5C8CB

Crystal structure of recombinant coxsackievirus a16 capsid
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
310
structure length
286
Chain Sequence
ENSNSASEGSTINYTTINYYKDAYAASAGRQDAPPLKSPSAEACVAQLTIGNSTITTQEAANIVIAYGEWPEYCPDTDATAVDKPTRPDVSVNRFFTLDTKSWAKDSKGWYWKFPDVLTEVGVFGQNAQFHYLYRSGFCVHVQCNASKFHQGALLVAVLPEYVLGTIAGGTGNENSHPPYATTQPGQVGAVLTHPYVLDAGIPLSQLTVCPHQWINLRTNNCATIIVPYMNTVPFDSALNHCNFGLLVIPVVPLDFNTGATSEIPITVTIAPMCAEFAGLRQAVKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords VP1
publication title Structures of Coxsackievirus A16 Capsids with Native Antigenicity: Implications for Particle Expansion, Receptor Binding, and Immunogenicity.
pubmed doi rcsb
source organism Coxsackievirus a16 (strain tainan/5079/98)
total genus 57
structure length 286
sequence length 310
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00073 Rhv picornavirus capsid protein
B PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5c8cB00
2RR11 1ZBE3 2R063 1D4M1 4WM7A 1FPN2 2VQ0A 1TMF2 2RS12 1C8M3 1FOD3 3DPRB 3VBHB 1R1A2 1RUF3 1VBE1 2ZAHA 1AYM1 5C9AB 1AR91 1VBD1 5BNOC 2HWB2 5K0UC 3ZFEC 3J8F2 1MQTB 5D8AB 5A32A 1X36A 2HWD2 5CFCC 2HWC2 2WFF3 1ND3C 5ABJC 2WZR1 5JZGC 2HWB3 1RUG3 1EAH1 4WM8B 1RVF2 2PLV2 3TN92 1BEV2 1QQP1 2HWE2 1VAKA 3VBSC 1AR82 2WS92 1RHI3 4CDWB 1PO12 1HXS3 4RHV2 4RR3A 1HQNA 5GKAC 3TN93 1BEV3 1FPN1 1NCQA 1TMF1 2RS11 1FMD1 1AR83 2WS93 4CEYA 1R1A1 4N43C 1K5MC 4GMP0 3ZFFB 1ZBA3 1OOPC 1RUC2 1EV11 3J8F1 4GH4C 1RUJ2 1VBB3 1WCDJ 2X5IA 4Q4V2 3VBFB 4CDXA 2HWD1 2HWC1 3VBUC 3JBG2 1R082 1AR63 2RS53 4GB31 1RUC3 1TME2 1RVF1 4Q4V3 2PLV1 5C4WA 5C9AA 2HWE1 4Q4Y1 3ZFGB 3JBG3 5CFDB 1R083 4Y5Z0 1PO11 1PVC3 4FTSA 4RHV1 1QJX1 1PO21 1RUH1 4CEWA 5A32B 1TME3 3CJIB 5DDJ2 1PGW2 3JD71 2XBO2 1COV2 1X33A 5L7OC 1BMV2 1VB2A 4WM8A 2IZWA 3M8LA 4JGYC 4CDUB 1RUD2 3VDDB 4YVSC 4IV1B 5DDJ3 4PDWB 5C8CA 1F2NA 1RUJ1 5K0UA 1OHFA 1NOVA 4Q4W2 4RS5C 4NWVA 4Y4YA 1F8VA 4RR3B 4YVWC 1VRH3 1NA1C 2R073 1NCRC 1NCQB 1HRI2 2R062 2RM23 3ZFFA 1R092 3JB4C 1ASJ1 1A6CA 3VBSA 3NAPA 3VBOC 1C8M2 1FOD2 5J98B 3VBFA 1Z7S3 4QPGC 2X5IB 1PGW1 5BNPA 1HRI3 2XBO1 1QJU1 1COV1 1R093 2BBVA 1V9U3 2R043 2MEV3 1SMVA 2WFF2 1M06G 1QJY2 1RUD1 4N43A 4RQPC 3ZFGA 5C4WB 5CFDA 1RUG2 1NY71 4LLFA 1HX6A 5D8AC 4Q4W1 2DF7A 3CJIA 1POV1 3VBUA 1B35C 1CJDA 1MEC3 4QPIC 4CEWB 1QJY3 1VBC3 3HAGA 1RHI2 2FZ2A 1HXS2 1ZBE1 4CDUA 3VDDA 2R061 1ND2C 4IV1A 4PDWA 2ZTNA 1C8M1 1FOD1 5BNOB 5C8CB 5K0UB 1RUF1 3ZXAC 1H8TA 1ZBA2 1AR72 1RUI3 1C8NA 1RMU3 5CFCB 2RMU3 1RUE2 1VBB2 4JGZC 5L7OA 5ABJB 5A33A 2WFF1 4IV3C 4CDQC 5BNNC 4JGYA 1AR62 1BBT3 1HRV2 2RS52 5LK7B 1AR73 2HWB1 1RUG1 1AL23 3VBSB 3NAPB 4Q4X3 1RUE3 1AYN3 2XPJA 4RS5A 4RFT0 5BNPB 1RHI1 1VBA3 4WM7C 1HRV3 1HXS1 1PVC2 3TN91 1BEV1 4N43B 1POV0 3VBOA 1AR81 2WS91 1OOPB 4GH4B 1PIV2 1ZBA1 3VBUB 1VBB1 1E57A 2WWSA 1AR61 2RS51 1VRH2 2ZZQA 1PIV3 1RUC1 2R072 5BNOA 4Z92B 3ZFEA 4Q4V1 5ACA3 5AC92 2RM22 3FBMA 3JBG1 5CFCA 1H8TB 4RR3C 1R081 3VBRC 1ND3A 5ABJA 1PVC1 1Z7S2 5JZGA 5L7OB 4AEDC 4N53C 1TME1 2RS33 2HWF3 5A33B 5AC93 4CEYC 5FMOL 4JGYB 4GMP3 1V9U2 2R042 4YVSB 2MEV2 1AYM2 4FTBA 2RR13 3LOBA 1D4M3 2X5IC 4CDXC 1W39A 5DDJ1 4RS5B 4JGZA 4YVWB 1BMV1 2BPA2 1VBE3 1AYM3 4IV3A 1AR93 1NA1B 1VBD3 1MEC2 3DPRC 3VBHC 1NCRB 4CDQA 1VBC2 4FTEA 1VRH1 1K5MA 5C9AC 2R071 2QQPA 1OOPA 4GH4A 1MQTC 2FZ1A 2RM21 3VBOB 2WZR3 3S6PA 4QPGB 4CEWC 1EAH3 1Z7S1 1QQP3 1RUI2 4WM8C 1RMU2 1HRI1 1FMD2 2RMU2 1R091 5FMOS 1V9U1 2R041 4RQPB 4NWWA 2MEV1 5C8CC 1EV12 4CDWC 3ZFEB 1BBT2 1FPN3 1TMF3 2RS13 1AL22 1B35B 1FMD3 4QPIB 4Q4X2 1R1A3 1ND3B 1AYN2 4GB32 5JZGB 1MEC1 1EV13 1QJY1 1VBC1 3J8F3 1VBA2 3ZFFC 1ND2B 4YVSA 2HWD3 2HWC3 4Q4Y2 3NAPC 1CD3G 3VBFC 1QJX2 4GB33 1PO22 1RUH2 2BFUL 2TBVA 3VBRA 1PGL2 5BNPC 4YVWA 1RVF3 3JD72 2PLV3 4JGZB 4AEDA 1NA1A 1RUI1 2HWE3 4N53A 1NCRA 4Q4Y3 1RMU1 1RB8G 2RMU1 4IV3B 4CDQB 5BNNB 1PO13 2BUKA 3ZFGC 2WLPA 1QJX3 4RHV3 1PO23 1RUH3 1K5MB 5CFDC 3JD73 1BBT1 4QPGA 1IHMA 1AR71 3CJIC 1AL21 2GH8A 4Q4X1 1RUE1 1AYN1 5ACA2 4WM7B 1GFF2 3DPRA 3VBHA 4CDUC 3VDDC 1RUJ3 1VBA1 4RQPA 1HRV1 4IV1C 4PDWC 1ASJ2 2RS32 3JB8A 1QJZA 2HWF2 1MQTA 5D8AA 1AL0G 1H8TC 2BFUS 1DDLA 1PGL1 1B35A 4QPIA 2RR12 1D4M2 1QJU2 3IDEA 1NCQC 1ASJ3 1VB4A 1ND2A 2GSYA 1VBE2 1AR92 1VBD2 4SBVA 4FSJA 4CDWA 1NY72 2XBO3 1QJU3 1COV3 1PIV1 4EJRA 3VBRB 5ACA1 1RUD3 2WZR2 4AEDB 4N53B 5J96B 1ZBE2 5BNNA 1OPOA 1AUYA 1EAH2 5C4WC 4CEYB 4Q4W3 1NG0A 1QQP2 2RS31 2HWF1 1POV3 5FOJB 5AC91 4BCUA 4GMP1 1RUF2 2Y26A 4CDXB
chains in the Genus database with same CATH superfamily
