1EY2A

Human homogentisate dioxygenase with fe(ii)
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
439
structure length
419
Chain Sequence
AELKYISGFGNECSSEDPRCPGSLPEGQNNPQVCPYNLYAEQLSGSAFTCPRSTNKRSWLYRILPSVSHKPFESIDEGHVTHNWDEVDPDPNQLRWKPFEIPKASQKKVDFVSGLHTLCGAGDIKSNNGLAIHIFLCNTSMENRCFYNSDGDFLIVPQKGNLLIYTEFGKMLVQPNEICVIQRGMRFSIDVFEETRGYILEVYGVHFELPDLGPIGANGLANPRDFLIPIAWYEDRQVPGGYTVINKYQGKLFAAKQDVSPFNVVAWHGNYTPYKYNLKNFMVINSVAFDHADPSIFTVLTAKSVRPGVAIADFVIFPPRWGVADKTFRPPYYHRNCMSEFMGLIRGFLPGGGSLHSTMTPHGPDADCFEKASKVKLAPERIADGTMAFMFESSLSLAVTKWGLKASRLKSHFTPNSRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords HOMOGENTISATE 1,2-DIOXYGENASE
publication title Crystal structure of human homogentisate dioxygenase.
pubmed doi rcsb
source organism Homo sapiens
total genus 88
structure length 419
sequence length 439
ec nomenclature ec 1.13.11.5: Homogentisate 1,2-dioxygenase.
pdb deposition date 2000-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04209 HgmA homogentisate 1,2-dioxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ey2A02
4R52A 1WLTA 3NW4A 4I2OA 4L2NA 4QGLA 2E9QA 4MZUA 4PIXA 3NKTA 3ACLA 4B29A 3E6DA 4KU8A 1UIJA 2MNGA 1J59A 2PFWA 3WW2A 1RUOA 4HSJA 3BCWA 3D82A 1YFWA 2Y0OA 2ET7A 2IXLA 3WW4A 3ZDSA 4QM9A 1ZVFA 3NVCA 4IETA 4QGNA 3FWEA 5LEKA 1NZCA 3EJKA 2PQQA 3LAGA 3NSTA 3O14A 1EPZA 3E5XA 4BIFA 3RYPA 2KXLA 4WVZA 5BY5A 1YFYA 2PYTA 3EQEA 1CAVB 1ZZCA 3OD0A 1NXMA 4EWAA 4X6QB 2PAKA 5CVRA 1DGWA 2F4PA 2GAUA 4YSFA 1CAXA 1CAUB 3D0SA 3KSCA 5JSOA 5E1RA 3FE5A 4UBHA 2QNKA 2IXHA 1NE4A 1GQHA 2K0GA 1SEFA 1ZZ6A 2GH2A 3UKNA 5FLIA 2XLGA 5J3UA 4LUKA 3E6CC 1U12A 4HBNA 2PA7A 4I0BA 4HVOA 4IEXA 5T3NA 3GBFA 5KHHA 2PHDA 3WW3A 3UKTA 1TQ5A 2WFPA 1DGRA 5FQ0A 4O9EA 2OA2A 1VR3A 5JSRA 4I09A 4IEOA 5I8SA 2N7GA 3E5UA 3WW1A 2HJIA 2XL7A 3M3IA 2IC1A 3FJSA 2GU9A 4FBFA 1O3SA 4XFGA 3H1MA 5F1RA 3U11A 3R6SA 4Q0UA 2HKXA 4MV2A 2XLFA 2B9UA 4XETA 2QVSB 1UPIA 2BYVE 1CGPA 3H7YA 3TNPB 1NYWA 2Z2SB 2XKOA 4YARA 5EZWA 4JTNA 4MGYE 4J1XA 4EV0A 2C0ZA 4DINB 4HSLA 1VJ2A 4I3PA 1RC6A 1OD5A 5FPXA 1FT9A 4Q0QA 4TLFA 4YYOA 2XL9A 5I93A 3EBRA 3ST7A 2V09A 1Q3EA 4IEVA 2XHKA 3IIAA 2QCSB 3L2HA 4J1WA 3PNAA 3QOPA 1YFUA 3I59B 4HN1A 5BV6A 1OI6A 3CJXA 5CADA 2H0VA 1ZZ9A 3FZ3A 4XF9A 3B02A 5BUVA 3U0ZA 1CX4A 1UD1A 3S7IA 2BEOA 4HVRA 4META 1RUNA 4KU7A 4MX3A 2ZKLA 1J58A 1G6NA 2D40A 3FX3A 4OLLA 2B8MA 1Y3TA 5D1IA 1O7FA 3KMHA 1UW8A 4FT8A 1ZRDA 3RDIA 4O9GA 5I91A 1O3RA 2CAVA 2FQPA 3ELNA 2MHFA 4AQ2A 4Z07A 4F7ZA 5KHGA 1GQGA 3LA3A 4D7SA 4BYYA 3OF1A 4I02A 3C3VA 2Z69A 2XGXA 1EP0A 1YUDA 5FCCA 3U10A 5I8TA 4Q0SA 4AXOA 2B5HA 1L3JA 3KGZA 4XFIA 4XFHA 1UIKA 3MYXA 2GC0A 4E2QA 3DN7A 3LA7A 1QY4A 1EYBA 1RL3A 2CAUA 4KWLA 1DZRA 2DCTA 1QXRA 2EAAA 1O3QA 2O1QA 4IERA 2VPVA 2IXKA 4XFAA 3LOIA 1IPKA 4N9IA 4QM8A 1YWKA 1JUHA 4HZFA 5KHJA 3EO6A 4FAHA 3OTFA 5E16A 3KGLA 4NVPA 2GC3A 4KL1A 5KHIA 4HN0A 4JTOA 4PJYA 1O5LA 3IBMA 1XE7A 1J1LA 2IXJA 4AVAA 5I0RA 3SCHA 3NL1A 4AQ6A 4ZU4A 2OZ6A 2PTMA 3BPZA 3PVBB 4BH9A 4ONUA 4HMZA 4E2GA 4PIZA 5KHKA 2UYBA 2OZJA 3SCGA 1LB2A 3H1WA 5FQ0B 2D5HA 3S0MA 4Q29A 3H1YA 2ATFA 2IXCA 1X8EA 3H7JA 3BALA 3BU7A 5KBFA 1ZRCA 1CAWA 3RNSA 3ES1A 4EWDA 3G7DA 4AVCA 3MPBA 4QX5A 4LA3A 1J3RA 2MPFA 2I45A 4UXAA 1ZX5A 5BPXA 2PAEA 4H7LA 1ZRFA 5JAXA 5EFUA 4EWEA 2EVXA 3JZVA 5CU1A 4F8AA 3CLPA 4MUVA 5J7MA 1VP6A 3SMHA 5J48A 5FLHA 4ZU5A 4LA2A 1I6XA 3FFQA 1DZTA 3MDPA 4LEJA 4LUMA 3E97A 1EY2A 3M70A 3FHIB 5C6CA 4LTAA 1J3QA 2Q0AA 3OCPA 2K9ZA 2GZWA 1ZRRA 4UBGA 4HVQA 1OMIA 4IEYA 3RZZA 2PHLA 4X6RB 2PAMA 3NJZA 3IDCB 4K8FA 3CF6E 3CEWA 3ES4A 2OYZA 4HLTA 1WA4A 4N9HA 4XF4A 4XF3A 4IEUA 5BXXA 3DV8A 5AVPA 4Q0VA 2O8QA 1O3TA 4MH0E 4A2UA 2H6CA 4XFBA 1RGSA 2XLAA 5JSPA 3OGJA 2ZCWA 1ZNPA 4YRDA 2OPKA 5I0UA 5HI0A 4YNIA 3MZHA 4P9GA 1YHFA 5I0SA 2D93A 3GYDA 3LZZA 3H3ZA 3ETQA 2XKPA 5LRSA 3E5QA 1SFNA 2BNMA 1QXJA 1PMIA 3PLQA 3S7EA 4R8HA 1CAXB 3ROUA 3I54A 4XF0A 2H6BA 1CAVA 2D5FA 1X8MA 1YFXA 2UYAA 4JVAA 4IEWA 5JCTA 2ETEA 3SHRA 2BNNA 1LKNA 3CL1A 3VHRA 2GC2A 2Q30A 1WGPA 1FXZA 2BGCA 5LRRA 3H9AA 2FMYA 1CAUA 2VQAA 4QGMA 1XE8A 4XFCA 1NE6A 1HW5A 4BHPA 3RYKA 2Q1ZB 4ORFA 5K8SA 1ZZBA 4XF1A 3SXWA 1I5ZA 1ZREA 4IEQA 3UKVA 1Q5OA 3DKWA 4RD7A 1J3PA 3HIFA 1O5UA 3H8UA 4KWKA 1UCXA 1XRUA 2CV6A 3QACA 2QJVA 5I8YA 5FDBA 3RPQA 2CGPA 1CAWB 5I0TA 3DL3A 4GULA 4L11A 2IXIA 4E2SA 1ZZ7A 5FPZA 1H1IA 2Q4SA 1H1MA 4MGIE 4CYDA 1QWRA 4Q0PA 4QMAA 4XEZA 4IESA 4LULA 1ZZ8A 2BNOA 3LA2A 1LR5A 3CO2A 3USSA 3N4MA 1LRHA 2P17A 4MGZE 3TNQA 1V70A 4I01A 1YLLA 3HT1A 4OFGA 3H3UA 2GC1A 4KWJA 4Z82A 1RTVA 5LEJA 4I0AA 4WBBA 3EHKA 5JR7B 3HT2A 5C8WA 4AVBA 4D7TA 2EA7A 2WC2A 1Q43A 4ZU7A 1O4TA 4LLOA 1FI2A 3SCFA 2UY9A 1X82A 3IDBB 4JV4A 4WZCA 2UY8A 2ET1A 2VECA 4QXKA 1SQ4A 4FAGA 5FLJA 3I7DA 1PM7A 3I59A 4XFFA 4IEPA 3E6BA 4PIYA 1Y9QA 3BB6A 3LWCA 4EROA 3HQXA 1OFNA 3D0JA 1IPJA 1X7NA 4IEZA 3H50A 3IWZA 3KCCA 2QDRA 4MGKE 3RYRA
chains in the Genus database with same CATH superfamily
