1XE7A

Crystal structure of the yml079w protein from saccharomyces cerevisiae reveals a new sequence family of the jelly roll fold
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
194
structure length
186
Chain Sequence
ANAAIEPASFVKVPMPEPPSSLQQLINDWQLIKHREGGYFKETDRSPYTMEVEKPVMVTRNQSTLIYYLLTPDSPIGKFHKNINRIIHILQRGKGQYVLVYPDGQVKSFKVGFDYKNGEVSQWVVPGGVFKASFLLPNEEFDNGFLISEVVVPGFDFEDHTFLKGEDELKHLVGPEKAAELAFLAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical 22.5 kDa protein in TUB1-CPR3 intergenic region
publication title Crystal structure of the YML079w protein from Saccharomyces cerevisiae reveals a new sequence family of the jelly-roll fold
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 49
structure length 186
sequence length 194
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06172 Cupin_5 Cupin superfamily (DUF985)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1xe7A00
3FJSA 4XFFA 2FQPA 1Y3TA 4IEUA 4KWJA 4ONUA 4XF0A 2KXLA 5BPXA 2K0GA 5K8SA 3SHRA 4MGKE 3LOIA 3U10A 1YUDA 4ZU4A 5FQ0B 4I2OA 2PAMA 2HKXA 3LAGA 3M3IA 1YFWA 3ZDSA 3HT2A 5BXXA 1O7FA 3NW4A 4HZFA 3E97A 1O3RA 2BNMA 4MUVA 1ZZ7A 5KBFA 1ZVFA 3DN7A 2CAVA 4MX3A 3H1WA 4ORFA 3QOPA 4Q29A 3IBMA 4H7LA 1LB2A 4EV0A 2P17A 3CJXA 2XLAA 4QGMA 4FAGA 2OYZA 4QGNA 4I0BA 1RGSA 1ZZ9A 2O8QA 4HVQA 1EPZA 5I93A 3UKVA 3MZHA 3EJKA 4XF1A 2IC1A 3E5XA 3E6BA 1CAUB 4K8FA 3NKTA 3HIFA 1VJ2A 5BUVA 3KCCA 4B29A 3H1MA 4LEJA 3CO2A 1X8MA 3CL1A 4FBFA 4KU7A 1V70A 3H9AA 4XFCA 1RL3A 2E9QA 2O1QA 1RC6A 4Z82A 4BHPA 2N7GA 4YSFA 3IWZA 5EFUA 1GQGA 1UD1A 3I59A 1XE8A 2QJVA 1LRHA 2H0VA 4MV2A 4QM8A 5JR7B 1X82A 4OLLA 2XL7A 3RZZA 4XFGA 4O9EA 3LA3A 4N9HA 2Q30A 4BIFA 5J7MA 1UPIA 1WA4A 4QX5A 1CAVA 1H1IA 4Q0QA 1U12A 2IXCA 1ZZ8A 3FX3A 5C8WA 5JSPA 5I91A 2XGXA 1O5UA 1PMIA 2GZWA 3RPQA 4ZU7A 3NVCA 4F8AA 1G6NA 4LUMA 2XL9A 4JTOA 1IPKA 3EQEA 5LRRA 3G7DA 3CF6E 5KHKA 1ZRRA 4LUKA 3LWCA 3M70A 2VPVA 2GC2A 3SCGA 1H1MA 2QVSB 3QACA 4MH0E 3FWEA 3O14A 4E2QA 4O9GA 4Q0PA 2XKOA 4XFHA 3WW1A 1YWKA 1CAXA 2OA2A 2VQAA 1JUHA 3H8UA 4IEYA 4IERA 4D7TA 3D82A 1DGWA 1DZRA 4HBNA 3PLQA 4J1WA 3EO6A 4Z07A 2QNKA 1NZCA 2B5HA 4XETA 4AVAA 1J59A 3H1YA 1NE4A 3BPZA 3S7EA 1SEFA 5KHGA 2PAKA 3S7IA 2ETEA 2B9UA 4KL1A 2PAEA 3ROUA 4XF9A 5I0TA 2D5FA 2IXJA 1RTVA 1Q3EA 3ACLA 5LEJA 2UY8A 3PNAA 4JVAA 3LA2A 4F7ZA 3RYKA 1EYBA 3I59B 2I45A 1YLLA 3B02A 3E5UA 3EHKA 3PVBB 3RDIA 5BV6A 2ET1A 1YFXA 3KMHA 3KSCA 3S0MA 1Y9QA 4N9IA 5LRSA 2GC0A 3EBRA 5J48A 3E6CC 2MHFA 1CAVB 3MYXA 1NE6A 1SFNA 3GBFA 5JSOA 3HQXA 4YNIA 4EWDA 1QY4A 2WFPA 5J3UA 3U0ZA 2ATFA 1J3QA 4MGZE 1OI6A 1XRUA 5AVPA 3R6SA 5JCTA 3UKTA 2K9ZA 4IEPA 1X7NA 4BH9A 4R8HA 3E6DA 2CV6A 2Y0OA 1CAWA 1QXJA 1OFNA 4QXKA 2ET7A 2PTMA 2UYAA 4EROA 4LA2A 2IXKA 4HLTA 4PJYA 5CVRA 3RNSA 4GULA 2OZ6A 1CAXB 5I8YA 4PIXA 4TLFA 1Q5OA 1Q43A 1I6XA 5CADA 5F1RA 1PM7A 3NSTA 1SQ4A 4LULA 4YRDA 2B8MA 4IEWA 4I0AA 1XE7A 1J1LA 3NL1A 4YARA 2QCSB 5BY5A 1ZX5A 2V09A 1WLTA 3NJZA 4IEOA 2PYTA 4LTAA 2DCTA 4LA3A 4DINB 4FAHA 2PQQA 3JZVA 3ELNA 3LA7A 2XHKA 3OD0A 3WW4A 4HN0A 3LZZA 1ZRCA 3IDCB 5FLHA 5JSRA 2Q4SA 4BYYA 3CLPA 1O3QA 2IXLA 3DV8A 2GC1A 3OGJA 1ZRDA 3H3ZA 2Z69A 5I8TA 4AVCA 3TNQA 3D0SA 1FT9A 3N4MA 4QMAA 3OCPA 5C6CA 4D7SA 2PHLA 2BEOA 4AVBA 2VECA 3ES4A 3SXWA 2BNNA 1ZRFA 3IDBB 2BGCA 4I01A 4RD7A 1UCXA 2H6BA 4P9GA 3DL3A 4HMZA 4J1XA 5I0UA 4L11A 5I0RA 1ZREA 2IXHA 4UXAA 3GYDA 2MPFA 4KWKA 2Z2SB 4EWEA 4I02A 3RYPA 4Q0UA 2CAUA 3E5QA 3TNPB 5EZWA 3L2HA 5FLJA 2GC3A 4UBGA 5I0SA 3MDPA 4Q0VA 3BCWA 1I5ZA 3DKWA 1CGPA 3I7DA 5T3NA 2XLGA 4E2GA 3OTFA 1CAWB 1EP0A 2GH2A 4UBHA 4XEZA 1YHFA 1NXMA 1NYWA 3H3UA 3U11A 2HJIA 3BALA 4WVZA 2EAAA 4IEXA 1LKNA 1EY2A 2PHDA 4NVPA 1ZZBA 2PFWA 3OF1A 2D93A 5I8SA 2UY9A 4MZUA 4L2NA 2EA7A 4FT8A 3FFQA 1FXZA 1O5LA 2D5HA 4XFIA 3H50A 1J3PA 5E1RA 5FPZA 4XFAA 4A2UA 4QM9A 3SMHA 4PIYA 1O3SA 1WGPA 2QDRA 4MGYE 5KHHA 5FCCA 2ZKLA 1OD5A 3D0JA 5LEKA 4IESA 4EWAA 1O3TA 2D40A 2IXIA 5HI0A 4IEZA 1ZZCA 4QGLA 1RUOA 5FQ0A 2ZCWA 3IIAA 4I09A 3VHRA 4X6QB 2Q1ZB 1QWRA 1ZNPA 3FE5A 4Q0SA 2MNGA 1FI2A 4OFGA 3H7YA 3MPBA 1J3RA 3RYRA 2C0ZA 4WZCA 4HVRA 3SCHA 2CGPA 4KU8A 1IPJA 4HSLA 2F4PA 4HVOA 4R52A 3H7JA 1YFYA 3HT1A 1GQHA 2WC2A 3C3VA 1DZTA 3BU7A 4E2SA 2UYBA 1DGRA 1YFUA 1UIKA 1UW8A 4IEQA 3WW2A 1HW5A 1CX4A 4META 2FMYA 5KHIA 1UIJA 1ZZ6A 1J58A 1CAUA 3I54A 4AQ2A 1RUNA 4HN1A 5FLIA 1LR5A 3CEWA 3UKNA 1X8EA 4YYOA 4WBBA 2Q0AA 5JAXA 3KGZA 3FZ3A 3SCFA 2XLFA 3ES1A 4X6RB 1L3JA 4MGIE 5FDBA 2GU9A 4LLOA 2OZJA 3ST7A 3WW3A 2BNOA 1O4TA 4XF4A 4AQ6A 3FHIB 5CU1A 2H6CA 1VR3A 5KHJA 3ETQA 4JV4A 2XKPA 4KWLA 3KGLA 4AXOA 3BB6A 2GAUA 1TQ5A 5D1IA 4CYDA 4IETA 1OMIA 4IEVA 2PA7A 4ZU5A 4HSJA 4PIZA 4I3PA 4XFBA 3USSA 2EVXA 2BYVE 4JTNA 4XF3A 1VP6A 5FPXA 1QXRA 5E16A 2OPKA
chains in the Genus database with same CATH superfamily
