5EZWA

Thiosulfate bound rat cysteine dioxygenase y157h variant
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
187
structure length
187
Chain Sequence
TELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLHSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cysteine dioxygenase type 1
publication title Thiosulfate bound rat cysteine dioxygenase Y157H variant
rcsb
source organism Rattus norvegicus
total genus 55
structure length 187
sequence length 187
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2015-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5ezwA00
4KU8A 4O9GA 4QMAA 1CAWA 2K0GA 5T3NA 3USSA 1ZRRA 3RYKA 2D5FA 1G6NA 4HSLA 3SCGA 5KHJA 4GULA 4B29A 3NVCA 2ETEA 5K8SA 5I8TA 1RUNA 4IEOA 4KWJA 2PHLA 3HQXA 4MGKE 2IXJA 3H7YA 4EROA 1OI6A 1RC6A 3FJSA 2OZ6A 2OA2A 3FZ3A 3UKVA 2UY9A 3M70A 4IEQA 3SXWA 2H6BA 2PA7A 5JCTA 4PIZA 3RYPA 2H6CA 2D5HA 4LEJA 1SFNA 2DCTA 1VP6A 4YARA 2PAEA 3KGLA 4XFGA 4KU7A 3I59B 3E5QA 4K8FA 3H3ZA 2IXCA 3ES1A 2GC3A 3I7DA 1X8MA 5HI0A 2Q0AA 4XF9A 3LAGA 1NYWA 4IEWA 3N4MA 5LRRA 4IETA 2XLAA 4HN0A 1RGSA 2I45A 2D40A 4X6QB 2ZKLA 1U12A 3CEWA 4FAHA 1ZZ8A 3MZHA 4MGYE 4I3PA 4FAGA 3H1WA 3CL1A 4N9IA 3GYDA 3WW3A 1X8EA 1ZX5A 4Z07A 3D0SA 3R6SA 2BNNA 1UIJA 3LA7A 1J58A 2BGCA 4BHPA 1YLLA 4I0AA 3U0ZA 3H7JA 1DZRA 4I01A 4HVQA 3FX3A 4AQ6A 4OFGA 5FQ0A 1LRHA 2B9UA 4MUVA 4L2NA 2XGXA 2MNGA 3L2HA 4BIFA 1O3RA 2XL9A 5EZWA 1NE6A 2XLGA 2ZCWA 1X7NA 3DV8A 1ZZ6A 4LTAA 4Q0SA 1ZNPA 4XFBA 4EWAA 2K9ZA 1ZZ7A 2FMYA 4AQ2A 5LEJA 2GC0A 4IEUA 2C0ZA 4META 4J1XA 5KHKA 3EJKA 5FDBA 2HKXA 4XFFA 4LUMA 5D1IA 1Q43A 2Q30A 4N9HA 3WW1A 3ZDSA 3KMHA 3KSCA 2IXLA 4PIYA 4I0BA 1O4TA 4E2SA 2GH2A 3S7EA 1QWRA 4PIXA 3OGJA 5BY5A 