3PL0A 1XNTA 1W6QB 1WLTA 4PDWA 2QQPA 2BQPA 2VUJA 4E9KA 5FUIA 4I2OA 3VKNA 3A22A 4DXSA 2QE3A 4PIXA 2WZR3 4Y33A 3VBUA 2MNGA 2PQSA 3MW2A 1J59A 3WW2A 4EJRA 4JDOA 1BK0A 3D82A 1RUG2 1KXGA 4A7KA 3PVNA 2RR13 3HWJA 2DCKA 1V9U1 3DPRB 5A32A 1BBT2 1UXZA 3OBRA 4LO6B 2XWBB 4E4SA 4YVWC 3LKJA 2ZTNA 3KVAA 5AC92 5LBEA 2VMFA 4IETA 4QGNA 5JXIA 1NZCA 3MFAA 4NROA 2ZXQA 4UT5A 3VBUC 2Y38A 2JKBA 3WNNA 2PQQA 2RS53 2IUWA 1UKGA 3H8RA 4HK8A 3QH6A 1UZWA 2W1WA 2ZMKA 4JQRA 1AXKA 2G9GA 1CAVB 4YVSB 4IE6A 4RFRB 4CU7A 4NPLA 2V4AA 4QDSA 1MPXA 3V0AA 2JDZA 3MPPG 1U5YA 5EPAA 2WS91 2ZX1A 3F95A 3J4UH 2BFUL 2D6MA 3ZR5A 2XPJA 2F17A 1DGWA 2WSUA 5IVBA 1H8TC 2OXBA 4DUVA 2GAUA 5FYVA 4FTSA 1C8M3 1GOFA 4E4ZA 2C1FA 3PTRB 3KV5A 3RZLA 4Y20B 1MR5A 5B4NA 2SLIA 1PO23 1RUJ3 3K46A 1SZBA 4MADA 1WMXA 3DF0A 3FE5A 5FZKA 4JQTA 1WZXA 4ZONA 4HXCA 5FP4A 4AF9A 4BE3A 3OPWA 1A3KA 3DXTA 1GUIA 2D6LX 2VMEA 2WNVB 5KWRA 2DFCA 4FOWA 3POIA 2GH2A 3R4DB 5HCBA 5FLIA 2WSVA 1ND3A 3AP6A 4CDXA 3FLPA 5LB6A 3WZ1A 4BQWA 2E7TA 3LPFA 2B42B 2NMOA 4KI5M 3T4HB 1PMJX 1U12A 4IUGA 1UOGA 4OZOA 5CFDA 3DYPA 1UNBA 1CQ9A 1W6MB 2Y34A 4E4HA 4PI2A 4B3NA 5KHHA 2PHDA 4UYBA 2WWJA 2ZGNA 3WW3A 4TYSA 1LGBA 3ALQA 1DGRA 5FQ0A 1GFF2 1ND3C 4UFKA 5FZ4A 4A6SA 1Z7S3 4KWUA 1DQ1A 5GZEA 1O8SA 3V65A 2RS32 1OUXA 2R063 1GLHA 4IEOA 5I8SA 1XNDA 1WD4A 2HWD3 5CFDC 2FDKA 1MVEA 2A70A 3M3IA 3BOPA 3HAGA 4XURA 5DAWA 3E1F1 3V0BA 4XFGA 3H1MA 3N7LA 3U11A 3AMNA 4AI2A 1RVF3 1QJY1 2ZHKA 1PIV1 1VMFA 2HKXA 3AK0A 3AXEA 2HWE2 1ASJ2 1AR91 1CR7A 4IGQA 1LGNA 3OBTA 3ZO0B 2EXHA 3TEYA 2BYVE 4LO8A 4Y5TA 3U4SA 1QNYA 4NRMA 1NYWA 3GXUA 3OEAA 1OSGA 2Z2SB 2DVFA 2VTFA 3AZXA 3VD7A 1RUD3 1CIYA 2VZUA 3AJYA 5EZWA 1WLDA 3LB9A 1AX1A 4LR4A 4J1XA 1IG0A 2QQIA 1G9BA 1UY0A 3WDXA 4AFDA 3IZOA 1RC6A 3P6BA 5LY1A 4YZ1A 1E5RA 2ZMNA 3TAYA 5FPXA 4ITCA 4AVTA 3B5LB 2JENA 1WCUA 2DCJA 4TTGA 3THTA 1PK6A 5I93A 1FATA 1NUKA 3THDA 1S0BA 4IEVA 3I2HA 4TLGA 2XHKA 1OF3A 3IIAA 2O8OA 3O5SA 3QOPA 4OCTA 3VUOA 2G9FA 3I59B 4D69A 5BV6A 5FO9B 3GDBA 3QCWA 1D2SA 2VAUA 2V4VA 5KXCA 2VL4A 3FZ3A 4XAAA 1YCIA 4KG8A 3U0ZA 3ZXLA 1CX4A 3VB9A 3P1IA 3S7IA 1UWWA 5FY0A 4HVRA 5FZAA 1FAYA 3VDDC 2E31A 4PDWB 1KJLA 1W0NA 4UI9L 1UPSA 3CIHA 1DQ0A 2B45X 2DCZA 3OGVA 4FPLA 5CISA 1STMA 2D40A 2VZSA 3JB4C 3FX3A 4OLLA 2B8MA 4V1PA 3VBUB 3VBOC 3O7OA 4CU6A 3BGAA 1HQWA 2OQ6A 3SKVA 4ES8A 4CPBD 2D98A 1FNYA 1D4M2 1WW4A 5I91A 1OPOA 3RWNA 1O3RA 3FBYA 3ELNA 1RITA 3PJYA 5A32B 3ZXDA 1GQGA 5DMYA 4QX3A 1HKDA 1OLRA 2B9VA 1LENA 5DUWA 3ZXAC 2DYCA 5G05L 4D7SA 2L9LA 5A6XA 3GHMA 2Z69A 4XXAA 2XGXA 1PHMA 2IFRA 1JHNA 2HEVF 2HWC2 3C7GA 2B5HA 1L3JA 2VNOA 2VUCA 2ZACA 5C8CC 1R64A 4XFHA 1OQDA 1HB3A 2R1BA 2GC0A 2RS12 1BBT1 1UYXA 2RG4A 3CKHA 4NO4A 1RL3A 2CAUA 4U36A 2DCTA 2P1BA 2V5DA 4TWTA 5EP9A 1GOHA 4RA0A 5CIRA 3VZMA 3WHTA 3V0AB 1QQP2 4DS0A 1Y43B 2VPVA 3FHAA 5GZFA 1LHWA 1WLWA 4N9IA 4QM8A 3VZOA 2VZ3A 3MUZ1 1B35A 1YC61 3ILNA 3NAPA 1LHNA 5DAXA 1FPN2 3EMRA 1QOSA 2YMZA 3OUIA 2NMNA 2P6HA 4X8PA 4FAHA 4QQLA 3O1TA 2ZA9A 3VBFA 4ATFA 1K5JA 2JECA 1W2UA 3MW3A 4Y4RA 5FMBA 1OBNA 4QXCA 1RINA 4GJZA 2A6WA 4HN0A 4JTOA 4PJYA 3AFGA 3TN91 5A7SA 3NAPC 1SLCA 4AVAA 1UY4A 2E26A 5FXWA 4CDXB 4DMIA 1OH3A 3NL1A 5IVVA 4MHUA 3GCXA 2YYOA 1JYTA 1LEDA 2X5IA 3K77A 4BQYA 3BPZA 5CFDB 5EYYA 4BH9A 3TEZA 3IM0A 1YJLA 5EQUA 5FZHA 3BPSA 4MSVA 5KHKA 2UYBA 2JKXA 1OKOA 3PVEA 2XBO2 3H1WA 4YW7A 3U14A 5FQ0B 1OVPA 4AL9A 5CFCC 5FZGA 3RRDA 5HCFA 1JW6A 2D5HA 2Y60A 1RMU1 1AR93 3MIBA 5I0DA 3O12A 4CCNA 2IXCA 1A78A 5H9QA 2X5IC 4RL7A 2GN3A 2ZX4A 3BALA 1PNFA 1JN2P 4BB3A 2ZS6B 3WUCA 1TMF1 2Y6HA 4NRQA 4Y1VA 4EWDA 1JZ6A 3V0BB 3WINE 2XOMA 3MPBA 1GWMA 1H8VA 1C57A 1W9WA 3W21A 5IVYA 1J3RA 3KT1A 4XTMA 5K9YA 1OKQA 2AGSA 2WYSA 1PVC3 2RS31 4GIQA 3WDVA 5FFOC 3JZVA 2WKKA 1CPMA 5E89A 4ZZ5A 4RHV1 2XQRA 4R9CA 4ES9A 3JBG1 4Q4V3 4MUVA 4UF0A 1JU3A 3B00A 1LOFA 2VMCA 5A3MA 4KQ7A 2W1QA 1DQ6A 1V6KA 1VAVA 4NE9A 2HWE1 1ASJ1 1QF3A 1W2NA 4Q5OA 1YIFA 5FLHA 4H14A 2GNMA 4LE3A 5LASA 3UT0A 1SLBA 1PK6B 4QQHA 2FCTA 1JZ4A 1DZTA 4LUMA 2D7FA 5IWFA 3VBSB 2YPDA 1S0FA 2VY0A 3USUA 2HBTA 1LHOA 2PELA 3E97A 1QJZA 4SBVA 1LOFC 4QPWA 5C70A 4AI3A 5A7WA 4N43B 3QBQA 2CDPA 1VIWB 3IT8A 4IQPA 2WFF2 5C6CA 2DVBA 4A7YA 1VRH2 4LT5A 1ZBA2 2F4LA 3TB0A 4GWJA 2JXAA 5FTTC 1A8DA 3HN3A 1DG6A 1SCSA 1TME2 3OCPA 2WQZC 1R082 3KVBA 1GNHA 3ZKUA 4XOGA 4HVQA 1MQTC 1V6OA 3NWKA 2PHLA 3HJRA 1BMV2 2CHHA 1MZFA 1MZ5A 2Y64A 3NJZA 4DB5A 1VBE3 2XJQA 3CEWA 3ES4A 4FCAA 4NPMA 2OYZA 3FMGA 2Y6JA 2JD9A 4N9HA 1PO12 4XF3A 2XMLA 2VMHA 1GU3A 4D8MA 2TUNA 1ZA7A 4M3CF 3KD4A 3O1UA 3SH5A 1POQA 2O8QA 1O3TA 5LA1A 4BPZA 2H6CA 4FQZA 3THPA 3Q8CA 1RGSA 4NN0A 2GNTA 2W47A 2A6ZA 2YXSA 5HI0A 2WZR2 3OBZA 3POSA 4AAPA 1CN1A 5FPVA 4LBKA 4L0PA 4E8CA 2D6PA 2D6OX 4P9GA 1COV3 5FPUA 3ZYIB 4AHZA 4SLIA 3GYDA 3LZZA 2RR12 2G4IA 4W6XA 4E4DX 1U5ZA 1WD3A 4MLOA 1D4M1 5A3WA 5C5UA 5K0UA 3Q8FA 1A6CA 1AF9A 1G9FA 2W46A 4GB33 1WWYA 2VUAA 2CGNA 3H3ZA 1YRZA 1NX9A 1K42A 1H0BA 3OYWA 4ASMB 4QX7A 3VZKA 4DY5A 1PGL2 1OH4A 2OS2A 4HG6B 1SLAA 1S0CA 2BU9A 5LRSA 2BNMA 2FCVA 1QXJA 2RS52 4NIHA 1VBA1 1DZQA 2WNOA 2Q8DA 3S7EA 3TN93 1B35B 1N3OA 4LO5B 3GZTB 1ULGA 5HCAA 2OUHA 1X8MA 4XJWA 5EV7A 1NG0A 1V00A 1ZYBA 2PHRA 3IAPA 2P6CA 1QQP1 1W8NA 4QAWA 4JVAA 5GKAC 3VBFB 2HWB1 5FYCA 5FXVA 4NIGA 5JCTA 4W4ZA 2VW1A 4AK3A 2EXKA 5T55A 4ZPIA 2VOVA 1C8M2 3KCYA 5B2GB 1FPN1 4UFIA 2Q30A 1BLZA 5GLVA 1PO22 4M00A 1FNZA 2WL1A 1POV1 1WCDJ 2FMYA 3K4DA 4AEMA 1T2XA 4DXTA 2AEZA 4QPGA 4XFCA 1NE6A 1RMU3 