3RWKX 1ZBE3 1J3PA 1TQ5A 2HEVF 3LEGA 3Q8FA 4JDMA 2P6HA 3JQWA 1WCSA 1GP5A 2BZDA 1SDWA 2UURA 1TMF2 2RS12 5GLTA 3VDBA 4XJ9A 4RGKA 1N47A 1H8VA 2XG3A 1BK0A 1L3JA 4HVQA 4XHXA 1RUF3 1VBE1 2E7AA 5CIRA 4YM3A 5C9AB 4NOTA 1SACA 2ZEXA 4ZXKA 3N7JA 2LALA 3FMGA 5CZKA 5K0UC 3ZFEC 4NJ4A 1D0GA 4JTOA 2ZGQA 2PFWA 3OPZA 1Q43A 3VD4A 1UY4A 2HWD2 1H1IA 3AP4A 4UWDA 2WFF3 1CWPA 4PF5A 3V0AA 2EXIA 3WCSA 1PMHX 3CHXA 5HCFA 5C3QA 1YXWA 2HWB3 2BGPA 1JYCA 2UWBA 4AVAA 4UF0B 4WM8B 5LY2A 1DBNA 2QQVA 5FMBA 1RVF2 4XIKA 4MXVA 2PLV2 5C3RA 3SH3A 4XFBA 3BYWA 3ZO0B 1DQ6A 1OQ1A 3KV5A 3A7QA 2GZWA 2ZX3A 2VULA 3M3OA 3ZN6B 1S4CA 4D3WA 4KBBA 2HYKA 4CDWB 1LHOA 1HXS3 2VOWA 3LIHA 4P9YA 4RHV2 4C90A 4RR3A 2BDRA 1JXNA 3LFIA 3BVCA 2RV9A 3WUDA 3EJKA 1QXPA 3HNMA 5F2SA 5GKAC 1BEV3 1NCQA 4D0QA 3NL1A 1GP6A 1O91A 4GXLA 4LTAA 1ZRFA 1SBEA 3K48A 2VXJA 2WR9A 1BLZA 1D2QA 3GBWA 3GBFA 3K4AA 3O5SA 1R1A1 2DBIA 3PVBB 4XCBA 5FZIA 4CEYA 1MS0A 1GUIA 4JHTA 1PGSA 4YW7A 1ZBA3 4HKWA 3CBNA 3MLKA 5T5JA 5FY1A 2ZJCA 3OUJA 1RUJ2 3NV2A 2F4LA 4NRMA 2X5IA 4PBPA 2IXCA 4Q4V2 2JXAA 4XF3A 2GC0A 3T2OA 1YUDA 1N3QA 2XQXA 3VBFB 4CDXA 1IKPA 1T6BX 5IVCA 5KBFA 1HB1A 2ZAAA 1WW6A 3JBG2 1L7QA 4I0BA 1W2NA 1I5ZA 2OA2A 3MIFA 5CVRA 4FFIA 2RS53 3OY8A 5EYXA 4FOQA 5F6KA 5FFOC 4D94A 1OBNA 4FI9A 3OGJA 1EUUA 5J1XA 2EIGA 4LQRA 2P37A 4XACA 1UD1A 3I2KA 1LGCA 4NVPA 5GZEA 2A5ZA 5BPXA 5JR2A 3S5AA 3T0AA 3WUCA 4W8JA 4AQ2A 2AUYA 5C9AA 1DGWX 2BQPA 2ES3A 4Q4Y1 2Q30A 2WC2A 1SLTA 4BJ0A 4AOCA 1PO11 3M70A 4OYUA 2E6VA 2D7FA 5A32B 1JZ7A 5DDJ2 4OMCA 3LA7A 3OBZA 3JD71 4YW1A 2HH9A 4IE4A 5IK8A 3KHCA 1X33A 1POQA 2UWCA 5E88A 1BMV2 3J4UH 3WT3A 4HSLA 3ZYRA 2ET7A 5FR3A 2YC2A 2VVDA 4O9GA 2IZWA 1NYWA 1OQEA 3M8LA 4MGKE 4WM8A 5FYVA 5KR7A 2PQQA 5FV3A 3BCWA 4NHLA 3MICA 4IV1B 4YVSC 4YFWA 2XL7A 3ZN6A 1J3QA 5C8CA 5FIXA 4B4PA 3WNKA 1XU1A 3C8XA 3RS6A 4S2FA 5CAZA 1WCQA 3KGLA 4YVWC 1WMEA 4AI3A 5F5AA 1VRH3 2BJSA 3JU9A 3RPQA 2OPKA 1OLRA 1JI6A 4XQDA 2AGSA 4OHZA 1S1AA 5EJZB 1MVEA 1OPMA 3IKWA 4M4PA 5KWRA 3MW4A 3PVOA 3RJ2X 5FK7A 4W4ZA 2LM3A 5JMCA 4E27A 5JIAA 5A7WA 1C8M2 4HK8A 1O5UA 3VBFA 1XPWA 1Z7S3 1WA4A 3MIHA 5FMDA 2AYHA 3LD8A 4IE5A 4XOGA 1PGW1 3ATGA 4OUMA 3N9PA 4AGRA 2V4VA 1QJU1 1COV1 4M01A 1EPZA 5IYYA 4Q0SA 2P6CA 2PHUA 3VL9A 5G04L 1HQWA 5C5UA 5L9RA 4D7YA 1QJY2 1A34A 4G9SB 5JOZA 5LEKA 4OHXA 2QTWB 5A1FA 1GZCA 2KXLA 2ZMKA 3MYXA 3OCPA 4S2GA 5FPVA 5IVEA 4LO6B 2JWPA 1RUG2 3H50A 4L2NA 4XF0A 4CU8A 1HN0A 4KWKA 2P17A 1QDCA 1W8WA 3OEBA 5CKMA 4YNIA 3VD3A 2CV6A 4BU2A 2A3YA 3VBUA 1B35C 4CEWB 4K8FA 2W5FA 3HAGA 5K4LA 5D1IA 4RFRB 3VDAA 2FZ2A 4YM0A 1JHNA 2YFZA 1V00A 1ZBE1 1WW5A 1UYXA 4IV1A 4AEJA 5J37A 3B9CA 4AAPA 2ZTNA 4XEZA 2YU2A 1BCXA 4YGCA 3ABZA 4D7TA 2AR6A 1V6LA 2E53A 4XQWA 1ZM1A 1C5IA 5BNOB 4OFGA 1UMIA 1RUF1 3A23A 4UFLA 1KQRA 1H8TA 1NZCA 4QKFA 2R1BA 4XTMA 2A6YA 2WO2A 4NPRA 5E8AA 4LULA 3IAPA 4QQHA 1URXA 4HZFA 1VBB2 3IAQA 4DXZA 3OOXA 4TZDA 3EXUA 4LHNA 3KM5A 3WINE 3VZJA 2WFF1 4AHXA 4IV3C 4AFAA 4LHKA 4CDQC 4XC9A 4N8MA 5BNNC 1F5FA 1HRV2 1FNZA 2HWB1 2JG9C 1O8PA 2QE3A 3VBSB 2BWAA 4Y1YA 1PZ9A 1J3RA 1JH5A 1RUE3 1Z78A 2VTXA 3P6BA 2QUOA 5FO8B 4X6QB 4RS5A 3WNXA 2LW8A 3THPA 1MS3A 2CNAA 1N1YA 1OFSA 1EY2A 4F3JA 2WT1A 1OKQA 2QBXA 1HXS1 2Y64A 3O12A 4WVWA 5FREA 5A80A 3OD0A 2ZHMA 4Y20B 5DZFA 5FKBA 4BK4A 5HPOA 3KVAA 4MGTA 3WG2A 5C8WA 1SZBA 3HN1A 4BQ3A 4X8PA 1BEV1 4N43B 3S7IA 1ZA7A 4QAWA 2PHDA 4CYDA 1POV0 3VZKA 1CX4A 4CSWA 4JHZA 4D6SA 2QVSB 4QHBA 4AHWA 3T4VA 2VUDA 1ZBA1 3VHPA 4QB1A 2PHWA 3WDYA 3PDQA 1QOTA 4QKDA 3RRDA 1O3SA 3APBA 4AVTA 4WVZA 1XYNA 5DMYA 4TTGA 3V56A 3WF1A 4NAOA 4XFGA 2GMPA 5FZOB 2WWSA 4CP9B 4O7XA 2RS51 5FRAA 3PMEA 5FZCA 2YY1A 3PL0A 2ZCWA 1SLCA 4FVVA 4YZ4A 4E8CA 3B02A 2R072 5BNOA 4XDQA 4NIIA 1RXFA 4XDPA 3SCHA 2LRPA 2A70A 2RM22 2RDQA 1ENQA 4AGGA 2QQNA 3HIFA 3ACGA 4RR3C 3TYJA 3VD5A 3ZYGA 4UT5A 2PHFA 1G9DA 1W8OA 2Q1MA 5FBZA 2YFUA 1YJKA 1S2KA 4ISRA 5FP9A 2EXJA 1ULPA 3LDKA 1W03A 3M3CA 4N53C 5IATA 2Z2SB 5L7OB 2HWF3 3C7EA 1GU3A 2XUMA 5A33B 3CNAA 3GHMA 1YIFA 1W05A 2P3IA 4CEYC 5FMOL 3K46A 4JGYB 2JB8A 1V9U2 1W6MB 2WUHA 3E97A 4KU7A 2W87A 1I5PA 5SV8A 1RIRA 2ZS6B 1S0IA 4DS0A 3LOBA 3BTXA 3ACIA 1JS9A 4EWDA 2X5IC 2KM2A 4CDXC 1PK6A 4XUTA 1JN2P 2BNOA 4U2AA 2O0OA 3KWVA 1UXZA 2GU9A 2JG8B 2PAKA 4INDA 3WW2A 1ZRDA 2Z79A 1CIYA 1TNRA 3AMMA 1XYOA 2X10A 4JGZA 4F83A 4Y20A 4QD2A 3UK9A 2BPA2 1HB3A 4N90A 1AYM3 1UU6A 3V0BB 3V65A 1NCRB 1VRBA 2ATFA 2VOKA 1LOFA 3FL7A 4ONUA 5FYTA 1VRH1 3KCXA 3KVBA 3NV3A 1K5MA 2OVUA 4XCAA 1U5ZA 5C9AC 1CONA 2XB6C 3ITQA 4HANA 1V0AA 1C28A 5C3OA 1U12A 1W3VA 1F31A 4ZU5A 3USSA 2W1UA 2ZOEB 3N9OA 1UNBA 1I6XA 1XB9A 2VZVA 2WKKA 4LBQD 1YO8A 1ZZ9A 5EHDA 2X05A 3ZN5A 3C2UA 1EAH3 1Z7S1 2WNOA 2WAOA 3CZJA 2XGXA 1A8DA 4KG0A 1GZWB 4MGZE 5D2AA 1RUI2 5LRSA 4WM8C 4CP9A 1RMU2 1S0GA 3AP9A 2WO1A 1QXJA 1U5IA 3QLQA 3ZX7A 4HVOA 1KJRA 2D40A 2FDHA 1XJAA 2C9KA 5C8CC 4NMIA 4ZS2A 3PU3A 4QU1A 5G05L 1FATA 3CIHA 3FJSA 5F3GA 5GZFA 3ZXJA 4AW7A 1VMJA 3ZFEB 4BK5A 3VKOA 1BBT2 5FAXA 4BOWA 1XNAA 2EF6A 2DUOA 1SG3A 2JE7A 3ALQA 1AL22 4IW3A 4LBJA 4NIGA 4QPIB 2OQ6A 4ASKA 4DXRA 3N7KA 2QZ3A 2OW4A 1UZWA 1VPHA 2HKXA 3E6BA 2CWMA 3PTYA 3L2HA 3RG0A 5IAXA 1UX6A 3ENRA 4Q1PA 4QT6A 1EV13 3UKVA 4DY5A 1VBA2 1W6MA 3D6EA 5FZHA 5J48A 1ND2B 1DZTA 3LF7A 4CP0A 2G9ZA 5L9VA 1O8SA 4Q4Y2 2GALA 4A42A 1JZ6A 3RGBA 1WWYA 4Y1UA 1C57A 2TNFA 4K8RB 1A78A 3VBFC 4CCKA 4CP1A 4YFZA 4LHSA 3DCQA 5F5CA 3U78A 2BYVE 4GB33 1FI2A 2BFUL 3KF3A 3LPFA 4IXLA 2DCKA 4K1YA 3E6DA 1N3PA 5HV4A 1EUTA 5K9YA 3JD72 2Q4SA 1US3A 1WUVA 3TAYA 2GC3A 4AEDA 4AHZA 2LUWA 1NCRA 3PIJA 5F9TA 3VUOA 3I3DA 3VD7A 1YC61 1Q8VA 1X9PA 2JDUA 4YW6A 1ODMA 3QBQA 3LIGA 4I01A 2K9ZA 1RUH3 4X6RB 1MACA 5JSOA 4I3PA 3ETQA 2W92A 5KXBA 3R05A 1W8ZA 5JWPA 2XJUA 1DQ0A 3WP4A 2ARBA 1WMXA 2UYBA 1LR5A 3N9LA 3HNBM 4HT1T 4Y24A 1SFPA 1RUE1 1ZZ6A 3SH4A 5ACA2 2X29A 