5C8CB

Crystal structure of recombinant coxsackievirus a16 capsid
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
310
structure length
286
Chain Sequence
ENSNSASEGSTINYTTINYYKDAYAASAGRQDAPPLKSPSAEACVAQLTIGNSTITTQEAANIVIAYGEWPEYCPDTDATAVDKPTRPDVSVNRFFTLDTKSWAKDSKGWYWKFPDVLTEVGVFGQNAQFHYLYRSGFCVHVQCNASKFHQGALLVAVLPEYVLGTIAGGTGNENSHPPYATTQPGQVGAVLTHPYVLDAGIPLSQLTVCPHQWINLRTNNCATIIVPYMNTVPFDSALNHCNFGLLVIPVVPLDFNTGATSEIPITVTIAPMCAEFAGLRQAVKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VP1
publication title Structures of Coxsackievirus A16 Capsids with Native Antigenicity: Implications for Particle Expansion, Receptor Binding, and Immunogenicity.
pubmed doi rcsb
source organism Coxsackievirus a16 (strain tainan/5079/98)
molecule tags Virus
total genus 57
structure length 286
sequence length 310
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00073 Rhv picornavirus capsid protein
B PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5c8cB00
1COV2 1QQP1 2BFUL 4YVSB 4AEDB 1HX6A 5BNOC 1NY71 3IDEA 3VBHB 1FMD1 1VBD2 4RFT0 1K5MC 4Q4W3 3NAPC 1VB2A 3J8F3 1RMU3 3VBOC 5C4WA 4N43C 4GB31 2HWC3 1ZBA1 1PVC1 4Q4X2 1K5MB 3VBSA 4IV3A 3NAPB 5ABJA 3VBOB 1TME2 4RQPA 2WS93 4N43B 1ND3C 1COV3 2RR11 1MQTC 2WFF2 5AC91 4CDWA 3JD72 4RR3A 3VDDA 5A32A 1VBD3 4Y4YA 4GH4A 5CFDA 4BCUA 1ND3B 2VQ0A 3VBFA 1V9U3 1MQTB 1PO22 1MEC3 4Q4W1 1IHMA 5C4WC 3J8F1 1RMU1 4FTEA 2HWF2 1RUD2 2RMU2 2TBVA 3VBSC 1TME3 4IV3C 1BBT3 5ABJC 4RQPC 1AL0G 2WFF3 5C4WB 1RHI1 3JD73 3VBRA 3VBSB 4CDWC 2WS91 4RR3C 1R081 4IV3B 1COV1 3VDDC 5ABJB 1R1A2 1FMD2 4GH4C 5CFDC 4CDUA 1NOVA 4Z92B 2GH8A 1PO23 3VBFC 1VBD1 3FBMA 4CDWB 4RR3B 3VDDB 5A32B 4GMP0 1V9U1 3ZXAC 2HWF3 2RM22 1HXS2 4GH4B 3ZFEA 2RMU3 5CFDB 2ZAHA 1EAH2 4RS5A 3TN92 3VBFB 1BEV3 1TME1 1RUF3 2WLPA 5AC92 1POV3 3VBRC 2ZTNA 4SBVA 2DF7A 2WFF1 3JD71 1R082 5ACA2 4CDUC 2ZZQA 1VBE2 3VBRB 2RM23 1HXS3 3LOBA 1PO21 3JB8A 3TN93 4QPIA 3ZFEC 4CDUB 4RS5C 4FSJA 2HWC2 1QJU2 2HWF1 1RUD1 2RMU1 1QJY3 1VRH2 3ZFEB 3ZFGA 1FOD3 5ACA3 1VBB2 2RS13 2RS32 1R1A1 1VBE3 4CDQA 1AR62 5J96B 1TMF2 1V9U2 2HWE2 1PGL1 5BNOB 2BUKA 4QPIC 1MEC2 1QJU3 2RM21 1HXS1 4CEYA 1EAH1 1RUI3 1D4M2 3TN91 1VRH3 5L7OA 1B35A 1ZBE3 5BNNA 4CDXA 1BBT2 2GSYA 4QPIB 1VBB3 2HWB2 3ZFGC 2RS33 1BMV2 1AR63 1FOD1 1PIV2 4Y5Z0 5ACA1 4JGYA 4CDQC 1TMF3 2HWE3 2RS11 3ZFGB 1VBE1 1F2NA 2WWSA 4RHV2 1D4M3 2XPJA 4CEYC 4CDQB 4PDWA 2HWC1 1QJU1 5L7OC 1B35C 1GFF2 1ASJ3 5BNNC 1RVF2 1BEV2 2BPA2 1OPOA 1W39A 4CDXC 5CFCA 2HWB3 1NCQA 5GKAC 1VRH1 5FMOS 2PLV3 1FPN2 4CEYB 1RUF2 2MEV3 4QPGA 1PIV3 5L7OB 1B35B 1VBB1 5BNNB 4RQPB 1AL22 4CDXB 1QJX3 1NCRA 2RS31 4JGYC 1DDLA 1VB4A 1AYN2 1AR61 1PGL2 4RHV3 1AR82 1TMF1 1C8M2 2HWE1 3HAGA 1HRI2 1PO12 1MEC1 1NA1A 4JGYB 4EJRA 1RVF3 2RS53 4PDWC 3VBUA 3S6PA 1D4M1 5CFCC 4NWWA 4YVWA 1FPN3 1NCQC 1QJY2 1BBT1 1ASJ1 3M8LA 5C9AA 4QPGC 2HWB1 4PDWB 1AL23 1RUG3 1FOD2 5JZGA 1BMV1 5CFCB 1AYN3 1NCQB 2RS12 1NCRC 1PIV1 4CEWA 1AR83 1C8M3 1VBC2 4QPGB 1OOPA 4Q4V2 1HRI3 1PO13 1R092 1ND2A 1QQP3 2XBO2 1EV12 4RHV1 2FZ2A 1NA1C 1NCRB 3VBUC 1AR92 1RUI2 5LK7B 5J98B 1RVF1 4YVWC 1BEV1 1HRV2 1ZBE2 4N53A 1NG0A 2WZR2 4WM8A 1QJZA 4RS5B 1NA1B 5C9AC 1FPN1 1RUF1 3VBUB 4JGZA 4FTBA 5JZGC 1POV1 1RUJ2 4YVWB 4IV1A 1AL21 1VBC3 4CEWC 4Q4V3 1R093 5C9AB 3JB4C 1AYN1 2XBO3 1OOPC 1ND2C 1EV13 5JZGB 1AR81 1PGW2 1C8M1 1AR72 1HRI1 1PO11 4CEWB 1AR93 1VBA2 2FZ1A 1HRV3 2WZR3 1OOPB 3JBG2 1ND2B 1C8NA 1ASJ2 4N53C 1RUE3 1QJY1 4WM8C 2R042 1RUC2 1CJDA 1RB8G 1RUJ3 2PLV2 1RUH2 5C8CA 2MEV2 4JGZC 5A33A 5K0UA 5FMOL 5DDJ2 4N53B 4IV1C 1QJX2 4WM8B 2R072 1RHI3 2BFUS 2X5IA 1VBC1 1AR73 4JGZB 4Q4V1 1R091 1VAKA 1R083 2XBO1 4IV1B 1F8VA 1VBA3 1EV11 1WCDJ 3JBG3 1Z7S2 4NWVA 4GMP3 2RS52 1HQNA 1AR91 3CJIA 1RUI1 2R043 1RUC3 2BBVA 5BNPA 1ZBE1 1HRV1 2WZR1 1RUH3 1RUE1 4WM7A 5C8CC 5DDJ3 4Q4X3 1SMVA 1RUG2 1M06G 1AYM2 1RUJ1 2R073 5K0UC 1H8TA 3ZFFA 2HWD2 4Q4Y2 2X5IC 5C8CB 2R062 5A33B 1Z7S3 1PGW1 5K0UB 1QQP2 1AR71 1NY72 1VBA1 2X5IB 3CJIC 3JBG1 1X33A 5BNPC 4GMP1 4FTSA 3DPRA 2R041 1RUC1 4WM7C 1AYM3 4GB32 2PLV1 1RUH1 1ZBA2 1RUD3 5D8AA 2HWD3 1PVC2 2IZWA 2MEV1 3CJIB 4Q4Y3 2QQPA 1H8TC 3ZFFC 5BNPB 5DDJ1 4YVSA 4Q4X1 4AEDA 1QJX1 2R071 2R063 4WM7B 2RR12 3VBHA 1H8TB 3ZFFB 1R1A3 1FMD3 1AUYA 5BNOA 1Z7S1 1A6CA 2RS51 1K5MA 1E57A 3NAPA 1RUE2 4GB33 3DPRC 1ZBA3 3VBOA 4Q4W2 1PVC3 1CD3G 1EAH3 3J8F2 1RMU2 4N43A 5D8AC 1RUG1 1AYM1 1POV0 4YVSC 5FOJB 4AEDC 2HWD1 2RR13 3DPRB 1OHFA 4Q4Y1 4LLFA 1RHI2 1X36A 3VBHC 5AC93 1ND3A 5D8AB 2R061 1MQTA 2WS92 2Y26A
chains in the Genus database with same CATH superfamily