2W2IA 3ZX7A 2FQPA 2EIGA 1Y3TA 3E1F1 5A3UA 2YC2A 4JGZA 5A3WA 2A75A 4R9BA 4R9DA 4HPKA 5GZGA 2WZR1 4O7XA 2KXLA 1G9CA 3TN93 1OUXA 4QPYA 4Y1VA 4DXZA 4MGKE 1UYXA 4RFT0 2ZX3A 5HV4A 1TME3 3U10A 1YUDA 2W95A 3KVBA 4XMIA 3VBHA 4YGBA 4ZU4A 2ZHKA 2XR4A 4I2OA 3JD71 3M3IA 1YFWA 1Q8SA 2ZGRA 1LHWA 4OQ8A 4AHXA 3DYMA 3H8RA 1S0JA 3VBSC 1RUH2 4QKBA 1IOAA 3E97A 3LF7A 4WV8A 4OHWA 2JX9A 4F3JA 3PDQA 1VBD1 1ZZ7A 1FPN3 2C24A 1RUF3 2E53A 3DN7A 1GSLA 4A6SA 1M06G 1BK0A 3DGTA 4ORFA 1RUE2 4AFDA 1BMV2 3IBMA 4H7LA 2WS91 3OGGA 3DYOA 4QU1A 1RITA 3AK0A 4QX2A 2Y6FA 1CIYA 2XLAA 5IK8A 1B35A 1AJKA 3HBZA 2WNOA 4IGOA 2GN7A 4BDVB 4L9BA 1MS5A 1ZYBA 2ARBA 5E6HA 2OKXA 3N7KA 3UKVA 4HVQA 5KC5A 2IC1A 3E6BA 5DQ0A 3WOGA 1CAUB 1KJRA 2DUPA 2XWBB 4K8FA 4QKFA 4TZDA 1S0BA 3HIFA 1AYN1 3IKWA 1VB2A 2FBEA 3KV5A 5GZDA 1Y4WA 5F7UA 5FXXA 4IV3A 1PGSA 1MS8A 5IHRA 2ZGNA 4E8CA 1NLQA 2VXRA 2N7GA 3MV01 3IWZA 1G9BA 1UF2C 4LBNA 1DDLA 5H9RA 3Q8EA 1V6KA 4LLFA 5FUNA 1XE0A 3MFAA 2Y33A 2WNEA 1W0PA 1RUI1 1MS3A 1SMVA 2DUOA 3I59A 4AEJA 4NWWA 2NP0A 2WA3A 4PF1A 4LBQA 3AZYA 2VCCA 2QQOA 1MQTC 2ZEXA 1SLTA 4H7MA 2YHJA 2J42A 4P5HA 4QPIB 3PUHA 4DY5A 2AENA 2LM3A 2VZQA 4R4ZA 1U0AA 3BGAA 3O0WA 4KH9A 5DAQA 1GFF2 3MEPA 5IYYA 4IUGA 3RZZA 3LA3A 1COV2 1W6MA 3SKJE 2Q30A 4PBPA 5FY7A 1UPIA 5C4WA 4QX8A 3RJ2X 5LW9A 4QX5A 1CAVA 1FV2A 1AL22 5DG2A 1ZZ8A 2ARAA 1QJU1 1VBE2 3O0VA 5A7WA 5JOXA 5DZEA 1DQ1A 5JSPA 2JENA 5I91A 1JYNA 2XGXA 1O5UA 3DPRA 1T6GC 4JGZB 4HPKB 3HEIA 3T3YA 3NVCA 4GJYA 4LUMA 5F39A 3NNMA 4YW3A 5FYIA 5BNNC 1GWLA 2WN3A 3BTYA 1TMF2 1XU1A 1UZVA 4JGYC 4PF5A 3MIBA 3EQEA 4N53A 2VZVA 3VBHB 2X05A 2A6YA 1JU4A 3CF6E 1OH3A 1G9FA 2XB6C 1ZRRA 1RUC3 2RS11 2XQXA 3ZN4A 1GOHA 5IVJA 4RA0A 1N1VA 2GC2A 4Q1RA 3ZXFA 1VE0A 1N1SA 3WNNA 2WWSA 2XQRA 1UOFA 4E2QA 3VB9A 4KG8A 3C7HA 3FBYA 4XOGA 1ND3A 3ZN6A 5JOWA 1YC61 3VDDA 3A4UA 2OA2A 2XJPA 1JUHA 2VL4A 3H8UA 3ITQA 4ZS2A 4B8EA 1QH6A 1AYM1 4IEYA 4BLIA 5E88A 1DQ2A 3C7GA 2JG9A 5IK7A 4D7TA 2HBUA 1LENA 3NRUA 5FYSA 2DFBA 1B35B 3U78A 4QX1A 2VXJA 1RYYA 1VRH1 2WIIB 1REEA 2ZKNA 3PLQA 3WXPA 3EO6A 1JUIA 1R1A3 1HXS3 2QNKA 4YVSA 4AVAA 4Y22A 1XBFA 2VVFA 5ANQA 2FDFA 2DU1A 4IXLA 1AR62 1XSQA 2QZ3A 4GB32 1PO12 1NE4A 2NMNA 4CTEA 4W50A 4E27A 4IV3B 2CGOA 4AFBA 3POJA 4KL1A 1C8M1 3HJRA 2W39A 1V9U2 2Z42A 5I0TA 4B4RA 5CFCA 5D8AA 5JUVA 1ZBE2 1UX7A 2IXJA 4FOWA 4N90A 3RS6A 4IV1A 1Q8VA 2HWE1 3PNAA 3AKTA 4JVAA 5FFOC 3ZKYA 3PURA 1EYBA 2NM1A 3I59B 5GLWA 3PU3A 1HJGA 1GV9A 1RUJ3 5EYXA 5F5CA 4A41A 2I74A 1LAJA 1F35A 2I45A 3NMBA 4LBQB 3OGVA 3M4FA 4QDRA 3VHOA 1LCLA 1SHWB 2QQUA 3URFA 1JYWA 4DRVA 1KS5A 3PJYA 3I2GA 5BV6A 3MLJA 1GR3A 2ET1A 3LCPA 1YFXA 1SFYA 3HN3A 3MW4A 5LB6A 3VD5A 1W6MB 1REFA 4CCDA 3RZHA 3WF4A 5C4WB 1CAVB 1CZVA 2WJSA 3ZIXA 4QAWA 5FBZA 2BUKA 4LHNA 4BU2A 4FPJA 2XG3A 3MYXA 5FV3A 1NE6A 1SFNA 2AEYA 3NAPC 5A7WB 4EE2A 5GLVA 5JSOA 5IFTA 1V6JA 2FHRA 3C8XA 2WZR3 4YNIA 4ATFA 3DPRB 1QY4A 2WFPA 2E7QA 4XYXA 5FZ6A 5H9PA 1DLLA 1GBGA 3NNFA 2ATFA 4B3NA 5CA6A 5J3UA 3U0ZA 3RZJA 4YW2A 1B09A 2WO2A 3J8F2 3OJBA 4GMP3 3WP5A 3R6SA 2LUWA 4B1LA 3WNPA 4N53B 4C0HA 3JD73 3UKTA 1YQ6A 1AXZA 1SBEA 1L7RA 1MS9A 4Y5TA 1BXHA 1XNKA 5FZEA 1OF3A 4X8PA 5LBBA 4NO4A 2CV6A 4IE6A 1CAWA 3ZLIA 1UNBA 4COZA 1VRBA 4LA2A 5LATA 1APNA 1VBD3 3HNBM 4HLTA 4RFRB 5CVRA 5FRAA 1ND3B 3ZN6B 2G9GA 4Z92B 3VDDB 4LOTA 5KXCA 2YC0A 1Q43A 3DXUA 2WS93 5CZKA 5DUXA 4NPMA 1D4M1 3K48A 3VZNA 1S4CA 1DQ4A 3NSTA 2JG9B 1UMHA 2YROA 4AAPA 3AKQA 3H8XA 2DCJA 4XUOA 4IEWA 1ODNA 4Q26A 4QXCA 1J1LA 2W3JA 1AX0A 3NL1A 3WVJA 3ZYRA 1WCUA 2HEYF 5JMCA 2RMU2 3OBZA 2A6XA 4LTAA 2DCTA 5K4LA 3P3PA 4YVSB 2OQ6A 1AYN3 2X29A 3KCXA 4Y22B 1O4YA 4GWJA 4Y26A 3VBRC 1UPSA 3POWA 1YEWA 5CAZA 1KDKA 1ENSA 1X36A 2Y6GA 4UW4A 4E4SA 5BNOC 5FZKA 2PMWB 1OUSA 3IDCB 3VBFA 2Q4SA 2ZMNA 3CLPA 5LK7B 5F3CA 1O3QA 5F6KA 3WDXA 2VJXA 2ZGOA 5CFDA 3CJIC 4ZHNA 5CFCB 5C9AA 2R071 5D8AB 5T54A 5IVFA 1ZRDA 1RUI3 5D21A 2Z69A 4FOQA 2JKXA 4IV1B 4DFSA 4M3CF 2Q8CA 3W9AA 4XJUA 2R041 3N3HA 5F3GA 1DYKA 4CPBA 1F4HA 1AZDA 1S0GA 4YGCA 5C6CA 2O0OA 3Q9OA 4OI2A 1UKGA 4RS5C 3VKMA 3LE0A 4AL9A 4D7SA 4W65A 5APAA 2LW8A 4LHLA 2VECA 5ISLA 3AP9A 1A8DA 1C4RA 4IE7A 2XBO3 4W8JA 3IDBB 2BGCA 2WT0A 2RVAA 3VL9A 3NJYA 4HMZA 4J1XA 4QT6A 5I0UA 5B2GB 3VD4A 1O59A 1ZREA 2JDZA 4JKKA 4UXAA 2VBPA 2VOXA 2A6ZA 2OIIA 1QJU3 3POIA 3JBG1 4Q4W2 4KWKA 1FMD1 4AAXA 4IGPA 2PLV1 2NPIA 1ULGA 3ZMOA 4EWEA 1POV1 3AFKA 3RYPA 2QQLA 5SV5A 3WF3A 3E5QA 4EN6B 1GICA 3A0KA 2ES3A 5T55A 3VKFC 2VU9A 4UBGA 2CHHA 3VBOA 5DPNA 1W6PA 3MDPA 4DEVA 2IUWA 2RS13 4XDOA 1EAH1 5FO9B 3HVDA 1I5ZA 4YFZA 2GNMA 3U4XA 5FYMA 2DFCA 1JZ4A 3GDBA 3TEWA 3OTFA 4BA6A 5IVEA 1OA3A 5KWRA 1CAWB 1EP0A 2YBSA 1F15A 3N7LA 4UW6A 3USUA 2JG8A 4J25A 4UBHA 4KGQA 4XEZA 1AR71 1YHFA 3ZXKA 1NXMA 1AYM3 1NYWA 4NIDA 4MOAA 3D5OA 2D98A 4IEXA 1HQLA 2XUMA 4LO6B 2E32A 3BODA 5F2SA 3ZYFA 1ZZBA 1H9PA 2Q8OA 4A3ZA 2V4AA 1AXKA 1VRH3 3UETA 4MZUA 3JQWA 4AOCA 3VBUA 2EA7A 1S0EA 3ZFEA 1YXWA 2VNRA 2ZHLA 2V5YA 1PIV1 1G8WA 2ZX1A 4A45A 5FOBB 1XNTA 4Q1PA 1FXZA 4RR3A 3MW3A 3ZPYA 2RHPA 3T09A 4I30A 4HT1T 1KEXA 2OW4A 4M3CA 1SDDB 1C8M3 4A42A 3VBFB 5C33A 4PIYA 2IVIB 4M3CE 4QHBA 4I0WB 1H0BA 4QB1A 5GLZA 4AVSA 5CFDB 2E6VA 3D0JA 2HWE3 5C9AB 4EWAA 2YGMA 4IEZA 2Y34A 1RUOA 5FQ0A 2ZCWA 4OUEA 3IIAA 3GXUA 1V6NA 2JDNA 1E5HA 2RR12 4NHKA 2GSYA 3AZVA 4CUBA 1QWRA 1W8NA 1ZNPA 3T2TA 3IIIA 1NA1A 1WCDJ 1FI2A 1QOTA 5FYBA 1DFQA 5C3PA 1A8MA 1UYPA 3ZSJA 1NT0A 2P1BA 5DN2A 5FYZA 1VLNA 5CG8A 2WUHA 1HV0A 3SCHA 3F2ZA 2YV8A 3KQ4B 5FYHA 3ZKUA 4QD2A 4UWDA 2ZAAA 2YB7A 3SLIA 3H7JA 3GBGA 5HV0A 3GZAA 2WC2A 3BU7A 4IE4A 5A3OA 1HB3A 