4CPBA 2XJTA 2J7MA 4NWWA 4J25A 2WAAA 4XUTA 3S5QA 2AACA 3RJ2X 5IAXA 1OURA 1UY2A 5FZBA 5BNOB 3PDQA 2FDIA 4Q4X3 1QOOA 2J22A 1TMF3 3N7KA 1QDOA 2W1UA 4IEQA 3J7LA 2DCYA 1EV11 4RD7A 3MO4A 4JRAA 3HIFA 2E63A 3ZXGA 1O5UA 1H6YA 2C9AA 4KWKA 3RG0A 1DGLA 3LFMA 3QACA 3MIFA 3ZFEA 1XE0A 2QJVA 4M3CA 4RHV3 4R4XA 4D0QA 5JWPA 3JBG3 2XBO1 3DL3A 1ACCA 3PIJA 4E2SA 5LBFA 4XMIA 1Z7S2 2WT2A 4CUCA 2JDPA 4COUA 1AHSA 4WVMB 4CSWA 2QDNA 4MGIE 2AYHA 2E7QA 3U1XA 5HPOA 1G9AA 5ISLA 4CYDA 2J1EA 2R062 2R0HA 4GXLA 1JTZX 1UO9A 3ZSJA 1CX1A 5KC5A 1DF0A 2HWD2 3BN6A 2FDFA 3B93A 3GGLA 4ZHNA 1KRIA 2A3WA 4XEZA 5CZKA 4LULA 4PF1A 4UF0B 4AOCA 3CO2A 3POFA 1RVF2 1WW7A 4XCBA 1REFA 4QT6A 4MGZE 4BISA 1DHKB 1Q8OA 4FPEA 3Q8EA 5ERLA 1E5SA 2K2SA 4DO0A 4RSUA 1DYOA 5HCHA 3ZOIA 3LOBA 2DBIA 1JZ2A 4XTPA 3DECA 1HXS1 2GC1A 1H4HA 2VH9A 1PZ9A 1RUD2 3AX4A 5CG9A 3T4VA 1RTVA 2E53A 3L2YA 3USUB 4I0AA 3RZJA 4NRPA 3A4UA 3NV1A 5A7WB 3AB0A 4ARYA 5C8WA 4D7TA 3CNAA 3T30A 2WC2A 1NCQA 2QQOA 2ZJCA 1Q43A 1V6NA 2ZGOA 3V64A 4OUMA 5CAZA 5HXMA 3RMXA 3GZAA 3ZN4A 2WNUB 2UY9A 3IDBB 4EN6B 4ISQA 1F9KA 5FMOL 2UY8A 4L9BA 4QXKA 3VD9A 1SQ4A 3RZMA 2VQTA 4GAZA 5FLJA 2E51A 4XUQA 4IEPA 1HN0A 2LS6A 3SNMA 1VRH1 3LWCA 4CXYA 5JOZA 2B46X 2IVJA 1NCQC 1X7NA 1K45A 3J9SA 3Q8BA 4AHYA 3BTXA 1E5HA 2RE9A 5C9AA 1TME1 3IWZA 3KCCA 1R081 2XWJB 3PVOA 4MGKE 1IKQA 1D4M3 2JG9A 2XJRA 3HEIA 5A3OA 5LBCA 3RYRA 4R52A 3RZKA 2CNAA 1N3QA 1RIRA 3MIGA 1HDKA 2XJUA 4AEJA 2GNBA 2E9QA 1PO11 4LHNA 4Z1VA 4B29A 4KU8A 2PFWA 1RUOA 2ZEYA 5IVEA 1VBA3 2BGPA 5FKBA 4U2AA 4P9YA 5K0UB 2IXLA 2WIIB 3ZDSA 2WWUA 2JDYA 4BOWA 3KT4A 2VW0A 4XC9A 1NLRA 1I9RA 2P2KA 2VZRA 3WQBA 1ZVFA 3O1VA 1LOEA 2YY1A 2R49A 2CY6A 3OYWB 3ZYPA 1NAEA 3HNMA 3ZMNA 5LW9A 2DTYA 2HWB3 1NOVA 2YBPA 3LAGA 3H8OA 3NSTA 2JWPA 1EPZA 1FV3A 5B4XA 2UWBA 3ZSEA 4GZ9A 2KXLA 5FY9A 3I8TA 1YFYA 3QD6A 3GJBA 1L7RA 5F5QA 1UYYA 3LD8A 3I2IA 4K7JA 4BXSV 2QZ2A 4WM8C 1PGL1 4BQXA 3WR0A 4JCKA 1ZRIA 5IW0A 1NXMA 4DEQA 1DGRN 4X6QB 5FZLA 4HK9A 3AP5A 2F4PA 2W9XA 4B7EA 4FFGA 1AR63 3RZHA 3C7OA 1QOTA 4FPOB 4JDMA 1EV13 1WKYA 2WT1A 1GP4A 3KSCA 4FO9A 4QPGB 5JSOA 5ANNA 1MS4A 4QKNA 4AEDA 5FP9A 4QDQA 1IOAA 3HBKA 2VBPA 4MVTA 2WJSA 4HL0A 3ZIXA 1NE4A 5BNQA 1XYOA 3ZYRA 1ZZ6A 4Q8LA 2Y6FA 2W2IA 1MS0A 3AYCA 2A6YA 1WW6A 2HEYF 4XQ4A 4PQQA 3ZDVA 5FYUA 1IS4A 4CP1A 5FZ7A 1CVNA 3HVDA 1OA3A 5EYXA 2PMWB 1O4YA 4AFCA 3UGGA 2VMIA 4AEDC 2AZ5A 4KBZA 3ZFEB 1HV1A 4HVOA 5F6KA 2XONA 2JD4A 5ABJA 3UV9A 4YGBA 4XJUA 3SISA 4BJ0A 5CB7A 4LBMA 1UYZA 2D6KA 4QX8A 3MUY1 1HB4A 4O9EA 4QXHA 3ECQA 4A3ZA 1AR92 5F2WA 5A1LA 4ARXA 4G3YC 2DDUA 1FMD1 2JIGA 2PHWA 5EJZB 3LCPA 3FLTA 1UQXA 1K5MB 1JBCA 1HXS3 2XL7A 3U37A 5ABJC 3OGGA 2W1SA 2I74A 2BDRA 4IL7A 5FJHA 5A6QA 2P3YA 5F1RA 5JR2A 1CIWA 3C7HA 2OVUA 1F4HA 4EZHA 3WXPA 2AH2A 1PVC2 2VXJA 2XLFA 3I2JA 1XC6A 3ZYHA 2R071 2P3JA 5EXOA 2HWD1 1UPIA 2P37A 5AFBA 3TNPB 1LGCA 4Q4V2 5BNPC 2XKOA 4LBQD 5IHRA 4MGQA 1RVF1 4MGYE 2NPIA 2ZPXA 3GF6A 1WBLA 1JYCA 2XVGA 4IDZA 4YW4A 3U07A 4BQ4A 4EE2A 4EV0A 1VJ2A 3POGA 1SFPA 1VRH3 4PLNA 2Y26A 4Y1YA 5FZMA 3VL9A 4CE8A 1IS3A 4L8QA 3T2TA 4Q0QA 3U4XA 2LROA 4Q4W1 3VBHA 4K6BA 3EBRA 2C6SA 1REEA 2V09A 2ZGLA 3ZSMA 3O1PA 3AP9A 2WUHA 5FZ0A 5JLVA 3L2HA 5CBLA 4R9BA 1W3VA 2AC1A 3I2DA 5GLTA 3CBNA 5JOXA 5KXDA 4EQVA 2VZVA 3OGSA 3ACFA 5CADA 3NJXA 2QQNA 2FDJA 2DUQA 3KF5A 4I3GA 5C9AB 3B02A 3PUHA 2BVVA 1W8FA 3AL6A 5FBJA 5L73A 4YG0A 4CEYA 2JG9B 3B69A 4YVWA 3D5OA 5C33A 4CEWC 4OHZA 1RUH1 2YC0A 1VBE2 2CU5A 3CQOA 5DZEA 1J58A 5JI9A 4YM0A 1O7FA 2V72A 1JUIA 2X09A 3N36A 4OUSA 3HNYM 4Y24A 3LGRA 2YGLA 4ZXKA 4BM8A 3BODA 5FWJA 1BYHA 1Y4WA 1F5FA 1W9FA 2CAVA 4CEYC 1DCSA 1SG3A 4AQ2A 4F7ZA 4P14A 3LA3A 3PMSA 4V2WA 5EWSA 3R05A 4PBOA 3C3VA 5FJKA 3VHNA 1COV2 1H8TA 3WF3A 4CCOA 1KGYA 4N90A 3IPVB 1Y9MA 5I8TA 3HR9A 4AXOA 4FPHA 3KGZA 4FSJA 4H7MA 4AQTA 2VU9A 1PM4A 4GB32 1ULCA 1VRBA 2E33A 3MYXA 1GR3A 1XXNA 4E2QA 1QY4A 4JGYC 2WO2A 1DZRA 1DGWX 1H9WA 2EAAA 2RDQA 3KV9A 4XIOA 1O3QA 2O1QA 1K3IA 1UY3A 3P3PA 4CTEA 3KT7A 1X9PA 1W8OA 3QH7A 4XFAA 4A42A 1KS5A 3J7NA 3LPGA 4LORA 3WDTA 4FTEA 1RUI1 1IPKA 3ZPYA 2WR9A 3TN92 1GZWA 1YWKA 5TSWA 1XNAA 4M0HA 4CDQA 5L9VA 2BJSA 1W3XA 5KHJA 1KDKA 2F6BA 2VNRA 2BVBA 4YZ2A 3OTFA 1RUE3 3ZR6A 5IK7A 3KGLA 1Q8QA 3A0KA 5L9RA 4XIKA 1LOCA 1JZ3A 2YV8A 1VB4A 1GQPA 1JOPA 5KC6A 5T50A 1J1LA 4R9AA 5J98B 4AWDA 4CDQC 4UFLA 3KV6A 1W9TA 4BQ1A 1RMU2 1MZEA 3LEIA 3T0AA 1ND2B 3N9LA 2OZ6A 4YG3A 1FMD3 1I3HA 2KR2A 2OT7A 1YEWA 3NKGA 3PVBB 2LTNA 1KQRA 5BNNB 4FPKA 4E2GA 4Q4X2 5ABJB 3GZUC 4QKDA 1BEV1 5FYHA 2NP0A 1TMF2 5FZCA 3MEPA 2VQ0A 1W6NB 2VJXA 1V6MA 4ZXEA 4QX2A 4Y5Z0 1QDCA 2C24A 1G8WA 5C3PA 3KV4A 4FPYA 1D4VB 1GICA 4XDOA 2R073 2ATFA 3WCSA 4NPRA 4LIVA 4XABA 4RHV2 3BU7A 3M3EA 3MI8A 5KBFA 5IK5A 1UMHA 3JBG2 5GLZA 1YQ6A 1AR71 4RS5C 3WP5A 4DZGA 1LTEA 1ZRCA 1MS1A 4UW6A 2WLQA 4GMP3 1IKPA 4L92A 4W6YA 1QJX1 3M8LA 4B1MA 2I45A 3J26N 4UXAA 4XYXA 1Q56A 2JB4A 1RUC3 1ZX5A 2LW8A 3HBZA 2PAEA 5BPXA 5KXBA 5JAXA 4Q4W3 5EFUA 4EWEA 2EVXA 2NZ9A 3ACHA 5CU1A 3S30A 3VBRC 1GZ9A 3MIEA 4AW7A 4F8AA 1W8UA 2ZAAA 3CLPA 2QBXA 5F8PA 1OLME 3ENRA 4OZXA 1XB9A 2ERFA 3M1HA 3W20A 5J7MA 1AL23 1W6PA 2A5ZA 2WQ8A 4KNCA 3DEMA 2YHJA 2VMGA 5DG2A 3DYMA 1PVC1 2QZ3A 3KQRA 1QJU1 4NHYA 5D8AA 1E57A 