1KGYA 4FPJA 4WM7B 1W28A 1VIWB 1W2AX 3DN7A 2B7YA 1QH7A 4OZXA 3DPRA 3U10A 3VBHA 3ZXFA 1JU3A 3D82A 5FLHA 2GN3A 3M7AA 4IV1C 2J1TA 4IE7A 2W47A 3QH6A 2CAVA 2VUAA 3AMNA 1NQDA 3EHKA 2PYTA 1QJZA 2ZABA 4WVVA 4COUA 3I59B 5D8AA 1F4AA 2KD7A 3M4FA 1C4RA 4AEMA 3IZOA 1K45A 1H8TC 4QPIA 2RR12 1OFNA 1K3IA 1QJU2 2G19A 4GAZA 2QCSB 4LA3A 4XETA 4E4DX 4EYUA 2VZ1A 1DGWA 1VB4A 2H0BA 3A22A 1BYHA 5KHGA 4UW5A 2CYFA 1ND2A 1W0OA 3NRUA 2WSUA 4P9XA 5IWFA 2LTNA 1UZ0A 2ZHLA 1ENRA 2DDUA 2RE9A 2XJPA 3MFAA 2GNTA 4IGPA 4AR2A 2GP3A 3C7FA 4QXBA 4QGMA 4WZCA 1AR92 1VBD2 2Q8CA 4I0WB 1DG6A 2C1FA 3CEWA 3WNOA 2WZEA 2IXIA 3THTA 2GMMA 5DQ0A 4ES8A 1JZ8A 2CL2A 4COYA 4E4HA 3AC0A 5AFBA 1NKGA 1WD3A 1N1VA 5EIYB 1GOHA 4FPHA 1YI7A 2WZR2 5FK8A 3WNNA 1S0EA 4FXGB 3HOBA 5EJ3A 1ZBE2 3B3QE 4UBGA 3ZXKA 4D8MA 3CF6E 5HXVA 1XNCA 1OC1A 1W8NA 4Q4W3 2Q8DA 1WA6X 2JDZA 5DAWA 2W08A 2HWF1 1POV3 2J1UA 4LE4A 3FHQA 3MW3A 2YC0A 4HK9A 4V2WA 4XJZA 3WVJA 4CUCA 1US2A 2JIJA 3WW4A 5HXMA 1YYNA 5C3PA 4FPYA 4LO7A 3NSTA 5GZDA 1RUF2 3KGZA 2BNNA 1IS4A 1A3KA 1AF9A 5FOBB 3FLPA 1RINA 2W39A 3ZIXA 4NPMA 3BN6A 2R063 4NE9A 4WM7A 1HKDA 3CMGA 1GSLA 3VB9A 3B94A 1FPN2 3LEIA 2VQ0A 4J6GA 1YJLA 4LO4B 1FOD3 5LW9A 3LGRA 1AYM1 1NE4A 4Y4RA 5BNOC 1SEFA 2HWB2 4Q8LA 4XW3A 1DYPA 3J8F2 5T55A 4EN6B 2B45X 4YG3A 2B4KA 2LS6A 4KU8A 1TE1B 4FXKB 2HWC2 1WZXA 2W68A 3G7DA 4YW2A 4D6RA 4XBLA 3UESA 3ZLIA 3A21A 2BERA 2EALA 3EBRA 2XHNA 4HFSA 3MIEA 2NM1A 1RJ8A 1W9YA 2VUCA 4KH9A 1WBLA 4ZZ5A 1EAH1 1VJ2A 3GBGA 1KJLA 4IGOA 2GNMA 5LBCA 1BEV2 2QQMA 4NAMA 2HWE2 3H0OA 1UL9A 3VBSC 4YPJA 2ZGSA 4LNVA 3RJRA 3WHUA 1JZ5A 1NLQA 2UYAA 1U5YA 3A4UA 1H2LA 2C4XA 4MYEA 3ON7A 1W6PB 4O65A 3UGGA 3MV01 1CJPA 1M4WA 3ST7A 5LBEA 4AI1A 1REFA 4C1WA 1IZ3A 5F2WA 1A8MA 4C91A 1J59A 3SEPA 2VNRA 2ET1A 3LWCA 3TN93 1H2MA 5JXIA 3OSDA 3FN9A 1CAXA 4XTPA 5CU1A 3MLLA 3URFA 1AR83 3ZXGA 4N43C 4AFBA 4B3NA 1S0CA 1K5MC 1MS1A 4GMP0 1ZRIA 4XZPA 1LODA 3H7JA 4NUBA 4XYXA 1EV11 3ME2A 3H9AA 2WA4A 3WR0A 1W2TA 3OYWB 3BUCA 4HG6B 3ZSJA 1FT9A 1UOJA 4XJ8A 4SLIA 4NIHA 3DEMA 2XQRA 4I09A 4EN8B 1AR63 3I2FA 1PMJX 4EZ4A 1W04A 3TWIA 1REEA 1LHNA 1NT0A 2P3KA 1CPMA 4GB31 4I02A 4Q0UA 3NWKA 2XOMA 2DUQA 3QCWA 4XUOA 2V09A 4YZ3A 4QDRA 4DQAA 2IVIB 2RG4A 4LMFA 1QMJA 2HEWF 3POFA 3U14A 4LK7A 1R083 2VZRA 4Y5Z0 1OA4A 1W99A 2D43A 2R0HA 3B9IA 4BMBA 1PVC3 4CCOA 3N36A 2CGPA 1RUH1 3NMBA 3KQ4B 2PHLA 4PQQA 4URAA 3CJIB 3WQBA 3WSOA 1JHJA 2NPIA 2XBO2 3KCCA 5L7OC 3V0AB 1VB2A 2RVAA 2JD9A 5IW0A 5T50A 4GJZA 1C1LA 4HETA 1LOEA 1ULOA 3TEZA 2EAKA 4JGYC 3GM8A 1RUD2 3ZMNA 4JRLA 3BIEA 4L8QA 3NNGA 3OUHA 4AXOA 3WDWA 1LGBA 2Z5WA 1UOBA 1F2NA 2D3SA 3LAGA 5FYHA 4AAXA 2NP0A 3AKTA 4F8AA 4PCRA 2C24A 2VNGA 1OHFA 1W6PA 3J7LA 1ST8A 1ZRRA 2JG8C 2CWSA 3AYDA 3LA2A 2HEYF 2ZMLA 3BIWE 4NHMA 4RR3B 4YRDA 3UETA 3WW3A 2WJSA 4CXYA 4UFIA 3ZKYA 2ORZA 1APNA 1HJFA 3IWZA 3PURA 5DAVA 3W20A 1NCRC 1NCQB 4AWDA 4KWLA 4JKMA 5K8SA 3BGAA 5A6XA 2FCTA 1FV3A 3KT7A 3ZR5A 3OG2A 3MZHA 3N7MA 4ARXA 1A6CA 2D6NA 4Z8BA 3PTRB 4IETA 4KWUA 1RUNA 3IT8A 2Y0IA 4Y3OA 2OUHA 2WSVA 1ULFA 2X5IB 4ZS3A 3T2QA 5DAXA 4AFCA 5BNPA 4ZONA 1HRI3 4HSJA 4P9IA 3OUIA 2J42A 1GZTA 2WBKA 2XKOA 3OBRA 4HPKA 4W6WA 4CE8A 2BBVA 4MLOA 3MI8A 4KL1A 4UW3A 3OY8B 4P14A 3WX5A 2MEV3 1SMVA 3E5QA 4M3CB 3VZLA 3T30A 1J1TA 4EROA 1DQ2A 2D6MA 4QM9A 5A3NA 4GWNA 4COZA 5FWJA 2VZUA 5FXVA 1UKGA 2VCBA 4NIDA 3EYPA 3FFQA 3D8CA 1YFXA 4NHKA 4XBNA 2BU9A 2EAAA 4XURA 4E2QA 4A45A 1NY71 5IT6A 4LLFA 1HX6A 5D8AC 3POWA 1W9SA 4Q4W1 3U4XA 2DF7A 3CJIA 1YQ8A 1POV1 2VUJA 1CJDA 1MEC3 1UPSA 4QPIC 1VBC3 1QHDA 1RHI2 4RGGA 1OA2A 4R8HA 3MIGA 3GCWA 2XH6A 4NIAA 4FPOB 1GWKA 2R061 1OD5A 4A6SA 1ND2C 3KV4A 3R0RA 1ZA4A 1LOGA 1UW8A 5A7OA 3ZYJB 1KS4A 2BGCA 3WDVA 2VL4A 1OQDA 1FOD1 3UKNA 5C8CB 4Z07A 5IHRA 3B69A 4FOVA 1G9FA 1C8NA 3MEPA 3SXWA 2A6ZA 1RUE2 2HBTA 2JJ6A 4RD7A 2YHJA 1W2OA 2YUEA 4QXHA 1ODNA 5DAPA 5ABJB 1GQGA 5LY1A 3SKJE 4ASLA 4LHLA 1QU0A 3AJYA 4XPVA 2Y6GA 1MZ5A 1H9WA 1KXGA 4XFFA 1Y9MA 2PAMA 4JX0A 2XLAA 2WQ8A 3PUSA 1OH4A 3WNLA 1AR73 1AXKA 3AB0A 1G7YA 1UZZA 3MPBA 3I3QA 1Q5OA 1JZ4A 2IXKA 3AFGA 5T5LA 4AI9A 2VQAA 4Q4X3 1AYN3 3RVHA 4OHWA 5A3UA 3ELNA 1UX7A 1W6QA 4QX5A 4RFT0 4CZSA 3KMHA 4A7YA 5CISA 4ZU7A 3CU7A 4WM7C 5LBFA 4JKLA 1X7NA 1BZWA 2Y0OA 2VW2A 4M3CA 3RWNA 4NHXA 2VOVA 4ZZ8A 4P9JA 2CGOA 2D93A 1H4GA 4YG6A 1QY4A 4GULA 4IDZA 3TN91 1JYXA 3JCIA 3RI8A 5H9RA 1XNTA 1W9FA 1Y7BA 5FYBA 3J9SA 1AR81 3VBOA 1UYPA 2OIIA 4XJAA 3MIBA 2C26A 2A75A 4ATEA 1GANA 2TUNA 4BIOA 3CKHA 2FDKA 2ETEA 3VBUB 1MVQA 2GC1A 1E5RA 4XFAA 1QKQA 5J3UA 3N3HA 4KGQA 3AP5A 3U07A 4FCAA 4YZ2A 2P34A 4BM8A 1UY0A 1AR61 5HCBA 1IG3A 2X09A 4HL0A 3DYMA 2ZZQA 3WP6A 1IQDC 1PIV3 3MHZA 1Q8QA 1ZZBA 4Q0VA 5GLWA 3Q8CA 1SPPA 3POBA 1J58A 2BGOA 5FUNA 5SV5A 5FP3A 4K7JA 1OLME 2WT0A 3ACFA 3M3EA 2W2IA 1JUHA 4UAPA 5L36A 4R4XA 3IIIA 3FBMA 2ZEYA 4IUGA 4H7MA 1H8TB 1WW7A 2VCMA 1R081 4AI2A 3GJAA 2QZ2A 5ABJA 2FQPA 1PVC1 4LT5A 4GWIA 5JZGA 5LASA 2RS33 3K3OA 2W3JA 2XKPA 3DL3A 4LR4A 1O3RA 4YARA 1OH3A 2DFCA 2VNVA 2VZSA 3D4KA 3NV4A 5FZKA 4LKEA 4GMP3 4MUVA 2R042 3W9AA 4Z1VA 5A1LA 3VN4A 1JZ3A 1D0HA 1GP4A 3U37A 1AYM2 4CRQA 1UU4A 1D4M3 2CHHA 2WN2A 3AVRA 4BZ4A 4DUXA 5HBAA 3KT1A 1YI9A 3S5QA 4CTEA 1CQ9A 4FOWA 4M0NA 1KS5A 5KXEA 