1XE7A

Crystal structure of the yml079w protein from saccharomyces cerevisiae reveals a new sequence family of the jelly roll fold
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
194
structure length
186
Chain Sequence
ANAAIEPASFVKVPMPEPPSSLQQLINDWQLIKHREGGYFKETDRSPYTMEVEKPVMVTRNQSTLIYYLLTPDSPIGKFHKNINRIIHILQRGKGQYVLVYPDGQVKSFKVGFDYKNGEVSQWVVPGGVFKASFLLPNEEFDNGFLISEVVVPGFDFEDHTFLKGEDELKHLVGPEKAAELAFLAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical 22.5 kDa protein in TUB1-CPR3 intergenic region
publication title Crystal structure of the YML079w protein from Saccharomyces cerevisiae reveals a new sequence family of the jelly-roll fold
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural genomics, unknown function
total genus 49
structure length 186
sequence length 194
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06172 Cupin_5 Cupin superfamily (DUF985)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1xe7A00
4XF4A 2B5HA 1I5ZA 3R6SA 4H7LA 1XRUA 2P17A 1EPZA 1OI6A 3DKWA 4YNIA 3LA7A 4PIYA 5J3UA 2QDRA 1RGSA 5JSOA 5FLJA 3H7JA 4IEUA 4EROA 3OF1A 4MUVA 3RYKA 1WGPA 3NKTA 4PIXA 4L11A 4WZCA 1J3QA 3IBMA 3GBFA 3NJZA 4LEJA 4A2UA 1U12A 4LUKA 1Q5OA 4HMZA 1G6NA 5FPZA 2XL7A 3O14A 2D5FA 5BUVA 2DCTA 3FJSA 2XLAA 4XEZA 2EAAA 1J58A 3H50A 3NSTA 4AQ6A 1H1MA 2H6CA 3D82A 1CGPA 1ZZ9A 4EV0A 4TLFA 4IEQA 1CAWB 3D0JA 1X8MA 1QXJA 1YFXA 3B02A 4BHPA 4UBHA 3M70A 5J7MA 4I09A 2D5HA 4J1WA 1RTVA 4I0BA 1ZX5A 1J59A 1J3PA 3FFQA 1OD5A 1I6XA 5FQ0B 3IIAA 1ZRFA 2XHKA 3RYPA 3L2HA 1YLLA 5FDBA 4Q29A 4QGLA 4XF3A 2GZWA 1LRHA 3H1MA 4KL1A 1EYBA 2FQPA 1UCXA 2K9ZA 1IPJA 2Q0AA 4DINB 5JAXA 3SHRA 1NZCA 3UKTA 2IXKA 5KHGA 2PFWA 4AVAA 2Z2SB 3E5XA 1VP6A 5FPXA 1CAVA 3U0ZA 3GYDA 3D0SA 5CVRA 3BB6A 5F1RA 2Y0OA 3OCPA 3H9AA 2ET1A 3KGLA 2CGPA 5KHJA 1ZVFA 2KXLA 2I45A 5HI0A 3WW1A 3LOIA 3EO6A 4O9GA 4IETA 3HT2A 5I91A 3I59B 4YSFA 1X7NA 5KHKA 1ZZBA 3CEWA 3FX3A 4FAHA 5LEKA 4I02A 2UYAA 2UY8A 4IESA 1CAXB 1YFYA 1NE6A 2OPKA 2E9QA 1Q3EA 1UD1A 3ES1A 2EA7A 2MPFA 1YFUA 2QNKA 5I0TA 2PAMA 4IEZA 2MHFA 3S0MA 2IXIA 2H6BA 3FWEA 1GQGA 1WLTA 4L2NA 4HBNA 4JTOA 1YWKA 3VHRA 5JSPA 2ZKLA 3HQXA 3NW4A 3SCFA 4R8HA 1IPKA 4X6QB 4XFFA 1ZNPA 4LA2A 4EWAA 4IEYA 1LKNA 5KBFA 1DGWA 3USSA 3PLQA 3WW4A 4AVCA 2BNMA 3LA2A 3MPBA 5BV6A 2PA7A 4QM9A 4HSLA 4HN1A 5T3NA 2PQQA 4X6RB 3ELNA 4MV2A 1SFNA 4XFIA 2H0VA 5JR7B 1YFWA 3HIFA 5I8TA 1FI2A 2GC0A 2PYTA 3UKVA 5I0UA 2PAEA 3EHKA 4Z82A 1FT9A 3LAGA 3MYXA 5J48A 3RPQA 1RUOA 2EVXA 2MNGA 1ZZ8A 1UW8A 4Q0VA 4K8FA 5K8SA 4JV4A 3CLPA 2Q1ZB 4N9HA 4QGMA 5I8YA 1PM7A 1H1IA 3SMHA 1CAWA 4LA3A 3H1WA 4HLTA 2GC3A 3ROUA 1XE8A 2Q4SA 4HN0A 5E16A 1OMIA 4HVRA 1O5UA 4PJYA 3DV8A 2VECA 3I7DA 3UKNA 3H3ZA 3PNAA 4E2SA 3WW3A 3E97A 1OFNA 2BGCA 3QOPA 4IEWA 4J1XA 2GAUA 1O3RA 3S7EA 3OD0A 4UBGA 3BALA 3RDIA 4HVQA 4I3PA 2PHDA 3LA3A 2IC1A 4PIZA 1V70A 3FE5A 4XF1A 4MGZE 4CYDA 3IWZA 1CAVB 4XF0A 3NL1A 2IXJA 1DZTA 3ZDSA 4NVPA 5EZWA 2C0ZA 3IDCB 2QVSB 2BYVE 2VPVA 4QM8A 2OYZA 4I0AA 1ZZ6A 2IXLA 4BYYA 2PAKA 3KSCA 2ZCWA 3ETQA 4BIFA 4KU8A 4BH9A 1X8EA 4E2QA 2OZJA 4XF9A 5KHIA 1O7FA 4HVOA 3I59A 1FXZA 5I93A 1O3TA 2ET7A 5JSRA 1CAUA 2CV6A 3H1YA 4E2GA 3KMHA 2D40A 4QX5A 2GH2A 3RNSA 3TNPB 4F7ZA 4IEOA 2HJIA 4IEVA 2B9UA 1L3JA 3QACA 3CJXA 4MH0E 3MDPA 5LEJA 2XKOA 4LULA 3ES4A 1WA4A 3E6DA 3EBRA 1ZRCA 1Y3TA 5FLHA 3ACLA 2ATFA 4MGIE 1XE7A 1ZZ7A 3S7IA 3KGZA 3ST7A 1LR5A 3FZ3A 4WVZA 1UIKA 4B29A 2IXCA 2WC2A 1NYWA 3G7DA 3H3UA 3FHIB 1ZZCA 4FAGA 4ONUA 1CX4A 1QY4A 3MZHA 4XFAA 2GC1A 2UY9A 3BPZA 1VR3A 1EP0A 4XFCA 4EWEA 4F8AA 3OTFA 4UXAA 3CF6E 4IEXA 3NVCA 4JVAA 4WBBA 4FT8A 5BXXA 5D1IA 4XFGA 4Q0UA 4Q0QA 4QXKA 4KWLA 1SEFA 2XGXA 4N9IA 4EWDA 4D7TA 2XKPA 4LUMA 2N7GA 5I0RA 2OZ6A 2F4PA 4MX3A 3RYRA 4Q0SA 3BU7A 4GULA 4LTAA 4OLLA 1YUDA 1LB2A 1J1LA 1RL3A 1Y9QA 2K0GA 1O4TA 4AXOA 4HSJA 4P9GA 3E6BA 1DGRA 3CO2A 4MGYE 5E1RA 5LRSA 3OGJA 4LLOA 5FLIA 2QCSB 3RZZA 2D93A 4KU7A 2B8MA 3SCHA 3E5QA 2VQAA 4XETA 1DZRA 2PHLA 5FQ0A 4YYOA 2XL9A 5FCCA 2Q30A 1QWRA 4ORFA 4MZUA 1VJ2A 2WFPA 3HT1A 4MGKE 4QMAA 2O1QA 2CAVA 4KWKA 2XLFA 2CAUA 1GQHA 4O9EA 3C3VA 3LWCA 2UYBA 2GU9A 4OFGA 4IERA 3EJKA 3DL3A 4XFHA 2HKXA 2FMYA 5C6CA 2OA2A 3SXWA 1O3QA 1X82A 2BEOA 1SQ4A 5I8SA 2ETEA 4Q0PA 4I01A 2BNNA 3I54A 1ZREA 1JUHA 4ZU5A 4META 3PVBB 3WW2A 1QXRA 2Z69A 1ZRRA 3BCWA 4I2OA 3U10A 4JTNA 1UPIA 3IDBB 3M3IA 3E5UA 4FBFA 3H7YA 1ZRDA 1RC6A 4IEPA 2GC2A 4ZU7A 5CADA 5JCTA 1O5LA 3JZVA 4YARA 3TNQA 3KCCA 5C8WA 5I0SA 2IXHA 4XFBA 4D7SA 1CAXA 4RD7A 3LZZA 3E6CC 3N4MA 1NE4A 4R52A 4KWJA 2PTMA 5EFUA 1Q43A 5KHHA 1HW5A 3CL1A 4HZFA 4QGNA 4Z07A 1CAUB 1J3RA 3DN7A 5BPXA 1TQ5A 1O3SA 2XLGA 2BNOA 1PMIA 4YRDA 1NXMA 1YHFA 3H8UA 4AVBA 2V09A 2QJVA 3SCGA 1RUNA 5AVPA 5CU1A 5BY5A 5LRRA 3U11A 3EQEA 2O8QA 1UIJA 4ZU4A 4AQ2A 1EY2A
chains in the Genus database with same CATH superfamily