3TNPB 4ONUA 1UIKA 2VPVA 1I6XA 4YSFA 3E97A 4JV4A 1H1IA 2HJIA 3B02A 5JAXA 3FFQA 2KXLA 5I0RA 4IEYA 1O3SA 1YFYA 4OLLA 1WGPA 4HVRA 4LA3A 4XETA 5LRSA 1ZRCA 1EYBA 1SQ4A 1CAUA 2QCSB 2Z2SB 1UCXA 4D7TA 1O7FA 3C3VA 3E5UA 1LB2A 1OMIA 4MH0E 4Q0VA 3E6CC 2QVSB 4KWKA 4XF0A 1GQHA 2OPKA 1UW8A 1FT9A 1Q3EA 5EFUA 3IDCB 2PAMA 2O8QA 4EWEA 4MV2A 4WVZA 4YNIA 4WZCA 1O3TA 3NL1A 1JUHA 5J48A 3NW4A 1FXZA 1PMIA 2O1QA 5FLIA 3VHRA 4QM8A 2BNMA 3HIFA 5I0SA 1X82A 3DN7A 5BPXA 4R8HA 3CO2A 3H9AA 1YWKA 3OTFA 3E6DA 4QM9A 3E5XA 3NKTA 4X6RB 3G7DA 3H8UA 3OF1A 3BB6A 2E9QA 1O3QA 3TNQA 2CV6A 4PJYA 3H1MA 2QDRA 1CAXA 1ZZBA 3EQEA 2P17A 2Z69A 3HT1A 2QJVA 4QGNA 1RL3A 2XKPA 4AVBA 3PVBB 4A2UA 3E6BA 4UBHA 1CAWB 2XL7A 5FLJA 1CAVA 2IXIA 1FI2A 3LZZA 3FWEA 4XFCA 2MHFA 3M3IA 2VECA 4HVOA 2IXKA 3H3UA 4QGMA 1HW5A 4L11A 3ST7A 4ZU5A 4BYYA 2PTMA 3RPQA 4HMZA 5FCCA 4EV0A 1EP0A 3IBMA 1EPZA 2B5HA 4HLTA 5KHHA 5I0UA 3SCHA 4HN1A 2UYBA 4E2GA 3EO6A 3D0JA 4LA2A 2PYTA 4XF3A 4XFIA 3OD0A 5AVPA 4MX3A 3NJZA 4BH9A 3DKWA 4JTNA 4F8AA 3ETQA 4ORFA 4J1WA 1V70A 3U11A 4R52A 5E16A 5F1RA 1DGWA 1XE7A 1SEFA 5BUVA 4UBGA 2PQQA 2GC2A 3ELNA 2N7GA 4XEZA 2GAUA 1NXMA 4Z82A 3HT2A 3FE5A 1QY4A 5I0TA 3LWCA 1ZRDA 4QX5A 4XFAA 2B8MA 1NZCA 3RNSA 5FQ0B 3OCPA 4YRDA 3CLPA 4Q29A 1WA4A 4DINB 4Q0QA 3KCCA 4KL1A 1YFWA 4I09A 5JSRA 1ZVFA 5FPXA 2PFWA 1LKNA 2FQPA 3EBRA 5C6CA 4I2OA 3CF6E 4LUKA 4MGZE 3SMHA 1DZTA 3ES4A 1J3PA 1L3JA 5FLHA 3I59A 2V09A 1J3QA 3S0MA 1UD1A 3PLQA 4AVAA 1OD5A 1EY2A 3LA2A 3SHRA 4IESA 1I5ZA 4Q0PA 4D7SA 5I8YA 3WW4A 3ACLA 4E2QA 2D93A 2VQAA 4QXKA 1DGRA 2WC2A 2ET1A 3H1YA 2Q1ZB 3GBFA 2F4PA 3O14A 2XLFA 4IEVA 4MZUA 4TLFA 1J1LA 3I54A 5J3UA 4FBFA 1CAUB 1YFUA 4UXAA 1Y3TA 2OZJA 3SCFA 1YFXA 4HSJA 2UYAA 4CYDA 4Q0UA 