5C8CB

Crystal structure of recombinant coxsackievirus a16 capsid
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
310
structure length
286
Chain Sequence
b'ENSNSASEGSTINYTTINYYKDAYAASAGRQDAPPLKSPSAEACVAQLTIGNSTITTQEAANIVIAYGEWPEYCPDTDATAVDKPTRPDVSVNRFFTLDTKSWAKDSKGWYWKFPDVLTEVGVFGQNAQFHYLYRSGFCVHVQCNASKFHQGALLVAVLPEYVLGTIAGGTGNENSHPPYATTQPGQVGAVLTHPYVLDAGIPLSQLTVCPHQWINLRTNNCATIIVPYMNTVPFDSALNHCNFGLLVIPVVPLDFNTGATSEIPITVTIAPMCAEFAGLRQAVKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VP1
publication title Structures of Coxsackievirus A16 Capsids with Native Antigenicity: Implications for Particle Expansion, Receptor Binding, and Immunogenicity.
pubmed doi rcsb
source organism Coxsackievirus a16 (strain tainan/5079/98)
molecule tags Virus
total genus 57
structure length 286
sequence length 310
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00073 Rhv picornavirus capsid protein
B PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5c8cB00
1ZBA1 1C8NA 1PO12 3VDDC 5D8AB 1C8M1 2HWC3 4JGYB 1AYN3 5C4WB 4YVSA 1TME2 1HRI1 1RMU3 4GH4A 4YVWC 1AR63 1OPOA 2R062 2DF7A 1R083 1Z7S2 1RUD3 5D8AC 1E57A 3VBSB 1EAH1 4QPIB 4IV3A 4WM8A 1PO11 5C4WC 1TMF3 5FMOS 1RUJ3 5FMOL 2R042 1VBD2 1EV11 2RS32 4NWWA 1TME1 1NG0A 1AL21 2GH8A 3VBSC 4QPIC 2R061 5JZGB 1BEV3 1POV3 1VRH2 3FBMA 1QJU1 1RVF3 4CEYA 2ZZQA 2R041 1AR73 2RMU2 1VBD1 2HWD2 4Q4X3 5C9AA 1FPN3 5JZGC 1IHMA 1K5MB 3CJIA 1W39A 2RS12 2R072 2BBVA 2BUKA 5K0UA 1VRH1 1ZBE3 5J98B 4GMP0 2IZWA 3VBUA 3DPRB 4CEWA 1K5MC 5DDJ3 4CEWB 1QJX3 3LOBA 2RS53 1FMD2 1HX6A 2RMU1 4CDXA 2HWD1 2Y26A 3ZFFA 4RR3B 3ZFGA 1HXS3 1VBB3 1B35A 2RS11 2R071 1MEC1 1ZBA3 1AR81 3DPRC 3NAPB 4CEWC 1GFF2 1C8M3 4N53B 1AYM2 4RR3C 2WWSA 1FMD1 1H8TA 1NCRA 1QQP2 2X5IB 3NAPC 5C8CA 4N53C 1EAH3 5BNPA 1R1A2 1MQTA 1MQTB 1AYM1 5FOJB 2X5IC 1EV13 2FZ2A 1TME3 2BFUS 2ZTNA 1AL23 3VBRA 2R063 4Q4W2 4BCUA 1RUE1 2BFUL 1MQTC 1RUC2 1QJU3 1R1A1 4CDUB 2WZR2 5ABJB 3S6PA 2R043 5AC93 1VBD3 4Y5Z0 1PVC3 3VDDA 3ZFEB 1ND3A 4AEDB 2VQ0A 2HWF2 4Q4W1 4CDUC 1RUI2 1RUC1 1VRH3 4Q4V2 1VBC2 4YVWA 5ABJC 3ZFEC 1ND3C 5D8AA 4AEDC 4JGYA 5C4WA 2RMU3 1QJZA 2HWD3 1VAKA 4PDWB 1VBA2 2RS13 2R073 1MEC3 4IV1B 3TN91 2RM22 1AR83 4CDQB 3JBG2 2XBO3 4Q4V1 1VBC1 3VBSA 4JGYC 4QPIA 1PIV3 4PDWC 1FMD3 3VBFB 4IV1C 4CDQC 1VBA1 2WS92 4JGZB 5L7OB 5JZGA 2RM21 1Z7S1 3VBHB 1AYM3 3VBFC 1OOPB 4N43B 4JGZC 4RQPB 1HQNA 2RS31 5L7OC 3JD72 1K5MA 1RUE3 3VBHC 3ZXAC 1FOD2 1PGL2 5BNNB 1V9U2 4GMP1 1CD3G 1F2NA 1OOPC 1R1A3 4GB32 4N43C 1VBE2 4RQPC 3DPRA 2GSYA 1NA1B 2HWC2 5BNNC 2RR13 4RR3A 3JD71 1AYN2 1WCDJ 4Q4W3 1BBT2 1AL0G 2BPA2 1PGL1 1FOD1 1RUC3 1V9U1 3NAPA 4GB31 5ACA2 1NA1C 1RUD2 2WFF2 4N53A 1RUH2 1TMF2 5A33B 1HRI3 2HWC1 2X5IA 1RUJ2 1RHI2 1BBT1 4Q4Y2 3TN93 4QPGA 4RHV2 4QPGB 5BNOB 1DDLA 2PLV2 4Q4V3 1VBC3 5CFCB 2HWE2 1PO13 5ACA1 4WM7B 1AR92 1RUD1 2WFF1 1M06G 1QJY2 1RUH1 1ND2B 4CDWB 5BNOC 4QPGC 1QQP1 1VBA3 5CFCC 1RHI1 1AR72 4Q4X2 4Q4Y1 1FPN2 4RHV1 1Z7S3 4WM7C 2PLV1 2HWE1 4CDUA 4LLFA 1AR91 1ND2C 4RS5B 4CDWC 5ABJA 2FZ1A 3J8F2 1QJY1 3ZFEA 1POV0 5J96B 1R092 2RS33 2ZAHA 4AEDA 5DDJ2 2RS52 5A32B 4SBVA 4Q4X1 4GMP3 4RS5C 1VBB2 1ASJ2 1RUG2 2WZR1 3M8LA 3J8F1 1RB8G 1COV2 1R091 3JD73 1RUF2 1SMVA 4Y4YA 4PDWA 2RS51 1FOD3 2HWF1 1NY72 1V9U3 4IV1A 4CDQA 1RUI1 4GB33 5LK7B 3VBOB 1NCQB 1ASJ1 1RUG1 1EAH2 4RFT0 2QQPA 1COV1 3VBFA 2MEV2 1RUF1 1BBT3 1EV12 4YVSB 4JGZA 1D4M2 1NY71 3VBOC 5L7OA 1AL22 1NCQC 2HWB2 4GH4B 3VBHA 3HAGA 3JBG1 5ACA3 5CFDA 1PO22 5CFDB 1HRV2 2WFF3 1QJU2 1CJDA 1X33A 1OOPA 4IV3B 1RUH3 4WM8B 3JB4C 4N43A 4YVSC 1A6CA 1QQP3 4RQPA 1AUYA 2WLPA 1RHI3 2MEV1 5AC92 1F8VA 4GH4C 1PVC2 4Q4Y3 1BMV2 4RHV3 2WS91 1D4M1 2PLV3 5BNNA 5CFDC 2HWB1 2HWE3 4IV3C 4WM8C 1AR93 1PO21 1HRV1 1QJY3 1PGW2 1NA1A 4CEYB 5AC91 5GKAC 1PVC1 1BMV1 5C9AB 3CJIB 1RMU2 4FTEA 1AR62 1MEC2 1R082 5K0UB 2WZR3 1AR82 2XBO2 4CEYC 1VBE1 4Z92B 2XPJA 1X36A 3J8F3 1PIV2 3VBUB 1R093 1PGW1 5C9AC 5A33A 3CJIC 2HWF3 1AYN1 4CDXB 3ZFFB 5BNOA 5K0UC 3IDEA 1RUI3 3ZFGB 5CFCA 1RMU1 4FSJA 1B35B 1AR61 1ASJ3 1RUG3 4WM7A 3VBUC 1R081 1BEV2 2XBO1 1PIV1 1COV3 1ND2A 1TMF1 1RVF2 1RUF3 4CDWA 3ZFFC 4CDXC 3ZFGC 1RUJ1 1B35C 1H8TB 1NCRB 2RM23 3JBG3 1RUE2 5C8CB 4RS5A 1BEV1 1POV1 5BNPB 1ZBE2 1H8TC 1NCRC 2MEV3 1RVF1 1VB4A 1QJX2 2TBVA 2WS93 5A32A 1D4M3 4NWVA 1AR71 2RR12 3VBRB 2HWB3 1FPN1 5C8CC 1HXS2 4EJRA 5BNPC 1OHFA 4FTSA 1PO23 1HRV3 1ZBA2 1ZBE1 4FTBA 1C8M2 3VBRC 5DDJ1 3VDDB 1QJX1 1ND3B 1HRI2 3JB8A 2RR11 1VB2A 1HXS1 1NOVA 1VBB1 3TN92 3VBOA 1NCQA 1VBE3 4YVWB
chains in the Genus database with same CATH superfamily
