DP0A 3AJYA 2WN2A 5F04A 4PIZA 5J36A 1B35C 2DMPA 4EQVA 4IRGA 5DUIA 4DB5A 2OPKA 2F48A 1YYVA 1KD7A 3WCSA 3T1LA 3WQ0A 1P4WA 3CF6E 2CMPA 1FMVA 4JP0A 4AC0A 3G4SI 1W8NA 5F1JA 1MZEA 2FXAA 2LD5A 3FISA 4PHZA 1GFF2 2ID4A 5KXCA 3B73A 2W84A 1VBB2 1Q8OA 3K4ZA 1HF0A 4Y3OA 4BQAA 2VMFA 3BP8A 3I5UA 1EPWA 4CDQA 1O3TA 3MQ0A 3JAMK 1PZ9A 2MEV2 1E5IA 2CW8A 4LG0B 1OA3A 1A36A 2HWF3 2LTNA 1Q3EA 2LMDA 4BEHB 3DGTA 2XLAA 3HOZJ 5JLXA 4IDZA 4AQ6A 1PM4A 1W0UA 4Q8KA 4NOTA 1LKNA 1STMA 1HW5A 3KF3A 3ECOA 3OF1A 3D0SA 3KEYA 1FP2A 3C1DA 5FZAA 3MIBA 4FI9A 2VQTA 2YROA 4AI3A 1WH5A 4QMAA 3GZ6A 2OYZA 1RITA 4PDKA 4Q5OA 2EZHA 1XSXA 3DEEA 1Z6RA 1R083 3NJVA 3LOBA 5K7HA 4DPNA 3ZFGC 3VD9A 2HOSA 2HJIA 1UPSA 2PLYA 2GP5A 3ZRGA 4HG2A 2I2SA 5BY5A 2VE9A 4IRHA 3MKZA 1ZQ3P 2JVGA 3L2YA 3MKYB 1AL0G 1GUUA 2STTA 1EH8A 1PGSA 5E6HA 1JT6A 3ZMZA 1IF1A 3M4OJ 1UMHA 3K2AA 1VRH2 3HYIA 3U14A 2RM23 2NVUB 2OPWA 1A31A 4A3FJ 2ZZQA 1W6QB 3JBG1 1LOBA 3WF2A 1CAXB 1FT9A 2UWAA 4QHOA 2VNGA 2ZKNA 5FXZA 5T52A 1SFXA 1PK6A 4U36A 5FYCA 4HG6B 1ZZBA 4JTNA 4PLMA 3WDUA 1WRJA 1DGWX 2EQRA 1TMF1 5A6YA 3LEKA 4XTMA 2NS8A 1VP6A 2CAVA 1ZK8A 3GF6A 2J1RA 2EXHA 5FUPA 1W2NA 1RUJ3 1ETYA 3VZLA 1IG0A 3GCWA 4FTSA 3AP4A 2R7FA 3M7AA 2VCMA 3T4VA 2OJED 1NCQC 2OA2A 1Z3YA 4N0BA 3HJEA 3VFZA 4A0XA 4UW5A 2W0XA 2IXKA 1AR92 4K6BA 3LEGA 2BP6A 1K5MC 1Q5OA 2CO5A 1AOYA 1RR7A 4BAYA 1WI9A 2AQFA 5FPVA 2RS33 2R7VA 2UURA 1U5YA 2XAFA 1OURA 4LT5A 3I4PA 1YQ8A 3ENRA 4A6SA 5GM0A 5GZEA 3SQOA 2V26A 1NQDA 3T0DA 1IRFA 1L3LA 4N8MA 1MEC2 1JI8A 5DQ0A 2L4MA 1A8DA 2FE3A 1O8SA 1WA4A 4XUPA 5CBLA 1D2QA 1Z7S1 4HXCA 3TEDA 2RM22 2PHFA 1WW4A 5TGTA 1D8JA 3ZYFA 4XDPA 4RAFA 1GR3A 3NQOA 3QOEA 3D5RC 5C70A 1T6GC 3V42A 4XIKA 3D0JA 4FX0A 1O4TA 1ZTRA 4NIAA 5IPAA 4LBLA 1POGA 4KU8A 4HSRA 1HCRA 2R0FA 3TB0A 3H42B 4UB6C 2KKOA 3PQKA 1Z05A 5FTTC 1LDJA 3EDPA 1BEV1 2QJVA 5HCBA 2ZA9A 3IN9A 1XQNA 5DZFA 2BW3B 1UKRA 1WBLA 4EROA 2AREA 5FD5A 2YUEA 1I3HA 2G9WA 3I7DA 5CLSA 3Q0VA 2A6VA 3FHIB 3VBFB 2TRTA 1Y9QA 3VBUB 3L1PA 1ENSA 4QPYA 4XSZF 3WHTA 3BU0A 5ANQA 4DXZA 2W94A 4PSWA 3K69A 1FSEA 1AXKA 2M4KA 1RXFA 2LFBA 4DUVA 4KIGA 3HMYA 4P9YA 4NIIA 3F21A 1NLQA 1IG3A 5HNHA 1WZXA 2WSVA 4PLOA 4CA9A 2K9ZA 5F0HA 2ET7A 2C6SA 3RZLA 2XWJB 2OU2A 1AYM2 3P5BA 1MBFA 3SJMA 1QWRA 3CC4I 4UUVA 5B4XA 2AH2A 1BVP1 2RS53 5FDBA 4NNJA 5FFOC 5EJ1B 4CUBA 3GLXA 2WKKA 1WCSA 2KHMA 3D82A 1PDNC 5CFDB 4IQ4A 1X7NA 2DT7B 5LY1A 5C3OA 2M4GA 5FLMJ 4QQ2A 3ZYHA 3L9JT 1CAUB 1IN7A 4B3XA 1CN1A 3KEOA 4TZDA 4AGVA 5B3SH 1CJPA 3GMEA 3SCGA 4M73A 1OCTC 5E3LA 2MD0A 1ZRRA 5D6EA 4BJ6C 2DQLA 1O59A 4YW4A 3IKTA 2VQLA 5F27A 3SKVA 2DT6A 4AHYA 5KC6A 2ZGKA 1TTYA 3OYKA 2VR4A 3K51A 2QKDA 1T39A 4QD2A 1BQPA 3DUIA 3FKJA 5FYHA 4IXLA 3PU3A 5D8LB 1SLBA 2JDHA 5JSOA 4D7SA 4MGKE 4YLZA 3FXOA 2VJ4A 3O8HA 1ND2B 4N53C 