2VMFA 2AENA 2WFPA 4RS5B 5FPXA 3AXEA 2FCVA 3ZM8A 2GNDA 4Y5SA 5EQUA 3BPSA 1YHFA 4BLJA 3PUAA 1Q8SA 4MADA 1T6GC 1HQLA 5A3PA 1GR3A 4KGGA 2DU1A 2QQPA 1XYPA 4LBKA 4H14A 3VHNA 4BQXA 1WD4A 1YLLA 2FZ1A 2PAEA 3O1PA 1IS6A 4QPGB 1GKBA 3RMXA 2ZX1A 1W6NB 1HJGA 2FMYA 5FTTC 5B4XA 3PNAA 3V64A 4E2SA 1LESA 5A3MA 1ULGA 3POJA 4M00A 1QQP3 5A3WA 3VV1A 1HRI1 4LKSA 1G9BA 2RMU2 2XMLA 2ZEWA 2D3PA 5FMOS 5FY8A 4QQ2A 1CAWA 4IQPA 4EN0A 3K75B 1JYNA 3U75A 3M3QA 2MEV1 2VECA 4NWWA 5CA6A 2VBPA 2UY8A 3GZTB 1EV12 3E5UA 3JQXA 5IUQA 3IB3A 4LO8A 1W0PA 1W8FA 1QNYA 3BALA 2J1SA 1TMF3 2RS13 3FE5A 4G3YC 4QDQA 4I30A 1FMD3 5CNAA 4GALA 3KT4A 5A7WB 1O59A 5BNQA 4GB32 4LBLA 2WNUA 1MEC1 2TEPA 4L0PA 1REDA 1WW4A 1ZNPA 1VBC1 2DBNA 2BRTA 2UWAA 2F4PA 5CG8A 1O4YA 3ZSEA 5LA2A 4YYOA 2HWD3 4FBFA 1SLLA 3OGVA 2OKXA 1H9PA 3USUA 3LSDA 1RUH2 4UFMA 2FD8A 2TBVA 3VBRA 1PK6B 4GIQA 5BNPC 1MZEA 2K0GA 4FP3A 5DUWA 1RVF3 1Y9GA 5IK5A 3H8UA 4LLOA 2PLV3 4LPLA 2D5HA 4JGZB 2VU9A 4AG4A 4CCLA 2EA7A 2EXKA 4RHV3 1QJX3 1K5MB 2YXSA 1W0NA 4MOAA 2ZGTA 5F5QA 3WQ1A 5HV0A 3BPZA 2ZZJA 2W1QA 1NAEA 4DPNA 4XQ4A 4QPGA 3AX4A 3POEA 1W6NA 1AR71 3CJIC 2DCJA 4HBNA 2E32A 3FLRA 3DYPA 4XABA 2VMEA 3ZN4A 4CUBA 3AP6A 5AVPA 2JB4A 3UNPA 1JW6A 4JDNA 2RHPA 1UO9A 4Q4X1 1AYN1 1QWRA 1DF0A 2WZ8A 4B7EA 3KHBA 1GFF2 3ILRA 4PLOA 1RUJ3 3U0ZA 1BVP1 2ZX4A 4Q27A 3ACLA 1KITA 3RSJA 1UPIA 3ZPOA 2B46X 4JV4A 4YW3A 3GGLA 2PHXA 2ZX0A 3JB8A 2PHRA 1PVXA 4NR1A 1MQTA 3QACA 5FY0A 4R4ZA 4FPFA 4AF9A 5IFPA 4UW6A 2WQZC 1XBFA 2BFUS 2VO5A 2VJXA 3HT2A 5A7NA 1PGL1 3IDBB 1UY1A 4R9DA 2NMNA 3TNQA 4Q0PA 1L7LA 2ZHKA 3IDEA 1RC6A 3H8OA 1NCQC 1ASJ3 2ZGNA 4YWAA 2VOTA 4B4QA 2RJLA 1LULA 3RYPA 3VKFC 3AMHA 3GNEA 4NRQA 5H9PA 3IM0A 1VBE2 3K2OA 1MZFA 3KF5A 1MS4A 1H6XA 4XIOA 1F15A 3O1SA 2VM9A 2VY0A 5GM0A 1SBDA 3WF3A 1NY72 4LBMA 3N4MA 2P2KA 3Q8EA 1PIV1 1Y3TA 2VAUA 4A7ZA 4XFIA 4FPLA 1AHSA 4AZZA 4COWA 1GNYA 4H3WA 1UIJA 4EJRA 5CKQA 3D0JA 4L9BA 3U1XA 3PVNA 4ET7A 4GZ9A 3VD9A 3WF4A 4K1ZA 1WBFA 4AEDB 1OA3A 1H30A 1SQ4A 2DCZA 3DGTA 3TNPB 5K7PA 1OPOA 1ULCA 4DFSA 4Y22B 5J36A 1DQ4A 2RS31 1S55A 4B8EA 5JR7B 3INAA 1CIWA 3ZDVA 4PIYA 3H1MA 4QDSA 3GDBA 1FX5A 1H1AA 1W8TA 2Y6JA 2A3WA 4BCUA 4GMP1 5A1AA 2ZGPA 2VVEA 1D4M1 4CCJA 4MGYE 3K77A 4BB3A 4QX2A 5FZDA 4Z2AA 4W50A 1C8M3 2CTVA 1PMIA 1EYBA 1HDKA 5KHHA 2WQ4A 1SFNA 3DPRB 3VBHB 1R1A2 2BEOA 3BOWA 3WQ7A 1GOGA 2WO3A 3P1IA 2L9LA 5LATA 3Q8AA 2C9AA 2HBUA 4IE6A 3VZOA 1GQHA 4S2HA 4FT8A 1OLMA 3Q8BA 2DVAA 2WWUA 5D8AB 4EZHA 3WF0A 1VLNA 4EE2A 4AGVA 4NROA 2YBPA 1SLBA 5F39A 1NUKA 5FP8A 5KXDA 5DG1A 5JPNB 5T3NA 4BQ5A 5ABJC 5T5PA 5JZGC 3VKNA 5FZBA 3RMYA 3TEYA 3MDPA 4XF9A 1OF4A 1RUG3 3TEXA 1WMDA 4ITCA 3MFCA 5FZ8A 3TN92 1MPXA 3LB9A 1QQP1 2AZ5A 2P5BA 1CAVA 3R4DB 1MS5A 5DABA 1VAKA 3SCFA 4A41A 1LEMA 4TWTA 1AR82 2ZGRA 4QX7A 4FPGA 4N7UA 4YGDA 3AFKA 2WT2A 5FZ4A 4BISA 1PO12 4I0AA 1F5JA 4AVCA 1S0JA 5F7UA 2AACA 3VZMA 3NV1A 4NO4A 2YPJA 3UT0A 5FO7B 4OHVA 5FYSA 1XQNA 3GJBA 5GALA 3WNPA 2JICA 1TMF1 2RS11 4XJUA 3H3LA 4K9SA 1FMD1 4DUVA 4Y22A 2WS93 1IG0A 4DOUA 3SISA 5HCAA 3ZFFB 4M0HA 3ZXLA 5FUPA 4Q5OA 3AMPA 4OHYA 2G9FA 2XJQA 3OJBA 2UU8A 2WNVA 4XJWA 5LZ6A 1VBB3 1WCDJ 3OPTA 1O5LA 3N7LA 2I45A 1JTZX 2HWD1 4A3XA 1YQ5A 3VBUC 1VAVA 5FYCA 1H0BA 1AXYA 4DZGA 1DGLA 1R082 3PUQA 2O14A 1LNSA 2BVBA 2DV9A 1QF3A 4LKFA 4A4AA 1JU4A 4JC1A 1RUC3 2JD4A 3I3BA 4Q1RA 5C71A 3NJXA 2O8OA 1C5HA 1RVF1 4AVVA 5BYNA 2PLV1 5C4WA 3O0WA 2XVKA 3KZ4C 4CUGA 1JUIA 3PUIA 3NKTA 4LIUA 5KHIA 3LDRA 5CFDB 1PX3A 4AE2A 2YG0A 1Z0HA 4FTSA 4RHV1 1QJX1 2YYOA 1O3TA 2WINB 1TME3 2ERFA 2QQIA 5KHKA 1PGW2 5F37A 5F1RA 2O1QA 1G9AA 5FZ7A 1COV2 1Y9QA 4HONA 4NRPA 1DGRN 3KV6A 4QXCA 2W46A 2Y6KA 2MPFA 1F35A 2BV4A 2NQYA 5DG2A 2WNUC 2ZACA 3ILNA 1RUOA 2OX0A 4CDUB 1HLCA 3MUY1 1ENSA 4MZUA 1UZVA 4QGLA 5FYMA 4ARYA 1NE6A 2R7EB 4IEZA 1JYIA 1XOYA 3ORJA 1RUJ1 5K0UA 1UKRA 3WF2A 1LTEA 3WNMA 3TEWA 2ADEA 1S0BA 2VQUA 1O7FA 4RS5C 4GQ7A 1AX0A 1F8VA 2YC4A 1QNWA 1ALYA 4YGBA 5CADA 3J7HA 2VOXA 1LECA 4JVAA 5LWBA 4LXLA 5CB7A 2R073 5IVVA 3EMRA 3UKTA 3AL6A 1CAXB 1HRI2 3SHRA 2RM23 5FXWA 3ZFFA 4OUEA 1W9TA 3KV9A 1XNDA 1UOFA 1ASJ1 2EXHA 1G8WA 3NW4A 2W0XA 4YSFA 2P3YA 4N7IA 2VMGA 1DLLA 1N1TA 3NAPA 1CN1A 3P5BA 4ATFA 3LE0A 5C6CA 1CAUB 1AJOA 2Z69A 5J98B 4QPGC 2VCAA 1OUXA 5FY4A 5FZ1A 1W8HA 2VZOA 1VAMA 5JLVA 2BOIA 3KQRA 1XC6A 4EN7B 3CO2A 3EO6A 2BNMA 2NYYA 1R093 2WA3A 1V9U3 3QD6A 3D5OA 3LDBA 1UCXA 5IJRA 2WFF2 3R4SA 2ID4A 3MO4A 5FO9B 3HBKA 1NLSA 1M06G 4CXWA 2ZHNA 3KS7A 1ZREA 2BW8A 4IEUA 3I4IA 5LA1A 3AKSA 3OBAA 5CFDA 3ZYPA 3GF6A 3DYOA 2VGDA 2IFWA 5HI0A 3TOJA 2DUPA 1DLCA 5IVBA 1OF3A 5JIUA 4DEVA 3PJYA 4BHPA 4CU9A 2J1AA 2A1XA 3THCA 3ZYBA 4FPEA 4YM2A 3WG3A 5GZCA 3MLJA 3NVCA 3LCPA 4EV0A 1OMIA 2VMHA 2ZGUA 2JDHA 3MPPG 3DUIA 1HXS2 4L99A 1HB4A 4CDUA 1LENA 3NJVA 2W95A 4YGEA 1AXZA 1D7PM 2Y38A 4BDVB 4P9LA 2F6BA 1E5IA 3RZMA 1C8M1 3NKGA 4ES9A 3LQCA 4UFJA 2V72A 3O1VA 5FPLA 1SCRA 2VD7A 5LB6A 3BTZA 3POSA 3ZXAC 5JPMB 5I0SA 3VHOA 1ZBA2 1AR72 1PK6C 1RUI3 1V6NA 2C0ZA 2WL1A 5H9QA 1RMU3 3PJQA 3W21A 5CFCB 1UIKA 1GQPA 4JGZC 5CYYA 1CR7A 1V6IA 4ZY9A 4TN7A 1H4HA 3H1YA 4XXPA 3ZIWA 1Y43B 2OPWA 3AZZA 3IMNA 4FAHA 3WEZA 4A7KA 1YRZA 4DO0A 3ZDSA 4CXXA 4FFHA 3CL1A 1LOFC 5IFTA 4CPBD 4LBOA 