2CAVA 3D82A 3BCWA 2WFPA 4LULA 4ZU7A 2Q4SA 3IDBB 5JSOA 2IXHA 2OYZA 2QNKA 4IEXA 3UKTA 4AVCA 1OFNA 5KBFA 1XE8A 4QGLA 3RZZA 1ZRFA 1NE4A 3EHKA 1CGPA 3H50A 1Q5OA 5JR7B 3RYRA 2GC1A 4EWDA 3IIAA 2UY8A 4IEZA 4IEPA 2PHDA 5JSPA 3DL3A 5CADA 4H7LA 1ZREA 3ROUA 2EVXA 3BU7A 1IPKA 5CVRA 4JVAA 2XHKA 1ZZ9A 1GQGA 1WLTA 2ET7A 4IERA 2BEOA 5E1RA 2MPFA 4P9GA 4WBBA 1TQ5A 4AXOA 4O9EA 3KGZA 3JZVA 1VJ2A 5J7MA 1IPJA 3NSTA 1CAXB 5LEKA 4JTOA 1CX4A 3PNAA 4HBNA 4I02A 1QXJA 2GZWA 1RUOA 3MYXA 1J3RA 5KHGA 1CAVB 1PM7A 3LOIA 4MGIE 2CGPA 2EAAA 5I93A 5KHIA 1LR5A 3QACA 5BV6A 1Y9QA 1UPIA 1QXRA 4HZFA 2CAUA 2EA7A 4RD7A 5C8WA 1YHFA 2H0VA 4KWLA 5BXXA 3BPZA 1RTVA 2XKOA 2IC1A 4F7ZA 3BALA 2PAKA 2BYVE 5CU1A 3CJXA 1O5LA 3S7IA 4LLOA 4ZU4A 5FPZA 4XF4A 3FHIB 4XF1A 4FT8A 3IWZA 1J59A 2BNOA 3MPBA 5I91A 1O5UA 4NVPA 4XFHA 1ZZCA 1XRUA 3U10A 5I8SA 3WW2A 1H1MA 1VR3A 3UKNA 2Y0OA 2GU9A 3RDIA 3LA3A 3MDPA 2ATFA 1YUDA 4YYOA 3QOPA
chains in the Genus database with same CATH superfamily
4AEKA 3LGRA 4ZXEA 4V1PA 2JECA 4QMAA 1VBE1 1K3IA 2VCBA 3KV5A 4XQ4A 1IS5A 1ZRRA 4N53A 2WWJA 4P9WA 4P5HA 3TWIA 2WN2A 4TXWA 3CJIC 2Y6GA 1G9FA 4HSLA 1PNFA 3BTYA 3ZOIA 2E63A 4C91A 4QAWA 5K8SA 1RUNA 4RN5A 3AJYA 4P9JA 3AXDA 3VBFC 4XZPA 3FHAA 3LPGA 4IEOA 1BYHA 1R1A1 3ENRA 1JZ4A 3V0BA 3DCQA 3H7YA 4XIOA 1D4M3 2CYFA 4GAZA 4ZS2A 2RS12 5K0UA 1NX9A 1AR71 3ETPA 2G4IA 2WQZC 5FMOL 5FZOB 3FZ3A 5A3UA 4A44A 3T1MA 3N9PA 3ZKYA 3BOWA 1PO12 1YEWA 3RYPA 5JXGA 3UGHA 4IGQA 4R9CA 2DBIA 3E1F1 3RZHA 2YGLA 4ITCA 5FYBA 3CU7A 1OA4A 1VP6A 1W2NA 4WM7B 1PMHX 2P6CA 5CKNA 4Q8KA 5J96B 2YZ4A 4A7ZA 4OZOA 4K8FA 3H3ZA 5ACA3 3V64A 3ES1A 2GC3A 3VD4A 1J84A 4J25A 1G9AA 1WMFA 3I2HA 3AMQA 4FPCA 1XNTA 4IEWA 4YVSC 5FZAA 3B9CA 3RGBA 4AI0A 