4AUXA 5A7NA 2VQ0A 4MUVA 2ORZA 3OV8A 4NPMA 2ECBA 1W2OA 2OW4A 3I2GA 3UJOA 1YQ5A 1I3QJ 3IHUA 4HYEA 1HOMA 1GKBA 1MSFC 5CVIA 2UWMA 5E89A 1WWYA 2F5EA 3SZPA 3KP3A 2OUJA 4H55A 4E2QA 1VQ6I 2VOKA 1YW8A 2HLEA 3BI3A 3TOJA 3H0OA 2FF4A 1C4RA 4IUGA 2ELHA 2MH9A 2BNOA 2GH2A 5EJ3A 2JIGA 1H8TB 2RV8A 4OI4A 2V1NA 3H0GJ 4TXWA 1R1A3 1I9RA 2XAHA 1LHVA 3RJ2X 1IN8A 1KYWA 3JR9A 3ZFEB 4IEQA 1W4MA 3ZXSA 2YY1A 3UGGA 2WS91 2DCEA 5FB2A 2HR3A 4BH9A 4UFKA 1GOGA 2Z33A 2PYTA 4Y1YA 2WTEA 1CAWB 4YWAA 3AFKA 2HWD2 1X19A 1F9KA 1URXA 4RB2C 2GMMA 5LBEA 3CCQI 1KU9A 2O61A 5FZBA 4YVWC 1Z0XA 4IOCF 3FBYA 3JBG2 4XPVA 3MW2A 2Z3YA 1R1VA 4PBOA 2H8WA 2D6MA 2X5IA 3FBNB 1UPIA 1FIAA 2QENA 1IZ3A 2QBYB 3ZDVA 4NHLA 1PIV1 2ELKA 2IWGB 2R7SA 5AFEA 4QQLA 1L3JA 4GH4C 4Y20A 3SLIA 4ZU4A 1MDMB 4ITCA 1R22A 1RUC1 4DXSA 2R062 1K5MA 2EB7A 3THCA 4A0ZA 5LEKA 2D6KA 3K9TA 4Z92B 4QDSA 3WF0A 4XF9A 4YVSC 1NCRB 5FLIA 3HN3A 5A6QA 1ULFA 4C0HA 4JGZA 1ALYA 1YG2A 1DFQA 5LCWL 3LSHA 3I2IA 5FREA 1VE0A 5J48A 4DNYA 4C91A 2YBSA 1YIFA 5BNNC 2B9VA 2D2WA 3SITA 4ZTJA 2LM3A 5F3GA 2VBYA 4GB33 3VBUA 1C3HA 1YLLA 1LU1A 5KHDA 4L9NA 2HWC1 3DPUA 3CUQC 1PZ8A 2K9LA 4CCKA 2IUWA 3I2DA 5HODA 1N78A 1FATA 4CGZA 3BLYA 4GYIA 1RUG3 5AVAA 3U11A 2DDUA 3GTQJ 4A2UA 1REPC 1O7LA 1S6LA 5K0UA 3ZQCA 2P7VB 4O6JA 1V9U1 2JDMA 3O1MA 2CAUA 1DZQA 2VVDA 2ZEYA 5L7OB 4BQ4A 2RS12 1IPSA 1TME2 2DI3A 4C2MJ 3M8JA 3AYEA 1GP4A 4Y13A 1SFUA 3JW4A 5DDJ1 5L3CA 5HPOA 1GP5A 3I3LA 3BTLA 4M3CF 3APBA 2GN3A 1X9PA 3IDBB 2MEV3 4HNVA 1R64A 1KGYA 3VYRB 3OPZA 5JPNB 1D1BA 4OUMA 1BIAA 4XIDA 4OI0A 3WZ1A 4ENJA 1H6XA 4XZUG 4HA8A 3CDIA 1XU2A 1QVTA 1XE7A 4EZ4A 3U0ZA 4M9ZA 2YPRA 1B72A 3R4UA 1U5XA 5IK4A 1QQP3 1MZBA 4XQFA 5DAVA 2R4GA 3UKGA 1TW2A 1M1EB 4QPIB 4FAHA 4L9VA 2CYYA 3UYJA 3ABTA 2KP6A 2DN0A 1ZNPA 3LIHA 4LA3A 4CP9B 3CDLA 3ZR8X 4XHBA 5KWRA 2QZ3A 4UUTA 3IIAA 3ZSKA 1OCZH 2K02A 1WMFA 3KYDB 5T50A 2M3AA 3GCMA 4JCKA 2HYXA 1JTXA 3A02A 3B6AA 1JZ7A 1MNMC 2QQIA 4COZA 3S2WA 5CFCA 1QOTA 4BM8A 1WW5A 4KT6A 3I3QA 2DA6A 3BTCA 4HKLA 3HRSA 1OLQA 1XMXA 1G9BA 4OHVA 1X1AA 2ZOEB 2QQKA 1CWPA 5FZMA 2NNNA 3VSKA 3J4UH 1HQLA 2HGCA 2KFDA 2YUSA 3GTPJ 5B2GB 1WCUA 3AKZA 2ATFA 3VBOC 1G59A 1QJFA 5LFAA 5BNPA 3I3MA 3GJAA 2KDZA 1VBC3 3B7MA 3GGLA 2GA1A 3ILFA 3KV4A 1I5ZA 4R9CA 5DM7F 3H5AA 2P3JA 4P9XA 2DURA 1QHGA 4XE9A 5D4SA 4QDRA 4M0NA 2IT0A 1US3A 4EEFG 1MGTA 1OCCH 2MLGA 3DEMA 4GMP3 3WEZA 2WT2A 2ZNYA 4FQGA 1ZGJA 1DPRA 1GZTA 2B8MA 1RVF3 2D6NA 3DPRA 1KQRA 3CCEI 3I3EA 2X6XA 3ILRA 4KWKA 1I5PA 1O3QA 1QQIA 1LAJA 2V1XA 5FO5A 1R00A 1WCDJ 3ZIXA 5FUIA 2X0LA 1W7PA 2CU5A 1ZRFA 5CVRA 2VZSA 2HWB1 1OMIA 4N7UA 2M7BA 3BN6A 4MGYE 1GVDA 1B72B 3J80K 2M8EA 2R5YB 2XQXA 3IWFA 1RUOA 4GH4A 1GQPA 4BY1J 3B01A 1HQNA 4J1XA 2A3YA 4AU7A 1ZKGA 1HN0A 1Z0HA 5J7MA 5TRDA 2BY1A 4FPLA 2WLQA 4O61A 