1W6NA 2HWF1 1RUD2 1BCXA 4Y4RA 2LS6A 5HCAA 2XONA 1FX5A 3ZSKA 3HPNA 1UIKA 2WN2A 2I2SA 4CUCA 4Q27A 4NUBA 4I3GA 1AR91 2ZEYA 4IEQA 4LR4A 1HW5A 4META 4AR2A 1JZ6A 1RVF2 2TEPA 2R16A 1YI7A 1ZZ6A 4JKLA 4DB5A 5FY9A 1RUNA 4HN1A 4WM8C 3VBOB 1W6PB 3J7MA 4Q2FA 1X8EA 4D7YA 2W92A 3J4UH 3KGZA 2FDKA 1DGLA 4XJ9A 2R1BA 3GJAA 4IL7A 4OYUA 3AMHA 1OLQA 3LD8A 4CVUA 4LLOA 5DUVA 3GM8A 4BXSV 1SBFA 3PUSA 3USUB 3WCSA 2JG8B 4BZ4A 1AR83 1AXYA 1CJDA 4OI1A 3O1TA 4AQ6A 3FHIB 1X9TA 2RDSA 1YJKA 1QH7A 2A6VA 1D4M3 1ASJ2 1VBC1 3ZIWA 1RUH1 4C90A 5K9YA 3ETQA 1XB9A 2LROA 3KCYA 4JGZC 3MIDA 1G86A 2TUNA 3KGLA 3S6PA 4QQLA 3BB6A 4Q4X2 4NHXA 1TQ5A 1BK1A 3TEXA 4AGRA 4XZUG 3WT3A 4MADA 4CXWA 4DUVA 1OMIA 2HWB2 4ASLA 1OBNA 1NX9A 1RUE1 4OVEA 5EJ1B 1BMV1 2J1RA 4LHKA 2QQWA 3VBUB 4DOUA 4PIZA 4I3PA 3ZFEB 3WG1A 1AVBA 4AQTA 1XJAA 2C5DA 3ZXAC 2ARXA 4KGGA 2BYVE 3ZO0B 2P5BA 2WO1A 4KI5M 4LBKA 4RR3B 4NHLA 4XF3A 3I3DA 5DXDA 4UFKA 1FYUA 3WG3A 4O9GA 3B93A 1RUG2 2BFUL 4M3CB 5FKCA 5IK5A 4OI4A 4CP0A 4AF9A 1R1ZA 5DAWA 3AZZA 4XW3A 4TYSA 2R073 1HLCA 4UFIA 3OYWA 4N7UA 4AE2A 2NN8A 2Y6JA 1BEV3 3LOIA 3UL2A 2R043 2WZ8A 1EV13 1PGL2 2BBAA 2EIEA 1ONAA 2J1VA 4U2AA 5FQ0B 1IKPA 1ALYA 5EV7A 1B35C 3LAGA 4K1YA 2W08A 1JHJA 1URXA 2EXHA 2BPA2 3ZSMA 1QF3A 2ID4A 4QDQA 5FWEA 3S30A 4ZS3A 4PLMA 2DUQA 5FYTA 4Z1VA 1OKOA 2ZAHA 1LNSA 1O3RA 1PVXA 2OUJA 1CZSA 4L99A 4LKEA 1H6YA 5KBFA 1ZVFA 1W8OA 4MVTA 2RG4A 2KA3A 4KG0A 5FMOL 3U14A 3UGGA 3H1WA 3JBG3 4HANA 4WM7A 4Y24A 4DXSA 1JZ5A 1LB2A 1FMD3 4LPLA 3J7LA 4LMFA 2WNUA 3JQXA 4NRPA 2PLV3 4H2AA 4CCCA 2D6PA 1COV1 1POV3 1P8JA 1W6NB 4BOWA 2PHWA 4QGMA 1F5JA 1VBA2 5FPLA 1LGBA 4AI8A 4CEWA 1V0AA 1MPXA 4FAGA 3LOBA 3HBKA 1AL21 1GANA 1UO9A 2QZ2A 5I93A 3LQCA 5FZFA 3EJKA 1YNAA 1VBE1 1HB2A 3BPSA 1XOYA 1EAH3 1VJ2A 4XXPA 3KCCA 4AQSA 3H1MA 1FV3A 1X8MA 1W8WA 4LQRA 4YZ5A 5JXHA 4V1PA 4GQ7A 2OXBA 4KU7A 5IVCA 1V70A 4XFCA 1TMF1 1CIWA 1RL3A 3BIWE 3IZOA 1PK6A 1TNFA 4YSFA 3KT4A 4D0QA 5KXDA 1W2UA 1AR73 4XVHA 2CY6A 1WMDA 4NOTA 4XBQA 3THCA 5FXWA 3BI3A 3ENRA 2CSGA 3MUY1 3CQOA 4E4DX 1XE8A 1W8TA 1HJFA 4XILA 4CU9A 3AJYA 3DPRC 1LRHA 4M4PA 1F8VA 4GA9A 5B4XA 4O61A 1US3A 2D6NA 4URAA 3PHMA 4FPKA 4BQWA 2C9KA 3F95A 3LPGA 1PIV3 4XFGA 4O9EA 2YPJA 4N53C 4EJRA 1VIWB 2WA4A 3AMPA 1DGRN 1WBFA 3R0RA 1KQRA 5J7MA 2PHUA 2QFEA 2VMIA 2WFF3 3VZMA 1D7PM 1H1IA 1ENQA 2BVBA 2Q1FA 2JICA 4NHYA 4UI9L 3PVNA 1JOBA 3IDAA 3OUIA 5EYYA 1CVNA 5A6YA 4XDQA 1W2NA 2HLEA 3THDA 1ND3C 2GZWA 3PUAA 5FXVA 2YXSA 1AR61 3JB4C 3OPWA 1Q8PA 4GB31 1JS9A 2VUJA 1G6NA 1PO11 5FZAA 5LK5A 3OYWB 4LBLA 4F8AA 4TN7A 2GALA 2Y6HA 1LOEA 1IPKA 4D3WA 3R05A 1QJY2 2GNBA 5FAXA 2C4XA 1R092 1XQNA 4YGDA 1RHI2 3GF6A 3S5QA 4LIUA 3FUQA 2Y60A 5FP7A 1N3OA 3LWCA 1V9U1 2DURA 2VPVA 3KVAA 3J26N 3CKHA 1ZBE1 2RV9A 2VBDA 3O5SA 1H1MA 2QVSB 4YW5A 3AZWA 2KM2A 4GZ9A 3O14A 2MEV3 2VVEA 3NJXA 4Q5OA 4YVSC 1QQP2 4YW4A 4DRRA 4XFHA 2WNVA 5C3SA 1UU4A 1QJFA 3ZYHA 1NCQA 1HIXA 3BIEA 1V6LA 1WUVA 4WM7B 2F4LA 3GHMA 2JDPA 4LO7A 1Y9GA 2HWF3 2KR2A 2WNUB 3PUIA 4P14A 3RZMA 3T08A 5A33A 1X33A 2VZRA 3HAGA 1AR93 3IM0A 4HBNA 5FP4A 2ZXQA 2P3JA 3KZ4C 4CEWB 3CZJA 3OUJA 2RM22 2R0HA 3H42B 4CDQC 1W9SA 2JEMA 1NCRA 1NZCA 2B5HA 3G6JB 5A80A 3M7AA 4RSUA 5IW0A 4ZZ8A 1W28A 1W9YA 1W05A 1VAKA 3ZMNA 4BWOA 4YZ2A 4FPOB 1LJ7A 2R1DA 3J7NA 4GMP0 4XQDA 5EJZB 4CP9A 3H1YA 3BPZA 2NMOA 3S7EA 4XQWA 3TOJA 4AW7A 1ULPA 3LGRA 3J8F1 2B9UA 1U5IA 2H0BA 1DZQA 2WSUA 1SLCA 4L97A 1W39A 4BQ2A 1PK6B 3GNEA 3RVHA 1VBC2 3I3EA 3MIEA 5A3PA 2D5FA 3P5BA 1TVGA 5FZOA 3WDWA 1RUH3 4FI9A 3T2PA 5IVVA 5K0UC 3NV1A 2YYOA 5F2WA 1JMUB 3WQ7A 3RYKA 1POQA 3OBAA 5JXGA 2QBXA 3VV1A 3JXSA 2D6OX 3OGRA 4FPYA 4CEYA 3RSJA 3RI8A 2XWJB 5AFBA 1Q8QA 4GKYA 2CNAA 3E5UA 2BOIA 3EHKA 4R9AA 3KV9A 3RDIA 4DEQA 1K12A 4XUPA 1S2EA 2HWC2 4FFIA 4MGTA 2IZWA 2DTYA 1RXFA 3ACIA 3S0MA 3AYAA 4N9IA 3E6CC 5FWJA 5J48A 3P6BA 1SCSA 3W59A 1UWWA 1JYIA 4ET7A 2RMU1 3WP6A 2B42B 2QQIA 1F5FA 5FZLA 3H3LA 3L2YA 5JZGC 1LU1A 4FXKB 1WA6X 4PQ9A 3POBA 3K4DA 4BE3A 3PIGA 2VQTA 4ES8A 4Y3OA 4YGEA 4YW7A 2JIJA 1QIQA 1W90A 2VOVA 4QXHA 5AVPA 1GNYA 2BGOA 2KD7A 1MACA 4JHZA 4XQ4A 1C8NA 2EIDA 5H9QA 3SC7X 3OPZA 1JZ3A 4ASMB 1C3HA 1HRI2 1OQEA 4DNYA 4LO5B 2Y0OA 4BPZA 1QXJA 3T0DA 1OFNA 3I2FA 1DF0A 2AC1A 1AX1A 1OOPA 2ET7A 1PX4A 2GH8A 2UYAA 3MIFA 4QXKA 5A1AA 3B3QE 3VLBB 3AP6A 4PJYA 4D6SA 2WNVB 3S5AA 5I8YA 5DZFA 4D8MA 3O1RA 4TLFA 3WDUA 1DCSA 4LT5A 1Q5OA 3AVSA 2HWD2 1NCQB 5SV8A 5CADA 1RJ7A 3AKPA 5C70A 4UYBA 3VBFC 1SQ4A 1COV3 1W99A 2VUCA 2EAKA 3JB8A 1HV1A 5LA1A 4LULA 2VW1A 4CU6A 4YRDA 4C8DA 2VOKA 1XE7A 1DU3D 5CFDC 5A33B 4QQPA 1AL23 1NAEA 1WW7A 3QLQA 3CBNA 5C3RA 1KS4A 3ZYGA 1WLTA 1VBE3 3NJZA 4IEOA 2PYTA 2C9AA 3AP7A 4AHWA 4XTMA 2R0FA 1NCRB 2BVVA 4LA3A 4Q4W1 5JOYA 4DINB 4FAHA 1K5MA 1UX6A 2J1EA 5JIUA 3LA7A 5JOZA 5FZHA 4CP9B 4DQAA 1OPOA 1TMF3 2Q8DA 5CISA 4YG3A 5FLHA 5JSRA 1MVEA 1DIWA 4OHVA 5ACA2 1AX2A 1VBB2 3AL5A 2X8KA 4S2HA 3H3ZA 5L7OC 1O91A 5FZOB 3RFRA 5AFEA 4M00A 4CDUA 1ST8A 1UXXX 2WQZC 4CEYB 3OCPA 4TXWA 1QOOA 5FPBA 2SLIA 2V73A 2ZBJA 1RUC2 4QKDA 1YIPA 3I49A 2BTVC 3NNLA 4L8QA 5FXZA 4RD7A 3VBOC 4P9GA 4KBZA 5FZDA 3AYCA 5I0RA 2ORZA 3PVOA 4NJ4A 4NROA 4LKDA 2VC9A 1IQAA 3V56A 4BQ4A 2XHNA 1OPMA 4FPCA 5JDBA 5BNPA 2GDFA 