1XE7A

Crystal structure of the yml079w protein from saccharomyces cerevisiae reveals a new sequence family of the jelly roll fold
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
194
structure length
186
Chain Sequence
b'ANAAIEPASFVKVPMPEPPSSLQQLINDWQLIKHREGGYFKETDRSPYTMEVEKPVMVTRNQSTLIYYLLTPDSPIGKFHKNINRIIHILQRGKGQYVLVYPDGQVKSFKVGFDYKNGEVSQWVVPGGVFKASFLLPNEEFDNGFLISEVVVPGFDFEDHTFLKGEDELKHLVGPEKAAELAFLAH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical 22.5 kDa protein in TUB1-CPR3 intergenic region
publication title Crystal structure of the YML079w protein from Saccharomyces cerevisiae reveals a new sequence family of the jelly-roll fold
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural genomics, unknown function
total genus 49
structure length 186
sequence length 194
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06172 Cupin_5 Cupin superfamily (DUF985)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1xe7A00
4KWJA 4EV0A 5FLIA 2D40A 3PVBB 4O9GA 3G7DA 5C6CA 1V70A 3H1MA 3H1WA 2PAMA 3KGLA 5T3NA 3M3IA 3FHIB 5AVPA 3ES4A 3HQXA 1DZRA 2O8QA 2Y0OA 1SQ4A 3H3ZA 5BUVA 4XFGA 5KHKA 2MHFA 4FAHA 2WC2A 2D5FA 3DN7A 3E6DA 3SHRA 4Q29A 3FE5A 3S7EA 3ETQA 5I93A 1GQGA 3OF1A 3H50A 2GU9A 4PIZA 3D82A 1QXJA 1CAXA 2D5HA 2GZWA 3ELNA 3H3UA 3CLPA 4P9GA 2QVSB 4H7LA 1I6XA 5K8SA 4D7SA 4XETA 1PMIA 4BIFA 1SEFA 4X6QB 1ZNPA 4BYYA 2BNOA 1IPKA 5FLHA 2K0GA 1O5LA 3BCWA 4BHPA 4YNIA 4XFAA 5FQ0B 3S0MA 2B9UA 3IBMA 3E5QA 1UW8A 2ET7A 1FT9A 3B02A 3LA7A 1FI2A 3I59B 4OLLA 2PAEA 3SCHA 2BGCA 4Q0VA 3ROUA 5KHGA 3RYPA 1PM7A 1IPJA 1HW5A 1O3QA 2DCTA 2UYBA 2XLFA 2PHLA 3LAGA 4HN0A 1O3SA 4FT8A 2XKOA 1LR5A 2GC2A 2QJVA 1JUHA 4WBBA 2E9QA 5KHJA 3RZZA 2PFWA 4QXKA 2BEOA 2PA7A 2ATFA 3FX3A 2XL7A 1RTVA 3H8UA 4KL1A 4AVBA 4MH0E 1RL3A 2ETEA 5E16A 4DINB 2N7GA 5FCCA 2XHKA 2O1QA 4QGMA 1DGRA 1UPIA 2EA7A 2OZJA 1H1MA 4OFGA 4ORFA 1QWRA 3EBRA 2WFPA 4A2UA 1CAVB 3SCGA 1ZZBA 2FMYA 3H7JA 4IESA 3C3VA 1VJ2A 3TNQA 3ES1A 3DKWA 2PAKA 2CV6A 2C0ZA 4R52A 5J48A 4QGNA 1RUOA 1NYWA 3D0SA 4PIXA 2P17A 1GQHA 1TQ5A 4XFFA 3KCCA 4IEPA 2GH2A 2H6CA 4IEVA 3PLQA 4X6RB 3MPBA 1EY2A 4EROA 4Q0SA 3R6SA 4XFBA 3U0ZA 5LRSA 4J1WA 4MX3A 1WLTA 4F7ZA 4D7TA 5I8TA 1X7NA 4ZU5A 1J3PA 4L11A 4MGYE 3SXWA 4KU7A 3ZDSA 4JTNA 4I2OA 4IEOA 3LA2A 3BB6A 1YHFA 1RC6A 3L2HA 1ZRFA 4LA2A 1CAUB 4PJYA 5I0UA 1YLLA 2GAUA 4HSLA 3UKNA 5JAXA 4Z07A 5JR7B 5KHHA 3WW4A 1CAWB 3H7YA 3OCPA 4IEWA 2CGPA 4LUKA 1LRHA 2BNMA 4O9EA 1I5ZA 4WVZA 3RNSA 4KWLA 5EFUA 5KBFA 3IDBB 4KU8A 2H0VA 4MGIE 2QDRA 1QY4A 2I45A 4N9HA 3RYRA 1UIJA 1OI6A 4XF3A 3EHKA 4META 1O4TA 1O7FA 3TNPB 2UY8A 3U11A 3SCFA 4UBGA 2IXHA 4QX5A 4AVCA 3KMHA 3E6BA 4HN1A 4AQ2A 1EYBA 4I3PA 4QMAA 2IXCA 4QGLA 3GBFA 1OMIA 4F8AA 4Z82A 1J1LA 4Q0PA 4LA3A 3ACLA 3WW2A 1LKNA 3EO6A 2CAVA 4YYOA 3BPZA 4HLTA 1ZX5A 4CYDA 1O3TA 4HVRA 4E2GA 3USSA 5BV6A 1CGPA 1WA4A 1DZTA 3E6CC 5CADA 2Q4SA 4HZFA 4I09A 1ZZ9A 1XE7A 5FLJA 5BY5A 5J3UA 1J59A 3DV8A 1ZVFA 5E1RA 4UXAA 4EWAA 2H6BA 1YFYA 3IIAA 1NE6A 3WW3A 1XE8A 1U12A 3CF6E 4QM9A 4HSJA 3ST7A 5CU1A 4YARA 1DGWA 4Q0QA 2B8MA 2Q30A 2UYAA 5EZWA 3NSTA 4ZU4A 1O5UA 2Z69A 5I0TA 4HMZA 1FXZA 5BXXA 4MV2A 4BH9A 3HT2A 1Y9QA 3WW1A 1WGPA 3OGJA 4QM8A 4E2SA 1EP0A 3H9AA 3UKTA 4MGZE 4AXOA 3MDPA 1OFNA 2FQPA 4J1XA 4AQ6A 2XGXA 3H1YA 4LLOA 2OA2A 3LZZA 2QNKA 5FQ0A 3BU7A 3MYXA 4XF0A 5JCTA 2K9ZA 4XFCA 2PYTA 1NZCA 2ET1A 3D0JA 1UD1A 3BALA 2OYZA 3I59A 2GC1A 1CAXB 2IC1A 2VPVA 4NVPA 3U10A 4MUVA 4XF4A 1H1IA 4LTAA 1L3JA 1ZZ7A 3EJKA 5J7MA 3E5XA 1ZZCA 3VHRA 1YFUA 3JZVA 3FFQA 2BNNA 3HIFA 5I8SA 1OD5A 1SFNA 4RD7A 1X8MA 2D93A 3IDCB 4TLFA 4WZCA 3CEWA 2Q0AA 4B29A 5F1RA 1Q5OA 4GULA 5I8YA 4JV4A 3QACA 2XLAA 3RYKA 1Q43A 4YRDA 1UIKA 2PHDA 4IEYA 3KSCA 2VQAA 3E5UA 2MNGA 2HKXA 2EVXA 1O3RA 1NXMA 1VP6A 3KGZA 5I91A 4FAGA 1XRUA 1X8EA 1J3QA 5LEKA 3NL1A 1ZREA 3QOPA 3FZ3A 1CAVA 3I7DA 4ONUA 4PIYA 3RPQA 4MZUA 4HVQA 4FBFA 2Q1ZB 3NKTA 3EQEA 1J58A 3SMHA 3MZHA 3PNAA 5LEJA 4XFHA 2IXLA 1EPZA 1ZRRA 3N4MA 1CX4A 1ZZ6A 2IXJA 2OZ6A 1YFXA 2GC3A 1QXRA 3CL1A 4L2NA 1YUDA 1Y3TA 1LB2A 4JTOA 1Q3EA 2B5HA 2XLGA 3LOIA 4LUMA 4HVOA 1YWKA 4I0AA 4I01A 4EWDA 1ZZ8A 4I0BA 3OD0A 1YFWA 3HT1A 2CAUA 3S7IA 2PTMA 4EWEA 4XFIA 4K8FA 3M70A 1CAUA 2EAAA 1NE4A 4ZU7A 1X82A 5JSOA 4KWKA 3O14A 2QCSB 5HI0A 2XKPA 1CAWA 4R8HA 4MGKE 5CVRA 5C8WA 3NVCA 2BYVE 2XL9A 3DL3A 3NJZA 5JSRA 1UCXA 2HJIA 5LRRA 4HBNA 4I02A 2PQQA 1ZRDA 5KHIA 4IEUA 1J3RA 5FDBA 3FJSA 5I0RA 3NW4A 2OPKA 3CJXA 3LWCA 4IEQA 4XF1A 1G6NA 2IXIA 2ZKLA 4JVAA 4UBHA 1RUNA 4XF9A 5I0SA 5D1IA 3UKVA 5JSPA 3GYDA 3OTFA 2VECA 3LA3A 5FPZA 4AVAA 5FPXA 1RGSA 5BPXA 3E97A 4N9IA 2MPFA 2Z2SB 4YSFA 4LEJA 1ZRCA 4Q0UA 4XEZA 2KXLA 4IEXA 3RDIA 4E2QA 3CO2A 2ZCWA 4IETA 2GC0A 1VR3A 2F4PA 2UY9A 4IERA 3FWEA 3IWZA 4LULA 4IEZA 2IXKA 2V09A 3I54A
chains in the Genus database with same CATH superfamily