5ACA1 1UNBA 3AMHA 1U5TB 1W36D 4G9YA 1W6OA 2X5IC 4AR2A 2HI3A 2Y9ZA 4HL0A 5FZ8A 4CU9A 1MACA 1S7AA 5FUNA 1QNWA 5E88A 3RI9A 4DMIA 2D97A 2CQ7A 3H9AA 3BJAA 4QPGA 2KIMA 2GLOA 4EV0A 2VB6A 3GZNB 5IP9J 3WTVC 4YRDA 3CP8A 2OBPA 3M8FA 1V6KA 3V0AA 1WHUA 1OR7A 3LCPA 1Q1VA 2ZZJA 4IV1A 2Z4FA 1YI7A 4CEYA 5M5WJ 2NS7A 1POV1 1RUC2 1FIPA 2HYKA 2VNVA 4RQPC 1WD4A 4L8QA 1C57A 4WF2A 4GMP1 1BC7C 1DCSA 2RKHA 3I49A 3CTAA 1KS5A 2IGKA 2ME6A 1SLAA 2QBXA 4LITA 4RGRA 4C3HJ 3BG6A 2VONA 1GBGA 4A7YA 4R9BA 5E8AA 3LA7A 2R1BA 2ZFUA 5F5QA 2HWD3 1XX5A 5FGMA 4ONUA 3ECQA 3OGVA 2ZGQA 3E5UA 1HXS2 2AZ5A 4E7SA 2X1CA 1G9DA 1QKQA 3NWKA 4G7HF 4KISA 4Q4X3 3KVBA 3VD3A 2NNYA 1SLTA 1TQPA 2DTZA 1KQ9A 2VUMJ 1JBCA 5K4LA 1Y43B 4WV8A 5A2QK 3RZHA 4KG8A 1VRH3 4BIOA 2B45X 4R8HA 4YZ1A 4MXVA 1HLCA 4KMQA 1W6NB 2JD9A 4XFCA 3WGGA 1DQ0A 2ORXA 1K78B 1ZYRF 4Z8BA 1ZZ7A 3NQHA 1K7AA 3VBFA 3LFUA 2PG4A 1BR4A 5FY8A 4OZOA 1W6PB 5FYUA 2QNKA 3E6BA 2GBYA 4QKBA 2EALA 1I39A 2RJ2A 4IV3C 1BI1A 4ZZLA 3OBRA 2ENRA 2CQNA 3GO5A 1V6NA 2W91A 2WZR3 2EFNA 4KQ7A 1QXPA 5C4JJ 1K83J 3H9QA 2B7YA 2BNMA 5FV3A 5FP3A 1VAVA 1ONAA 3AZVA 3QYBA 2R7TA 2VUAA 2PN6A 3LWCA 4BQXA 3RKQA 2O5RA 5E1RA 1IC8A 2ACJA 5FZ9A 5I0DA 4BXXJ 2YHJA 5LBCA 2W47A 1XCVA 4G12A 3FK7A 2LROA 2GC1A 4D94A 4C30A 3LSKA 4XLNF 1NZCA 4I30A 4E2SA 1IUYA 4M3CB 4NQWB 4FXGB 3N36A 2QSFX 2CDPA 1XE0A 1C28A 2AEYA 1Y9GA 3N7MA 4FOVA 5JIAA 3C7EA 4FFIA 3GHMA 4ABZA 5JUVA 1W3VA 2DTYA 2DCKA 1N77A 1H4GA 3CCVI 4O7XA 5CKNA 1R092 1ZG5A 4Y7NJ 3TGNA 4AAPA 2R5ZA 3M8LA 4QT6A 4RS8A 3HQXA 4M3CE 4QIWN 2W68A 4LK7A 2F2EA 1XXNA 3I59A 5HNFA 1UX6A 2W87A 3GZAA 2XL7A 4IHWA 4OAZA 3TW7A 1R082 4WM7C 4OWRB 3BTJA 4EM0B 5GAEJ 1VLNA 3ON7A 1IKPA 1VBA1 1LNWA 2CGOA 2VZVA 4HOBA 5A3OA 3JAMZ 2CL2A 1OUSA 1AYN3 2ESNA 4L0PA 2M5WA 4JHZA 2XH6A 4NHYA 1HA8A 2R043 4LO8A 2JK3A 3BG3A 1TWAJ 1SFOJ 2Y69H 1LE8B 1FMD3 4TSVA 2ZGOA 3ESWB 2VY0A 2EAAA 4FP2A 1OYIA 5FQ0B 5FPXA 4ANJA 4BIFA 2BUKA 2RMU3 5B1AH 2EFPA 3PO2J 4QWNA 2ZHNA 4QGLA 4IJAA 4JQTA 1D4M3 1Q8VA 4I3PA 3K4DA 2P6HA 5IOZA 1RETA 3WD5A 3PDQA 2LUWA 4AYBA 2WQ8A 3NJXA 4YSFA 5T5PA 3EUHA 1Y1WJ 1U3EM 2Q4SA 2Q8KA 5A3TA 3HDDA 5FBZA 3AVSA 1W0TA 1FSHA 2VZOA 1ULDA 5FLXZ 4C9YA 3DFGA 5IP6A 4B48A 1S55A 1I50J 4XRSA 4Q0SA 2WJSA 1AR63 2XF7A 2IEKA 1OD5A 2WINB 2WS92 2GMPA 3SFZA 3EPZA 3R0AA 5IVYA 1ETOA 1R4MB 2EA2A 3H36A 1FOWA 4ENMA 1UXZA 1MZ5A 2QQLA 3PUIA 4QXCA 3AXEA 1IW7F 2ZGMA 5JWPA 2W3JA 3PUSA 1YO5C 2HQNA 3DKWA 2ZX2A 4QPQA 4TTGA 1S0CA 1V6IA 4ZYGA 3JCUC 5LRRA 1QJU2 2D3RA 4ETSA 4BUPA 1DGRN 3EBRA 4BQ1A 1B9NA 2PJPA 4MNUA 1REFA 1RVF2 3I4NJ 3BY6A 3L09A 2XUEA 4QX7A 4P9UA 3GF2A 3BGAA 4Z82A 3ACFA 3LSEA 1CZTA 2K27A 4NRQA 5A1AA 1JI6A 3VBOB 1MMSA 1A5JA 3OYCA 3CU7A 2Y33A 5LW9A 1IJWC 1BOBA 1RUG1 1J59A 4YG3A 2VQGA 4XJ9A 5JSRA 4PI0A 1E5RA 1DQ4A 