4M3CE 1F2NA 1UKRA 2A3XA 1BLZA 2JE9A 5LCWL 3NQHA 5FY1A 3R6SA 3POWA 1PO21 2TEPA 4H7LA 5F3CA 3POJA 1OI6A 2BGPA 3OBAA 5D8AC 3DKWA 4DQAA 4RHV3 2ID4A 5I0DA 1CVNA 4D8MA 4F3JA 2ZMLA 3SITA 1XNKA 1ODNA 4A7ZA 5IT6A 2QZ2A 3O1OA 4V2VA 4ZPIA 4LIVA 5C9AC 1ENSA 3G6JB 2GH8A 2QE3A 2RS33 2HWE3 4MUVA 3RYKA 3RWNA 3NKTA 1QGLA 2YBSA 4FXKB 4CZSA 5ANNA 1OQEA 1OD3A 4JZRA 1QDCA 4A2UA 3TEZA 3ECQA 3RSJA 1E57A 1FNYA 4TWTA 2HWB1 4LUKA 4NJ4A 1Q5OA 2W46A 1NT0A 2ZACA 5CA6A 1G6NA 5FPZA 1HB4A 1W3VA 3AYEA 2DCTA 5BUVA 2P6HA 2ADEA 3Q8CA 1A3KA 3WCRA 4YW1A 1JU3A 4DRVA 3NSTA 2P3IA 4AQ6A 5HCBA 1H1MA 1UY2A 5FPAA 3UGHA 1CGPA 5FJKA 1ND2B 1ZZ9A 2PHRA 2YBPA 5H9RA 1PO11 1WW4A 1IS5A 4PI2A 3D0JA 3PUSA 2EIEA 4YM3A 4LKSA 2AH2A 1VBD2 4KWUA 5L73A 1WWYA 3THCA 4AHWA 4P14A 4CA9A 2ORXA 3B9CA 4YW3A 1WD3A 4CUGA 3MV11 3GXUA 1UZWA 3DCQA 1OD5A 4JRLA 1K3IA 2HBUA 4FFIA 1W2UA 1ZRFA 3WEZA 1W9SA 4FOVA 2YYOA 5GM0A 4PCRA 3PIJA 1HRI3 3GCWA 5FDBA 3KVAA 2WSUA 5L9RA 4QGLA 2WT1A 2WUHA 3I4IA 4DXSA 2PLV2 1LRHA 2R32A 2W1SA 4AEDA 2FQPA 3VBHA 2Q0AA 4DINB 1F8VA 4XQWA 4UWDA 4KBZA 3UKTA 1QJX3 4Q1RA 3VL9A 1BHGA 4PHZA 1AYM1 5A3OA 4AHYA 3RI8A 1RUG1 1HB1A 5LBFA 4NHXA 1DIWA 1XBFA 5CKNA 4FFHA 2UWBA 4SBVA 3D0SA 5SV8A 4N53B 1UAIA 1PMJX 2A6XA 1AYN2 2C26A 3OUHA 3U37A 1DP0A 3H9AA 2RM22 3ZSEA 3WF4A 2CGPA 4CEYA 3FHQA 1KGYA 2KXLA 4QQPA 4B8EA 4AZZA 2MEV2 3WY6A 3V56A 2I45A 3OGSA 4RFT0 1DQ0A 4UYBA 4EE2A 3HN1A 1RMU3 1GKBA 5HI0A 4NHLA 4MXWB 3WW1A 2LALA 4AGRA 3AP9A 3EO6A 1W6OB 3WF3A 1UYPA 3ZN6B 4XUNA 4YW7A 1ENRA 4ZXEA 2ZHMA 5I91A 1HJFA 1BJQA 4PQQA 5FYUA 1U5YA 1VB4A 5EHDA 3J8F1 5KHKA 1ZZBA 2C5DA 4CEWA 3CEWA 2D6LX 2RMU1 4QQ2A 2PHXA 4P08A 4I02A 5FXVA 2E7AA 1TME2 3VD9A 1YFYA 1NY71 1NE6A 2OVUA 4BB3A 1WBFA 3O12A 4TTGA 2E9QA 3T30A 1RUH3 2FDJA 2RR13 1AR63 4EN8B 1XXNA 4J6GA 1BBT3 5CKMA 1WMEA 4GWIA 4E8CA 4BZ4A 2PELA 3ZFEB 2EA7A 2A5ZA 2WBKA 4CUBA 1FMD2 4CCCA 5I0TA 2WYFA 5DAXA 4M00A 4XAAA 3S0MA 4BMBA 2AGSA 5DAVA 3UT0A 2XJSA 5F2SA 4AL9A 5FAXA 3Q8EA 3VBUC 3LEMA 1OA2A 1OURA 3ZYPA 5F7UA 1WLWA 1GANA 4L2NA 4LKDA 1NCRC 1WCSA 5JDBA 3ZMOA 5CFDB 4AK3A 2XDVA 1R092 5JSPA 4URTA 3I49A 3SEPA 1CONA 2ZKLA 3HQXA 5IVYA 3ZSMA 3SCFA 5L9BA 4COZA 2ZZJA 3DGTA 3T4HB 1SDDB 2QDNA 5A6QA 1NQDA 3BI3A 2ERFA 4IEYA 1LKNA 3TBDA 4CE8A 4NRMA 1XNDA 4KG8A 1DGWA 4AE2A 2YG0A 5GLWA 3ASIA 2BNMA 2YPJA 3O0XA 4FQ4A 4D7YA 4ZZ8A 4HKWA 5J37A 1M06G 5BV6A 2HYKA 2PA7A 1RUD1 2C9KA 3ZYJB 4HN1A 1W9TA 5T3NA 3ZXAC 2E33A 4M01A 3ELNA 1SFNA 2BOIA 1Q8OA 2UU8A 1R081 2B42B 1VRH2 4XUTA 3O1UA 1HIXA 5I8TA 1WD4A 5F6LB 3L2YA 5FZOA 2PYTA 2QFEA 2ZX1A 5KC5A 2ZEXA 1C57A 1W39A 1UY1A 4Z82A 1FT9A 3LAGA 3MYXA 3MV01 2EVXA 1AZDA 4XJ8A 2MNGA 3FBMA 5J96B 1UMZA 3DEMA 1JYTA 4Z2WA 4W6YA 4IE5A 2JJ6A 4AQSA 1NLQA 1QIQA 3TYJA 3A0NA 2XBO2 5I8YA 1PM7A 3DYPA 4UFLA 2VCAA 1H1IA 4AI1A 1RUF3 4LA3A 5A7PA 4XMAA 5FJHA 1V9U3 2GC3A 3M3EA 4XOGA 3IMNA 4GQ7A 1QEXA 2HWC1 2WNOA 4I30A 1GNZA 4HN0A 3VKLA 4Y26A 5LASA 1O5UA 1TNRA 4PJYA 3DV8A 2JD4A 2JG9C 2R30A 4MVTA 1DLCA 1POQA 3UKNA 3T3YA 3I2HA 4CDQA 3KWVA 2AYHA 2PMWB 1EUUA 2TNFA 3NRUA 4GMP0 1SLLA 1AXKA 2B7YA 4KGGA 2XPJA 4Q27A 4DUWA 3WF0A 2VW0A 2A6ZA 1V6OA 5IWFA 5IK7A 4ITCA 1OFNA 2VQ0A 3VDBA 2ZXQA 4GWNA 5LA2A 4OI4A 3ZVXA 2NQYA 2C1FA 4QHBA 4R9CA 3MO4A 1VBE2 1C4RA 3KF5A 5F6KA 5BNPA 5IAVA 3OG2A 1F9KA 1Z7S1 5T54A 4CDXC 3THDA 3VBHB 3ZR5A 4J25A 2E7TA 4GH4C 3BOWA 4JHZA 2XVLA 4XF1A 1LOCA 2RDSA 2ARBA 4IW3A 4Q4W2 4BXSV 1UZZA 2VGDA 3HNMA 4FPCA 5IVVA 4LHNA 3V65A 2ZS6B 4P9YA 3VDDA 3TN92 2IFRA 1DZTA 2NYYA 3ZDSA 4ARYA 1CIWA 1QJU3 5EZWA 2OYZA 4CRQA 4CEYB 2IXLA 4N7UA 1UL9A 4NE9A 1GQPA 4Q4Y1 2ZX4A 5FY5A 1V6IA 2OZJA 4NAMA 4RR3C 3RZLA 1W90A 2G4IA 4HVOA 3NV4A 4P00B 3ZIWA 5FYMA 1UY0A 4CXXA 5A3UA 1NLRA 2DBNA 4W8JA 5DQ0A 1JS9A 3VN4A 5FY8A 2GMMA 1VIWB 2CV6A 4E2GA 1ASJ2 2QQPA 3ZN5A 3RNSA 4COYA 3TAYA 4XIKA 4JQRA 3TNPB 5DAQA 3WQ0A 4CEWB 4P5HA 1PNGA 1VBB1 3QACA 3PDQA 2LUWA 4MH0E 2VXJA 2VMDA 5EYXA 1WMDA 1G8WA 4LULA 1G9AA 4N43A 2WO3A 1C8NA 1C8M2 4AFAA 1ZRCA 3I8TA 4ZS2A 4Z92B 5A7SA 3NO8A 3W59A 3MEPA 2XB6C 2EAKA 1ZZ7A 1J1TA 3KGZA 4HL0A 4U36A 4BA6A 4OUSA 3H8XA 3IT8A 5GZEA 1H6YA 4DXTA 2WA4A 3GZAA 3PU3A 3UGGA 2ARXA 4AI3A 3AMNA 2BFUL 1COV2 4GB31 5EIYB 1CX4A 2Y8KA 3I3BA 1HN1A 3MLJA 2OT7A 1UOBA 5F2WA 4YGDA 1N3OA 1XNAA 1ONAA 2UWCA 4OHZA 3PJQA 1PK6C 1NY72 4G9SB 1RUI3 3BPZA 1R1A2 2C24A 2Q8DA 3LF7A 3VLBB 3WP4A 2XWBB 4Y1VA 2DU1A 1C5HA 2L9LA 1YO8A 2ZGSA 2YXSA 4DO0A 3URFA 3A22A 3WVJA 2P6CA 2RS52 1ULCA 2R062 4UXAA 4QPIA 2VVDA 3NJXA 4IUGA 5BXXA 2Y0IA 4XDOA 2R042 5DDJ1 1KFXL 1QF3A 1UX6A 4M0NA 2YZ4A 3I2IA 4M3CA 1E5RA 3IM0A 4ATFA 2PHFA 4AGGA 1KD7A 2WT0A 3KD4A 2XKPA 3ENRA 4K21A 2WS93 2J1VA 3ME2A 4BQ3A 4LHKA 1GWKA 2OZ6A 3HMYA 5CG9A 2VZVA 1W8OA 3RG0A 3KV4A 4RHV1 1IZ3A 4LOSA 3J26N 3WCSA 5ACA2 5G04L 1IS3A 3ILNA 1O8PA 4LTAA 4OLLA 1LB2A 2IVJA 5DMYA 1LECA 1O4TA 4Q8LA 4NOTA 1QQP3 4AXOA 4CCOA 4HSJA 1XSRA 2RDQA 3CO2A 3LGRA 4MGYE 1B35C 3MF6A 5FLIA 5FZ4A 1AL0G 2RS31 2G9FA 2HWE1 5F3GA 5FPBA 2D6PA 2D3PA 4COUA 2D93A 4AYUA 4KU7A 3MICA 4DXRA 2VMEA 1D4M3 2JDKA 4XW3A 4BXFA 4XE9A 1LHOA 3C7EA 1S4CA 1DZRA 1ULPA 5A6YA 5IVEA 4YYOA 2Y6FA 1YC61 5FCCA 4D69A 4YVSA 1D2QA 5EJ3A 2ZBJA 5L7OC 2BVBA 4WM7A 3HT1A 3ILRA 4QMAA 3U07A 4KWKA 3ZYFA 3HR9A 5FYSA 2XLFA 2CAUA 1GQHA 3D6EA 4O9EA 4QDSA 3M7AA 2UYBA 2RS13 5FYBA 5FZ9A 2XUMA 4IERA 1OA4A 4YVWA 1BCXA 3EJKA 5JPNB 4YM2A 4FPKA 2CU5A 1PZ7A 3WD5A 2OUJA 3K3OA 2W91A 1UO9A 1LHNA 3FMGA 5T5OA 3SXWA 1M4WA 2BEOA 1SQ4A 5FO9B 5ERLA 2VNRA 2XVGA 3ZKYA 2BNNA 1OQ1A 1NCQA 1MVQA 1ZREA 5BNPB 2A75A 3HNYM 2DCKA 1OH4A 2PHUA 2Z69A 