5J48A 3ETPA 4YGCA 3IMNA 1RUF3 2CDOA 1ENXA 1UMIA 3LQCA 4LA2A 2J1TA 2XJVA 3N35A 2ORZA 5LY2A 2Q8EA 1U5IA 3VBHB 4J6GA 4OYUA 4Q4V1 3VDDA 4LEJA 2RMU3 2VE1A 1GNZA 1RUH3 1YQ8A 3M70A 1WMFA 3FHIB 1VBD1 3VKOA 3VBOA 3VDBA 3C2UA 4XQDA 1WLCA 3NQHA 4LTAA 1F31A 5A7OA 1UZYA 4AG4A 1YXWA 5D8AC 5FBZA 5F37A 1OF4A 2ARXA 3D8CA 2QQVA 1JI6A 5C71A 2NYYA 1F35A 5F5AA 3WP3A 4KGQA 4YVWB 5GZDA 2BBVA 2YU1A 3AM2A 3N9PA 4LBNA 5FZ8A 5A7NA 5FAXA 1QGLA 3O0XA 4YW6A 4CCDA 3JXSA 1W8TA 4L99A 5IK8A 4FVVA 5C8CA 1ZA4A 3BUCA 2EALA 2GMEA 3MLKA 4PLMA 1W2OA 3UL2A 1MS8A 3LE0A 5BXXA 3DV8A 4QXBA 4JC1A 1IZ3A 2CWSA 4MH0E 4AQSA 3RSJA 1VBE1 5JI7A 4CXXA 3OGJA 2IZWA 2ZCWA 4M0NA 1QH6A 1ZNPA 5I0UA 1REDA 4AFAA 2UWAA 3HD8B 2DFBA 1I5PA 1J1TA 1QNWA 3ZXFA 2Y33A 1H8TB 4LBQA 3MZHA 1YHFA 2J1RA 3WQ1A 1VBA2 3ACIA 3DXUA 2RDNA 2GMPA 2CSGA 1P8JA 1RUI3 1PMHX 2QKDA 4FPFA 5FV3A 5FYIA 4GH4A 2OKXA 4JGZA 4S2FA 1JOBA 1OFSA 1NA1A 3DGTA 2CYFA 4NUBA 3B01A 4YW1A 4MYEA 2HWB2 1COV1 4HKLA 4XJAA 4ET7A 3E5QA 4N7UA 1UMZA 4YGDA 4ZZ8A 1PMIA 4R4ZA 1FOD3 4DXRA 1DFQA 2DU0A 3WSOA 4GB31 1MS3A 3PUQA 4WZFA 5C7GA 1GZWB 4JHTA 1AR81 3I54A 5JIAA 1H2LA 2ZGKA 4GH4C 5J37A 4JGZC 2D5FA 2VG9A 3LSDA 2KD7A 3M2MA 1NA1C 1YFXA 1ENQA 2UYAA 4YM3A 1OXCA 4P08A 2R0FA 3EB7A 5JXGA 4OQ8A 3SHRA 1BK1A 1LKNA 2VGDA 4FP2A 1AR62 2X53S 1BEV3 1JU4A 1ND3B 5CFCA 5LRRA 1EV12 1LULA 3ATGA 1D0GA 1XE8A 1HLCA 4RN5A 2IWGB 4BHPA 1WA6X 2R1DA 5A80A 4P9JA 3O1MA 4XHXA 2Q1ZB 3DYOA 4FQ4A 2CGOA 3WT3A 5JVVA 2VXRA 1SBEA 1BCXA 1ZZBA 1JMUB 4YGEA 5K8SA 1AR73 1I5ZA 1VLNA 4AEKA 3IN9A 4FTBA 4JKKA 1XYPA 1W9YA 3A23A 1QJX3 2YDEA 3JQWA 4MOAA 3IAQA 1W8ZA 3H8UA 4RQPA 1J84A 5FZEA 3W9AA 1XRUA 2QFEA 4CDUA 4EN8B 2Q1MA 2DUOA 4IGOA 2D3SA 2WABA 1ULDA 4O65A 4Q4X1 2ES3A 5FY1A 5CEHA 1CPNA 4BMBA 1RB8G 1GZTA 2A6VA 3HQRA 1DQ5A 4QB1A 1ULPA 2R042 3DUIA 1R1A3 3RGBA 4LBLA 4WV8A 4MO3M 1XNBA 3D4KA 1QJU3 2VOWA 4RQPC 4YFZA 5F3CA 2JDHA 1QWRA 4Q0PA 5DAVA 4CDUC 3ZYGA 1XSRA 4ASKA 1HXS2 5FP3A 1BZWA 1ZZ8A 2BNOA 2JDAA 2RJ2A 3GNEA 2ZX3A 4KMQA 5DUVA 1T6BX 3BOWA 2JE9A 1VBD3 3KF3A 4FP3A 3BI3A 1LRHA 2P17A 4GWNA 4IV3A 5K4LA 4N7IA 1LCLA 1UU4A 1V70A 5D8AB 2XXZA 1IG3A 2EF6A 5ANQA 4I01A 1YLLA 3VZNA 3HT1A 1G7YA 1MQTA 3POEA 1NCRC 4OFGA 4AI1A 3VDDB 3H3UA 3ZIWA 2VNVA 4KWJA 5L7OC 5FYBA 1GYKA 2ZAHA 5FOBB 5LEJA 4WBBA 1PZ7A 2VTXA 3PUAA 4DRVA 1D7PM 1N1TA 1OA4A 1VMJA 5JR7B 4COZA 3VBOB 5C3RA 4D6SA 4AVBA 5JXHA 3FL7A 2EA7A 4IV3C 4AI0A 4ZU7A 1UZ0A 2WA3A 5C3SA 3N3HA 4CCMA 5CA6A 4LLOA 2VZQA 1XYNA 4P9LA 4JV4A 2VECA 2A75A 3WHUA 4FAGA 1AYN3 2TEPA 5IVCA 3R4UA 4AGVA 3I3QA 4QB6A 5FK8A 3E6BA 2VCCA 1XNCA 2XHNA 4HFSA 4EROA 1CONA 2OW4A 2XG3A 3AZWA 4QX0A 3D0JA 4AVSA 5C8CB 2BW8A 1UOFA 1AJOA 1X9TA 1YQCA 1C5HA 3ZMOA 2QDRA 4IV1C 3J7HA 3TOJA 1RJ7A 2P3KA 2O14A 1DYKA 1POV0 1OC1A 1QMJA 2JE8A 2ZABA 4FXKB 4KBBA 3NW4A 4QQPA 4D6QA 5A70A 3O0WA 2P4EA 4BU2A 3CU7A 1KS4A 4QGLA 4AI8A 2A6XA 3H42B 5J36A 2ADDA 1UIJA 2P5BA 3RI9A 4Q26A 4LBQB 2FZ2A 4GKYA 4HSJA 1G9CA 3MF9A 2Y0OA 2VZOA 3NV4A 4D7YA 3M3CA 2ET7A 2RV9A 1AR83 2ORXA 4FPGA 3ZFGC 4YZ3A 2VCMA 2VOTA 2X10A 1NA1B 1VBC3 1W99A 5D2AA 4COWA 3FWEA 2QTWB 4JHZA 3AVRA 3EJKA 2EXIA 3CJIC 3FFZA 1MS5A 2HEWF 4DUWA 4QKFA 3NAPB 3RYPA 3LSEA 3ZLIA 1OUSA 3IMMA 5BY5A 5G04L 1YYNA 2BGOA 2E32A 3EQEA 3PHMA 1ST8A 3I49A 2PXJA 3FC0A 3VDAA 1S0DA 3K75B 3WNMA 1ZZCA 2X05A 4CP9A 1GV9A 3OD0A 4QHBA 4YFWA 4JRLA 5FP8A 4EWAA 3MW4A 1PGSA 5FY7A 2OQ7A 3WQ7A 3WX5A 3SITA 1OA2A 4DUXA 1W0PA 2WAOA 3PU8A 1CZVA 1DQ4A 5JOYA 2ZGSA 3RS6A 5CFCB 1ZBE3 1YQ2A 1A8MA 1CAXA 5C3OA 3AMHA 4NHLA 4QU2A 3D0SA 5DAPA 5KXEA 2XVKA 1RUE2 5E1RA 2AREA 2X5IB 4YLZA 2DBNA 3AP4A 2X29A 4XDPA 5FYZA 2VQUA 3KHBA 4Q27A 1URXA 2QNKA 4TN7A 4UBHA 5A3NA 2W08A 2PHXA 1W28A 1AR61 1NQDA 2WZ8A 3K3NA 4PI0A 1SEFA 4OMCA 1LNSA 3UKNA 2XLGA 3ORJA 2BRTA 2OIIA 2YC4A 2W91A 5JDBA 4E8DA 2K46A 4GD4A 4Y1XA 2JDMA 1L7LA 1FMD2 2VOKA 3OG2A 4FOYA 1NT0A 3VV1A 4CDUB 1S0GA 4I0BA 4CXWA 3U75A 5FWEA 3CZUA 1SDWA 1GP5A 2YG0A 4HPKA 2RDSA 3SEEA 5JZGC 2JJ6A 3GBFA 1DQ2A 2J42A 1WMDA 2DURA 2WFPA 3WG1A 4W50A 2E7AA 1MEC1 1I1EA 1CJDA 2OA2A 3KLSA 1AXZA 3ZYJB 1W0OA 3L9JT 3NNFA 4NIAA 2R072 1VR3A 3PMEA 1X33A 5A33A 4F83A 1M06G 1MS9A 5FOJB 4I09A 4B4QA 5C5TA 2N7GA 1RHI3 2PHFA 2HJIA 2ZEWA 4K1ZA 4BDVB 1BVP1 2YC2A 5FZ1A 1GANA 1WW5A 2IC1A 3WNPA 1O3SA 2R041 2XR4A 3H3LA 3R6SA 4Q0UA 2JX9A 1XBFA 1Y7BA 4N53C 4CDWC 1RUC2 2B9UA 4XETA 2ZMLA 4Q4W2 4LO4B 4M4PA 4XZPA 1MQTB 3NMBA 5FZ9A 3KS7A 4YARA 1SLTA 2R32A 4WVVA 1AL22 1Q8PA 1EUUA 4LPLA 2C0ZA 4QHZA 3UYJA 4M4RA 5DZGA 4C1XA 5JMOA 3IB3A 5LZ6A 1HB2A 1RUF2 3HMYA 4OI0A 2RDRA 1JXNA 2WWSA 5IFPA 2XL9A 2W3JA 4QKBA 1Q3EA 3I4IA 1HJGA 2RMU2 1L7QA 1RUH2 2QCSB 2JIJA 4J1WA 2SBAA 2XUEA 3BYWA 3R4SA 5GZGA 4WVWA 3SH4A 3SLIA 1IS6A 1NY72 1OI6A 4Q4Y1 3CJXA 4JAAA 5HV4A 4CCCA 1C8NA 3RMYA 1CZSA 4XZUG 1GWLA 1ZZ9A 2H0VA 2ZGTA 3A21A 4DEVA 5HXVA 5GJ6A 4D94A 5K7PA 3RFRA 3WCRA 2HYKA 1RXGA 1UD1A 1ULEA 1OT5A 1TNFA 5JPMB 4LBJA 1VBB1 4META 1C1FA 4AHXA 1E5IA 1PX3A 1VALA 4KU7A 5FYTA 1Q8SA 2HBUA 2ZKLA 1G6NA 1F2NA 3KQ4B 3MLLA 4HKOA 3UJQA 2DVDA 5D1IA 3KMHA 2DV9A 3FUQA 1UW8A 1C1LA 4LXLA 5FZOA 3BTZA 3ILRA 3GJAA 3WEZA 3ZN6A 4MGSA 1BJQA 4WM8A 2EIEA 3I2GA 3P5BA 3PUSA 1ENSA 5GALA 5C4WA 5CKNA 5KHGA 2MHFA 2RM21 5CKMA 2Q8CA 