1D4VB 1G9CA 4MIMA 4IE7A 4KBZA 4AL9A 4P02B 5AFBA 2D3PA 1YIJI 2QUOA 5LWBA 2ISZA 5JOWA 1TNFA 1IDYA 2FEZA 1Y3TA 4JQRA 4RAZA 3ZP5A 1U0AA 1A35A 4ASKA 5C3RA 1OQ1A 4KG0A 4AZZA 2J1SA 4ZXKA 4Q4W3 4AEDA 5IJRA 2W00A 3NMBA 1LFBA 4Y5SA 3POYA 3SEEA 3HG9A 4II3A 1Y1VJ 3UKTA 4Q0QA 1TEIA 4WBBA 2VZRA 4LOTA 4LFUA 4Y15A 2DBIA 1OF3A 4QPOA 3P9IA 1ASJ2 1UZVA 3RS6A 1D1CA 1TWGJ 1PGL2 4H0EA 1DIWA 1JZ8A 4V2FA 5FY7A 3DN7A 5DD4A 1SLCA 5FYZA 1JYCA 4PJLA 1RUD3 1T2XA 2HVSA 4QX1A 1DBNA 1YRNA 1FNNA 2DCYA 4CO8A 4IV3A 4LO7A 2R7DA 4P5YA 2JT1A 4IGPA 3ZXKA 2JXAA 1RPWA 2VUDA 3WTUC 1YNAA 4HBNA 5FZFA 1TW3A 5DD8A 1C8NA 2NXNB 3BDDA 1WUVA 2CS3A 3DF8A 3OGJA 3J8F1 3N9MA 4IZZA 2ZXIA 1MS3A 3HBLA 1MS9A 2Y6LA 4PDWC 4L99A 1ULOA 1SDWA 1X1BA 4AI9A 2PJRA 3WDYA 5LEJA 2LNBA 3PHMA 4HF1A 2E36A 2WZR2 5GZGA 3HEIA 3FXRA 4EJOA 1U5ZA 4CP9A 2R073 1ZRDA 1LJ7A 3J7ZI 1GSLA 2A6HF 2DYCA 3BYWA 5DZEA 2JG9C 4I09A 2GNBA 2XJQA 2AXTC 4NB5A 3POEA 4ESBA 3FMSA 2FQ3A 5A3WA 2IVIB 1RL3A 1BW6A 1ZA4A 2V5YA 2YX4A 1S0IA 1AX1A 4CPBA 2VM9A 2FZ1A 1LFPA 3CO6C 5FY4A 2DBNA 2D6OX 5IK5A 4S0HB 4YVSB 3EMRA 3ST7A 3BTYA 4BE2A 2QQ8A 3BG9A 3S3MA 1BYHA 2H1KA 2P5VA 4UUSA 2ZJRF 1ZGAA 4PQ9A 2QQAA 3WU1B 5FPZA 3G3ZA 4CZZA 2L7FP 2CQQA 2CUFA 3S1RJ 3INAA 4OQ8A 2HKXA 2QWWA 3OGRA 4XYXA 3MW4A 1QJY3 1GDTA 4AWXB 3PTRB 5C8CB 1NTCA 1AUYA 3U2RA 3L00A 4W6YA 1RUH3 2Z79A 2OVUA 4HN1A 2R072 1Z9CA 1FWZA 5CNAA 4DJAA 1SD6A 1WLCA 3MZHA 4BB3A 2BY2A 4YFNF 1QU3A 2KLOA 5HLHA 4D0PA 1CONA 2PAEA 4OQ9A 2VTXJ 4KNYA 1GICA 2K3PA 2VJXA 3PQJA 5T54A 2Y2ZA 5DMYA 4HKOA 1RJ8A 1DZTA 4ZY9A 4CEWC 1BBT1 3ORJA 3USSA 1PP7U 2X48A 3Q9OA 3NNGA 4PGGA 4OI2A 3OL3A 1EPZA 4ORFA 1K5MB 5BNOA 2FSWA 3S57A 3C2HA 4WXDA 2G7UA 2LK2A 4D5CA 4DBQA 4Q0PA 3AJZA 1XJAA 1W8WA 1Q1HA 1WH7A 2GXBA 4X8PA 3WHUA 1H88C 3WW1A 1VAMA 3CUOA 4XRMA 1RUI2 2XAJA 2PMWB 4JX6A 1UG2A 3ULQB 3W2WA 3X29B 3S0MA 3VZOA 5C8CC 2V6CA 1D0XA 2HWE3 1H0MA 3K7AJ 2V4AA 2AEZA 4PDWA 3VBHC 3BT9A 1JKPC 1SAUA 3NV4A 3IZOA 3OPTA 2JJ6A 4AYUA 1L7RA 2BFUS 5K7ZA 5M3MJ 1POQA 2XB6C 1CPNA 5FXXA 5CAZA 3ZQFA 2A6YA 4YM3A 3MPPG 1XG1A 4W6XA 2GNDA 1P4AA 1LNSA 4RL7A 4CU8A 2BOJA 1AR73 2JA5J 1W28A 4N90A 4J19A 5B1BH 3Q3SA 3H9GA 1JJ6C 1UY0A 3FKIJ 4WCGA 2MSYA 5L36A 2KMUA 1QDCA 2E19A 2CYFA 5I0SA 3ZSEA 3RSNA 2ZAHA 5E17F 3Q8AA 3JD71 2UXXA 3GBWA 2W7NA 3JQXA 1USTA 5H9PA 1HXS1 5JOZA 4HQMA 3OOPA 1ETXA 5E16A 1PUFA 3ZPLA 3G73A 5ABJB 1E5HA 2EIEA 2IXCA 4PFOA 2Y30A 3UGFA 2JB4A 3SZGA 4IRIA 5JR7B 1UYYA 3U9GA 2Z69A 2JE8A 3KEQA 4L5JA 2XG3A 3ZYGA 3N9NA 1OLME 2I5UA 3TWIA 1K42A 1KXGA 1V6OA 1G4DA 1TL8A 2XBO3 1SCSA 1GYKA 5FD6A 2E1OA 4G6DA 4JX5A 3WX5A 1LHWA 1B35A 4D3WA 3COAC 2LKXA 1ZHFA 3RKXA 1J83A 1NG0A 3G2BA 2ILMA 2VZUA 4IEPA 3VKOA 4XUTA 4MHRA 2XASA 1AR83 3AK0A 1Z6TA 4QHZA 2JN6A 4MTDA 2L01A 2W57A 3MV11 4MEYF 4A3GJ 3MF9A 