4NHMA 1TE1B 4A3ZA 4HN0A 2BFUS 2RJKA 4Q4W1 1QOOA 4LHKA 4X6QB 4CDWA 2ZKLA 4YZ2A 1J83A 5A70A 3A21A 2VD7A 1DP0A 1ZZ8A 2ZACA 5FPBA 3H3LA 2WNVB 3GHNA 2QFEA 1OBNA 3UGFA 5JOZA 1YYNA 1PGL1 3AP5A 5FZ9A 2QZ3A 4N7UA 1OLRA 3AP9A 1E5IA 3GF6A 3LA7A 4NUBA 4BMEA 1QJEA 2BGCA 2ZABA 4K8RB 4BHPA 3ZDVA 5AC93 5C3OA 1C3HA 3VDBA 1YNAA 3PHMA 2JE9A 3ZXEA 1UXXX 4COZA 4E4SA 4R9DA 1OC1A 3ZYGA 5HV4A 3UK9A 5FQ0A 2B9UA 3RI9A 1CZVA 2LUWA 3WEZA 4XDOA 1VAMA 4BU2A 4DXTA 5LA0A 4YZ4A 3UETA 4L92A 1PVC2 5E6HA 3IPVA 2ZCWA 4LTAA 4MXVA 1ZZ6A 3GBGA 1F5FA 5JOYA 4EWAA 2EXKA 2CDOA 2K9ZA 2ZOEB 1BKZA 1QJY3 1ENXA 1RJ7A 2IUWA 5C33A 1LODA 1HXS3 2ZMNA 2GMEA 4NAOA 4LHLA 1R081 2VZPA 4IEUA 1LHWA 4RQPA 1ODMA 4XZUG 1LOEA 4F83A 1JYXA 1B09A 2GH8A 2VQTA 2WWSA 3VDAA 1LNSA 3EJKA 4XFFA 4DMIA 4DIQA 4N9HA 3VBOB 1U5ZA 4BQ4A 2ARAA 1BK0A 1W0NA 3BYWA 4PIYA 4HXCA 4P5YA 4TWTA 4CE8A 4NIIA 4E2SA 1NLRA 5FWEA 4LO6B 1LEDA 3IKWA 3IMMA 1O4ZA 1US3A 4I30A 1QWRA 4PIXA 5FZ6A 3K4DA 4HKWA 2HWE2 2Y0IA 2VPVA 1LU1A 1I6XA 3HAGA 3N7KA 2BBVA 1WUVA 1V6MA 1H1IA 2HJIA 5J1XA 3OG2A 3T09A 1VBE2 5DUXA 3DPRB 1O59A 5I0RA 3UT0A 2XQRA 5AVAA 1NA1B 5T5PA 3POWA 4LR4A 1WGPA 3WR0A 5IK5A 2VUJA 3CZUA 4HVRA 4LBMA 5HCAA 2W39A 1MEC3 3MLJA 1W0OA 4FCAA 5LRSA 4CCKA 2AH2A 4HOOA 1SQ4A 4EE2A 5D8AB 5F39A 2IFWA 3B5LB 3ATGA 4P02B 4BQ3A 4DPNA 3TEZA 4AFBA 5JUVA 1R1A2 3I97A 3WUCA 1FT9A 2D6LX 3AX4A 3WOGA 2ZX4A 4GALA 2VMGA 1GWKA 2WSUA 3IDEA 5FYSA 5T52A 4MV2A 2Q8DA 1REDA 4EWEA 1AR72 1CIYA 2HBUA 1GICA 5EJ3A 4BPZA 1RUH3 4QX7A 1LULA 1ND3B 5BNNB 2YC2A 5J48A 2A5ZA 4M3CA 1HKDA 4Q1RA 5LA9A 2E32A 5ISLA 3FLRA 2W9XA 4AHXA 5FZ7A 3VHRA 1DHKB 2VVEA 1AJKA 4QM8A 3B94A 1WBFA 1FOD3 2BNMA 1KJLA 2KD7A 3I2IA 4UFJA 3UJQA 1VIWB 5FYHA 3MO4A 1ND2C 