3ZFFC 3B7MA 4XVHA 2FCUA 2J1AA 4B7KA 4ZKTB 3I2OA 3AMMA 3VD3A 1EP0A 1YUDA 1SBDA 3NO8A 1TG7A 2A73B 1RUI2 4Q0SA 1JZ5A 5FUPA 4S2GA 2J1UA 1UIKA 4XBQA 2VUDA 3SH3A 4BWOA 4NIDA 1LODA 1ALYA 3DN7A 5C4WC 3LA7A 4FFIA 4DY3A 1QXRA 5F3GA 4IE7A 4IERA 4OHVA 4CP9B 2PHTA 2ZHMA 1W90A 4BLJA 2G19A 1FOD2 4M01A 1MVQA 5FZDA 3D6EA 1JUHA 4PCRA 1WBFA 3DPRC 3OJBA 4QPIA 3J7MA 5E16A 2AR6A 2D6NA 2MEV1 3AVSA 3JD71 5FRAA 5KHIA 4YM1A 2GH8A 1BEV2 1IQDC 2RVAA 1V6JA 3WQ0A 1O5LA 3IBMA 1XE7A 1HRI3 2IXJA 3GCWA 3MFCA 5I0RA 1S0IA 3NJVA 5F39A 1IHMA 1MEC3 4YZ4A 1RUE1 3SCHA 2ZX2A 2D43A 4MHRA 1KFXL 1OLQA 1W2TA 4QPIC 2FZ1A 4FFFA 4ZU4A 2DUPA 4CVUA 4M3CB 1TZOA 3NJYA 4NJ4A 2V5YA 5BYNA 4ONUA 3SEPA 3N9OA 1OPMA 1AR72 4HPKB 4URTA 2PLV1 2WNVA 3SCGA 4HANA 2R043 3BIWE 1QJX2 3R0RA 4B1LA 4C0BA 3M3OA 5FXZA 1SMVA 3ZXEA 3H1YA 3ME2A 5A33B 1QU0A 5BNPA 5FMDA 1X8EA 1BHGA 1HQLA 3H7JA 1NXD1 3ZM8A 4BXFA 4Y22A 1JYVA 2WN3A 4DRRA 5M0TA 2WNVC 4UAPA 5LBBA 1R1A2 1J83A 2WT0A 4QX5A 1QJU2 1A34A 4QB2A 5HV0A 2MPFA 1V6IA 2ADEA 3AMQA 3RI8A 3TEXA 5LWBA 3OGRA 3IIIA 1ZRFA 2W68A 2BP6A 5F5CA 5H9RA 1R091 2VW2A 4XUPA 4GMP1 3MBWA 2KA3A 3EXUA 3I97A 1VBD2 3KZ4C 3OEBA 1KD7A 1NCQB 2Y0IA 4PLOA 4XILA 1ENRA 4IXLA 4Q4Y3 1RUC1 2FDGA 4DNYA 1H6XA 4DIQA 4UW3A 3SMHA 1BQPA 4ZS3A 2LM3A 4CUAA 1JOJA 4CEWA 1O59A 3FFQA 3D3AA 2VBDA 3KM5A 3MDPA 3POYA 1SHWB 4LNVA 1AL21 1NLSA 1VBB3 2GALA 3AC0A 1EY2A 1UX7A 3INAA 5FUNA 4CUGA 5L36A 4AGRA 3AFKA 1QJEA 4Y4YA 3AXDA 3SQOA 1RUF1 3LDRA 4Y26A 2AENA 3O1OA 1JYNA 3GALA 1JODA 2VZTA 4H3WA 5CG8A 2WDBA 4FOVA 2WYFA 2Q0AA 4PQ9A 2K9ZA 2RMU1 4UBGA 2XVLA 3AKPA 3KB5A 5A6ZA 4C0HA 1AYN2 1OMIA 2FBEA 1CESA 2EIDA 4IEYA 3W59A 3LEKA 3RZZA 3HQUA 1APNA 5CKQA 5LK7B 1US3A 2RM23 3IDCB 3N7MA 2WRAA 1NY71 3JCIA 4JZRA 3MLJA 4K8FA 1LAJA 4YW3A 1W6OA 4BLIA 2QQJA 3C7EA 4EN7B 1D0HA 4IEUA 3UGFA 3WY6A 1DDLA 4NAMA 1W39A 4QHOA 5FZOB 5DABA 4Q0VA 4JGYA 3ZN6B 1LHVA 4WM8B 4E27A 4XFBA 1IQAA 4RGKA 2VM9A 3N9NA 1KITA 3O1RA 2XLAA 1ODMA 3IDAA 2ARCA 4P9WA 2OPKA 2H0BA 4YRDA 4KH9A 2CL2A 3K48A 3ABZA 1U5XA 2FD8A 2GMMA 3LEMA 3WDUA 3BTYA 4NWVA 2ARAA 3BKZA 4LE4A 3ZXKA 2RJLA 2WN2A 4XUOA 1YJKA 4C8DA 2J1VA 1AR82 3EYPA 4XPVA 4XXPA 5FZIA 3J8F1 3T08A 2VZ1A 5IVJA 1VBC2 5DXDA 4PDWC 4RR3A 3LDBA 2VBBA 2WO3A 3A0NA 2DVAA 4NR1A 4P5HA 4CCLA 3T0DA 4XBLA 3K51A 1VPHA 2LRPA 1UN1A 2MEV3 3JB8A 3JD73 3MGUA 2DTWA 4LKFA 2VCAA 3POJA 4COYA 3AZYA 4W8JA 2EXJA 1H4GA 3WG4A 4N8MA 3FHQA 4R8HA 4XDQA 3WF2A 1YQ5A 2QQLA 4XF0A 3NRUA 1US2A 2YBKA 3NV3A 1YI9A 1AXYA 4QPIB 5LATA 3VL8A 3VZJA 4AEDB 2PHUA 4RR3C 2NM1A 1FOD1 3WV6A 1BKZA 1EAH1 4YPJA 2ETEA 5A7QA 4LHLA 3NNLA 4AFBA 2PLV3 1ZBE2 2QQKA 2GC2A 4LKSA 3CMGA 5CNAA 4ZY9A 3F2ZA 1LESA 1FXZA 1WGPA 2VOXA 2ZEXA 2ZGQA 3VGIA 3H9AA 4D6RA 1OQEA 1CAUA 1JH5A 2VQAA 4NMIA 5T5OA 4QGMA 3GM8A 1DLLA 5F32A 5IUQA 3RYKA 2YPJA 1SCRA 3GHNA 3MIHA 4OHWA 1SFYA 4ORFA 1DIWA 4RS5A 5J1XA 4FOQA 4CU8A 3AYAA 1LU2A 3UETA 4OUEA 2GN7A 1OHFA 3WP4A 4Z2AA 3UKVA 1Q5OA 3DKWA 1VB2A 3B94A 1SPPA 3ASIA 3H8XA 1PGW2 4DOUA 4K20A 4PHZA 3B9CA 5EIYB 2ZGPA 1PZ8A 3VBRA 4AE2A 3KHCA 2CV6A 2JE7A 1JYWA 5BNPB 3T0BA 3FUOA 3K4ZA 4AYUA 5F9TA 3RQ0A 1R093 3RPQA 4MXVA 1CZTA 4P9IA 4Y22B 3TEWA 2YU2A 5I0TA 4GULA 2IXIA 5ACA2 1H9PA 2W87A 1H1IA 1TE1B 2Q4SA 3GBWA 3THCA 1GOGA 2BV4A 4GKXA 1OVSA 3WNXA 4CDXC 4GA9A 3CDZB 3WD5A 5FYSA 1UZVA 1RHI2 1W03A 1OD3A 4QMAA 3N9MA 2GNDA 5EJ1B 4PT6A 3JU9A 3UGHA 1LR5A 1R1A1 3SC7X 3VN4A 5DDJ3 4XCAA 3LIHA 3GZEA 4AI9A 2BWAA 3I2FA 1JS9A 4K40A 4A7ZA 1S2EA 1YO8A 1OLMA 2JB8A 3A7QA 1TVGA 1HRV3 2XH6A 4CEWB 3T2PA 2A3XA 3MICA 4V2VA 2ARBA 2QQMA 2WO7A 3ZVXA 2VTXJ 2G9ZA 3WF1A 1ZM1A 2A3YA 2Y6KA 4IE0A 3HT2A 5IT6A 1JZ8A 3KCXA 1WCQA 3OUJA 1D2QA 3PTYA 1SACA 3CZJA 3T1LA 1PVXA 5A7PA 5FPBA 4G4FA 4YW2A 1O4TA 3PU3A 1FI2A 2ID4A 3O0VA 3SCFA 4XJ8A 4Z2WA 1AYM1 3VLBB 4CEYB 2C26A 2HH9A 1IS5A 3WNKA 4AFMA 1Z78A 2ET1A 1UKRA 5DQ0A 2ZGRA 5DUUA 2B39A 3VBSA 3I7DA 5FK7A 4ASLA 1PM7A 1LOGA 1W06A 4XFFA 3WP6A 4A44A 4LO7A 1Y9QA 3BB6A 2CTVA 3PURA 1HN1A 4N43A 1UF2C 4UW5A 3AKQA 4CP0A 1OFNA 1W6OB 1YNAA 1IPJA 1SDDB 4A3XA 1HB1A 3H50A 4X8NA 4DQAA 1K12A 4KG0A 3BVCA 2IVIB 1AYN1 3OB8A 4JGYB 1PK6C 4R9DA 3J8F3 4HT1T 1V9U3 4H2AA 4L2NA 3VBSC 1OQ1A 1QXPA 4MZUA 4K21A 3ZXJA 3OBAA 3NKTA 3ACLA 4N43C 5JUVA 3E6DA 4I0WB 3ZSKA 2VULA 3BCWA 4OHXA 1YFWA 3T2OA 3ON7A 1U0AA 5IFTA 3I3MA 5FO7B 3WW4A 4FFHA 4QM9A 4OMDA 2BFUS 5IK4A 3WVJA 1XU2A 1XNKA 3NVCA 4K3UA 5FPAA 1KDMA 5HBAA 2D3RA 4RR3B 4YZ5A 5LEKA 4HKWA 3TWIA 1LOAA 1EAH3 2WS93 3O14A 3E5XA 4BIFA 1HV0A 1RUG1 1CD3G 4CDQB 3OSDA 2LUWA 4WVZA 1UL9A 2PYTA 4P00B 2RJKA 1VBC1 2BTVC 3PUIA 2VD7A 4INDA 5AC91 2VVFA 1W8WA 3FN9A 4YW5A 3OPZA 2D44A 4F3JA 4IW3A 4Q1PA 2PAKA 5CVRA 1TEIA 5LA9A 5FY5A 4OQ9A 4MG2A 2NQYA 1FV2A 1KJRA 3IDEA 3VHPA 2EICA 4B4PA 4YSFA 4EN9B 4OI2A 2C4XA 1CAUB 2W94A 3K3OA 3VKMA 4WM7A 4EZ4A 4XBNA 2YBSA 2LALA 5APAA 2BOIA 1UAIA 2OUJA 2VVDA 4RS5B 2IXHA 4FPCA 1GQHA 1ZBE1 2K0GA 4LLFA 1HRI2 2ZZJA 4RGGA 2YROA 3WF4A 1VAMA 3LEGA 1NLQA 2E6VA 1MEC2 2VVEA 4W6WA 3RZGA 5J3UA 1B35C 1SLIA 2I07B 4LUKA 1SPPB 4IE4A 3E6CC 1R1ZA 4WM7C 4BCUA 2DU1A 5J09A 3VBRB 4HBNA 2PA7A 5GM0A 3VBFC 4CZSA 4IEXA 3WOGA 2ILMA 2ENRA 5T3NA 4C91A 1W04A 3AJZA 4XAEA 3WNLA 4A45A 5BNOA 2FHRA 1PX4A 3UKTA 1TQ5A 5IATA 2O0OA 2PN5A 