1O4ZA 3DYPA 1C8NA 2VZUA 2W3JA 1IPJA 1UKRA 1YI9A 4P9GA 3RMYA 2EIEA 1IG3A 1YRZA 4Q8LA 5C3PA 5G05L 5JCTA 1VAMA 1TME2 1SEFA 3U78A 2WNVA 5I8SA 1JH5A 2FD8A 5FRAA 3KQ4B 1Y9MA 4QQ2A 3HBKA 2BNOA 1AR63 1OPOA 4ES9A 5E8AA 5FZAA 1Z7S2 2IVJA 1X8EA 2JDZA 4HN1A 2ID4A 3VBSB 3AZXA 4FOWA 4QPIB 1CZTA 2Q1FA 5FMOS 3PUAA 1XSQA 1TZOA 2UY9A 3GZUC 2X10A 2Z2SB 5FK7A 5FMOL 5C70A 2R042 1JOBA 3HNMA 3PUSA 1VBD2 1Z78A 1EV11 3EB7A 4HSJA 1TME1 1W99A 2VL4A 2WZEA 1J83A 2WKKA 5F32A 3H50A 4N90A 3HQRA 3VD3A 3VBSC 4QPIC 5JSPA 1MACA 5JZGB 1BEV3 5FYTA 3WW3A 3E1F1 2VMCA 4IETA 4NHKA 4R4ZA 4CXYA 1C3HA 5FYSA 1RVF3 1W8FA 5GM0A 3WQ7A 5JWPA 3ZYFA 3HJRA 5GZCA 4QB2A 3WQ0A 5KC5A 2WO2A 4TLFA 2ZZQA 3KZ4C 2R041 3LDBA 1VBD1 2HWD2 4Q4X3 3NWKA 3VL8A 5JZGC 1K5MB 2ZPXA 1K42A 1TQ5A 4BIFA 3NV4A 2C5DA 2WNOA 5F2WA 2RS12 4AFAA 5FZHA 2ZGLA 4LE4A 2BBVA 1MZ6A 2BUKA 1GR3A 3HEIA 4QQHA 4WZCA 4C90A 4I0WB 4YM1A 2JDYA 1LESA 1JZ5A 1G9FA 1VALA 4M3CF 5IUQA 4AHXA 5HBAA 1GQHA 1STMA 3FBYA 4AEMA 3SEEA 1DGRA 3DPRB 2GNDA 1K5MC 4O61A 1UIJA 2IC1A 3ZXJA 3BU0A 1UY1A 2CSGA 3LF7A 1W9YA 2B9UA 2HWD1 2Y26A 1QH6A 2W5FA 2W52A 4AEJA 3ZFGA 4K9SA 1WMXA 2RS11 2HYXA 4AHWA 2PHUA 5LEJA 1AXZA 1AHSA 2ZCWA 3H3UA 1S0EA 3DPRC 4OI0A 2HKXA 1C8M3 1W6PA 1AYM2 2RDRA 1LHOA 4K8RB 1UZWA 4OUMA 1DZTA 2IFWA 2WWSA 5FY8A 1NCRA 1QQP2 2OIIA 3MW3A 5H9RA 1O6UA 2QQKA 2RDQA 3GZEA 4Q8KA 2W47A 5DQ0A 2WABA 2VECA 1AZDA 3O1RA 4LA2A 2B4KA 5IK4A 4YSFA 3VZMA 2RVAA 5B2GB 2VZOA 1EAH3 3F95A 3NJXA 3E5UA 4QB1A 1N3QA 1QMJA 2BZDA 4CCEA 3LE0A 3RJRA 3I2GA 3S30A 3I3BA 3KHCA 4EROA 1AYM1 3AYAA 3DN7A 2YB7A 3CL1A 3FX3A 3BALA 3VZNA 2BFUS 1WMFA 3VBRA 2FMYA 4DUVA 5C5UA 1W2NA 4Q4W2 3TB0A 1AJOA 2BFUL 2FMDA 2QCSB 4BCUA 3K4DA 4LXLA 1RUC2 3S5AA 3U11A 2BOJA 1ENSA 1Q43A 2JB4A 3OBZA 4Z2WA 3T2TA 2D97A 5JIUA 1RJ7A 2ZKLA 5AC93 1FV3A 2J7MA 5AFBA 1DQ1A 5JXIA 3ZFEB 2K0GA 4QGMA 2VULA 1UN1A 1W6QA 3OEBA 4LPLA 3SKJE 1N3OA 4IEYA 3DYMA 4AHZA 3MIFA 2VTFA 1VAVA 4Q4W1 2XJRA 2D6MA 2UYBA 4INDA 4AZZA 1RUC1 3E6CC 4FI9A 1UZZA 1DZQA 2P3IA 1BXHA 2X29A 4FP2A 1MPXA 4K40A 4LQRA 2JE8A 2OQ7A 3ZFEC 5FR3A 2JG8B 4UFLA 5F5AA 5F6LB 3ATGA 2CWSA 4CZSA 3AM2A 3A22A 4YM3A 3D0JA 3LSDA 4LHLA 5DN2A 5C3OA 1GNHA 1LHVA 2EA7A 2WYSA 1B09A 4TSVA 4MGYE 2R073 4RGGA 1DP0A 3SHRA 4Z2AA 1MEC3 1DF0A 4WVZA 5FOBB 2GZWA 1IGOA 4IV1B 1BK0A 3FHIB 4CDQB 2JG8C 4PT6A 1E5IA 2ZXQA 4COWA 3B69A 2DCJA 4QPIA 3VBSA 2ORXA 1PIV3 4KBZA 1SBEA 2DVDA 4IEVA 1V6KA 2PHRA 5FZ8A 2BP6A 3D4KA 2WLQA 3DL3A 1O4YA 2C9AA 1LJ7A 1J1TA 2WAOA 3CZJA 3PUQA 1JHJA 2VUDA 4XJ9A 5JLVA 4BLJA 2CAUA 2PAKA 2BDRA 3QACA 4IV1C 3VBFB 4Y33A 1ONAA 4GJYA 4CDQC 3WP6A 4JGZB 4XUNA 3SLIA 4I02A 5IFTA 2VCAA 2KR2A 5L7OB 3ZMNA 3O0WA 5JZGA 1Q56A 4D6RA 3KV4A 3VBHB 3B5LB 1GP6A 1NE6A 1JYWA 3ZPOA 3WDXA 3WLUA 1UU5A 3CDZB 3VBFC 5FY0A 2G4IA 1WZXA 1JU3A 3LGRA 3WNOA 2G9GA 4AGRA 4JGZC 5FYVA 2WQZC 2PHDA 2WSVA 4JDNA 4XPVA 5L7OC 4C1WA 1K5MA 3MF9A 1RUE3 5LW9A 4LBOA 1JBCA 1LHNA 1U0AA 1XE8A 3VBHC 3WF4A 1GV9A 3LFMA 3NNGA 3HQXA 4IE7A 2F4PA 5LRSA 1ACCA 4S2DA 2O8QA 4ASKA 1CPMA 2P1BA 1VR3A 4MYEA 2D7FA 1SLCA 3WX5A 4LNVA 5EXOA 5E88A 4XBQA 5A1LA 3AYEA 4ZU7A 2YGLA 3DPRA 4XBNA 3W59A 4AI3A 1SFYA 4P9LA 2MHFA 4MUVA 1OF3A 2RJLA 1AYN2 4UI9L 1WCDJ 3OGJA 4XETA 4YGDA 2BPA2 5LA2A 1DGWX 3Q8BA 3ZSEA 1MVQA 1O5LA 3BTXA 4QPYA 1LOGA 4HXCA 1O8SA 4QXHA 2DWRA 4ZS2A 5ACA2 1RUD2 4QT6A 5FBJA 5T52A 5LBFA 2J1VA 4URAA 2VXJA 4AI9A 2JD9A 2VOVA 5DAWA 4YG0A 5F5CA 1RUJ2 1NZIA 4XE9A 5H9QA 3ZXDA 1NXD1 2XJUA 1C28A 4QPGA 1DDLA 3KD4A 5T50A 4N7IA 3ITQA 2GH2A 3LEIA 4ASMB 1UL9A 4BDVB 4K6BA 3PTYA 4UFHA 1UMHA 2D44A 4IEOA 5ACA1 1GICA 5FY4A 1RUD1 3T0AA 1HKDA 5T5LA 1WD4A 2BNMA 2NMNA 3ZLIA 4HONA 4OZOA 1ND2B 3ZOIA 1U5YA 2ZGOA 3ZYPA 1C4RA 3ABZA 2V09A 4HLTA 5A3MA 3C8XA 4R9AA 1AR72 1RITA 1ENXA 2WA4A 2XJTA 4AR2A 1FPN2 2BU9A 2P2KA 3AYCA 4WV8A 1D4VB 2EALA 3OUHA 4QPWA 1UXZA 4N8MA 3BYWA 1G9BA 1ND2C 4RS5B 4NO4A 1KDKA 5A1FA 4LJHA 3I2OA 4EE2A 2NPIA 4NROA 3J8F2 1US2A 2XL7A 4N7UA 4XQ4A 2RS33 3ZFEA 2ZAHA 5FYMA 5D21A 4R4XA 1FX5A 5DDJ2 3OD0A 2XJVA 3CBNA 3WG2A 3G7DA 1O8PA 3ACLA 4GMP3 1POQA 4N9IA 1REEA 2W68A 4RS5C 1J3QA 3AP5A 3KV5A 2ZX2A 2EICA 4A2UA 4PLMA 4OI2A 1ASJ2 2VH9A 5IYYA 4Q1RA 1LGNA 2JG8A 4Y22B 5FP8A 1F4AA 1W06A 4HFSA 3J8F1 3MEPA 4XUOA 1RB8G 2G1MA 5DXDA 3JD73 1PK6A 3AMHA 3OGGA 3ZXEA 4LA3A 4ONUA 1RUNA 4XHXA 4NPMA 4J25A 4K21A 1FOD3 1RINA 1NY72 1S0JA 2VTXA 3V64A 4IV1A 5A3WA 2RDNA 1U12A 2PA7A 4NAMA 4CDQA 4WBBA 4YW5A 4CPBD 2DYCA 4BH9A 2YBKA 2VQUA 2VMEA 1ASJ1 2ZGPA 2KD7A 3H8RA 3OBTA 4ZY9A 4HKLA 2QQPA 2WT0A 5JMOA 1IZ3A 1OVPA 1KXGA 3VBFA 4J1XA 2A6WA 2VOXA 3CEWA 3N9NA 4WVWA 4JGZA 4DEQA 3WZ1A 2VTXJ 1NY71 2ZGRA 4JHTA 5L7OA 1AL22 5FZCA 5LBCA 1DLCA 2VZ1A 4GH4B 3VBHA 3HAGA 3WHTA 1QJEA 2PTMA 5CFDA 2DVBA 1UCXA 2WFF3 4Z1VA 4B8EA 3PHMA 3K75B 4XZPA 1W8NA 1X33A 1JOJA 2O14A 2OPKA 2QE3A 2VVFA 3I3DA 4GIQA 1OC1A 5CVRA 4MGZE 1T2XA 1OSGA 4W65A 4XUTA 4RYDA 2VE1A 2XONA 4FXGB 5GALA 1LOCA 1RHI3 2ZX4A 5M0TA 1MR5A 4GH4C 3GZAA 4RHV3 2WS91 2PLV3 4IE5A 3APBA 3ZXLA 1JZ3A 4P5YA 2HWE3 5FLIA 3NJZA 1AR93 3UK9A 4LBKA 4XILA 1W0NA 3ACGA 1OLME 2WL1A 2BEOA 5CAZA 4AHYA 1LU1A 5EIYB 5FY7A 1QJY3 3LIGA 3LDKA 1UZYA 2BOIA 1Q8SA 5G04L 3HIFA 5CKQA 3OGRA 3W5MA 4X8NA 2F17A 3OTFA 3H7JA 5FY1A 3VN4A 5C7GA 4XIOA 4Q0SA 3J7HA 1RMU2 5FXZA 2R6QA 4KWUA 4FTEA 4OHYA 1R082 1YFWA 2QQJA 1D2SA 1AR82 2WZR3 4OQ8A 1QOOA 2XBO2 5FPBA 5I8TA 2E9QA 1VBE1 4Z92B 1X36A 4NMIA 4D7SA 5ISLA 1DG6A 3VBUB 3VKMA 4I3PA 2Z5WA 4MGIE 4EYUA 1D0GA 1WUVA 4AI8A 2H6BA 3UNPA 1GOGA 3T0DA 5KBFA 1RTVA 4QM9A 2JX9A 1CIWA 2D5FA 2ZGSA 4GALA 5FYUA 4UFIA 4Y26A 4BLIA 2IWGB 4CDXB 2CWMA 3RS6A 4JDOA 1DQ4A 5JIAA 3AVSA 5AVAA 2XH6A 3GYDA 1RMU1 4I0AA 1GZCA 1B35B 1OQ1A 2GMPA 4NHMA 3EHKA 3LPGA 3VZOA 4FSJA 4LKEA 2O0OA 3VHRA 3VBUC 2CAVA 1R081 3S7EA 3OEAA 2VPVA 2XBO1 1NX9A 3B7MA 3V0BB 1L7RA 5JMCA 3MIBA 