1IPSA 1QQP1 2YBKA 2BDRA 2CGOA 1IZ3A 2NYYA 4K20A 5FY4A 1LOEA 2XLAA 3B94A 1W0PA 3WF2A 5F9TA 1OF3A 2WT0A 1I3HA 3IDEA 5C3QA 1E5HA 4BIOA 1VBD2 3MUY1 1ZRFA 4RFT0 2XG3A 5FZOA 4OYUA 4OHYA 1KXGA 4AYUA 4E2QA 3ITQA 3M3QA 2J1AA 5F3CA 3WR0A 3VBOC 3JQXA 2HEYF 5IVBA 5K8SA 2Y6FA 1HB2A 1OFNA 3AKTA 4N43C 5IUQA 3GZTB 2HWC3 4GB31 3WG4A 5JOXA 1W99A 2FDKA 3CLPA 4QXKA 5FR3A 1PVC1 1K5MB 4DFSA 1S2BA 4MGYE 5ABJA 3NAPB 2RDSA 4BA6A 2Y64A 4XJ9A 4UT5A 4BK4A 4ES9A 1QNWA 1N47A 1W8NA 2V09A 2CV6A 4B4PA 3RWKX 1GUIA 1BK0A 3AVSA 1ND3C 3LE0A 3W21A 4XEZA 5B4NA 1ST8A 4F8AA 3RZMA 4KBBA 5BXXA 3RZJA 2WFF2 1V70A 5AC91 1J3QA 1E5SA 1UF2C 1WUVA 5A32A 5SV5A 3POIA 4Y4YA 1ZA4A 4XF1A 4BE3A 5CFDA 5FKCA 5FLJA 4XILA 4PI2A 2W92A 3ES1A 1V9U3 4XDPA 2J1VA 1MQTB 4PQQA 2Q4SA 2ZACA 5CISA 3MUZ1 5JSOA 1MEC3 3A23A 3TEZA 2A6YA 5J09A 3ZSJA 3WY6A 3IBMA 2PHXA 4I0WB 4LBLA 4YW4A 1BHGA 3K4AA 2JDKA 3CIHA 4MYEA 2YU1A 5A6XA 4K40A 4OQ8A 3H0OA 5EJ1B 3NKGA 2RMU2 3WDWA 3CJXA 3WNLA 4L97A 3POWA 3OOXA 5FQ0A 5LEJA 4LIUA 3B9IA 3HD8B 2D7FA 4KWKA 5FYSA 5D2AA 3E6DA 1AL0G 1OQDA 4AGRA 3O0VA 1OA4A 5JOYA 4MLOA 3VBRA 4LBOA 1JYCA 2A70A 2ZGNA 3D0JA 1U5YA 2ZMLA 3VBSB 3LIGA 4IV3B 2OIIA 4XCBA 3VDDC 4P9GA 3J26N 1R1A2 3FC0A 1UYXA 3KT1A 2SBAA 4FPKA 5IVFA 4GH4C 2YC2A 2AYHA 5BNOA 1W6NA 4R9AA 4W6YA 3UJOA 4Z92B 3BKZA 4GWMA 1SFNA 2Z5WA 1NX9A 2GZWA 1GICA 1J3PA 1W8HA 1IGOA 1WMXA 1ULGA 2A6XA 5FZBA 5JXGA 3BTZA 4CDWB 2K46A 1EP0A 4QGNA 4RR3B 3TB0A 1V9U1 3ZXAC 2HWF3 2RM22 2E9QA 1YEWA 4S2DA 1FV3A 1EAH2 1VALA 3QOPA 4RS5A 3VDBA 1YLLA 1UCXA 3AMHA 4XYXA 5FPUA 2VECA 2ADEA 3CMGA 4YFWA 4FQZA 2ZEZA 3A4UA 4YW5A 3IN9A 3GHMA 1XYPA 4MXVA 5JXJA 1UW8A 4AEJA 2Y34A 4LO6B 2VR4A 1WD4A 5BV6A 2LALA 5K4LA 4W6XA 4LTAA 3WXPA 2WO7A 1WCSA 2ZA9A 4A6SA 1FYUA 1EPWA 2Z69A 4LUMA 2LUWA 4Y1VA 3V65A 2BOIA 4WVWA 1S0DA 5LW9A 4E8DA 1BCXA 1GNYA 2Y0IA 3AXEA 1RGSA 2DCJA 1R64A 3LOBA 3I3DA 5T52A 2BOJA 1C5HA 4L0PA 3TN93 3EO6A 4CDUB 1Q8QA 2ZMNA 1DLLA 2HWF1 2JECA 3WF4A 1RUD1 4CP1A 3AP7A 4DNYA 3H8XA 4QX8A 2E7QA 2JIJA 4Q8LA 2MPFA 1WCUA 3L2HA 4LK7A 4QDRA 5DZEA 3TEWA 1S1AA 3IAQA 2F17A 4CP9B 3ZFEB 3NJVA 4UW3A 1TG7A 3ZFGA 4A3XA 5F32A 1C28A 1FOD3 5ACA3 2P3JA 1GZCA 2DCTA 2JG9A 3FL7A 2CDOA 3POFA 4D69A 4PF5A 2MHFA 4XXAA 3TNPB 1WLDA 2RS32 4GD4A 4IESA 5T3NA 3ZMOA 4MZUA 1J83A 1ZM1A 2XWJB 2WNEA 2CAUA 3C7FA 1OURA 5JLVA 1H4GA 5BYNA 2PYTA 3IWZA 2RV9A 4ZZ8A 5JIAA 2XOMA 4AI2A 5JUVA 3KSCA 4OUEA 1PGL1 3HR9A 1NZCA 5JMCA 2HKXA 2BGOA 1SZBA 1LOCA 2OUHA 2RDRA 4RL7A 4LO8A 4Q8KA 5CAZA 4UWDA 3TN91 3KLSA 4CUBA 1VRH3 4XTPA 5L7OA 2ZGLA 5I0SA 2WWUA 1F9KA 5BNNA 1SBFA 1AHSA 3WNNA 4IETA 2GSYA 1AX0A 1YRZA 4QPIB 1JYVA 4ATFA 1ODMA 2HWB2 4PI0A 4X6QB 2QFEA 4FXKB 1NLSA 3J4UH 2PAKA 1W06A 3SCFA 4TXWA 2DV9A 2JX9A 5A1AA 1FI2A 5F5QA 3D82A 3N36A 4KWJA 4AQTA 1NE6A 4IEPA 1W8TA 1FOD1 1PIV2 2AGSA 2WLQA 5ACA1 2XDVA 4JGYA 5A1FA 5EJ3A 1L7QA 2O0OA 4NPRA 4UFIA 5JMOA 1W0NA 2YC4A 2XVLA 3TNQA 1W04A 1OFSA 4BQYA 1DG6A 4RHV2 4QB6A 3O1PA 4HONA 4HOOA 4ISRA 2AACA 2PHWA 4HMZA 2O8QA 4CCDA 4P9XA 1YFYA 4HKOA 1UY0A 2OT7A 1B35C 1GFF2 2GC3A 3WVJA 1RVF2 2PXJA 2BPA2 5FP9A 1KEXA 3MW2A 1NCQA 4Y5SA 3O1UA 1VRH1 2TNFA 3DYPA 2W94A 1W6PA 3Q9OA 1JYXA 5A7SA 1IS5A 1PX4A 1BVVA 5F5IA 1QJEA 1HB1A 5FZAA 1A34A 3ZSKA 4L99A 2ZHNA 4A7KA 1SBDA 1FAYA 3IKWA 3J7LA 3OEBA 4E4SA 4OZOA 2ZEXA 1JTZX 4XQDA 5D1IA 4AI3A 1AL22 3N7MA 3A22A 4PLNA 2XVKA 4NN0A 2WNVA 2VVDA 3I3BA 1UKRA 2Q8OA 3RRDA 2YV8A 5DG1A 4ZPIA 1JODA 1AR82 1SLLA 2B46X 3BALA 2ZGKA 1I5PA 4QM8A 2GC0A 1DYOA 2VULA 4L2NA 4BMBA 4F7ZA 4IE0A 1W2OA 1UZVA 2E7AA 2B8MA 3RJRA 1O3RA 4ORFA 1Q5OA 1PK6B 4PDWC 1AJOA 2XONA 3IPVB 1MS8A 3LWCA 4P08A 2VZVA 1H6YA 2YZ4A 4YW7A 4NWWA 5E1RA 3SCGA 1TNFA 3NV1A 4QDSA 2XH6A 2V72A 5KWRA 2VZ3A 5DAPA 3OD0A 4BMEA 2VOVA 4IEVA 4QQLA 2EAAA 3ILFA 2ZKNA 4D8MA 4DY3A 2WSVA 4XETA 2FCTA 2XB6C 1RUG3 3C7EA 1JW6A 1MS3A 2UWBA 1M4WA 3FBYA 3H7YA 3THCA 1AYN3 2A5ZA 2QZ3A 4GWJA 5CFCB 3LAGA 4D6SA 1LB2A 4CEWA 4JTNA 1ZRDA 5GZCA 2HLEA 1W8FA 3ZXJA 1C8M3 4JCKA 2AR6A 4QPGB 1HV0A 1HRI3 1R092 4XDQA 1ND2A 4LOTA 1UIKA 3B69A 4JDOA 4HBNA 1CVNA 4W50A 3SKJE 3TOJA 4XOGA 1EV12 3OUJA 1NCRB 3DYOA 5FZKA 4FPEA 5A7PA 3IMMA 4QQ2A 1KITA 1UY1A 3S57A 3ABZA 2CGNA 3N4MA 4NAOA 5CEHA 4MH0E 1ZBE2 1HRV2 2VQTA 2GNDA 1W2NA 4WM8A 1LNSA 1FV2A 4RS5B 2JENA 1NA1B 2DVBA 2PTMA 2KM2A 3FUOA 1DGLA 4CPBD 4E8CA 4LIVA 5C9AC 1RUF1 3AYCA 3VBUB 4AVCA 4I01A 5A3MA 4L9BA 3PU8A 2EAKA 4UBGA 5FJKA 1X7NA 2JDZA 3UESA 4XFAA 1JZ7A 2PQSA 2E6VA 4Q4V3 2O1QA 3J9SA 1CIWA 1AYN1 1W90A 1CPMA 4Y5TA 3SXWA 4I30A 1UAIA 3NNGA 1JN2P 1PX3A 1X82A 3MW4A 4NOTA 1WW4A 3LA7A 4QM9A 3BN6A 1PGW2 5JZGB 3B93A 3VD4A 1C8M1 1QDCA 1AR72 3OGJA 3T2QA 4A7ZA 3U75A 5FYTA 1HRI1 5FO7B 5FAXA 4LNVA 1DZRA 3WW1A 5I8SA 5T5OA 2ARBA 4NPMA 2WNUC 4S2FA 4OCTA 1OOPB 2C9AA 2ES3A 3JBG2 1P8JA 5A3UA 3LZZA 1ASJ2 1SACA 2J1UA 4FT8A 4O9GA 2R0FA 5K7PA 1IG0A 4Q2FA 2R042 4XE9A 4N8MA 5FZDA 3IMNA 1RB8G 2QCSB 2PLV2 5B2GB 2JDHA 1LJ7A 1WLCA 3U4SA 4JGZC 2XJRA 4LO5B 3FFZA 3P1IA 2OPKA 1OKOA 5K0UA 3AZZA 4N53B 4AFAA 5FPVA 2VXRA 4XPVA 4FPGA 4YW3A 2ZGOA 4BQ3A 1C1LA 4FAGA 3AKRA 4BDVB 4Q4V1 2ADDA 1YHFA 2GMPA 1VAKA 3NNJA 1AVBA 1R083 2ORXA 1SCSA 4HZFA 2ERFA 2CWSA 1CWPA 1L7LA 3ZSLA 2A6VA 4IV1B 4E2SA 3BU7A 3HT2A 1WCDJ 4V2WA 1GOFA 1YQCA 1UU4A 4WVMA 3U07A 3WF3A 3CJIA 1U5ZA 1PMHX 1RUI1 3J7MA 4FFIA 4JQTA 3ZKYA 3ASIA 1CAVA 1RUC3 2VMCA 2IC1A 2Y6LA 3JUUA 3KZ4C 3URFA 2BBVA 3VD5A 1ZREA 1RUH3 1BKZA 1W9SA 2VZSA 1H6XA 3GYDA 3MV01 4IEOA 4ASMB 1H4HA 3VZNA 3ZKUA 2NMNA 1Q8PA 3O12A 2Q8CA 5DDJ3 3PJYA 4CZSA 2EALA 2VNRA 2NN8A 3LGRA 3ZYBA 4NRMA 4MV2A 1EY2A 4P5YA 3OBRA 5FWEA 1W28A 1JXNA 3I2HA 1POQA 1H2LA 2W1SA 3TEXA 1LOFC 2HYXA 1X9PA 3VL8A 4LBMA 5C8CB 1G7YA 5F7UA 4QX3A 2A3XA 5A33B 3L9JT 4EROA 1DF0A 4XIOA 4QX1A 3MBWA 4O9EA 3TAYA 2CAVA 4OULA 3OUIA 1YQ6A 2GMEA 1NY72 2QNKA 2VL4A 4QX0A 1JS9A 