3I2GA 3MHZA 3I3MA 4R9AA 3SEPA 2WNVC 3G7DA 4XJAA 4PHZA 1DGRN 3H1WA 2JENA 2AREA 5FZ3A 2VZPA 4LBNA 1KD7A 1VBA3 5FYCA 2WRAA 4OUSA 3P3PA 3VZKA 5LASA 1AX1A 4NIGA 3VLBB 1V9U2 2Y0IA 3LEIA 3HR9A 2EIDA 2JG9C 2Y0OA 3AK0A 3PURA 5LA0A 4QHBA 3H3ZA 3KLSA 4G4FA 1R093 2JJ6A 3BVCA 4K7JA 5A7SA 2Z5WA 2YYOA 4CEYB 3WDVA 5JMCA 4OHXA 5BNPA 3CNAA 3H8RA 3MV01 4QX1A 1CQ9A 2E6VA 3ZVXA 2YXSA 2JDUA 3DUIA 2O0OA 1XNDA 1W6MB 5IJRA 2G1MA 1LOCA 3ORJA 1OLMA 4KGGA 3W58A 4NE9A 1RVF2 5LZ6A 5HCHA 3OOXA 4XZUG 1T6BX 5E8AA 2A6ZA 3PJQA 1WCQA 5C3OA 1GMMA 1R082 2P37A 2VZ1A 2VGDA 1PK6B 3H50A 3I3QA 1PGL2 4LHNA 2GU9A 4EZ4A 2HWD1 4B4PA 3C7GA 5K7PA 3DPRB 2A6VA 2JICA 2FHRA 4AHYA 3ELNA 3RJ2X 2JD4A 1JOPA 4ATEA 5DAPA 4W6YA 1HV1A 1WW4A 3VD7A 5LW9A 2QKDA 4A44A 2G19A 5CKMA 5K8SA 4YZ4A 3N9LA 1MS1A 4QX7A 4UF0A 1JYNA 2WQ8A 3PUQA 4X6QB 4YW3A 1IQDC 1SLTA 1YNAA 2NPIA 4XTPA 1HRV1 5FLHA 1REFA 2W46A 3KQ4B 4CDXB 1H9PA 1O5LA 2Z42A 4C90A 4J6GA 4XFAA 1FPN1 5FQ0B 1UXXX 3S0MA 1EV11 2ZGRA 3E5QA 1UW8A 4XBLA 1PO11 4XHXA 2Q5TA 2RS11 3PIJA 3O1VA 1HXS3 4XBNA 3PMEA 3RZLA 1UYYA 1Y43B 2FMDA 2GN7A 4V1PA 1BMV1 3SCHA 1L7QA 4KGQA 3POWA 4BA6A 1VBE3 4N7IA 4Q0VA 3ROUA 3IKWA 4Y3OA 3AZYA 4UFKA 1F8VA 1URXA 5JXJA 3OUJA 1HW5A 3B69A 4H2AA 4FCAA 1CX1A 4XW3A 4S2GA 1FMD1 1Z7S2 2PHLA 1RUJ3 4HN0A 4FT8A 4A41A 2KR2A 2WSVA 3I4IA 1AXZA 2A71A 4LKEA 1GOGA 4WBBA 2ARBA 4YVSB 1R64A 2PLV1 4CEYA 4XOGA 4CUAA 2XB6C 4LBQD 2OXBA 1GV9A 3WXPA 3C8XA 1U0AA 2PA7A 4AEDB 2LROA 4Y1UA 1DDLA 5D8AA 1UMIA 3F2ZA 4AVBA 4JRAA 2WFF1 3DYMA 3WHUA 1QIQA 5BNPC 5A80A 4AQSA 2ETEA 2ORZA 5EQUA 1KEXA 2N7GA 4ASMB 1BEV2 1PGSA 2QQMA 1DGRA 2W95A 5SV8A 2ORXA 4L0PA 4GB32 2WN2A 4XURA 4WVVA 1OFSA 3LPGA 1HJFA 4N7UA 2GH8A 4TTGA 2UWAA 1POV1 4JDMA 1E57A 1L7RA 1AZDA 2FMYA 2W92A 4QQLA 2IWGB 3RFRA 1Q8VA 4YZ2A 3ZYFA 2XUEA 2A3WA 3BTAA 1AR83 4OHZA 5IVVA 5A6XA 1NYWA 2E51A 1XQNA 3IPVB 5IUQA 3J26N 4PIXA 5DABA 5FZ9A 5A3OA 2I2SA 4TYSA 4XCBA 2DCYA 4MLOA 3MF9A 2HWE2 3NJXA 1PIV3 5FY4A 4B7KA 1Q8PA 1XC6A 2H6CA 1MS4A 2Y6KA 3AYEA 4W8JA 5DUUA 1W2OA 4QXHA 2UWCA 4YWAA 1EY2A 4EROA 1XBFA 4EE2A 3AVSA 1OURA 4DS0A 5GZGA 4Q27A 2R1BA 1R1A2 2W52A 4RSUA 2WFF2 4KWUA 3ETPA 4UI9L 5LRSA 4FXKB 4NJ4A 3WNKA 4BK4A 4AFAA 4F7ZA 1AYM3 3RSJA 1BJQA 2E32A 1J3PA 2NLRA 2BWCA 5F3EA 5FYBA 4KU7A 3SXWA 4YVSA 1YQ8A 3LA2A 1JI6A 3BB6A 1CR7A 1UXZA 2CY6A 5T52A 1ZRFA 1DG6A 3LEMA 4LA2A 1CAUB 1Y7BA 5GLTA 1M06G 1S55A 4Y5TA 2C6SA 1SBEA 4XVHA 2VOWA 2VMIA 2GAUA 2AC1A 4ISQA 1UF2C 3DXUA 4UFLA 1LNSA 5JR7B 3UKNA 3WW4A 5BNNC 4IEWA 3HBKA 5L7OA 1RB8G 4LUKA 2VQ0A 4UWDA 2P3KA 3O1OA 5AVAA 4O9EA 1SPPB 2DU0A 2WN3A 1I5ZA 5GLUA 4Y26A 4HXCA 4XCAA 3RS6A 4CCKA 5EFUA 4PQQA 3IDBB 5E88A 3S57A 1QY4A 2BPA2 2RG4A 4QPWA 1UIJA 1UZYA 5FZMA 2JDYA 3CHXA 4META 2BUKA 3K2OA 2D6LX 3O1UA 2UU8A 5FZ4A 1S0BA 2UY8A 1A3KA 1Q8SA 2W68A 3SCFA 5KC5A 2DF7A 2IXHA 1HN1A 2RV9A 3HWJA 1YYNA 3WX5A 4QXCA 4AVCA 4YFZA 4Q4X2 3ON7A 3I2HA 5IVYA 5A3LA 1AL21 4FPLA 4UFIA 4LKDA 1RJ8A 3GCXA 3E6BA 4Y1XA 3MW3A 3DKQA 4UT5A 3FL7A 1QH7A 1QMJA 1XSQA 3HBZA 3AZXA 5JI9A 2FDGA 3LCPA 4V2VA 1J1LA 4Q0PA 1OF4A 2D3PA 2QZ3A 3ACLA 3J8F2 3JCIA 4A7KA 1W8OA 3PUAA 5FZLA 4A6OA 5F6LB 4BE3A 5BNOC 1XXNA 5ANQA 3BPZA 3OUIA 4HLTA 2QQUA 1F5JA 1QNYA 2WAAA 3O0VA 5T54A 1O3TA 3VDBA 4HFSA 1CGPA 2VZVA 1WA4A 1LESA 3W21A 2VJXA 4ZZ8A 2Q4SA 4COWA 1ZZ9A 5HXVA 1UY1A 3WSOA 2YFUA 2OPWA 2XWJB 2ARCA 3OGRA 3DV8A 3FBMA 2VZTA 3WDUA 1SFYA 4EQVA 1S0GA 5FK8A 1S2EA 4JGYB 4QDRA 5CFCA 4JCKA 3ZFEC 1OLME 3K3OA 4AWDA 4C8DA 2FDIA 1AYN3 4TSVA 2DYCA 1X9TA 1U12A 2RJKA 4IV3C 2CDOA 3CF6E 1R1ZA 2QBXA 4HSJA 1LULA 4CU7A 4M3CB 2DUOA 3KM5A 2WUHA 4RR3C 1DGWA 3SISA 1DHKB 3AXEA 4KBZA 4ZU4A 3MPPG 3T4HB 4N43B 1DYPA 4LO6B 2WS93 5I0TA 4ITCA 1BYHA 2VVDA 3O0XA 4MGSA 1SLCA 4RHV1 3WZ1A 5IAXA 2PN5A 3AJZA 3WQBA 3HT2A 4CPBA 5A1FA 1IPSA 5C8CC 4LBOA 5FZFA 4Q1PA 1JOBA 1R092 3BODA 4BQXA 1QJZA 5A7WA 3J7MA 4QM8A 5F5IA 3NJYA 3HQRA 1EP0A 3TOJA 4FPFA 3VBUB 2OQ7A 2HWC3 2VNGA 3H9AA 1W06A 4RS5A 2C1FA 4AQ6A 1ZA4A 3H1YA 2UWBA 4LLOA 5FP7A 2G4IA 4W50A 5FJKA 1A8MA 1W9WA 3BU7A 3KVBA 2J1RA 4AI9A 3O5SA 5JCTA 2E26A 1NG0A 2XMLA 2K9ZA 5KC6A 4WM7C 1NZCA 3LIGA 3I59A 1OVPA 4P9IA 4PDWB 5A7QA 4DIQA 1CAXB 2IC1A 2WZR2 2VAUA 4NVPA 1W0NA 2IVIB 2X5IC 3U10A 2W91A 2XJQA 4MUVA 4XF4A 5A70A 4JHTA 4PBOA 5DAQA 1W8NA 5C9AC 4YG6A 2LS6A 1NKGA 4FPJA 4DXSA 5FYHA 2BNNA 2GALA 3I2KA 5B4XA 3SH5A 1NUKA 3T2PA 5F5QA 2VZRA 3JBG2 2Q8EA 1C8NA 3IDCB 4RD7A 3UESA 1DQ0A 4Z2WA 3M3QA 2FZ2A 4CDQC 2EXJA 1HIXA 2RS52 3CEWA 4NWVA 5F1RA 5FO9B 1Q5OA 1C57A 2AUYA 3QH7A 4JV4A 1E5HA 1N3QA 4QQOA 3QACA 4XMAA 1RUG3 1UOGA 1Q43A 3LDBA 1UIKA 1VBE2 1VIWB 4IEYA 5ACA3 4M0NA 2C26A 2MNGA 2HKXA 3LGRA 1VP6A 3KGZA 4BXSV 3V64A 1NA1B 4FOYA 4BPZA 1TMF1 4CSWA 2A6YA 5LEKA 2CNAA 4QPIB 3MFAA 2DU1A 3FZ3A 1CAVA 1Q56A 1RUE1 5DDJ1 3ZMOA 4Q8LA 4Q2FA 3RPQA 5F8PA 4BXFA 2HBTA 1RMU1 2W1SA 4MZUA 1G8WA 4QHZA 4Y4RA 2PHUA 1COV2 3MGUA 5JXHA 5L9BA 2OQ6A 3AL5A 3AKSA 1M4WA 4FOVA 2KM2A 1J1TA 1F4HA 2DVGA 3GHNA 5AFEA 2ZMKA 3SEEA 1PNFA 4YW5A 3NKTA 5FZCA 3EQEA 4Q4Y3 1UAIA 3SMHA 4JKMA 1P8JA 1XE0A 5FP4A 4XFHA 2X53S 5LEJA 2ZJCA 2IXLA 4Q4V3 3J7LA 1SCRA 5FZ0A 1RUI1 2IXJA 2BRTA 2OZ6A 2WT0A 1REEA 2GC3A 3HEIA 4D6QA 3WG4A 1N1YA 2IZWA 3QLQA 1GZWA 3C7FA 3RZMA 3S30A 3JD72 4BOWA 4EN0A 1Q8OA 1TME1 5F3IA 1QOOA 4IE4A 1HX6A 3VBRC 3UJQA 3FBYA 4KG0A 1UOFA 1DZQA 1YEWA 3BPSA 4I0AA 4I01A 3VD9A 5JZGA 1V9U3 3WV6A 1YRZA 3SITA 2RR13 3MBWA 1RUD2 5FZOB 2TNFA 1UZWA 3U4XA 1FOD1 1VRH2 2SLIA 5FZAA 3VL8A 3JQWA 2JD9A 3AP5A 4YPJA 2BV4A 3S7IA 4HKLA 1GU3A 1YQ6A 2FBEA 4XFIA 3NNJA 5H9QA 1D2QA 