The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
49
|
sequence length |
194
|
structure length |
186
|
Chain Sequence |
ANAAIEPASFVKVPMPEPPSSLQQLINDWQLIKHREGGYFKETDRSPYTMEVEKPVMVTRNQSTLIYYLLTPDSPIGKFHKNINRIIHILQRGKGQYVLVYPDGQVKSFKVGFDYKNGEVSQWVVPGGVFKASFLLPNEEFDNGFLISEVVVPGFDFEDHTFLKGEDELKHLVGPEKAAELAFLAH
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule keywords |
Hypothetical 22.5 kDa protein in TUB1-CPR3 intergenic region
|
| publication title |
Crystal structure of the YML079w protein from Saccharomyces cerevisiae reveals a new sequence family of the jelly-roll fold
pubmed doi rcsb |
| source organism |
Saccharomyces cerevisiae
|
| molecule tags |
Structural genomics, unknown function
|
| total genus |
49
|
| structure length |
186
|
| sequence length |
194
|
| chains with identical sequence |
B, C
|
| ec nomenclature | |
| pdb deposition date | 2004-09-09 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF06172 | Cupin_5 | Cupin superfamily (DUF985) |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Sandwich | Jelly Rolls | Jelly Rolls |