3OYWB 5EFUA 3RMXA 4D0QA 2X5IB 4LE3A 4YZ2A 1QH6A 4R4XA 3HQUA 2Q0AA 3T0AA 1LU2A 2DWRA 4KWUA 3ORJA 4B8EA 5BNPC 4KI5M 2NM1A 4IEZA 2VU9A 1W3XA 2GC1A 4YW1A 4XURA 2PQQA 1F35A 3CQOA 3DPRA 4Z1VA 3POEA 1RUC1 1V6JA 3PVBB 1AYM3 2VGDA 1RUH1 1ZBA2 2PAEA 2OPWA 4HKLA 3RYPA 3G7DA 5LY2A 3ZOIA 2DVFA 1APNA 4O7XA 3DCQA 1H8TC 4W4ZA 4XFBA 3P3NA 5DDJ1 1F4AA 5EV7A 1FX5A 3VGIA 1L7RA 4LEJA 1REFA 2WT1A 1QJX1 1ZX5A 4Y1ZA 4YLZA 4OQ9A 1JZ6A 4WM7B 1ZRCA 4BLJA 5FYZA 4H3WA 4MG2A 4MGQA 3ZYJB 3MIDA 1AX2A 3MFCA 3IDAA 4RGAA 5JXIA 4PIYA 3J7NA 1R1A3 2XUMA 3MIGA 1YI7A 1T6BX 2E51A 1QF3A 4HN0A 1AUYA 1JH5A 1O8SA 2VC9A 4I0AA 3T2PA 1NXMA 3HJRA 1UYZA 1OF4A 3QBQA 4Q1PA 2EXKA 2RS51 1DQ0A 1K5MA 3ZN5A 1GZTA 3OBTA 1U5XA 1QU0A 2F4LA 2VVEA 1MZ6A 1RUE2 3D5OA 3NAPA 3KCCA 4UYBA 4WVZA 2OVUA 2D6KA 2XJTA 3GXUA 4K6BA 5FY5A 3WNXA 4FFHA 2VAUA 2B42B 1CD3G 1EAH3 3D8CA 3EJKA 4EN0A 5KC5A 1RMU2 4XJZA 4M00A 3SH4A 1H0BA 3HPNA 3DXTA 3GBGA 1LODA 1AYM1 2O8OA 4UOJA 2SLIA 1UWWA 4YVSC 2GALA 4AEDC 3NRUA 2XVGA 2DBIA 3HNMA 1AJKA 1QOOA 3FZ3A 4LLFA 1RHI2 1W03A 2QQMA 4CVUA 5KC6A 3H1MA 5D8AB 1DQ2A 1N1YA 4A44A 2P3KA 1MQTA 3DEMA 1KJRA 1COV2 1ULEA 4NR1A 2HJIA 1GBGA 1GQHA 1BYHA 3ZXEA 4NO4A 2YYOA 4MX3A 2C4XA 5LCWL 1WGPA 3PJQA 1TQ5A 2VNGA 3VBHB 5I8YA 4JDNA 1PZ7A 5EP9A 2A3YA 2JG8C 1LAJA 5HV4A 1CN1A 4DRVA 4E27A 2PHFA 1OXCA 1YYNA 4OI2A 2VQUA 3WSOA 3PNAA 2ZGTA 4XF9A 2JIGA 4KGQA 2P6HA 1UYYA 3D6EA 4ZHNA 4Q4X2 1O6UA 3VBSA 1XSRA 4IV3A 4QQHA 4Z2AA 1O5UA 4LE4A 4R8HA 1XYOA 3MIHA 3CL1A 4QKFA 2PN5A 2VBDA 2WS93 3POSA 4NHYA 4LBKA 3TRSB 3PUQA 4BPZA 4EWAA 1G9FA 3RZGA 3POGA 3WDVA 4YG0A 5BUVA 3VD3A 2DUOA 4V1PA 5A7QA 1PM7A 4RR3A 4CDWA 1FXZA 2XL7A 4HVOA 1ULOA 4B4RA 3ZPOA 2XJSA 5IK4A 2EIDA 4BCUA 3G6JB 5FZ4A 1OLRA 4B1LA 2B4KA 1O5LA 1PO22 4LBQB 2AH2A 4P9LA 4BH9A 1MVQA 1BJQA 1SPPB 1LHOA 4INDA 1IHMA 4EE2A 1I1EA 1UOBA 3ZIWA 3ZR5A 3C3VA 4MADA 4KQ7A 4FTEA 4JX0A 2YFUA 1MR5A 2TBVA 1TME3 4LJHA 5GLVA 5ABJC 4XACA 3HBZA 5IVEA 4XMAA 5FBJA 4NROA 5C4WB 1Y3TA 2CY6A 4FPLA 2LROA 3JD73 2VW0A 1GNZA 4AVVA 2WS91 4GJYA 3DXUA 4YYOA 2E31A 1LHNA 3N9NA 3TWIA 2BV4A 2F4PA 3BODA 1FMD2 1ACCA 2FD8A 4AG4A 5CFDC 1IS4A 1OLMA 4CDUA 5FIXA 4R9DA 1U0AA 2GH8A 3K3NA 5EYYA 3RWNA 3RYKA 4EV0A 4YM2A 3IZOA 3GDBA 3ETPA 3KV5A 1Y9QA 1F5JA 2GAUA 4XF4A 2QQVA 1IQDC 3AC0A 4GA9A 3SISA 2QQJA 2FMDA 3UETA 2QQOA 4CP9A 1QMJA 3U78A 4W65A 2VUCA 3IIIA 1JU4A 3HNYM 3ZFEA 4IEQA 1JU3A 3AMQA 3VKLA 4LA2A 3PVOA 3VHOA 1W05A 3VBFB 3VZJA 5JIUA 2CYFA 2I07B 1UO9A 2J7MA 4KG8A 2FBEA 1IG3A 1O3QA 3HT1A 1DYKA 2YU2A 1TME1 2JDMA 4LHNA 4L8QA 1NT0A 2D5HA 5FZLA 2AEYA 1QIQA 2OS2A 1GSLA 1POV3 5CU1A 1GYKA 2ET1A 3VBRC 3AP4A 1OI6A 2DF7A 4YW6A 5T5JA 3JD71 4RSUA 2Y0OA 5L9RA 2LW8A 1ENQA 4DOUA 3WHUA 4EN8B 1OA3A 1CZSA 5LA0A 1PZ9A 2ZZQA 1SFPA 1ZNPA 1CAXB 5HV0A 3ZVXA 1JZ3A 3FLTA 1HXS3 3BB6A 3IDCB 4R4ZA 3FE5A 3CZUA 1BXHA 3LEMA 4DIQA 1IOAA 1W6MB 4QPIA 1O8PA 1GQGA 4EZHA 4KL1A 4RS5C 3ZPYA 1QH7A 4XC9A 4FAHA 5E89A 2VZ1A 4QPYA 5L73A 4FP3A 4HG6B 1OUXA 1W9WA 3PL0A 2C1FA 2DDUA 2WJSA 4HPKB 4HK8A 1QXRA 2JE9A 4XUTA 4MSVA 3KMHA 4JRLA 4WVVA 3UGGA 4TZDA 5LRSA 1KS4A 3KS7A 4H2AA 4BQ4A 5JVVA 2BGCA 4D7TA 5C5TA 5GZGA 2O14A 3CO2A 2ZX4A 3TYJA 2TEPA 1ENXA 3GBFA 2G9FA 2DU1A 5JOWA 1VBE3 4XHBA 5F3GA 1JZ5A 1N3PA 5EQUA 2ZZJA 5J96B 3DYMA 3PUSA 3ZYFA 4AE2A 2HWE2 4IE6A 4XDOA 2UY9A 1FATA 5BNOB 2BUKA 3AZXA 1QJU3 3O7OA 3OG2A 2AEZA 4XW3A 3WG2A 4KBZA 1HXS1 1GMMA 2FCVA 3MI8A 4Q0PA 5A70A 3BIEA 5CIRA 3SEPA 3CZJA 3ZSEA 5IK5A 2P5BA 5CKQA 1S2KA 1V6LA 2W0XA 4ZS3A 1IS3A 3UNPA 1RITA 1ZBE3 5ERLA 1VAMA 5LEKA 3KF5A 1BBT2 3LB9A 4UFMA 5EHDA 1SLTA 3H42B 3S30A 4LLOA 1X50A 4BOWA 4BQ5A 1N1VA 1VBB3 4YZ1A 1OPMA 3AJZA 3HVDA 3C2UA 3H8RA 3SEEA 3ZFGC 1MACA 5EPAA 5L36A 4CCCA 3HMYA 1JHJA 2JG9C 5KHIA 1ULDA 1PNFA 3A0NA 1AR63 1WLWA 4ATEA 1UOFA 2E53A 4AHYA 1XE8A 3HIFA 3O0WA 2BNOA 5J36A 2CL2A 1JOBA 1TMF3 1FNYA 1PK6A 4LO7A 4ZXKA 4URAA 3IPVA 2N7GA 3NV2A 1VBE1 5EXOA 5FZ7A 4Y22B 4HN1A 2RDNA 3UKVA 2VMIA 2ZHMA 1DYPA 4XABA 3I3MA 1W0OA 4ZY9A 1D4M3 1A78A 2XPJA 1W3VA 3OBZA 2WNOA 4NHLA 4CDQB 3KQRA 3KV6A 1REEA 2HWC1 1QJU1 5L7OC 4DEQA 1ASJ3 4A4AA 4JHZA 3FWEA 5BNNC 1RUNA 1BEV2 2WT2A 1W39A 5CFCA 4QB2A 1CR7A 1PZ8A 4WV8A 4FPHA 4BQ1A 2GP5A 3DL3A 2V4AA 3DN7A 4RN5A 1JHNA 4UFHA 5FMCA 2PLV3 2GMMA 3RMYA 2VW2A 2WO1A 5CBLA 4CEYB 3E5UA 4D94A 4QPGA 4CXYA 1US3A 4NE9A 3ALQA 2EVXA 1VBB1 2PMWB 2WO2A 2HEVF 4QXHA 4WZCA 3KQ4B 3WNMA 4CDXB 5L9BA 1NCRA 1STMA 4JGYC 1BVP1 3X29B 4BJ0A 2P1BA 4BK5A 1AR61 3USSA 4K8FA 2XMLA 3OEAA 3NJXA 1LOAA 5F5CA 4HT1T 4QU2A 3M3IA 3O1SA 3BUCA 4XIKA 3W5MA 1TMF1 1KFXL 3OBAA 2YPJA 3WW3A 2VOKA 2PHRA 1GLHA 4P9WA 4N7IA 1MEC1 2YBPA 4NIHA 1NA1A 2JKBA 1G6NA 3GZAA 3PTYA 2ZXQA 2XHKA 3VBUA 4NHMA 5F1RA 1D4M1 3ZXFA 1WD3A 2P37A 4OFGA 3GM8A 4UFJA 1WZXA 4UI9L 3AYDA 4QKDA 3ZLIA 1ZVFA 3PU3A 4AQ6A 1FPN3 1NCQC 1QJY2 4RFRB 4ZKTB 4UBHA 1ASJ1 1N1SA 3M3EA 3M8LA 4IEWA 4JTOA 3WCSA 4CUGA 2VMHA 4O61A 3ACGA 5JZGA 1BMV1 1IKPA 3NJZA 2Q1FA 2RS12 3GZEA 3N7JA 2I74A 3R6SA 1J58A 2WNVC 3I2FA 1J1LA 1K42A 1JZ4A 4QKNA 1VBC2 2VOXA 4N9IA 4QXBA 1OOPA 1Z78A 5CZKA 1PO13 2VOTA 5FXXA 2PHDA 1W9FA 5FPLA 5CKNA 5A6YA 1QKQA 3WQ1A 1HN1A 3SLIA 3I2GA 3P3PA 1ZZCA 3Q8FA 3O14A 4P9IA 4XXPA 3D0SA 1O3SA 1DGWA 4LUKA 4KMQA 4ZXEA 