1O6UA 4AW7A 5CFDA 2HWB3 1NE4A 4ZU7A 4M4PA 4ES8A 4AGRA 3O14A 1ENQA 1QJY1 2QCSB 2ZBJA 3WF3A 2XKPA 3GZAA 4LXLA 1UKRA 4LO7A 3ZSLA 4MGKE 3ZXDA 4IE0A 1NCQA 2VCMA 3NRUA 5CVRA 3WY6A 1G86A 1ND2A 3WF4A 2BYVE 3DL3A 1F2NA 2C9KA 2P5BA 1RVF3 5E89A 3VL9A 2W94A 2D6OX 1UCXA 2HJIA 2RS32 1RUC1 5LRRA 1AX0A 2BQPA 3LSDA 4UW5A 2XJUA 3VN4A 4I02A 4OI1A 5ERLA 2PQQA 4AHWA 5K0UB 1R083 5GKAC 3HNBM 5FY1A 4FPGA 4GJYA 4OCTA 1NX9A 4BIOA 5FDBA 5I0RA 1AUYA 3VBOA 3LWCA 5ABJB 4IEQA 4K3UA 4ZXEA 1LODA 1G6NA 2HWF1 1AF9A 2IXIA 3ZFFA 4CRQA 2ZEZA 5LBCA 4KG8A 3VBHB 3K4ZA 4K21A 5JSPA 1LU1A 1OA4A 2WWJA 4LLFA 1SACA 4BZ4A 3WLUA 1GLHA 5IVBA 3H3LA 5BPXA 2VBDA 5GALA 4LE3A 4W4ZA 5JPNB 2MPFA 2R7EB 5A32B 1BBT2 5G04L 1WLDA 1UOBA 1HB2A 5J1XA 2AACA 1D2SA 1ZBA1 4HG6B 4FFHA 4XEZA 3OUHA 1PVC1 1VBC1 1RUH1 4WZFA 3ZFGB 5F32A 4EYUA 3T0AA 4BQ5A 3HD8B 3H0OA 4R9BA 1XPWA 3ZXJA 3GNEA 1ZA7A 4NAMA 5JIAA 2NYYA 1Z7S3 1H8TB 3BU0A 2Y38A 2ZGLA 2Z79A 3IWZA 3ECQA 2AGSA 4AGGA 3A0NA 3K4AA 4IV1C 1HDKA 2HWD3 2IXKA 1Z0HA 1GANA 5FMOL 1MQTB 2OW4A 4FI9A 4KWJA 4EV0A 1QOTA 2VUCA 4XJUA 2DCKA 1OKOA 2K46A 2WNUC 2G9FA 5C6CA 1V70A 3ZKYA 2A73B 1LHWA 2JXAA 1KRIA 2NMNA 3DXTA 5AVPA 1OOPB 2L9LA 3MLLA 4KQ7A 1S1AA 3WHTA 5FJHA 2EF6A 5GM0A 2R041 1DQ1A 2WJSA 1DZRA 4UFHA 1BEV3 5DUXA 2O8QA 1RJ7A 3LF7A 5CKNA 3VBSC 5F3GA 3NV2A 3RG0A 4JDOA 5C5UA 4GB33 1FPN3 4OQ8A 3VV1A 1VB2A 1W6PB 4XUQA 2DCZA 2WNVB 1A8DA 2W08A 4QT6A 4AEJA 5FAXA 2MHFA 4FAHA 2RS13 4KNCA 3NNMA 3TEZA 4WM8A 2YY1A 2WC2A 1OF3A 2YGLA 4ZPIA 1NQJA 4E4HA 2AENA 2J1VA 4Q29A 2ZTNA 3SHRA 4AVSA 3I2FA 3W5MA 4P9YA 2W5FA 2ZGTA 3J7NA 3NV1A 5CNAA 2ZHNA 2JG9B 4DRVA 2ZZQA 5I93A 3MLJA 4CEWB 4CP1A 2FCUA 3NO8A 4L9BA 4DY5A 1PZ7A 2BDRA 5IVFA 1NLQA 3FHQA 1QJU1 1UZZA 4CDWC 3N3HA 2PLV3 4NHKA 4OI2A 4CCOA 5FY7A 3N9OA 1OA3A 2QVSB 4H7LA 2GDFA 4AFCA 3S6PA 4D7SA 2CSGA 3VKMA 2E7QA 3LPFA 2WFF3 1V6LA 1SMVA 2WINB 4I30A 4YVWA 4LBMA 3WQ7A 1TVGA 2BNOA 1NCRB 3ZXEA 3QCWA 2K0GA 1F9KA 5A3UA 1RYYA 2D3RA 1KITA 3OPTA 2JB4A 3IBMA 1SFPA 3WOGA 3IM0A 5LA2A 1DYKA 3Q8BA 1SLIA 2XJTA 1FI2A 2R1DA 3I8TA 3V0BB 3W5NA 1X33A 2YU2A 1AXYA 2BGCA 3DGTA 3AM2A 1B09A 3WF1A 4LPLA 1AR61 1D4M2 2GP5A 1JW6A 2X10A 2CWMA 3JUUA 2VC9A 1DQ4A 2UYBA 1O3QA 2WAOA 4EN8B 3BYWA 2VZQA 2XLFA 2KD7A 5FYZA 5C3QA 2XKOA 3A7QA 3DECA 4G9SB 4NROA 1LR5A 5T5JA 3RGBA 2QJVA 1JUHA 3DEMA 2PFWA 4QXKA 3O7OA 3N7LA 1LGCA 2ATFA 4BJ0A 1JYVA 5C4WA 4Q4X3 2XL7A 5FZHA 4EN7B 4KL1A 4MH0E 1HRI1 4CCDA 2QDNA 1RL3A 4DINB 5LBFA 2XJVA 3MW4A 2O1QA 4CDUA 1UPIA 1DQ2A 2XVKA 3N9QA 1C1LA 2VQUA 2YMZA 3USUA 2EA7A 3KF5A 2RE9A 4OFGA 4AI2A 3AYAA 1QWRA 3EBRA 3J8F3 3W59A 2WFPA 4A2UA 5FO8B 4RGKA 5FPVA 3WNNA 2OUJA 4Y20B 4C91A 2QQVA 3TN92 1ZZBA 2QQNA 5AC92 2HBUA 1LU2A 3H7JA 1Z78A 3C3VA 1B35A 1VJ2A 1XNKA 2EIBA 3TNQA 1K5MB 4PI0A 3DKWA 1TE1B 2CV6A 5JR2A 3WQ1A 4AEKA 2NN8A 3HNMA 4R52A 3VZMA 4LO8A 3AC0A 4HANA 4NHLA 5KXEA 5DMYA 2W3JA 2P17A 1W3XA 1NLRA 2BERA 3Q8FA 4YGDA 2FDFA 1AJKA 3IMMA 4MO3M 4QPGA 1AR92 2JG8B 5L9VA 5A3TA 2GH2A 1UYPA 4IEVA 3PLQA 4S2DA 3GBGA 3MPBA 1NT0A 1V6MA 1O4YA 4QX0A 3NAPC 1UYXA 2JKXA 4Q0SA 3ILRA 3ME2A 4QPYA 4DZGA 4INDA 2EALA 4GH4C 1IS3A 3PDQA 4BMEA 1HRI2 1SLAA 3K75B 1S0CA 3AYDA 3RQ0A 5C33A 1OVSA 1WLTA 2VCBA 3KB5A 4MX3A 4D7TA 4UOJA 2RR12 3MLKA 1X7NA 4L11A 3ZDSA 5CAZA 1ULGA 2VOVA 4I2OA 4IEOA 1RUF1 4DRRA 1C5IA 2HWB2 5JVVA 2LRPA 1IKQA 1D0GA 4OYUA 4NIHA 1SHWB 1H4GA 5I0UA 2VZ3A 3PUIA 5JAXA 5FZBA 5FOJB 1OA2A 1CAWB 1TG7A 3MW2A 2CGPA 1OH4A 4E4ZA 2BNMA 4FQ4A 5FWEA 3POYA 2VNVA 4N8MA 3CJIC 1CN1A 4KWLA 2CYFA 2YC4A 5KBFA 1LCLA 2H0VA 4BISA 5IVCA 2JEMA 3TEWA 4DQAA 1JMUB 1MS8A 1RHI1 2VMEA 1QJX2 1XNBA 3RYRA 3WP5A 4COYA 4WVMA 4XUTA 1O4TA 2AZ5A 2HEYF 1WMXA 4XQWA 1O7FA 2E53A 4FOQA 4OULA 5EPAA 3TNPB 4GZ9A 1QF3A 5BNNB 5FY5A 4HKOA 5A7OA 2WZR3 1VPHA 5J36A 4RN5A 3VZNA 5JMOA 2ZACA 5FMOS 2CHHA 3ZIWA 3T09A 4Y33A 1DF0A 1WZXA 3MIEA 1JZ5A 4I3PA 4K1ZA 4V2WA 2ZGOA 5FP3A 1XU2A 5CISA 4FPHA 2A6WA 4NHYA 4C0BA 1OMIA 4Q26A 5GLWA 1H6YA 3TBDA 1GBGA 4AFBA 1HN0A 1JYWA 3BTYA 2F6BA 3JBG3 1GOFA 3WVJA 5EV7A 1GKBA 1W9SA 3THPA 4BB3A 1OBNA 3SNMA 4I3GA 4MG2A 3EO6A 2J1TA 1REDA 2RS53 3N7JA 4BQ3A 5C9AB 1ND3A 3UYJA 3W9AA 1DQ5A 4B4RA 1PM4A 4CYDA 2R061 1W8ZA 4E2GA 3USSA 3E1F1 1VBB1 1W6NB 4RGAA 4AYUA 3BTXA 1DZTA 3SH4A 5CADA 3E6CC 4AG4A 3VDDC 3NNFA 1XE7A 5BY5A 3T2QA 1WUVA 1J59A 4XJZA 2YFZA 1MS5A 1TEIA 3I97A 5E1RA 1QNWA 1KS5A 2Y34A 4YFWA 4XYXA 5BNOB 1ZRIA 4UXAA 4NIDA 2H6BA 5FPUA 3LEKA 3VD4A 2YGMA 1W0OA 1ASJ1 2HWD2 5FIXA 1XE8A 1PGW1 2XQXA 1US3A 5TSWA 5CU1A 1COV3 2V5DA 4YARA 5BNQA 1ODNA 2UYAA 4IE6A 4QQ2A 1W6MA 2CL2A 3O0WA 4NHXA 4CPBD 2LALA 4BK5A 1UZVA 2ZAAA 2Q8CA 4XUNA 3KHCA 3ZFEB 2BJSA 1HRV2 2DCJA 4UFMA 1W8TA 5BXXA 5J96B 4E4DX 4BH9A 2RJLA 1PK6A 4IV3B 2WR9A 1FPN2 1JZ4A 4CU6A 5EJZB 1EV12 1POV0 3DPRA 5A1AA 4RR3B 2Q8DA 4Y5SA 1PO12 4IE5A 2CDPA 2WDBA 5CZKA 3OBRA 3I2JA 1OXCA 2RS12 5L9RA 3OGJA 2B7YA 2WLQA 4CTEA 1BMV2 3JD73 2BFUS 4G3YC 4MGZE 1PVXA 4LIVA 1QHDA 4AFDA 5KWRA 1PO21 1Y4WA 1UY3A 4NPRA 4MSVA 5C8CB 2R0FA 4LR4A 3BUCA 2ZHKA 2WT2A 1FMD2 1UNBA 1LOFA 2HH9A 4CDXA 1IS4A 2QNKA 1JZ2A 5FQ0A 1F31A 1RUD3 3IAPA 1SBFA 4Q5OA 4YW2A 3AKTA 1VRH3 2PLV2 4KH9A 1ASJ2 1OLRA 1VMFA 3BALA 5FWJA 2V5YA 1ULPA 1RMU3 2GC1A 5A3NA 2YPJA 2WZPP 