5I0SA 3KQ4B 3DN7A 5A3TA 4U2AA 1CESA 2Y38A 2Y33A 3N35A 3SH5A 2P34A 2QKDA 4H2AA 4DUXA 1LHNA 1XNCA 3Q8AA 4Q4W2 3OTFA 1SFYA 4LQRA 4QX8A 1ZYBA 5FREA 1TEIA 5HCBA 3ASIA 2HWD3 3BN6A 3KF5A 3H8UA 2E9QA 5FZLA 3HVDA 2WS91 1MQTC 2JKBA 4QDSA 4X8PA 2E7QA 1PGL2 4O65A 5H9RA 4QDQA 2VE1A 4KMQA 2YBSA 3WDXA 2P17A 2DTWA 2AYHA 2WT2A 3LPFA 3ZSMA 3DF0A 5JR2A 4A2UA 3E6BA 4D7YA 1D2SA 2ZTNA 1KS5A 5JOWA 4CCLA 2IXIA 4Q4X1 2NMOA 4KNCA 5LY2A 2WZ8A 1SLLA 4LE3A 3MF9A 4YVSA 5GZGA 4AR2A 2XWJB 2MHFA 3M3IA 4FFFA 2BOIA 1OSGA 1QDCA 4QGMA 4GXLA 5F3EA 1HW5A 1UY3A 4BYYA 1R082 2PTMA 2WT0A 3AL6A 2ZGOA 2PHXA 4M4RA 1RVF3 2AEYA 2CDPA 1PK6C 2VUAA 3ZXFA 1W2TA 1WCKA 5C70A 3N9NA 3K4ZA 5IVCA 1AYM1 1EP0A 4TLGA 1HX6A 1GZCA 3JD73 1Z0HA 4XYXA 2JICA 3RVHA 2WFF3 2BPA2 1VBB3 2A6XA 4ZY9A 1W6NB 3IIIA 5I0UA 3AM2A 3ILNA 4LBKA 1RYYA 2JD9A 2PYTA 2VXRA 2BGOA 1F2NA 1PHMA 3LFMA 3N36A 1G8WA 1JZ5A 2WINB 1PZ8A 4QT6A 1A34A 1OH4A 4MX3A 3NJZA 3VZNA 3AYCA 3H42B 3DKWA 4YGCA 4F8AA 1WW6A 1JU4A 2YGMA 5FYZA 5L36A 4Y1YA 1XQNA 3WP3A 1W6QB 1GV9A 2VUDA 1TG7A 1S0CA 2VOVA 3KV4A 3K2OA 4G9SB 4XURA 5E16A 2OKXA 2DVGA 3SEPA 1DGWA 5LZ6A 3BOPA 1GP5A 2WZR3 3NNGA 4DOUA 2L9LA 2P6HA 4UBGA 2PQQA 3OEBA 4QXHA 3MBWA 3ELNA 1VRH2 2G19A 2XJVA 1QJU3 2GAUA 4ZXKA 2GSYA 3DYMA 1TZOA 4Z82A 4Z2AA 1JYNA 4IUGA 4P9YA 2W87A 4AHYA 2X53S 4ARYA 2JIGA 3VKLA 2JIJA 4H7MA 5GLUA 5EJZB 2D7FA 2JEMA 2ZGSA 5J98B 1C8M1 2NZ9A 1GMMA 2E7TA 2BUKA 3RMXA 4IV1C 2FDFA 5SV8A 5IVYA 1CQ9A 4C0BA 4CP0A 1UY2A 2DUOA 2ZGPA 2XXZA 3OCPA 1BEV3 4CXWA 3M3OA 3AFGA 2A6VA 4FQZA 3O1VA 2D98A 1LOGA 1VALA 2JE7A 4MYEA 3MUY1 3PTRB 4HPKB 4UW4A 3AXEA 4CU6A 1AXYA 5C6CA 1W9YA 4IE0A 5A80A 1JHNA 1UU4A 4JQRA 4LUKA 4YVWA 5FY8A 5F8PA 4JC1A 1EV13 3SMHA 4XILA 3V65A 