1LHOA 2MPFA 1UZYA 1A6CA 2Z2SB 1PO22 2V4VA 1UY4A 2BERA 1AR63 5J96B 1JZ2A 1EUTA 4GB33 4XABA 4Q4Y2 1PO13 1GWMA 4QU2A 3PMSA 5EZWA 2VMDA 3L2HA 1E5IA 5KR7A 4OZXA 1LEDA 5ANNA 2VNGA 4N7IA 5DDJ2 3VL8A 3WUCA 2ZTNA 3OPTA 1V9U3 3BCWA 4CCNA 3DKWA 4YZ1A 1ZBE3 3PU8A 4CCKA 1CGPA 3WV6A 2DDUA 2G9FA 3PJQA 3DEMA 1N3QA 3ZM8A 3W5MA 4AWDA 4E2GA 1JYVA 3D4KA 2QTWB 1HQNA 3VBUC 1OOPB 3FLPA 1KRIA 2A5ZA 3WDYA 1NZIA 3OEBA 1BBT2 1V6OA 2VZPA 3B5LB 4PDWA 2RR11 4QPGA 4LKFA 4RR3C 1LULA 4EQVA 3H3UA 2L9LA 1SLAA 5FJHA 3WLUA 3BALA 4WVZA 3O1PA 1E5RA 2D6KA 5B4NA 3W5NA 2EAAA 4R4XA 1LKNA 1EY2A 2WYFA 1O8SA 1NQDA 2PFWA 4LIVA 3UT0A 4QQOA 2D93A 3AMMA 2A3YA 4YZ3A 1NQJA 5KC6A 1G9AA 2CU5A 2AEZA 1LESA 4BQXA 1UOJA 3B01A 1LHVA 3I3MA 5JVVA 3K4ZA 1WD4A 2UU8A 5IJRA 1LOCA 2A6WA 5FYVA 3V64A 1GP6A 1RUD1 2Y64A 4XIOA 1K5MB 4OMDA 2RDQA 2X53S 4XFIA 5FZMA 3RWNA 5FPZA 5FY8A 3J8F3 4A2UA 2VW0A 1RVF1 2VCAA 2YGLA 2W68A 4NIHA 1YQ2A 3KB5A 5GZCA 4COVA 5C3OA 5AVAA 4MGYE 5EWSA 5FCCA 4GWNA 4HL0A 5IATA 1I1EA 3INAA 1OD5A 5FOJB 1HRV2 2YBPA 4IESA 2Q8EA 1FNYA 5CBLA 1MVQA 1DQ0A 2QDNA 2IXIA 5HI0A 3U37A 1ZZCA 4QGLA 4CDUB 4DS0A 1WCKA 1ULOA 4P9IA 4YPJA 4X6QB 4Q0SA 4FTBA 2MNGA 3IN9A 4ITCA 4JDOA 4Q4V2 3M3QA 5FP3A 4FO9A 3W21A 4BXFA 3H7YA 1ASJ1 2WDBA 5C5UA 2IWGB 4LK6A 3MPBA 4DUWA 5IVBA 1OSGA 4AI1A 1GNZA 3T1MA 2RJLA 3LEIA 1W2AX 4JX0A 1NXD1 3VDBA 4H14A 4HVRA 1FOD2 2IFRA 4Q4X1 1IPJA 2F4PA 4MGQA 2RMU3 4BQYA 4BQ5A 5A6QA 1GNHA 1G9DA 3ILRA 2HWB1 5FJKA 1CN1A 5G05L 1GQHA 2FDJA 5BNPB 1DZTA 3DUIA 4LE3A 1DP0A 2UYBA 2DCKA 4YM1A 1H8TA 2HH9A 3WW2A 5CNAA 2E7AA 1UIJA 1WWYA 1J58A 2ZX0A 3HD8B 3I54A 3SH4A 4AGVA 4AQ2A 5FLIA 1GMMA 1RUG1 1LR5A 2B7YA 1IS6A 1OHFA 4YYOA 5FPAA 4WBBA 1W8HA 1KFUL 3LEMA 3FZ3A 3SCFA 5J37A 5LBCA 1SPPA 4P00B 4X6RB 5LA2A 5F37A 4L92A 3V0AA 2ERFA 2OZJA 1SDWA 3ST7A 3WW3A 1MZ5A 1E5SA 2BNOA 1PGL1 2XVLA 2CDOA 4GJZA 2DWRA 3W58A 4XF4A 4ZKTB 3W20A 1RJ8A 4QPGB 1NG0A 5CU1A 3FHQA 3MI8A 5T5PA 2H6CA 3H0OA 4CDWC 5KHJA 2JDAA 4YW1A 2AACA 1MEC1 4INDA 4KWUA 1XNAA 2JD4A 4OI0A 4JV4A 4RQPA 5C3QA 1GOGA 3GZTB 1SLLA 5JWPA 3M3CA 2W1QA 4CXYA 2GAUA 3Q8CA 4CUGA 5F8PA 2JIGA 4AVVA 3KF5A 3FLRA 4IETA 2ENRA 1POV0 3AFGA 5BNNA 4Q4W3 4ZU5A 4YVWA 5K7PA 5LWBA 1JYXA 4HSJA 1H6XA 2YZ4A 4XFBA 2XBO2 4OZOA 3IMNA 5AC92 4JTNA 3I2DA 1VBA1 2R6QA 1UYYA 1XSRA 1ZA7A 2VG9A 4XACA 4Y5SA 1XYOA 2VM9A 4QPWA 3N9PA 4Y4YA 4YW6A 5FK8A 1H9WA 5E16A 1C5HA 3PTYA 4ARXA 2WT1A 3HR9A 5ABJA 4XJ8A 1G7YA 1UU6A 2DVGA 4TSVA 4XBNA 4GH4A 4ONUA 3EYPA 4XF0A 1VAVA 1YO8A 3JCIA 2VW2A 3K77A 2ORXA 3WUDA 2E63A 2K0GA 4FP2A 5JMOA 1ENRA 3SHRA 3O1MA 1XNCA 3MO4A 1R082 4WM7C 2ZHMA 3PL0A 4FFHA 1H8VA 3OD4A 1EPWA 2WNUC 4K3UA 5E89A 5FMBA 3UJQA 3IDEA 3UYJA 2XJQA 1DQ5A 4CEWC 1GOFA 3NW4A 3PUQA 1XYNA 4XTPA 4HZFA 4YLZA 2QQPA 4PI0A 4LJHA 5FBJA 4XAEA 2AZ5A 3GZUC 2BNMA 4MUVA 4ZY9A 5GALA 1PHMA 2VZTA 2CAVA 3C7OA 4UW3A 4Z8BA 3K3OA 3U75A 1ULDA 4MX3A 4YM3A 3VZLA 3QOPA 4Q29A 3AZXA 2VUAA 3CJXA 3DYPA 3LSDA 4JHTA 5T5JA 3CIHA 3UJOA 3BU0A 2QE3A 4FTEA 4CCOA 3V0BA 5CYYA 1H8TB 4X8NA 2OYZA 1VALA 1WLWA 2A1XA 2O8QA 3T30A 1EPZA 1DG6A 3I2OA 3MZHA 4PHZA 3RGBA 1VMFA 3TB0A 4V2WA 5T52A 4FOYA 1YRZA 4QB6A 3WHTA 3NKTA 5FKBA 5T50A 5BUVA 4B29A 3QBQA 4LEJA 3ZR6A 4DIQA 2K46A 4BQ3A 4U36A 2JKBA 3QH6A 4S2DA 1SPPB 3I2KA 1PMHX 5F9TA 3V0AB 2O1QA 1RC6A 4Z82A 4NIGA 1QJY1 3KV4A 1R091 2RR13 5GLUA 2JXAA 1RHI1 1UAIA 3Q8AA 1GQGA 1Y9MA 2UURA 2VBBA 4Q8LA 4FFGA 3ZFFA 2ZPXA 3AKRA 1W3VA 2BFUS 5FUPA 1C5IA 2WBKA 4MLOA 4XUTA 5A7SA 4CE8A 2EIBA 1QQP1 3NQHA 4RQPB 4OCTA 5M0TA 3T4VA 2H0VA 1VPHA 5EIYB 2DCYA 4XJZA 4FPEA 2ZX2A 1WMFA 3AB0A 4LKSA 4QM8A 1K45A 5JR7B 1OKQA 3KD4A 2DBNA 2GN3A 4FVVA 3LKJA 3POEA 4OLLA 1L7QA 5BNNB 3L9JT 3CDZB 4N9HA 1RUD3 4YVWB 2PXJA 4QXBA 4YWAA 3WX5A 4LO8A 3ZXLA 4BIFA 1MZEA 4LHSA 4Y20A 1WA4A 2P34A 2XH6A 1GU3A 5F3IA 1U12A 1W06A 5GZEA 2RM21 3BTAA 4FPLA 2DF7A 3MFCA 4QB2A 2AUYA 5C8WA 4IQPA 3WQ1A 1LGNA 4QQ2A 4CSWA 2A7AA 4QPIC 5ABJB 3ATGA 4F83A 4KNCA 2FDGA 2VY0A 1UYZA 2P2KA 5FMOS 5T5OA 2VMCA 1CONA 3A22A 4GH4B 2WQ4A 1CQ9A 2VZSA 2XL9A 4A4AA 1KFXL 2Z5WA 1QDCA 4AI3A 1TZOA 2YFZA 4MO3M 5FZGA 5IWFA 3LDRA 2XUEA 4DPNA 5LRRA 4WZFA 2A71A 2Y6LA 4K9SA 1JHNA 1S2BA 3SCGA 3THTA 3TYJA 3QACA 1H2KA 3FWEA 4L0PA 3FUOA 4HETA 3ZXJA 3I97A 4K7JA 3RMYA 2XKOA 2YMZA 3WW1A 1YWKA 3IAPA 1CAXA 4S2GA 3P3NA 4UFMA 4Q4X3 2VNOA 5KXEA 2VQAA 1W0NA 4XJWA 2EXKA 1AR82 2VOWA 3VBHC 4ES9A 2WINB 4IERA 4H3WA 3NV2A 2HWC1 5A32A 4LO4B 3D82A 4LBMA 1Y7BA 3OEAA 1IGOA 3GGLA 4HKOA 1DZRA 1LTEA 1IS4A 3S57A 4CRQA 2WKKA 1H4HA 3V0BB 2ILMA 4DY3A 3MPPG 4BK4A 4AG4A 1OA4A 2BWCA 2QQJA 1LOFA 2VTXA 2WSVA 4J1WA 4ZPIA 4ZXEA 1H2MA 3ZR5A 1DBNA 2ADDA 2ZZQA 3M3EA 4XUNA 3RJRA 4BB3A 1UMIA 2QKDA 3WZ1A 1ULCA 1SZBA 4CEYC 4RHV2 1QHDA 1J59A 4JDNA 1KITA 5ERLA 2FMDA 2YC4A 3FL7A 4RS5A 2VZ1A 2RS32 5J98B 3T2QA 1PZ7A 2PAKA 3S7IA 4A7ZA 1S0DA 3M2MA 3R4UA 2ETEA 3SKVA 1UY1A 3V65A 4CU8A 4HKLA 3WSOA 2JDHA 1MEC2 1SLIA 2XMLA 1NA1B 3MIHA 3ZFFB 1RTVA 1HRI1 1Q3EA 1W2OA 3ACLA 2FZ2A 4W6YA 3FFZA 4XURA 3CU7A 2WQ8A 3LA2A 4F7ZA 3B9IA 2RDRA 4KQ7A 3AMNA 1BEV2 1K5JA 2XDVA 4LNVA 1DHKB 1EV12 4LORA 4PLOA 4XCAA 4AFAA 4IV3C 4C91A 4FPGA 1H2NA 3ZFGA 5IUQA 1JN2P 3ACFA 1D0GA 2WO7A 2HWD1 1LU2A 1XU2A 2FDHA 1FATA 2ZS6B 3KMHA 