5C3SA 4N53A 2WZR2 3THDA 4YWAA 5JOZA 1VMJA 4LQRA 1FPN1 1KDMA 5FFOC 5CKMA 1LRHA 3I2KA 1MS9A 1WMDA 5SV8A 4A7YA 3ZDSA 2VBPA 1RUJ2 3SNMA 4YVWB 4IV1A 2BNMA 5JAXA 4A45A 4CEWC 2IWGB 2ARAA 1VMHA 4Y33A 4LITA 3ZXKA 1MS1A 2YBSA 3H3UA 1RUOA 2IXCA 3FHIB 1ENSA 3WW4A 2XBO3 1ND2C 4AVBA 2IXHA 2Q8DA 4S2HA 4YZ4A 3WQ7A 1OUSA 2GP3A 2Z42A 3NWKA 4HLTA 5F2WA 3ZYPA 5LWBA 2Q8EA 1PO11 1AR93 3RSJA 3ZYHA 5FUIA 3UGHA 1NKGA 2X53S 1VBA2 3MDPA 4NVPA 4UF0B 4YZ3A 4XQ4A 4BQWA 3DKWA 5DAVA 1RUE3 3OGRA 5DAXA 4AZZA 5IK7A 3QACA 4WM8C 3T0DA 2Y6JA 4QX7A 4MUVA 4P14A 4M01A 4ZU4A 5LBBA 3WG1A 1L3JA 3FN9A 3BCWA 4MHRA 1VPHA 1Z0HA 2VZUA 3CNAA 2VZQA 1ZRIA 2UY8A 2MEV2 2WZ8A 2WYSA 2Y6GA 5FMDA 5T50A 5TSWA 5C8CA 5A33A 1V0AA 4HXCA 4XF0A 3C7HA 4PIZA 1YUDA 3Q8BA 2R072 3ILRA 5IJRA 1RHI3 3OYWA 4Q0VA 3AXDA 2X5IA 3NKTA 3UJQA 1QWRA 1K3IA 2OXBA 3H8UA 3NV3A 2JD4A 4YM0A 2XBO1 5JR7B 4BM8A 1F8VA 3I97A 3RDIA 3U1XA 3N3HA 4AHWA 5A7WB 1Z7S2 4NWVA 4RGKA 4AVAA 5F3IA 1W6QB 1K5JA 1G9CA 3HBKA 2WA4A 1UMIA 5DZGA 1AR91 2QQLA 1ZZ9A 1CAWB 3WD5A 4I2OA 2QQIA 2Y38A 4CUCA 3ZYRA 5EYXA 5FZCA 3OF1A 1F31A 4HANA 1UOJA 1RUE1 4WM7A 2ZGPA 5F3EA 4AL9A 1YJKA 3AFKA 2Q1MA 5FMBA 3UKTA 2DYCA 4Q4X3 1SMVA 3N9LA 1XB9A 2IVIB 2DCKA 2VBBA 4AGGA 5K0UC 3KD4A 4DY5A 1PVXA 2YC0A 2VJXA 1UY3A 2CTVA 2W1UA 1JI6A 4Y1UA 1MVEA 2WAOA 2IFRA 4Y24A 3OPWA 1QDOA 3LQCA 2R062 3AL5A 4GQ7A 2B9UA 1IS6A 1CQ9A 3NNLA 1QQP2 2RDQA 1LGBA 4ISQA 5LATA 3DGTA 5A1LA 3LPFA 3UK9A 3NNMA 3VDAA 4AF9A 4COVA 1S55A 1TVGA 1MS5A 3E97A 3CJIC 1DLCA 3V0BB 3FLRA 2EIGA 1JZ8A 1XSQA 2JICA 2W3JA 3OUHA 1X33A 3SC7X 3AMMA 4XAEA 1OBNA 2BVVA 1JUHA 3HN3A 1IQAA 3ZR6A 2HH9A 3D3AA 1UPSA 4GB32 2IXKA 4J25A 1KD7A 4C90A 5D8AA 2HWD3 1PVC2 3JCIA 4KNCA 1HJFA 5FZ8A 5LY1A 4Q4Y3 2X05A 3KHBA 4Q4X1 2JWPA 5FXWA 3VKMA 5C6CA 3F2ZA 4IEUA 1Q8OA 4OUSA 1MZEA 3O1MA 1AXKA 1HIXA 1XC6A 4QGMA 3VBHA 1H30A 4B7EA 1DQ6A 3AX4A 4MGIE 3WT3A 3EXUA 4ARXA 3JQWA 2D6OX 3VN4A 3ZFFB 1QGLA 2DUQA 2Y33A 3WHTA 1FMD3 1Y9GA 3UKNA 5FZ6A 3MYXA 3NV4A 2YB7A 5LA2A 5IVJA 3AZWA 3LDKA 3LA3A 3OGSA 1OSGA 3RGBA 3LEGA 1O4YA 4K7JA 1YNAA 4XBLA 3U0ZA 4JZRA 3DPRC 1LESA 2WDBA 1XYNA 1YQ2A 5C70A 1LOBA 5FP3A 4R9CA 1DIWA 2BQPA 2Q5TA 2D3PA 2ZKLA 5FYVA 4TYSA 1RUG1 2R49A 4DZGA 1POV0 3RVHA 1UMZA 2WL1A 5E6HA 2LM3A 4XVHA 2HWD1 2RR13 3PUHA 2EA7A 4Q4Y1 2BBAA 3FUQA 3I8TA 3KGZA 3WV6A 3AP6A 4YZ5A 4JQRA 3ETQA 2XUEA 5ANQA 3T08A 1W9TA 1OA2A 5JDBA 2D93A 3P5BA 3K48A 4LBQA 2BFUL 3W9AA 1YQ8A 1O3TA 3H7JA 3AKSA 1SPPA 1H1MA 2ZX0A 5BNOC 2K2SA 1WMEA 4LA3A 1CAUB 2JKXA 4META 3VB9A 1ODNA 4XUPA 3I54A 4C0HA 4COZA 1FMD1 4Y1XA 3JU9A 5I93A 4PHZA 1K5MC 5IWFA 4Q4W3 1U12A 2VUJA 5FO9B 1N3QA 1VB2A 2ZCWA 3NAPC 4WBBA 5LASA 3J8F3 4IW3A 2J42A 2C24A 4AK3A 5C4WA 1Q8SA 2OKXA 4Y4RA 2D43A 3EBRA 5GZEA 2ZAAA 3HQRA 2D6PA 1S0FA 2IXIA 3LOIA 1BZWA 5FY0A 1UKGA 4K1ZA 4M3CB 2IFWA 5FZIA 3DF0A 3VBOB 4LMFA 4RQPA 4HFSA 4BISA 4XUOA 1GV9A 3LKJA 4I0BA 1X8MA 3OTFA 4IEXA 4FCAA 4N43B 2RR11 4XFHA 2FDFA 5I0RA 2JD9A 4JVAA 4D7YA 4OHXA 4B7KA 1MQTC 4NAMA 2BRTA 1LGNA 1VR3A 4BHPA 3TBDA 2X8KA 1VBD3 4XJAA 4NPLA 4R9BA 3MLJA 2V5YA 1KJLA 1W8ZA 2CSGA 5ANNA 3HWJA 4M0NA 2JDYA 1ND3B 3S5QA 3VBFA 1BK1A 3VZOA 2XKPA 4AOCA 4A6OA 5KXEA 3ACFA 4KWLA 2BJSA 3PDQA 1LECA 5FP7A 4Q4W1 4ASKA 4DB5A 4GALA 5FPAA 2Q30A 2YY1A 3J8F1 1YFWA 2D97A 2HWF2 4MGZE 1RUD2 5FO8B 1XU1A 3VBSC 3CDZB 4J6GA 3UL2A 4IV3C 1BBT3 4CU6A 5HBAA 2WFPA 1PMJX 3LPGA 2FDIA 4XFGA 1LHVA 2PAMA 2VUAA 2C0ZA 2WFF3 2VCBA 5GLUA 1CAXA 3NMBA 4HK9A 1LOGA 4CDWC 1JMUB 4RR3C 1Q8VA 1R081 3B9CA 3RFRA 1W6MA 4FP2A 4QXCA 1NLQA 1SQ4A 2XL9A 3AYAA 2WUHA 4NRPA 1UL9A 1NOVA 2H6CA 1VBD1 4PLMA 1W6OB 1WLTA 2J22A 5AVPA 3RZHA 1SHWB 3FBMA 3BOPA 4XZUG 1XNCA 4HPKA 5FP8A 1DQ1A 3VDDB 4B29A 1RL3A 4GMP0 3GBWA 4IERA 5JWPA 1VE0A 2WBKA 5FYHA 3E5XA 4GH4B 2RMU3 1D2SA 4HSLA 2OX0A 3AZVA 3VD7A 3TN92 5A6ZA 5C33A 2FDJA 3KWVA 1QNYA 4W8JA 2RVAA 1BEV3 3MEPA 2OA2A 5T54A 2BNNA 2W08A 1UY4A 4ARYA 1VLNA 2R1DA 2ZPXA 1CGPA 4P9YA 3QLQA 5AFBA 4COYA 3ZXLA 3QH7A 4XMIA 5FRAA 3I3QA 3HOBA 4SBVA 3ACIA 2WFF1 1YQ5A 3WDYA 4D3WA 4TLFA 4QX2A 1Y4WA 1J84A 4GWNA 5ACA2 4MHUA 4CDUC 2HBTA 2W1QA 2W52A 3LIHA 5FYYA 2WINB 4YM3A 3N9QA 1Y7BA 2CU5A 4ZU5A 1YXWA 3WG3A 3BPSA 2RM23 5IYYA 1ALYA 2QTWB 3ZDVA 4BQ2A 2ZHLA 2RJKA 2KD7A 4X6RB 1QOSA 2BWAA 3ZFEC 4AAPA 4OI0A 3T3YA 4FSJA 1XNAA 1ULFA 2ZS6B 3LA2A 1CIYA 4LBJA 4QKBA 5FZGA 4C1XA 4CSWA 2NZ9A 2ZHKA 3MHZA 4LOSA 1J1TA 2RMU1 4UFKA 5CVRA 5HXVA 5FZ3A 1QJY3 2E7TA 1OVSA 5GM0A 1VRH2 3HQXA 3ZXGA 3ZM8A 3WUDA 1LCLA 2V73A 2WABA 5A3PA 1NAEA 5A3LA 2VZTA 2VMFA 1G9BA 4J1WA 4Y22A 5FPBA 4AEMA 2VVFA 2VG9A 3RPQA 4LPLA 4ZU7A 1TE1B 3OB8A 5I8TA 2RS13 3WLUA 2YGLA 2DVDA 3WP4A 1NQDA 1R1A1 2WA3A 3EHKA 1XBFA 2DVAA 2IUWA 3NQHA 1S0EA 4H7LA 4CDQA 1Y43B 1ZZBA 1ULCA 1D0HA 5EJZB 3SH3A 3ZO0B 3M3OA 5A6QA 3SH5A 2KXLA 3MICA 4CCMA 4CCJA 5LB6A 3WNPA 2VPVA 3VHPA 2E33A 2ZJCA 4QPIC 2JE8A 5FDBA 4FFFA 1S2EA 2RM21 1KGYA 5JI7A 3SITA 4CEYA 2BP6A 4DXRA 1EAH1 4GKXA 1H1IA 3M3CA 2P3YA 3W5NA 2W2IA 3EB7A 1YFXA 1QXJA 3ZIXA 2K9ZA 4MGKE 2CGPA 3E5QA 3M70A 3T4HB 4CDXA 3MIFA 3RNSA 1W2TA 1OQEA 4MO3M 1UY2A 2R7EB 4Q1RA 4CU7A 5FK8A 4MXWB 2JDUA 3LSEA 4LO4B 5L19A 4LKEA 4X8PA 2RS33 4CE8A 1LTEA 1OH3A 2QUOA 5J3UA 3ZN6B 4OHWA 1XNBA 3AP5A 4YM1A 