4CUBA 3T2QA 1C28A 4DPNA 1F8VA 1PGW1 5F5IA 1NCRA 1QJY3 1S0JA 1PIV3 3G6JB 4XQWA 5JSRA 5FPLA 1BVVA 2YGMA 3MV11 3HNBM 2BWCA 5JMCA 1CJPA 5L7OA 4UW4A 3E5UA 1QH7A 3WW1A 3ZPOA 1GSLA 3FJSA 2GP3A 2GU9A 5ACA1 1W6PB 4FBFA 5BNOC 2R16A 1XOYA 5CYYA 5T5JA 3RJRA 2FDHA 3W5MA 1ONAA 4QX1A 3UJOA 1AX2A 1WUVA 2JEMA 2ZGMA 4Y5SA 4MV2A 2TBVA 4BQ5A 5A3TA 2Y6LA 2QVSB 4WVMA 2WBKA 4NHXA 1RHI1 1CGPA 3H7YA 1AYM3 4GALA 4LKDA 3JQXA 3K4AA 4CP2A 4EYUA 1G9DA 2J1SA 1C3HA 4JTNA 2JG8A 1C5IA 1H1AA 3M7AA 4LQRA 3P3NA 4A4AA 1F15A 2A7AA 2R30A 4HSLA 1GP6A 4Q4Y2 4I3PA 4DINB 1OD5A 1FYUA 1AJKA 5DPNA 1SLLA 1FT9A 5JPNB 1LOBA 3HN1A 4IV1A 4TLFA 4HONA 4YYOA 3V56A 3ST7A 5A3LA 1VBB2 3HPNA 3TRSB 5H9SA 3PNAA 5IJRA 1YFUA 2HWF2 2IFWA 2JG8C 2R7EB 4HN1A 4MXWA 4UOJA 4AGGA 2TNFA 2Y6GA 3UESA 3URFA 4YWAA 1QEXA 2ZBJA 1OOPA 3OD4A 2W92A 4XF9A 5IVFA 5BUVA 1QKQA 2W95A 2WNUA 3LF7A 2BEOA 3ZFGA 2YFUA 2RM22 4CCEA 1RUNA 4MX3A 5FP7A 3DCQA 3IKWA 4GWIA 5EJ3A 3CJIA 3T09A 5E6HA 1Y3TA 3VD4A 2YZ4A 3VHOA 1H2KA 1OOPC 2VO5A 4FT8A 3WUDA 3OOXA 4UFHA 4FPJA 1ZRDA 3RDIA 5C3QA 2VZPA 3AMPA 4O9GA 4GH4B 1RUG3 2AEYA 4ZS2A 3UNPA 4JGZB 2WNUC 2FQPA 3ITQA 2VMDA 2VC9A 4Z07A 1BBT3 4XJZA 4P02B 4BYYA 3OF1A 4I02A 2XDVA 4LJHA 1W2AX 4XMAA 3WG2A 5AC93 3UK9A 4Q1RA 5KR7A 1AL0G 3Q8AA 1H30A 1NQJA 4HOOA 5FCCA 3U10A 4JKMA 4XFIA 1JHJA 4BK4A 5J96B 3SKJE 1S2KA 1XSQA 3NV2A 3RVHA 5H9PA 1EYBA 4KWLA 4W65A 3S5AA 2G1MA 5A3PA 3POWA 1LU1A 4Y1UA 4DFSA 2WZEA 2IXKA 2MEV2 2JDNA 3I3DA 3JD72 1V0AA 5FIXA 4DXZA 1AVBA 1XU1A 3LOIA 2BPA2 2HWC1 4LKEA 5IYYA 1UU6A 5A1AA 1UY1A 2RS11 3MHZA 4P9XA 4HZFA 4PBPA 4COVA 5DG1A 5K0UC 3MIDA 1S55A 5FO8B 3EO6A 2A71A 2BUKA 2ZKNA 4WM7B 3VKLA 1RXFA 2Y8KA 1H2MA 2EAKA 4GWMA 4NVPA 5LA2A 4GQ7A 2GC3A 1XQNA 4IGPA 2BOJA 4KL1A 5JZGA 1F4AA 2PLV2 2Z4FA 1JYXA 4Y1ZA 4XHBA 3RWKX 3JUUA 2P34A 4RQPB 1RUJ2 1XPWA 1V6LA 4S2DA 5L19A 2C9KA 3BTAA 3POBA 3ZYBA 4AQ6A 2W39A 4LHSA 2VR4A 5E88A 5FYMA 4Z8BA 5GLWA 3OY8A 2PTMA 3VBHC 3S57A 2Q8OA 4YM2A 3PJQA 4HMZA 4AAXA 1B09A 1HRI1 4PIZA 4XUNA 5FZFA 1UOBA 2OZJA 2Q5TA 4B8EA 5FMCA 5ACA3 3APBA 1LB2A 4N53A 4QQOA 4CDWA 4RFT0 4Z92B 5T52A 4M3CE 5FY4A 5FZ6A 2GP5A 3ACGA 4OI4A 3AKSA 1WCKA 1PNGA 3ZYFA 3S0MA 3AYDA 3AP7A 1DBNA 1NCRB 1VMHA 3AZVA 1LJ7A 4Q29A 5D21A 4QPGC 2DVGA 2FMDA 3AL5A 2RS33 5L7OB 1R092 5L9BA 3OPTA 3BIEA 1CAWA 3NNJA 1S2BA 3RNSA 3ES1A 4GJYA 4JDNA 1EUTA 3G7DA 4IV3B 4AVCA 4OVEA 2W5FA 4UFMA 4CU9A 1DLCA 5FYYA 2BZDA 4LA3A 2WZPP 4CA9A 2HWE3 1ASJ3 4H7LA 1NKGA 3VDCA 1YI7A 2WLPA 2XJPA 2JICA 2NLRA 1K5MA 2YFZA 1WCSA 3LDKA 3WNOA 5FREA 3ZFEC 4ATEA 5DDJ2 1W05A 2JG8B 5IAVA 3X29B 5A6YA 3ZN5A 1AX0A 1BXHA 1VP6A 3B3QE 5DZFA 4Q8KA 2ZEZA 3K2OA 5AFEA 4IV1B 1HRV2 4O7XA 4ZU5A 2NN8A 1LEMA 5LK5A 1I6XA 4A6OA 4MGTA 2QQUA 3M4FA 1K5MC 2WNEA 2Z5WA 5AVAA 3AYEA 3AKTA 3FBMA 3C7FA 2BBAA 5F3EA 5FXXA 3VD5A 4MXWB 4C90A 5FY8A 1UZZA 1OOPB 3AZZA 5EHDA 1J3QA 1Z0HA 1O91A 3WDYA 2GZWA 1ZRRA 2DWRA 1IGOA 1X36A 5E8AA 3ZKYA 4XACA 3ZFFA 1VE0A 3ZFGB 5DUXA 2YB7A 4X6RB 4BA6A 2EIGA 2HWF1 2PAMA 4JX0A 2A1XA 4UWDA 3AKRA 2GDFA 3CF6E 4AZZA 1HIXA 2XQXA 1LHUA 2RHPA 4A41A 2JDUA 2WFF1 4O61A 1DU3D 3CJIB 1WA4A 1ZBA1 4HLTA 4XF4A 1YIPA 2QQWA 4BK5A 3W58A 4I30A 5AVPA 4YG6A 3W5NA 1RYYA 3J8F2 1V9U2 4UFJA 5FKCA 4A2UA 1W6QA 5FR3A 1CWPA 1S0EA 5JSPA 1BMV1 3H0OA 3ILFA 1HX6A 4NAOA 4YNIA 2ZGUA 2JDKA 2Q1FA 2XB6C 3M3QA 4C1WA 5T54A 5F3IA 2D93A 4BIOA 3GBGA 4FI9A 4LK6A 5I0SA 4BQ2A 2HWC3 5C9AC 1O8PA 4NHKA 3QLQA 1KEXA 3DPRA 4TXWA 1W9SA 1X50A 3VZLA 2RS13 3T1MA 1W8HA 3I3EA 1ULOA 2JG9C 1N1SA 3KWVA 3ZX7A 2HYXA 3ETQA 4LMFA 2D3PA 2WZR1 2XKPA 2DF7A 3U78A 1UU5A 2P3IA 1SFNA 1EAH2 1QQP3 1GZCA 2D97A 4TSVA 2WS92 3IPVA 4NHMA 3PLQA 4BMEA 2RR11 4QQ2A 1DP0A 3O1SA 1CAXB 3ROUA 5A3UA 1M4WA 1RJ8A 1FPN3 2H6BA 3S6PA 1CAVA 4YVSA 1JYIA 1WMEA 1POV3 4JKLA 1DYPA 1F5JA 1UX6A 1Y9GA 4K1YA 4IEWA 4LK7A 5T5LA 1GWKA 1MZ6A 3LIGA 2V73A 3BU0A 2C5DA 5JZGB 2B7YA 2W0XA 2RS51 2BNNA 4CCJA 1QHDA 2ZHLA 4GMP0 4QD2A 2UWCA 3CL1A 5GLUA 3VHRA 4Y20A 2BGCA 1O4ZA 1GBGA 4G9SB 3OUHA 4YVSC 3NNGA 2BERA 1HW5A 4FXGB 1T6GC 4IE5A 5T5PA 2Z42A 1GKBA 3OY8B 2ZHNA 1AZDA 4LOSA 3TYJA 1LECA 4CCKA 3FLRA 4KGGA 4XF1A 2WQ4A 1GMMA 1Q8VA 2WO1A 3SXWA 1C8M1 3NNMA 2QUOA 3Q9OA 1JZ7A 1ZREA 4OHYA 4N53B 2I2SA 2ZZQA 1PO21 1RUJ1 1UOJA 2XBO3 3B9IA 1J3PA 3MF6A 3MV01 4NIIA 4CDWB 4XJ9A 1IPSA 1UCXA 4S2HA 3WDWA 1AUYA 1ND2A 1EPWA 1S1AA 2X8KA 5LA0A 1XJAA 5I8YA 1W6MA 5FDBA 2CGPA 4AR2A 5BNNA 5JXJA 1CAWB 4Y3OA 3PIGA 5SV8A 4L11A 1ZZ7A 2OPWA 2OX0A 1G86A 3I2KA 3WG3A 5FPZA 4B4RA 3LFIA 2YUEA 1HJFA 2WINB 1QJY2 1H1MA 1W6NA 1PIV2 4QU1A 2Z79A 4QDRA 3N9QA 4BQ3A 1UXXX 1ND2C 2ZX0A 4NOTA 4H55A 2VCBA 4IESA 4OULA 4OI1A 4BZ4A 3I3BA 5BNNC 1H2NA 3LA2A 3USSA 5DAQA 3WF0A 4CRQA 3N4MA 1FX5A 1ULFA 1Z7S1 5F6LB 2KM2A 5FMOS 3TNQA 3WLUA 5LCWL 1N1YA 3DKQA 2R061 4AHWA 1AYM2 2AUYA 5A1FA 3HOBA 4LBOA 2UURA 3ZSLA 3TBDA 5SV5A 2GSYA 4ISRA 2CWMA 4L97A 4RYDA 4Z82A 5DDJ1 4D3WA 4HETA 1N47A 1TNRA 2HWF3 2B4KA 3EHKA 4K8RB 4XW3A 4Q2FA 5GZCA 1QIQA 4LHKA 5JOWA 1N1VA 1KFUL 4LITA 4LOTA 4QPYA 2WFF3 4TZDA 1ZBA3 1MACA 1HRV1 4EN0A 1N3PA 4URAA 4K9SA 5F2SA 5F7UA 3VKFC 5FZ3A 1HQNA 1VAKA 1X82A 2UU8A 4RGAA 4WZCA 1TME3 2R6QA 4P5YA 1ODNA 1R083 3C8XA 5JIUA 3ZFFB 1RUD1 4XE9A 1S4CA 3T3YA 2VNGA 3I59A 1GNYA 1O6UA 3CHXA 2EIBA 4LIUA 4PIYA 2W52A 5DN2A 4AVVA 3HQXA 1QJFA 1SBFA 2XJSA 1UYPA 1PO13 4IEZA 4PF5A 1NZIA 4QWNA 2HLEA 1C4RA 5C4WB 2ZOEB 2XUMA 3N7JA 2WA4A