5CG9A 4LBQD 1CESA 1ND2A 1TMF1 4CDXC 2E33A 3B9CA 1UMZA 4XFBA 3BB6A 1CR7A 3RZJA 1J58A 1B35C 5HCBA 1H8TB 4COZA 4IESA 4AQ2A 2RM23 2XKOA 2ORZA 2OYZA 3OUIA 3WNKA 3D0SA 1W8TA 4XHBA 1ZREA 2BGOA 5EPAA 5FYYA 2VAUA 5C33A 2ET7A 4QGLA 4RS5A 1RGSA 5I0DA 3M1HA 3LEKA 1UY4A 2C9KA 4GA9A 2FCTA 2QNKA 2RV9A 3BTYA 2WDBA 1H8TC 4LK6A 5B4XA 2DFBA 1VB4A 4JCKA 2DVGA 3AZYA 3QOPA 3NV3A 2XUMA 2W1QA 1QJX2 4FFHA 1AX1A 2AACA 4J1WA 1X9PA 1CVNA 3SEPA 4K8FA 1ULOA 1RYYA 4FPHA 2BBAA 4G3YC 3I7DA 4HK8A 5BXXA 3RPQA 2W95A 1W9SA 4W4ZA 4XFFA 4EJRA 4PLOA 4FTSA 2CTVA 1ZBA2 4OULA 4P00B 4Y22A 3ST7A 1W90A 2Q8OA 4XOGA 3NKTA 2OQ6A 4CSWA 1QJX1 2D40A 2W39A 1LGCA 2D6LX 2Q5TA 2ZGTA 3JB8A 3SNMA 4FP3A 4YZ2A 2D6OX 1TVGA 3MIGA 4AQ6A 5F1RA 4W8JA 5DG1A 5LBEA 4XMIA 1G86A 1A8MA 3TN92 4N9HA 2OXBA 4JQRA 2E51A 1GMMA 1X9TA 3DCQA 5A7NA 3O5SA 5C3QA 4IL7A 3OJBA 3LEGA 3B94A 5A3LA 1ZBA1 1CGPA 2XB6C 3A0NA 4XFAA 4CU8A 3ZXFA 2ZGKA 1TE1B 2ZEYA 5JPNB 5I0SA 5D8AB 3X29B 1HB2A 3URFA 1DYKA 2JJ6A 4M3CE 3IMNA 4DIQA 3MW2A 1DGRN 1OUSA 2YFZA 1PM7A 2HJIA 2J1EA 5FZ9A 4B7KA 2LTNA 2FBEA 2PQSA 1V6OA 4QX7A 4GH4A 2ZOEB 2R062 1UO9A 2AR6A 3AJYA 4AAXA 1J3PA 5D8AC 2QQLA 3UKVA 1E57A 3POSA 1RIRA 2GU9A 1GBGA 1YXWA 2VZSA 1JS9A 3POIA 3RJ2X 3DEMA 1V0AA 3HQUA 4BM8A 1XPWA 2VCBA 3W21A 5F3GA 2ZGQA 4QQLA 2WYFA 3WD5A 4CA9A 5A6XA 4YARA 4UW6A 4BQYA 3WP4A 3GCXA 4RGKA 3N35A 4BQ3A 3WNMA 4DY3A 2GH8A 3KM5A 3ZYIB 2R061 4L92A 1C5HA 3AYDA 3OB8A 2OKXA 1JYIA 2PHXA 3WINE 4P14A 1QJU1 1XC6A 3WP5A 2JDNA 3BPZA 2Z4FA 1EPZA 4LBQB 4DMIA 3ZXGA 3DXUA 4XCBA 3NNMA 4BOWA 1UX6A 1GWLA 4YW2A 5H9SA 3H3LA 2RMU2 3N3HA 3QH7A 4FVVA 4LLOA 3U75A 1HW5A 4LBMA 5KXDA 1IHMA 1GWKA 3KV6A 4JKKA 4UFKA 5AVPA 4PCRA 5FZ4A 5A7PA 5EJ3A 3OBAA 1ZZ7A 5C6CA 5HXMA 1XNCA 2ZHLA 3ZYJB 5FPAA 1ZBE3 2NMOA 2R1DA 1RC6A 3CLPA 2C0ZA 4GMP0 5J98B 4AI0A 1EPWA 3L2YA 4AXOA 4GWIA 2QQIA 4Y20B 3VBUA 4AWDA 5A3NA 4L0PA 3AP7A 1UOBA 2RS53 1IS6A 4NE9A 4XUPA 1BQPA 5FYCA 1FMD2 1ZA4A 5A80A 2RMU1 3RRDA 4CDXA 1VLNA 1F35A 2A6VA 2VZTA 4EN8B 1HXS3 1VBB3 5FZDA 2LALA 1B35A 2XJQA 5H9PA 2JDKA 5HXVA 1MS4A 3VZJA 3WDVA 3G6JB 1W9TA 3HMYA 5CKMA 1OLRA 3V0BA 1OI6A 1GFF2 4QDSA 4A3ZA 3TEYA 1KEXA 2E31A 4BPZA 4LKSA 3BTZA 1ULEA 3JQXA 3MLJA 5FAXA 1FMD1 2XXZA 1EY2A 1H8TA 1QWRA 4OVEA 1PM4A 2YU1A 3MLKA 1SLTA 4COUA 3IPVB 3WCSA 2BGPA 5L9BA 4CPBA 3B00A 3H8UA 1H8VA 2CGNA 2IXKA 3POEA 3UGHA 2VQAA 4MX3A 1DYOA 1ULGA 2YY1A 3WT3A 4BYYA 3NMBA 4AL9A 1JU4A 4QMAA 4CTEA 4BQ5A 2VOWA 3GHNA 2BNNA 1EV13 1L7LA 3BOWA 4Q0PA 3VDBA 2FZ2A 1TME3 4YW3A 2Q4SA 1YQ5A 1WKYA 2YHJA 4D7TA 4E2SA 3EQEA 3A7QA 4A41A 4E2QA 3DUIA 3VDCA 1S4CA 1HLCA 2Q8CA 5LY1A 4IGPA 3N9QA 4AVTA 2DDUA 2OVUA 2BJSA 3F2ZA 4CP2A 1H2KA 4ATFA 1WA4A 2VZQA 3ZSJA 4CYDA 4BE3A 1X8MA 2BV4A 1PMIA 2RJ2A 2JE9A 5IW0A 3MV11 1PNGA 2R043 4D7YA 3AC0A 1VBD3 5C5TA 2X53S 5KHJA 2W92A 1QJFA 2YXSA 3AMMA 5IVJA 2JB8A 2N7GA 2V5YA 3VD7A 3OOXA 4BMBA 1Y9QA 2VZVA 2AUYA 2HWF2 2ZGNA 2D6KA 3ACIA 4GWJA 1MZFA 4B4RA 3GM8A 4BQ1A 1OFSA 5J37A 1RUI2 4FPLA 1S2BA 1WMDA 3N9OA 1T6BX 2W1WA 4YLZA 1LU2A 2P37A 4D94A 5D8AA 3ORJA 1ZA7A 4PI2A 2VMDA 1X50A 4YW7A 4E27A 1QJZA 1JYXA 2HWD3 2Y6HA 4HL0A 2AENA 1H0BA 2JECA 4YM0A 4JKMA 1CN1A 1VAKA 2QZ2A 5KHHA 3LWCA 1W05A 2RS13 4KWKA 2AEYA 5JSOA 5GLVA 2VD7A 1W8UA 2D3RA 4JTOA 3JBG2 1Q8OA 4X8PA 5F3IA 5FJHA 1OT5A 1LB2A 2GALA 2P6HA 3AP6A 5BPXA 3QBQA 2EXIA 1S2EA 2J1TA 2VMGA 1WW6A 3RDIA 2H0BA 3HVDA 1GANA 3KVAA 4YZ3A 2XQXA 1XNKA 5FV3A 2WBKA 4QHZA 1GNYA 2A6XA 1OA2A 4O9EA 5K7PA 1XU1A 5FFOC 2YBSA 1OH4A 1S1AA 1Z7S1 5DUVA 2R1BA 3FLTA 4I2OA 1KQRA 5JR7B 3BI3A 1OF4A 4CVUA 1W8ZA 1AYM3 4LBQA 3RQ0A 2ZEXA 5JUVA 1T6GC 4HZFA 3RZMA 1CX1A 4ZU5A 4N43B 1XXNA 2OT7A 1BVVA 2CHHA 1LNSA 1N47A 2VY0A 4KGGA 3NRUA 1H6XA 3MF6A 4IXLA 4Y1YA 1O5UA 2J1UA 1WCSA 4MGTA 1PGL2 2C4XA 3HN3A 1O3SA 4URTA 4HVRA 3BKZA 1JXNA 3HPNA 1F2NA 1LHWA 1JN2P 4GB32 3MDPA 4HG6B 5T5PA 1WCUA 4N43C 4XFCA 4AI1A 1SLAA 1BYHA 4Y20A 1IG0A 2FDGA 2P4EA 1GNZA 3OPZA 2P34A 3VV1A 3WVJA 3V65A 1XB9A 1JZ2A 3IMMA 3ROUA 1LKNA 2RR13 1GSLA 3IM0A 4Q4W3 1BBT2 2JKXA 2YBPA 2WT2A 1PGL1 1RUC3 5JPMB 4UFJA 3UESA 3V56A 5FLJA 1OH3A 4DXZA 4JDMA 4GB31 1DCSA 2FDKA 1D2QA 4XTPA 3TYJA 3AFKA 1CQ9A 4CUCA 1V6LA 4CU6A 1DU3D 2LM3A 3POYA 3SQOA 5GZDA 2J1RA 2YG0A 3VUOA 1HRI3 5LA0A 2VW2A 2OA2A 3O1MA 3IPVA 3M7AA 2VXRA 5LBBA 5HV0A 1BBT1 4Q4Y2 4XIKA 3JU9A 5KWRA 5BNOB 4QPGB 3RYKA 4LITA 3H0OA 5CFCB 1HB3A 2B5HA 2WN2A 2PHLA 2W2IA 4LR4A 2E32A 4GXLA 5BY5A 1PO13 4WM7B 5K9YA 3NJYA 3BN6A 3T09A 1OUXA 3WF2A 4Y1UA 1M06G 5KC6A 1SFNA 4XJWA 4OUEA 2ENRA 4W6XA 3PIJA 4QPGC 2FDJA 4B1LA 1QQP1 5BNOC 2DV9A 3KGLA 2EXHA 5HI0A 5CFCC 3U14A 4WVMB 3A0KA 1K3IA 4EWEA 4Q4X2 4Q4Y1 2GDFA 4ZKTB 5EFUA 2KA3A 2RDSA 4WM7C 4OI1A 1FATA 3BUCA 1WLWA 2A3WA 3SH5A 5FP4A 3JZVA 1OKQA 1XE0A 5DUWA 2R7EB 4LLFA 3USSA 1YQ2A 1BKZA 2OZJA 4I30A 1XNBA 3RVHA 3T3YA 5J96B 3VKNA 2CV6A 2ZEWA 4UWDA 2VNGA 5I0RA 4EN6B 1LENA 1F5JA 3ON7A 4A6OA 2OUHA 3ASIA 1W0PA 1ZYBA 4Q4X1 3WNXA 1YQ8A 2Z42A 1DHKB 1DGWA 3LFIA 2XKPA 2ZX3A 4S2FA 4S2HA 4PIZA 5ANQA 4XW3A 2I2SA 3MICA 4TN7A 1ZRIA 2CY6A 3POGA 5D2AA 5FPLA 2XL9A 4PF5A 4AQSA 2DURA 3M8LA 1YFUA 4META 3BOPA 2XG3A 1NQDA 3WSOA 5IHRA 1WW4A 1RUF2 2JG9B 4Y4YA 1PK6B 5J09A 1OVSA 4NOTA 1XE7A 2PHWA 4UW5A 3GBWA 2ZMNA 