2FDFA 2ENRA 1BBT3 2RS52 3J7NA 3IBMA 1LB2A 1HN1A 1V6OA 2PN5A 2XJVA 5ANNA 1CAUA 1RUG1 5JSRA 1AL23 1XRUA 4MXWB 1DP0A 3QH7A 1YFYA 4B29A 4V2VA 1RTVA 1XE7A 1YFUA 1DYKA 1JODA 5DZGA 2EIEA 1SLIA 3WD5A 2XPJA 4A2UA 1V6JA 1TZOA 4UFHA 3N9NA 5FZEA 5BNPB 4G4FA 1VBA3 1TG7A 4IEYA 2Q8EA 4HKLA 1JZ2A 4HPKB 4MGSA 3PHMA 3ZSKA 3WG1A 5LA0A 1GBGA 1QJEA 4LJHA 3GCXA 1IKQA 1RYYA 3G6JB 5GLZA 2DU0A 3HQXA 4O61A 4L11A 4R9AA 4NN0A 1LJ7A 1RJ7A 2I74A 2VCCA 4ORFA 2WS91 3WV6A 1OOPB 3IDCB 4AK3A 2VTFA 2XJSA 3K4DA 2SBAA 4XF1A 4C8DA 4DXTA 4M3CF 4GH4B 1PIV2 2JDYA 5I0UA 3SMHA 2EIDA 3E5XA 2QQWA 1VBB1 2D6KA 4AQSA 3T1LA 5KHJA 3HQUA 3S0MA 1PM4A 3M1HA 5F3CA 3PUHA 2PELA 2Y8KA 2DTYA 4FO9A 3HBZA 5FZMA 1VRH2 5FXXA 4P5YA 4QHOA 1RUC1 5A6QA 3O7OA 3POIA 1UY3A 5LEJA 4L92A 4XUQA 5ACA3 4LBQB 4WVMB 2RJKA 2CAUA 2A71A 3F2ZA 1KRIA 2YB7A 1X9TA 5CFCA 2IXJA 5E1RA 3B7MA 1ND3A 2YPDA 5EFUA 4BA6A 4E8DA 1Z7S2 1XE8A 4BQ4A 2NN8A 5LA9A 2WRAA 4XZUG 4AEDC 2YBSA 1TME1 1NLRA 3FLTA 4LO5B 3JUUA 2VH9A 1FYUA 2R0FA 5AC93 4DB5A 1OVSA 1YQCA 3SEEA 5M0TA 1DIWA 2G1MA 4UOJA 4MXWA 3UJOA 1JOBA 2RR13 3H8XA 3H42B 3I97A 3HN3A 3ASIA 1GWLA 2CU5A 5GZGA 1W6QB 1RITA 3C7HA 3ZKUA 2B9UA 2NLRA 2XUEA 3VDCA 2PHTA 1HIXA 4IV3A 1AR93 1NA1B 1VBD3 4GJYA 2VE1A 3DPRC 3GALA 3VBHC 4CDQA 4BPZA 4FQZA 3SCGA 5T54A 3WP3A 4FTEA 3THDA 1JYVA 3WXPA 2DTWA 2R071 4N9HA 4OLLA 2JG9A 1OOPA 1UF2C 5JOXA 2XL9A 3L9JT 1CZVA 2ZGOA 3GXUA 4PIZA 4GH4A 2JENA 2RM21 3VBOB 2X8KA 5FZ9A 5GLUA 4AYUA 2WZR3 1LU2A 2ZX2A 4AL9A 2QQLA 5JI7A 4CCNA 4PLMA 2FDGA 2DYCA 4JKKA 5ANQA 3T0BA 1ZZ8A 2JE9A 3H7YA 4UI9L 5FY5A 3ZOIA 3SQOA 1FMD2 2VPVA 2WLQA 5E6HA 5JOWA 1R091 2P3JA 4FP2A 4X8NA 1V9U1 4EWAA 4RQPB 2E33A 3HNYM 2D97A 5E16A 4OZOA 1QOSA 4QKBA 4LBQA 1SPPB 2YZ4A 2E31A 4WVMA 4E2GA 5JXJA 3OD4A 1PX4A 2WYSA 4R9CA 4B1LA 5I8TA 3ZSLA 3I8TA 1FPN3 4XVHA 2Y6HA 3CQOA 2BVVA 3I3EA 2YROA 2XWJB 3ZVXA 3WDTA 5L9BA 3HJRA 5A3TA 5A6YA 1DCSA 3O0VA 2A3XA 2QDNA 5JZGB 5C3SA 1IQAA 4A3ZA 2PXJA 3KB5A 3J8F3 1I3HA 4P9WA 1B09A 2VG9A 3ZFFC 4BXFA 3BU0A 1WLWA 2CGNA 2H6BA 5FCCA 3FUOA 1WLDA 3I2HA 2HWC3 3X29B 1ENXA 1ZRCA 3NAPC 3OEAA 4CDWC 4B1MA 1QJX2 5F5IA 3RQ0A 4KMQA 2FDJA 3KD4A 1C1FA 3B01A 3Q9OA 2VBBA 4QX0A 3UGHA 1PZ8A 1NA1A 1RUI1 2HWE3 4N53A 2ZEZA 1JYTA 2ZXQA 4IESA 1RMU1 1O6UA 2WNEA 1RB8G 4Y33A 4XF4A 3WOGA 4BH9A 2KR2A 3VL8A 2A6XA 4LORA 3TB0A 4ASMB 2WLPA 3OGRA 2AH2A 1PO23 2N7GA 2Q0AA 5CFDC 1Q8OA 5DZEA 5EJ1B 3IMMA 3I3MA 3SNMA 2W91A 2MNGA 1HB2A 2RDNA 2ZMNA 3AK0A 1BVVA 1IPKA 1BBT1 3AZWA 4M4RA 4OI4A 2GMEA 5I8YA 3RYKA 2OZ6A 4LKDA 1AL21 1CPNA 2R49A 4OI1A 2QQJA 2GH8A 2YDEA 3D0SA 3RNSA 3GZEA 3ETPA 1S0FA 2A7AA 4CDUC 1IPJA 1H1MA 1VBA1 4RQPA 4XFCA 1LAJA 3I7DA 2BBAA 3T1MA 3O1MA 4AHYA 3E6CC 2OUJA 3BTYA 1CAWB 1ASJ2 1UMHA 2ZBJA 3IPVB 1U0AA 1S2EA 2HWF2 3W58A 2Y33A 4XAEA 2QFEA 2ZGMA 4MHRA 1AL0G 1VE0A 3ACHA 4O9EA 2XJTA 1GZ9A 5L19A 2FDIA 5B2GB 1UMZA 3AJZA 1YIPA 4NHYA 4DINB 4MG2A 4IL7A 5I0DA 4KQ7A 4I2OA 1YQ6A 4TXWA 1DYOA 1N3OA 3ZPYA 3MBWA 4XAAA 1LU1A 4UF0A 2WYFA 4BIFA 1BJQA 4MVTA 4EQVA 2WNUB 3BI3A 3C7OA 1AJKA 4Y1VA 4GD4A 4YLZA 3BB6A 2PQSA 2GC2A 5CG9A 4UBHA 2YGLA 4XXAA 4QB6A 1ULEA 4AVBA 4SBVA 1CX1A 4FSJA 4CDWA 3DKWA 2XBO3 2HYXA 4BQWA 4QB2A 1U5XA 4GWMA 4MV2A 1J1LA 5I0TA 4DRRA 5BV6A 3MW2A 3USUB 1WGPA 5FPBA 3VBRB 5ACA1 1RUD3 1QH6A 4KWJA 4IE0A 2Q8OA 2OZJA 4AQTA 1ONAA 3ZXDA 2DCTA 3IDAA 1AUYA 1EAH2 1KD7A 4MO3M 1KFUL 3PVEA 5CEHA 1NG0A 4IEWA 4ZU4A 1KDMA 2JKBA 5FQ0B 5AC91 1WKYA 2DVDA 4LEJA 3WG4A 1XNBA 2CY6A 5B4NA 2Y26A 2JDKA 2RR11 3N35A 1GICA 2R6QA 5IVJA 2W52A 4P5HA 4JAAA 5F32A 2MHFA 2A6VA 1PZ7A 4Q0QA 1QDOA 2OXBA 3GZUC 3ZYFA 2EIBA 5JXGA 1F4HA 5L73A 4Q29A 2Q1FA 1K12A 1S0DA 3BODA 4H7LA 2AREA 3IPVA 2ZAHA 1UAIA 4LITA 3MV11 4R52A 1AR91 1VBD1 2AEZA 4B7KA 1LHUA 4P02B 5JMOA 1MQTB 1F9KA 4BE3A 5A32A 5AFEA 1X36A 3RZLA 1VMFA 1VALA 3H1WA 1PHMA 1NQJA 4IERA 4DXSA 5CFCC 2E26A 2EVXA 3NNJA 1ND3C 4RYDA 2VBDA 5FBJA 5CKNA 2WZR1 1HV1A 2FCUA 2ZPXA 4Y5TA 1KDKA 4XDOA 1IS3A 1HV0A 2VC9A 2WN3A 3KSCA 5HCHA 5JXHA 2J22A 4PJYA 5FYIA 2FHRA 1GV9A 5JOYA 3ILFA 5F8PA 2VMIA 5CBLA 1WCKA 2B8MA 4DY3A 5C33A 3MF6A 2OYZA 3FFZA 1SFYA 2DFBA 1H2NA 5JAXA 2WS92 1XXNA 3AVSA 2B39A 1RHI3 1GYKA 3HMYA 4FFGA 1C3HA 2WABA 3RZJA 2GP5A 5FZGA 5I8SA 1J83A 3POGA 1K5JA 3I2IA 3AZVA 1TVGA 5E89A 2VZPA 1HQNA 2R32A 4E9KA 2DVGA 1DQ1A 3KCYA 1IGOA 1FPN1 3T0DA 2W94A 4LIVA 4Z82A 2CDPA 4KG8A 1I1EA 2JDAA 5KXCA 1E5SA 2D5FA 3RZZA 5C5TA 4MH0E 2LROA 2ZKLA 1KEXA 3S57A 1UYYA 5JCTA 2K46A 3HVDA 5J7MA 5FQ0A 4QQLA 1OOPC 1RUC2 4QXKA 3WW1A 4LBNA 2PTMA 1JYWA 3J8F1 4LOTA 3U4SA 4GH4C 4QM8A 1JBCA 1P8JA 5FDBA 1AZDA 2HWC1 4K40A 3NJYA 5FYZA 2E63A 3RI9A 1QIQA 2D6PA 1UYZA 1X82A 3O1UA 4COVA 2F17A 3AYAA 4XILA 2VMCA 4CPBA 4XHBA 4MSVA 5F3EA 4CCEA 1TME2 5FY7A 4WBBA 5JDBA 2AC1A 1QOOA 4A44A 5FUIA 1LOCA 5LBBA 4Q4V3 5FPZA 5IK4A 2HWE1 2Q1ZB 1Q3EA 3ZFGB 3JBG3 4KNCA 1VP6A 3KLSA 4E4SA 1ZVFA 3BOPA 2YBKA 1PO21 4K20A 3RDIA 4KBZA 5FZ6A 1YWKA 4CEWA 4OUSA 3BKZA 4DUWA 2JX9A 1BXHA 3LOIA 1UZYA 3A0KA 3VLBB 1O4ZA 1RGSA 3P3NA 3VDDB 2VW1A 4QX8A 4PDWB 1CAVB 1OSGA 4URTA 5DDJ3 5DUXA 1WLCA 2QQKA 2JE8A 2QJVA 2H0VA 4UW4A 2NMOA 3T3YA 3OF1A 5F6LB 3LEKA 1NOVA 4Q4W2 1DGRA 4W65A 1UY2A 2K2SA 2P1BA 5A3OA 1OI6A 3HEIA 1OKOA 4NWVA 4Y4YA 