5G05L 1BQPA 3FLPA 5FKBA 5IATA 1LENA 3P6BA 2J1EA 2JDAA 1UX6A 5J7MA 2X10A 2A7AA 2RS11 3ENRA 1WW7A 4LKFA 1V6NA 2OYZA 2WR9A 5AVAA 3TEYA 3MFAA 1G9AA 1MPXA 2WWSA 2WQ4A 1V00A 1UZ0A 2VCMA 2V4VA 2C6SA 4XAAA 4TLGA 2BU9A 4CA9A 4B4QA 1DP0A 1RC6A 5DUUA 4CXWA 5FBZA 5H9RA 5FY7A 1OPOA 2HWB3 1A3KA 5GKAC 3VDCA 2RJ2A 5JSPA 3M1HA 1VMFA 3CBNA 1MZFA 3D4KA 3FFQA 2NP0A 1RUF2 2MEV3 2NMOA 2Y6HA 3KVBA 4UFLA 3KVAA 1US2A 3OGGA 1PIV3 1B35B 4EWEA 3S0MA 1JZ2A 4RQPB 3MLKA 4GJZA 5IFPA 1VAVA 2WN2A 3RQ0A 2RS31 3AJYA 5C3RA 2XQRA 2LRPA 1AYN2 1PK6C 1VB4A 4FI9A 4JKMA 5FJHA 4CCEA 1CONA 5IAVA 2P3IA 5J48A 4D6RA 4G4FA 3VV1A 4RHV3 4R52A 4FOYA 1C8M2 1W8OA 5GZDA 2E63A 3EMRA 5F37A 2W47A 1HRI2 5A7NA 1JYWA 4JKLA 4EJRA 2CDPA 3MF9A 4GAZA 4QHZA 1RVF3 3O1OA 3POJA 1GANA 4JRAA 3S6PA 1JYIA 3WOGA 4AFMA 2K0GA 2DU0A 1E5IA 1I6XA 4I09A 4QB1A 1R1ZA 5CFCC 3GJAA 4Q29A 4YVWA 2DTWA 3GALA 3S7EA 3I59B 5A3OA 3BVCA 1PNGA 5F6KA 2PHLA 2XQXA 2VM9A 3WZ1A 4QPGC 2HWB1 1G86A 4FPCA 4PDWB 4RGGA 5DAWA 1AL23 4QDQA 2CWMA 5DPNA 1A8DA 2BEOA 2A73B 2R1BA 5FZMA 2AENA 1D7PM 2R6QA 1NCRC 1PIV1 3DECA 3I3EA 3PUAA 1F4HA 3R05A 1AR83 1W8WA 1Y9MA 1HLCA 3W20A 4BLIA 4FPYA 3WQ0A 2QDNA 4Q4V2 1GR3A 4UF0A 1O4ZA 1QQP3 2GDFA 2ZX3A 3OGVA 4AWDA 1SCRA 2ZOEB 3CHXA 2MNGA 3GGLA 4RHV1 1NA1C 4NJ4A 3MO4A 4AXOA 4ITCA 4CU8A 5I91A 2FHRA 1OC1A 2ZGMA 4UW4A 3VBUC 4EN9B 4Q0SA 3UV9A 1CJPA 1PHMA 1RUI2 3OSDA 2ZGRA 1GWMA 2XXZA 4FO9A 3PTRB 3U11A 1RVF1 4K8RB 3ZSMA 1NG0A 5LBCA 4OHVA 1CX4A 3SCHA 2WWJA 1C4RA 2A71A 2EICA 3FX3A 4LHSA 2D6MA 2W9XA 2IXLA 3LFIA 5A3TA 3GCWA 3BYWA 1YCIA 5L9VA 4FTBA 5JZGC 1POV1 1W9YA 4YGDA 1IKQA 5FWJA 1AL21 5GZFA 2XJVA 1HW5A 5B4XA 5A7WA 3WW2A 1R093 1W6QA 1NYWA 3JB4C 4I3GA 5DZFA 3WNKA 5C9AB 3WDTA 3CU7A 5E8AA 1OOPC 1C5IA 1KQRA 3AYEA 1SBEA 1EV13 1CAWA 4HVQA 2ZX2A 1AR81 4LBNA 5HCHA 1OLME 1YIPA 4AFBA 5J1XA 1D4VB 3BTAA 4TWTA 2JE7A 4KGGA 5A3NA 2XJUA 1JYNA 1LHWA 5KHGA 4G9SB 1HRV3 2DTYA 3WQBA 2H6BA 4N53C 1SDWA 2ID4A 2OUJA 1RXGA 4OI4A 4K9SA 3AKQA 2H0BA 1RUC2 4C91A 1CJDA 1MS4A 2L9LA 3SKVA 1RUH2 1DQ4A 2ZX1A 1XNTA 2WNUB 1J3RA 4V2VA 4A3ZA 1VRBA 4G3YC 5FMOL 5DDJ2 4KH9A 4IV1C 1H2MA 1QOTA 4AHXA 1QJX2 2D5FA 3T1MA 1RJ7A 3B02A 4CUAA 3IIAA 2BFUS 4K1YA 4IEYA 4H55A 4P9JA 3V0BA 1AR73 1I9RA 4JGZB 2VW1A 4L92A 3T0BA 1R091 1AZDA 4PLOA 4XFCA 3USUB 2ORZA 1DGRN 2Y8KA 1V6OA 1O4TA 1EV11 2VE1A 3JBG3 2ZEYA 3AVRA 4KG0A 4QAWA 4UXAA 4URTA 1XRUA 2Z2SB 1NLRA 5GLWA 4CCLA 4NHXA 5DQ0A 1OLQA 4GMP3 3MGUA 2RS52 5FZ9A 1K12A 1HQNA 1ULPA 2VNVA 1HN0A 4M4PA 2R043 5CB7A 1UNBA 3QH6A 5KXDA 1ZBE1 1HRV1 4HKWA 3U37A 4XFIA 5HXMA 5AFEA 3EYPA 4GWIA 2JB4A 4GIQA 2B5HA 3WP6A 3SHRA 5C8CC 2VY0A 3LSDA 4LK6A 5DAQA 4YFZA 1AYM2 1B09A 1NZIA 1QEXA 1URXA 2R30A 3MW3A 1ZRRA 4E2GA 5LA1A 3ZFFA 3MIBA 3K4ZA 5DUXA 5IVYA 5JCTA 1REDA 2D3SA 2VO5A 1ZZ6A 4YSFA 4LKDA 4D6QA 5T5PA 2X5IC 4Z07A 4IGOA 2UWAA 3M2MA 5HI0A 1PGW1 2BZDA 5H9SA 4MGTA 4GXLA 5A3WA 1AR71 3LDBA 2W95A 1H2NA 2HEWF 2D44A 3KCXA 3Q8EA 4O65A 4OMCA 4XF3A 3N9OA 3OPZA 2AC1A 1K45A 2R061 1HB3A 1Q3EA 1XQNA 3JBG1 3ELNA 2NQYA 4QMAA 3WP3A 3LD8A 1DGWX 1TZOA 4GMP1 3IT8A 2GH2A 4FTSA 3VHNA 2R041 2QQNA 2UWCA 4DUWA 4WM7C 1NQJA 2QVSB 2XWBB 1RYYA 1N1TA 2PLV1 3NVCA 1RUD3 4BB3A 1KDKA 2IZWA 4NHKA 2QQPA 1GNHA 1QY4A 2X09A 3PIJA 2WIIB 1UZWA 4IDZA 5BNPB 3KHCA 2Z79A 2I45A 2WN3A 4CU9A 2XLGA 3OY8B 1CAUA 3WNOA 1ZYBA 2P6CA 3AMPA 2QDRA 4NMIA 4LR4A 3L2YA 3VKFC 3DUIA 1UOGA 1F15A 3N7LA 1H8VA 1ENRA 1H8TB 4X8NA 3B5LB 1WA4A 3HEIA 1H1AA 4LBQD 2FMYA 3OPTA 1LGCA 2P17A 2WZEA 3H9AA 1WW6A 1AX1A 1XNKA 4Y20B 2ARXA 2ETEA 5FY8A 3C7GA 2G19A 2XR4A 3IB3A 3LEIA 1E57A 4BWOA 4ZZ5A 5IVVA 1CZTA 4M3CA 4QGLA 4YRDA 4DXTA 4OMDA 1EYBA 1ZBA3 2BVBA 3C8XA 4LULA 3VBOA 4C1WA 3V0AB 4N43A 3I4IA 2DURA 2PHUA 5D8AC 1G8WA 5F2SA 4DRRA 5ISLA 2A6WA 5FYUA 4BZ4A 4Q5OA 4U36A 1IPJA 4Y3OA 3M7AA 3WF1A 5EIYB 2HYKA 5FOJB 4PBPA 2VTFA 3JZVA 2ZGQA 5GJ6A 3WX5A 2W87A 1LHUA 1SEFA 5T55A 3ZXDA 4BXSV 1D2QA 3VBHC 1KS5A 1ND3A 4E4DX 2EIEA 5FPXA 5EZWA 5FXZA 2WS92 5FZEA 4YVSB 3VD9A 4AEDB 1HX6A 3AFGA 2ET7A 4Y26A 1DQ5A 2J1RA 3PMEA 2GN3A 3ZN4A 3AMNA 4YG6A 4CP2A 4AEKA 1NY71 5JPMB 1W2AX 4HSJA 4GKYA 4BXFA 4N7UA 4XHXA 2LS6A 2AREA 3H1YA 5FTTC 1UU5A 2D98A 4J1XA 4AQ2A 1DBNA 3CF6E 1RMU3 3PVNA 2FDHA 1S0CA 3BIWE 3FJSA 3O0XA 5BY5A 4FQ4A 5FP4A 1KFUL 1ZBA1 3FHQA 3VKNA 4KU8A 2XKOA 1QHDA 2JG8B 1YFUA 2GU9A 2NPIA 4PQ9A 2FCUA 3ZYGA 4AI0A 4E4HA 2QE3A 1SLBA 1TME2 4MGSA 2A3WA 2EXJA 3OCPA 2VZPA 4B1MA 4Q26A 5KXBA 3E6CC 5LBFA 4OI1A 1COV3 2JEMA 4XBQA 1W6OA 2GNMA 3M4FA 1SDDB 4CYDA 2UYBA 3JD72 2QKDA 3LEKA 3VDDA 4DUXA 4JDMA 2E26A 4GH4A 4M0HA 1GZWB 4QHBA 4F3JA 4JHTA 2Q1ZB 4AAXA 4NIGA 2G9ZA 5IW0A 4AW7A 2VQ0A 1MS0A 5FZHA 2AZ5A 2WO3A 3GHNA 2W5FA 2D6LX 5A80A 4S2GA 2YPDA 5HCFA 4BYYA 3MIEA 1DFQA 5C4WC 3VLBB 5FREA 2JXAA 2W68A 1VJ2A 1RMU1 3WUCA 1PGSA 3RI8A 3ACHA 1AF9A 3GF6A 5EWSA 5FZOB 1HJGA 2YHJA 2ZABA 3ROUA 2A1XA 4M3CE 3HN1A 2X29A 1GWLA 1EPZA 5JPNB 4RQPC 4Q27A 3WF0A 4E4ZA 4AI1A 2GNBA 4E9KA 2WYFA 1CPNA 4FVVA 4BU2A 5HPOA 1RHI1 4AGVA 1WBLA 3V56A 3B01A 1QXPA 3NNFA 2ZGUA 1E5RA 2XJPA 5C5UA 4DO0A 2UU8A 5ABJB 4YARA 1COV1 3C7OA 1S0JA 3KGLA 2R32A 1OQ1A 2EF6A 4ZS2A 2RJLA 5DXDA 1V6MA 3SQOA 3WINE 1PO23 3KM5A 3VBFC 3FHAA 3I49A 5C7GA 1HB4A 4BIFA 3U10A 4DMIA 