1POV0 4OYUA 1SLTA 3VBFC 5BNOA 4JTNA 2EXKA 3RGBA 3A0KA 4FBFA 4NIDA 2CDPA 3VBSC 1NQJA 2I07B 2GC2A 1HRI1 5GZDA 3H8RA 1SBFA 3ZLIA 1O5LA 5FKBA 5GLVA 4D6RA 3AXEA 5JCTA 4YW6A 1YQ2A 1SBDA 5C8WA 1OBNA 2VZOA 3MIFA 2WAOA 3SH4A 2BW8A 3CZJA 5I0SA 2VQTA 3PVOA 1RUJ3 4GJZA 3WHTA 4AW7A 2D3SA 2VM9A 3POSA 5K0UA 5A7WA 1QJX1 3HD8B 1CAXA 2AREA 4Q4X2 3LZZA 4L9BA 5CNAA 1NE4A 4R52A 4KBBA 1LHVA 3OB8A 4S2HA 5IHRA 1N1YA 3ZPYA 2LM3A 2VCBA 1Q43A 2AUYA 1ZM1A 2W95A 3HJRA 3JBG2 4ZS3A 4DFSA 1OHFA 3VD5A 4BIOA 2HLEA 1HW5A 2XQRA 2WZR3 4KG0A 4PT6A 1HLCA 3DN7A 4JHTA 3T4VA 2FD8A 3I2OA 4LKFA 3AZVA 5HPOA 3WF1A 1KJLA 2PHWA 4HKLA 2V09A 4C1XA 5GKAC 2VNOA 1WLDA 1W2NA 1RMU1 2VOVA 1RUNA 1G9CA 1UQXA 2OQ7A 5ABJC 1O59A 4N43B 1UYYA 5DZFA 5LRRA 3U11A 4AHZA 3GGLA 2WZPP 1UIJA 1WMXA 3T2PA 4QB1A 4AQ2A 1S55A 4ET7A 3OBZA 1GFF2 1AR73 2LRPA 4WM8C 2Y60A 2Y26A 3K48A 1I5ZA 4JDNA 5FK7A 1HB2A 3HEIA 3VHNA 2ZGPA 2P17A 3VD7A 1UYXA 4UFMA 3LA7A 2VNVA 3MW4A 4PIYA 4A7YA 1LOGA 1GSLA 3FLTA 1RGSA 5JSOA 1RUH1 1VBB2 2RR11 1AR61 3LEGA 4QU2A 2GNMA 1XJAA 4OMDA 1EAH2 1BBT1 2YFZA 3GDBA 1UU6A 2D97A 3GJBA 1NX9A 2E7QA 1JHJA 4R9AA 3ZIXA 5GZCA 1MS5A 1WGPA 5CISA 1MEC2 2F17A 2DUOA 2ZGLA 4WZCA 1LEDA 1J3QA 3ZYRA 4FTSA 2VZUA 2ZTNA 5C8CB 3NJZA 3NNJA 4LEJA 4PDWA 2WNVA 2Z79A 1F5FA 4OUEA 4Y22B 5FZEA 4QPIB 1QJZA 2FCVA 5T50A 4HMZA 1ZYBA 3E1F1 3LFIA 2XL7A 3O14A 4OVEA 2W87A 2D5FA 3GZEA 4O65A 3WNLA 3WNXA 4AEJA 1VBA2 1K5MA 4M3CB 4XEZA 2EAAA 1W8ZA 2AENA 2JG8A 2WL1A 4P02B 1IOAA 4QX1A 5A7QA 3ZFFA 1XYNA 1WW5A 1X33A 1CX1A 3AVSA 1ULGA 1UZ0A 4TLFA 2YHJA 4IEQA 1CAWB 3O0WA 1OOPC 2VZ1A 1QXJA 3B02A 4FPYA 3LB9A 3FC0A 4XAEA 3M70A 5J7MA 1DYKA 3OEAA 4I09A 1PVXA 2DUQA 3DPRA 5HCAA 3CU7A 3N9QA 1Y4WA 1OPMA 4GALA 5EQUA 1XNTA 5F9TA 5F39A 4I0BA 2A6VA 3BTAA 4M4RA 4QX8A 4N53C 3LEIA 1HV0A 1QXPA 3T09A 5CKQA 5C3OA 3O5SA 4ISRA 2WLQA 2DF7A 3WSOA 5CYYA 1I6XA 1K45A 1TG7A 3IIAA 4AFMA 3TEYA 1V6KA 3RYPA 4COVA 1ND3A 3ZFEC 1YI7A 4YVSB 2HWF2 1HRV3 4Q29A 3FUQA 4H55A 4XF3A 2P3JA 4E9KA 3I3MA 1GLHA 1BK1A 5A80A 2XJPA 4L97A 3HNBM 2OKXA 3JCIA 3M3OA 1NZCA 2GDFA 4XBNA 2IXKA 1RUF1 2PFWA 3KZ4C 4AVAA 3AZWA 4UW3A 1QJY3 3E5XA 1V9U1 4P9WA 1VP6A 3F95A 4YVWB 3WINE 1YI9A 4Y1XA 2R073 1VB2A 1W0PA 4XXAA 1I5PA 3ZN4A 4JAAA 3U0ZA 4B4PA 3GYDA 2HEYF 5F37A 3HN3A 2RVAA 2BWCA 1AF9A 2DVFA 2JX9A 2ZGTA 3BB6A 2QQVA 2A71A 3OY8A 4LBLA 3OCPA 1H8TC 1WMFA 2ET1A 1DHKB 3KGLA 5CAZA 1W2TA 2ZMKA 4L8QA 1LHWA 1NCQB 4XCAA 2VULA 3PURA 1HQNA 3T1MA 5BYNA 3LFMA 2CL2A 3BGAA 1OF4A 1YQ8A 2CSGA 4OQ9A 4CXYA 1LNSA 1QNWA 2P4EA 1JUIA 2QBXA 1N1TA 1US3A 3GHNA 5FO7B 4CDUA 3WNKA 3CJIA 4XILA 4HKOA 3WP6A 5JZGA 1GV9A 4O9GA 3U14A 4IV3A 5DG2A 5EXOA 4NPLA 3ZPOA 3NNFA 1RUC2 1AX0A 3WDUA 4YSFA 2Q8CA 1W6PA 3ZMNA 5T55A 2XQXA 3K75B 4XABA 3FX3A 3KLSA 1KFUL 3WP3A 4FAHA 5CFDC 3TEWA 5K0UB 3GM8A 2YBKA 5A7WB 1SACA 1WW7A 1CAXB 3EB7A 4Q1PA 5TSWA 1TZOA 4A44A 4CCEA 1RXGA 4A45A 2UWAA 3MW2A 3VV1A 1WCKA 3BYWA 1O91A 2WN3A 3ES1A 3DECA 5C4WC 2GMPA 2HWD3 1AR82 1IS6A 3LKJA 1QJU1 2MPFA 1WBLA 2OUHA 2O14A 3I2JA 2YV8A 3V0AB 3H3LA 4QQLA 1TMF2 1UU5A 4NR1A 3HAGA 1IQDC 4LBNA 5IFTA 5J1XA 1UOJA 3ZOIA 3UJOA 2H6BA 1CD3G 1PIV2 3N7LA 4GKYA 1FPN2 4AAXA 2VL4A 1GQGA 2JDAA 3FBYA 4IV1C 1WLTA 4LHSA 1PGL1 1EV12 5A3TA 1YQ5A 4HBNA 1YXWA 1SCRA 3WT3A 3HBKA 3WF2A 1ZBE3 4AWDA 1RUE3 4FVVA 4R8HA 3UGFA 1IPKA 2OIIA 2PN5A 1ZNPA 2NN8A 2YROA 4UW4A 5BNNA 2VZSA 2ES3A 2Y6GA 2QQNA 1ZBA2 1DQ1A 3FUOA 3JQXA 1X9PA 3ZSLA 3AJZA 3PLQA 1QH7A 3C7GA 4P9XA 4AFBA 4AVCA 4BLIA 1XOYA 1HXS3 3POYA 1X9TA 3K4ZA 4NIIA 3N9PA 1Z78A 2JKBA 3CHXA 5HV4A 1VAMA 1N47A 2PQSA 1CWPA 2P3YA 3DXTA 3K51A 2CWSA 3AP6A 3HIFA 2W3JA 4LBQB 1DLLA 1FI2A 5AC93 2LW8A 4LORA 5D8AA 5J48A 4PDWB 1RUOA 3AB0A 3AP4A 4Q8KA 3ZYBA 1UKGA 3I3EA 1SLIA 3WNPA 1UW8A 3I2GA 4K8FA 4IL7A 4WVWA 2WSVA 4ZKTB 1PZ9A 1YYNA 5T5JA 1RUI1 3GHMA 4JV4A 2G1MA 3CLPA 5A6XA 3ATGA 3VBRC 5C9AA 2OXBA 2Q1ZB 4XCBA 4Q2FA 1K5MB 1W03A 1YJLA 2J1SA 5F3EA 3PTRB 1JODA 2BTVC 3GF6A 3LDRA 3Q8BA 3AC0A 5FFOC 3SH5A 3AL6A 3H1WA 2K46A 4IGQA 3RRDA 3ZFFB 5C3RA 3WDTA 1W8HA 2F6BA 1H9PA 1W6NA 2NZ9A 3AMHA 4RQPB 1E5SA 1XE8A 3MIEA 4BU2A 2BBVA 3T2TA 3VKOA 2J1UA 5C5TA 1BMV1 2VAUA 1ALYA 1RVF2 3UL2A 1RITA 3VDCA 4AVTA 1F4HA 1AL23 3I7DA 4HPKA 4CP2A 4TZDA 1MZ5A 5FRAA 1JYVA 3PNAA 3PUQA 4Z1VA 2WS91 4CSWA 2YC2A 3WR0A 4EYUA 2G9GA 3WW3A 4MO3M 1G9DA 2ARCA 3E97A 3L9JT 2WT2A 3QLQA 4IEWA 3T08A 4GKXA 1JZ8A 1PMHX 1QQP1 3OD0A 1MZEA 1ND3B 5HCFA 3R05A 5JPMB 3BALA 3RDIA 1NOVA 4I3PA 4HVQA 5CBLA 4N90A 4DEVA 2ZAAA 3LA3A 3CNAA 2XJVA 2WZ8A 4PIZA 1D4M1 3ACFA 3H0OA 4JGYC 1IG0A 3KCXA 1C1FA 4URAA 2IZWA 3EYPA 1APNA 2EXIA 2LROA 4I0WB 4TXWA 4NIHA 2EXHA 3KT1A 3WLUA 2RG4A 3GNEA 3IKWA 5J36A 4RS5C 1FYUA 4A3XA 1WCDJ 4LMFA 4AG4A 4CP0A 4MSVA 5H9SA 3APBA 4NVPA 1STMA 4ZXKA 3IDCB 3BU0A 2DDUA 1RINA 2BYVE 3OY8B 2VPVA 4QM8A 4DS0A 5A32A 4GA9A 1ZZ6A 4D6SA 1FOD2 5FV3A 4BYYA 2PAKA 2RS11 2Q8OA 3ETQA 4BH9A 3JD73 1JMUB 1W6QA 2X5IB 4XC9A 3OPZA 1RUF2 3I59A 1GOHA 3ABZA 4XHBA 2DTWA 4CDUB 5I93A 2ET7A 3BTXA 3U78A 3W9AA 5JSRA 5JZGB 3CZUA 1KS4A 1UZYA 1GUIA 4IV3B 5GLUA 1LTEA 4NUBA 1AR92 1LOEA 3KMHA 5CB7A 2GH2A 3EXUA 1ZA4A 5KR7A 2RHPA 1LGNA 1W6PB 2J7MA 2J1EA 4JKMA 2BV4A 2WFF2 4GXLA 2XKOA 4CP9A 3NWKA 4H14A 5APAA 3EBRA 