4HMZA 2IXLA 1UN1A 4DEQA 3OGSA 3SH5A 1N1SA 4GA9A 1DHKB 4YW4A 1NA1C 3FUQA 2DVFA 3BTAA 3T08A 2R062 1UU5A 4S2DA 2DCYA 1R092 3AKRA 3JB4C 1Q56A 2J1RA 3ES4A 3SC7X 1X50A 5FPAA 3R6SA 4Q26A 3VBSA 4F7ZA 2IC1A 4H2AA 4J1WA 4UFKA 3VBOC 4IEVA 4YZ5A 1FOD2 1I9RA 2WZPP 5IVYA 2VMDA 2WNVB 2E51A 2JEMA 3JZVA 4CVUA 3W5NA 4BQYA 2W1WA 4QGNA 2RDSA 1IPSA 5TSWA 4CP2A 2XBO1 1R64A 1XU2A 3MGUA 3VZNA 2GNBA 3LFMA 1X8EA 1LHWA 2R043 4HN0A 1W90A 4PLNA 2RDRA 3IN9A 1NX9A 1V70A 5AVAA 5FYUA 3CLPA 2ZGKA 5I91A 5EPAA 1RUD1 3DF0A 4N43A 4RQPC 3WDUA 2CSGA 2EICA 3ZFGA 1IS5A 5C4WB 5BY5A 2XJRA 4IEOA 5A7SA 3H8RA 2D98A 2G9GA 3C3VA 3FX3A 3W5MA 3DKQA 4OCTA 3OTFA 2YGMA 3FBYA 3H3ZA 5FZFA 2GAUA 1QJY3 3UV9A 2QDRA 3AZXA 2UY9A 1BK1A 2VZTA 5FZOA 4JTNA 4LUKA 4TSVA 2ADDA 2ORXA 2OQ7A 4I3GA 4WV8A 2YMZA 3ECQA 4PIXA 3VDDA 5FPUA 4MGQA 2YU1A 3WP5A 3GHNA 4Z2WA 4PDWA 4MGIE 5DPNA 2B9VA 1CGPA 5D21A 1STMA 5A6ZA 3ZYHA 2ILMA 2BWCA 2GH2A 3AXDA 3CDZB 1OUSA 4YM1A 3TRSB 1LCLA 1ZYBA 2DVBA 2JDMA 5A70A 5K0UB 3O1RA 2R1DA 2XONA 3EQEA 5FWEA 1SCSA 5ISLA 2RMU3 1RXGA 3CZUA 4H55A 3ZYIB 2Q5TA 4QWNA 5L7OA 3DECA 1NZIA 1LHVA 4BYYA 2XXZA 4IEPA 5A33A 3U11A 1NXD1 4C0HA 4CCMA 3HWJA 2JIGA 5EYYA 4JGYA 2ZGLA 3NQHA 1AR62 5BUVA 5FZLA 4P9GA 5LK7B 4EWEA 2C5DA 1YCIA 2I2SA 4ZKTB 2WAAA 3DXUA 4YG0A 2D6OX 3O1OA 5LK5A 1YQ2A 1XE0A 3NAPB 2C6SA 2VQTA 4OVEA 4BWOA 5IK7A 1ACCA 2WWJA 2ARCA 4RGAA 2JG8A 2JDPA 1Y4WA 2E9QA 2BOJA 1JOPA 1RHI1 2I07B 4J25A 4QX3A 4ZPIA 1HRV3 4Q8KA 3AKPA 1WMFA 1PVC2 4C1XA 2VR4A 4MHUA 3K4ZA 3V0BA 3AKQA 3OBTA 1O3QA 4RL7A 1FV2A 4D6QA 4CU6A 1UOGA 3AL5A 5DAQA 4CA9A 1GNZA 2HJIA 1OXCA 2XLGA 3O14A 5IAVA 5C7GA 2WO7A 1JMUB 4LE3A 1R1ZA 5DUVA 4FFFA 4PI2A 5FMCA 1D4VB 5FZAA 4FQ4A 4L97A 5C70A 3ZXEA 3HPNA 1GZWA 2AEYA 1E5HA 4RA0A 5JSPA 3I49A 4OULA 1PM7A 4PBOA 5IVFA 5A7PA 3FWEA 1E57A 1WCUA 1NXMA 4BMEA 1OURA 4KI5M 1IOAA 4FOYA 1GNHA 1SBFA 3S30A 3FHIB 4FPKA 4OI0A 4PF1A 1D2SA 2VXRA 3PMSA 2Y60A 4RN5A 2FBEA 5I93A 4Z92B 2ZKNA 5FZ0A 4QQPA 3T2PA 3N9QA 3ZFEA 1DZRA 1MZ6A 3NNMA 1FAYA 4Q4V1 4UYBA 3UYJA 5AC92 4IEQA 1YEWA 3RFRA 4XE9A 3JBG1 4YW5A 1O4TA 3AP7A 4QU2A 3VBRC 1OD3A 3LSEA 1LEDA 1QJFA 5FJHA 3DV8A 3WZ1A 4CCDA 1XNKA 2R16A 1ZX5A 4PQ9A 2GN7A 1FXZA 3NNLA 5DN2A 4AQ6A 1DZQA 1T2XA 1ULDA 5BXXA 4A6OA 2R30A 3EB7A 5F3IA 4K21A 3WQ0A 2XWBB 2D6LX 3M2MA 3ZR6A 2IUWA 3JXSA 1UXXX 2MEV2 4YVSB 4FTBA 2V5DA 2GDFA 4DIQA 2VVFA 4B4RA 4HXCA 2JECA 3VKMA 1EP0A 3NJZA 4CCCA 4GKXA 4DMIA 5FP7A 1W39A 5DDJ1 3LEMA 3J7MA 3MF9A 3AYCA 3RZKA 1BKZA 4Y1ZA 2XVGA 4ZHNA 2IWGB 4YVWB 1BMV1 2VW0A 1VBE3 4OI2A 5KC6A 1DFQA 1GLHA 3WY6A 3AMQA 3DXTA 2Y6FA 1MEC2 2PMWB 1VBC2 3LA3A 4QKNA 3T2TA 2XDVA 1PNGA 2XLFA 2ZA9A 4U36A 3AM2A 3POYA 4DNYA 3SLIA 4JDOA 3AZYA 2Y6LA 4MX3A 2D3RA 5FLJA 3S7EA 4N9IA 3PU8A 4JCKA 3TBDA 3QOPA 1MQTC 1CZSA 5FYYA 3RYRA 2XHKA 3HT1A 1EPWA 3S6PA 3K51A 1BQPA 1Q8PA 1BHGA 2CDOA 2HLEA 2Z4FA 2BP6A 4HOOA 2QNKA 4CEWC 5I0RA 3ZMOA 4D7SA 1SLAA 4PT6A 1WLTA 1S2BA 1GWMA 4M3CE 4GWJA 1G86A 3I2DA 5DXDA 3WLUA 2J1VA 4BQ1A 1GMMA 2XVLA 4QHZA 1XSRA 3FHAA 2JDNA 1KFXL 1H6YA 2PA7A 5EXOA 5FKCA 3H3UA 2R041 1ZZ7A 5FP4A 5JI9A 3IIAA 1MS9A 3MIDA 4UXAA 1K42A 3I59A 3P3PA 1W8UA 2H6CA 5ERLA 5FJKA 3T4HB 2B42B 4BXSV 5FZ3A 4AI0A 4JQRA 3NO8A 4ZXEA 4R9BA 4XMAA 1L7RA 3BU7A 1LOBA 1AVBA 3LPGA 5LCWL 4K3UA 5T52A 3HR9A 2V5YA 4JRAA 4NPLA 1B35B 1OLQA 2VNOA 4JZRA 4Q4X2 1R1A3 1ND3B 3VHRA 1AYN2 3UL2A 4P08A 4BLIA 4Q2FA 2YV8A 3I54A 4LK6A 1QJY1 4LA2A 3FC0A 3OPWA 2A73B 3MUZ1 4FPCA 5H9SA 2XR4A 2KA3A 4AEKA 5FXZA 3N9MA 4YVSA 4TLGA 4QX1A 3RZHA 5LRRA 2DWRA 1CD3G 4AFDA 5APAA 3OGGA 3B93A 4QMAA 4ISQA 4RSUA 3T09A 1YFWA 2ARAA 1PO22 1PNFA 2D44A 2SLIA 4K6BA 4EN9B 3PLQA 4V1PA 1PGL2 1OVPA 1RL3A 2W1SA 4YVWA 4XUPA 4OQ8A 4DRVA 4XUNA 5J09A 1V6KA 3LZZA 3WDXA 1X8MA 1ZZCA 4LUMA 4Q4Y3 4Y1XA 5DUUA 1FNYA 4FAGA 2V4AA 2RMU1 4IV3B 1CVNA 2Y34A 4CDQB 5A3LA 4P00B 5BNNB 1DQ5A 1PO13 2BUKA 2NZ9A 3ZFGC 2IFRA 4E4ZA 1H2KA 2FMDA 3PIGA 1CZTA 2Z42A 3B00A 2ARXA 2JG9B 3I2GA 3GZAA 5GJ6A 1W9WA 1CESA 1QGLA 2OT7A 3I2JA 3JD73 1IHMA 1W6OB 1AX1A 4CU7A 2IXHA 5EV7A 5T5OA 4TYSA 3R4UA 4META 5KC5A 5JUVA 1TEIA 2WIIB 1W06A 4PHZA 3E1F1 2V73A 3J26N 3B5LB 5EWSA 1HW5A 1TNFA 2WDBA 2X53S 4GKYA 3ROUA 3VDDC 3VKLA 3ZSMA 3M3IA 1HRV1 1SHWB 3C7GA 3D3AA 1V6MA 2QQOA 4PDWC 2RS32 3W59A 1SDDB 2A6WA 4YZ1A 2E7QA 3GYDA 2E7TA 4TLFA 2G4IA 1LOAA 3F95A 5EP9A 5GLVA 4AI8A 3L2YA 2JKXA 4XMIA 1DDLA 1B35A 4IGQA 1MR5A 4XFHA 1AX2A 2J7MA 2BTVC 2P4EA 4W6XA 1W3XA 4PI0A 1D4M2 4W6YA 2QQUA 3VGIA 2W9XA 4BQ2A 1DU3D 4HLTA 4D69A 4JQTA 4LOSA 3O1TA 3FZ3A 2IVJA 2GSYA 1JOJA 3A0NA 1OT5A 4IEXA 1MS8A 1QXRA 2OS2A 1LRHA 4OMDA 2VZ3A 1G9CA 2VTXJ 3UJQA 5FLIA 2WNVC 1UQXA 1VR3A 1QJU3 1COV3 1YNAA 4AVSA 3O0XA 3K3NA 1LGNA 1VMHA 3SKVA 3RZGA 1UWWA 4OQ9A 4C0BA 4HN1A 5A7QA 1G6NA 2O8QA 4Y26A 3HQRA 4HVRA 3CJXA 4N53B 5J96B 3WHTA 5BNNA 1LKNA 3HD8B 4WZFA 4XBQA 2J1EA 5EZWA 4QPYA 5JVVA 3SITA 4CEYB 4AFMA 1XSQA 5C4WC 1QQP2 2B5HA 1J84A 2QKDA 3OB8A 3UGFA 3WCRA 3I2OA 4J1XA 1QEXA 3OYWA 5FOJB 1GOFA 2RJ2A 4QQOA 2VZQA 1W6OA 4QPWA 3LKJA 1W2UA 4CUAA 5FY9A 3ES1A 3NNFA 2DURA 3AYEA 4HKOA 4CDXB
chains in the Genus database with same CATH topology