4TWTA 1E17A 3WQ1A 2RHPA 3V7RA 1A04A 2FBHA 2LDUA 2Y6FA 2IRFG 2ID3A 2M0MA 5FPAA 4RS5C 2V7FA 1MKMA 4ET7A 4KWLA 2K0GA 4Y5Z0 3AZWA 1GQHA 2D5FA 3FUQA 3MIGA 4MGSA 2JJ7A 3WDWA 4ISRA 3S1MJ 2IXSA 2JDZA 1X3WB 3GW2A 4BQNA 5A7SA 5DUXA 1AKHA 3ZFGA 4CXFA 3TO6A 1G8XA 3R6SA 4QWQA 3WE2A 1HN1A 5AIQA 4RGUA 2KRHA 4Q4Y3 4DQ2A 1ETWA 1UZYA 3W21A 4XN0A 3CQZJ 2OPTA 5CVJA 1S29A 4JGYC 1GV2A 4J6GA 5FMCA 2K5CA 1OHFA 3T1MA 1B6AA 1W6MB 2GXGA 4E4ZA 4D69A 5I0UA 2BEOA 5FZ4A 4YW1A 3FWEA 4HW0A 5GAGJ 3J81K 5ILVA 4HPKA 2WLPA 4EN9B 3K2ZA 4QSHA 3HNYM 3A0BC 2PHUA 4LR4A 2ES3A 2X1DA 1FP1D 3BIWE 2VQCA 1KFXL 1QXRA 5A70A 3RI4A 4M6YA 2BERA 2EFOA 5E3OA 2QEXI 2LYCA 2DO7A 2JSPA 4M9XA 4LQRA 5FZOA 1EAH3 5TISC 5EYRA 1AJOA 2HWVA 5L73A 1W2UA 2R7UA 1IZ1A 4KBBA 4LXLA 1YQ6A 1YE9A 1OC1A 1DQUA 2P7CB 4UFJA 2EVXA 1W8TA 1K5JA 2P34A 4UI9L 3GALA 2AGSA 2OQGA 3AYDA 1QU0A 2B7EA 3ZFFA 2VJ5A 1RMU3 3U1XA 4DYQA 1YQCA 4QQPA 4HT1T 4YFZA 3GZ5A 3PO3J 2J5OA 4RR3B 4K8FA 2LH9A 2M30A 4XEZA 3ZX7A 5CEHA 2MPFA 2WFF3 5I91A 2ZX4A 4YM0A 2WY7Q 1AX0A 1PUFB 4YELA 3CMAI 5FKKA 4KWJA 2HPMA 1CESA 2VW1A 4XFIA 3P7NA 3NRUA 3BPSA 1FEXA 4K40A 1BMV2 2L7KA 2VCAA 1X82A 2IGMA 4HEA2 4NDLA 1LOEA 4DUWA 2HYFA 1EYBA 3QPTA 3AM2A 3TW6A 4WX9A 1W06A 4GULA 5IVCA 1NKGA 1H1MA 1ND3B 5A7WB 1DGWA 1QQP1 1UX7A 4XFHA 3P9KA 3JZVA 5EHDA 5IK8A 3AL6A 1RUF1 3ZYIB 2CUJA 2QQJA 3PIJA 1ZZ8A 2A6TA 2EZLA 2I07B 1D2SA 1G3WA 1N3OA 2YC4A 2EV0A 1TT5B 1IS5A 2Z42A 4NR1A 1LOCA 3ZMNA 2EINH 4LJHA 1NCRA 4NQWA 2PELA 1XNKA 3HRUA 3RPQA 4B4PA 3CDHA 4Y4YA 4R4ZA 3OYMA 2STWA 2BNNA 4P9WA 3T2QA 1AHDP 1DG6A 1LULA 5LB6A 1APLC 2EFQA 2W2IA 4A7KA 3OPWA 4OVEA 4YVSA 2E7QA 4LBJA 5FZ1A 5C5TA 3ZR5A 5EFUA 2BHYA 4PI2A 3RYKA 2VMIA 3WNLA 3LSTA 1IV6A 1G86A 2M2EA 1JH5A 2LBFA 3AX4A 1XRUA 2DMTA 4A4AA 5FZCA 4XBQA 1DLCA 3DPRC 5TJJA 3C7GA 2DCZA 4U87A 3ES4A 1WVRA 2FUG2 2VJIA 1S2KA 5D8AC 2Y48A 5E3MA 1WGXA 1AR93 1UY1A 1GZ9A 2F4OB 4PUSA 4BQOA 3VBSA 4RB1A 1K12A 4XOTA 5LHHA 3W9AA 1WMEA 2VMCA 1RUC3 2IJLA 5J1XA 3H1MA 3W58A 3ZR6A 4XF1A 2FDJA 1BR1A 3NNLA 3IUOA 5G04L 4EATA 3SDBA 2RDSA 2Q8OA 2DQRA 1V70A 2GAUA 3MPBA 4CPBD 2ZJ2A 3O7OA 2JWTA 5EZHA 5DAPA 3T1BA 4DEVA 2KT0A 1ZBE3 2DLLA 5EG0A 4BQQA 3J7YJ 4LUKA 5IFPA 1YO8A 1O3RA 2R5YA 4XHXA 2DVGA 3CC2I 3N9OA 2PHDA 1PK6B 5K1YA 1LJ9A 4M6XA 4AVPA 2EICA 1WBFA 1AX2A 1XSQA 2WFF1 3ONQA 1W6QA 2ZX0A 5HV0A 1PK6C 2DFBA 2YU3A 3UV9A 3JRGA 3J8F2 5IP7J 1RUJ1 1S4CA 1GWKA 3H8UA 4HBLA 3OSGA 3T30A 3A0KA 5LASA 1YHFA 5J40A 4CP0A 1YC61 4ENNA 1HQCA 2JDPA 2J1VA 1PO13 4H7LA 4DQAA 1VBD3 2VL8A 4W50A 2RR12 2WT1A 3ZSLA 1LENA 1ZZ6A 3A2KA 1YLFA 4O65A 1WQ2A 5DDGA 1OPOA 4B09A 5KCMA 2IXIA 3ACLA 3NKTA 1AXZA 1AA7A 4KYWA 5D5VB 1GXPA 5FLJA 3V8JA 2OS2A 5J4YA 2YB7A 2RS31 4IQPA 1O4ZA 4ZYHA 2WA4A 1FY7A 4RS5B 4GQ7A 2RC4A 2CSOA 3LOCA 1RR8C 4QHBA 3OD0A 