3KSCA 3BN6A 2D6LX 1QNWA 3EBRA 4Y20B 4CPBD 1Z7S2 2MHFA 2Q5TA 3DXTA 4C1WA 1QJEA 4CDXA 2YG0A 5A6XA 1GZ9A 4JRAA 1ODMA 3ZOIA 4EWDA 1MR5A 1O6UA 4B7EA 4S2FA 1HB4A 3VN4A 1GZTA 4NHMA 4COUA 1V00A 4MGZE 1OA2A 3KWVA 1OI6A 1XRUA 3AXEA 4HG6B 3TBDA 1LHNA 4XZPA 2RDNA 1PVC2 1N3PA 1WCQA 5D2AA 5C4WC 2K9ZA 4IEPA 2O8OA 3ZYPA 5LBEA 3I3QA 5ACA1 1QJX2 2VQ0A 4JDMA 3T0BA 1VBB1 4BH9A 3I2IA 3E6DA 3ILFA 1PZ9A 3ZVXA 2PTMA 4EROA 2SBAA 3MW2A 1UKRA 4E4ZA 3AXDA 1LOGA 1GYKA 2OZ6A 1STMA 3WP3A 3LDBA 1CAXB 2X5IA 4PCRA 4PIXA 1MZ6A 4BK5A 1U5XA 2B4KA 1I6XA 2PQSA 1RUC1 4GKXA 5F1RA 1S1AA 1JODA 3AYEA 4XC9A 3SNMA 5JXJA 1ZBA2 2E31A 2BJSA 5CKMA 4B4QA 1GUIA 2VTFA 1J1TA 5A32B 2RS52 3NO8A 2B8MA 4RGGA 3QH7A 4I0AA 2Y6KA 4JAAA 2AYHA 4XBLA 4YM2A 4YG6A 2QCSB 2WZPP 5BY5A 1ZX5A 3OOXA 2V09A 1ULFA 3N36A 2Y38A 2ZZJA 4QDSA 3UGHA 4ARYA 2C6SA 3I4IA 4LITA 3RZLA 4CDUC 4QHOA 2ZGKA 3GCXA 1IKQA 3VDDC 1PO21 1MS0A 1PZ8A 2F6BA 3AP5A 3ELNA 2R32A 1ZRIA 4Q4Y1 3RRDA 2JG9C 5LY1A 4HN0A 2DYCA 4RS5B 2WFF2 3LZZA 4UAPA 1ZRCA 1S0IA 3ECQA 1QJY3 1V6MA 4RYDA 4XUQA 2BDRA 2CDPA 1R093 2WO3A 5E8AA 5DDJ1 2OX0A 1RHI3 2IXLA 2GC1A 1OC1A 3OGJA 1WW6A 5L9BA 1O8PA 2QUOA 4RGKA 4PT6A 4Y5Z0 3WDTA 5I8TA 2EXIA 3TNQA 2EICA 2P3KA 1FT9A 3GHNA 2R062 2VMGA 1QQP3 2W47A 3POSA 2VOTA 4NN0A 3C7EA 1IQDC 3ZPOA 4C0BA 4CXXA 3EB7A 3MV11 5LA9A 4QMAA 4NIIA 3WG2A 1BBT1 1JTZX 1SCRA 1RMU2 2PHLA 2TNFA 2BEOA 4AVBA 3FC0A 1BVP1 3ES4A 2YBKA 3SXWA 3ZFGB 2BNNA 2ZHNA 4RN5A 4EN0A 3BYWA 1ZRFA 1SLBA 3O7OA 1F9KA 1PX3A 3AP4A 1DGWX 2H6BA 4JKMA 5CKQA 3VGIA 5D8AC 4SLIA 2MEV2 4D6RA 4WM8A 4QX0A 4L11A 4IV1C 4D69A 2IXHA 3MBWA 2RM23 3O1UA 2W1WA 5A6ZA 1WW4A 4CDXB 2W46A 1PM4A 1W2TA 5FPVA 2FCUA 5LBFA 2D97A 1E57A 1JOPA 3SEPA 1GWKA 4Q0UA 1I5PA 1F4AA 2JB8A 2HYKA 1H1AA 4HK9A 2D3SA 2GC3A 4IE0A 2WL1A 4Q0VA 1UZWA 4EYUA 3UK9A 2VMFA 1VBC3 5FP8A 3KQRA 1LOBA 1JW6A 3DECA 3KS7A 3TN92 2UWCA 4JRLA 5T3NA 1HRV1 2XLGA 1JZ8A 5EPAA 1D2SA 2J1AA 1TME2 4K6BA 4CCLA 5L19A 1US2A 1NY72 2GH2A 3DKQA 4WVWA 3T1LA 3EMRA 5FY0A 3ILNA 4E4HA 4GMP1 4NR1A 5FPUA 2JE7A 1W9FA 1RUE3 2X5IB 3K3NA 1GKBA 3U11A 4HONA 2VTXJ 3O12A 4P9WA 4Q4V1 2ARCA 2HWC3 1JYCA 1C57A 2PHDA 4G4FA 3AMQA 2QQVA 3WNOA 1FPN2 1RUF2 3OF1A 1TNRA 5FMCA 3T4HB 4CA9A 2UY9A 1ND2A 2P3IA 1FOD1 5JR2A 4YG0A 3SEEA 5CEHA 3SH3A 4E9KA 2A3XA 4L2NA 3A21A 4WVMA 5FYUA 1U5YA 3MF6A 3TEZA 4AFCA 3H50A 2D3PA 1J84A 1QNYA 1BQPA 1J3PA 1F31A 3VKLA 4XFAA 1XNDA 5FYYA 1CZTA 1J83A 1PNFA 4BQ1A 4QM9A 1VAMA 3WNKA 3U1XA 3SMHA 1S55A 4DO0A 3POGA 1RIRA 1UOGA 1WGPA 3I2HA 1BKZA 2QDRA 5KHHA 2VZUA 2ZKLA 1HRI3 3AC0A 3A7QA 3NNJA 4GD4A 1SG3A 1O3TA 1VMJA 3BOWA 5F5AA 3I8TA 1O4ZA 4BMEA 2YFUA 3ALQA 2PN5A 2Q1ZB 1H8TC 3FE5A 4BCUA 1IS5A 3OG2A 3WEZA 1HKDA 4AK3A 1QKQA 2HWD3 5LCWL 4OFGA 5GKAC 1DYPA 2A73B 3FBMA 2W1UA 2EF6A 3RYRA 4UOJA 4UT5A 5C8CA 4M0NA 5C9AC 3O0XA 2ZMLA 4FPFA 4WM8B 2B45X 2VE1A 2XVGA 3O1VA 1BLZA 4IDZA 2XJVA 3J7HA 4MHUA 4G3YC 4R52A 4AFMA 2R7EB 1SACA 1YFYA 5EP9A 4AI2A 3GZEA 4E2SA 1WZXA 3OUHA 1DGRA 1YFUA 1XC6A 4IE5A 2XBO1 3NWKA 4P9YA 5FZ8A 5L9RA 5AC91 5J36A 2Y8KA 3SQOA 1UW8A 5F6LB 3OGSA 5HCBA 4NIAA 5KHIA 2FZ1A 5GJ6A 1W8FA 2ZACA 4RQPC 3UKNA 5ACA3 4AEDA 1VBB3 2ADEA 3R4DB 5JAXA 3HMYA 3UESA 2XLFA 1L3JA 1V6IA 2JDMA 1N1TA 4MGIE 2GU9A 4Y1YA 5FDBA 3MIGA 1H30A 5JZGA 3CZUA 1R081 5BNQA 2J1TA 5IAXA 2VGDA 3AKSA 5A7PA 1O4TA 2D3RA 1QU0A 2EALA 2ZGMA 4YVWC 1CESA 2FCTA 5FY4A 4EZ4A 1A3KA 4OULA 1N47A 3QD6A 3WCRA 1M4WA 2XJRA 3B69A 4YFWA 5FY1A 2C26A 5A1FA 4K20A 4KWLA 2XJSA 1QDOA 1Q8OA 2NZ9A 2WWUA 5ABJC 3RI9A 2Z79A 5JXIA 2CGNA 5KXBA 1WMEA 4GH4C 1SFPA 2VNVA 2WAAA 1DYOA 1UY3A 1ND2B 2NQYA 2JG8C 2ZMKA 1QGLA 2W0XA 1PO23 4WVMB 4TLGA 2OUHA 3GCWA 3USSA 2EVXA 2VULA 5HBAA 4QQHA 5CKNA 4LBOA 2W9XA 4Q4Y3 3HQUA 3WQBA 2CTVA 4OHZA 4DXTA 2P3YA 4UW5A 1TE1B 1VP6A 1UMZA 3K51A 4LOSA 1CD3G 4MGSA 1QXRA 2B9VA 4CU7A 4UFJA 1CX1A 2OPKA 1R1A2 1HXS2 2WWJA 4N43A 3PIJA 2XPJA 3FJSA 4XFFA 5DDJ3 3C2UA 4IEUA 4KWJA 5HXVA 4D94A 1IZ3A 1S0CA 5BPXA 1Z78A 5K8SA 2ZOEB 5DAPA 4GXLA 3ZFEC 5CIRA 5FMDA 4AI0A 2OVUA 4HOOA 4COYA 3AL6A 4QWNA 5A3NA 1PGW2 2FD8A 1I9RA 5IVYA 1BBT3 2PAMA 2HKXA 1OXCA 3ZDSA 5A7OA 5A1LA 3HT2A 4J6GA 3B9CA 5BXXA 3NJVA 1O7FA 4COWA 4AEMA 1OT5A 5I0DA 2BQPA 3ABZA 3UV9A 1HX6A 4CDQA 1RUJ2 4Z2AA 2CWMA 4AHYA 5C8CB 5FZBA 4W6WA 2AGSA 4V2VA 5F3EA 4EV0A 2P17A 2VQUA 4EZHA 3ZXDA 4N8MA 5EQUA 4ASKA 3O1OA 1MZFA 1JXNA 2A70A 3N35A 4XHBA 1NA1C 2PHXA 3ZFFC 4NRQA 4QGNA 4I0BA 1RGSA 1ZZ9A 3VBSA 5A3MA 4OHYA 2YDEA 1BZWA 3M3OA 4XF1A 3E5XA 5K0UA 1CPNA 1KDMA 1AL0G 1ZA4A 4JCKA 2WZR2 3NNGA 4M0HA 1WMXA 4DZGA 1ULEA 5T5LA 3CO2A 2YU1A 3FN9A 4AEDB 2WR9A 3ZYJB 3CL1A 1HRV3 1BYHA 3WNXA 4FBFA 5G04L 2ZABA 2BW8A 3H9AA 3Q8BA 5JZGB 2E9QA 5LY2A 2VCBA 1YYNA 4BHPA 3JD72 1OQ1A 5EFUA 4RGAA 1C1LA 4EN9B 1UD1A 2UWBA 2A3WA 4Q4V3 1XPWA 3POYA 4JQRA 2YU2A 2VAUA 2E51A 1ACCA 1NLRA 2BBVA 2D44A 2DVAA 3M8LA 1VBD2 2YPDA 5LASA 4XXAA 1Y43B 2QJVA 3THPA 1JYTA 1W9WA 4XDPA 4MV2A 3LB9A 4A7KA 1FOD3 4XAAA 1OURA 3ACGA 4DUXA 1GP4A 1A34A 1AR81 2E7TA 2XXZA 1X82A 1QMJA 2WS92 3VUOA 1X50A 5JLVA 2XL7A 5EJ3A 4R9CA 3N9OA 5FZ3A 2V5DA 3VZJA 1VB4A 1EUUA 1F2NA 3K4AA 1GLHA 4IGQA 1NKGA 4Q0QA 2IXCA 2W87A 4M4RA 5CB7A 4TTGA 1JBCA 4Q8KA 4MG2A 3FX3A 1CWPA 3VDAA 4N43B 1AYN2 