1ZBE3 1J3PA 1TQ5A 2HEVF 4JDMA 3JQWA 1WCSA 1SDWA 2UURA 1TMF2 2RS12 5GLTA 4XJ9A 1N47A 1H8VA 2XG3A 1L3JA 4HVQA 4XHXA 1RUF3 1VBE1 2E7AA 5CIRA 4YM3A 5C9AB 4NOTA 1SACA 4ZXKA 3N7JA 2LALA 3FMGA 5K0UC 3ZFEC 1D0GA 4JTOA 2ZGQA 2PFWA 3OPZA 1Q43A 2HWD2 1H1IA 3AP4A 2WFF3 4PF5A 3V0AA 2EXIA 3WCSA 5HCFA 1YXWA 2HWB3 1JYCA 2UWBA 4AVAA 4WM8B 1DBNA 1RVF2 4XIKA 4MXVA 2PLV2 3SH3A 4XFBA 3ZO0B 1DQ6A 1OQ1A 3M3OA 2GZWA 2ZX3A 2VULA 3ZN6B 4D3WA 4KBBA 2HYKA 4CDWB 1LHOA 1HXS3 2VOWA 4P9YA 4RHV2 4C90A 4RR3A 1JXNA 3WUDA 3EJKA 1QXPA 5GKAC 1BEV3 1NCQA 3NL1A 4LTAA 1O91A 4GXLA 1ZRFA 1SBEA 3K48A 3GBWA 1D2QA 3GBFA 3O5SA 4CEYA 1R1A1 3PVBB 1MS0A 1PGSA 5T5JA 1ZBA3 4HKWA 3MLKA 2ZJCA 1RUJ2 3NV2A 4XF3A 2X5IA 4PBPA 2IXCA 4Q4V2 2JXAA 3VBFB 2GC0A 4CDXA 1YUDA 1N3QA 4F83A 5KBFA 1IKPA 2ZAAA 1WW6A 3JBG2 4I0BA 1I5ZA 2OA2A 3MIFA 5CVRA 5EYXA 2RS53 3OY8A 5F6KA 4FOQA 5FFOC 4D94A 3OGJA 2EIGA 2P37A 1UD1A 5GZEA 1LGCA 4NVPA 5BPXA 2A5ZA 3WUCA 4AQ2A 5C9AA 2AUYA 1DGWX 2BQPA 2ES3A 4Q4Y1 2Q30A 2WC2A 1SLTA 1PO11 3M70A 2E6VA 2D7FA 5A32B 5DDJ2 3LA7A 4YW1A 3JD71 5IK8A 1X33A 2UWCA 5E88A 1BMV2 3J4UH 3WT3A 4HSLA 3ZYRA 2ET7A 2VVDA 4O9GA 2IZWA 1NYWA 1OQEA 3M8LA 4MGKE 4WM8A 2PQQA 3BCWA 4NHLA 3MICA 4IV1B 4YVSC 4YFWA 2XL7A 3ZN6A 1J3QA 5C8CA 4B4PA 1XU1A 3RS6A 4S2FA 5CAZA 3KGLA 4YVWC 1WMEA 4AI3A 1VRH3 3JU9A 3RPQA 2OPKA 1OLRA 4XQDA 2AGSA 4OHZA 1S1AA 1MVEA 1OPMA 3IKWA 5KWRA 3MW4A 3PVOA 3RJ2X 2LM3A 5JMCA 4E27A 5JIAA 1C8M2 4HK8A 1O5UA 3VBFA 1Z7S3 1WA4A 3MIHA 2AYHA 4XOGA 1PGW1 3ATGA 4OUMA 4AGRA 1QJU1 1COV1 4M01A 1EPZA 4Q0SA 2PHUA 3VL9A 1HQWA 4D7YA 1QJY2 4G9SB 5JOZA 5LEKA 4OHXA 1GZCA 2KXLA 2ZMKA 3MYXA 3OCPA 4S2GA 4LO6B 1RUG2 3H50A 4L2NA 4XF0A 4KWKA 2P17A 1QDCA 4YNIA 2CV6A 2A3YA 3VBUA 1B35C 4CEWB 4K8FA 3HAGA 5D1IA 2FZ2A 4YM0A 1JHNA 1V00A 1ZBE1 1WW5A 4IV1A 4AEJA 5J37A 3B9CA 2ZTNA 4XEZA 4YGCA 1BCXA 4D7TA 2AR6A 1V6LA 2E53A 4XQWA 1ZM1A 1C5IA 5BNOB 4OFGA 1RUF1 1KQRA 1H8TA 1NZCA 2R1BA 4XTMA 2A6YA 4NPRA 5E8AA 4LULA 4QQHA 1URXA 4HZFA 1VBB2 4DXZA 4TZDA 3EXUA 4LHNA 3KM5A 3WINE 3VZJA 2WFF1 4AHXA 4IV3C 4AFAA 4LHKA 4CDQC 5BNNC 1F5FA 1HRV2 2JG9C 1FNZA 2HWB1 2QE3A 3VBSB 2BWAA 4Y1YA 1PZ9A 1J3RA 1JH5A 1RUE3 1Z78A 5FO8B 2QUOA 4X6QB 4RS5A 3WNXA 3THPA 1MS3A 2CNAA 1N1YA 1OFSA 1EY2A 4F3JA 2WT1A 1OKQA 3O12A 1HXS1 4WVWA 5FREA 3OD0A 2ZHMA 4Y20B 5DZFA 3WG2A 5C8WA 3HN1A 4X8PA 1BEV1 4N43B 3S7IA 2PHDA 4CYDA 1POV0 3VZKA 1CX4A 2QVSB 4QHBA 4AHWA 1ZBA1 3VHPA 2PHWA 3WDYA 3RRDA 1QOTA 1O3SA 3APBA 4AVTA 4WVZA 1XYNA 3V56A 4XFGA 2GMPA 2WWSA 2RS51 5FRAA 3PMEA 2YY1A 4YZ4A 2ZCWA 1SLCA 4FVVA 3B02A 2R072 5BNOA 4XDQA 3SCHA 2A70A 2RM22 1ENQA 4AGGA 3HIFA 4RR3C 3TYJA 3ZYGA 2PHFA 1G9DA 2Q1MA 5FBZA 1YJKA 1S2KA 4ISRA 2EXJA 3M3CA 5L7OB 4N53C 2Z2SB 2HWF3 2XUMA 5A33B 3CNAA 3GHMA 1YIFA 2P3IA 4CEYC 5FMOL 4JGYB 1V9U2 1W6MB 3E97A 4KU7A 5SV8A 1RIRA 2ZS6B 1S0IA 4DS0A 3LOBA 4EWDA 2X5IC 2KM2A 4CDXC 1PK6A 1JN2P 2BNOA 4U2AA 2O0OA 4INDA 2JG8B 2GU9A 2PAKA 3WW2A 1ZRDA 2Z79A 1TNRA 3AMMA 1XYOA 4JGZA 4Y20A 4QD2A 3UK9A 2BPA2 4N90A 1AYM3 1UU6A 3V0BB 3V65A 1NCRB 2ATFA 2VOKA 4ONUA 1LOFA 1VRH1 3KCXA 3NV3A 1K5MA 2OVUA 1U5ZA 5C9AC 1CONA 2XB6C 4HANA 1C28A 1U12A 1F31A 4ZU5A 3USSA 2ZOEB 4LBQD 1I6XA 2WKKA 1YO8A 1ZZ9A 3ZN5A 3C2UA 1EAH3 1Z7S1 4KG0A 2XGXA 1A8DA 1GZWB 4MGZE 1RUI2 5LRSA 4WM8C 1RMU2 1S0GA 3AP9A 1QXJA 1U5IA 3QLQA 3ZX7A 4HVOA 1KJRA 2D40A 5C8CC 1FATA 5GZFA 3FJSA 3ZXJA 4AW7A 4CDWC 3ZFEB 3VKOA 1BBT2 5FAXA 4BOWA 2EF6A 2DUOA 2JE7A 3ALQA 1AL22 4LBJA 4QPIB 3N7KA 2QZ3A 2OW4A 2HKXA 3E6BA 2CWMA 3PTYA 3L2HA 3RG0A 1UX6A 3ENRA 4Q1PA 4QT6A 1EV13 3UKVA 4DY5A 1VBA2 1W6MA 3D6EA 5J48A 1ND2B 1DZTA 4CP0A 4Q4Y2 2GALA 4Y1UA 1C57A 2TNFA 3VBFC 1A78A 4CP1A 4YFZA 2BYVE 4GB33 1FI2A 2BFUL 4IXLA 2DCKA 4K1YA 3E6DA 1N3PA 5K9YA 3JD72 2Q4SA 1WUVA 3TAYA 2GC3A 4AEDA 4AHZA 2LUWA 1NCRA 5F9TA 3VUOA 1Q8VA 3QBQA 4I01A 2K9ZA 1RUH3 4X6RB 1MACA 5JSOA 4I3PA 3ETQA 5KXBA 3R05A 5JWPA 2XJUA 1DQ0A 3WP4A 2ARBA 2UYBA 1LR5A 4HT1T 4Y24A 1RUE1 1ZZ6A 3SH4A 5ACA2 2X29A 4FPJA 4WM7B 1VIWB 3DN7A 2B7YA 1QH7A 4OZXA 3DPRA 3U10A 3VBHA 3ZXFA 3D82A 5FLHA 2GN3A 3M7AA 4IV1C 3QH6A 2CAVA 2VUAA 3AMNA 1NQDA 3EHKA 2PYTA 1QJZA 2ZABA 4WVVA 4COUA 3I59B 5D8AA 3M4FA 1C4RA 4AEMA 1H8TC 4QPIA 2RR12 1OFNA 1QJU2 4XETA 2QCSB 4LA3A 4E4DX 1DGWA 1VB4A 2H0BA 1BYHA 5KHGA 4UW5A 2CYFA 1ND2A 1W0OA 2WSUA 4P9XA 2LTNA 2ZHLA 1ENRA 2XJPA 2RE9A 3MFAA 2GNTA 4QGMA 4WZCA 1AR92 1VBD2 4I0WB 1DG6A 2C1FA 3CEWA 2IXIA 3THTA 2GMMA 4ES8A 2CL2A 4COYA 5AFBA 1WD3A 1N1VA 4FPHA 1YI7A 2WZR2 1S0EA 4FXGB 5EJ3A 1ZBE2 3B3QE 4UBGA 3ZXKA 3CF6E 5HXVA 1XNCA 4Q4W3 2JDZA 2W08A 2HWF1 1POV3 4LE4A 4HK9A 3MW3A 2YC0A 4XJZA 3WVJA 3WW4A 1YYNA 4FPYA 4LO7A 3NSTA 5GZDA 1RUF2 3KGZA 2BNNA 1IS4A 1A3KA 1AF9A 5FOBB 3FLPA 1RINA 2W39A 3ZIXA 2R063 4WM7A 1HKDA 1GSLA 3B94A 1FPN2 2VQ0A 4J6GA 1YJLA 4LO4B 1FOD3 3LGRA 1AYM1 1NE4A 5BNOC 1SEFA 2HWB2 4Q8LA 4XW3A 1DYPA 3J8F2 5T55A 4EN6B 2B45X 4YG3A 4KU8A 1TE1B 4FXKB 2HWC2 2W68A 3G7DA 4YW2A 4XBLA 3EBRA 4HFSA 2EALA 3MIEA 2NM1A 1RJ8A 4KH9A 1WBLA 1EAH1 1VJ2A 3GBGA 1KJLA 2GNMA 1BEV2 2HWE2 3H0OA 1UL9A 3VBSC 2ZGSA 4LNVA 3RJRA 3WHUA 2UYAA 1U5YA 3A4UA 1H2LA 4MYEA 1W6PB 3ST7A 1CJPA 1M4WA 4AI1A 1REFA 4C1WA 1IZ3A 4C91A 1A8MA 1J59A 2VNRA 2ET1A 3LWCA 3TN93 1H2MA 1CAXA 4XTPA 5CU1A 3MLLA 3URFA 1AR83 3ZXGA 4N43C 4AFBA 4B3NA 1S0CA 1K5MC 