3MUZ1 1PX4A 1QJEA 4HETA 3O1VA 4MGIE 1MS3A 1IKQA 3PVEA 4QPGA 4WVZA 2DTYA 3FFZA 1UIKA 4AF9A 1RUJ1 2IXCA 1VBD3 3KS7A 3LPFA 1NYWA 3H3UA 4EN7B 4Y33A 2DFCA 1OFSA 3MW3A 2VZTA 4R4ZA 4ONUA 1NLSA 3WQBA 5A1AA 1D7PM 5C70A 1V00A 5T5PA 4DXZA 4MADA 5H9QA 5C7GA 3R4UA 5LK5A 4LQRA 1UXXX 5F5IA 4EJRA 1SMVA 4Q4V2 2WINB 4Y1YA 3B69A 2Y33A 4CCMA 2UY9A 2WZR1 4AGVA 2KA3A 2QQJA 4UW5A 5E8AA 4ASMB 2Y38A 2EIGA 5LY1A 4PI0A 5FZCA 4XFCA 5JVVA 5JIAA 3ZYIB 4UFJA 2PLV3 1ULDA 5FUPA 2W0XA 1K5JA 1NA1C 3NVCA 1HX6A 4JVAA 5CZKA 4FT8A 4XBQA 1S2BA 4O7XA 5LA9A 1W0NA 5FOJB 3WZ1A 3VBUA 1PO22 2JXAA 4XFGA 4Q0UA 2E26A 4Q0QA 1YQCA 4NPRA 4EN0A 4LE4A 1NCRA 3USUA 1AR71 5KXBA 4N9IA 2XXZA 4OHXA 5JWPA 2K2SA 2Y34A 4B4RA 2BZDA 5I0RA 3U4XA 3S6PA 2RM23 4QD2A 5FPUA 4TSVA 3BU7A 4LO6B 1KDMA 3J4UH 2W5FA 3ZFGC 3RZKA 2AZ5A 5D8AB 3MGUA 4AI2A 1RHI3 2FMDA 2MEV3 3B93A 4NN0A 3VD4A 2P1BA 4LXLA 1GZTA 4P9GA 5FWJA 3T2QA 2ZPXA 3H42B 2BFUS 5E1RA 2YU1A 5LRSA 3UETA 2QCSB 2E32A 1SFPA 2R16A 1LCLA 1X36A 4INDA 2HWB2 2B8MA 4FPJA 5EPAA 3BKZA 3NKGA 3RZJA 3R0RA 5K4LA 3ZX7A 1UU4A 2PHLA 4A7KA 2WWUA 2XL9A 2VNGA 4HFSA 4AQTA 5BNPC 1QWRA 1F35A 2YC4A 3U1XA 1TME3 4MZUA 4ORFA 2WA3A 2WO1A 1VAVA 3RVHA 3UESA 2O1QA 2Q1FA 3C8XA 4LK7A 4JGZC 4NO4A 2FDGA 4HPKB 1PO12 3C3VA 1D0HA 2OS2A 3LWCA 1AUYA 2JDYA 3IDAA 1G9FA 4AEDB 1S0FA 1S0DA 5JUVA 1FMD3 4XFHA 3WOGA 3O1MA 5B4XA 2FDHA 2FMYA 3MFCA 4WVVA 3DKQA 2ZZQA 4AFCA 3KT4A 2OA2A 2DWRA 3MLKA 1O3QA 1X82A 3JB8A 2BPA2 1UOFA 4TLGA 2X05A 3ORJA 3NNLA 4MHUA 5A33A 4LJHA 3QH6A 4BJ0A 3W5MA 2ORZA 2GP5A 1R093 4A42A 2DVDA 3WW2A 4CCDA 5T5LA 4E4ZA 1IHMA 5CFCC 1VAKA 2V73A 4HONA 1VRBA 3H7YA 3MIHA 1RC6A 1JH5A 4G4FA 4IEPA 4CDWC 3CBNA 5CADA 3W5NA 1HRV1 3MBWA 3KQRA 5T52A 3C7FA 3TNQA 2W1QA 1AYM2 2DVGA 4CCKA 3KHCA 1VBC3 1RUG2 2V4VA 4KI5M 2ZX2A 4L99A 3GCXA 4HG6B 4N43C 3W58A 4C0BA 5A32B 1CZSA 4GZ9A 2V72A 5FYYA 1QJY1 3IAPA 5FBZA 3N4MA 1JW6A 2R071 4KWJA 2PTMA 4OMCA 3VB9A 1JN2P 1HJGA 1EPWA 1W6QB 4XYXA 2Y6KA 3K4DA 1VRH3 5EFUA 2W1WA 4NHYA 4I3GA 4BQXA 3JUUA 5KHHA 2JKXA 4XQDA 2KR2A 3P1IA 3VDAA 4BDVB 4QGNA 3IMMA 5FP9A 2ZGRA 4HOOA 2FDFA 1LGCA 3AKRA 2YGLA 3AYCA 1OUSA 3NNMA 3ZYGA 4V1PA 1WZXA 4YRDA 3H8UA 1OLME 4AVBA 5FYIA 2XBO3 2I74A 5AVPA 4CP9B 2WNUA 1O6UA 3O7OA 4RR3A 5F5AA 4C8DA 3J8F2 1DQ2A 1VE0A 1ZA7A 2ZEYA 1PGW1 3EQEA 2RMU2 1OQDA 3FLRA 3GBGA 5C3SA 1EY2A 5C8CC 5FPLA 4M4PA 4AVVA 1WCQA 4XF4A 2B5HA 4QPGB 2B4KA 2JB4A 4QPIC 3I2KA 2AEYA 3M3CA 3SLIA 1EPZA 3AX4A 3IZOA 3AJYA 1LODA 1W06A 2NMOA 4YNIA 5J3UA 1XU2A 2QDRA 2WWJA 3CKHA 1QH6A 5FR3A 4A41A 1CESA 3O1PA 4WVMA 2JICA 4UW6A 2BDRA 1DQ4A 2HWD1 4PQ9A 5KXDA 3WP5A 1OLQA 3MIDA 1GOGA 1S0IA 2XH6A 4EROA 3U75A 1MZFA 4FQZA 3VZOA 3ZO0B 4Y5Z0 1CJDA 4BISA 5IVCA 2XONA 3WV6A 3IBMA 1VBE3 2DUPA 2XJUA 3WUCA 1SCSA 4XZUG 3QCWA 5JXHA 1MZ6A 1K42A 1U12A 4XZPA 5FYTA 4NWVA 4PLOA 2JE7A 2Z4FA 3LSDA 5FZOB 3A4UA 2C4XA 2WO7A 3HBZA 1C1LA 3K46A 2B45X 3VBUB 1ZBE1 4Q4W3 5IAXA 1RUE1 3I3QA 5L9VA 1KQRA 3FJSA 1PK6A 3SQOA 1FNZA 1NCRB 2WYSA 5AFEA 1J58A 1S0EA 3AYDA 2A3WA 5EJZB 4HK9A 4YVSC 3N9OA 3TN93 4K1YA 2CWMA 4DUXA 5GALA 4B7KA 2P2KA 1DQ6A 4DB5A 3B9IA 5FOBB 5JOZA 5M0TA 2XVKA 2EALA 3AZYA 5ANQA 3NAPC 4OULA 4XJWA 1RUD2 1T6GC 1X8MA 2ZGKA 3MI8A 1HXS1 1KJRA 4UBHA 5EWSA 1R082 1RYYA 1L7RA 4IQPA 2XHNA 2D5HA 3N7JA 4AEMA 3VBOC 3VZMA 4J1WA 4HK8A 1BK0A 3KM5A 5FZ1A 1W6MA 1CN1A 3MIBA 1ZX5A 1TEIA 1LESA 1J3PA 4LKEA 4IE0A 4XBLA 2ZHNA 3FFQA 1ASJ3 1PHMA 4YW2A 4CDQB 5AC91 2VOKA 2YPDA 3VKMA 2ZX0A 5A3NA 4RYDA 2H0BA 4C0HA 4Y1ZA 1BYHA 3L2HA 1YLLA 3OBRA 4CU8A 4XDQA 3POFA 4FOQA 3J9SA 2GZWA 2V5DA 1UN1A 1C8M3 4KL1A 4YZ1A 2YGMA 1EYBA 3ACGA 3HQUA 1F4AA 3LIGA 1ULFA 3M8LA 2HWC2 2O0OA 3SHRA 2VR4A 1HB3A 2Z2SB 5FPXA 2IVIB 3AYAA 3LDBA 1CAVA 1R64A 2JEMA 3QBQA 1W28A 2A73B 4YZ4A 1SHWB 2ZGOA 3T0AA 1PVC3 3FN9A 4B7EA 2C6SA 4Q5OA 5FXWA 1COV3 1GP5A 5F1RA 3MHZA 1AL21 1BQPA 5L7OA 4LT5A 2VCMA 5K9YA 3VDDB 5KHJA 5J09A 1YCIA 5A33B 4L92A 4QQOA 2BU9A 2WQ8A 1E5IA 4Y24A 1MQTC 3N3HA 1R1A3 3AFGA 1W99A 5FIXA 3IPVA 3RZMA 4FXGB 5LA0A 4YGCA 1DYPA 5E6HA 2W94A 1FAYA 3LOIA 5CG8A 4AI0A 1Z7S2 2RS53 2R063 2OPWA 2VU9A 4IETA 4YZ5A 1GR3A 2KD7A 3ON7A 4IGOA 5FYHA 1S0BA 4IE4A 2R043 4M3CF 2J22A 4QQHA 3DYMA 4QDQA 4AVSA 4YG0A 2UYAA 2VC9A 2UY8A 2ADDA 2Y6HA 3SH3A 3SKVA 1IGOA 2YFUA 2ZAHA 3VZLA 1W8FA 2E51A 2W47A 4JQTA 4Y4YA 1OF3A 2QQLA 1SBEA 5ACA3 3VBSA 2AC1A 4B3NA 1KS5A 4Q4Y2 5G05L 1XYOA 1JZ2A 1MS1A 2Q8EA 2LTNA 1LU1A 1MVEA 3OOXA 4BK4A 1XNCA 4QWNA 3JD71 4EQVA 4LOTA 2IWGB 2DCZA 2FDIA 3FWEA 4QHZA 1CPMA 3C7OA 5LK7B 3ZXJA 2E6VA 3VKFC 5JXIA 2WNUB 1OH3A 4JTOA 3T0DA 1JXNA 1DU3D 3OJBA 3WHUA 5DUUA 2ENRA 2BWAA 4X6QB 4LA2A 1ND2C 3NV2A 4BPZA 5FXXA 1T6BX 4EWAA 3KHBA 3UNPA 3KQ4B 5FYCA 3SKJE 3KV6A 1LJ7A 3SEEA 4GJYA 3WDWA 5D2AA 3WW4A 3LA2A 2VOTA 3CMGA 4WVMB 3MPBA 4R9DA 4FFGA 5ABJA 3KF3A 5DXDA 4QM9A 3WG2A 4GMP3 4E4SA 4NIGA 2DURA 2VOWA 2XMLA 4GB32 4RQPC 4X6RB 5FUIA 5FZ3A 1DGLA 4XFIA 4UOJA 3VD3A 1VBD1 2CTVA 4WM8A 1R1ZA 5FMDA 1GICA 3WXPA 5JR2A 1JZ6A 4CU6A 1VMHA 4Y5TA 2GC0A 4CP1A 2PAEA 2VTFA 3EHKA 4K1ZA 2RDNA 4UFHA 4ZONA 3THTA 4YPJA 1XB9A 1ZZ8A 2Q1MA 4Q0VA 3D8CA 3N7KA 3B3QE 4FI9A 4DY5A 3JB4C 3K2OA 5JOYA 2WAAA 1CIYA 1RJ8A 1LENA 2RJ2A 4QGMA 1PK6B 1SDWA 2VY0A 3T1LA 4P9JA 3AP5A 