4BZ4A 1REFA 1DIWA 3MYXA 1LGBA 2NQYA 3O14A 5F8PA 5FP9A 3THCA 1IS4A 3VBOB 4JZRA 2QVSB 3KGZA 5FTTC 4KL1A 1EAH2 1MS8A 2JG9C 1PK6C 4IQPA 4XYXA 1RXGA 3LDRA 1GWMA 1WLDA 1F15A 2MEV2 1RUF1 3AXEA 1FYUA 5DAPA 4B29A 1D4M2 1NLSA 1S0GA 3VBOC 1VPHA 1XYOA 4DUXA 2HWB2 1DYPA 4Z07A 4QKBA 3GXUA 1QNWA 3U4SA 4CCCA 4E4ZA 3AL5A 5ACA3 5EHDA 1PO22 1XQNA 3RG0A 4E2GA 4CU9A 1BCXA 4BHPA 2D93A 5CFDB 1KRIA 4YW1A 4DOUA 1ULCA 1V6IA 4IV3B 4WM8B 1N1TA 1ZRCA 3JCIA 4N43A 1JMUB 4Y5SA 5FYIA 1ZZCA 1A6CA 2DCTA 4PQ9A 4I0BA 2MEV1 1IPKA 5AC92 4TTGA 3AZWA 3C3VA 1BMV2 1OFNA 1D4M1 4EWDA 5CFDC 4QHBA 1MS0A 2B7YA 2HWB1 1IQDC 5ERLA 2D3SA 3AP9A 3D82A 4IV3C 4UW3A 1PO21 2H6CA 4Q5OA 4WM8C 4ASLA 2GMMA 3HBZA 4YNIA 1SBDA 1YFYA 2Y6GA 4A6SA 1QXJA 3K4AA 2A70A 2DCZA 3HR9A 5FY5A 3UGFA 1QKQA 1F31A 2VO5A 3PVEA 5EZWA 2JE7A 3C7HA 4GAZA 5FZMA 4ES8A 1WW7A 5AC91 3C7GA 5GKAC 5LZ6A 1HDKA 2F6BA 3FWEA 1BMV1 1M4WA 1JZ6A 1YYNA 2VUAA 4Q0UA 3E5XA 4QDQA 1UZVA 5FMCA 3SCFA 2QDNA 1MEC2 2CDPA 4EZHA 4OMCA 1E5SA 5DPNA 3LKJA 5K0UB 3ALQA 4OUSA 4PBPA 1CAVB 1QDCA 3J8F3 2I74A 1MS1A 1MS5A 1OXCA 1PIV2 3BGAA 2A3YA 3IN9A 1ZNPA 1KS4A 4FT8A 4ISRA 4EZ4A 1UYPA 5LB6A 2OZ6A 3RWNA 2PQQA 4PLNA 4DUWA 1S55A 3WUDA 1AYN1 2VOKA 3EJKA 3ILNA 3POJA 5JOZA 4M4RA 3ZFFB 5BNOA 3I3QA 2HEWF 5FLHA 5K0UC 5EWSA 5CFCA 4UAPA 4XXAA 3ACHA 1XU2A 4LORA 2JICA 3KCCA 1ASJ3 2DCYA 2WJSA 3IDAA 4P5HA 1YIPA 3ENRA 4JC1A 4WM7A 3T4HB 4ARXA 5J1XA 4FOVA 1QH7A 4AF9A 5I93A 5J3UA 3KT4A 1PIV1 3AMPA 2WR9A 2Y6LA 4L9BA 3ZFFC 4JKLA 2XVKA 4B4QA 2X09A 4GZ9A 1RUJ1 3MHZA 4WVMA 1FNYA 2UYAA 5FP7A 4K3UA 4BQXA 4FPFA 1LOBA 1RUE2 2Q1MA 3UJQA 5JOWA 4UW4A 1R64A 5C8CB 2HH9A 2XLGA 3J26N 4HOOA 1U5XA 1OPMA 2CU5A 1POV1 2YGMA 3HWJA 4QX5A 1X82A 1V00A 4UF0B 2PFWA 4O7XA 3VB9A 3T0BA 5A7OA 3CQOA 3DGTA 2TBVA 2WS93 1WCQA 3Q8EA 4NWVA 3D5OA 5A3UA 5J48A 1AR71 4D0QA 3U07A 3MW4A 5C8CC 1FPN1 4GKXA 4OHVA 1PZ7A 3RYRA 3U10A 1EUUA 2OUJA 4AVCA 1D0HA 3A4UA 2E26A 5CISA 1O91A 5EYYA 4NRQA 1W8OA 2QKDA 3RWKX 4R9CA 1PNFA 2FDHA 3AK0A 5HCFA 3J7MA 4BQ4A 5J36A 2JWPA 5C3SA 2JG9A 2ZA9A 4LO5B 4MHRA 4LO7A 5DDJ1 2XLAA 1H4HA 1ND3B 2VBBA 5FZOB 3VDDB 4F7ZA 1W2UA 1SACA 2VOTA 4C0HA 1JYTA 2PELA 5CA6A 4FPOB 3MIEA 3RYPA 1LCLA 1VB2A 3DV8A 1G7YA 5CYYA 3VGIA 4ITCA 3T1MA 3VBOA 4XACA 1VBE3 4YVWB 2PXJA 2UWCA 4FPYA 2VQTA 4K1ZA 4MADA 5FZFA 4XABA 2D3PA 3VDDC 4D69A 2QQWA 3UV9A 2HWC3 3OG2A 5LCWL 5GZGA 4JGYB 1I5ZA 5E1RA 1W03A 4XUQA 1KITA 1VP6A 3H1MA 4QXBA 5L9RA 5HPOA 5IVEA 1JUIA 2UWAA 3FL7A 4AEKA 1RMU3 1WLCA 3ZYRA 4FPJA 4ET7A 4C8DA 3K2OA 4YVWC 3WG1A 2VM9A 1O3TA 2DF7A 3FE5A 1R083 1XNAA 4LBNA 4R8HA 3H1YA 4UYBA 4D3WA 2EXKA 3LCPA 4YZ4A 4IGOA 4I01A 4IV3A 2WWUA 4WM8A 2YYOA 3WG4A 1TMF3 2O1QA 3E6DA 3D6EA 3H3ZA 4NHXA 1WD3A 3VHNA 1XYNA 4CRQA 2DU0A 4LBJA 2RHPA 3L9JT 5FZ3A 1QDOA 5DUXA 2PN5A 3C7FA 2RS32 4NWWA 4DQAA 3U0ZA 4GKYA 1NG0A 2XUEA 1H4GA 1JYCA 2HYKA 3IDBB 1AL21 2P5BA 3H7YA 3EYPA 4JRLA 3WG3A 1HN1A 2KM2A 4KU8A 3J7LA 4YZ1A 2XHKA 4KMQA 4QKDA 1VRH2 3BU7A 4EN9B 2IXHA 2ET1A 3SISA 3SC7X 1PMJX 3O1PA 3K46A 3A21A 1GYKA 2J42A 2VCMA 4AFDA 3ES1A 3ZMOA 2BRTA 4CE8A 5KXBA 1QHDA 3AXDA 5JOXA 4QHOA 4QAWA 3RFRA 5CG8A 1W6MB 5FO7B 1I9RA 1A34A 4KG0A 2GNMA 3N36A 4ZS3A 1O3QA 1DGLA 1HV0A 3GNEA 5K0UA 5T5OA 1F4HA 1VRH1 1CAVA 2WZ8A 4FPGA 1Y43B 3KF5A 4P9YA 2IZWA 4KGQA 4YGBA 4IEZA 2OPWA 4Z8BA 5IAVA 4CEWA 1X7NA 3W5NA 1QJX3 1HX6A 4OHWA 1JZ7A 2MPFA 1IS5A 3ZFFA 2PHFA 3PU8A 4PI0A 3MIHA 2JIGA 1ZZ9A 4QX3A 1CZSA 2PYTA 3FLPA 1ZBA3 1G9AA 1AR81 2GNTA 3NAPB 1XSRA 3EMRA 5CIRA 2Q30A 1DFQA 1UD1A 4QX2A 1DQ5A 1FT9A 1WGPA 3UETA 3I97A 4TZDA 4N53B 1W2AX 3SMHA 2ZEZA 3FMGA 3POFA 3VDAA 3WXPA 2O8OA 5L19A 4K20A 5APAA 2KXLA 1NYWA 3T2QA 1LR5A 3PJQA 1XOYA 4KWJA 5FZBA 3ZR6A 1XBFA 2GC2A 3RI8A 3KT1A 4MOAA 4F3JA 4PF1A 3NAPC 3R4UA 2VVDA 1W28A 1ULFA 3H8OA 4FPEA 4L2NA 5C8CA 3T08A 4N53C 3ZYGA 2XDVA 4Q2FA 2HLEA 4EWAA 1KJLA 4LOSA 1R1A2 1MQTA 1YIFA 3ZSLA 3ZSMA 1UXXX 4UF0A 5GLWA 2VCCA 3IT8A 4AOCA 2YV8A 3WQ1A 3ZR5A 1HJGA 2BQPA 2D6NA 5GJ6A 1UAIA 5A7QA 4RL7A 4P9WA 3I2IA 1UYZA 2ZTNA 2VMFA 2BVBA 2R063 4QU1A 2B8MA 2VNRA 4MXWB 1UYYA 1W6NA 4HMZA 4YG3A 2ZHMA 2IUWA 2E7TA 3MIDA 3NNFA 3S5QA 5F3CA 1QJU3 2XWJB 2R0FA 3OPWA 4ZZ5A 3S0MA 3NW4A 4HVQA 1SHWB 1R1A1 4H55A 5FZIA 4CDUB 2WZR2 4ZXEA 5ABJB 3S6PA 1DQ2A 3I54A 3PDQA 1AX2A 4LHNA 2EAAA 1W6OB 1PVC3 3CNAA 3VDDA 1ND3A 2IXCA 4GULA 3AZVA 2XJSA 5FZOA 4XF0A 3ZVXA 2CDOA 1O7FA 1GKBA 3ILRA 1U5ZA 4LTAA 2GMEA 4CDUC 4DXRA 4Y1VA 2ARXA 5E6HA 4Q4V2 1S0IA 1VBC2 4YVWA 3THPA 2G9ZA 3CIHA 1S2KA 5ABJC 3D3AA 3OGSA 4XQWA 4H2AA 1KDMA 1SLBA 5DG2A 2DUQA 4JGYA 5FCCA 1DBNA 1W04A 3I2HA 1PMHX 2RMU3 4NRPA 4XZUG 1S0BA 1YNAA 5C8WA 2EAKA 3KWVA 3VD9A 3H42B 1NQJA 1SG3A 1VBA2 4IEPA 1YO8A 4PDWB 1ZRDA 5FZGA 2YU2A 2FDFA 4LULA 2VU9A 3P6BA 2RM22 3TN91 1UY0A 1VBC1 4Q4V1 3U1XA 1N1VA 5FK8A 3BPSA 1PZ8A 2UU8A 1UWWA 4CXWA 4YG6A 4M0NA 4NHYA 4GWNA 2B39A 1LOEA 5A6YA 1QU0A 3WW4A 4PDWC 1FMD3 4D6SA 3O1SA 3WNLA 2AGSA 2V5DA 1BK1A 1CAXB 4YFZA 1JYNA 3AJZA 3BIWE 4QM8A 2ARBA 1VBA1 3CHXA 3LEMA 1Y7BA 1OKOA 2GP5A 3ECQA 4ZHNA 3ZIWA 4UT5A 2RM21 1UOJA 3FN9A 2X8KA 2HEYF 1O4TA 2JDHA 3P3NA 5FREA 4P08A 4TWTA 2J22A 5GZEA 1I3HA 4AE2A 5L36A 1HB1A 2E7QA 4Q26A 1HQNA 1G8WA 1ZZ6A 3CF6E 3IBMA 4UOJA 1W6MA 2WRAA 2Y33A 