2ERFA 3PTYA 2IFRA 2XOMA 1WCDJ 4RFRB 1H30A 5FK7A 5FYSA 3CMGA 1UY4A 4LTAA 3T4VA 1L3JA 1ZZ7A 3ZXFA 5FMBA 1ZZCA 5FY8A 3VKFC 5DUVA 1IGOA 3FFQA 4CZSA 2VOKA 1OUXA 3HIFA 4QB1A 4WM7B 5HV0A 3BKZA 1OD5A 2YPDA 2RS33 2VD7A 1H1AA 4FP3A 1X8MA 2D93A 4LHSA 4TLFA 4AOCA 2VUJA 3MFCA 4AI1A 4LKFA 2D43A 2X5IB 3VB9A 3N7MA 2IUWA 2W1UA 4FSJA 3BTZA 1UX7A 3APBA 2ZMLA 2FZ1A 4GKXA 1MACA 2ZX1A 4AEDA 1SG3A 3RYKA 3SKJE 1BLZA 4LE4A 4CEYC 1JZ3A 4OUEA 3E5UA 3IDAA 5FZEA 5LBBA 2EVXA 4Q1RA 1NXMA 2O8OA 4XJ9A 3NWKA 3P3NA 1UO9A 5D8AC 4FAGA 4CDQB 1XRUA 1X8EA 3FLPA 1LOEA 4JGZB 3VDAA 4COZA 2R32A 3NL1A 1ZBE1 3QOPA 1UY0A 5FFOC 5FY0A 4DY3A 1FV3A 2BGPA 3LDKA 5DZGA 1FOD3 3UETA 5CIRA 3BI3A 4HVQA 4YW7A 1CESA 4H3WA 3IIIA 2Y6GA 5DQ0A 5A33B 1BBT3 3FN9A 5FP9A 1CD3G 2Q1ZB 1IHMA 4LO5B 3M8LA 5FZ8A 5C5TA 3M7AA 1DLCA 4PI2A 2VOXA 3WD5A 3I2DA 4P9XA 5EIYB 3IPVA 3J7HA 1NOVA 4ZY9A 3S5QA 1J58A 1LEDA 1LHNA 1MPXA 2W9XA 2P6CA 3AL6A 4LBQB 2ZKNA 5IVEA 3MZHA 3PNAA 4EN6B 3OYWB 3ILFA 1ZRRA 2ZEYA 1CONA 1FV2A 3A23A 3B01A 3FUOA 1MVEA 1YFXA 3OD4A 1QXRA 4Y24A 4CCJA 5IK5A 2XBO1 3WNLA 3G6JB 1HQWA 4Y22B 1HB4A 3WT3A 1FNZA 1YUDA 2VG9A 3R4UA 4EN9B 3V0AB 1PX4A 2I74A 4AFMA 1LB2A 2HWF3 3AMQA 3NMBA 3SQOA 3RMXA 1Q3EA 1VBA1 4S2HA 4C1WA 2WQZC 5FYYA 3WNMA 2ZMNA 3AX4A 1LHUA 1UPSA 1OHFA 2YHJA 1LECA 3AMNA 3WUCA 2WQ4A 1W6QB 3ZDVA 4QU2A 1H2MA 4OHVA 3DYPA 1PHMA 1N1VA 4XPVA 4GMP1 4LITA 2PMWB 1DLLA 2CAUA 2PTMA 3VBFB 3T3YA 4GWMA 2GSYA 1CAUA 1O59A 4YVSC 3VBRB 2VTXJ 4GALA 5JSOA 3POBA 4KWKA 3OBTA 4P08A 1GFF2 1AL22 1QDOA 4R8HA 3ZYGA 4FVVA 4TWTA 1L7LA 4OMDA 4XDPA 5BYNA 5C8WA 4Z92B 1SPPA 4QKNA 3WCRA 1W2TA 4QB2A 1KJLA 2RDSA 4JGZA 4WV8A 5LA1A 2Y8KA 5L7OC 2D44A 4HBNA 1VMJA 2WABA 3O12A 4N53B 2WO3A 2VVEA 1GZCA 4IEUA 3FJSA 3NW4A 1ZM1A 2OPKA 2Y6HA 3KZ4C 5A33A 4GWNA 1W9FA 5EJ1B 3H8XA 3P1IA 4FPYA 4XF1A 1XYPA 2JDAA 1KGYA 1ULDA 2ZKLA 2EIGA 1PZ8A 1GQPA 1RUNA 4XF9A 5I0SA 4A6SA 3CZUA 3T2TA 4NMIA 4QDSA 1OSGA 5CBLA 4ZS3A 1H2KA 5A1LA 3WUDA 4QX3A 5CA6A 3VZOA 1DU3D 4A3ZA 1NQDA 3E97A 4DXTA 1CIWA 1YC61 2EXIA 1HXS1 1C4RA 4P00B 4BQYA 5GZDA 2AYHA 4ASKA 1WCUA 3SC7X 4D0QA 1V0AA 4XE9A 2BZDA 1X50A 2BOJA 4Q0UA 1UYZA 1Y9GA 3RDIA 5J37A 5A6ZA 1D4M3 3FMGA 2ZX4A 1WBLA 4M01A 2D97A 3HAGA 1RXFA 1RUJ1 4RFT0 4RHV2 4JGYA 5A3PA 4K6BA 3RI9A 1KFXL 3WF2A 4BDVB 3B93A 1GP6A 3CZJA 3MI8A 3VBFA 4D69A 2BOIA 1QJU3 1DCSA 4IEZA 5HCAA 4FTBA 2XJSA 2V09A 5CFCC 4M3CA 5DG2A 4YZ1A 1W6OB 5FLIA 2VNOA 4O9GA 2VUAA 2Y6FA 3H1MA 3KGLA 4N43A 5T3NA 3FHIB 2JE8A 3HQXA 1I9RA 1ZYBA 3FHAA 5C3RA 3AZZA 4IV1B 4HOOA 3A0KA 1X9PA 4PF5A 1D7PM 2XUMA 1SQ4A 3LQCA 3M3CA 1ULOA 1UX6A 2W0XA 2WNUB 4JC1A 4LO4B 5J09A 1BVP1 3TN93 4BQ2A 1C8M1 5AC93 3VBUA 1DIWA 4AAPA 5IFPA 1JODA 3R0RA 5LA9A 2TUNA 1H8VA 3E6DA 1AR81 2P2KA 3U75A 4DUWA 3RZKA 4AVVA 4JAAA 4GKYA 4QAWA 3VBSB 3B5LB 3S7EA 5HCFA 1LOBA 2A1XA 2YG0A 3ETQA 2LUWA 2ZHLA 4FP2A 1GQGA 3KT4A 3AZVA 1SLLA 4RS5C 1N3PA 3OF1A 1LGNA 3MF6A 1E5IA 1PIV1 2GNMA 5J98B 3NV3A 3D82A 4PDWA 1AR93 1CAXA 3I3EA 2D5HA 4FPCA 5IWFA 3H3UA 1F5FA 3CLPA 4P9GA 3ZX7A 2ES3A 2J1UA 3KCYA 4B4QA 5LY2A 2ZOEB 5FYTA 4CCMA 2AR6A 3THDA 2HEVF 4CU8A 2V4AA 1SCSA 1HRI3 3MIGA 2XVLA 2B9VA 3QD6A 3ATGA 3DYOA 4GJZA 2ZABA 3LKJA 1AYM1 2OX0A 3WDTA 4BYYA 1IPKA 4NAOA 1TMF2 4CDWB 2VXRA 4O7XA 3ZO0B 1GWKA 3MV11 1YI9A 4BHPA 4YW6A 4YNIA 5EP9A 4Z8BA 5DDJ2 5B4NA 1RUE2 3D6EA 4P5HA 1DGWX 4H14A 4LIUA 1S0EA 4HKWA 2WNOA 2GMEA 1RMU2 3B02A 1HQLA 5FXZA 1WCSA 1VBD1 1KS4A 1UL9A 4IL7A 4XILA 3UK9A 3FLTA 3I2IA 4NPMA 3GALA 5L73A 1QKQA 5KHGA 4YG0A 2VTFA 3OB8A 1PM7A 3N9PA 1BK1A 4HPKB 4OUMA 1NA1A 1UMZA 2D98A 1JHJA 2DCTA 2VOTA 4NOTA 3LAGA 4QPIA 1WLCA 2V4VA 3BN6A 1O3SA 1ULEA 4IQPA 4BCUA 4EZHA 4HL0A 2VZSA 5F2WA 1U5XA 4KI5M 3MIBA 1QJX3 1RUI2 4B3NA 5LK5A 3GZEA 3RZZA 5M0TA 2X09A 5F5AA 4MYEA 4QX8A 4RGGA 3O1TA 4HONA 4OI0A 3JB8A 5DN2A 3FX3A 3IT8A 1TME2 1N1SA 1RTVA 3H8UA 1G9FA 1VB4A 2BTVC 1UU5A 2BVVA 3IZOA 2W47A 3VBUC 3ZXLA 3KD4A 3B00A 4RQPB 5E16A 5FCCA 3RMYA 5F9TA 5F7UA 2GMPA 2TBVA 4QGMA 1W9TA 2PHWA 1VE0A 2A3YA 2EXKA 4ORFA 2MEV1 2W1WA 1FOD2 4QU1A 4YM0A 1K5JA 1HV0A 4AI0A 4CUGA 2JE7A 1OQ1A 4YW1A 1RUF3 4PQ9A 3RWNA 2D7FA 3MIDA 5K9YA 1TNRA 2PHRA 4XIKA 3HN3A 2RDRA 2HYXA 3VGIA 3B9IA 4GA9A 2ADDA 3T0DA 3OY8B 5T55A 4B8EA 1QJY2 3O1SA 4LT5A 3ES1A 2PAKA 5LWBA 2A3XA 5C3PA 2C0ZA 2NZ9A 4QGNA 3ZN6B 4Z2AA 5HV4A 1RUOA 2K2SA 1POQA 1ENXA 1EPWA 1RUC2 5FO7B 2ZXQA 2XXZA 4AGVA 3MUY1 2QFEA 5FZOA 1GQHA 1TQ5A 2CU5A 3U14A 1RHI3 2JECA 3ZSMA 3SKVA 3WDXA 1AYN1 4BQWA 5JZGC 3ITQA 4HK8A 5HXMA 2WL1A 4FPOB 4FTEA 2ZAHA 1JOJA 2BBVA 2HWF2 4RYDA 2VXJA 3B7MA 4BQ4A 5FTTC 5CFDC 2VNRA 4XFBA 2WS91 3U4SA 3EMRA 4J1WA 3WQ0A 3GM8A 2R071 5C3SA 1FAYA 5CEHA 3OEAA 2GMMA 3VZLA 2VMCA 1UN1A 1HRV3 1NCQC 3BGAA 4JHZA 4ZU5A 2Y26A 4XJ8A 1ND2C 1CZTA 3NQHA 3C2UA 4XZPA 5K0UA 4JTNA 2E7AA 5F37A 3NAPB 4W65A 2E31A 1EV13 1YHFA 4Q4W1 3TEXA 5ABJA 1PO13 2AEZA 5FYUA 1MEC1 1NY71 5C7GA 2PELA 1Q8QA 4PJYA 4MXVA 2HWC1 4FPKA 1ZBA2 2WYSA 2DUPA 1VBB3 1EAH1 1ST8A 1V6JA 1YLLA 3RJRA 2ZEWA 3VBHA 4HSLA 3H8OA 3VBOC 2W2IA 5KHHA 1PVC2 1VBC2 1RUH2 3OCPA 4CXWA 4DUXA 1LRHA 4RQPA 3AP9A 4CU9A 1PZ9A 1C5HA 2RM21 3KV6A 2GN3A 3ZFFC 1IS5A 2IFWA 3O1MA 2ZGKA 2ENRA 1S4CA 2VZOA 1J83A 4MGIE 1FMD3 2Y64A 4N9HA 2YROA 4XF3A 