2HWD2 2RV9A 2JIGA 2R7EB 4YLZA 1QNYA 4G3YC 5DDJ2 3PL0A 2EF6A 2PLV1 1MS4A 3ROUA 3VZJA 4JDMA 3ZKUA 4AOCA 1H4GA 1ACCA 1OVPA 5FYZA 2GNTA 4A6OA 2JDZA 1O8SA 4Q4X3 4HVRA 5FZ6A 1XNBA 2VZRA 4JKKA 4RHV2 4NAOA 3OSDA 1CPNA 3H3ZA 3BIWE 5E88A 2YMZA 1QKQA 1W6MB 4CPBD 3JBG3 4WM7B 1RUE2 2QTWB 3WUDA 1ENQA 1VMFA 2RJLA 2D3RA 2P34A 4YFZA 2RM21 1UXZA 4YZ2A 2BGCA 5HXMA 2D43A 4LR4A 4J1XA 1RHI1 2RS32 2HWE2 4Y5SA 2MEV1 4FO9A 5A7OA 2GAUA 2W39A 1O3RA 4PF1A 1OOPA 2IFWA 4PLMA 4YM1A 4OHVA 4YG3A 1GU3A 4XUQA 1BEV3 2X5IC 1W8WA 2VCCA 2YU2A 4WV8A 5DUWA 2VZ3A 3NMBA 1UNBA 4BQ4A 3O1SA 2IC1A 5C71A 2J1AA 5JZGC 3FE5A 4IV3C 4XTMA 2VG9A 1QU0A 1FX5A 2VUAA 4XJUA 2FCUA 4W6XA 2CGOA 1CAVB 3Q8FA 4BQ1A 2ZMNA 1H6XA 3ILFA 3AMMA 3NL1A 3U4SA 1LULA 1TME1 1LOFC 3EMRA 1CR7A 3OPTA 5BNOB 2W08A 3ZFEA 5KC6A 5C3QA 4NIAA 4BWOA 5L7OB 2J42A 1EAH3 4I0AA 4YGBA 1W6OA 4BIFA 1QOSA 2GALA 4JDOA 4KU8A 1FMD1 3M3QA 4CUCA 4XF9A 2VMHA 3IPVB 3PVNA 1D4VB 3LSEA 1MEC3 1H9WA 3OPWA 5E89A 5FY4A 1YNAA 4BLJA 1FXZA 3WDVA 1DF0A 4OI1A 2DVBA 4KMQA 2XJRA 1AHSA 2BBAA 1IPSA 4Z2AA 4QX5A 2QUOA 2JENA 2VMCA 4LBJA 2GP3A 1OVSA 1H8TA 1R091 2XJTA 3HWJA 5FY9A 2JDHA 1A6CA 1DGWX 1WCUA 1VBA3 4KH9A 4LK6A 1L3JA 1HRI2 1YEWA 3CJXA 1GYKA 3MDPA 5LEJA 3ES4A 1Y3TA 3S30A 2I2SA 3ACLA 3OEBA 5A7NA 1J84A 1XE7A 3HVDA 2DV9A 3B5LB 3MIGA 5HCHA 1QJX2 3ST7A 1U5XA 3FZ3A 1WKYA 3VBSB 2B46X 1VBC1 3B01A 4B29A 3NJYA 2WC2A 3I97A 3LQCA 3G7DA 4FAGA 1OKOA 1X50A 3RS6A 3VHPA 4PBOA 4MG2A 4XFAA 1VRH1 2XUEA 5A1FA 2PHTA 5FZGA 1TE1B 4WZFA 4QAWA 4FPOB 4KNCA 1ZRIA 5C4WA 1NUKA 3GALA 2HBTA 1RMU2 4P5YA 2HWF3 5JLVA 2QQWA 1S1AA 4F8AA 1AJOA 3ZXGA 1OLMA 4ASKA 4LBKA 5FREA 1JYNA 1DCSA 4BQ5A 1P8JA 2JDPA 2XBO1 3ITQA 1AX2A 4WBBA 5D1IA 4KQ7A 3JD72 1JYXA 2VUJA 2HH9A 5AFBA 4IV1A 2X29A 4LBQD 2FZ1A 2GNBA 1IKPA 2WNVB 2BQPA 2ZX3A 4KWLA 2XGXA 5ABJB 4FPGA 2D98A 5DUXA 2YDEA 4EWDA 1AX1A 2WQ4A 3N9LA 4LUMA 2N7GA 4ES8A 1RUH2 2FHRA 2RR12 2Z5WA 4WM8B 1AR62 3H8OA 1UYZA 1XSQA 1BBT2 4IE6A 3POEA 4IGPA 4MX3A 4Q0SA 2JG8B 1DFQA 1YUDA 1J1LA 3DF0A 4D0QA 2FDKA 1VPHA 3A23A 1OA3A 5FZAA 4ZHNA 3LIHA 3K3NA 3AK0A 5IK5A 3B94A 4AEDC 5FZKA 3E6BA 1DGRA 3VBHC 3JXSA 3OGJA 4LLOA 1GWMA 1VLNA 5A3MA 1GNHA 4D6QA 5LWBA 1POV3 3SCHA 3DPRB 5F32A 1QDOA 1VBE1 3E5QA 4P9LA 1RUC3 3AL5A 2VQAA 1JOPA 4MYEA 4DMIA 5EJ1B 1V6LA 4S2FA 1HKDA 4EN6B 5FQ0A 4GWJA 4RFRB 2DU0A 3NNGA 4UF0A 4ATEA 4LIUA 4C1WA 1W05A 3KV5A 4LNVA 4FOWA 3IDEA 4Q4W1 3UJQA 4CEYC 1ULEA 1UPSA 3DXUA 1HV1A 3M1HA 4BQYA 3LPGA 1KEXA 1SLAA 4U2AA 4HT1T 5AVAA 3VBRA 3TN91 1DDLA 5FTTC 3O1RA 2GU9A 2D6OX 1AR83 4DY3A 1Q8VA 4LE3A 2DCJA 4ZY9A 3DL3A 3HOBA 4P9IA 5IATA 2HKXA 4GWMA 5FK8A 4CCNA 1TMF3 1JHNA 3PMEA 3POGA 2X09A 3RMYA 2Y6LA 5A70A 1HDKA 1JYCA 2GMEA 2W92A 2ZOEB 2VW1A 5I8SA 1OOPB 2ETEA 1PIV3 4CEWC 1FPN3 4I01A 3IN9A 1DG6A 4ZU5A 1EV13 3AKSA 3LE0A 4JKLA 3UYJA 2HEWF 2ZKNA 4H3WA 5F5QA 3BUCA 4YM0A 1ZRRA 4AAPA 1F15A 1ASJ1 3WDYA 1U5IA 4I2OA 4AI9A 3U10A 2VVEA 3PUAA 1UPIA 3HQRA 1XYPA 4OHWA 3QD6A 3PIGA 1DYOA 1ULOA 1GP4A 4ZU7A 1ZBA3 3O1TA 1FV3A 2DFBA 1C8M1 1RHI2 1V9U2 2VTXJ 2ZA9A 3CJIB 2IXHA 4FP2A 1J83A 1GBGA 1BKZA 2G9ZA 3ACIA 4XFBA 5LATA 3LOBA 2ZGUA 3LDKA 3B00A 4K40A 5GJ6A 4D7SA 5F5CA 5FZ7A 5JMOA 4LO8A 4RD7A 1JZ4A 4JGYA 1CZVA 3RMXA 4W50A 4QPGC 1AXZA 3E6CC 2YB7A 4LBMA 3VKNA 1G9BA 1PVC1 2J1TA 2J1RA 5GZGA 2A6YA 4YW5A 1COV1 1D2SA 2ARAA 1QMJA 2R0FA 2X8KA 1XQNA 1XU1A 2D44A 1W3XA 3CL1A 4HZFA 4RS5A 4Z07A 5JIUA 4XPVA 5BPXA 1O3SA 2XLGA 1W8TA 5LBEA 2DYCA 5JOWA 2VQUA 5DZGA 4YFWA 1YJKA 4FOYA 1H8TB 3RZHA 1H2KA 1R1A1 2QQIA 2BVVA 2P3KA 3T0BA 4DOUA 5FYVA 3Q8AA 3AKPA 4NHMA 5LBCA 4FTBA 5CU1A 1JI6A 3WX5A 4XUOA 1LOAA 2RS51 2R061 4QX0A 1HN0A 4HXCA 2W52A 4ARXA 2XG3A 1A8MA 1PNFA 2R041 5A1LA 1H2MA 2R6QA 3IIIA 1XRUA 1RVF3 4XVHA 1WUVA 5SV5A 5L36A 4QX3A 5FMBA 4QKNA 3CDZB 5JXGA 3POBA 3RI9A 1QJU2 5BNNB 3OGVA 1F31A 5FLJA 1B09A 1N3PA 1Q8PA 4MGQA 3H7JA 4IEUA 5ACA1 4RL7A 2VVFA 4LO4B 3OF1A 4W6WA 4D94A 5IW0A 5C4WB 4PIXA 4FCAA 4L11A 1LU2A 5CEHA 1PGL2 1UOGA 2DBIA 3ZSKA 1VBC2 3T2OA 3GBFA 2RJKA 1NKGA 3W21A 1AYN3 2BUKA 3J7MA 4DUVA 5IVJA 4XUPA 2TBVA 1ODMA 1AJKA 5DAWA 5FXZA 3V0BA 2WDBA 4CDQC 4LO5B 4IV1B 1H30A 1YIFA 4MGSA 2XLAA 2E63A 3ALQA 3H50A 3AZXA 1JYWA 1V0AA 2VUDA 1T2XA 1W04A 4QB6A 3J7LA 1LOBA 2H6CA 3D82A 4E8DA 5C9AB 3RWKX 1H0BA 1LGBA 4DZGA 4XMIA 4EV0A 4FPHA 2NLRA 3FL7A 1FOD3 2Q5TA 3JU9A 3RZGA 1WLCA 1YFXA 3N9NA 4BHPA 4Y20A 1NA1A 2JDNA 5IK8A 3ZSJA 2P37A 4Q26A 4LPLA 4PF5A 2ZGNA 3KV9A 3VGIA 1W6NB 4GMP1 4XJZA 4XQ4A 5A3LA 1RTVA 4JRAA 3WG3A 4DNYA 4N7IA 2CNAA 1J59A 1UF2C 1AR93 4BCUA 4QKFA 4RSUA 5FP3A 1K12A 1RUI2 3VDDC 3I3DA 5FQ0B 1WA6X 5IUQA 3ZFGA 1PGSA 2QKDA 2XHKA 4QX7A 2WFF3 2BJSA 4UF0B 4IXLA 2CYFA 1OUXA 3ACHA 3H1MA 4ISQA 4LO7A 1HQLA 1UCXA 1N1SA 1IPJA 2HEVF 2K9ZA 2WWSA 3NV3A 4IDZA 5JAXA 5JOXA 4K3UA 5KXCA 3VBRB 5FMOS 5KHGA 2XJQA 3HPNA 4DIQA 5C3PA 2JG9A 5A3WA 5DPNA 1BMV2 5IFPA 2WO2A 4HANA 4LHLA 1UMIA 3N35A 3QH7A 4MHRA 4O61A 2W68A 1WW6A 3OD4A 2PXJA 1SPPA 4Q4X1 2RDRA 2WS92 4FP3A 1DBNA 5CVRA 5K7PA 1S2KA 4OZOA 1GZWA 4CU7A 2Y0OA 1JOJA 2X10A 2E31A 5JMCA 1H2LA 3BPSA 2FBEA 1ZVFA 3JBG1 4JGZA 4Q4V3 5FZIA 3SISA 1W2AX 3AM2A 2O8OA 1QQP2 2ZGQA 2VBDA 2NPIA 4YW4A 1FATA 3TRSB 4AEKA 2VMIA 4BK5A 1OSGA 1US2A 2QQKA 4CDXA 