4L8QA 2B46X 2LRPA 4YRDA 3I8TA 5BNNB 1GZWB 1V9U2 4B1MA 2YROA 3N9MA 5KHKA 1ODMA 3C7OA 1IKPA 2VW0A 4IE0A 4RFRB 4CP1A 4NN0A 1PVXA 2WFPA 3T2OA 1LRHA 4CCMA 5FPXA 4V1PA 3MGUA 1PZ9A 5JI9A 1QXPA 2ADEA 5DAVA 2F4LA 5HCHA 1MZ5A 2YPDA 4M3CB 3PIGA 1QXRA 4FOQA 4PHZA 4ZPIA 5BUVA 3KCXA 2W08A 1GP4A 1DQ0A 5BNNC 3HT1A 5FO8B 3NV1A 3GBFA 3J9SA 1CX4A 3ELNA 2ETEA 4FOYA 1FV2A 5T5JA 1V9U1 1QY4A 5FPZA 4CP0A 4YZ5A 4LEJA 3NAPA 4DPNA 1QF3A 2DUOA 3MFAA 4QKFA 3DECA 2UWBA 4N53A 2AC1A 3J7NA 2JEMA 2NN8A 2VW1A 4IUGA 1RUH2 3WEZA 3THDA 4V2VA 5LWBA 1G9CA 4QX1A 3H8XA 1YWKA 1Q8QA 1HB4A 3I3EA 1H1AA 1SLLA 1YHFA 2ES3A 5IWFA 4ARYA 3H9AA 1GQGA 4HBNA 1OLMA 1H1IA 4MV2A 2GC0A 3WP3A 4AGVA 3RZGA 1K12A 2A1XA 3AP4A 1R1ZA 3AB0A 3GZTB 3KLSA 4BISA 4FPKA 2SBAA 5CU1A 2D5HA 3RI9A 1ZRFA 3VD4A 4L97A 4LT5A 1VJ2A 1L3JA 5J7MA 3ETPA 1RUH1 4NIIA 2FCUA 1W2TA 3K4ZA 3KHBA 1N3PA 3OCPA 5FY9A 1CAUB 4G4FA 1LEMA 2OX0A 3IIIA 5KHIA 3M3OA 1A8DA 1RJ8A 4FXKB 4WZFA 5IK5A 5KXEA 4MXWA 4IERA 1Z7S3 5CNAA 4M01A 5IVYA 2YC4A 4QXKA 4DY5A 2QQNA 4CDUA 5IJRA 3ZYHA 3I59B 3WV6A 4IEUA 5ABJA 4H14A 2W0XA 3IAQA 4HSLA 4IGQA 1W6OA 3RSJA 2BYVE 2XR4A 3Q8FA 4OFGA 3PMEA 1UYXA 1R092 4C91A 1LHUA 4U36A 4ZU4A 1C5IA 3R05A 4MZUA 5F5IA 5A6QA 2JDPA 4SLIA 2RS52 4ORFA 1F9KA 4OYUA 2B9VA 4YPJA 1EYBA 2WO3A 2WWJA 5GZFA 4SBVA 3IB3A 1VMFA 4NJ4A 5FXVA 5CKNA 2VMIA 3UYJA 2P6CA 1VBB2 2DVAA 4A7ZA 2E53A 1WWYA 3Q8AA 2GC3A 2A5ZA 1RUG2 3MPBA 3ZM8A 4E9KA 1Q3EA 4MHUA 1W3XA 3OGVA 4F8AA 2ZABA 1COV2 1R091 4HVOA 3EO6A 2VJXA 2ARAA 4PDWA 4A45A 2RS51 3ZKUA 4AVBA 2HWF1 2FQPA 3ZKYA 4AFBA 4E8DA 1REDA 3WDTA 1RUI1 4GB33 1APNA 4XDPA 3R6SA 3ETQA 5EJZB 4B4PA 1RUG1 4LKDA 4RFT0 5FMDA 3JQWA 1ULPA 1KD7A 4HT1T 4PQQA 4QB6A 5HCAA 1AF9A 3PVOA 4R9BA 5DUUA 5FPVA 5AFEA 1CAXA 1COV1 2W9XA 1FI2A 5IATA 5BYNA 2VGDA 1BBT3 1EV12 4YVSB 1V6NA 1IPSA 3GALA 4QX8A 4LIUA 1Q8PA 2WNUA 2W91A 5HV4A 2WUHA 2JKBA 3JBG1 2NM1A 1KS5A 2OW4A 1HRV2 4MH0E 1Z0HA 1G9DA 1PX3A 1CJDA 1UPSA 4M0HA 2K2SA 5BV6A 2XGXA 2I45A 2NLRA 4CCDA 4MGSA 5K4LA 2Y34A 5FPUA 3M3EA 1LECA 4YVSC 3LA7A 1JW6A 1QQP3 1CWPA 2RG4A 1AUYA 2EF6A 3TOJA 1KJRA 2BTVC 1CAWB 4CCJA 4DNYA 1XJAA 5FIXA 4Q4Y3 5SV5A 2PMWB 3I2JA 5BNNA 3OY8B 1GZWA 4CCOA 5JXHA 3PMSA 3QH6A 4X6RB 2B42B 5JOYA 1YQCA 3N7KA 3TEXA 2D6PA 4FQZA 1HRV1 4BJ0A 1MZEA 3OSDA 1ENQA 4M3CA 4EN7B 3RZZA 2VUJA 3WF3A 2K9ZA 4HANA 4CEYB 2EXJA 4A7KA 3NL1A 4RD7A 1OBNA 2VNOA 5L73A 4CU7A 1A3KA 5C9AB 1Y4WA 2A6YA 1V70A 4FAGA 4BK5A 3GBGA 3CJIB 3U4XA 3S57A 2D98A 4MVTA 1OMIA 4FCAA 2VUCA 1AR62 4DRRA 1J3RA 1ODNA 5FZKA 4AVAA 2JDMA 2CL2A 2Y60A 2Q8DA 4FFGA 3PVBB 3M3CA 1UU4A 4CEYC 5JI7A 3ILFA 3O0XA 3OF1A 4Q0VA 4YWAA 5JVVA 4BXFA 1QOTA 2XPJA 2ZHNA 4LHSA 3H1WA 5C9AC 1LAJA 2IXIA 2XWBB 4BQ2A 2ZACA 3CJIC 3DF0A 4IEXA 3QD6A 2A75A 2VZ3A 4BXSV 1JTZX 4HETA 3FFZA 2XVLA 3IDEA 3ZN6B 5A6ZA 2HBUA 5FWEA 1I1EA 1RUOA 1QOSA 3UJOA 4E8CA 1AR61 3P1IA 4DS0A 4HKOA 2WO1A 1NT0A 1BEV2 2JD4A 2EIDA 2PHTA 3KCYA 4K7JA 1WBLA 1JODA 1AXKA 3AVRA 4UBGA 2VBPA 2W46A 4LO8A 1RVF2 1RUF3 3RGBA 3VL9A 3N9PA 1CAUA 2ZKNA 2YFUA 5LK5A 3VD5A 1Q8VA 4AVSA 4E4SA 2A73B 5JXGA 2H0VA 2VR4A 3OD4A 3IZOA 2YC0A 3VZKA 1LODA 1LULA 2W87A 3K77A 3LOIA 5FZ7A 2ADDA 4GD4A 1GOFA 1UPIA 1W9WA 2GAUA 1UY2A 3FZ3A 3I59A 1BEV1 5TSWA 5BNPB 1S0CA 2DBNA 2GN3A 2B45X 2MEV3 1RVF1 2BWCA 5C3RA 4E4HA 2R30A 3GF6A 3D8CA 1D4M3 1SDWA 2R32A 1XNTA 3LAGA 4FFIA 2RR12 5DABA 2HWB3 2QFEA 2XQRA 1DQ6A 1MS9A 2ILMA 2R16A 3IIAA 3LA2A 4F83A 5A70A 1OHFA 3LA3A 1PO23 5FZEA 5GLZA 5LY2A 5BNPC 4TYSA 5JXJA 1NLQA 2W1SA 4COYA 4NR1A 3GCWA 4C1XA 3J4UH 4XCAA 1VIWB 3HD8B 1C8M2 2YZ4A 4AW7A 4J6GA 3SH4A 4D8MA 5JDBA 3ZN4A 1SZBA 2ERFA 1YC61 3AMNA 5FUIA 1HRI2 4B7EA 1G6NA 2RR11 1FXZA 4FQ4A 3WF1A 4KBBA 2WAAA 4IE6A 2I07B 1NOVA 3CO2A 4KWLA 4P9IA 3T4VA 1ZZ8A 4OLLA 2DBIA 4MGKE 4NPRA 1YJKA 5C71A 4KG8A 1PO12 3ZPYA 4CUBA 1JZ4A 3MV01 1I6XA 4P9JA 3TRSB 1C8M1 4AFMA 4HK9A 2EIBA 2QQUA 3B01A 1AYN3 5EV7A 3DKQA 5C4WB 4YVSA 2VZRA 3PUIA 1HRI1 3THTA 5T3NA 1UW8A 3PJYA 1VE0A 1W8HA 3FUOA 4ZXKA 5LA1A 1CPNA 1RUD3 2Z79A 2FDIA 2VMHA 1EAH1 4P02B 5C4WC 1PO11 1AX0A 1J1LA 3AKSA 1RUJ3 1CAWA 2YUEA 3ACFA 2JXAA 3RZLA 5CADA 3NNJA 2WQ8A 3OY8A 1ALYA 1BJQA 3FHAA 3W58A 4A4AA 4W6WA 4CXXA 4MXVA 5FKCA 1POV3 3FBMA 5I0UA 3I2DA 5KHGA 4M4PA 3C7EA 2VC9A 3SCHA 4FAHA 4CEYA 4NRMA 4OHZA 4L99A 4MSVA 1Y3TA 1AR73 4XAEA 4XXPA 2IXJA 5C9AA 3WOGA 1FPN3 1YJLA 4XDOA 3CJIA 3GJBA 5FKBA 4XJAA 5FXWA 5T54A 1W39A 3MLLA 1KGYA 4QD2A 4OQ9A 3TWIA 2NYYA 2R072 5FQ0B 2G19A 4CUAA 1RL3A 2DCKA 3ME2A 4YW6A 5BNQA 3POWA 4A44A 4Q0QA 1D7PM 2QJVA 1Q5OA 2YDEA 3KV9A 2JDAA 3LOBA 4CEWB 2Z69A 5DDJ3 2FCVA 1EUTA 2QBXA 4IE4A 4XF1A 1H2NA 4X6QB 5FBZA 3RNSA 4RR3B 5EJ1B 5E16A 3ZN6A 5DMYA 3FUQA 4UXAA 3DXTA 4JV4A 2R071 3N4MA 3I49A 1MEC1 1W3VA 2ZAAA 3WNNA 4DO0A 4BU2A 3IKWA 2Y6KA 4CEWC 5F3EA 2A3XA 1UX7A 3UGGA 3O1OA 1H2LA 4XQDA 5DAQA 3PURA 3SITA 4AGGA 1H2MA 4RR3C 1LOFC 4NUBA 4H3WA 4LUKA 3PUHA 4U2AA 4XFIA 3WW1A 4IDZA 1VRBA 3AZZA 1CONA 2X5IB 3N7JA 4HKWA 1NLRA 3B02A 1BZWA 4QQOA 4R52A 1SDDB 3EXUA 4PJYA 3UL2A 3WCRA 1EP0A 4MG2A 2CYFA 3VKOA 4UBHA 2DFCA 4EN0A 2Y0OA 3LD8A 3E6BA 4KI5M 1MQTB 3WR0A 1MS3A 3W20A 3M4FA 4LK7A 4XAAA 4AVVA 5JAXA 3V0AB 4ISQA 5FOJB 2X5IC 2WIIB 5FYHA 3WUCA 2AH2A 3KVBA 4JTNA 5FMBA 