5HV4A 1F8VA 2SLIA 2XJPA 4QDQA 1JW6A 3BPXA 5FBJA 3DPTA 2BYVE 2ICWG 3AB0A 3L2CA 2B39A 2F4IA 3WW2A 4AIHA 5HS8A 3PNAA 1CF7B 3ROUA 2ZSHB 2BGOA 3RTRA 2TNFA 4LLLA 3Q8BA 1UZZA 4LG0A 1L7LA 4XNFA 4IV1C 3TQNA 4J1WA 3O3KA 1QZZA 3VBSC 4WVMA 1RUH1 4C1XA 1H1AA 1OA4A 4DO0A 2W39A 5FYYA 3I0TA 3V64A 1F1ZA 3OOXA 1NG6A 1EUUA 3MUZ1 5GLUA 4NC6A 5A33A 5IVVA 2M0CA 4LKSA 4I99C 2VLAA 4E4SA 3IL2A 4IEJA 2ZTNA 3ZKUA 4D8MA 4CCLA 4QKDA 1YJKA 1ZR2A 4HSTA 5ABJC 3U4SA 1NHAA 3U21A 2JSCA 4Q48A 4E9KA 2JDAA 1YITI 5H9SA 1IDZA 1NX9A 3H1WA 4LE3A 3VKLA 1QJY1 4A69C 4MHUA 2JRTA 2VZTA 1GU3A 1LR5A 4I7HA 1T38A 1NY72 1JYNA 1EUTA 4B7EA 3I71A 2VTXA 3ZN6B 3HPHA 2EIBA 4ZDPA 2WO7A 4XM3A 2XPUA 3I8TA 2Y0IA 1QJX1 5JFRA 3O1PA 1LU2A 4O9EA 3V65A 1QDOA 4CCOA 3WY6A 3AZXA 2VNOA 4B4QA 4LOCA 3O6BB 2H27A 5GAHJ 3ALQA 1RI7A 3E3VA 4A41A 2FHRA 5JI9A 3OSFA 4AQSA 3TNQA 5H6QA 2B5HA 2D5VA 5IVBA 4CYCA 4LKDA 3WG4A 3A01B 1JE8A 4MGTA 3HOTA 1HRV3 4ZZDA 4JDMA 3DLLF 2W24A 4Y26A 1JHHA 3ECHA 2NVXJ 1MS1A 1YUDA 3TAYA 5HXMA 4BBRJ 3M07A 4BXUA 1P7JA 2JDUA 4M3EA 3I56I 5CB7A 2ZHLA 5BOXA 5SV5A 1NXD1 5FO9B 3Q9SA 1ZBE1 5H6RA 1W2AX 5F9TA 1UHMA 2LY1A 1CD3G 4QKFA 3NEUA 4N53A 1UB9A 3T2OA 1E57A 5LATA 1LOFC 1PGW2 4M3FA 4JGYB 2CH0A 3FMRA 3JRIA 1HB2A 2WRAA 5LK5A 4BLJA 2ETEA 3OR1C 4CU6A 2GOMA 4D1QA 1KYZA 4LHSA 5CYYA 1OKQA 1KQ8A 2R0QC 1U6GA 2VGDA 4ARXA 5F5CA 3NRVA 4IHVA 3I9V2 3I54A 4RA2A 5KR7A 2VIXA 4Y52J 2XLGA 3RMXA 3NARA 4XRFA 3VL9A 2HVRA 5IT6A 3C7OA 3OS2A 2OZUA 2VT3A 3E5XA 2L54A 3W6VA 3MLKA 2R063 5LGTA 4GZ9A 5LBQA 3KWVA 3NJZA 4AVVA 2MG4A 3WXPA 3TP3A 5CISA 4AD9A 1ULEA 3FK6A 2ZHKA 4BE1A 1SLIA 3KT4A 3IB3A 3RDIA 3VB2A 2HTSA 4RMNA 2TEPA 3GM8A 1P92A 2YYOA 1HJFA 1RUNA 4QX2A 4UOJA 1GXQA 1ONVA 2MBFA 4EE2A 4BGDA 2CW0F 3JRDA 1J09A 1MJBA 5CKMA 3WG1A 1FMD2 4CH7A 1A78A 2YPJA 3O0XA 2AUYA 2ZGUA 2P81A 3RQ0A 4B4CA 4KDPA 1NK3P 3O8GA 4QQOA 3ZYRA 2X6YA 4CXYA 1VBB3 3R4SA 3KYCB 3KT7A 3WW4A 4PJYA 1MBJA 1SMYF 1FXZA 2H1LA 2J22A 1GV5A 5F2WA 2LF7A 3PVOA 2YBPA 3FXUA 2NMOA 2H6CA 2E33A 3KE2A 3MLLA 2W1UA 3TNPB 4S2DA 1BI3A 5FYSA 4L0ZB 1Z7S2 5IVEA 4U0YA 1D8KA 2IPQX 2RR13 1BI2A 4CDWA 3OEAA 3KF5A 4IEYA 2XPWA 3I2HA 1XNDA 1GHCA 1E2XA 5HS9A 2XJTA 4K1YA 1W8ZA 1VR3A 5D5WB 4ZJZA 1F35A 3IAPA 2P6SA 2MHFA 2GA2A 3THDA 1YW7A 4DEQA 4LHNA 2BE5F 4Y22A 1S2EA 3ZXJA 1T2KA 2KL4A 4IHTA 1IHMA 2HPIA 2IS6A 2YU1A 3WNNA 2A6ZA 1WJDA 2Q2EA 5BNQA 1S7OA 3P5JA 4HFSA 3URFA 3VYTB 3TBIA 1VBE3 4PJNA 1SLLA 2Y8KA 1PO12 3T5XA 4OFGA 1PUEE 2EWNA 1SFEA 2YC2A 5J6XA 4RAYA 4COUA 2PHWA 2QM3A 1QBJA 3JBG3 3O1RA 1FYUA 1FI2A 2ZXQA 1CR7A 1VQNI 2CGNA 3QPHA 1LQ1A 4FFFA 2Z99A 4CDWC 1K78A 4ZPIA 1DPUA 3IIIA 3RJRA 3QRFF 1QOSA 4QXHA 1TQIA 2XPJA 1F2NA 1GZWA 2RQQA 3HKZN 4FOYA 4NRMA 5ICCA 2H8RA 1OQYA 3RFRA 5DS9A 4FPOB 4IE0A 2CRGA 3AG3H 1P8JA 2P8TA 2JE7A 