2XJRA 3TB0A 3EHKA 2R0HA 5A32A 1ASJ3 2CGNA 5FPAA 1W3VA 3ABZA 3F95A 3C7HA 2QQOA 5F2SA 4UBGA 1IQAA 5L19A 4NR1A 1E5SA 2XDVA 3CJIB 2PXJA 2H0BA 3ZFGA 4AQTA 1JXNA 1XSRA 1EYBA 2E63A 3ZN6A 4OZOA 4M3CE 1KDKA 3TYJA 4UW4A 1BKZA 2R042 3GBFA 4XXPA 1H8TA 2YDEA 3I3BA 4Z82A 4F8AA 4Y1VA 3ALQA 1AJOA 1UKGA 3N7KA 3LFIA 4NN0A 4A42A 1LKNA 3TWIA 1WW6A 5AFBA 2CAVA 4YYOA 4AI3A 4OZXA 1AR71 1MQTA 4R9CA 1POV3 4ZXKA 3U37A 4QHOA 1GWLA 1RUG1 1CJPA 5BV6A 4AE2A 2D6MA 4LOSA 5ACA1 2EICA 1PMHX 5JPMB 2OT7A 1OOPA 2R6QA 2BBAA 5FXWA 3GJAA 4ISRA 2WIIB 2DVDA 3ILNA 2E33A 1HB3A 2YBPA 1H0BA 3KS7A 3ZXKA 4XABA 4ZHNA 4UAPA 5CG9A 1DGLA 1N3OA 1YQ2A 3WNXA 1IZ3A 2WA4A 1W6PA 3LD8A 4TLGA 2DBIA 1QJU2 2WNVA 2PHFA 3VHOA 4ARXA 5HBAA 2GNBA 4QM9A 3ST7A 5A3WA 4Q8KA 2RMU1 4FQZA 5JOXA 1CIYA 3ZLIA 3HJRA 4IGQA 4Z1VA 3FLRA 5FUPA 4CCCA 1HJGA 3OBZA 2VU9A 1A6CA 2Z69A 4WM8C 1OH3A 2JG9A 4DB5A 2DDUA 4Q4Y1 2Y33A 3WDYA 1BK0A 3M3EA 1FXZA 4CEWA 2D6NA 1O8SA 3DF0A 3WP3A 2R49A 5GZCA 3D4KA 2A70A 3POFA 4Q4V1 2ZX3A 1Y9QA 1YIPA 4RA0A 3WW1A 2YZ4A 2ILMA 1WGPA 4OHYA 3MUZ1 5JWPA 1AVBA 1TZOA 1NZIA 5KXCA 4E2SA 2DUQA 3GDBA 1HB1A 4FFFA 2WA3A 5DAXA 5BNPB 4S2FA 5DZEA 3UKTA 1WA6X 5JOWA 1XB9A 4W6XA 4AXOA 1AR62 4C1XA 3MDPA 4DUVA 5FOBB 1OFNA 1VAVA 2XGXA 3POEA 1NCRA 3LZZA 4UW3A 5FXVA 4LJHA 1D0HA 4M3CF 3JXSA 5KR7A 1GYKA 4YVWC 4ZZ5A 3T30A 4SLIA 2PYTA 4D7YA 1MS3A 4UW6A 2ET1A 2FD8A 3D0JA 1UD1A 3V0BA 1C28A 2OYZA 5C71A 5I0DA 4DEQA 3Q8EA 2RMU2 1LHVA 4COUA 2VPVA 1S0JA 3EXUA 1KDMA 4H7MA 2JX9A 1AL23 1H1IA 3NKGA 3TAYA 3EJKA 4QKBA 2QTWB 3E5XA 3HQUA 3VHRA 1W8UA 1RVF1 5FR3A 2NP0A 4UF0B 1N47A 5I8SA 4H55A 3M4FA 3PTRB 2D6PA 4XUOA 1V6IA 3GBWA 2ZPXA 3ZYIB 2YC0A 2Q8OA 4CCLA 1R081 1EUTA 2KA3A 1V6OA 1T6GC 2ARXA 1LOAA 1PGL1 2J1SA 2Q0AA 4B29A 5F5CA 3X29B 2YB7A 2C4XA 2XBO3 2B39A 3R05A 4GULA 4JRLA 4P9LA 2V73A 1C3HA 1E5RA 3Q8CA 4IW3A 1H2LA 4QB6A 5EHDA 4M4RA 4IDZA 3RZGA 3OJBA 4Y1ZA 2VZUA 1W04A 2O14A 4PF1A 1CWPA 5I91A 1JTZX 3BIEA 1MZFA 3WF0A 2JB8A 2WLPA 1IG0A 5C4WC 2Y6LA 2PHTA 4XACA 2P3JA 1J3QA 3PVNA 2J1EA 4JQRA 1ZREA 5FMCA 4DEVA 2ZGPA 4E9KA 3I7DA 4CE8A 4CEWC 4GMP3 2DVBA 4NRMA 4Y20A 4NIAA 4B1MA 4CDUC 2HEWF 4N90A 3I2OA 1DP0A 1BVVA 2LTNA 3KV9A 4X8PA 3UT0A 5IT6A 1K5MA 4PLMA 5T5LA 3ZYJB 4GWJA 3MIHA 5D8AB 2GNDA 4MADA 3FFZA 5FXXA 3IN9A 4AL9A 1B35C 2X8KA 4IXLA 2ZX2A 1JUIA 4QKFA 4IGOA 5FKBA 2YUEA 4KBBA 1Z7S1 4AVTA 4RHV3 4E8CA 3C7EA 1CX4A 1CZSA 1ZZ6A 5DZFA 1NCRC 2JG8A 4XBQA 3ACFA 1GOHA 1RUF2 4ZS2A 3CL1A 1WD4A 4L2NA 1NXD1 1QJFA 1G9CA 3IB3A 4LBJA 1G7YA 1Y3TA 4PT6A 3TRSB 2NQYA 4QPGC 4M0HA 1YJLA 2HLEA 3KCXA 2PHXA 1DYOA 4J25A 4JTOA 4LBKA 3CDZB 5JOYA 3LOIA 2XLGA 3WEZA 3SH3A 3ZPYA 2D6KA 4BLIA 4HVOA 1YWKA 2QQPA 2WWUA 1BEV1 2RHPA 1QOSA 5FBJA 1ZZ8A 4LHKA 2P3IA 4L92A 4GB31 1RHI2 4TXWA 5IW0A 4FPEA 4PCRA 3HT1A 5FV3A 4CCEA 4EWEA 5FZIA 1GP4A 4K8FA 3IDEA 4K40A 3THCA 2EAAA 2XHNA 4PLOA 1UU4A 1X82A 4XAAA 1BXHA 2ZHMA 3OGSA 5GLZA 4YM3A 1W99A 3GHMA 2BGOA 1CAWA 3EB7A 5FPLA 2B4KA 5H9SA 3S5AA 1QU0A 3AJYA 2XVGA 2JKBA 4CXXA 3K51A 3NVCA 4D94A 5B2GB 5IYYA 5JSRA 1WCKA 4AZZA 1S0IA 3BOPA 1V00A 4XC9A 5FUNA 3THTA 2DWRA 1LEMA 4OMCA 4JQTA 1XNAA 3B94A 5IK4A 1ZRDA 2HWE1 3AP6A 1J3RA 3OPWA 1WMDA 4JDNA 3FUQA 1BCXA 1QJEA 1W2AX 4URTA 5JIUA 4DXZA 1ODMA 5BNNA 5CYYA 1APNA 2R062 4MXWB 4JZRA 1VBB2 3VKLA 2XWBB 2OS2A 4JVAA 1R1A1 4CCNA 4UBHA 3UV9A 1W90A 4CP9A 4BLJA 2DVFA 4D3WA 2WSUA 5D2AA 3ZKUA 4FFGA 5D1IA 1DQ6A 4AF9A 2P6HA 3CBNA 5F39A 5L7OB 1SZBA 1K5MC 2GNTA 3UKVA 2GP3A 4AHZA 4ARYA 1XYOA 2VW0A 3AYCA 5A6QA 3OTFA 2JWPA 3LA3A 1TMF3 5T5PA 2FCTA 3ZXGA 5IAVA 3ZR6A 2Q1MA 5FPXA 1J84A 1RGSA 4N9IA 5DDJ3 1RUE3 1XOYA 4MHUA 4ZKTB 5C9AA 3UL2A 2IVJA 1HKDA 4X8NA 1PGW2 3PU8A 2Z2SB 5FY9A 2UURA 2F4LA 1F4AA 1W6NA 1QQP1 1C8M3 1NAEA 2J22A 2JDNA 2JG8C 3PHMA 2VMGA 4QD2A 1AX2A 4LEJA 4YSFA 5FRAA 3L9JT 4AEMA 1ZRCA 3ZOIA 1ND3C 3EYPA 2QQIA 3MO4A 1JYCA 5H9RA 2QQKA 1PX3A 4E2QA 1PMJX 2XJPA 2ZCWA 4IETA 1W03A 5G05L 2YBKA 2F4PA 2UY9A 3AXDA 4YM2A 4DPNA 5BNOA 3AKQA 4MVTA 2XH6A 3T08A 4MHRA 4URAA 1WD3A 4XTMA 2AEYA 2B45X 3O1RA 5GLVA 3B3QE 4CUCA 1RUI3 4OI4A 3WINE 4A3XA 4LK6A 4MOAA 1CVNA 4LBLA 5T50A 3I54A 4E4SA 4CVUA 3UNPA 1OPMA 1FNYA 2VBBA 2D40A 3PVBB 4LORA 5FZ6A 4Q4X1 4P14A 3AZWA 1JZ8A 3M2MA 2PAMA 1TME3 2QQLA 4Y4YA 2JIJA 3M3IA 1PO22 3POGA 3ZFEA 1ENSA 3GZTB 3ES4A 4JKLA 2C9AA 4R4ZA 3URFA 1ULFA 4YLZA 3POSA 2WKKA 3IAQA 1HQNA 2A7AA 4IV3A 4AHXA 3J8F1 4BWOA 1GUIA 1UU6A 2JE9A 5DAWA 5CFCB 3VHPA 2RVAA 2DTWA 1JH5A 4RR3A 4CA9A 5BUVA 2WYFA 4QXBA 5LK7B 4XFGA 5KHKA 5FP8A 1PK6C 1DFQA 4MXWA 5F3CA 3KV5A 1W8HA 3BIWE 1QQP2 4XUPA 1VBD3 3DPRC 5FPBA 1SBDA 2D5FA 3DN7A 1PNGA 5IATA 1QJY3 4QX2A 3FE5A 5C8CA 4DXRA 1OUSA 1YXWA 5A6YA 3AFKA 3A21A 1RUC3 1YO8A 3PMSA 1I1EA 1YQCA 4KMQA 4PIZA 3NJVA 4CDXC 1LOFC 1QXJA 3J4UH 3MEPA 2GZWA 3K48A 4GQ7A 5A7WB 5KXBA 5FREA 4CUBA 1I6XA 2VULA 3ZM8A 4YW4A 2VQTA 2ZS6B 4XETA 1F35A 3M1HA 1PMIA 4A7ZA 2X29A 4RS5B 4BIFA 1HLCA 1SEFA 5GJ6A 5LCWL 4K20A 1ZNPA 1W2UA 4WM7A 3LEGA 1YCIA 3ACIA 4BQ1A 2YBSA 3CKHA 1ZBE2 3BCWA 4GMP0 3I49A 2B9UA 2DFBA 2MEV3 4GIQA 5JI7A 4O61A 4P9WA 1R091 2X5IA 4QKDA 2ET7A 1FT9A 3LA7A 4B1LA 3N35A 3I59B 4OLLA 3ZSEA 3VDCA 2PAEA 1GICA 1ZBA3 1SDWA 1OKQA 1GSLA 1PVC3 1VBC3 1RUH3 1CPMA 3AB0A 3JU9A 