4ISQA 4LXLA 3X29B 1MQTA 1PMIA 2ZGLA 3RPQA 5L9VA 4ZU7A 5FR3A 4RHV1 1LOAA 4FOVA 4JTOA 3JU9A 1ZM1A 4BM8A 2RS31 2GMMA 5FREA 3ASIA 4CCEA 5TSWA 4HK8A 4NWVA 4PDWB 1WKYA 3G7DA 2Y0IA 5KHKA 1WD3A 2VD7A 4LUKA 4ZXKA 3M70A 3WDVA 2W52A 3AVRA 1YQCA 1MS1A 5FYCA 1RUI2 2AR6A 4MH0E 1QXPA 1LECA 1LOFC 3HNYM 3N7MA 5HCHA 2VR4A 4Q0PA 5A3LA 1HQWA 1UQXA 4CDQB 3EXUA 4QX3A 1BEV1 5FO8B 2YUEA 3O1SA 1EV11 3FHAA 3J9SA 1UU5A 4K1ZA 3RWKX 2CWSA 3UNPA 1W8UA 3RG0A 3DF0A 4UFHA 4MXWA 3SH5A 1OD3A 4JGYA 4A6OA 3HOBA 5FO7B 4K8RB 2D43A 4OQ9A 2XVKA 2JWPA 4LBQD 4AGGA 1DGWA 2JDUA 3IPVA 5AC93 3U4SA 3UGFA 5IK4A 4ATEA 2DVFA 2GNDA 3LSEA 4BISA 1QJU2 1Z7S1 3SISA 3VBSB 3WF2A 4Z07A 5J1XA 5L7OA 4XETA 5GZFA 3ZSLA 2VZ3A 3KHBA 4NE9A 2VMHA 1K42A 2GMPA 5K0UB 3WF1A 4FP3A 4LE4A 3VKOA 1OF4A 4CDWA 1JOJA 3K75B 1SEFA 2HEVF 1WCSA 1W9TA 1HN0A 2YY1A 3AYDA 5KHGA 1KD7A 3VZKA 3ZFGC 1R083 2HYXA 3CNAA 1QJZA 5L36A 1DQ6A 2VCMA 3VKNA 3T0AA 1PVC1 2XOMA 2PAEA 3ROUA 2RS12 4P9JA 1I3HA 2PHRA 4XF9A 4D6QA 2Z4FA 1JH5A 5C7GA 4GALA 1QJX1 2WYSA 3LFMA 4MYEA 3B94A 5LEJA 2UY8A 3WR0A 4CDXC 3D6EA 1UY0A 4BMBA 3WD5A 3BTXA 4YM0A 3VD7A 1YLLA 1AF9A 4WVVA 3APBA 2BGPA 3B02A 1AYM2 4AYUA 4A7YA 2WZEA 3PVBB 3OB8A 4K40A 4PQQA 4AZZA 1PK6C 4H55A 3AX4A 2WT2A 2VUDA 1L7LA 2VH9A 5LZ6A 1ZBA1 4BJ0A 4FXGB 2RS51 1Y9QA 5LRSA 3BKZA 2X10A 1VRH2 2GC0A 1RINA 3KV6A 3ZDVA 4XHXA 3LEGA 3GBFA 1YI9A 3HQXA 2K2SA 3P1IA 3T2OA 1XYPA 1C1FA 1WLCA 1MQTB 2DTWA 3IAQA 3WQ0A 3TAYA 2X5IC 2CL2A 1WW5A 4PBOA 2G19A 1J3QA 3ME2A 4NPRA 3NV4A 2WAOA 2Y26A 3H8OA 2WFF1 1W6QA 4CCMA 1C8M2 2W5FA 2WLPA 5JCTA 3PTRB 2VZOA 3ACHA 4QHZA 5CG9A 2PHFA 3WNLA 1X7NA 5DABA 2J22A 3BOPA 1WLDA 4NAMA 5FTTC 3HN1A 4R8HA 5DUUA 4AVTA 2HWE2 4AHZA 3DCQA 3NAPA 5FZ4A 3ZN5A 3ZSEA 4DMIA 2R061 2IXKA 2HEWF 3RNSA 1W8ZA 3AM2A 4GULA 2LTNA 4FCAA 2GP5A 4O65A 3ZYIB 2G9ZA 4CCJA 2E26A 1YQ8A 4XCBA 4Y1XA 1RMU1 3WF0A 4IW3A 3I3BA 3N9QA 4Y1ZA 2F17A 1PM7A 4MXWB 4PI2A 4JGYB 5FIXA 2TBVA 2WRAA 2DVDA 4W6XA 4ISRA 1MS4A 2MEV1 2ZJCA 1HB1A 3IPVB 1RVF3 3R4SA 4YARA 2DU0A 3OBRA 5DUWA 2ZEZA 1LODA 1YIFA 2J7MA 5BYNA 3U07A 2WNVC 1IG0A 3HNMA 5L7OB 3FMGA 3LEKA 1GZWA 2G4IA 4P9XA 4B7KA 2PQQA 3JZVA 3N7JA 3WHUA 1NCQC 1JZ7A 1GZCA 2XHKA 4P9LA 2X09A 3OD0A 3GALA 4CDWB 5DAXA 1ENXA 5JI9A 2DCZA 3MF9A 3WW4A 2BZDA 5IT6A 1D0HA 3GBWA 3IB3A 3K2OA 1N1YA 4GAZA 1OFSA 3NV3A 3HQRA 5EXOA 5FUIA 4BYYA 3CMGA 4KMQA 3A0NA 4BLJA 3KT1A 3DV8A 4PLNA 1JI6A 1OVSA 1ASJ3 2O14A 2GNTA 3ON7A 1NCRC 1W04A 2ZGSA 3TN91 4AVCA 4OUSA 1UXZA 3D0SA 2JE9A 1W03A 1TME1 2RJ2A 3LFIA 1NY71 1JU3A 4HXCA 3VBRA 3N4MA 4W4ZA 2PHTA 3Q8FA 2W1SA 1WBLA 2HWB3 2ZX4A 5BNOA 4UF0A 4P08A 1KGYA 3BUCA 4QKNA 3MLLA 4XE9A 3WG4A 1UY2A 4CUAA 1D4M2 3ETPA 4MSVA 4LBJA 4TWTA 2QQNA 2JDKA 4I01A 1S2KA 1UCXA 3ZYBA 2R49A 4GWMA 3CJIA 1BJQA 4OUMA 3VHPA 2ZGQA 3DL3A 3K46A 3WP4A 2ZGPA 1FPN1 1RUF1 2OPWA 3RQ0A 5HCFA 2V72A 3IT8A 5A70A 5EHDA 5JPMB 1RUG3 3GYDA 4CP2A 1W6OA 2B39A 3B00A 3CHXA 4HKWA 5DAVA 3N9MA 1U5ZA 4UFLA 3QCWA 2VVDA 3D3AA 4EN7B 4CP1A 1LHUA 1FAYA 1D4VB 4RHV3 2G1MA 2QQMA 4I02A 4NRMA 2JD9A 1K3IA 3BTZA 2D6MA 2CAUA 5FZ9A 3TRSB 2RS33 2BRTA 3TNPB 3VHNA 1PMJX 2BWAA 1IG3A 1RXGA 4OMCA 5FLJA 5J09A 5I0SA 1W6QB 2W91A 4CZSA 2J1UA 2R30A 4FTSA 1MEC3 2XJUA 2JJ6A 2R072 4LK7A 5IAVA 1IS3A 5A3TA 3I7DA 2DV9A 2EXJA 1OVPA 1ND2C 2I07B 2RJKA 3IMMA 1Q56A 3TEYA 3OY8A 2R042 2VMEA 1IHMA 2OT7A 3NAPB 2IFWA 3VD9A 5DG1A 1QOSA 2JDYA 5F5QA 2HJIA 5CFCC 4XIKA 3N9LA 5FZ0A 5IFPA 5A7NA 5C5TA 3RZGA 3ORJA 3WINE 1VBA3 4NVPA 2GMEA 5FZ7A 1NOVA 2LALA 1NUKA 3LPFA 3MLKA 5I8SA 4OHXA 1Z7S3 1OLRA 4P02B 2WLQA 4XJAA 1OOPC 3JBG2 4JQTA 3JUUA 4KBBA 1FMD2 4G9SB 4A44A 2FDIA 4URTA 2IVJA 2PLV2 4FT8A 3FFQA 2DVBA 5F5IA 1GZWB 4A3XA 1XXNA 3HWJA 3KF3A 3MUZ1 2ZGTA 1O5LA 3PVEA 2D5HA 4XPVA 4B1MA 5HXMA 1LGCA 4P5YA 5E1RA 3RMXA 2AREA 1W0OA 3LIGA 3KT7A 3LIHA 1PVC3 5FY5A 3TWIA 4BIOA 2WABA 3ZXGA 4AEKA 1O3SA 5C8CC 1EAH2 1REDA 1SBDA 4GWIA 4K21A 1QJX3 4NMIA 2HBTA 1AUYA 3MGUA 5LEKA 1A78A 2D40A 2J1SA 2P6HA 3SITA 1YQ5A 1YCIA 1DLCA 1K5MC 4I09A 3OSDA 2OQ7A 3VBRB 1AR72 4M01A 3VHRA 1OQDA 1AHSA 3AJZA 1UZZA 5FZ1A 5BNOB 4UF0B 4RL7A 3KHCA 5FP9A 2ZGUA 3PMEA 2B46X 3VD3A 4GIQA 3VZOA 1AJOA 1QEXA 1ZBA3 1J3RA 2JECA 3I2JA 2ZA9A 3NKGA 3OBTA 4FQZA 2C0ZA 2RS53 4WZCA 5GM0A 3BVCA 3CJIB 4AEDC 4E8DA 2FCVA 1TG7A 1CR7A 1IPSA 2CGPA 1UZ0A 1UOBA 4KU8A 4HSLA 1NLSA 2OS2A 1S0FA 1HN1A 2BU9A 3A23A 2C1FA 1OH4A 1W6OB 2JB4A 3HT1A 4HVOA 3C3VA 2CYFA 1PIV2 4MXVA 1CJPA 4FPHA 3N9NA 2VO5A 4B4PA 1BHGA 5L73A 4MHRA 1YJLA 1H4GA 5FK7A 5HPOA 3WNMA 2QQKA 1CX4A 1T2XA 5F32A 5JPNB 2FMYA 3C7FA 1CAUA 1CPMA 2D7FA 4FFFA 1LEMA 1R1A1 1HXS1 2XJTA 4XMAA 5FZCA 3ZXEA 2AH2A 2P4EA 3CEWA 1PNGA 2NYYA 3B7MA 2E33A 2Q0AA 5LA0A 1TEIA 5DZGA 1Z0HA 2UWAA 1UL9A 3ES1A 3MICA 5BNPC 5A7QA 3LDKA 3MHZA 2P37A 4FQ4A 1BVVA 2R063 3OY8B 2RE9A 1OLMA 1D2QA 3KM5A 4YZ4A 5GLTA 5JIAA 1PGW1 3POFA 3WY6A 4DXRA 1W3XA 2DBIA 2W94A 3GJBA 3KLSA 5H9SA 1T6BX 1OLME 2BP6A 1RMU3 2BV4A 2JE8A 2Q1MA 4ZZ5A 1FNZA 4NAOA 4EN8B 1KXGA 1VR3A 1X9PA 3M1HA 4C1XA 4Z2WA 4HFSA 2PELA 2NLRA 3VDCA 1VMHA 2XKPA 4N43C 2P6CA 4Y1UA 1H2LA 3D8CA 2BOJA 5JI7A 1RUJ1 4JC1A 4AXOA 1RB8G 2ZEWA 4QPIA 1R64A 1GP5A 5D1IA 4CYDA 4SBVA 1KJLA 4ZONA 4Y33A 1C28A 4IEVA 5C71A 3RZKA 2PA7A 2GP3A 5FZIA 2HWF2 4PDWC 4QPGC 1XNBA 3FLTA 1GQPA 4NPLA 1UN1A 1AR92 4JZRA 5DMYA 5FPXA 4AI9A 4QX7A 2LRPA 4FSJA 1HDKA