1OMIA 2B7YA 5A32B 2BWCA 3B00A 3O5SA 5CG8A 3DV8A 1GZ9A 1WCQA 4P02B 1CX1A 1HXS2 2Y60A 5DUVA 5CFDB 4XJ8A 2ZAHA 3E6BA 5BPXA 3RI9A 3SMHA 2R16A 4LT5A 2XJQA 3CEWA 5F5AA 2PFWA 3THPA 2QQKA 4P5HA 2W91A 4GULA 4AVSA 2OZ6A 4AFDA 3DKQA 5CNAA 1UPIA 1SLIA 3A0KA 4CCOA 1RUF3 5CA6A 2WLPA 1OH4A 4PBOA 2CHHA 3F95A 4CCNA 1SLCA 1RTVA 5GLTA 4AI9A 2D3RA 5AC92 5KHJA 2ZTNA 1YC61 3WDUA 4QWNA 1UQXA 1XOYA 3AB0A 5FQ0B 1O7FA 3JXSA 2I2SA 3MPBA 3AK0A 2Y6KA 1VBE2 2PA7A 5KHHA 4IL7A 3N35A 3VBRB 5C3PA 2ILMA 4COWA 1PO21 1W2UA 3JB8A 4YW2A 1LEDA 4CXXA 2VQAA 1W6NB 3BI3A 5DMYA 1AXYA 1GWKA 4MXWA 2HWC2 1QJU2 3CKHA 1XU2A 1LULA 2YUEA 4XJUA 3LF7A 5FYCA 5E88A 5IAXA 1W8UA 3ZN6A 1SLAA 1TEIA 4OLLA 1UZYA 2OQ6A 4EN6B 1VP6A 1DZQA 1BLZA 4AFCA 3I2OA 3PUIA 2B9VA 4QHOA 4YGCA 2D6NA 4ZONA 5DABA 3UT0A 3K51A 3B7MA 3S5AA 2XHNA 1O91A 3BPZA 1VBB2 2EIBA 1Q43A 4FOWA 4XUQA 3ZMNA 1UYPA 1NE4A 3KV9A 4C0BA 3IAPA 5I0UA 4EYUA 1AR62 2DBNA 1JUIA 1NXD1 3U4XA 3VUOA 5C8WA 2VTXA 4Z82A 2LTNA 1TMF2 1V9U2 4Y1YA 3NJYA 3VHRA 4XZPA 4XFFA 5LRRA 1MEC2 4PT6A 2G1MA 1C3HA 2QQWA 5LZ6A 2VMEA 2KR2A 1YJLA 1RUI3 1D4M2 2WC2A 1NUKA 3FMGA 3O1RA 3PMSA 3NSTA 1B35A 1LEMA 4IE7A 2DVGA 1G9DA 1LKNA 3VZMA 1WA6X 1UU6A 2YG0A 3QCWA 4K21A 5JSRA 5DN2A 5DUWA 2VOWA 1DHKB 4EN7B 3POBA 1BMV2 3B3QE 2DCZA 4QPWA 3EQEA 1S0BA 1X8EA 4Y5Z0 4IQPA 3ME2A 4M3CF 3U14A 4CDQC 5GALA 3E1F1 2ATFA 2HWE3 1ZA7A 3RG0A 1MZ5A 4OHZA 3ZFGB 1F2NA 4DXSA 1FT9A 1JOPA 5DG2A 2P34A 1FNZA 2AUYA 2J1TA 2JG9B 1DZTA 2WSUA 4I3PA 4L11A 3ST7A 4DQAA 3R0RA 1CZVA 2BGPA 4IGPA 3VZLA 2OW4A 3I59A 2BYVE 1HDKA 2VZOA 4P00B 1LR5A 2VH9A 3NO8A 4CEYC 2W46A 3N9PA 4OZXA 4PDWA 3ACLA 2YMZA 4GZ9A 1RXFA 2OQ7A 4MVTA 5FZFA 3ZX7A 4CDXC 2VD7A 5FCCA 5FMOS 1JOJA 3ZYIB 3KT7A 1FPN2 3T4VA 4HETA 4AI8A 1XPWA 2J1SA 1JYTA 3I7DA 1WCKA 1UXXX 5L7OB 5BNNB 4RYDA 3KCYA 2E32A 2DFBA 1QJX3 4YG3A 4PIXA 2YFZA 4NIIA 4PJYA 3LDRA 1S0IA 1DDLA 5C71A 2DUPA 3UYJA 2Y26A 3Q8CA 4H14A 3K75B 4UAPA 3K3OA 3WCRA 1PGL2 1S0GA 5G04L 2HBUA 5H9PA 3MPPG 4EZ4A 1UMHA 3AZYA 5GLZA 3W58A 2HWE1 3W59A 3HAGA 4FXGB 4OUMA 4Q0UA 1PO12 3BTYA 5M0TA 1ZZ8A 4JGYB 3I2JA 2RS53 2QZ2A 3A7QA 4RA0A 4AR2A 4ONUA 2RHPA 4CCKA 4TN7A 5J37A 2QQUA 3MF6A 1ONAA 3APBA 1BBT1 1QJFA 1GQPA 1DGRA 5FPZA 5FLHA 2PHTA 4Z2WA 2VCAA 1SFYA 5C9AA 1YWKA 2GNTA 2YGMA 5CADA 5BNQA 1FOD2 3BOWA 3POYA 5FK7A 3RS6A 4B3NA 1NCQB 5JXHA 3KB5A 4XUNA 1W6PB 5KBFA 2UYAA 3H3ZA 1T6GC 4IGQA 1OVPA 3AL6A 2G4IA 3VZKA 2WQZC 3ILNA 5A7OA 5HCAA 3BGAA 4RD7A 1GP5A 4K3UA 3ES4A 3R4SA 1OD3A 2XBO2 3KT4A 1RIRA 4AQSA 5CG9A 4NIDA 4NIAA 2H0VA 2FZ2A 1A8MA 2WKKA 3H50A 2ZMKA 3K4DA 2RE9A 3T09A 2WNVB 2VCCA 4QU1A 1CESA 2WNUA 4A42A 1AR92 1OKQA 3GJBA 1V6IA 3PIGA 4U2AA 3ATGA 4NRQA 5LK7B 5HCBA 4W6WA 5J98B 1HQLA 4YVWC 1BEV1 4LHKA 2DFCA 1QJZA 1H9PA 2VTXJ 3H3LA 1V6KA 5E16A 3RYRA 2FQPA 2W1WA 1O59A 4YPJA 2BERA 5CYYA 4JGZA 2CNAA 3OJBA 1XE7A 1DU3D 4NUBA 2VUDA 4D7SA 3N9MA 3USUA 2C26A 3PHMA 3S7IA 1KRIA 1UXZA 1VBC3 3RZLA 4LORA 3I2IA 4UW6A 1YI9A 4LKSA 2GC2A 4SLIA 1GKBA 5C3OA 2G9GA 4OVEA 4N90A 2PELA 4C8DA 1UZZA 4M4RA 5LK5A 1S4CA 2B39A 2DCYA 3T1LA 3KF3A 4IXLA 3IM0A 4CEWB 1XJAA 2JDNA 5FUPA 3AM2A 3A21A 5KHKA 1VIWB 4QT6A 2FZ1A 1OT5A 3O1TA 2WZR3 3K77A 5JI9A 1ND2B 1C8NA 5APAA 4DPNA 3RZKA 3K46A 4QQOA 1QJY1 2V5DA 4JKKA 4A2UA 4YGEA 4CPBA 1UX7A 2XLFA 1YIFA 4Z8BA 4FOQA 2R0HA 2WZPP 1RUJ3 3T2TA 3VKOA 5FYBA 4AHZA 1C1FA 4IE4A 5I0TA 1H9WA 3R4UA 4ES8A 2EXHA 4WM8B 1WWYA 4YNIA 1TNRA 3LCPA 4PF1A 2IVJA 3NW4A 1U5IA 1LOFA 4FPFA 1IPKA 1VBC1 3INAA 4XTMA 4CTEA 5I0DA 3N7KA 3RJ2X 1GOHA 1YO8A 2ENRA 2WRAA 3HNBM 4PCRA 2TUNA 5FOBB 4CP0A 4FFGA 1VBA3 3WP5A 1JBCA 1GP4A 4A41A 2VMDA 4YGBA 5T5LA 4DEVA 4JAAA 5JR2A 2ZBJA 1H2KA 4CRQA 1ZZ7A 3GCXA 3THTA 4IUGA 5BNPA 5FZ0A 2JB8A 3WDXA 2WZR1 3MLLA 3WEZA 4TTGA 1T2XA 3OY8A 2GN7A 1DCSA 4FBFA 3PURA 4EWDA 2YXSA 2KA3A 2YDEA 4N9HA 1SG3A 5F8PA 1RUG2 1M06G 4AVTA 2QBXA 1RUJ1 2R073 3QD6A 5LA9A 2F6BA 1J59A 1HV1A 1H8TA 3GZUC 4BQXA 2HWD2 4DUVA 4IE5A 4XBNA 2OZJA 4Q4Y2 1X9TA 1WBFA 1WMFA 1UD1A 4ASLA 1RJ8A 2D40A 2BW8A 4Y20A 2VXJA 1Z7S3 1XXNA 3K2OA 4KU7A 5K0UB 4DS0A 3NL1A 2W39A 4LHLA 5F6LB 1AXZA 2VMGA 1EUUA 4JV4A 2C9KA 1GU3A 3V0AA 5KXCA 3ECQA 2YROA 1GP6A 5FV3A 5H9QA 1VBA1 1HKDA 4FOVA 5K9YA 2IXJA 5KR7A 3V64A 2A75A 2WQ8A 2XGXA 2ZGSA 4DXZA 4EQVA 2FDGA 1XNDA 2EXIA 2RG4A 4QD2A 1N3OA 1UN1A 4XQWA 4WVMB 3BTXA 4UW5A 2MEV1 5FUNA 1PM4A 3CJIB 3T30A 1LU1A 2NLRA 4DINB 1RINA 1CAVB 5FYIA 2ZEWA 3ZFFC 4TSVA 4YVSA 4XCAA 3T2OA 4AEDA 3KV4A 5IK8A 2BTVC 3RZZA 2R071 5D21A 2R063 2VZRA 1EUTA 3BU0A 4QX5A 2WAAA 2RR12 4FPOB 4Q0QA 4LXLA 5FY9A 1F5FA 5IT6A 3OD4A 1Q56A 1WKYA 1I5ZA 5LBEA 4HL0A 4F83A 4FPJA 5F39A 1Z7S1 1A6CA 5FZ1A 5IVCA 4COUA 3Q8AA 3ON7A 2C5DA 2P2KA 4XJWA 2A6ZA 2JG8A 3AP9A 3R4DB 3H1WA 2B45X 4GB33 3J7HA 1WW5A 2VNOA 4JC1A 3PLQA 4Q4W2 3VL9A 1PVC3 2ARCA 5FLIA 1HQWA 1PMIA 5IHRA 3J8F2 3H8OA 2JDPA 2Z4FA 5FXVA 3O1VA 3AKPA 3I2DA 3LFMA 4ET7A 1GOGA 2UURA 4WZFA 3IDBB 3DPRB 1OHFA 2P4EA 3MV11 2QJVA 1UIJA 1GZWA 4HVRA 3MZHA 5AC93 1X36A 1OD5A 2JJ6A 3GNEA 3PVEA 5FY1A 1XE0A 4I02A 5FYMA 3UGFA 5IFTA 1D0GA 4MOAA 4QQPA 1C57A 4H7MA 1R082
chains in the Genus database with same CATH topology