4HDUA 1J58A 3H8RA 1W99A 4RSUA 2EA7A 2UZKA 2QQNA 1VMJA 5BV6A 5FZ0A 2BGPA 1C8M3 2VT2A 2EFWA 1NT0A 4LKEA 2E60A 2PMUA 5SV8A 1PP8F 5FMOS 3KP5A 3ZMSA 3AMNA 1FOD1 2EK5A 2VG9A 5A32B 5A32A 4NIDA 1VBC1 3DKYA 2YGLA 4HLTA 1A8MA 3KV6A 2X8KA 2YFUA 2JMWA 1GP6A 4AIDA 3CMYA 1BBYA 2WV1A 2EV5A 4IHSA 2FCVA 3SH3A 2CHHA 1D3YA 3PU8A 5JZGB 5EJZB 4X6RB 2ZFWA 3ZSMA 4EGZA 2NOGA 4BY7J 3JREA 2JIJA 5GLZA 4FSJA 5FYMA 5E1ZB 2W5FA 1VB4A 3S3NA 2DPUA 4OIRF 3K4JA 3VBRC 2XB0X 4MLOA 5FOJB 2IC1A 4O9GA 3SHFA 3SFIA 3OUJA 1SQ4A 5FZ3A 2W48A 1JT0A 4EN8B 1HDKA 1VQPI 4M4PA 3N97A 4IESA 4MO7A 5K0UB 1EH6A 1OSGA 1X1DA 4A12A 3RQ4A 4PIXA 2NOJB 2P37A 3A22A 3CJRB 5I8TA 4WM8B 1UU4A 2LRDA 3F8FA 3WT3A 3PL0A 3KLSA 3EQEA 1Z78A 3FFZA 3DYOA 1FX5A 1QJZA 2RMU2 2P2KA 3A4CA 1Q56A 3WP3A 4EWAA 1C8M2 3AYAA 3G7DA 3ABZA 5HXVA 1OR7C 1WGPA 3GCXA 3M3QA 2E53A 4DRRA 3WG3A 5F5IA 3CCRI 4JV4A 2XJVA 2WNVA 2NM1A 4NE9A 4KNCA 3VZNA 3WG2A 5JOYA 3HD8B 3POIA 1WLWA 2FQPA 4EM2A 1TQMA 1W3XA 5F37A 2VOWA 4F92B 4D7TA 5IYBJ 4E8DA 3CL1A 2A69F 3J9SA 5JXJA 3PIPF 3TKYA 3ZQIA 4Y1UA 1FYKA 3DXJF 4HVRA 2JA7J 3DPRB 1WJFA 2AXLA 5I0RA 1IRZA 2DCJA 2QQUA 3MFCA 3TEWA 2HKOA 2OT7A 1B59A 2L9NA 5FOBB 1W9SA 1AR91 1PGL1 5LA0A 1CVNA 1H30A 2EV6A 3S6PA 3TBDA 1O4XA 2WNEA 1S8NA 5FY1A 3PMEA 2MD5A 2ZNZA 4JRAA 1W9YA 4OI1A 2TCTA 1R58A 3QH7A 3KVAA 2YV8A 2F5FA 1V6MA 3CO7C 2PJRB 1UJ8A 1OVPA 3FHQA 5J47A 2WYFA 2DVBA 4DZGA 3VUOA 3Q0UA 4AHZA 2OF7A 1KU3A 3C8XA 2BXZA 2XPVA 4MTEA 4WXCA 1R36A 4BDVB 2O0YA 1QIQA 3S16J 1W9TA 3GEZA 1QMJA 3ZMDA 3JXSA 1X2NA 3QBQA 3M8EA 1SD7A 5DG1A 2WO1A 3J8F3 3EUKL 4HSLA 4W65A 1IXCA 1WMXA 3VDDB 2VI6A 1GWMA 3C2GA 3B00A 2AR6A 3ZCOA 1MMGA 1UN1A 2WL1A 4Q5SF 3AFGA 1FNYA 4Q4W2 3VYSB 5LGUA 2OQ6A 3B6CA 3PVBB 5LA1A 3FLRA 2B9SA 4YFXF 4Y24A 4L97A 4FPFA 1IXSB 4OMZA 3AYCA 1CX4A 3I2JA 4PF5A 1V55H 5EEAA 3KCCA 5TSWA 4DOZA 1I1GA 1RGSA 3HSFA 1D4M1 1QJEA 4GWMA 3H92A 4OULA 2HZDA 3FF5A 5IW0A 2PAMA 3HBKA 4BNCA 4BQ5A 1YFXA 4EQQA 1LPQA 3ZN0A 1H0BA 1IN4A 1RC6A 1XC6A 4FFHA 4FOWA 3ZFEA 5DCFA 4IEXA 1E5SA 1NCQA 1BC8C 3MGUA 3JRAA 4G7ZF 3ZQHA 1K4SA 4J00A 2G4IA 4RGKA 4L0YB 5C3EJ 2R7WA 3Q8EA 2IA1A 2VCCA 2V9PA 5F1RA 3OYFA 4GKYA 2FMYA 2XVKA 2QZ8A 5FKBA 4LUMA 5IWFA 2FDKA 1XGSA 3RMYA 2MA3A 3ZPOA 1ZX5A 2ERFA 2DU9A 1D5YA 2V5DA 3RZDJ 3M3CA 2GU9A 2IVMA 1LESA 1AKHB 1SD5A 3ZGKA 2UWBA 5D5UB 4YW3A 2Q8DA 1W6OB 4LGWA 2UUZA 5BXXA 1O57A 2AS5F 3POBA 1SHWB 2EXJA 3KQ4B 1NG7A 1FPN3 2AYHA 2XBO2 1GNZA 1AR81 3D8CA 2VJJA 2NLRA 3NAPA 2X5IB 4NWWA 1SMTA 1FJLA 1UOFA 2VXJA 3CEWA 1EA3A 2GWRA 1XOYA 2L7ZA 3K70D 1G9AA 2C9AA 2NZ9A 2WFPA 3HHGA 4GA9A 3DBHB 1IN6A 4P9FA 3K4CA 2SBAA 2VW0A 2HEOA 5K5OA 2JVHA 4ZC3A 2UU8A 4ES8A 5FKMA 4Z07A 4BZ4A 5DTDA 2Q30A 4QLCU 4LIVA 4OMYA 1DU6A 1FOYA 2ZX3A 4UXAA 5CIRA 3ZDSA 1ZZ9A 4CICA 2XAGA 2A6EF 3ABLH 3SH4A 