4GH4A 1F5JA 4CCLA 2VE1A 3HT2A 2FZ2A 4RA0A 1D4M2 1BEV1 2AR6A 1GZCA 2CGNA 2SBAA 3D5OA 3I59B 3MF9A 1Q8SA 1X7NA 5GLTA 4RGGA 3FHAA 1PO23 5FZHA 5LEKA 2WNUC 4BMEA 1L7QA 4R9BA 3WDXA 2CDOA 4W4ZA 1I1EA 4IESA 1H1AA 5DG1A 2B9VA 4XACA 4JGYB 4NHKA 1MACA 2OPKA 2VUCA 1Q3EA 1XC6A 3KT7A 5CFCA 2WZEA 1UD1A 2VTXA 2TUNA 2BP6A 4IE7A 1BVP1 1MS0A 1UMHA 2RS12 4CDWA 5A6ZA 4LBOA 4NROA 1Z0HA 2D7FA 4RS5B 1YFUA 2QNKA 4CVUA 2PAMA 4IEZA 5KXEA 1EAH1 2MHFA 3MPPG 5FZFA 5GLZA 5IK4A 2GN3A 3AMQA 5A3PA 2VBPA 2ZEWA 2IXIA 1GOFA 1A78A 4NPMA 5FZ8A 1FV2A 1MEC1 2HWB3 4QX2A 3SNMA 2WNEA 1YRZA 3ZXDA 1S2EA 4MXVA 3ZYHA 3ZXKA 1RIRA 1YWKA 3VHRA 5FY0A 1PX3A 4K7JA 3NW4A 3PUIA 1PVC2 5LZ6A 2A3YA 2QQMA 3GJAA 4XFFA 2EXJA 3VL8A 1SZBA 2JDMA 1VBA1 2YUEA 2WKKA 5KBFA 3PMSA 5F8PA 1V6MA 4NWWA 3USSA 4DEQA 1PO13 5DAPA 4N8MA 1GZ9A 1RUJ2 2AACA 2WLPA 3C7HA 3PHMA 2BOJA 4QKDA 5FMOL 1TVGA 4HSLA 2PQQA 2A6WA 1DGRN 4MV2A 3AMPA 5C8CA 4A4AA 3M2MA 3BOPA 4Z8BA 4JC1A 3ZXLA 3W20A 2H0VA 3LCPA 4Y22A 1CZTA 5JR7B 4A6SA 4BQWA 1YFWA 4CTEA 5C33A 3USUB 3WNNA 3UKVA 2D6MA 5I0UA 3UK9A 3S57A 1CQ9A 1REEA 1S0GA 1YQ6A 2WZR2 1Y7BA 5FPVA 3THPA 3RPQA 4XIOA 1KRIA 4WM7C 1JYIA 3VZNA 3I2DA 1N3QA 4RGKA 2W9XA 1SLBA 5JI9A 3PUHA 2D6KA 4M0HA 5K8SA 5FZ0A 3V0BB 3C2UA 1LEMA 4FFFA 2ZEZA 4X8NA 2BERA 3D3AA 4N9HA 4YVWC 2WQZC 3M4FA 1DQ5A 4EZ4A 2HWF1 4PBPA 3SMHA 1CAWA 4CUAA 4BE3A 4RN5A 4BOWA 2BGOA 1AYM3 3AKTA 4HLTA 5FP4A 3ZXFA 5IVFA 3ZDVA 1RUG3 2Y6JA 1BXHA 1A34A 2R1DA 1AR72 3OUJA 3BIEA 2Q4SA 3S5QA 3WQ7A 5E16A 1OMIA 3IAQA 1NA1B 4Y20B 3R4SA 3ZM8A 1NCQC 1W2OA 2WABA 1S0JA 4K6BA 1C5IA 2VMGA 4KGQA 4SLIA 5FUNA 2VECA 5DUVA 1JZ3A 2WRAA 3ETPA 4OZXA 1UZVA 4NMIA 4A3ZA 4E2SA 4CPBA 2VJXA 5BNOC 2JWPA 4K20A 4YWAA 2JE8A 4GIQA 4NRPA 1B35A 4XHXA 1JU4A 3OYWA 3QOPA 2FCTA 2LS6A 4S2GA 4D3WA 3NAPA 1O4ZA 3BTZA 1LHUA 3S7EA 3ZFGB 2OX0A 5KWRA 2A1XA 4F83A 3VHOA 4UBGA 5K0UC 1KITA 5B2GB 2YY1A 2PHDA 1PZ8A 4QDRA 3VBOA 3J8F3 5FWEA 1POV1 4TYSA 2RMU3 3FLPA 1V70A 1VALA 4QXHA 1RUC1 5FMCA 3Q9OA 4OQ8A 3BN6A 4MGZE 4QKBA 2UURA 2JG9B 4CYDA 2WIIB 5HV0A 3OGRA 3IWZA 1Y43B 2VO5A 4H2AA 1U0AA 4S2DA 4CXWA 1RB8G 4XF0A 3PJYA 3DYOA 2IXJA 1SPPB 1URXA 3P3PA 2WR9A 3D4KA 3J7HA 1I9RA 1NAEA 3P6BA 3TB0A 2VZPA 2C0ZA 4K8RB 5IJRA 1GZWB 2QVSB 4MGTA 4OUMA 2XOMA 1IG3A 1W8NA 5EV7A 3KSCA 3ZR6A 1AR81 2ZCWA 1W8UA 1UY3A 2JIJA 3LD8A 4JGZB 4QXCA 1OT5A 1KDKA 1SLCA 2AEZA 1X8EA 2CHHA 4E2QA 1BZWA 4Y1UA 5LA1A 5FP7A 5KHIA 2CY6A 1TMF1 1O7FA 1W0OA 4NRQA 4E27A 4CDXB 2VBBA 4FSJA 1GP6A 1O3TA 1C28A 3VZKA 1N1VA 4AHXA 2W1UA 4GH4B 3VUOA 3B7MA 1LAJA 1CAUA 3H1YA 3VBFA 1PIV1 1FPN1 2D40A 4ZZ5A 1E5HA 1EV11 4JCKA 4F7ZA 2ZHLA 4IEOA 5FY7A 2HJIA 2ZGMA 2D6NA 2WJSA 2EICA 2B9UA 4IEVA 4H7MA 5FZBA 1HRV2 3WNOA 1MQTA 4LITA 4W65A 1WA4A 3E6DA 2EIDA 1H8VA 2JD9A 5FLHA 1Q56A 2ATFA 5CFCB 3V0AA 1U5ZA 1IS4A 1VMJA 3S7IA 1ZBA1 1NXD1 1RUD3 1LR5A 1V6NA 2HYXA 4QHOA 1QJY2 4BM8A 4CDWB 4RR3B 2VMFA 4FTEA 1AVBA 1H2NA 1MPXA 2R072 5FKCA 2W2IA 1R083 4MLOA 2F4LA 1L7LA 1BEV2 2VW2A 3FHIB 4PDWC 1ZZCA 2E53A 2WNVC 4UAPA 3OGGA 2JB8A 1HQWA 3IB3A 5DABA 3ZXEA 1QY4A 4AFDA 1TNFA 2QQUA 4TN7A 3MZHA 4XJ9A 4GAZA 4DPNA 5LBBA 5FZLA 3RFRA 2GC1A 2NMNA 3WNMA 4C90A 1K5MC 1Q8QA 5EYYA 4UI9L 3TEXA 3KB5A 3N9MA 2JG8C 5EP9A 4YZ3A 1OKQA 1G86A 1VR3A 1EP0A 3ZFFC 2WN2A 3K4AA 4EWEA 4XJAA 4ASLA 1RJ7A 2R49A 3OTFA 3X29B 4ES9A 1PGW2 2BRTA 1W9FA 2GN7A 3CF6E 1ENXA 4IEXA 4FPFA 5DZEA 5DN2A 4OHYA 2HWC3 3P5BA 2X53S 3K77A 2A7AA 3DPRC 1GNYA 1UWWA 2DVAA 3BVCA 3I2FA 1KXGA 4UFKA 5JI7A 4BQ2A 2R0HA 4QXKA 3PU8A 3DUIA 1SEFA 1OXCA 1I3HA 4LBQA 3OBTA 4Y4RA 2YC0A 4D7TA 4EZHA 3R4DB 5FZMA 3AP7A 3TWIA 1RVF1 2EIBA 5FBJA 3A7QA 1ND2A 2RE9A 3OUIA 2F4PA 4JX0A 4XTPA 3RYRA 4UFIA 1QHDA 4GULA 1ND3C 1NZIA 5F3IA 5BNQA 5L19A 2VH9A 5LB6A 1RL3A 1O4YA 1Y9QA 2R1BA 2K0GA 5FP8A 4LLFA 5FZDA 4L0PA 2JDUA 3JQWA 3AVRA 2C9AA 2OW4A 5J98B 3AFKA 3KCYA 4C91A 1UX7A 3CIHA 4QB2A 1SFYA 1Z7S3 3RZZA 1NG0A 4COWA 1AXYA 4XDPA 2GNDA 3V64A 4RQPA 1W9YA 1G7YA 4QU1A 2IUWA 4XETA 1QOOA 3P3NA 4AR2A 1ZBE2 1AYN1 1XE0A 2Z42A 3GZTB 4E4HA 2Q30A 4B4QA 1MR5A 2P5BA 3RJ2X 3O0VA 3SC7X 4B1LA 1VJ2A 2WFPA 4MGKE 1SG3A 2CAVA 3A21A 1QJFA 5IVBA 2XR4A 2ZHKA 4Y3OA 3RJRA 1REDA 3AKQA 3INAA 1MS8A 4OFGA 4B1MA 1HXS2 4Q4Y3 4CDUC 1UY4A 2XWJB 4YG6A 3WQ1A 3CJIC 2V5YA 1B35B 3BODA 3MFAA 5C6CA 1FOD1 1XPWA 3OYWB 5GZFA 4YGEA 3MUY1 3TOJA 4N53A 3NAPB 1A8DA 5FO8B 3WG4A 3NJVA 1DZQA 3PTYA 4Q0PA 1JZ5A 4CU9A 5AC92 2QQOA 3I54A 4R4XA 3GBWA 1JUHA 3N36A 1GMMA 4K9SA 4META 4QXBA 2VZQA 1OLRA 3VBOB 1S0CA 1BVVA 3PVBB 4FPEA 5ISLA 1CJPA 1QXRA 1VBB3 4UT5A 1AR91 4RGAA 3BCWA 4MXWA 4AI8A 5C5UA 5IYYA 1V6JA 3IDBB 1IQAA 3M3IA 2SLIA 3E5UA 4V2WA 3LEKA 4PLNA 3ZN6A 5HBAA 1ZRDA 4OI0A 3J7NA 3S5AA 3MLLA 1OC1A 2WFF1 4FPLA 1REFA 2KM2A 4E4DX 2NM1A 3AZZA 1GWLA 1Y9MA 3JZVA 5D21A 4YARA 3KCCA 3KVBA 1YIPA 1QOTA 4QPYA 4QPWA 2ILMA 1C3HA 2V4AA 2VXRA 1Y9GA 4GD4A 2X5IA 4MOAA 4DRRA 4QT6A 5LY2A 1JBCA 1RXFA 1ST8A 3RQ0A 3WG1A 4GB33 5B4NA 5JXJA 1W9WA 1JOBA 1AL22 1D0GA 2OQ6A 2A70A 1PM4A 5H9PA 2ZABA 2QZ3A 3POIA 3GZUC 3CQOA 1JZ7A 4XXPA 4CCJA 5CIRA 2NP0A 3AXDA 2GSYA 2G19A 1CAUB 1J3RA 1LOFA 2DCYA 3VBFB 5BNNC 1TQ5A 1MS9A 2BNOA 4Q4V1 4XURA 3BTYA 3NV1A 5HXVA 1JTZX 4OI2A 1PMIA 1NXMA 1YHFA 2JECA 2VOXA 2Y64A 2VD7A 4EN9B 2QJVA 3SCGA 1EUTA 3F2ZA 5LW9A 1OPOA 3UV9A 1MQTB 5BY5A 3N7MA 1H4HA 5CFDA 4X8PA 4OCTA 5DDJ3 2O8QA 2ZJCA 4ZU4A 2B39A