chains in the Genus database with same CATH topology
3ZX7A 2FQPA 2EIGA 1Y3TA 4JGZA 2A75A 4R9BA 4R9DA 4HPKA 5GZGA 2WZR1 2KXLA 1G9CA 3TN93 4QPYA 4Y1VA 4DXZA 4MGKE 4RFT0 2ZX3A 1TME3 3U10A 1YUDA 4XMIA 3VBHA 4YGBA 4ZU4A 2ZHKA 4I2OA 3JD71 3M3IA 1YFWA 1Q8SA 2ZGRA 1LHWA 4AHXA 1S0JA 3VBSC 1RUH2 1IOAA 3E97A 4WV8A 4OHWA 2JX9A 4F3JA 1VBD1 1ZZ7A 1FPN3 1RUF3 2E53A 3DN7A 1GSLA 1M06G 3DGTA 4ORFA 1RUE2 4AFDA 1BMV2 3IBMA 4H7LA 2WS91 3OGGA 1RITA 3AK0A 2XLAA 5IK8A 1B35A 1AJKA 3HBZA 2GN7A 4L9BA 1MS5A 1ZYBA 2ARBA 4HVQA 3UKVA 3N7KA 5KC5A 2IC1A 3E6BA 3WOGA 1CAUB 1KJRA 2DUPA 2XWBB 4K8FA 4TZDA 1S0BA 3HIFA 1AYN1 3IKWA 1VB2A 2FBEA 5GZDA 4IV3A 1PGSA 1MS8A 2ZGNA 2VXRA 2N7GA 1G9BA 3IWZA 1UF2C 4LBNA 1DDLA 5H9RA 1V6KA 4LLFA 3MFAA 2WNEA 1W0PA 1RUI1 1MS3A 1SMVA 2DUOA 3I59A 4AEJA 4NWWA 2NP0A 2WA3A 4LBQA 3AZYA 1MQTC 1SLTA 4H7MA 2YHJA 4P5HA 4QPIB 4DY5A 2AENA 2LM3A 4R4ZA 1U0AA 3O0WA 4KH9A 1GFF2 3MEPA 3RZZA 3LA3A 1COV2 1W6MA 2Q30A 4PBPA 3RJ2X 1UPIA 5C4WA 4QX5A 1CAVA 1FV2A 1AL22 5DG2A 1ZZ8A 1QJU1 1VBE2 3O0VA 5JOXA 5DZEA 1DQ1A 5JSPA 2JENA 5I91A 2XGXA 1O5UA 3DPRA 1T6GC 4JGZB 4HPKB 3NVCA 4LUMA 4YW3A 5BNNC 1TMF2 1XU1A 4JGYC 4PF5A 3MIBA 3EQEA 4N53A 3VBHB 2A6YA 3CF6E 1G9FA 2XB6C 1ZRRA 1RUC3 2RS11 3ZN4A 4RA0A 1N1VA 2GC2A 4Q1RA 3ZXFA 1N1SA 2WWSA 4E2QA 4KG8A 3FBYA 4XOGA 1ND3A 3ZN6A 5JOWA 3VDDA 3A4UA 2OA2A 2XJPA 1JUHA 3H8UA 4B8EA 4CDWC 1QH6A 1AYM1 4IEYA 4BLIA 5E88A 1DQ2A 5IK7A 2JG9A 4D7TA 1LENA 2DFBA 1B35B 1VRH1 2WIIB 1REEA 2ZKNA 3PLQA 3WXPA 3EO6A 1JUIA 1R1A3 1HXS3 2QNKA 4YVSA 4AVAA 4Y22A 2VVFA 2DU1A 4IXLA 1AR62 2QZ3A 4GB32 1PO12 1NE4A 2NMNA 4CTEA 4E27A 4IV3B 2CGOA 4AFBA 4KL1A 1C8M1 2W39A 1V9U2 2Z42A 5I0TA 4B4RA 5CFCA 5D8AA 1ZBE2 2IXJA 4FOWA 4N90A 3RS6A 4IV1A 1Q8VA 2HWE1 3PNAA 3AKTA 4JVAA 5FFOC 1EYBA 2NM1A 3I59B 5GLWA 1RUJ3 1GV9A 5EYXA 2I74A 4LBQB 2I45A 3VHOA 3M4FA 1LCLA 3URFA 4DRVA 1KS5A 3PJYA 5BV6A 3MLJA 1GR3A 2ET1A 3LCPA 1YFXA 1SFYA 3MW4A 1W6MB 1REFA 5C4WB 1CAVB 2WJSA 3ZIXA 5FBZA 2BUKA 4LHNA 4FPJA 2XG3A 3MYXA 1NE6A 1SFNA 3NAPC 5GLVA 5JSOA 1V6JA 2FHRA 4YNIA 2WZR3 4ATFA 3DPRB 1QY4A 2WFPA 2E7QA 4XYXA 5H9PA 5CA6A 1DLLA 1GBGA 4B3NA 2ATFA 5J3UA 3U0ZA 4YW2A 1B09A 3J8F2 4GMP3 3OJBA 3WP5A 3R6SA 2LUWA 4N53B 3JD73 3UKTA 1AXZA 1SBEA 1MS9A 1BXHA 1XNKA 4X8PA 4NO4A 2CV6A 1CAWA 4COZA 4LA2A 1APNA 1VBD3 4HLTA 5CVRA 5FRAA 1ND3B 3ZN6B 2G9GA 4Z92B 3VDDB 5KXCA 2YC0A 1Q43A 2WS93 5DUXA 1D4M1 3K48A 3VZNA 1DQ4A 3NSTA 2JG9B 2YROA 3AKQA 2DCJA 4IEWA 4Q26A 1J1LA 3NL1A 1AX0A 3WVJA 3ZYRA 5JMCA 2HEYF 2RMU2 2A6XA 4LTAA 2DCTA 3P3PA 4YVSB 1AYN3 2X29A 3KCXA 4Y22B 1O4YA 4Y26A 3VBRC 1UPSA 3POWA 5CAZA 1KDKA 1ENSA 1X36A 4UW4A 4E4SA 5BNOC 3IDCB 3VBFA 2Q4SA 2ZMNA 3CLPA 5LK7B 1O3QA 5F6KA 3WDXA 2ZGOA 5CFDA 3CJIC 5CFCB 5C9AA 2R071 5D8AB 5T54A 1ZRDA 1RUI3 2Z69A 4FOQA 4IV1B 4DFSA 4M3CF 3W9AA 4XJUA 2R041 3N3HA 1DYKA 1S0GA 1AZDA 4YGCA 5C6CA 2O0OA 3Q9OA 4OI2A 1UKGA 4RS5C 3VKMA 1I1EA 4D7SA 4W65A 4LHLA 2VECA 3AP9A 1A8DA 1C4RA 2XBO3 3IDBB 2BGCA 2WT0A 3VL9A 4HMZA 5I0UA 4J1XA 4QT6A 5B2GB 1ZREA 2JDZA 4UXAA 2VOXA 2A6ZA 2OIIA 1QJU3 3JBG1 4Q4W2 4KWKA 1FMD1 2PLV1 2NPIA 1ULGA 3ZMOA 4EWEA 1POV1 3AFKA 3RYPA 5SV5A 4EN6B 3E5QA 1GICA 3A0KA 2ES3A 5T55A 3VKFC 2VU9A 4UBGA 3VBOA 1W6PA 3MDPA 2RS13 1EAH1 5FO9B 1I5ZA 4YFZA 2GNMA 3U4XA 2DFCA 3OTFA 4BA6A 5KWRA 1OA3A 1CAWB 1EP0A 3N7LA 4UW6A 3USUA 2JG8A 4UBHA 4KGQA 4XEZA 1AR71 1YHFA 3ZXKA 1NXMA 1AYM3 1NYWA 3D5OA 2D98A 4IEXA 1HQLA 2XUMA 4LO6B 3BODA 1ZZBA 1H9PA 2Q8OA 1AXKA 1VRH3 4MZUA 3JQWA 3VBUA 2EA7A 1S0EA 3ZFEA 1YXWA 2VNRA 2ZHLA 2V5YA 1PIV1 1G8WA 2ZX1A 5FOBB 4Q1PA 1FXZA 4RR3A 3MW3A 3ZPYA 2RHPA 4I30A 4HT1T 2OW4A 4M3CA 1C8M3 3VBFB 5C33A 4PIYA 4QHBA 4M3CE 4I0WB 1H0BA 5GLZA 4AVSA 5CFDB 2E6VA 3D0JA 2HWE3 5C9AB 4EWAA 2YGMA 4IEZA 1RUOA 5FQ0A 2ZCWA 3IIAA 1V6NA 2RR12 4NHKA 2GSYA 3AZVA 1QWRA 1ZNPA 3T2TA 1NA1A 1WCDJ 1FI2A 1QOTA 1DFQA 1A8MA 3ZSJA 1VLNA 5CG8A 1HV0A 3SCHA 2YV8A 4QD2A 2ZAAA 3SLIA 3H7JA 3GBGA 3GZAA 2WC2A 3BU7A 1W6NA 2HWF1 1RUD2 1BCXA 5HCAA 1FX5A 3ZSKA 1UIKA 2I2SA 4Q27A 4I3GA 1AR91 4IEQA 4LR4A 1HW5A 4META 1RVF2 2TEPA 2R16A 1YI7A 1ZZ6A 4DB5A 1RUNA 4HN1A 4WM8C 3VBOB 1W6PB 4Q2FA 1X8EA 4D7YA 3J4UH 3KGZA 1DGLA 4XJ9A 2R1BA 4IL7A 3AMHA 1OLQA 4LLOA 5DUVA 1SBFA 3USUB 3WCSA 4BZ4A 2JG8B 1AR83 1AXYA 1CJDA 4OI1A 4AQ6A 3FHIB 1YJKA 1QH7A 2A6VA 1D4M3 1ASJ2 1VBC1 3ZIWA 1RUH1 4C90A 5K9YA 3ETQA 3KCYA 4JGZC 3MIDA 1G86A 2TUNA 3KGLA 3S6PA 4QQLA 3BB6A 4Q4X2 1TQ5A 1BK1A 4AGRA 3WT3A 1OMIA 2HWB2 4ASLA 1RUE1 4OVEA 1BMV1 4LHKA 3VBUB 4DOUA 4PIZA 4I3PA 3ZFEB 3WG1A 1AVBA 4AQTA 2C5DA 3ZXAC 2ARXA 4KGGA 2BYVE 3ZO0B 4LBKA 4RR3B 4XF3A 4NHLA 5DXDA 1FYUA 3WG3A 4O9GA 3B93A 1RUG2 2BFUL 4M3CB 5IK5A 4OI4A 4CP0A 4AF9A 1R1ZA 3AZZA 4XW3A 4TYSA 2R073 1HLCA 3OYWA 4N7UA 4AE2A 2NN8A 1BEV3 3LOIA 3UL2A 2R043 1EV13 1PGL2 1ONAA 4U2AA 5FQ0B 1IKPA 1ALYA 5EV7A 1B35C 3LAGA 4K1YA 2W08A 1URXA 2EXHA 2BPA2 3ZSMA 1QF3A 3S30A 4PLMA 2DUQA 4Z1VA 2ZAHA 1O3RA 1PVXA 2OUJA 4L99A 5KBFA 1ZVFA 4MVTA 2KA3A 4KG0A 5FMOL 3H1WA 3JBG3 4HANA 4WM7A 4Y24A 1LB2A 1FMD3 2WNUA 3JQXA 2PLV3 2D6PA 1COV1 1POV3 1W6NB 4BOWA 2PHWA 