chains in the Genus database with same CATH topology
1W6QB 1WLTA 4PDWA 2QQPA 2BQPA 2VUJA 4E9KA 4I2OA 3VKNA 2QE3A 4PIXA 2WZR3 3VBUA 2MNGA 3MW2A 1J59A 3WW2A 4EJRA 4JDOA 3D82A 1RUG2 1KXGA 4A7KA 3PVNA 2RR13 3HWJA 2DCKA 1V9U1 3DPRB 5A32A 1BBT2 3OBRA 4LO6B 2XWBB 4E4SA 4YVWC 3LKJA 2ZTNA 5AC92 4IETA 4QGNA 1NZCA 3MFAA 3VBUC 2Y38A 2JKBA 2PQQA 2RS53 1UKGA 4HK8A 3QH6A 2ZMKA 4JQRA 1AXKA 2G9GA 1CAVB 4YVSB 3V0AA 2JDZA 3MPPG 1U5YA 2WS91 2ZX1A 3J4UH 2BFUL 2D6MA 2XPJA 2WSUA 1DGWA 1H8TC 2GAUA 4FTSA 1C8M3 4E4ZA 2C1FA 4Y20B 1MR5A 2SLIA 1PO23 1RUJ3 3DF0A 3FE5A 4AF9A 4BE3A 1A3KA 2D6LX 2WNVB 2DFCA 4FOWA 2GH2A 3R4DB 5HCBA 5FLIA 2WSVA 1ND3A 3AP6A 4CDXA 3FLPA 3WZ1A 2E7TA 2B42B 2NMOA 1U12A 5CFDA 1CQ9A 1W6MB 4B3NA 5KHHA 2PHDA 3WW3A 2ZGNA 4TYSA 1LGBA 3ALQA 1DGRA 5FQ0A 1GFF2 1ND3C 1Z7S3 1DQ1A 5GZEA 3V65A 2RS32 2R063 1GLHA 4IEOA 5I8SA 1XNDA 1WD4A 2HWD3 5CFDC 1MVEA 2A70A 3M3IA 3BOPA 3HAGA 3V0BA 4XFGA 3H1MA 3N7LA 3U11A 3AMNA 4AI2A 1RVF3 1QJY1 2ZHKA 1PIV1 3AK0A 2HKXA 3AXEA 2HWE2 1ASJ2 1AR91 1CR7A 1LGNA 3OBTA 3ZO0B 2EXHA 2BYVE 4LO8A 1QNYA 1NYWA 1OSGA 2Z2SB 2DVFA 3AZXA 1RUD3 5EZWA 3AJYA 1WLDA 3LB9A 1AX1A 4LR4A 4J1XA 1G9BA 3U4XA 4AFDA 3WDXA 1RC6A 4YZ1A 2ZMNA 3TAYA 5FPXA 4ITCA 4AVTA 3B5LB 2JENA 2DCJA 3THTA 1PK6A 5I93A 1FATA 1S0BA 4IEVA 2XHKA 3IIAA 2O8OA 3O5SA 3QOPA 3VUOA 2G9FA 3I59B 4D69A 5BV6A 5FO9B 3QCWA 1D2SA 5KXCA 3FZ3A 1YCIA 4KG8A 3U0ZA 3ZXLA 1CX4A 3S7IA 4HVRA 1FAYA 3VDDC 4PDWB 1KJLA 1UPSA 1DQ0A 2B45X 2DCZA 4FPLA 2D40A 3JB4C 3FX3A 4OLLA 2B8MA 4V1PA 3VBUB 3VBOC 3O7OA 1HQWA 4ES8A 2D98A 1FNYA 1D4M2 1WW4A 5I91A 1OPOA 3RWNA 1O3RA 3FBYA 3ELNA 1RITA 3PJYA 5A32B 3ZXDA 1GQGA 1HKDA 1OLRA 3ZXAC 1LENA 5DUWA 4D7SA 2DYCA 3GHMA 2Z69A 4XXAA 2XGXA 1PHMA 2IFRA 1JHNA 2HEVF 2HWC2 5C8CC 2B5HA 1L3JA 2VNOA 2ZACA 4XFHA 1OQDA 2R1BA 2GC0A 2RS12 1BBT1 4NO4A 1RL3A 2CAUA 4U36A 2DCTA 4TWTA 3WHTA 4RA0A 5CIRA 3VZMA 3V0AB 1QQP2 4DS0A 1Y43B 2VPVA 5GZFA 1LHWA 1WLWA 4N9IA 4QM8A 3VZOA 1B35A 3ILNA 3NAPA 1LHNA 1FPN2 1QOSA 2YMZA 4X8PA 2NMNA 4FAHA 4QQLA 2ZA9A 3VBFA 4ATFA 2JECA 1W2UA 3MW3A 1RINA 2A6WA 4HN0A 4JTOA 4PJYA 3AFGA 3TN91 3NAPC 1SLCA 4AVAA 4CDXB 4DMIA 3NL1A 2YYOA 1LEDA 2X5IA 3BPZA 5CFDB 5EYYA 4BH9A 3IM0A 1YJLA 4MSVA 5KHKA 2UYBA 3PVEA 2XBO2 3H1WA 5FQ0B 5CFCC 3RRDA 5HCFA 1JW6A 2D5HA 1RMU1 1AR93 3MIBA 3O12A 2IXCA 1A78A 5H9QA 2X5IC 4RL7A 2GN3A 2ZX4A 3BALA 1PNFA 1JN2P 2ZS6B 3WUCA 1TMF1 4Y1VA 4EWDA 3V0BB 3WINE 3MPBA 1H8VA 1C57A 5K9YA 1J3RA 3KT1A 4XTMA 1OKQA 2AGSA 1PVC3 2RS31 4GIQA 3WDVA 5FFOC 3JZVA 2WKKA 1CPMA 5E89A 4RHV1 4R9CA 4ES9A 3JBG1 4Q4V3 4MUVA 3B00A 1LOFA 5A3MA 4KQ7A 1DQ6A 1V6KA 1VAVA 2HWE1 1ASJ1 1QF3A 1YIFA 5FLHA 4H14A 2GNMA 4LE3A 1SLBA 1PK6B 4QQHA 1DZTA 4LUMA 2D7FA 3VBSB 2VY0A 1S0FA 3USUA 2PELA 1LHOA 3E97A 1QJZA 4SBVA 1LOFC 4AI3A 4N43B 3QBQA 3IT8A 1VIWB 4IQPA 2WFF2 5C6CA 2DVBA 4A7YA 1VRH2 4LT5A 1ZBA2 3TB0A 2JXAA 5FTTC 1A8DA 3OCPA 1DG6A 1SCSA 1TME2 2WQZC 1R082 4HVQA 1GNHA 4XOGA 1MQTC 1V6OA 3NWKA 2PHLA 1BMV2 1MZFA 1MZ5A 3NJZA 4DB5A 1VBE3 2XJQA 3CEWA 3ES4A 4FCAA 2OYZA 3FMGA 4N9HA 1PO12 4XF3A 2VMHA 2TUNA 4M3CF 3KD4A 3SH5A 2O8QA 1O3TA 4BPZA 2H6CA 4FQZA 3THPA 4NN0A 1RGSA 2GNTA 2A6ZA 2YXSA 5HI0A 2WZR2 3POSA 1CN1A 4LBKA 2D6PA 2D6OX 4P9GA 1COV3 3ZYIB 4AHZA 4SLIA 3GYDA 3LZZA 2RR12 2G4IA 4W6XA 4E4DX 1U5ZA 1WD3A 4MLOA 1D4M1 5K0UA 1A6CA 1AF9A 1G9FA 4GB33 2VUAA 2CGNA 3H3ZA 1YRZA 1H0BA 3OYWA 4ASMB 3VZKA 4DY5A 1PGL2 1SLAA 1S0CA 5LRSA 2BNMA 1QXJA 2RS52 1VBA1 1DZQA 3S7EA 3TN93 1B35B 1N3OA 4LO5B 3GZTB 1ULGA 2OUHA 1X8MA 4XJWA 5EV7A 1NG0A 1V00A 1ZYBA 2PHRA 3VBFB 1QQP1 4JVAA 5GKAC 2HWB1 5JCTA 2VW1A 4AK3A 2EXKA 5T55A 2VOVA 1C8M2 3KCYA 5B2GB 1FPN1 2Q30A 5GLVA 1PO22 4M00A 1FNZA 2WL1A 1POV1 1WCDJ 2FMYA 4AEMA 4QPGA 4XFCA 1NE6A 1RMU3 2XJTA 4NWWA 3RJ2X 5BNOB 4Q4X3 1QOOA 1TMF3 3N7KA 1QDOA 4IEQA 2DCYA 1EV11 4RD7A 4JRAA 3HIFA 2E63A 3ZXGA 1O5UA 2C9AA 4KWKA 3RG0A 1DGLA 3QACA 3MIFA 3ZFEA 2QJVA 4M3CA 4RHV3 4R4XA 5JWPA 3JBG3 2XBO1 3DL3A 4E2SA 4XMIA 1Z7S2 2WT2A 4COUA 1AHSA 4WVMB 2QDNA 4MGIE 2AYHA 2E7QA 1G9AA 4CYDA 2R062 2R0HA 4GXLA 1JTZX 3ZSJA 5KC5A 1DF0A 2HWD2 1KRIA 3B93A 2A3WA 4XEZA 4LULA 3CO2A 1RVF2 1WW7A 1REFA 4QT6A 4MGZE 1DHKB 1Q8OA 4FPEA 2K2SA 4RSUA 3LOBA 4XTPA 1HXS1 2GC1A 1H4HA 2VH9A 1PZ9A 1RUD2 3AX4A 5CG9A 1RTVA 2E53A 3L2YA 3USUB 4I0AA 3A4UA 3NV1A 3AB0A 5C8WA 4D7TA 3CNAA 2WC2A 1NCQA 2ZJCA 1Q43A 1V6NA 2ZGOA 3V64A 4OUMA 5CAZA 3RMXA 3GZAA 3ZN4A 2WNUB 2UY9A 3IDBB 4EN6B 4ISQA 1F9KA 5FMOL 2UY8A 4L9BA 4QXKA 1SQ4A 5FLJA 2E51A 4IEPA 3SNMA 1VRH1 3LWCA 5JOZA 2B46X 1NCQC 1X7NA 3J9SA 4AHYA 2RE9A 5C9AA 1TME1 3IWZA 3KCCA 1R081 2XWJB 3PVOA 4MGKE 1IKQA 1D4M3 2JG9A 2XJRA 3RYRA 4R52A 2CNAA 1N3QA 1RIRA 3MIGA 1HDKA 2XJUA 4AEJA 2GNBA 2E9QA 1PO11 4LHNA 4Z1VA 4B29A 4KU8A 2PFWA 1RUOA 1VBA3 4U2AA 4P9YA 5K0UB 2IXLA 2WIIB 3ZDSA 4BOWA 3KT4A 2VW0A 1NLRA 1I9RA 2P2KA 1ZVFA 1LOEA 2YY1A 2R49A 2CY6A 3OYWB 3ZYPA 3ZMNA 2DTYA 2HWB3 1NOVA 3LAGA 3NSTA 1EPZA 1FV3A 3ZSEA 2UWBA 2KXLA 3I8TA 1YFYA 3QD6A 5F5QA 4K7JA 2QZ2A 4WM8C 1PGL1 3WR0A 4JCKA 1NXMA 1DGRN 4X6QB 4HK9A 3AP5A 2F4PA 4B7EA 1AR63 