1QQP1 2CGOA 1IZ3A 2NYYA 4K20A 1LOEA 2XLAA 3B94A 1W0PA 5F9TA 2WT0A 1I3HA 3IDEA 4BIOA 1VBD2 1ZRFA 4RFT0 2XG3A 4OHYA 1KXGA 4AYUA 4E2QA 3M3QA 3WR0A 3VBOC 3JQXA 2HEYF 5K8SA 5IUQA 1OFNA 3AKTA 4N43C 5JOXA 3GZTB 2HWC3 4GB31 3WG4A 3CLPA 4QXKA 1PVC1 1K5MB 4DFSA 1S2BA 4MGYE 5ABJA 3NAPB 4BA6A 4XJ9A 4ES9A 1QNWA 1N47A 2V09A 2CV6A 4B4PA 1ND3C 4XEZA 4F8AA 4KBBA 5BXXA 2WFF2 1V70A 5AC91 1J3QA 1UF2C 1WUVA 5A32A 5SV5A 4Y4YA 1ZA4A 4XF1A 4BE3A 5CFDA 5FLJA 4XILA 3ES1A 1V9U3 1MQTB 2Q4SA 2ZACA 5JSOA 1MEC3 2A6YA 5J09A 3ZSJA 3WY6A 3IBMA 2PHXA 4I0WB 4LBLA 4YW4A 4MYEA 4K40A 3H0OA 3NKGA 2RMU2 3WDWA 3CJXA 4L97A 3POWA 5FQ0A 5LEJA 3B9IA 3HD8B 2D7FA 4KWKA 4AGRA 3E6DA 1AL0G 1OQDA 3O0VA 1OA4A 5JOYA 4MLOA 3VBRA 4LBOA 1JYCA 2A70A 2ZGNA 3D0JA 1U5YA 2ZMLA 3VBSB 4IV3B 3VDDC 2OIIA 4P9GA 3J26N 1R1A2 3FC0A 3KT1A 2SBAA 4FPKA 4GH4C 2AYHA 1W6NA 4R9AA 4W6YA 3UJOA 4Z92B 4GWMA 1SFNA 2Z5WA 2GZWA 1GICA 1J3PA 1IGOA 1ULGA 2A6XA 4CDWB 3TB0A 1EP0A 4QGNA 4RR3B 1V9U1 3ZXAC 2HWF3 2RM22 2E9QA 4S2DA 1FV3A 1EAH2 1VALA 3QOPA 4RS5A 1YLLA 1UCXA 3AMHA 4XYXA 2VECA 4YFWA 4FQZA 3A4UA 4YW5A 3IN9A 3GHMA 1XYPA 4MXVA 1UW8A 4AEJA 4LO6B 1WD4A 5BV6A 2LALA 4W6XA 4LTAA 3WXPA 1WCSA 2ZA9A 1FYUA 1EPWA 2Z69A 4LUMA 2LUWA 4Y1VA 3V65A 4WVWA 1S0DA 1BCXA 2Y0IA 3AXEA 1RGSA 2DCJA 3LOBA 5T52A 1C5HA 3TN93 3EO6A 4CDUB 1Q8QA 2ZMNA 1DLLA 2HWF1 2JECA 1RUD1 4CP1A 3AP7A 4DNYA 2E7QA 4Q8LA 2MPFA 5DZEA 3L2HA 1S1AA 3ZFEB 4UW3A 3ZFGA 4A3XA 1C28A 1FOD3 5ACA3 2P3JA 1GZCA 2DCTA 2JG9A 4D69A 4PF5A 2MHFA 4XXAA 3TNPB 1WLDA 2RS32 4IESA 5T3NA 3ZMOA 4MZUA 1ZM1A 2XWJB 2WNEA 2CAUA 5JLVA 1H4GA 5BYNA 2PYTA 3IWZA 5JIAA 4AI2A 3KSCA 1PGL1 3HR9A 1NZCA 5JMCA 2HKXA 1LOCA 2OUHA 4RL7A 4Q8KA 4LO8A 5CAZA 3TN91 3KLSA 1VRH3 4XTPA 5L7OA 2ZGLA 5I0SA 1F9KA 5BNNA 1SBFA 1AHSA 4IETA 2GSYA 1AX0A 1YRZA 4QPIB 4ATFA 2HWB2 4X6QB 2QFEA 4FXKB 1NLSA 3J4UH 2PAKA 3SCFA 2DV9A 2JX9A 1FI2A 5F5QA 3D82A 3N36A 4KWJA 4AQTA 1NE6A 4IEPA 1FOD1 1PIV2 2AGSA 2WLQA 5ACA1 4JGYA 5EJ3A 2O0OA 4NPRA 2XVLA 3TNQA 1OFSA 1DG6A 4RHV2 4ISRA 2PHWA 4HMZA 2O8QA 4P9XA 1YFYA 4HKOA 1B35C 1GFF2 2GC3A 3WVJA 1RVF2 2BPA2 3MW2A 1NCQA 1VRH1 2TNFA 1W6PA 3Q9OA 1IS5A 1BVVA 3ZSKA 4L99A 2ZHNA 4A7KA 1SBDA 1FAYA 3IKWA 4E4SA 1JTZX 4XQDA 5D1IA 4AI3A 1AL22 3N7MA 4PLNA 2XVKA 4NN0A 2WNVA 2VVDA 1UKRA 2Q8OA 3RRDA 2YV8A 5DG1A 1AR82 1SLLA 2B46X 3BALA 2ZGKA 4QM8A 2GC0A 2VULA 4L2NA 4BMBA 1O3RA 3RJRA 2E7AA 2B8MA 4ORFA 1Q5OA 1PK6B 4PDWC 1AJOA 3IPVB 3LWCA 1MS8A 2YZ4A 4NWWA 5E1RA 3SCGA 1TNFA 3NV1A 2XH6A 5KWRA 4BMEA 3OD0A 2VOVA 4IEVA 4QQLA 2EAAA 3ILFA 2ZKNA 4DY3A 2WSVA 4XETA 2XB6C 1RUG3 1JW6A 1MS3A 2UWBA 1M4WA 3FBYA 3H7YA 5CFCB 1AYN3 2A5ZA 2QZ3A 3LAGA 1LB2A 4CEWA 4JTNA 1ZRDA 5GZCA 3ZXJA 1C8M3 4JCKA 2AR6A 4QPGB 1HV0A 1HRI3 1R092 4XDQA 1ND2A 1UIKA 3B69A 4JDOA 4HBNA 1CVNA 3TOJA 4XOGA 1EV12 1NCRB 4FPEA 4QQ2A 1KITA 2CGNA 3N4MA 4MH0E 1ZBE2 1HRV2 2GNDA 4WM8A 1FV2A 4RS5B 2JENA 1NA1B 2DVBA 2PTMA 2KM2A 3FUOA 1DGLA 5C9AC 1RUF1 3AYCA 3VBUB 4AVCA 4I01A 5A3MA 4L9BA 4UBGA 2EAKA 1X7NA 2JDZA 4XFAA 2E6VA 4Q4V3 2O1QA 3J9SA 1CIWA 1AYN1 3SXWA 1CPMA 4I30A 1UAIA 1JN2P 3MW4A 1X82A 4NOTA 4QM9A 1WW4A 3LA7A 5JZGB 1PGW2 3B93A 1C8M1 1QDCA 1AR72 3OGJA 4A7ZA 1HRI1 5FO7B 5FAXA 4LNVA 1DZRA 3WW1A 5I8SA 5T5OA 2ARBA 2WNUC 4S2FA 1OOPB 2C9AA 2ES3A 3JBG2 3LZZA 1ASJ2 1SACA 5K7PA 4FT8A 4O9GA 2R0FA 4Q2FA 4XE9A 2R042 1RB8G 3IMNA 2QCSB 2PLV2 5B2GB 1LJ7A 1WLCA 4JGZC 2XJRA 4LO5B 3FFZA 2OPKA 5K0UA 3AZZA 4N53B 4AFAA 2VXRA 4XPVA 4FPGA 4YW3A 2ZGOA 1C1LA 4FAGA 3AKRA 4Q4V1 1YHFA 2GMPA 1VAKA 4HZFA 1AVBA 1R083 1SCSA 2ERFA 2CWSA 3ZSLA 2A6VA 4IV1B 4E2SA 3BU7A 3HT2A 1WCDJ 1UU4A 4WVMA 3U07A 3CJIA 1U5ZA 1RUI1 3ASIA 1CAVA 1RUC3 3URFA 2IC1A 2BBVA 3JUUA 3KZ4C 1ZREA 1RUH3 1BKZA 3GYDA 4ASMB 4IEOA 1H4HA 3VZNA 2NMNA 1Q8PA 3O12A 5DDJ3 3PJYA 4CZSA 2EALA 2VNRA 2NN8A 3LGRA 4MV2A 1EY2A 3OBRA 1JXNA 1H2LA 1LOFC 3VL8A 4LBMA 5C8CB 1G7YA 2A3XA 5A33B 3L9JT 4EROA 1DF0A 4XIOA 4O9EA 3TAYA 2CAVA 4OULA 2GMEA 1NY72 2QNKA 5EFUA 3OYWB 3RMXA 2X5IB 4LE3A 4YZ2A 1QH6A 4R4XA 2Q0AA 1LU2A 2DWRA 4B8EA 5BNPC 2NM1A 4IEZA 2VU9A 4YW1A 2GC1A 2PQQA 4Z1VA 3DPRA 1RUC1 1V6JA 3PVBB 1AYM3 2VGDA 1RUH1 1ZBA2 2PAEA 4HKLA 3RYPA 3G7DA 2DVFA 1APNA 1H8TC 4XFBA 3P3NA 5DDJ1 5EV7A 3VGIA 1FX5A 4LEJA 4Y1ZA 1REFA 2WT1A 1QJX1 1ZX5A 4YLZA 4WM7B 1ZRCA 4BLJA 4H3WA 3ZYJB 3MIDA 1AX2A 3MFCA 4RGAA 4PIYA 1R1A3 2XUMA 3MIGA 1YI7A 1QF3A 2E51A 4HN0A 1AUYA 1JH5A 4I0AA 5BNOA 1NXMA 3QBQA 4Q1PA 2EXKA 2RS51 1DQ0A 1K5MA 3ZN5A 3OBTA 1U5XA 1QU0A 2VVEA 1MZ6A 1RUE2 3D5OA 3NAPA 3KCCA 4F7ZA 4WVZA 2OVUA 2D6KA 2XJTA 4K6BA 3WNXA 2B42B 1CD3G 1EAH3 3D8CA 3EJKA 4EN0A 5KC5A 1RMU2 4XJZA 4M00A 3SH4A 1H0BA 3GBGA 1LODA 1AYM1 2O8OA 2SLIA 4YVSC 2GALA 4AEDC 2XVGA 1AJKA 1QOOA 3FZ3A 4LLFA 1RHI2 5KC6A 3H1MA 5D8AB 1DQ2A 1N1YA 2P3KA 1MQTA 1KJRA 1COV2 1ULEA 4NR1A 2HJIA 1GBGA 1GQHA 1BYHA 3ZXEA 4NO4A 2YYOA 4MX3A 1WGPA 3PJQA 1TQ5A 2VNGA 3VBHB 5I8YA 4JDNA 1PZ7A 2A3YA 2JG8C 1CN1A 4DRVA 4E27A 2PHFA 1YYNA 4OI2A 3PNAA 2ZGTA 4XF9A 4KGQA 3D6EA 4Q4X2 3VBSA 4IV3A 4QQHA 1O5UA 4LE4A 4R8HA 1XYOA 3MIHA 3CL1A 2PN5A 2WS93 3POSA 4BPZA 4LBKA 3TRSB 4EWAA 1G9FA 3WDVA 4YG0A 5BUVA 2DUOA 4V1PA 4CDWA 1PM7A 4RR3A 1FXZA 2XL7A 4HVOA 4B4RA 2XJSA 5IK4A 4BCUA 3G6JB 1OLRA 1O5LA 1PO22 4LBQB 2AH2A 4P9LA 4BH9A 1MVQA 1BJQA 1LHOA 4INDA 1IHMA 1I1EA 3ZIWA 