chains in the Genus database with same CATH topology
4M3CE 1F2NA 1UKRA 2A3XA 2JE9A 3R6SA 3POWA 1PO21 2TEPA 4H7LA 1OI6A 5D8AC 4DQAA 3DKWA 4RHV3 1CVNA 4F3JA 2ZMLA 3SITA 1XNKA 4A7ZA 5IT6A 2QZ2A 5C9AC 1ENSA 3G6JB 2GH8A 2QE3A 2RS33 2HWE3 4MUVA 3RYKA 3RWNA 3NKTA 1QGLA 4FXKB 4CZSA 1OQEA 1QDCA 4A2UA 3ECQA 3RSJA 1E57A 1FNYA 4TWTA 2HWB1 4LUKA 1Q5OA 2ZACA 5CA6A 1G6NA 5FPZA 3AYEA 5BUVA 2DCTA 1A3KA 3WCRA 4YW1A 4DRVA 3NSTA 2P3IA 4AQ6A 5HCBA 1H1MA 1CGPA 1ND2B 1ZZ9A 2PHRA 5H9RA 1PO11 1WW4A 1IS5A 3D0JA 4YM3A 2AH2A 1VBD2 5L73A 4AHWA 4P14A 3B9CA 4YW3A 1WD3A 1OD5A 4JRLA 1W2UA 1ZRFA 4FOVA 2YYOA 5GM0A 4PCRA 1HRI3 5FDBA 2WSUA 4QGLA 2WT1A 3I4IA 2PLV2 1LRHA 2R32A 4AEDA 2FQPA 3VBHA 2Q0AA 4DINB 1F8VA 4XQWA 3UKTA 1QJX3 4Q1RA 3VL9A 1AYM1 4AHYA 3RI8A 1RUG1 1DIWA 2UWBA 4SBVA 3D0SA 5SV8A 4N53B 1UAIA 2A6XA 1AYN2 3H9AA 2RM22 3ZSEA 2CGPA 4CEYA 2KXLA 4QQPA 4B8EA 2MEV2 3WY6A 3V56A 2I45A 4RFT0 1DQ0A 3HN1A 1RMU3 1GKBA 5HI0A 4NHLA 4MXWB 3WW1A 2LALA 4AGRA 3AP9A 3EO6A 1W6OB 3ZN6B 1ENRA 2ZHMA 5I91A 1BJQA 1U5YA 1VB4A 3J8F1 5KHKA 1ZZBA 2C5DA 4CEWA 3CEWA 2D6LX 2RMU1 4QQ2A 2PHXA 4I02A 2E7AA 1TME2 1YFYA 1NY71 1NE6A 2OVUA 1WBFA 3O12A 2E9QA 1RUH3 2RR13 4EN8B 1AR63 1XXNA 4J6GA 1BBT3 1WMEA 4BZ4A 2PELA 2EA7A 2A5ZA 1FMD2 5I0TA 4M00A 3S0MA 4BMBA 2AGSA 2XJSA 5FAXA 3VBUC 1OA2A 3ZYPA 1WLWA 1GANA 4L2NA 1NCRC 1WCSA 5JDBA 3ZMOA 5CFDB 4AK3A 1R092 5JSPA 4URTA 1CONA 2ZKLA 3HQXA 3ZSMA 3SCFA 4COZA 2ZZJA 3DGTA 2QDNA 1NQDA 2ERFA 4IEYA 1LKNA 3TBDA 1XNDA 4KG8A 1DGWA 4AE2A 5GLWA 3ASIA 2BNMA 2YPJA 3O0XA 4FQ4A 4D7YA 5J37A 4HKWA 1M06G 5BV6A 2HYKA 2PA7A 1RUD1 3ZYJB 4HN1A 5T3NA 3ZXAC 4M01A 3ELNA 1SFNA 1Q8OA 2UU8A 1R081 2B42B 1VRH2 1HIXA 5I8TA 1WD4A 5F6LB 3L2YA 2PYTA 2QFEA 2ZX1A 5KC5A 1C57A 1W39A 4Z82A 1FT9A 3LAGA 3MYXA 2EVXA 1AZDA 4XJ8A 2MNGA 3FBMA 5J96B 1UMZA 4Z2WA 4W6YA 2JJ6A 4AQSA 5I8YA 3TYJA 3A0NA 2XBO2 1PM7A 1H1IA 4AI1A 1RUF3 4LA3A 4XMAA 1V9U3 2GC3A 3M3EA 4XOGA 3IMNA 4GQ7A 2HWC1 4I30A 1GNZA 4HN0A 3VKLA 4Y26A 1O5UA 1TNRA 4PJYA 3DV8A 2JD4A 2JG9C 2R30A 4MVTA 3UKNA 4CDQA 2AYHA 4LE3A 2TNFA 4GMP0 4KGGA 1SLLA 1AXKA 2B7YA 2XPJA 4Q27A 2VW0A 2A6ZA 1V6OA 5IK7A 4ITCA 1OFNA 2VQ0A 4GWNA 4OI4A 3ZVXA 2NQYA 2C1FA 4QHBA 4R9CA 1VBE2 1C4RA 5F6KA 5BNPA 1F9KA 1Z7S1 5T54A 4CDXC 3VBHB 2E7TA 4GH4C 3BOWA 4XF1A 2XVLA 1LOCA 2ARBA 4Q4W2 1UZZA 2VGDA 4FPCA 4LHNA 3V65A 2ZS6B 4P9YA 3VDDA 3TN92 2IFRA 1DZTA 2NYYA 3ZDSA 1CIWA 1QJU3 5EZWA 2OYZA 4CRQA 4CEYB 2IXLA 4N7UA 1UL9A 4Q4Y1 2ZX4A 1V6IA 2OZJA 4RR3C 2G4IA 4HVOA 3NV4A 3ZIWA 1NLRA 3VN4A 2GMMA 1VIWB 2CV6A 4E2GA 1ASJ2 2QQPA 3ZN5A 3RNSA 4COYA 3TAYA 4XIKA 4JQRA 3TNPB 3WQ0A 4CEWB 4P5HA 1PNGA 1VBB1 3QACA 2LUWA 4MH0E 5EYXA 1WMDA 1G8WA 4LULA 1G9AA 4N43A 4AFAA 1C8NA 1C8M2 1ZRCA 3I8TA 4Z92B 3NO8A 3W59A 3MEPA 2XB6C 2EAKA 1ZZ7A 1J1TA 3KGZA 4HL0A 4U36A 4BA6A 4OUSA 3IT8A 5GZEA 2WA4A 3GZAA 2ARXA 4AI3A 3AMNA 2BFUL 1COV2 4GB31 1CX4A 3MLJA 4YGDA 1N3OA 1ONAA 2UWCA 4OHZA 3PJQA 1PK6C 1NY72 4G9SB 1RUI3 3BPZA 1R1A2 3VLBB 3WP4A 2XWBB 4Y1VA 2DU1A 1C5HA 1YO8A 2ZGSA 2YXSA 3URFA 3WVJA 2RS52 1ULCA 2R062 4UXAA 4QPIA 2VVDA 5BXXA 2Y0IA 2R042 5DDJ1 1KFXL 1QF3A 1UX6A 4M0NA 2YZ4A 4M3CA 3IM0A 4ATFA 2PHFA 4AGGA 1KD7A 2WT0A 3KD4A 2XKPA 3ENRA 4K21A 2WS93 3ME2A 5CG9A 4LHKA 2OZ6A 3HMYA 3RG0A 4RHV1 1IZ3A 3WCSA 3J26N 5ACA2 1IS3A 3ILNA 4LTAA 4OLLA 1LB2A 1LECA 1O4TA 4Q8LA 4NOTA 1QQP3 4AXOA 4HSJA 3CO2A 3LGRA 4MGYE 1B35C 3MF6A 5FLIA 1AL0G 2RS31 2G9FA 2HWE1 4COUA 2D6PA 2D3PA 2D93A 4AYUA 4KU7A 3MICA 1D4M3 4XW3A 4XE9A 1LHOA 1DZRA 4YYOA 5FCCA 4D69A 4YVSA 1D2QA 5EJ3A 2ZBJA 5L7OC 2BVBA 4WM7A 3HT1A 3ILRA 4QMAA 3U07A 4KWKA 3HR9A 2XLFA 2CAUA 1GQHA 3D6EA 4O9EA 3M7AA 2UYBA 2RS13 2XUMA 4IERA 1OA4A 4YVWA 1BCXA 3EJKA 5JPNB 4YM2A 4FPKA 1PZ7A 3WD5A 2OUJA 1LHNA 3FMGA 5T5OA 3SXWA 1M4WA 2BEOA 1SQ4A 5FO9B 2VNRA 2XVGA 2BNNA 1OQ1A 1NCQA 1MVQA 1ZREA 5BNPB 2A75A 2DCKA 2PHUA 2Z69A 1POV0 1SLTA 3VBFC 5BNOA 4JTNA 2EXKA 4FBFA 3A0KA 3VBSC 1NQJA 2I07B 2GC2A 1HRI1 5GZDA 1SBFA 5JCTA 1O5LA 5GLVA 3AXEA 1SBDA 5C8WA 3SH4A 3MIFA 5I0SA 2BW8A 3PVOA 1RUJ3 3WHTA 4AW7A 2D3SA 3POSA 5K0UA 1QJX1 3HD8B 1CAXA 2AREA 4Q4X2 3LZZA 4L9BA 5CNAA 1NE4A 4R52A 4KBBA 1LHVA 4S2HA 1N1YA 3ZPYA 2LM3A 1Q43A 2AUYA 1ZM1A 5C33A 3JBG2 4DFSA 1OHFA 4BIOA 1HW5A 2WZR3 4KG0A 1HLCA 3DN7A 3AZVA 1KJLA 2PHWA 4HKLA 2V09A 4C1XA 5GKAC 2VNOA 1WLDA 1RMU1 2VOVA 1RUNA 1G9CA 5ABJC 4N43B 5DZFA 5LRRA 3U11A 4AHZA 2WZPP 1UIJA 4AQ2A 1S55A 1GFF2 1AR73 4WM8C 2Y26A 3K48A 1I5ZA 4JDNA 3VHNA 2ZGPA 2P17A 3LA7A 3MW4A 4PIYA 4A7YA 1LOGA 1GSLA 3FLTA 1RGSA 5JSOA 1RUH1 1VBB2 2RR11 1AR61 4QU2A 2GNMA 1EAH2 1BBT1 1UU6A 2D97A 2E7QA 4R9AA 3ZIXA 5GZCA 1MS5A 1WGPA 1MEC2 2DUOA 2ZGLA 4WZCA 1LEDA 1J3QA 3ZYRA 4FTSA 2ZTNA 5C8CB 3NJZA 4LEJA 4PDWA 2WNVA 2Z79A 1F5FA 4Y22B 4QPIB 1QJZA 5T50A 4HMZA 1ZYBA 2XL7A 3O14A 4OVEA 2D5FA 4AEJA 3WNXA 1VBA2 1K5MA 4M3CB 4XEZA 2EAAA 2AENA 2JG8A 2WL1A 1IOAA 3ZFFA 1XYNA 1WW5A 1X33A 1ULGA 4TLFA 2YHJA 4IEQA 1CAWB 3O0WA 1OOPC 1QXJA 3B02A 4FPYA 3LB9A 3FC0A 3M70A 5J7MA 1DYKA 4I09A 1PVXA 2DUQA 3DPRA 5HCAA 3CU7A 1OPMA 4GALA 5F9TA 4I0BA 2A6VA 3BTAA 4N53C 