3K4DA 1IPJA 4FOWA 4QWNA 1GNZA 3RYPA 4AEDC 4CDQA 1LGBA 4EJRA 1JU4A 4XDOA 5CKQA 1VALA 2DVAA 1YI7A 2P4EA 1CJDA 2ADEA 4UYBA 2GC2A 3LB9A 3ZSJA 2ZEXA 2E9QA 5KHJA 1XJAA 4F83A 2XBO2 4NUBA 4IUGA 3AVRA 2WO1A 2BVBA 2BEOA 2WZR1 4U2AA 1GP5A 4OQ9A 3WP4A 5GZEA 2WT1A 4ASLA 1VBA2 3LFMA 2JDHA 1VRBA 2VR4A 2Z4FA 2CGOA 3POIA 4QQHA 1UWWA 2EXHA 2VL4A 4LBQA 2XHKA 1VMHA 2R073 2R043 3OYWA 3PJYA 4HK9A 3JBG1 4Y5Z0 3HOBA 4BM8A 2OZJA 4QQPA 1GWMA 1H1MA 4BMBA 5JLVA 4MGTA 4AAXA 1CAVB 3OBAA 2RS51 1JBCA 3SCGA 2FDKA 4Y22A 4FTSA 4Q4W3 2VMDA 3V0AA 1MEC3 4IESA 4ET7A 1SDDB 2ZGQA 1W39A 3D3AA 2A5ZA 1RIRA 3KV4A 3B9CA 1VBE1 1WKYA 1EAH3 2VCCA 2SBAA 3IMNA 4I0WB 2Y6JA 5J48A 4D6SA 3O1PA 1AL0G 3PU3A 4A45A 4NO4A 1JU3A 1N1TA 2RM23 3K3NA 3W20A 3ZYHA 1W6QA 3D0SA 3OSDA 2BP6A 3MIFA 4U36A 1XYNA 3GGLA 1XNTA 1RINA 4XQDA 3WG3A 4M00A 4XFFA 4Y1YA 4P02B 1MS0A 3T1LA 3KCCA 4IEPA 2P1BA 3JQXA 4X6RB 4A7YA 3VBRA 1COV1 1GZWB 1ONAA 3U78A 1JYIA 3ZN5A 1BZWA 3HN1A 1H4HA 3R6SA 3U0ZA 1TNFA 1GNHA 3PUSA 1VAKA 3KT1A 3RWKX 2YC2A 3MICA 5I8TA 5JZGB 1OQEA 2ZX0A 5C70A 1UY2A 1YIFA 4MGYE 4N53A 4LNVA 5IK8A 1IS6A 1W2NA 4JGZC 5FZ7A 2VM9A 1RC6A 2XG3A 1G9DA 2VBPA 3TEYA 2ZGMA 3L2HA 1HXS2 1S0FA 1AR73 3NV4A 3WR0A 3KT7A 5CFDB 2QQWA 3JD71 5LBEA 4DMIA 4O65A 2LW8A 3LIHA 4CP9B 4NWWA 3SLIA 4Z07A 3VZJA 2YV8A 1MZ5A 3H7YA 1AR63 3PVEA 1UOJA 2BU9A 1NCQB 3LE0A 3P5BA 1S0DA 4NRPA 1ND2B 3KWVA 4WVZA 3RNSA 3WP6A 4K1YA 1JHNA 3ZN4A 4CXYA 4KU8A 1RUJ2 1H9WA 2VE1A 2QDRA 2WWSA 1Y9MA 5FYMA 1RUD1 2I45A 5JOZA 3UGHA 1X36A 1OI6A 1VRH1 4R9DA 4YGBA 5IK7A 5KXDA 3GF6A 1AHSA 3OG2A 1DBNA 1XNCA 3LDRA 3KF3A 3U11A 1F15A 3VBOB 5FBZA 4PLNA 2EIEA 1O91A 2RMU3 2WZEA 4QX5A 4XIOA 5JUVA 4E27A 3Q8AA 3ZFFB 3KMHA 2DURA 4HN1A 4XXAA 3NNGA 4AQ2A 1OQDA 1MS9A 2V72A 4K9SA 2NMOA 4E8DA 4YM1A 4QMAA 1K45A 1U5IA 2IXCA 4QGLA 1US2A 2ARAA 1I3HA 2RS31 4B7EA 2X05A 3INAA 5DUWA 5FZDA 1QEXA 4LA3A 3ZYRA 5A7NA 3WW2A 1FATA 2D3SA 3KHBA 2VW1A 2AH2A 1IOAA 1KXGA 4RL7A 4JGYC 3GZUC 3N9NA 1ZX5A 3Q9OA 1W9YA 1JYTA 1S2BA 1W6OA 1C8M2 1GZ9A 4HVRA 2DBNA 3K77A 2TEPA 4L8QA 3VBFC 1ENRA 2W39A 3RZHA 1AR82 4HZFA 4I09A 3ASIA 4XMIA 5FLJA 1A34A 5J3UA 4P5YA 4NIIA 3P6BA 4IGPA 4IV1A 1ZVFA 2F17A 2OIIA 4N43C 3ZMNA 5EXOA 1K42A 1CPNA 3AFGA 4LKSA 2XQRA 4EWAA 1YFYA 3IIAA 3LSEA 2VY0A 1PIV2 2OVUA 2WNUA 2HYKA 1NE6A 3WW3A 1SLBA 1WWYA 3AKRA 1YQ5A 4AI8A 2EAKA 1BBT1 4N53C 1H6XA 1KJRA 1W0PA 3AMMA 4Q0QA 2B8MA 1GNYA 1FYUA 2Q30A 5EZWA 3NSTA 1OT5A 4HT1T 1O5UA 4WVWA 3VBSA 1ALYA 2W1QA 3ENRA 4AK3A 4HMZA 1A78A 3POJA 3RZJA 2B42B 3U1XA 1AYM2 1WMFA 1XU1A 4MV2A 5HPOA 2ZGSA 3RVHA 1OC1A 3DCQA 5EJ3A 4GAZA 5LATA 2VH9A 4YZ3A 1GR3A 1K3IA 4OVEA 4K8RB 5A7PA 4C0HA 1VBD2 2G9ZA 1K12A 3C7OA 2WNEA 1NLSA 3CU7A 3GJBA 4WM8B 1BQPA 2XONA 3AMPA 4FXGB 4PDWC 4OHWA 5CG8A 4NRQA 1G9AA 5IFTA 2WO7A 4PBPA 3WDWA 2RDQA 2FQPA 4J1XA 4LOTA 2C5DA 4GD4A 2OA2A 4CDWA 1KFUL 3LOBA 4A4AA 1UQXA 3MYXA 4XF0A 3VUOA 4XFCA 3OPZA 5SV5A 3H42B 2P3YA 5GZFA 3D8CA 3VKNA 5D21A 5HCBA 3RI8A 2Q1FA 5EWSA 3ZYBA 1JN2P 4DO0A 1EUUA 3T2OA 1I5PA 2G9GA 3VD5A 4JX0A 5APAA 4FO9A 5CB7A 5J7MA 1JYXA 4HPKA 4SBVA 1QDCA 4TZDA 1YFUA 3JZVA 4YVWB 5FZ1A 1STMA 3GCWA 1SFNA 2QE3A 4FFIA 4WZCA 2MEV2 1NA1C 5K4LA 2WBKA 3J9SA 4QPIC 1G9BA 2DTYA 2R30A 5DAVA 3V65A 5DG1A 1D4VB 3N36A 5I8YA 3HPNA 1LAJA 4GH4B 1W05A 2XLAA 2R063 2JDKA 3K46A 5FMDA 4YRDA 3ZPOA 2PHDA 2FCVA 4XJWA 2NM1A 1CZVA 1IG3A 2VQAA 3KSCA 3ZYPA 1O3RA 2VUDA 1OPOA 1QXPA 3A4UA 2RDNA 4HETA 4W6WA 3L2YA 3PVOA 1RITA 2RJ2A 3OGVA 4QDQA 1VAMA 1LHOA 2XR4A 4ONUA 5JXGA 4PIYA 2CWSA 1U5YA 5ISLA 1JS9A 1AYN2 4L99A 4FBFA 3ZIXA 1JZ6A 5FZGA 1C1FA 3CQOA 3OY8A 4CP0A 3UGGA 2VVFA 5C4WB 2ZGUA 4R4XA 1WLWA 5E6HA 1D4M1 1H2NA 2WS92 4AR2A 5LY1A 5LB6A 2R072 3PL0A 1QGLA 4DNYA 4CDUB 5IHRA 3OGGA 3VHNA 2VW2A 4TN7A 3T1MA 5EYYA 5EYXA 1T2XA 3USUB 1OD3A 1IKPA 1EPZA 3N4MA 3AMHA 2HWE3 1W8WA 2VMHA 4Q4W2 1WMEA 2QUOA 1MEC2 1NY72 4D6RA 1GZTA 2VO5A 2ID4A 4JKKA 1B35B 2HWC2 2R16A 3AP7A 4NHMA 5ANNA 1EAH2 3HVDA 1R1A3 2E7TA 2J1AA 1V6KA 2B5HA 3ACHA 5DXDA 3ZR5A 4LUMA 4IE7A 4YGEA 2PQSA 1PO23 1OLQA 2RM22 3KQRA 4GXLA 4XDQA 1FX5A 4UFJA 4L97A 5F6KA 5JDBA 1RXGA 4EWDA 4F3JA 5H9PA 4I0BA 1O4ZA 2QQJA 3OD0A 4ZONA 1LTEA 3NAPA 4GWIA 1BHGA 1LJ7A 2P34A 3UGFA 1YFWA 2Y60A 3NNLA 4ATFA 4QPGB 2BFUL 5FZKA 5K0UC 3TN91 4XQ4A 4GH4A 4DOUA 5AC91 3M70A 3R4DB 3VDDB 2J7MA 2FDJA 1LOGA 2WO2A 1QQP3 3WG2A 1YJKA 1MVQA 5DPNA 3VD3A 5ABJC 1O8PA 5HI0A 3QBQA 3WNOA 5FYVA 5FKCA 2XL9A 1ACCA 2VCAA 3NJZA 3QH6A 4YGCA 2DFCA 5JXIA 3WCSA 2YU1A 3VBHC 3R4SA 4LHLA 3ACGA 3WG1A 4LQRA 3RRDA 1V6NA 3T0BA 4RQPC 3VKOA 5KHIA 1WBFA 3V56A 2XPJA 1AR91 4ES9A 1AR72 3CJXA 3CIHA 3M3OA 1UMHA 1RUG2 1AXKA 2OUHA 4BU2A 3JB4C 1JZ7A 1W28A 2BWAA 3FC0A 4LMFA 3CJIA 5ACA2 2QZ2A 4YZ5A 3KVAA 4DFSA 2CTVA 5IVJA 3OEBA 3I3DA 4MGQA 3GYDA 1V9U1 1ULCA 2B46X 2RR11 3A22A 3GXUA 3ZFGC 2I07B 2VECA 3HMYA 5FPZA 4AVAA 1U5ZA 2FDHA 2OKXA 4LK7A 2A75A 1ZBE3 3ZXAC 1KQRA 3HNYM 2VMFA 2ZZJA 4YG3A 3AKPA 3ZSKA 4D8MA 1H8TC 2JDZA 4WVMB 1WW5A 2W87A 5FYIA 2HWB1 5L36A 1LENA 2ZGNA 1WW7A 1S2KA 5A3MA 2DV9A 2JDMA 2A6XA 3U07A 4P9JA 2J42A 2WZ8A 3WNPA 2KXLA 1MQTC 1W8FA 4IEXA 1MZEA 2JDPA 3CO2A 1VLNA 2GC0A 1QH6A 1VR3A 2LM3A 4Q4Y2 4IERA 1MZ6A 3UJOA 4CP2A 3BOWA 1OOPC 4NPLA 1UZ0A 2ZA9A 3AP4A 3FWEA 4LULA 4Q4V2 4XHBA 1QJX1 2VTXA 2JIGA 4XAEA 3D5OA 3N9MA 2BW8A 2C24A 3PIGA 5FUIA 1MR5A 4COVA 5T5OA 3PUHA 3VDDA 1ND3B