2C26A 4JX0A 5GLTA 4LIVA 3Q8CA 2TUNA 2Y38A 1AL23 4P9XA 1QEXA 2UURA 4AAPA 4FPCA 1RUE1 4Q27A 3PTRB 4QXCA 5FXXA 1W6NB 1MQTC 2WA3A 3NSTA 4QWNA 5IFPA 4YW4A 4Q1PA 3Q9OA 5F39A 3VHPA 1DLLA 1UY3A 1S0DA 5EP9A 5IAXA 3UKTA 5IVFA 3GDBA 3B9IA 1JZ8A 2Y0IA 4Y5Z0 1SPPB 4W6YA 3WDYA 4AK3A 4BA6A 3TNPB 4AEDB 5EQUA 5FUNA 2VQ0A 1W8WA 3R4DB 3WNPA 2ZZJA 2QUOA 4CUGA 2JDUA 1OURA 2BGCA 4FO9A 1BVP1 3ZDVA 1AVBA 4BQWA 3NQHA 1UNBA 2C1FA 2ZMLA 5FZ1A 3O1TA 3DKWA 3AKQA 1VRH3 2E63A 4Y5TA 3USUB 3ZDSA 4A42A 4BIOA 4XJ8A 5IVBA 2GN7A 2V4AA 2YPJA 3LSEA 1ND3C 1O3RA 1BHGA 2WQ4A 4AEDC 4L11A 3NV2A 1VMHA 3P5BA 4IEWA 4NAOA 5C4WA 5F6KA 3UT0A 1QGLA 5A3OA 5CBLA 2CNAA 2QQOA 3UKNA 2R0HA 3M3IA 4LHKA 1H6YA 3HNBM 2J1SA 3K3NA 4OMDA 1UF2C 4YGEA 3VKFC 4BMEA 1WBFA 4QKNA 1AR83 1UIKA 2XBO3 3WW2A 1H30A 4XBLA 5KR7A 4JGYC 4PIXA 1NUKA 3FFQA 3K48A 2CGOA 2V4VA 3T1LA 5GLUA 3FJSA 3KF3A 1H1MA 1J59A 2QDRA 2LUWA 2WNEA 2Y64A 1C1LA 1K45A 3MPPG 2X05A 3SKVA 2A7AA 4Z82A 2ATFA 3IAPA 2PAMA 2GP3A 2WS92 2TEPA 1ZM1A 2C6SA 4NIAA 2XHNA 4Y3OA 3T30A 3AX4A 2XMLA 2VZPA 3ZIXA 2E6VA 4XMAA 4RA0A 1HQLA 2Q0AA 2ZS6B 2BWAA 1ZX5A 2GNBA 3EBRA 5A3TA 4AI2A 5CB7A 1PHMA 4XEZA 1OOPB 2NP0A 3QLQA 3GJAA 1XNDA 4I3GA 5LRRA 1SQ4A 2XJPA 3GHMA 3N9LA 1PX4A 4RQPB 4XJUA 3TEZA 1UZ0A 2RS31 3MUZ1 3JD72 4OZXA 3WDUA 3NVCA 4K1YA 2ZX1A 3OYWB 4OHXA 3ZYBA 3ZXAC 1FOD2 5FQ0A 5A7WB 2IXLA 4GMP1 4RGAA 3KB5A 1OLQA 1WA6X 2WINB 1CD3G 4I09A 1OOPC 1R1A3 3L2HA 2DVFA 4ATEA 5KXCA 2CGPA 3OPTA 1VBE2 4RQPC 2HBTA 3AKRA 3TAYA 3VKLA 2XLFA 2ZX0A 2GSYA 3FC0A 4HPKB 4QU2A 1NA1B 4XF9A 4XURA 1U5IA 2HWC2 2C24A 2TNFA 2SLIA 4Y4RA 1H9WA 2W1UA 1LOFA 3JD71 3K3OA 1JUHA 1MVEA 4RR3A 1C1FA 1AL0G 3NO8A 1DZRA 1FOD1 1ULDA 1V6JA 1VMJA 2ZMKA 3ZX7A 4BWOA 1CJPA 3WDWA 3ZN5A 1W2OA 3LIHA 4AQTA 1BLZA 4PIYA 1YLLA 4WVVA 2DU1A 1NA1C 3HT2A 3RZHA 2WFF2 2NZ9A 3ZSKA 4W50A 1QIQA 4HN0A 3SXWA 1TMF2 3WF0A 3IDCB 2Q1ZB 5A33B 3E5QA 1KFUL 2HWC1 2X5IA 3S7IA 1RHI2 1XYPA 4CCLA 3TN93 1CIYA 4RHV2 3HNYM 1YEWA 5FYZA 4LO4B 2PLV2 4UFMA 4NIHA 2WSUA 4LMFA 1VBC3 2P3YA 4Q4V3 3MO4A 1LTEA 1XRUA 5LA9A 3I4IA 2HWE2 3MUY1 1P8JA 2LS6A 4JRAA 1AR92 1N1SA 2VNVA 4FFFA 4DINB 2WFF1 4DXTA 3V0AA 1FAYA 3VHOA 4CP9B 1QJY2 1UOFA 3T2PA 3FLRA 2VVEA 2YMZA 4CDWB 4XFGA 2ZBJA 1YCIA 3MFCA 1VBA3 5EYXA 2P17A 1RHI1 1TNFA 2ZJCA 1US3A 3R0RA 4XDQA 4YYOA 2FHRA 4RHV1 1AJKA 3QCWA 1URXA 3E97A 3OBRA 4JHZA 2PLV1 1NZCA 5DZFA 4OI4A 4AYUA 4BK4A 4EQVA 1TNRA 2HWE1 1A78A 4Y24A 1IKQA 3C2UA 1AR91 1JHNA 4CDWC 3KS7A 1J84A 1UU6A 1NE4A 2D43A 5DZGA 2FZ1A 3PL0A 4AFCA 1ZRRA 1GP5A 1QJY1 1SPPA 1POV0 4YFWA 5BNPA 4AEDA 4KU7A 4LE3A 5FUPA 5F7UA 2BW8A 2E7AA 5IT6A 5A32B 4DEVA 4ZZ8A 4G9SB 4NPLA 2V73A 1FNZA 2A71A 3CU7A 3OUJA 2JIJA 5ANNA 1OA4A 2V72A 5FYBA 5K8SA 1W9FA 2K46A 3KT7A 3USUA 2AZ5A 1C57A 3N7MA 5FZLA 4NHLA 5FZ0A 1NAEA 2EIGA 3LQCA 4OCTA 5FDBA 4S2GA 5FWJA 4LOTA 2W94A 2WZR1 1GOHA 2Y6FA 5DAXA 1O59A 4R9DA 2YC2A 1SMVA 1IQAA 2RE9A 2ARCA 3BTAA 3PU3A 3JUUA 5JSRA 4O65A 3ZXKA 1ZZBA 1NXMA 1V9U3 1TG7A 2AYHA 2RJKA 4KQ7A 1OD3A 2VBDA 3ZO0B 5LEKA 4NVPA 5LK7B 1SLIA 3I2KA 1YUDA 2PAEA 4LKFA 1NCQB 4GQ7A 1GUIA 5F2SA 4XF3A 1W0OA 5JR2A 4XTMA 1NKGA 4LBLA 4QGNA 3VZLA 2IFRA 4COVA 3U37A 4D6QA 1UOGA 1HJFA 4JVAA 2L9LA 1JI6A 2WC2A 1S0FA 2WNVB 5D1IA 2WNUB 4Y1ZA 3SCGA 1NCQC 3CZUA 3TNQA 5F37A 4MLOA 5IVVA 1GLHA 3VLBB 3RMXA 3DYOA 3MI8A 5IVCA 4TXWA 1QJU2 2VG9A 2BERA 1OQEA 3KMHA 1OOPA 1ENRA 3O0VA 4IEQA 1OQDA 1RUH3 3JB4C 3I2FA 1H9PA 1UMIA 4PBOA 1ZVFA 4RQPA 2WNVC 5FZ6A 1Y9GA 2WNUC 1YQ6A 1JOPA 2WLPA 1F8VA 2LROA 4JQTA 1PVC2 3GGLA 2DUPA 3OYWA 1I5PA 2EVXA 3AFGA 4M00A 1HN0A 5A7WA 3I3MA 3CKHA 4XJZA 5IK7A 5CZKA 3NKGA 1WCKA 3B3QE 4KNCA 1E5RA 2ZGUA 4ZONA 1SBFA 4RSUA 5E89A 3O1UA 4XVHA 4HPKA 1PGW2 3W9AA 5I0TA 1NA1A 2J1AA 2WT1A 3O12A 1TEIA 3K51A 4CCKA 2UY8A 2DTYA 1GQPA 1SCSA 2WN3A 2P3KA 3KSCA 1PVC1 2ZGMA 3TBDA 1E5HA 1YI7A 1WW5A 3AL6A 2Y8KA 1ST8A 1UKGA 4H7LA 3HN1A 3O1VA 4Q29A 3SH3A 4C0BA 4MO3M 3BODA 4KH9A 1F5FA 1SCRA 5FJKA 2QZ3A 3M2MA 4JAAA 5SV8A 4NIGA 5A7SA 4B3NA 1GZ9A 1PGW1 1R093 4FBFA 5A33A 4LUMA 3CMGA 4IW3A 3RZKA 4TLGA 1JYVA 1RXFA 3IWZA 2HWF3 1IS3A 3BIEA 1LOAA 2JENA 1YFXA 3LB9A 1RUI3 2HEVF 4QX0A 3WY6A 3ZFGB 2Q8EA 5A1AA 4BB3A 1RUG3 2DTWA 1WMEA 3KQRA 3BVCA 4GWMA 5LASA 2GC1A 3CJXA 3INAA 2AREA 2ZHKA 4H7MA 4CP9A 4MGQA 3NNLA 2MNGA 4DRVA 1W6PB 1COV3 1HIXA 3M70A 4DZGA 1HV1A 4CDWA 3LPFA 3PLQA 4XFHA 2G9FA 3ZFGC 5F5QA 3HOBA 2QQVA 1QNYA 5FP3A 5B4NA 1NCRB 3A23A 3BCWA 1SFPA 4YM2A 3JXSA 2AEZA 5T55A 1V6MA 5I91A 5DZEA 1GZTA 3JBG3 2XOMA 5CEHA 1OA3A 1WLTA 4QDRA 2QQMA 2XVGA 2Y6JA 5A3PA 3AKTA 2OS2A 3NJVA 3WQBA 1ZBE2 5L9VA 2A6ZA 5F9TA 3AMQA 4DXSA 4LO6B 4XF4A 1NCRC 3B93A 3O7OA 3P3PA 2WZPP 1L7QA 3M3QA 4Y1XA 5IK8A 3R4SA 5A32A 5LATA 5I8YA 2LW8A 1OD5A 4QQPA 1K5JA 3MBWA 4DB5A 3VBRB 1IOAA 1AXYA 1HQWA 1HXS2 2R49A 3ES4A 3LZZA 4A3XA 1CZVA 1HRV3 2IVIB 4V2WA 4EV0A 3PNAA 1KFXL 1N1YA 2QTWB 2P3JA 4XC9A 3N7LA 1ZBE1 4CCNA 4GJZA 3FHQA 4E4DX 4FTBA 3PVNA 4AG4A 3TEWA 3VBRC 5FO9B 1GU3A 3MZHA 1W6QB 4O9GA 4A7YA 4NIDA 4RN5A 4YGCA 1LEDA 4DFSA 1HXS1 1VBB1 1PGSA 2BVVA 3AKPA 3WHUA 3POBA 1NCQA 2WO7A 1UQXA
chains in the Genus database with same CATH topology