1QOTA 4FPOB 4JDMA 1EV13 2WT1A 3KSCA 5JSOA 4FO9A 4QPGB 1MS4A 4AEDA 1IOAA 4MVTA 2WJSA 4HL0A 3ZIXA 1NE4A 5BNQA 1XYOA 3ZYRA 1ZZ6A 4Q8LA 1MS0A 3AYCA 2A6YA 1WW6A 2HEYF 4XQ4A 1IS4A 4CP1A 1CVNA 1OA3A 5EYXA 1O4YA 4AFCA 2VMIA 4AEDC 2AZ5A 3ZFEB 1HV1A 4HVOA 5F6KA 2JD4A 5ABJA 3UV9A 4YGBA 4XJUA 3SISA 5CB7A 4LBMA 2D6KA 4O9EA 3ECQA 1AR92 4G3YC 2PHWA 1FMD1 3LCPA 3FLTA 1K5MB 1JBCA 1HXS3 2XL7A 5ABJC 3OGGA 2I74A 4IL7A 5F1RA 1CIWA 2OVUA 3WXPA 2AH2A 1PVC2 2XLFA 2R071 2P3JA 5EXOA 2HWD1 1UPIA 2P37A 5AFBA 3TNPB 1LGCA 4Q4V2 5BNPC 2XKOA 4LBQD 1RVF1 4MGYE 2NPIA 2ZPXA 3GF6A 1WBLA 1JYCA 2XVGA 4YW4A 3U07A 4EV0A 1VJ2A 3VL9A 1VRH3 4PLNA 2Y26A 4Y1YA 1IS3A 4L8QA 3T2TA 4Q0QA 4Q4W1 3VBHA 4K6BA 3EBRA 1REEA 2V09A 2ZGLA 3ZSMA 3AP9A 5JLVA 3L2HA 5CBLA 4R9BA 3I2DA 5GLTA 5JOXA 5KXDA 5CADA 2DUQA 4I3GA 5C9AB 3B02A 2BVVA 5L73A 4YG0A 4CEYA 2JG9B 3B69A 4YVWA 3D5OA 5C33A 4CEWC 4OHZA 1RUH1 2YC0A 1VBE2 5DZEA 1J58A 5JI9A 4YM0A 1O7FA 1JUIA 3N36A 4OUSA 4Y24A 3LGRA 2YGLA 4ZXKA 4BM8A 3BODA 1BYHA 1F5FA 4CEYC 2CAVA 4AQ2A 4F7ZA 4P14A 3LA3A 3PMSA 5EWSA 3R05A 4PBOA 3C3VA 3VHNA 1COV2 1H8TA 4N90A 3IPVB 5I8TA 3HR9A 4AXOA 4FPHA 3KGZA 4FSJA 4H7MA 4AQTA 2VU9A 4GB32 1ULCA 3MYXA 1GR3A 1XXNA 4E2QA 1QY4A 4JGYC 1DZRA 1DGWX 1H9WA 2EAAA 1O3QA 4XIOA 2O1QA 3P3PA 4CTEA 3KT7A 3QH7A 4XFAA 1KS5A 3WDTA 4FTEA 1RUI1 1IPKA 3ZPYA 3TN92 1GZWA 1YWKA 5TSWA 4M0HA 4CDQA 5KHJA 1KDKA 2F6BA 2VNRA 2BVBA 3OTFA 1RUE3 5IK7A 3KGLA 1Q8QA 3A0KA 4XIKA 1LOCA 2YV8A 1VB4A 5KC6A 5T50A 1J1LA 4R9AA 5J98B 4AWDA 4CDQC 4BQ1A 1RMU2 1MZEA 1ND2B 2OZ6A 4YG3A 1FMD3 1I3HA 3NKGA 3PVBB 2LTNA 1KQRA 5BNNB 4FPKA 4E2GA 4Q4X2 5ABJB 3GZUC 1BEV1 2NP0A 1TMF2 3MEPA 2VQ0A 1W6NB 1V6MA 4Y5Z0 1QDCA 1G8WA 4FPYA 1D4VB 1GICA 2R073 2ATFA 3WCSA 4NPRA 4RHV2 3BU7A 3M3EA 3MI8A 5KBFA 5IK5A 3JBG2 3WP5A 5GLZA 1ZRCA 1AR71 4RS5C 4DZGA 1LTEA 1MS1A 4UW6A 2WLQA 4GMP3 1IKPA 4L92A 4W6YA 1QJX1 3M8LA 2I45A 3J26N 4UXAA 4XYXA 1Q56A 5KXBA 1RUC3 1ZX5A 3HBZA 5BPXA 2PAEA 5JAXA 4Q4W3 5EFUA 4EWEA 2EVXA 2NZ9A 5CU1A 3S30A 3VBRC 1GZ9A 3MIEA 4AW7A 4F8AA 2ZAAA 3CLPA 3ENRA 4OZXA 2ERFA 3M1HA 5J7MA 1AL23 1W6PA 2A5ZA 4KNCA 2YHJA 2VMGA 5DG2A 1PVC1 2QZ3A 3KQRA 1QJU1 5D8AA 1E57A 5J48A 4YGCA 3IMNA 1RUF3 1ENXA 4LA2A 2XJVA 3N35A 3VBHB 4DRRA 1U5IA 3VDDA 4J6GA 4Q4V1 4LEJA 2RMU3 1GNZA 1RUH3 3M70A 1WMFA 3FHIB 1VBD1 3VKOA 3VBOA 3C2UA 4XQDA 1WLCA 4LTAA 1F31A 1UZYA 4AG4A 1YXWA 5D8AC 5FBZA 2ARXA 3D8CA 2NYYA 3WP3A 4KGQA 4YVWB 5GZDA 2BBVA 3AM2A 4LBNA 5FAXA 1QGLA 3O0XA 4L99A 5IK8A 4FVVA 5C8CA 1ZA4A 2EALA 2GMEA 3MLKA 4PLMA 3UL2A 1MS8A 5BXXA 3DV8A 4JC1A 1IZ3A 2CWSA 4MH0E 4AQSA 3RSJA 1VBE1 3OGJA 2IZWA 2ZCWA 4M0NA 1QH6A 1ZNPA 5I0UA 1REDA 4AFAA 2UWAA 3HD8B 2DFBA 1J1TA 1QNWA 3ZXFA 3MZHA 1H8TB 4LBQA 1YHFA 3WQ1A 1VBA2 2GMPA 2QKDA 4FPFA 1RUI3 4GH4A 4JGZA 4S2FA 1OFSA 1NA1A 3DGTA 2CYFA 4YW1A 3B01A 4MYEA 2HWB2 1COV1 4HKLA 4XJAA 3E5QA 4N7UA 1UMZA 4YGDA 1PMIA 4R4ZA 1FOD3 1DFQA 2DU0A 4GB31 1MS3A 4WZFA 1GZWB 1AR81 3I54A 5JIAA 1H2LA 2ZGKA 4GH4C 5J37A 4JGZC 2D5FA 2VG9A 3LSDA 3M2MA 1NA1C 1YFXA 1ENQA 2UYAA 4YM3A 2R0FA 3SHRA 1BK1A 1LKNA 2VGDA 4FP2A 1AR62 2X53S 1BEV3 1ND3B 5CFCA 5LRRA 1EV12 1LULA 3ATGA 1D0GA 1XE8A 1HLCA 2IWGB 4BHPA 2R1DA 4P9JA 4XHXA 2Q1ZB 4FQ4A 2CGOA 3WT3A 5JVVA 2VXRA 1SBEA 1BCXA 1ZZBA 4YGEA 5K8SA 1AR73 1I5ZA 1VLNA 4AEKA 3IN9A 4FTBA 1XYPA 1QJX3 2YDEA 3JQWA 4RQPA 3W9AA 3H8UA 1XRUA 2QFEA 4CDUA 4EN8B 2Q1MA 2DUOA 2D3SA 1ULDA 4Q4X1 2ES3A 1CPNA 4BMBA 1RB8G 2A6VA 1DQ5A 2R042 3DUIA 1R1A3 4LBLA 4WV8A 1XNBA 3D4KA 1QJU3 2VOWA 4RQPC 4YFZA 1QWRA 4Q0PA 4CDUC 3ZYGA 1HXS2 1BZWA 1ZZ8A 2BNOA 3GNEA 5DUVA 2ZX3A 3BOWA 2JE9A 1VBD3 4FP3A 1LRHA 2P17A 4GWNA 4IV3A 4N7IA 1LCLA 1UU4A 1V70A 5D8AB 2EF6A 4I01A 1YLLA 3VZNA 3HT1A 1G7YA 1MQTA 1NCRC 4OFGA 4AI1A 3VDDB 3H3UA 3ZIWA 4KWJA 5L7OC 1GYKA 2ZAHA 5FOBB 5LEJA 4WBBA 1PZ7A 4DRVA 1N1TA 1OA4A 5JR7B 4COZA 3VBOB 4AVBA 2EA7A 4IV3C 4AI0A 4ZU7A 2WA3A 3N3HA 5CA6A 4LLOA 1XYNA 4P9LA 4JV4A 2VECA 2A75A 3WHUA 4FAGA 1AYN3 2TEPA 3R4UA 4AGVA 3E6BA 4HFSA 1XNCA 4EROA 1CONA 2XG3A 2OW4A 3AZWA 4AVSA 3D0JA 5C8CB 2BW8A 1AJOA 1C5HA 3ZMOA 2QDRA 4IV1C 3TOJA 2P3KA 1RJ7A 1DYKA 1POV0 1QMJA 2ZABA 4FXKB 4KBBA 3NW4A 4QQPA 3O0WA 3CU7A 1KS4A 4QGLA 4AI8A 2A6XA 5J36A 1UIJA 3RI9A 4Q26A 4LBQB 2FZ2A 4GKYA 4HSJA 1G9CA 3MF9A 2Y0OA 3NV4A 4D7YA 3M3CA 2ET7A 1AR83 4FPGA 3ZFGC 4YZ3A 1NA1B 1VBC3 4COWA 3FWEA 3EJKA 2EXIA 3CJIC 3FFZA 1MS5A 2HEWF 3RYPA 3NAPB 3LSEA 5BY5A 1YYNA 3PHMA 3EQEA 3FC0A 1S0DA 1ZZCA 1GV9A 3OD0A 4QHBA 4YFWA 4JRLA 4EWAA 3MW4A 1PGSA 3WQ7A 3WX5A 3SITA 1OA2A 1W0PA 1DQ4A 5JOYA 2ZGSA 3RS6A 5CFCB 1ZBE3 1A8MA 1CAXA 3AMHA 4NHLA 4QU2A 3D0SA 5KXEA 2XVKA 1RUE2 5E1RA 2AREA 2X5IB 4YLZA 5JI7A 3AP4A 2X29A 4YZ2A 4UBHA 4Q27A 1URXA 2QNKA 2W08A 2PHXA 1AR61 1NQDA 1SEFA 3UKNA 2XLGA 2OIIA 5JDBA 4Y1XA 2VOKA 1FMD2 4FOYA 4CDUB 3VV1A 1S0GA 4I0BA 1SDWA 4HPKA 5JZGC 2JJ6A 3GBFA 1DQ2A 1WMDA 2DURA 2WFPA 3WG1A 2E7AA 1MEC1 1I1EA 1CJDA 2OA2A 3KLSA 1AXZA 3ZYJB 1W0OA 3L9JT 2R072 1VR3A 3PMEA 1X33A 5A33A 4F83A 1M06G 1MS9A 5FOJB 4I09A 4B4QA 2N7GA 1RHI3 2PHFA 2HJIA 4K1ZA 1BVP1 1GANA 1WW5A 2IC1A 1O3SA 2R041 3R6SA 4Q0UA 2JX9A 1Y7BA 4N53C 4CDWC 1RUC2 2B9UA 4XETA 2ZMLA 4Q4W2 4LO4B 4XZPA 1MQTB 3KS7A 4YARA 1SLTA 2R32A 4WVVA 1AL22 1Q8PA 2C0ZA