1HV0A 1QXPA 3O5SA 4ISRA 2WLQA 2DF7A 1I6XA 3IIAA 4AFMA 1V6KA 3RYPA 4COVA 1ND3A 3ZFEC 1YI7A 4YVSB 2HWF2 1HRV3 4Q29A 3FUQA 4H55A 4XF3A 2P3JA 4E9KA 1GLHA 1BK1A 2XJPA 4L97A 3JCIA 3M3OA 1NZCA 2GDFA 4XBNA 2IXKA 1RUF1 2PFWA 3KZ4C 4AVAA 3AZWA 4UW3A 1QJY3 3E5XA 1V9U1 4P9WA 1VP6A 4YVWB 3WINE 1YI9A 4Y1XA 2R073 1VB2A 1W0PA 4XXAA 3ZN4A 4JAAA 3U0ZA 4B4PA 3GYDA 2HEYF 2BWCA 1AF9A 2DVFA 2JX9A 2ZGTA 3BB6A 2A71A 3OY8A 4LBLA 3OCPA 1H8TC 1WMFA 2ET1A 1DHKB 3KGLA 5CAZA 4L8QA 2ZMKA 1LHWA 1NCQB 2VULA 1HQNA 3T1MA 5BYNA 2CL2A 1QNWA 1JUIA 3GHNA 1N1TA 5FO7B 4CDUA 3CJIA 4XILA 4HKOA 3WP6A 5JZGA 1GV9A 4O9GA 4IV3A 5DG2A 5EXOA 1RUC2 1AX0A 3WDUA 4YSFA 1W6PA 3ZMNA 5T55A 3FX3A 3KLSA 1KFUL 3WP3A 4FAHA 5CFDC 5K0UB 1SACA 1WW7A 1CAXB 4Q1PA 5TSWA 2UWAA 3MW2A 3VV1A 1WCKA 1O91A 3ES1A 5C4WC 2GMPA 2HWD3 1AR82 1IS6A 3LKJA 1QJU1 2MPFA 1WBLA 2OUHA 2YV8A 3V0AB 4QQLA 1TMF2 1UU5A 4NR1A 3HAGA 4LBNA 3UJOA 2H6BA 1CD3G 1PIV2 3N7LA 4GKYA 1FPN2 4IV1C 1GQGA 3FBYA 1PGL1 1WLTA 1EV12 4HBNA 1YXWA 1SCRA 3WT3A 4AWDA 1ZBE3 1RUE3 4FVVA 4R8HA 1IPKA 2OIIA 2PN5A 1ZNPA 2NN8A 2YROA 4UW4A 5BNNA 2ES3A 1ZBA2 1DQ1A 3FUOA 3JQXA 3ZSLA 3AJZA 3PLQA 1QH7A 4P9XA 4AFBA 4AVCA 4BLIA 1HXS3 3POYA 1Z78A 2JKBA 1VAMA 1N47A 3K51A 2CWSA 3AP6A 3HIFA 4LBQB 1DLLA 1FI2A 5AC93 5D8AA 5J48A 4PDWB 1RUOA 3AB0A 3AP4A 4Q8KA 1UKGA 1SLIA 1UW8A 4K8FA 4IL7A 4WVWA 2WSVA 4ZKTB 1PZ9A 1YYNA 5T5JA 1RUI1 3GHMA 4JV4A 3CLPA 3ATGA 3VBRC 5C9AA 2Q1ZB 4Q2FA 1K5MB 1YJLA 2BTVC 5FFOC 3GF6A 3SH5A 3H1WA 3RRDA 3ZFFB 3WDTA 2F6BA 1H9PA 1W6NA 2NZ9A 3AMHA 4RQPB 1XE8A 3MIEA 2BBVA 3T2TA 3VKOA 1BMV1 1ALYA 1RVF2 3UL2A 1RITA 4AVTA 1AL23 3I7DA 4HPKA 4CP2A 4TZDA 1MZ5A 5FRAA 3PNAA 4Z1VA 2WS91 3WR0A 2G9GA 3WW3A 1G9DA 3E97A 3L9JT 2WT2A 3QLQA 4IEWA 4GKXA 1QQP1 3OD0A 1MZEA 1ND3B 5HCFA 3R05A 5JPMB 3BALA 3RDIA 1NOVA 4I3PA 4HVQA 5CBLA 4N90A 2ZAAA 3LA3A 3CNAA 2XJVA 4PIZA 1D4M1 3H0OA 4JGYC 3KCXA 1C1FA 2IZWA 1APNA 2EXIA 4I0WB 2EXHA 3KT1A 3WLUA 3GNEA 3IKWA 5J36A 4RS5C 1FYUA 4A3XA 1WCDJ 4CP0A 4AG4A 4MSVA 5H9SA 3APBA 4NVPA 4ZXKA 3IDCB 1RINA 2BYVE 3OY8B 2VPVA 4QM8A 4DS0A 5A32A 4GA9A 1ZZ6A 1FOD2 4BYYA 2PAKA 2RS11 2Q8OA 3ETQA 4BH9A 3JD73 1W6QA 2X5IB 3OPZA 1RUF2 3I59A 4XHBA 4CDUB 2DTWA 5I93A 2ET7A 3W9AA 5JSRA 5JZGB 1KS4A 1UZYA 4IV3B 5GLUA 1LTEA 5CB7A 1AR92 1LOEA 3KMHA 2GH2A 3EXUA 1ZA4A 2RHPA 1LGNA 1W6PB 4GXLA 2WFF2 2XKOA 3NWKA 4H14A 3EBRA 4HETA 4MGIE 1MS3A 1IKQA 3PVEA 4QPGA 4WVZA 2DTYA 3FFZA 1UIKA 4AF9A 1RUJ1 2IXCA 1VBD3 3KS7A 1NYWA 3H3UA 4EN7B 2DFCA 1OFSA 3MW3A 4R4ZA 4ONUA 1NLSA 1V00A 5T5PA 4DXZA 5H9QA 3R4UA 5LK5A 4EJRA 1SMVA 4Q4V2 2WINB 4Y1YA 3B69A 2UY9A 2WZR1 4AGVA 2KA3A 4UW5A 5E8AA 4ASMB 2Y38A 2EIGA 4XFCA 5JVVA 5JIAA 3ZYIB 2PLV3 1ULDA 2W0XA 1NA1C 3NVCA 1HX6A 4JVAA 4FT8A 4XBQA 1S2BA 5FOJB 3WZ1A 3VBUA 1PO22 2JXAA 4XFGA 4Q0UA 4Q0QA 4NPRA 4EN0A 4LE4A 1NCRA 3USUA 1AR71 5KXBA 4N9IA 5JWPA 4OHXA 2K2SA 5I0RA 4B4RA 3U4XA 3S6PA 2RM23 4QD2A 4TSVA 3BU7A 4LO6B 1KDMA 3J4UH 3ZFGC 2AZ5A 5D8AB 3MGUA 4AI2A 1RHI3 2FMDA 2MEV3 3B93A 4NN0A 4P9GA 2ZPXA 2BFUS 5E1RA 5LRSA 2QCSB 2R16A 1LCLA 1X36A 4INDA 2HWB2 2B8MA 4FPJA 3NKGA 3R0RA 3ZX7A 1UU4A 2PHLA 4A7KA 5BNPC 2XL9A 2VNGA 4HFSA 4AQTA 1QWRA 1TME3 4MZUA 4ORFA 2WA3A 1VAVA 2O1QA 4NO4A 4JGZC 4HPKB 1PO12 3C3VA 1D0HA 3LWCA 1AUYA 1G9FA 4AEDB 1S0FA 1S0DA 1FMD3 4XFHA 3WOGA 2FMYA 3MFCA 4WVVA 2ZZQA 4AFCA 3KT4A 2OA2A 2DWRA 3MLKA 1O3QA 1X82A 3JB8A 2BPA2 5A33A 3QH6A 1R093 2DVDA 3WW2A 5T5LA 4E4ZA 1IHMA 5CFCC 1VAKA 2V73A 3H7YA 4G4FA 3MIHA 1RC6A 1JH5A 4IEPA 4CDWC 5CADA 1HRV1 3KQRA 5T52A 3TNQA 1AYM2 2DVGA 1VBC3 1RUG2 2ZX2A 4L99A 4N43C 3W58A 4C0BA 5A32B 1QJY1 5FBZA 3N4MA 1JW6A 2R071 4KWJA 2PTMA 1JN2P 1EPWA 1W6QB 4XYXA 1VRH3 5EFUA 4I3GA 3JUUA 5KHHA 4XQDA 4QGNA 2ZGRA 1LGCA 3AKRA 2YGLA 3AYCA 3ZYGA 4V1PA 4YRDA 3H8UA 4AVBA 2XBO3 2I74A 5AVPA 2WNUA 3O7OA 4RR3A 3J8F2 1DQ2A 3EQEA 3FLRA 1PGW1 3GBGA 2RMU2 1OQDA 1EY2A 5C8CC 4AVVA 4XF4A 2B5HA 4QPGB 4QPIC 3M3CA 3SLIA 1EPZA 3AX4A 3AJYA 1LODA 2NMOA 4YNIA 5J3UA 1XU2A 2QDRA 1QH6A 1CESA 4WVMA 2JICA 4UW6A 1DQ4A 2HWD1 4PQ9A 5KXDA 3WP5A 1OLQA 3MIDA 1S0IA 2XH6A 4EROA 1MZFA 4FQZA 3VZOA 3ZO0B 4Y5Z0 1CJDA 3WV6A 3IBMA 1VBE3 2DUPA 2XJUA 3WUCA 1SCSA 3QCWA 1MZ6A 1U12A 4XZPA 4NWVA 4PLOA 2JE7A 3LSDA 3A4UA 3HBZA 1C1LA 3VBUB 2B45X 1ZBE1 4Q4W3 1RUE1 1KQRA 3FJSA 1PK6A 1FNZA 1NCRB 5AFEA 1J58A 1S0EA 3AYDA 2A3WA 4HK9A 4YVSC 3TN93 4K1YA 2CWMA 5GALA 4B7KA 2P2KA 1DQ6A 4DB5A 3B9IA 5FOBB 5JOZA 2XVKA 2EALA 3AZYA 3NAPC 4OULA 4XJWA 1RUD2 1T6GC 1X8MA 2ZGKA 3MI8A 1HXS1 1KJRA 4UBHA 5EWSA 1R082 4IQPA 2D5HA 3N7JA 4AEMA 3VBOC 3VZMA 4J1WA 4HK8A 3KM5A 1W6MA 1CN1A 3MIBA 1ZX5A 1TEIA 1LESA 1J3PA 4XBLA 2ZHNA 3FFQA 1ASJ3 1PHMA 4YW2A 4CDQB 5AC91 2VOKA 3VKMA 2ZX0A 4C0HA 2H0BA 4Y1ZA 1BYHA 3L2HA 1YLLA 3OBRA 4XDQA 4FOQA 3J9SA 2GZWA 1UN1A 1C8M3 4KL1A 4YZ1A 2YGMA 1EYBA 1ULFA 3M8LA 2HWC2 2O0OA 3SHRA 2Z2SB 5FPXA 3AYAA 1CAVA 2JEMA 3QBQA 2A73B 4YZ4A 2ZGOA 1PVC3 4B7EA 1COV3 5F1RA 1AL21 1BQPA 5L7OA 4LT5A 5K9YA 3VDDB 5KHJA 5J09A 1YCIA 5A33B 4L92A 4QQOA 4Y24A 1MQTC 3N3HA 1R1A3 3AFGA 3IPVA 4FXGB 4YGCA 1DYPA 1FAYA 3LOIA 5CG8A 4AI0A 1Z7S2 2RS53 2R063 2VU9A 4IETA 4YZ5A 1GR3A 1S0BA 4M3CF 2R043 4QQHA 4AVSA 4YG0A 2UYAA 2UY8A 3SH3A 1IGOA 2ZAHA 3VZLA 2E51A 4Y4YA