1O4ZA 1C8NA 1IPJA 1UKRA 1YI9A 4P9GA 3RMYA 1YRZA 4Q8LA 5JCTA 1VAMA 1TME2 1SEFA 2WNVA 5I8SA 1JH5A 5FRAA 4QQ2A 2BNOA 1AR63 1OPOA 4ES9A 5E8AA 1Z7S2 1X8EA 2JDZA 4HN1A 3VBSB 3AZXA 4FOWA 4QPIB 5FMOS 2UY9A 3GZUC 2Z2SB 5FMOL 2R042 1VBD2 1Z78A 1EV11 4HSJA 1TME1 2WKKA 3H50A 4N90A 3VBSC 4QPIC 5JSPA 1MACA 5JZGB 1BEV3 3WW3A 4IETA 4NHKA 4R4ZA 1C3HA 1RVF3 5GM0A 3WQ7A 5JWPA 5GZCA 5KC5A 3WQ0A 4TLFA 2ZZQA 3KZ4C 2R041 1VBD1 2HWD2 4Q4X3 3NWKA 3VL8A 5JZGC 1K5MB 2ZPXA 1TQ5A 4BIFA 3NV4A 2C5DA 2RS12 4AFAA 2ZGLA 4LE4A 2BBVA 1MZ6A 2BUKA 1GR3A 4WZCA 4QQHA 4C90A 4I0WB 4YM1A 1LESA 1G9FA 1VALA 4M3CF 5IUQA 4AHXA 5HBAA 1GQHA 3FBYA 4AEMA 1DGRA 3DPRB 2GNDA 1K5MC 1UIJA 2IC1A 3ZXJA 2B9UA 2HWD1 2Y26A 1QH6A 2W52A 4AEJA 3ZFGA 4K9SA 2RS11 4AHWA 2PHUA 5LEJA 1AXZA 1AHSA 2ZCWA 3H3UA 1S0EA 3DPRC 4OI0A 2HKXA 1C8M3 1W6PA 1AYM2 1LHOA 4OUMA 1DZTA 2IFWA 2WWSA 1NCRA 1QQP2 2OIIA 3MW3A 5H9RA 4Q8KA 2VECA 1AZDA 4LA2A 5IK4A 4YSFA 3VZMA 5B2GB 1EAH3 3E5UA 1N3QA 1QMJA 3RJRA 3S30A 4EROA 1AYM1 3AYAA 3DN7A 3CL1A 3FX3A 3BALA 3VZNA 2BFUS 1WMFA 3VBRA 2FMYA 4Q4W2 3TB0A 1AJOA 2BFUL 2FMDA 2QCSB 4BCUA 1RUC2 3U11A 1ENSA 1Q43A 4Z2WA 3T2TA 2D97A 5JIUA 1RJ7A 2ZKLA 5AC93 1FV3A 5AFBA 1DQ1A 3ZFEB 2K0GA 4QGMA 2VULA 1UN1A 1W6QA 1N3OA 4IEYA 4AHZA 3MIFA 1VAVA 4Q4W1 2XJRA 2D6MA 2UYBA 4INDA 1RUC1 3E6CC 1UZZA 1DZQA 2P3IA 1BXHA 2X29A 4FP2A 4K40A 3ZFEC 2JG8B 5F6LB 3ATGA 2CWSA 4CZSA 3AM2A 4YM3A 3D0JA 3LSDA 4LHLA 1GNHA 1LHVA 2EA7A 4TSVA 1B09A 3SHRA 4MGYE 2R073 4RGGA 5FOBB 1MEC3 1DF0A 4WVZA 2GZWA 1IGOA 4IV1B 3FHIB 4CDQB 2JG8C 4COWA 3B69A 2DCJA 4QPIA 3VBSA 1PIV3 1SBEA 2DVDA 4IEVA 1V6KA 2PHRA 3D4KA 2WLQA 3DL3A 1O4YA 2C9AA 1LJ7A 1J1TA 4PCRA 5JLVA 4XJ9A 4BLJA 2CAUA 2PAKA 3VBFB 3QACA 4IV1C 1ONAA 4CDQC 3WP6A 4JGZB 3SLIA 4I02A 5L7OB 3ZMNA 3O0WA 5JZGA 1Q56A 3VBHB 3B5LB 1NE6A 3WDXA 3WLUA 1UU5A 3VBFC 2G4IA 3LGRA 2G9GA 4AGRA 4JGZC 2WQZC 2PHDA 2WSVA 4JDNA 4XPVA 5L7OC 4C1WA 1K5MA 3MF9A 1RUE3 4LBOA 1LHNA 1JBCA 1U0AA 1XE8A 3VBHC 1GV9A 3HQXA 2F4PA 5LRSA 4S2DA 2O8QA 1CPMA 1VR3A 4MYEA 2D7FA 1SLCA 3WX5A 4LNVA 5EXOA 5E88A 4XBQA 3AYEA 4ZU7A 2YGLA 3DPRA 4XBNA 3W59A 4AI3A 1SFYA 4P9LA 2MHFA 4MUVA 2RJLA 1AYN2 1WCDJ 3OGJA 4XETA 4YGDA 2BPA2 1DGWX 3ZSEA 1MVQA 1O5LA 4QPYA 1LOGA 2DWRA 5ACA2 1RUD2 4QT6A 5T52A 2VOVA 4YG0A 1RUJ2 4XE9A 5H9QA 3ZXDA 1NXD1 2XJUA 1C28A 4QPGA 1DDLA 3KD4A 5T50A 4N7IA 2GH2A 4ASMB 1UL9A 4K6BA 3PTYA 4IEOA 2D44A 5ACA1 1GICA 1RUD1 1HKDA 5T5LA 1WD4A 2BNMA 2NMNA 1ND2B 1U5YA 2ZGOA 3ZYPA 1C4RA 2V09A 4HLTA 5A3MA 4R9AA 1AR72 1RITA 1ENXA 2WA4A 2XJTA 1FPN2 2P2KA 3AYCA 4WV8A 1D4VB 2EALA 1G9BA 1ND2C 4RS5B 4NO4A 1KDKA 2NPIA 3J8F2 2XL7A 4XQ4A 4N7UA 3ZFEA 2RS33 2ZAHA 4R4XA 1FX5A 5DDJ2 3OD0A 2XJVA 3WG2A 3G7DA 3ACLA 4GMP3 4N9IA 1REEA 2W68A 4RS5C 1J3QA 3AP5A 2ZX2A 4A2UA 4PLMA 4OI2A 1ASJ2 2VH9A 4Q1RA 1LGNA 2JG8A 4Y22B 4HFSA 3J8F1 3MEPA 1RB8G 5DXDA 3JD73 1PK6A 3AMHA 3OGGA 3ZXEA 4LA3A 4ONUA 1RUNA 4XHXA 4K21A 1FOD3 1RINA 1NY72 1S0JA 3V64A 4IV1A 1U12A 2PA7A 4CDQA 4WBBA 4YW5A 2DYCA 4BH9A 1ASJ1 2ZGPA 3OBTA 4HKLA 2QQPA 2WT0A 1IZ3A 1KXGA 3VBFA 4J1XA 2A6WA 2VOXA 3CEWA 4WVWA 4JGZA 3WZ1A 1NY71 2ZGRA 5L7OA 1AL22 4GH4B 3VBHA 3HAGA 3WHTA 2PTMA 5CFDA 2DVBA 1UCXA 2WFF3 4Z1VA 4B8EA 3PHMA 4XZPA 2VVFA 1X33A 2OPKA 1JOJA 2QE3A 5CVRA 4GIQA 4MGZE 4W65A 1OSGA 4FXGB 5GALA 1LOCA 1RHI3 2ZX4A 1MR5A 4GH4C 3GZAA 4RHV3 2WS91 2PLV3 3APBA 3ZXLA 2HWE3 5FLIA 3NJZA 1AR93 3UK9A 4LBKA 4XILA 2WL1A 2BEOA 5CAZA 4AHYA 1LU1A 1QJY3 1UZYA 1Q8SA 3HIFA 4X8NA 3OTFA 3H7JA 3VN4A 4XIOA 4Q0SA 1RMU2 2R6QA 4FTEA 4OHYA 1R082 1YFWA 1D2SA 1AR82 2WZR3 1QOOA 2XBO2 5I8TA 2E9QA 1VBE1 4Z92B 1X36A 4D7SA 1DG6A 3VBUB 3VKMA 4I3PA 2Z5WA 4MGIE 1D0GA 1WUVA 4AI8A 2H6BA 5KBFA 1RTVA 4QM9A 2JX9A 1CIWA 2D5FA 2ZGSA 4GALA 5JOZA 4Y26A 4BLIA 2IWGB 4CDXB 2CWMA 3RS6A 4JDOA 1DQ4A 5JIAA 5AVAA 2XH6A 3GYDA 1RMU1 4I0AA 1GZCA 1B35B 1OQ1A 2GMPA 4NHMA 3EHKA 3VZOA 4FSJA 2O0OA 3VHRA 3VBUC 2CAVA 1R081 3S7EA 2VPVA 2XBO1 3B7MA 3V0BB 5JMCA 5CG9A 3MIBA 4LBQD 1CESA 1ND2A 1TMF1 4CDXC 3B9CA 1UMZA 4XFBA 3BB6A 1CR7A 1J58A 1B35C 5HCBA 1H8TB 4COZA 4IESA 4AQ2A 2RM23 2XKOA 2OYZA 3D0SA 4XHBA 1ZREA 5C33A 2ET7A 4QGLA 4RS5A 1RGSA 3M1HA 4GA9A 2QNKA 1H8TC 2DFBA 1VB4A 4JCKA 2DVGA 3AZYA 3QOPA 3NV3A 2XUMA 1QJX2 1AX1A 4J1WA 1CVNA 4K8FA 4FPHA 4G3YC 4HK8A 5BXXA 3I7DA 3RPQA 4XFFA 4EJRA 4PLOA 4FTSA 2CTVA 1ZBA2 4OULA 4Y22A 3ST7A 2Q8OA 4XOGA 3NKTA 1QJX1 2D40A 2W39A 1LGCA 2D6LX 2Q5TA 2ZGTA 3JB8A 3SNMA 4FP3A 4YZ2A 2D6OX 3MIGA 4AQ6A 5DG1A 4XMIA 1G86A 1A8MA 3TN92 4N9HA 4JQRA 2E51A 3O5SA 1CGPA 4IL7A 3OJBA 5A3LA 3B94A 1ZBA1 2XB6C 3A0NA 4XFAA 3ZXFA 2ZGKA 1TE1B 5JPNB 5I0SA 5D8AB 3X29B 3URFA 1DYKA 2JJ6A 4M3CE 3IMNA 3MW2A 1DGRN 1PM7A 2HJIA 4B7KA 2LTNA 2FBEA 1V6OA 4GH4A 2ZOEB 2R062 2AR6A 3AJYA 1J3PA 5D8AC 3UKVA 1E57A 3POSA 1RIRA 2GU9A 1GBGA 1YXWA 3RJ2X 4BM8A 2ZGQA 4QQLA 3WD5A 4YARA 4UW6A 3WP4A 3N35A 4DY3A 2GH8A 3KM5A 3ZYIB 2R061 4L92A 1C5HA 3AYDA 1JYIA 2PHXA 3WINE 4P14A 1QJU1 3WP5A 3BPZA 1EPZA 4LBQB 4DMIA 3ZXGA 4BOWA 1UX6A 4YW2A 5H9SA 2RMU2 3N3HA 3QH7A 4FVVA 4LLOA 1HW5A 4LBMA 5KXDA 1IHMA 5AVPA 5EJ3A 1ZZ7A 5C6CA 1XNCA 2ZHLA 3ZYJB 1ZBE3 2NMOA 2R1DA 1RC6A 3CLPA 2C0ZA 4GMP0 5J98B 4AI0A 1EPWA 3L2YA 4AXOA 3VBUA 4Y20B 4AWDA 3AP7A 2RS53 1IS6A 1BQPA 1FMD2 1ZA4A 2RMU1 3RRDA 4CDXA 1VLNA 2A6VA 4EN8B 1HXS3 1VBB3 