4QGMA 1F5JA 1VBA2 4CEWA 1LGBA 4AI8A 4FAGA 3LOBA 1AL21 1GANA 2QZ2A 5I93A 3EJKA 1YNAA 1VBE1 1EAH3 1VJ2A 4XXPA 3KCCA 4AQSA 3H1MA 1FV3A 1X8MA 4YZ5A 4V1PA 4GQ7A 4KU7A 1V70A 4XFCA 1TMF1 1CIWA 1RL3A 3BIWE 1PK6A 1TNFA 4YSFA 3KT4A 5KXDA 1W2UA 1AR73 2CY6A 1WMDA 4NOTA 4XBQA 3ENRA 4E4DX 1XE8A 4XILA 3AJYA 3DPRC 1LRHA 1F8VA 4GA9A 2D6NA 3PHMA 4FPKA 1PIV3 4XFGA 4O9EA 2YPJA 4N53C 4EJRA 1VIWB 2WA4A 3AMPA 1DGRN 1WBFA 3R0RA 1KQRA 5J7MA 2PHUA 2QFEA 2VMIA 2WFF3 3VZMA 1H1IA 1ENQA 2BVBA 2JICA 3PVNA 5EYYA 1CVNA 4XDQA 1ND3C 2GZWA 2YXSA 1AR61 3JB4C 1Q8PA 4GB31 2VUJA 4F8AA 1G6NA 1PO11 5LK5A 3OYWB 4LBLA 2GALA 1LOEA 1IPKA 4D3WA 3R05A 1QJY2 2GNBA 5FAXA 1R092 1XQNA 4YGDA 1RHI2 3GF6A 3FUQA 1N3OA 3LWCA 1V9U1 2DURA 2VPVA 3J26N 1ZBE1 4YW5A 3O5SA 1H1MA 2QVSB 3AZWA 2KM2A 3O14A 2MEV3 2VVEA 4YVSC 1QQP2 4YW4A 4DRRA 4XFHA 2WNVA 1UU4A 1NCQA 1HIXA 1V6LA 1WUVA 4WM7B 3GHMA 4LO7A 2HWF3 2WNUB 4P14A 5A33A 1X33A 3IM0A 3HAGA 1AR93 4HBNA 5CFCC 3KZ4C 2P3JA 4CEWB 2RM22 2R0HA 4CDQC 2JEMA 1NCRA 1NZCA 2B5HA 3G6JB 3M7AA 4RSUA 1VAKA 3ZMNA 4BWOA 4YZ2A 4FPOB 1LJ7A 2R1DA 4GMP0 4XQDA 3H1YA 3BPZA 2NMOA 3S7EA 4XQWA 3TOJA 4AW7A 3LGRA 3J8F1 2B9UA 1U5IA 2H0BA 1DZQA 2WSUA 1SLCA 4L97A 1W39A 1PK6B 3GNEA 1VBC2 3MIEA 2D5FA 3WDWA 1RUH3 5K0UC 3NV1A 2YYOA 3WQ7A 3RYKA 3VV1A 2D6OX 4FPYA 4CEYA 3RSJA 3RI8A 2XWJB 5AFBA 1Q8QA 4GKYA 2CNAA 3E5UA 3EHKA 4R9AA 3RDIA 2HWC2 2IZWA 2DTYA 3S0MA 3AYAA 4N9IA 3E6CC 5J48A 1SCSA 3W59A 1JYIA 2RMU1 3WP6A 2B42B 1F5FA 3L2YA 1LU1A 4FXKB 4PQ9A 4BE3A 4ES8A 4YGEA 2VOVA 5AVPA 1MACA 4XQ4A 1C8NA 5H9QA 3OPZA 4ASMB 1C3HA 1HRI2 1OQEA 4DNYA 4LO5B 2Y0OA 4BPZA 1QXJA 1OFNA 4C0HA 1DF0A 2ET7A 1AX1A 1OOPA 2GH8A 2UYAA 3MIFA 4QXKA 3B3QE 3VLBB 3AP6A 4PJYA 2WNVB 5I8YA 5DZFA 4LT5A 4TLFA 3WDUA 1Q5OA 2HWD2 1NCQB 5SV8A 5CADA 1RJ7A 3AKPA 3VBFC 1SQ4A 1COV3 2EAKA 3JB8A 1HV1A 4LULA 2VW1A 4YRDA 2VOKA 1XE7A 1DU3D 5CFDC 5A33B 4QQPA 1AL23 1WW7A 3QLQA 1KS4A 3ZYGA 1WLTA 1VBE3 3NJZA 4IEOA 2PYTA 2C9AA 3AP7A 4AHWA 4XTMA 2R0FA 1NCRB 2BVVA 4LA3A 4Q4W1 5JOYA 4DINB 4FAHA 1K5MA 1UX6A 5JIUA 5JOZA 3LA7A 4DQAA 1OPOA 1TMF3 4YG3A 5FLHA 5JSRA 1MVEA 1DIWA 4OHVA 5ACA2 1AX2A 1VBB2 2X8KA 4S2HA 3H3ZA 5L7OC 1O91A 5AFEA 4M00A 4CDUA 2WQZC 4CEYB 3OCPA 1QOOA 2SLIA 2V73A 2ZBJA 1RUC2 1YIPA 2BTVC 4L8QA 4RD7A 3VBOC 4P9GA 3AYCA 5I0RA 3PVOA 1IQAA 3V56A 4FPCA 1OPMA 5JDBA 5BNPA 2GDFA 1LHOA 2MPFA 1UZYA 1A6CA 2Z2SB 1PO22 1AR63 5J96B 4GB33 4Q4Y2 1PO13 4QU2A 3PMSA 5EZWA 3L2HA 4OZXA 1LEDA 2VNGA 4N7IA 5DDJ2 3VL8A 3WUCA 2ZTNA 1V9U3 3BCWA 4YZ1A 3DKWA 1ZBE3 1CGPA 3WV6A 2G9FA 3PJQA 1N3QA 4AWDA 4E2GA 3D4KA 1HQNA 3VBUC 1OOPB 3FLPA 1KRIA 2A5ZA 3WDYA 1BBT2 1V6OA 3B5LB 4PDWA 2RR11 4QPGA 4RR3C 1LULA 3H3UA 1SLAA 3WLUA 3BALA 4WVZA 2D6KA 2EAAA 4R4XA 1LKNA 1EY2A 1NQDA 2PFWA 4QQOA 2D93A 3AMMA 2A3YA 4YZ3A 1NQJA 5KC6A 1G9AA 1LESA 3B01A 1LHVA 5JVVA 1WD4A 2UU8A 1LOCA 2A6WA 3V64A 1RUD1 4XIOA 1K5MB 4XFIA 3RWNA 2X53S 5FPZA 3J8F3 4A2UA 2VW0A 1RVF1 2YGLA 2W68A 3KB5A 5GZCA 4COVA 5AVAA 4MGYE 5EWSA 5FCCA 4GWNA 4HL0A 3INAA 1OD5A 5FOJB 1HRV2 4IESA 1FNYA 5CBLA 1MVQA 1DQ0A 2QDNA 2IXIA 5HI0A 1ZZCA 4QGLA 4CDUB 4DS0A 1WCKA 4P9IA 4X6QB 4Q0SA 4FTBA 2MNGA 3IN9A 4ITCA 4JDOA 4Q4V2 3M3QA 4FO9A 3H7YA 1ASJ1 2IWGB 3MPBA 1OSGA 4AI1A 1GNZA 3T1MA 2RJLA 1NXD1 4H14A 4HVRA 1FOD2 2IFRA 4Q4X1 1IPJA 2F4PA 2RMU3 1GNHA 1G9DA 3ILRA 2HWB1 5BNPB 1CN1A 1GQHA 1DZTA 3DUIA 4LE3A 2UYBA 2DCKA 4YM1A 1H8TA 3WW2A 5CNAA 2E7AA 1UIJA 3SH4A 1J58A 2ZX0A 3HD8B 3I54A 4AQ2A 4AGVA 5FLIA 1RUG1 1LR5A 2B7YA 1IS6A 1OHFA 4YYOA 4WBBA 1KFUL 3FZ3A 3SCFA 5J37A 4X6RB 4L92A 3V0AA 2ERFA 2OZJA 1SDWA 3ST7A 3WW3A 1MZ5A 2BNOA 1PGL1 2XVLA 2DWRA 3W58A 4XF4A 4ZKTB 1RJ8A 4QPGB 1NG0A 5CU1A 3MI8A 5T5PA 2H6CA 3H0OA 5KHJA 4YW1A 1MEC1 4INDA 2JD4A 4OI0A 4JV4A 4RQPA 3GZTB 1SLLA 5JWPA 3M3CA 2GAUA 4AVVA 3FLRA 4IETA 2ENRA 1POV0 3AFGA 5BNNA 4Q4W3 4ZU5A 4YVWA 5K7PA 4HSJA 2YZ4A 4XFBA 2XBO2 3IMNA 5AC92 4JTNA 3I2DA 1VBA1 2R6QA 2VG9A 1XYOA 4Y4YA 1H9WA 5E16A 1C5HA 3PTYA 2WT1A 3HR9A 5ABJA 4XJ8A 1G7YA 1UU6A 2DVGA 4TSVA 4XBNA 4GH4A 4ONUA 4XF0A 1VAVA 1YO8A 3JCIA 2VW2A 3WUDA 2E63A 2K0GA 4FP2A 1ENRA 3SHRA 1XNCA 1R082 4WM7C 2ZHMA 1H8VA 3OD4A 1EPWA 2WNUC 4K3UA 5E89A 3UJQA 3IDEA 2XJQA 1DQ5A 4CEWC 3NW4A 1XYNA 4XTPA 4HZFA 4YLZA 2QQPA 2AZ5A 3GZUC 2BNMA 4MUVA 5GALA 1PHMA 2CAVA 4UW3A 4Z8BA 1ULDA 4MX3A 4YM3A 3VZLA 3QOPA 4Q29A 3AZXA 2VUAA 3CJXA 3LSDA 5T5JA 3UJOA 4FTEA 2QE3A 3V0BA 1H8TB 4X8NA 2OYZA 1VALA 1WLWA 2O8QA 1EPZA 1DG6A 3MZHA 3TB0A 5T52A 4FOYA 1YRZA 3WHTA 3NKTA 5T50A 5BUVA 4B29A 3QBQA 4LEJA 4U36A 2JKBA 3QH6A 4S2DA 5F9TA 3V0AB 2O1QA 1RC6A 4Z82A 1QJY1 1R091 2RR13 5GLUA 2JXAA 1RHI1 1UAIA 1GQGA 2UURA 3ZFFA 4Q8LA 2ZPXA 3AKRA 2BFUS 1C5IA 4MLOA 1QQP1 4RQPB 2H0VA 2DCYA 4XJZA 4FPEA 2ZX2A 1WMFA 3AB0A 4QM8A 5JR7B 1OKQA 3KD4A 2GN3A 4FVVA 3LKJA 4OLLA 5BNNB 3L9JT 4N9HA 1RUD3 4YVWB 3WX5A 3ZXLA 4LO8A 4BIFA 1MZEA 4Y20A 1WA4A 2P34A 2XH6A 1U12A 5GZEA 2RM21 3BTAA 4FPLA 2DF7A 3MFCA 5C8WA 2AUYA 4IQPA 3WQ1A 1LGNA 4QQ2A 2A7AA 4QPIC 5ABJB 3ATGA 4F83A 4KNCA 2VY0A 2P2KA 5FMOS 5T5OA 4GH4B 1CONA 2WQ4A 1CQ9A 2XL9A 1KFXL 2Z5WA 1QDCA 4AI3A 4DPNA 5LRRA 4WZFA 2A71A 4K9SA 1JHNA 1S2BA 3SCGA 3THTA 3TYJA 3QACA 1H2KA 3FWEA 3FUOA 4HETA 3ZXJA 4K7JA 3RMYA 2XKOA