3C3VA 4KQ7A 4FTEA 1MR5A 2TBVA 1TME3 5GLVA 5ABJC 3HBZA 4XMAA 5C4WB 1Y3TA 2CY6A 4FPLA 3JD73 2VW0A 1GNZA 4AVVA 2WS91 4YYOA 1LHNA 3TWIA 2F4PA 3BODA 1FMD2 4AG4A 5CFDC 1IS4A 4CDUA 4R9DA 1U0AA 2GH8A 5EYYA 3RWNA 3RYKA 4EV0A 4YM2A 1Y9QA 1F5JA 2GAUA 4GA9A 3SISA 2FMDA 1QMJA 3ZFEA 4W65A 4IEQA 3AMQA 3VKLA 5JIUA 4LA2A 3PVOA 3VHOA 3VBFB 3VZJA 2CYFA 2I07B 4KG8A 2FBEA 1O3QA 3HT1A 1DYKA 1TME1 4LHNA 4L8QA 2D5HA 1GSLA 1POV3 5CU1A 1GYKA 2ET1A 3VBRC 3AP4A 1OI6A 2DF7A 5T5JA 3JD71 4RSUA 2Y0OA 1ENQA 4DOUA 3WHUA 4EN8B 1OA3A 1PZ9A 2ZZQA 1ZNPA 1CAXB 3ZVXA 3FLTA 1HXS3 3BB6A 3IDCB 4R4ZA 3FE5A 1BXHA 1IOAA 1W6MB 4QPIA 1GQGA 4KL1A 4RS5C 3ZPYA 1QH7A 4FAHA 5E89A 4QPYA 5L73A 4FP3A 2C1FA 2WJSA 4HPKB 4HK8A 1QXRA 2JE9A 4MSVA 3KMHA 4JRLA 4WVVA 4TZDA 5LRSA 1KS4A 3KS7A 4D7TA 5GZGA 5JVVA 2BGCA 3CO2A 2ZX4A 3TYJA 2TEPA 1ENXA 3GBFA 2G9FA 2DU1A 5JOWA 1VBE3 4XHBA 1N3PA 2ZZJA 5J96B 4AE2A 2HWE2 2UY9A 1FATA 5BNOB 2BUKA 3AZXA 1QJU3 3O7OA 3WG2A 4XW3A 1HXS1 4Q0PA 3MI8A 5CIRA 5IK5A 3ZSEA 1S2KA 1V6LA 2W0XA 1IS3A 1RITA 1ZBE3 1VAMA 5LEKA 1BBT2 3LB9A 1SLTA 3S30A 4LLOA 1X50A 4BOWA 1N1VA 1VBB3 4YZ1A 1OPMA 3AJZA 3C2UA 3ZFGC 5L36A 1MACA 3HMYA 2JG9C 5KHIA 1ULDA 1PNFA 3A0NA 1AR63 1WLWA 4ATEA 2E53A 4AHYA 1XE8A 3HIFA 3O0WA 2BNOA 5J36A 2CL2A 1TMF3 1FNYA 1PK6A 4LO7A 4ZXKA 3IPVA 2N7GA 3NV2A 1VBE1 5EXOA 4Y22B 4HN1A 3UKVA 2VMIA 2ZHMA 1DYPA 1W0OA 1D4M3 1A78A 2XPJA 4NHLA 4CDQB 3KQRA 1REEA 2HWC1 1QJU1 5L7OC 1ASJ3 3FWEA 5BNNC 1RUNA 1BEV2 2WT2A 1W39A 5CFCA 1CR7A 1PZ8A 4WV8A 4FPHA 4BQ1A 3DN7A 3DL3A 3MZHA 1JHNA 3RMYA 2PLV3 2GMMA 5CBLA 2VW2A 4CEYB 3E5UA 4D94A 4QPGA 3ALQA 2EVXA 1VBB1 2HEVF 4WZCA 4CDXB 1NCRA 4JGYC 1BVP1 3X29B 1AR61 3USSA 4K8FA 1LOAA 4HT1T 4QU2A 3M3IA 4XIKA 1TMF1 1KFXL 2YPJA 3WW3A 2VOKA 2PHRA 1GLHA 4P9WA 4N7IA 1MEC1 1NA1A 2JKBA 1G6NA 3GZAA 3PTYA 2XHKA 3VBUA 4NHMA 5F1RA 1D4M1 3ZXFA 1WD3A 2P37A 4OFGA 3AYDA 1ZVFA 4AQ6A 1FPN3 1NCQC 1QJY2 4ZKTB 4UBHA 1ASJ1 1N1SA 3M3EA 3M8LA 4IEWA 4JTOA 3WCSA 2VMHA 5JZGA 1BMV1 1IKPA 3NJZA 2RS12 3N7JA 2I74A 3R6SA 1J58A 2WNVC 1J1LA 1VBC2 2VOXA 4N9IA 1OOPA 1Z78A 1PO13 2PHDA 1QKQA 3WQ1A 3SLIA 3P3PA 1ZZCA 3O14A 4P9IA 4XXPA 3D0SA 1O3SA 1DGWA 4LUKA 4N53A 2WZR2 5JOZA 1FPN1 1KDMA 5FFOC 1LRHA 5SV8A 1MS9A 1WMDA 4A7YA 3ZDSA 1RUJ2 3SNMA 4YVWB 4IV1A 2BNMA 5JAXA 4CEWC 2IWGB 3ZXKA 1MS1A 3H3UA 1RUOA 2IXCA 3FHIB 1ENSA 3WW4A 2XBO3 1ND2C 4AVBA 2IXHA 4S2HA 4YZ4A 3WQ7A 2Z42A 3NWKA 4HLTA 3ZYPA 1PO11 1AR93 3RSJA 2X53S 1VBA2 3MDPA 4NVPA 4YZ3A 4XQ4A 3DKWA 1RUE3 5IK7A 3QACA 4WM8C 4MUVA 4P14A 4M01A 4ZU4A 3WG1A 1L3JA 3BCWA 1Z0HA 3CNAA 5T50A 2UY8A 2MEV2 5C8CA 5TSWA 5A33A 4XF0A 4PIZA 1YUDA 2R072 3ILRA 1RHI3 3OYWA 4Q0VA 3AXDA 2X5IA 3NKTA 3UJQA 1QWRA 3H8UA 3NV3A 2JD4A 4YM0A 2XBO1 5JR7B 4BM8A 1F8VA 3RDIA 3N3HA 4AHWA 1Z7S2 4NWVA 4AVAA 1W6QB 1G9CA 2WA4A 5DZGA 1AR91 1ZZ9A 1CAWB 3WD5A 4I2OA 2Y38A 3ZYRA 5EYXA 3OF1A 1F31A 4HANA 1RUE1 4WM7A 2ZGPA 1YJKA 3AFKA 2Q1MA 3UKTA 2DYCA 4Q4X3 1SMVA 5K0UC 2DCKA 4AGGA 3KD4A 4DY5A 1PVXA 2YC0A 2CTVA 4Y1UA 1MVEA 2IFRA 4Y24A 1QDOA 2R062 4GQ7A 2B9UA 1IS6A 1CQ9A 1QQP2 1LGBA 4ISQA 3DGTA 3UK9A 4AF9A 4COVA 1S55A 3E97A 1MS5A 3V0BB 3CJIC 3FLRA 2EIGA 2JICA 1X33A 3AMMA 2BVVA 1JUHA 1IQAA 1UPSA 4GB32 2IXKA 4C90A 1KD7A 5D8AA 2HWD3 1PVC2 3JCIA 4KNCA 4Q4Y3 4Q4X1 3VKMA 5C6CA 4IEUA 1Q8OA 4OUSA 1MZEA 1AXKA 1HIXA 4QGMA 3VBHA 1H30A 4B7EA 1DQ6A 3AX4A 4MGIE 3WT3A 3EXUA 3JQWA 2D6OX 3VN4A 3ZFFB 1QGLA 2DUQA 3WHTA 1FMD3 3UKNA 3MYXA 3NV4A 3AZWA 3LA3A 1OSGA 3U0ZA 1O4YA 4K7JA 1YNAA 4XBLA 3DPRC 1LESA 1XYNA 1LOBA 4R9CA 1DIWA 2BQPA 2Q5TA 2D3PA 2ZKLA 4TYSA 1RUG1 2R49A 4DZGA 1POV0 1UMZA 2WL1A 2LM3A 2HWD1 2RR13 2EA7A 4Q4Y1 3FUQA 3I8TA 3KGZA 3WV6A 3AP6A 4YZ5A 4JQRA 3ETQA 1OA2A 5JDBA 2D93A 3K48A 4LBQA 2BFUL 3W9AA 1O3TA 3H7JA 3AKSA 1H1MA 2ZX0A 5BNOC 2K2SA 1WMEA 4LA3A 1CAUB 4META 4C0HA 3I54A 4COZA 1FMD1 4Y1XA 3JU9A 5I93A 1K5MC 4Q4W3 1U12A 2VUJA 5FO9B 1N3QA 1VB2A 2ZCWA 3NAPC 4WBBA 3J8F3 4AK3A 5C4WA 1Q8SA 2D43A 3EBRA 5GZEA 2ZAAA 2D6PA 1S0FA 2IXIA 3LOIA 1BZWA 1UKGA 4K1ZA 4M3CB 2IFWA 3DF0A 3VBOB 4RQPA 4HFSA 1GV9A 3LKJA 4I0BA 1X8MA 3OTFA 4IEXA 4FCAA 4N43B 2RR11 4XFHA 5I0RA 4JVAA 4D7YA 4OHXA 4B7KA 1MQTC 1LGNA 1VR3A 4BHPA 3TBDA 2X8KA 1VBD3 4XJAA 4R9BA 3MLJA 2V5YA 1KJLA 3HWJA 4M0NA 1ND3B 3VBFA 1BK1A 3VZOA 2XKPA 5KXEA 4KWLA 1LECA 4Q4W1 4DB5A 4GALA 2Q30A 2YY1A 3J8F1 1YFWA 2D97A 2HWF2 4MGZE 1RUD2 5FO8B 1XU1A 3VBSC 4J6GA 3UL2A 4IV3C 1BBT3 5HBAA 2WFPA 4XFGA 1LHVA 2PAMA 2VUAA 2C0ZA 2WFF3 5GLUA 1CAXA 4HK9A 1LOGA 4CDWC 4RR3C 1Q8VA 1R081 3B9CA 1W6MA 4FP2A 1SQ4A 2XL9A 3AYAA 1UL9A 1NOVA 2H6CA 1VBD1 4PLMA 1W6OB 1WLTA 5AVPA 3FBMA 3BOPA 1XNCA 4HPKA 1DQ1A 3VDDB 4B29A 1RL3A 4GMP0 3GBWA 4IERA 5JWPA 3E5XA 4GH4B 2RMU3 1D2SA 4HSLA 3AZVA 3TN92 5C33A 1QNYA 1BEV3 3MEPA 2OA2A 5T54A 2BNNA 2W08A 1VLNA 2R1DA 2ZPXA 1CGPA 4P9YA 3QLQA 5AFBA 4COYA 3ZXLA 3QH7A 4XMIA 5FRAA 4SBVA 2WFF1 3WDYA 4D3WA 4TLFA 5ACA2 4GWNA 4CDUC 2W52A 2WINB 4YM3A 1Y7BA 4ZU5A 1YXWA 3WG3A 2RM23 1ALYA 2ZHLA 2RJKA 4X6RB 4OI0A 1QOSA 2BWAA 3ZFEC 4FSJA 3LA2A 1ULFA 2ZS6B 4LBJA 4C1XA 2NZ9A 2ZHKA 5HXVA 1J1TA 2RMU1 5CVRA 1QJY3 2E7TA 5GM0A 1VRH2 3HQXA 3ZXGA 3WUDA 1LCLA 2V73A 5A3LA 1G9BA 4J1WA 4Y22A 4AEMA 2VVFA 2VG9A 3RPQA 5I8TA 4ZU7A 1TE1B 2RS13