2LALA 1B35A 2XJQA 5H9PA 3VZJA 5HXVA 1MS4A 3WDVA 3G6JB 3HMYA 1OLRA 3V0BA 1OI6A 1GFF2 4BPZA 1ULEA 3JQXA 3MLJA 5FAXA 1FMD1 1EY2A 1H8TA 1QWRA 4OVEA 4COUA 3MLKA 1SLTA 3IPVB 3WCSA 3B00A 3H8UA 1H8VA 2CGNA 2IXKA 2VQAA 4MX3A 1ULGA 2YY1A 3WT3A 4BYYA 4QMAA 4CTEA 2VOWA 3GHNA 2BNNA 1EV13 4Q0PA 3BOWA 2FZ2A 1TME3 4YW3A 2Q4SA 2YHJA 4D7TA 4E2SA 3EQEA 4E2QA 3DUIA 1HLCA 4AVTA 2OVUA 4CP2A 1H2KA 4ATFA 1WA4A 3ZSJA 4CYDA 4BE3A 1X8MA 1PMIA 2JE9A 1PNGA 2R043 4D7YA 1VBD3 2X53S 5KHJA 2YXSA 3AMMA 2N7GA 2V5YA 4BMBA 1Y9QA 2ZGNA 2AUYA 2HWF2 2D6KA 1MZFA 4B4RA 4BQ1A 1OFSA 5J37A 1RUI2 4FPLA 1S2BA 1WMDA 4YLZA 1LU2A 2P37A 4D94A 5D8AA 1X50A 4E27A 1QJZA 2HWD3 4HL0A 2AENA 1H0BA 2JECA 4YM0A 5KHHA 1CN1A 1VAKA 2QZ2A 3LWCA 2RS13 4KWKA 5JSOA 5GLVA 2D3RA 4JTOA 3JBG2 1Q8OA 4X8PA 1LB2A 2GALA 3AP6A 5BPXA 3QBQA 2EXIA 2VMGA 1WW6A 3RDIA 2H0BA 1GANA 4YZ3A 1XNKA 2A6XA 1OA2A 4O9EA 5K7PA 1XU1A 5FFOC 1S1AA 1Z7S1 5DUVA 2R1BA 3FLTA 4I2OA 1KQRA 5JR7B 1AYM3 4LBQA 3RQ0A 1T6GC 4HZFA 4ZU5A 4N43B 1XXNA 1BVVA 4KGGA 1N47A 2VY0A 3MF6A 4IXLA 4Y1YA 1O5UA 1WCSA 1PGL2 1O3SA 4URTA 4HVRA 1JXNA 1F2NA 1LHWA 1JN2P 4GB32 3MDPA 5T5PA 4N43C 4XFCA 4AI1A 1SLAA 1BYHA 4Y20A 1GNZA 3OPZA 2P34A 3VV1A 3WVJA 3V65A 3ROUA 1LKNA 2RR13 1GSLA 3IM0A 4Q4W3 1BBT2 2WT2A 1PGL1 1RUC3 5JPMB 3V56A 4DXZA 5FLJA 4JDMA 4GB31 1D2QA 4XTPA 3TYJA 3AFKA 1CQ9A 1V6LA 1DU3D 2LM3A 3POYA 5GZDA 3VUOA 1HRI3 2VW2A 2OA2A 3IPVA 3M7AA 2VXRA 5KWRA 1BBT1 4Q4Y2 4XIKA 3JU9A 5BNOB 4QPGB 3RYKA 3H0OA 5CFCB 2B5HA 2PHLA 4LR4A 4GXLA 5BY5A 1PO13 4WM7B 5K9YA 4Y1UA 1M06G 5KC6A 1SFNA 4XJWA 2ENRA 4W6XA 5BNOC 4QPGC 1QQP1 2DV9A 3KGLA 2EXHA 5HI0A 5CFCC 4WVMB 3A0KA 4EWEA 4ZKTB 4Q4X2 4Q4Y1 2GDFA 5EFUA 2KA3A 4WM7C 4OI1A 1FATA 1WLWA 2A3WA 3SH5A 3JZVA 1OKQA 5DUWA 4LLFA 3USSA 1BKZA 2OZJA 4I30A 1XNBA 5J96B 3VKNA 2CV6A 2VNGA 5I0RA 4EN6B 1LENA 1F5JA 2OUHA 3ASIA 1W0PA 1ZYBA 4Q4X1 3WNXA 2Z42A 1DHKB 1DGWA 2XKPA 2ZX3A 4S2FA 4S2HA 4PIZA 4XW3A 2I2SA 3MICA 2CY6A 2XL9A 4PF5A 4AQSA 2DURA 3M8LA 1YFUA 4META 3BOPA 2XG3A 1NQDA 1WW4A 1RUF2 2JG9B 4Y4YA 1PK6B 5J09A 4NOTA 1XE7A 2PHWA 4UW5A 3GBWA 2ZMNA 4BZ4A 1REFA 1DIWA 3MYXA 1LGBA 2NQYA 3O14A 1IS4A 3VBOB 2QVSB 3KGZA 5FTTC 4KL1A 1EAH2 1MS8A 2JG9C 1PK6C 4IQPA 4XYXA 1WLDA 2MEV2 3AXEA 1RUF1 1FYUA 4B29A 1D4M2 1NLSA 1S0GA 3VBOC 1XYOA 2HWB2 1DYPA 4Z07A 1QNWA 4E4ZA 5ACA3 1PO22 1XQNA 3RG0A 4E2GA 5CFDB 1BCXA 4BHPA 2D93A 1KRIA 4YW1A 4DOUA 1ULCA 1V6IA 4IV3B 4WM8B 1N1TA 1ZRCA 3JCIA 4N43A 1ZZCA 1A6CA 2DCTA 4PQ9A 4I0BA 2MEV1 1IPKA 5AC92 3AZWA 3C3VA 1BMV2 1OFNA 1D4M1 4EWDA 5CFDC 4QHBA 1MS0A 2B7YA 2HWB1 2D3SA 3AP9A 3D82A 4IV3C 4UW3A 1PO21 2H6CA 4WM8C 4ASLA 2GMMA 3HBZA 4YNIA 1SBDA 1YFYA 1QXJA 2A70A 2DCZA 3HR9A 1QKQA 1F31A 3PVEA 5EZWA 2JE7A 4ES8A 1WW7A 5AC91 5GKAC 1HDKA 2F6BA 3FWEA 1BMV1 1M4WA 1YYNA 2VUAA 4Q0UA 3E5XA 3SCFA 2QDNA 1MEC2 3LKJA 5K0UB 3ALQA 4OUSA 4PBPA 1CAVB 1QDCA 3J8F3 2I74A 1MS1A 1MS5A 1PIV2 4FT8A 2A3YA 3IN9A 1ZNPA 1KS4A 4ISRA 3RWNA 2OZ6A 2PQQA 4PLNA 1S55A 3WUDA 1AYN1 2VOKA 3EJKA 3ILNA 3ZFFB 5BNOA 5FLHA 2HEWF 5K0UC 5EWSA 5CFCA 4XXAA 1XU2A 2JICA 3KCCA 1ASJ3 2DCYA 2WJSA 4P5HA 4WM7A 1YIPA 3ENRA 4JC1A 4FOVA 1QH7A 4AF9A 5I93A 5J3UA 3KT4A 1PIV1 3AMPA 4L9BA 3ZFFC 2XVKA 4B4QA 1RUJ1 4WVMA 1FNYA 2UYAA 4K3UA 4FPFA 1LOBA 1RUE2 2Q1MA 3UJQA 5JOWA 4UW4A 5C8CB 2XLGA 3J26N 1U5XA 1OPMA 3HWJA 1POV1 2YGMA 4QX5A 1X82A 1V00A 2PFWA 3DGTA 2TBVA 2WS93 5J48A 4NWVA 3D5OA 1AR71 3U07A 3MW4A 5C8CC 1FPN1 4GKXA 4OHVA 1PZ7A 3RYRA 3U10A 4AVCA 2OUJA 1D0HA 3A4UA 1O91A 5EYYA 2QKDA 4R9CA 1PNFA 3AK0A 5HCFA 5J36A 2JG9A 2ZA9A 4LO5B 4LO7A 5DDJ1 2XLAA 1H4HA 1ND3B 3VDDB 4F7ZA 1W2UA 1SACA 4C0HA 2PELA 5CA6A 4FPOB 3MIEA 3RYPA 1LCLA 1VB2A 3DV8A 1G7YA 3VGIA 4ITCA 3T1MA 3VBOA 1VBE3 4YVWB 2UWCA 4FPYA 4K1ZA 4D69A 2D3PA 3VDDC 3UV9A 2HWC3 5GZGA 4JGYB 1I5ZA 5E1RA 1KITA 1VP6A 3H1MA 1JUIA 2UWAA 4AEKA 1RMU3 1WLCA 3ZYRA 4FPJA 1O3TA 3WG1A 4YVWC 2DF7A 3FE5A 1R083 4LBNA 4R8HA 3H1YA 4D3WA 2EXKA 3LCPA 4YZ4A 4I01A 4IV3A 4WM8A 3WG4A 2YYOA 1TMF3 2O1QA 3E6DA 3D6EA 3H3ZA 1WD3A 3VHNA 1XYNA 4CRQA 2DU0A 4LBJA 2RHPA 3L9JT 1QDOA 5DUXA 2PN5A 4DQAA 2RS32 4NWWA 3U0ZA 4GKYA 1NG0A 1H4GA 1JYCA 2HYKA 3IDBB 1AL21 3H7YA 4JRLA 3WG3A 2KM2A 4KU8A 4YZ1A 2XHKA 1VRH2 3BU7A 4EN9B 2IXHA 2ET1A 3SISA 1GYKA 4AFDA 3ES1A 3ZMOA 5KXBA 1QHDA 3AXDA 5JOXA 5CG8A 1W6MB 5FO7B 1I9RA 4KG0A 2GNMA 3N36A 1O3QA 1DGLA 1HV0A 3GNEA 5K0UA 5T5OA 1VRH1 1CAVA 4FPGA 1Y43B 4P9YA 2IZWA 4KGQA 4YGBA 4IEZA 4Z8BA 4CEWA 1X7NA 1QJX3 1HX6A 4OHWA 2MPFA 1IS5A 3ZFFA 2PHFA 3MIHA 1ZZ9A 2PYTA 3FLPA 1ZBA3 1G9AA 1AR81 2GNTA 3NAPB 5CIRA 5F1RA 2Q30A 1DFQA 1UD1A 1DQ5A 1FT9A 1WGPA 4TZDA 4N53B 3SMHA 3FMGA 3WXPA 2O8OA 5L19A 4K20A 2KXLA 1NYWA 1LR5A 3PJQA 4KWJA 2GC2A 3RI8A 3KT1A 4F3JA 3NAPC 3R4UA 2VVDA 1ULFA 4FPEA 4L2NA 5C8CA 4N53C 3ZYGA 4Q2FA 4EWAA 1KJLA 1R1A2 1MQTA 1YIFA 3ZSLA 3ZSMA 5GLWA 3IT8A 2YV8A 3WQ1A 2BQPA 2D6NA 5GJ6A 1UAIA 4RL7A 4P9WA 2ZTNA 2BVBA 2R063 2B8MA 2VNRA 4MXWB 4HMZA 1W6NA 4YG3A 2ZHMA 2E7TA 3MIDA 1QJU3 2XWJB 2R0FA 3S0MA 3NW4A 4HVQA 1R1A1 4H55A 4CDUB 2WZR2 5ABJB 3S6PA 1DQ2A 3I54A 1AX2A 4LHNA 2EAAA 1W6OB 1PVC3 3CNAA 3VDDA 1ND3A 2IXCA 4GULA 3AZVA 2XJSA 4XF0A 3ZVXA 1O7FA 1GKBA 3ILRA 1U5ZA 4LTAA 2GMEA 4CDUC 4Y1VA 2ARXA 4Q4V2 1S0IA