chains in the Genus database with same CATH topology
4R9AA 2WNVC 3G7DA 4XJAA 1DGRN 3H1WA 2JENA 2AREA 4LBNA 1KD7A 1VBA3 4OUSA 3VZKA 3P3PA 1AX1A 3VLBB 1V9U2 2Y0IA 3HR9A 2Y0OA 2JG9C 3AK0A 4QHBA 3H3ZA 3KLSA 4G4FA 1R093 2JJ6A 4K7JA 4CEYB 2Z5WA 2YYOA 3WDVA 5JMCA 4OHXA 5BNPA 3CNAA 1CQ9A 2E6VA 3ZVXA 2YXSA 3DUIA 2O0OA 1XNDA 1W6MB 1LOCA 4KGGA 3W58A 1RVF2 5E8AA 2A6ZA 3PJQA 1R082 2P37A 2VGDA 1PK6B 3H50A 1PGL2 4LHNA 2GU9A 2HWD1 4B4PA 5K7PA 3DPRB 2A6VA 2JICA 2FHRA 4AHYA 3ELNA 3RJ2X 2JD4A 4ATEA 4W6YA 1HV1A 1WW4A 2QKDA 5K8SA 4YZ4A 1MS1A 4X6QB 4YW3A 1SLTA 1YNAA 2NPIA 4XTPA 1HRV1 5FLHA 1REFA 4CDXB 1H9PA 1O5LA 2Z42A 4C90A 4J6GA 4XFAA 1FPN1 5FQ0B 3S0MA 1EV11 2ZGRA 3E5QA 1UW8A 4XBLA 1PO11 4XHXA 2Q5TA 2RS11 1HXS3 4XBNA 3PMEA 1Y43B 2FMDA 2GN7A 4V1PA 1BMV1 3SCHA 4KGQA 3POWA 4BA6A 1VBE3 4N7IA 4Q0VA 3ROUA 3IKWA 3AZYA 1F8VA 1URXA 1HW5A 3B69A 4FCAA 4XW3A 4S2GA 1FMD1 1Z7S2 2PHLA 1RUJ3 4HN0A 4FT8A 2WSVA 3I4IA 1AXZA 2A71A 4WBBA 2ARBA 4YVSB 2PLV1 4CEYA 4XOGA 2XB6C 4LBQD 1GV9A 3WXPA 1U0AA 2PA7A 4AEDB 4Y1UA 1DDLA 5D8AA 4AVBA 4JRAA 2WFF1 3WHUA 5BNPC 4AQSA 2ETEA 2N7GA 4ASMB 1BEV2 1PGSA 1DGRA 5SV8A 4GB32 4WVVA 1OFSA 4N7UA 2GH8A 2UWAA 1POV1 4JDMA 1E57A 4QQLA 1AZDA 2FMYA 4YZ2A 2IWGB 1Q8VA 2A3WA 3BTAA 1AR83 4OHZA 1NYWA 2E51A 1XQNA 3IPVB 5IUQA 3J26N 4PIXA 2I2SA 4TYSA 2DCYA 4MLOA 3MF9A 2HWE2 1PIV3 4B7KA 1Q8PA 2H6CA 3AYEA 1MS4A 5DUUA 2UWCA 1EY2A 4EROA 5GZGA 4DS0A 4Q27A 2R1BA 1R1A2 2W52A 4RSUA 2WFF2 5LRSA 4FXKB 4AFAA 4F7ZA 1AYM3 3RSJA 1BJQA 1J3PA 2NLRA 2BWCA 3SXWA 4KU7A 4YVSA 3LA2A 3BB6A 1CR7A 2CY6A 5T52A 1ZRFA 1DG6A 4LA2A 1CAUB 1Y7BA 5GLTA 1M06G 1S55A 1SBEA 2VOWA 2VMIA 2GAUA 4ISQA 1UF2C 3UKNA 1RB8G 5JR7B 5BNNC 3WW4A 4IEWA 5L7OA 4LUKA 2VQ0A 2P3KA 5AVAA 4O9EA 2DU0A 5GLUA 1I5ZA 3RS6A 4Y26A 5EFUA 3IDBB 5E88A 1QY4A 2BPA2 1UIJA 1UZYA 4META 2BUKA 2D6LX 2UU8A 1S0BA 2UY8A 1A3KA 1Q8SA 2W68A 3SCFA 5KC5A 2DF7A 2IXHA 3HWJA 1YYNA 3WX5A 4YFZA 4AVCA 5C9AC 4Q4X2 5A3LA 1AL21 4FPLA 1RJ8A 4Y1XA 3E6BA 3MW3A 1QH7A 1QMJA 3HBZA 3AZXA 5JI9A 3LCPA 1J1LA 4Q0PA 2D3PA 2QZ3A 3ACLA 3J8F2 3JCIA 4A7KA 5F6LB 4BE3A 5BNOC 1XXNA 3BPZA 4HLTA 1F5JA 1QNYA 3O0VA 5T54A 1O3TA 4HFSA 1CGPA 1WA4A 1LESA 2Q4SA 4COWA 1ZZ9A 5HXVA 2XWJB 3DV8A 3FBMA 3WDUA 1SFYA 1S0GA 4JGYB 5CFCA 4JCKA 3ZFEC 4AWDA 1AYN3 4TSVA 2DYCA 1U12A 2RJKA 4IV3C 3CF6E 1R1ZA 4HSJA 1LULA 4M3CB 2DUOA 3KM5A 4RR3C 1DGWA 3SISA 1DHKB 3AXEA 4ZU4A 3MPPG 4N43B 1DYPA 4LO6B 2WS93 5I0TA 4ITCA 1BYHA 2VVDA 3O0XA 1SLCA 4RHV1 3WZ1A 2PN5A 3AJZA 3HT2A 5C8CC 4LBOA 4Q1PA 1R092 3BODA 1QJZA 4QM8A 1EP0A 3TOJA 4FPFA 3VBUB 3H9AA 2HWC3 2VNGA 4RS5A 2C1FA 4AQ6A 1ZA4A 3H1YA 2UWBA 4LLOA 2G4IA 1A8MA 3BU7A 3O5SA 5JCTA 1NG0A 2K9ZA 5KC6A 4WM7C 1NZCA 3I59A 4P9IA 4PDWB 1CAXB 2IC1A 2WZR2 4NVPA 3U10A 2X5IC 2XJQA 4MUVA 4XF4A 4PBOA 4YG6A 4FPJA 2BNNA 2GALA 3SH5A 5F5QA 3JBG2 1C8NA 3IDCB 4RD7A 1DQ0A 4Z2WA 3M3QA 2FZ2A 4CDQC 2EXJA 1HIXA 2RS52 3CEWA 4NWVA 5F1RA 5FO9B 1Q5OA 1C57A 2AUYA 3QH7A 4JV4A 1N3QA 4QQOA 3QACA 4XMAA 1RUG3 1Q43A 1UIKA 1VBE2 1VIWB 4IEYA 5ACA3 4M0NA 2MNGA 2HKXA 3LGRA 1VP6A 3KGZA 3V64A 1NA1B 4FOYA 4BPZA 1TMF1 5LEKA 2A6YA 2CNAA 4QPIB 3MFAA 2DU1A 3FZ3A 1CAVA 1Q56A 1RUE1 5DDJ1 3ZMOA 4Q8LA 4Q2FA 3RPQA 1RMU1 4MZUA 1G8WA 2PHUA 1COV2 3MGUA 3AKSA 1M4WA 4FOVA 2KM2A 1J1TA 2DVGA 3GHNA 5AFEA 2ZMKA 1PNFA 4YW5A 3NKTA 3EQEA 4Q4Y3 1UAIA 3SMHA 5LEJA 4XFHA 2X53S 2ZJCA 2IXLA 4Q4V3 1SCRA 1RUI1 2OZ6A 2WT0A 2IXJA 1REEA 2GC3A 3WG4A 1N1YA 2IZWA 3QLQA 1GZWA 3S30A 3JD72 4BOWA 4EN0A 1Q8OA 1TME1 1QOOA 1HX6A 3VBRC 3UJQA 3FBYA 4KG0A 1DZQA 4I0AA 4I01A 5JZGA 1V9U3 3WV6A 1YRZA 3SITA 2RR13 1RUD2 2TNFA 3U4XA 1FOD1 1VRH2 2SLIA 3VL8A 3JQWA 3AP5A 3S7IA 4HKLA 2FBEA 4XFIA 4AW7A 5H9QA 1D2QA 5CFDA 2HWB3 1NE4A 4ZU7A 4ES8A 4AGRA 3O14A 1ENQA 1QJY1 2QCSB 2ZBJA 2XKPA 3GZAA 3ZSLA 1UKRA 4LO7A 3ZXDA 4MGKE 3WY6A 1NCQA 5CVRA 1G86A 1ND2A 2BYVE 3DL3A 1F2NA 1RVF3 5E89A 3VL9A 2D6OX 1UCXA 2HJIA 2RS32 1RUC1 5LRRA 1AX0A 2BQPA 3LSDA 4UW5A 2XJUA 3VN4A 4I02A 4OI1A 2PQQA 4AHWA 5K0UB 1R083 5GKAC 5I0RA 4FPGA 5FDBA 4BIOA 1AUYA 3VBOA 3LWCA 5ABJB 4IEQA 4K3UA 1LODA 1G6NA 2HWF1 1AF9A 2IXIA 3ZFFA 4CRQA 4KG8A 3VBHB 4K21A 5JSPA 1LU1A 1OA4A 4LLFA 1SACA 4BZ4A 3WLUA 1GLHA 5BPXA 5GALA 4LE3A 5JPNB 2MPFA 5A32B 1BBT2 1WLDA 1D2SA 1ZBA1 4XEZA 1PVC1 1VBC1 1RUH1 4WZFA 3ZFGB 3HD8B 3H0OA 4R9BA 3ZXJA 3GNEA 5JIAA 2NYYA 1Z7S3 1H8TB 2Y38A 2ZGLA 2Z79A 3IWZA 3ECQA 2AGSA 4AGGA 3A0NA 4IV1C 1HDKA 2HWD3 2IXKA 1Z0HA 1GANA 5FMOL 1MQTB 2OW4A 4KWJA 4EV0A 1QOTA 4XJUA 2DCKA 2WNUC 2G9FA 5C6CA 1V70A 2A73B 1LHWA 2JXAA 1KRIA 2NMNA 5AVPA 1OOPB 3MLLA 4KQ7A 1S1AA 3WHTA 2EF6A 5GM0A 2R041 1DQ1A 2WJSA 1DZRA 1BEV3 5DUXA 2O8QA 1RJ7A 3VBSC 3NV2A 3RG0A 4JDOA 4GB33 1FPN3 3VV1A 1VB2A 1W6PB 2DCZA 2WNVB 1A8DA 2W08A 4QT6A 4AEJA 5FAXA 2MHFA 4FAHA 2RS13 4KNCA 4WM8A 2YY1A 2WC2A 2YGLA 1NQJA 2AENA 3SHRA 4Q29A 2ZTNA 4AVSA 4P9YA 2ZGTA 5CNAA 3NV1A 2ZHNA 2JG9B 4DRVA 2ZZQA 5I93A 3MLJA 4CEWB 4CP1A 3NO8A 4L9BA 4DY5A 1PZ7A 1QJU1 1UZZA 4CDWC 3N3HA 2PLV3 4NHKA 4OI2A 1OA3A 2QVSB 4H7LA 2GDFA 4AFCA 3S6PA 4D7SA 3VKMA 2E7QA 2WFF3 1V6LA 1SMVA 2WINB 4I30A 