1Z7S3 3KV9A 1BK1A 3DV8A 4YW5A 4CUCA 3ISPA 1KA8A 2XR4A 1IS3A 1RUD2 2K9NA 3S5AA 1JOBA 3NO8A 1MZ6A 2P3IA 4NJ4A 2C26A 2HOEA 1JXSA 3ME2A 2RMU1 2ISYA 4HRIA 5FO8B 3N4MA 1Y4WA 2XJUA 1XSDA 2RJLA 4CCJA 3JRCA 4GFBA 2E1MB 3O0VA 1PO23 4FQ4A 1Z3XA 2WDBA 3P3NA 4PIYA 4E4HA 3VHNA 3KZYA 4XQDA 5C4WB 5FQ0A 2XHKA 2ID6A 1YOVB 4FOQA 3PSFA 1VJ2A 3M7GA 4Q4V2 1ACIA 1USSA 4BISA 1W5SA 5BNGA 3K3NA 4E4DX 1OBNA 2B46X 3LEIA 4RFT0 3D3AA 4XUOA 4BOWA 1JKRC 1SZBA 3LQCA 1TWHJ 4MOAA 5D6FA 1T08B 1UKGA 2R0HA 5HCHA 1SPPA 1WCQA 1GVJA 2DMQA 1VQ5I 3TN93 3VDDA 4OU0A 3KP6A 2GOXB 5FK8A 3LSRA 2IVJA 3BVCA 1W1WE 1LODA 3WDTA 3CJQB 1AJKA 5CPRB 4K9SA 2KZGA 2CTVA 5HCAA 1JYIA 3FL7A 1JODA 2BW8A 4Y5TA 3AXDA 4MXWA 3KLOA 2YG0A 5FZKA 4F83A 2JENA 2OQ7A 2PX9A 4CDXB 4XR6A 3AMPA 1IS6A 3HWJA 1H2KA 1FPQA 3OYJA 1JXNA 3S8PA 5IT9Z 3TEYA 4Y4RA 1N47A 3BROA 2ZPXA 2A6XA 3BTAA 2DVAA 1PMIA 1AR61 4AEJA 4EWEA 3ETPA 2O8OA 4CU7A 4FAGA 2FBEA 4NROA 4XUQA 2ESHA 3M3EA 2HEVF 1ORKA 1UMIA 1S5LC 2ZXWH 1WW6A 3MCZA 1UO9A 3FE5A 1DYKA 3CMGA 4H14A 4HVOA 5FJKA 1UOJA 1W8OA 2XGDA 4CCMA 2I8DA 2K40A 3HB9A 2WNVB 2ARBA 3GBFA 4Q4W1 4G3YC 3DXTA 2Y6HA 3QPSA 2HEYF 2DCTA 4B3AA 4E7IA 5H2FC 3RNSA 4EJTA 2TUNA 5DXDA 1XC5A 3CESA 1JOPA 4QGNA 1FC3A 1XDSA 3H8XA 4LEJA 4V2VA 4HK8A 2WFF2 2VPVA 3GXOA 4M3GA 3KCYA 4F91B 4GXOA 4XFBA 4TV7A 4MQ9F 1X33A 1EV12 1HRI2 4YW6A 3O0WA 3IAS2 4YZ4A 5J4VA 4D6RA 4XLFA 1S0FA 1FBUA 2FNAA 1TNSA 4BJ0A 1WKYA 5H20A 2LY9A 3M1CA 3H7YA 3WQ7A 3H8OA 2VN2A 3PFIA 3RGBA 3WUCA 2R7EB 1JZ5A 3OGSA 1XYNA 2RS52 5J98B 1OLMA 4KI5M 2WO2A 1JUMA 3FBMA 3S5QA 1G9FA 4LK0F 3BG7A 3RZMA 2KM2A 5J8CA 3OYBA 3D1NI 4XL9A 3JSOA 2K9MA 4JDNA 1ZELA 1NA1B 1TLHB 3AVRA 3AP5A 4TN7A 3BJ6A 4A45A 5LBBA 3SXWA 1LDDA 2QVOA 1RUF3 4GH4B 1OFCX 1C1FA 3J7MA 4INDA 3WP5A 2P5LC 2XC7A 3IDCB 3MFAA 3VKMA 3DBRB 1DGRA 3CF5F 3RG0A 2Y0MA 1RUI1 1W90A 3H3ZA 2ZEXA 2C0ZA 3S7EA 4EYUA 2LOOA 2PFBA 4A5MA 3HQUA 2LY2A 3HIFA 2XVCA 1K3IA 3ZQ7A 3VZJA 3ASIA 2YS9A 3KFWX 4X1EA 3MIFA 1JTYA 2Q1FA 4UBHA 5E79C 4YZ2A 1SFYA 2WAFA 3I2KA 1WLTA 4QQHA 3VPRA 3UK9A 5DEQA 4U7DA 1GT0C 4MEXF 2BY3A 2ZJPF 4IEOA 1DU3D 4LBQA 4LBQB 2QVSB 2W25A 3BTIA 3NV1A 3EQLF 4HX7A 4PGHA 1UAAA 1RC9A 1W6NA 1PMHX 2WY8Q 3SISA 3WV6A 2MFZA 4WVVA 1LEBA 2VMEA 2A7AA 5C8CA 2OV7A 4RAGA 4I2OA 3WF4A 1E3OC 2RJKA 3MVPA 1T6BX 3D6EA 2HQ5A 3HL2A 3I4IA 1YEWA 1ZAOA 1KEXA 4AEDB 1MS8A 3TN91 3QU3A 2OUHA 2CWSA 3IWZA 4M3DA 3OB8A 1Z67A 3K4AA 1BN5A 4D0QA 1RXGA 1T0FA 3NSTA 2FBKA 4IPAA 2X85A 5JMCA 2JEMA 4UNOA 3IRQA 5CA6A 4MADA 1SVMA 4JKLA 2W95A 3LAGA 1VALA 2X51A 1K6OA 4RGXA 2FBIA 1M4WA 1T56A 3U1KA 5F08A 2ZXJA 3LKJA 5FY0A 3KX2A 2WAAA 2NS0A 2OCCH 4RQPB 3MIHA 5FPBA 2HYJA 3OMYA 2YU9J 5ERLA 5IAVA 3L2QA 3D5SC 4C3JJ 2PI0A 4DOUA 1JHJA 4BPZA 1SBFA 4AVZA 3ML6A 2X29A 1TZOA 3UNPA 4OCTA 1KITA 1KRIA 5F6LB