1MS1A 4GMP0 4XZPA 1LODA 3H7JA 4XYXA 1EV11 3ME2A 3H9AA 2WA4A 3WR0A 3OYWB 3ZSJA 1FT9A 4XJ8A 4SLIA 4I09A 4EN8B 1AR63 3TWIA 1REEA 1LHNA 2P3KA 4GB31 1CPMA 4I02A 4Q0UA 3NWKA 2DUQA 3QCWA 2V09A 4YZ3A 4DQAA 1QMJA 2HEWF 1R083 4Y5Z0 1OA4A 2D43A 2R0HA 4BMBA 3B9IA 1PVC3 3N36A 2CGPA 1RUH1 2PHLA 3CJIB 2NPIA 2XBO2 3KCCA 5L7OC 3V0AB 1VB2A 5T50A 1C1LA 4HETA 1LOEA 2EAKA 4JGYC 1RUD2 3ZMNA 4JRLA 4L8QA 4AXOA 3WDWA 1LGBA 2Z5WA 1F2NA 2D3SA 3LAGA 2NP0A 3AKTA 4F8AA 4PCRA 2VNGA 1OHFA 1W6PA 1ZRRA 2JG8C 2CWSA 3AYDA 3LA2A 2HEYF 2ZMLA 3BIWE 4NHMA 4RR3B 4YRDA 3WW3A 2WJSA 1APNA 3IWZA 1NCRC 1NCQB 4AWDA 4KWLA 5K8SA 1FV3A 3KT7A 3MZHA 3N7MA 1A6CA 2D6NA 4Z8BA 4IETA 1RUNA 3IT8A 2Y0IA 2OUHA 2WSVA 1ULFA 2X5IB 4AFCA 5BNPA 1HRI3 4HSJA 4P9IA 2XKOA 4W6WA 3OBRA 2BBVA 4HPKA 4MLOA 3MI8A 4KL1A 4UW3A 3OY8B 4P14A 3WX5A 2MEV3 1SMVA 3E5QA 4M3CB 3VZLA 1J1TA 4EROA 1DQ2A 2D6MA 4QM9A 4GWNA 4COZA 1UKGA 3FFQA 3D8CA 1YFXA 4NHKA 4XBNA 2EAAA 4E2QA 1NY71 5IT6A 4LLFA 1HX6A 5D8AC 3POWA 4Q4W1 3U4XA 2DF7A 3CJIA 1POV1 2VUJA 1CJDA 1MEC3 1UPSA 4QPIC 1VBC3 1QHDA 1RHI2 4RGGA 1OA2A 4R8HA 3MIGA 2XH6A 4FPOB 2R061 1OD5A 1ND2C 3R0RA 1ZA4A 1LOGA 1UW8A 3ZYJB 1KS4A 2BGCA 3WDVA 1OQDA 1FOD1 3UKNA 5C8CB 4Z07A 3B69A 4FOVA 1G9FA 1C8NA 3MEPA 3SXWA 2A6ZA 1RUE2 2JJ6A 4RD7A 2YHJA 2YUEA 5ABJB 1GQGA 4ASLA 4LHLA 1QU0A 3AJYA 4XPVA 1MZ5A 1H9WA 1KXGA 4XFFA 2PAMA 2XLAA 1AR73 1AXKA 3AB0A 1G7YA 1UZZA 3MPBA 1Q5OA 2IXKA 3AFGA 5T5LA 2VQAA 4Q4X3 1AYN3 4OHWA 3ELNA 4QX5A 1W6QA 4RFT0 4CZSA 3KMHA 4A7YA 4ZU7A 3CU7A 4WM7C 1X7NA 1BZWA 2Y0OA 2VW2A 4M3CA 3RWNA 2VOVA 4P9JA 2CGOA 2D93A 1H4GA 4YG6A 1QY4A 4GULA 3TN91 3JCIA 3RI8A 5H9RA 1Y7BA 3J9SA 1AR81 3VBOA 2OIIA 4XJAA 3MIBA 2A75A 4ATEA 1GANA 2TUNA 4BIOA 2ETEA 3VBUB 1MVQA 2GC1A 4XFAA 1QKQA 5J3UA 3N3HA 4KGQA 3AP5A 3U07A 4FCAA 4YZ2A 2P34A 4BM8A 1AR61 5HCBA 4HL0A 3WP6A 2ZZQA 1PIV3 1Q8QA 1ZZBA 4Q0VA 5GLWA 1J58A 5SV5A 4K7JA 3M3EA 2WT0A 5L36A 1JUHA 4R4XA 3FBMA 4H7MA 1H8TB 1WW7A 1R081 4AI2A 2QZ2A 5ABJA 2FQPA 1PVC1 4LT5A 5JZGA 2RS33 2XKPA 4LR4A 3DL3A 1O3RA 4YARA 2DFCA 3NV4A 3D4KA 4GMP3 4MUVA 2R042 3W9AA 4Z1VA 3VN4A 1D0HA 1AYM2 4CRQA 1UU4A 1D4M3 5HBAA 4BZ4A 3KT1A 1YI9A 4CTEA 1CQ9A 4FOWA 4M0NA 1KS5A 5KXEA 2AENA 2WFPA 4RS5B 5FPXA 3AXEA 2GNDA 1YHFA 4BLJA 1Q8SA 1T6GC 1HQLA 1GR3A 4KGGA 2DU1A 2QQPA 1XYPA 4LBKA 4H14A 3VHNA 1WD4A 1YLLA 2FZ1A 2PAEA 1IS6A 4QPGB 1GKBA 3RMXA 2ZX1A 1W6NB 2FMYA 5FTTC 3PNAA 3V64A 4E2SA 1LESA 5A3MA 1ULGA 4M00A 1QQP3 3VV1A 1HRI1 1G9BA 2RMU2 2D3PA 5FMOS 4EN0A 4QQ2A 1CAWA 4IQPA 3M3QA 2MEV1 2VECA 4NWWA 5CA6A 2UY8A 3GZTB 1EV12 3E5UA 3JQXA 5IUQA 4LO8A 1W0PA 1QNYA 3BALA 3FE5A 1TMF3 2RS13 4G3YC 4I30A 1FMD3 5CNAA 4GALA 3KT4A 5BNQA 4GB32 4LBLA 2WNUA 1MEC1 2TEPA 1REDA 1WW4A 1ZNPA 1VBC1 2UWAA 2F4PA 5CG8A 1O4YA 3ZSEA 4YYOA 2HWD3 4FBFA 1SLLA 1H9PA 3USUA 3LSDA 1RUH2 2TBVA 3VBRA 1PK6B 4GIQA 5BNPC 1MZEA 2K0GA 4FP3A 5DUWA 1RVF3 5IK5A 3H8UA 4LLOA 2PLV3 2D5HA 4JGZB 2VU9A 4AG4A 2EA7A 2EXKA 4RHV3 1QJX3 1K5MB 2YXSA 5F5QA 3WQ1A 2ZGTA 3BPZA 2ZZJA 4DPNA 4XQ4A 4QPGA 3AX4A 1W6NA 1AR71 3CJIC 2DCJA 4HBNA 3ZN4A 3FLRA 3AP6A 5AVPA 1JW6A 4JDNA 2RHPA 4Q4X1 1AYN1 1QWRA 1DF0A 4B7EA 1GFF2 3ILRA 4PLOA 1RUJ3 3U0ZA 1BVP1 2ZX4A 4Q27A 3ACLA 1KITA 3RSJA 1UPIA 2B46X 4JV4A 4YW3A 3JB8A 2PHXA 2ZX0A 4NR1A 2PHRA 1PVXA 1MQTA 3QACA 4R4ZA 4FPFA 4AF9A 4UW6A 2WQZC 2BFUS 3HT2A 1PGL1 3IDBB 4R9DA 2NMNA 3TNQA 4Q0PA 2ZHKA 3IDEA 1RC6A 1NCQC 1ASJ3 2ZGNA 4B4QA 2RJLA 1LULA 3RYPA 3VKFC 3AMHA 3GNEA 5H9PA 3IM0A 1VBE2 1MZFA 1MS4A 4XIOA 2VY0A 5GM0A 1SBDA 1NY72 4LBMA 3N4MA 2P2KA 1PIV1 1Y3TA 4A7ZA 4XFIA 4FPLA 1AHSA 4COWA 4H3WA 1UIJA 4EJRA 3D0JA 4L9BA 3PVNA 4K1ZA 1WBFA 4AEDB 1OA3A 1H30A 1SQ4A 2DCZA 3DGTA 3TNPB 5K7PA 1OPOA 1ULCA 4DFSA 4Y22B 5J36A 1DQ4A 2RS31 1S55A 4B8EA 5JR7B 3INAA 1CIWA 4PIYA 3H1MA 1FX5A 1H1AA 2A3WA 4BCUA 4GMP1 2ZGPA 2VVEA 1D4M1 4MGYE 1C8M3 2CTVA 1PMIA 1EYBA 1HDKA 5KHHA 2WQ4A 1SFNA 3DPRB 3VBHB 1R1A2 2BEOA 3BOWA 3WQ7A 2C9AA 3VZOA 1GQHA 4S2HA 4FT8A 2DVAA 5D8AB 1VLNA 4AGVA 1SLBA 5KXDA 5DG1A 5JPNB 5T3NA 5ABJC 5T5PA 5JZGC 3VKNA 3RMYA 3MDPA 4XF9A 1RUG3 1WMDA 4ITCA 3MFCA 3TN92 3LB9A 1QQP1 2AZ5A 3R4DB 1CAVA 1MS5A 1VAKA 3SCFA 1LEMA 4TWTA 1AR82 2ZGRA 4YGDA 4FPGA 4N7UA 3AFKA 2WT2A 1PO12 4I0AA 1F5JA 4AVCA 1S0JA 3VZMA 3NV1A 4NO4A 2YPJA 5FO7B 4OHVA 1XQNA 5GALA 2JICA 1TMF1 2RS11 4XJUA 4K9SA 1FMD1 4Y22A 2WS93 4DOUA 3SISA 3ZFFB 4M0HA 3ZXLA 4OHYA 3AMPA 2G9FA 2XJQA 3OJBA 2UU8A 2WNVA 4XJWA 1VBB3 1WCDJ 1O5LA 3N7LA 2I45A 1JTZX 2HWD1 4A3XA 3VBUC 1VAVA 1H0BA 1AXYA 4DZGA 1DGLA 1R082 2BVBA 2DV9A 1QF3A 4JC1A 1RUC3 2JD4A 4Q1RA 2O8OA 1C5HA 1RVF1 4AVVA 5BYNA 2PLV1 5C4WA 3O0WA 2XVKA 3KZ4C 1JUIA 3NKTA 5KHIA 5CFDB 4AE2A 1Z0HA 4FTSA 4RHV1 1QJX1 2YYOA 1O3TA 2WINB 1TME3 2ERFA 5KHKA 1PGW2 5F1RA 2O1QA 1G9AA 1COV2 1Y9QA 1DGRN 2MPFA 2NQYA 5DG2A 2WNUC 2ZACA 3ILNA 1RUOA 4CDUB 1HLCA 1ENSA 4MZUA 4QGLA 1NE6A 4IEZA 1JYIA 1RUJ1 5K0UA 1UKRA 1LTEA 1S0BA 1O7FA 4RS5C 4GQ7A 1AX0A 1F8VA 1QNWA 1ALYA 4YGBA 5CADA 2VOXA 1LECA 4JVAA 5CB7A 2R073 3UKTA 1CAXB 1HRI2 3SHRA 2RM23 3ZFFA 3NW4A 1XNDA 4YSFA 1ASJ1 2EXHA 1G8WA 2W0XA 4N7IA 2VMGA 1DLLA 1N1TA 3NAPA 1CN1A 4ATFA 5C6CA 1CAUB 1AJOA 2Z69A 5J98B 4QPGC 1VAMA 5JLVA 3KQRA 4EN7B 3CO2A 3EO6A 2BNMA 2NYYA