4YVWA 4LBMA 3WQ7A 2BNOA 1NCRB 3ZXEA 3QCWA 2K0GA 1F9KA 2D3RA 1KITA 3IBMA 3WOGA 3IM0A 1DYKA 1SLIA 2XJTA 1FI2A 2R1DA 3I8TA 3V0BB 1X33A 1AXYA 2BGCA 3DGTA 3AM2A 1B09A 1AR61 1D4M2 1JW6A 3JUUA 2CWMA 1DQ4A 2UYBA 1O3QA 4EN8B 2XLFA 2XKOA 4G9SB 5T5JA 1LR5A 2QJVA 1JUHA 2PFWA 4QXKA 3O7OA 3N7LA 1LGCA 2ATFA 5C4WA 4Q4X3 2XL7A 4EN7B 4KL1A 4MH0E 1HRI1 2QDNA 1RL3A 4DINB 2XJVA 3MW4A 2O1QA 4CDUA 1UPIA 1DQ2A 2XVKA 3USUA 1C1LA 2YMZA 2EA7A 2RE9A 4OFGA 4AI2A 3AYAA 1QWRA 3EBRA 3J8F3 3W59A 2WFPA 4A2UA 5FO8B 2OUJA 4Y20B 4C91A 3TN92 1ZZBA 5AC92 1LU2A 3H7JA 1Z78A 3C3VA 1B35A 1VJ2A 1XNKA 3TNQA 1K5MB 3DKWA 1TE1B 2CV6A 3WQ1A 4AEKA 2NN8A 4R52A 3VZMA 4LO8A 4HANA 4NHLA 5KXEA 2P17A 1NLRA 4YGDA 1AJKA 4QPGA 1AR92 2JG8B 2GH2A 4IEVA 3PLQA 4S2DA 3GBGA 3MPBA 1V6MA 1O4YA 3NAPC 4Q0SA 3ILRA 3ME2A 4QPYA 4DZGA 4INDA 2EALA 4GH4C 1IS3A 4BMEA 1HRI2 1SLAA 3RQ0A 1S0CA 3AYDA 5C33A 3KB5A 1WLTA 4MX3A 4D7TA 2RR12 3MLKA 1X7NA 4L11A 3ZDSA 5CAZA 1ULGA 2VOVA 4I2OA 4IEOA 1RUF1 4DRRA 1C5IA 2HWB2 5JVVA 1IKQA 1D0GA 1H4GA 5I0UA 5JAXA 5FOJB 1OA2A 1CAWB 3MW2A 2CGPA 4E4ZA 2BNMA 4FQ4A 3POYA 3CJIC 1CN1A 4KWLA 2CYFA 5KBFA 1LCLA 2H0VA 2JEMA 4DQAA 1MS8A 1RHI1 3RYRA 4COYA 1QJX2 1XNBA 3WP5A 4WVMA 1O4TA 2AZ5A 2HEYF 4XQWA 1O7FA 2E53A 4FOQA 4OULA 3TNPB 1QF3A 5BNNB 4HKOA 2WZR3 5J36A 3VZNA 2ZACA 5FMOS 3ZIWA 1DF0A 3MIEA 4I3PA 4K1ZA 2ZGOA 1XU2A 4FPHA 2A6WA 4C0BA 1OMIA 4Q26A 5GLWA 3TBDA 1GBGA 4AFBA 2F6BA 3JBG3 3WVJA 5EV7A 1GKBA 3THPA 3SNMA 4I3GA 3EO6A 1REDA 2RS53 3N7JA 5C9AB 1ND3A 3W9AA 1DQ5A 4B4RA 4CYDA 2R061 4E2GA 3USSA 1VBB1 1W6NB 4RGAA 4AYUA 1DZTA 3SH4A 5CADA 3E6CC 4AG4A 3VDDC 1XE7A 5BY5A 1WUVA 1J59A 4XJZA 1MS5A 1TEIA 5E1RA 1QNWA 1KS5A 4YFWA 4XYXA 5BNOB 4UXAA 2H6BA 2YGMA 1W0OA 1ASJ1 2HWD2 1XE8A 1PGW1 5TSWA 5CU1A 1COV3 4YARA 5BNQA 2UYAA 4QQ2A 1W6MA 2CL2A 3O0WA 2LALA 2ZAAA 3ZFEB 1HRV2 2DCJA 5BXXA 5J96B 4E4DX 4BH9A 2RJLA 1PK6A 4IV3B 1FPN2 1EV12 1POV0 3DPRA 4RR3B 1PO12 3OBRA 2RS12 3OGJA 2B7YA 2WLQA 4CTEA 1BMV2 3JD73 2BFUS 4G3YC 4MGZE 1PVXA 1QHDA 4AFDA 5KWRA 1PO21 4NPRA 4MSVA 5C8CB 2R0FA 4LR4A 2ZHKA 2WT2A 1FMD2 4CDXA 1LOFA 1IS4A 2QNKA 5FQ0A 1F31A 1RUD3 1SBFA 4YW2A 3AKTA 1VRH3 2PLV2 4KH9A 1ASJ2 1OLRA 3BALA 2V5YA 1RMU3 2GC1A 2YPJA 2WZPP 2ERFA 3PTYA 2IFRA 1WCDJ 1H30A 4LTAA 1L3JA 1ZZ7A 3ZXFA 1ZZCA 3VKFC 5DUVA 1IGOA 3FFQA 4CZSA 2VOKA 3HIFA 4WM7B 1OD5A 2RS33 1H1AA 4FP3A 1X8MA 2D93A 4TLFA 2VUJA 3MFCA 4AI1A 2D43A 2X5IB 3N7MA 4FSJA 3APBA 2ZMLA 2FZ1A 4GKXA 1MACA 2ZX1A 4AEDA 3RYKA 4LE4A 4CEYC 3E5UA 2EVXA 4Q1RA 1NXMA 2O8OA 4XJ9A 3NWKA 3P3NA 5D8AC 4FAGA 4CDQB 1XRUA 1X8EA 3FLPA 1LOEA 4JGZB 4COZA 2R32A 3NL1A 1ZBE1 3QOPA 5FFOC 4DY3A 1FV3A 5DZGA 1FOD3 5CIRA 4HVQA 1CESA 4H3WA 5A33B 1BBT3 1CD3G 2Q1ZB 1IHMA 4LO5B 3M8LA 3M7AA 2VOXA 3WD5A 3I2DA 4P9XA 3IPVA 1NOVA 1J58A 1LEDA 1LHNA 4LBQB 3MZHA 2ZKNA 3PNAA 4EN6B 3OYWB 3ILFA 1ZRRA 1CONA 1FV2A 3B01A 3FUOA 3OD4A 1MVEA 1YFXA 4Y24A 1QXRA 5IK5A 2XBO1 3G6JB 1HQWA 4Y22B 3WT3A 1FNZA 1YUDA 2VG9A 3R4UA 4EN9B 3V0AB 2I74A 4AFMA 1LB2A 2HWF3 3AMQA 3RMXA 1Q3EA 1VBA1 4S2HA 4C1WA 2WQZC 2ZMNA 3AX4A 1LHUA 1UPSA 1OHFA 2YHJA 1LECA 3AMNA 3WUCA 2WQ4A 1W6QB 4QU2A 1H2MA 4OHVA 1PHMA 1N1VA 4XPVA 4GMP1 1DLLA 2CAUA 2PTMA 3VBFB 4GWMA 2GSYA 1CAUA 4YVSC 3VBRB 4GALA 5JSOA 4KWKA 3OBTA 1GFF2 1AL22 1QDOA 4R8HA 3ZYGA 4FVVA 4TWTA 5BYNA 5C8WA 4Z92B 3WCRA 1KJLA 4JGZA 4WV8A 5L7OC 2D44A 4HBNA 3O12A 4N53B 2VVEA 1GZCA 4IEUA 3FJSA 3NW4A 1ZM1A 2OPKA 3KZ4C 5A33A 4GWNA 4FPYA 4XF1A 1XYPA 1ULDA 2ZKLA 2EIGA 1PZ8A 1RUNA 4XF9A 5I0SA 3T2TA 1OSGA 5CBLA 1H2KA 3WUDA 5CA6A 3VZOA 1DU3D 1NQDA 3E97A 1CIWA 2EXIA 1HXS1 1C4RA 5GZDA 2AYHA 4XE9A 1X50A 4Q0UA 3RDIA 5J37A 1D4M3 3FMGA 2ZX4A 1WBLA 4M01A 2D97A 3HAGA 1RUJ1 4RFT0 4RHV2 4JGYA 4K6BA 3RI9A 1KFXL 3B93A 4D69A 3MI8A 3VBFA 5HCAA 1QJU3 4IEZA 4FTBA 2XJSA 2V09A 5CFCC 4M3CA 5DG2A 4YZ1A 1W6OB 5FLIA 2VNOA 4O9GA 2VUAA 3H1MA 3KGLA 4N43A 5T3NA 3FHIB 3HQXA 1I9RA 1ZYBA 3AZZA 4IV1B 3A0KA 4PF5A 2XUMA 1SQ4A 3M3CA 1UX6A 2W0XA 2WNUB 4JC1A 4LO4B 5J09A 1BVP1 3TN93 5AC93 1C8M1 3VBUA 1DIWA 3R0RA 2TUNA 1H8VA 3E6DA 1AR81 2P2KA 4AVVA 4JAAA 4GKYA 3VBSB 3B5LB 3S7EA 5HCFA 1LOBA 3ETQA 4FP2A 2LUWA 2ZHLA 1GQGA 3KT4A 3AZVA 1SLLA 4RS5C 1N3PA 3OF1A 1LGNA 3MF6A 1PIV1 2GNMA 5J98B 3NV3A 3D82A 4PDWA 1AR93 1CAXA 4FPCA 2D5HA 3H3UA 1F5FA 3CLPA 4P9GA 3ZX7A 2ES3A 3KCYA 4B4QA 2ZOEB 2AR6A 2HEVF 1SCSA 1HRI3 3MIGA 2XVLA 3QD6A 3ATGA 2ZABA 3LKJA 1AYM1 3WDTA 4BYYA 1IPKA 1TMF2 4CDWB 2VXRA 3ZO0B 4Z8BA 1YI9A 4BHPA 4YNIA 5DDJ2 1RUE2 3D6EA 4P5HA 1DGWX 4H14A 1S0EA 4HKWA 2GMEA 1RMU2 3B02A 1HQLA 1WCSA 1VBD1 1KS4A 1UL9A 4IL7A 4XILA 3UK9A 3FLTA 3GALA 5L73A 1QKQA 5KHGA 4YG0A 1PM7A 1BK1A 4HPKB 4OUMA 1NA1A 1UMZA 2D98A 2DCTA 4NOTA 3LAGA 4QPIA 1WLCA 1O3SA 1ULEA 4IQPA 4BCUA 4HL0A 1U5XA 3MIBA 1QJX3 1RUI2 4B3NA 5LK5A 3RZZA 4MYEA 4RGGA 4OI0A 3JB8A 3FX3A 3IT8A 1TME2 1N1SA 1RTVA 3H8UA 1G9FA 1VB4A 2BTVC 1UU5A 2BVVA 3VBUC 3ZXLA 3KD4A 3B00A 4RQPB 5E16A 5FCCA 3RMYA 5F9TA 2GMPA 2TBVA 4QGMA 2PHWA 2A3YA 2EXKA 4ORFA 2MEV1 4YM0A 1FOD2 1HV0A 4AI0A 2JE7A 1OQ1A 4YW1A 1RUF3 4PQ9A 3RWNA 2D7FA 3MIDA 5K9YA 1TNRA 2PHRA 4XIKA 3VGIA 3B9IA 4GA9A 4LT5A 3OY8B 5T55A 4B8EA 1QJY2 3ES1A 2PAKA 2A3XA 2C0ZA 2NZ9A 4QGNA 3ZN6B 1RUOA 2K2SA 1ENXA 1EPWA 1RUC2