5BNOC 1DZTA 1UF2C 1RUJ1 3AKTA 3ES4A 4PBOA 4NPRA 2RMU1 2P4EA 2JDNA 4XTPA 5JPNB 3FBMA 1E57A 2R041 4AI8A 5FPVA 4AVAA 4JZRA 3THTA 4Y22B 5F5CA 3BVCA 1JU3A 4UI9L 5HV0A 5DAXA 5FY0A 2ZX1A 3GHMA 4BDVB 3ZPYA 5KC5A 4FTSA 2VULA 1I5PA 4CSWA 2WS92 2IVIB 1NLQA 2XVLA 4HG6B 2YUEA 3O1SA 3OUHA 3PMSA 2B9VA 4P08A 5A7QA 3LDBA 1GWLA 1QF3A 1TMF1 4P14A 2RG4A 3I3MA 4NPLA 4CDXB 1XSRA 2Q1ZB 2FMDA 1AL0G 3NQHA 1C28A 1K5MB 4K20A 4YZ1A 3K77A 4Y24A 2ZHMA 2F4PA 2ZJCA 2J1TA 2WYSA 2ZAAA 3O14A 3WDWA 1ND2A 4IEVA 1XNDA 2RE9A 3PDQA 3I54A 3I3BA 4Q4X2 5J3UA 1VE0A 2WZEA 2XJRA 1H4GA 2VTXA 2R6QA 3LCPA 1FPN1 2X5IC 4CVUA 1CAUB 4FTBA 5IK7A 3C7HA 2QDNA 3HNMA 4KBBA 1XYNA 2OZJA 3F95A 1VMJA 4LMFA 1YFXA 2VL4A 4OHXA 4FFHA 2QBXA 4HETA 2ORZA 3AYAA 3K75B 3LQCA 1CONA 2UYAA 4HSJA 4Y4YA 1B35B 1MQTA 2QQNA 4A3XA 2YXSA 4EZ4A 1AYM2 1F35A 5FBJA 3D5OA 2Q4SA 3IDBB 4OHVA 4FPYA 5FV3A 3U1XA 5C4WC 3VL8A 2V4AA 5ANNA 4A6SA 2W92A 5A32A 4COVA 5FXXA 4R9AA 3PIJA 5DG1A 1GSLA 2RM23 4AVCA 2AREA 1OFNA 1F8VA 2VNRA 3NKGA 3VBSB 2JWPA 3THPA 1XE8A 4CP9A 5KBFA 2RVAA 1ZRFA 1UZVA 1WD3A 2WNOA 3PIGA 4XAEA 1YO8A 1GP4A 1L7RA 3MIHA 4BQXA 1CGPA 2DV9A 1VRH3 1K12A 1JHJA 3J26N 4DNYA 4EWDA 3O0WA 4YM1A 4YM0A 5A3PA 1GQPA 4CCMA 1HV1A 1W6MB 4CEWC 2O0OA 1JMUB 5CISA 2P3YA 3ORJA 5FJHA 1M06G 3OBRA 4MXWB 2HH9A 2OT7A 2UWAA 3KCXA 3KT7A 4CEYC 2QTWB 1PK6A 1ZBA3 1JYIA 3R4DB 4FFIA 2JDAA 1TQ5A 1UX7A 2R063 4AXOA 4WM8C 2Y34A 2XQXA 4LKDA 1QIQA 4O9EA 3NNJA 1VJ2A 3HN1A 5J7MA 2RDNA 1PO21 4QHZA 3T2PA 2VNVA 5K7PA 1EPWA 2W47A 3MHZA 1CX4A 3PNAA 1OVPA 1XPWA 3NNFA 5FZ1A 1SBDA 3GALA 4GIQA 1C8M2 4ZZ5A 1QXJA 1W8OA 1HV0A 4JHTA 3MGUA 3MYXA 2OQ6A 2A6YA 3WNMA 3JB8A 3S57A 5IATA 4Y5SA 1CAVB 1H8TB 2JG8C 3I2DA 1O8PA 1KFUL 5C9AC 3AZYA 2OUJA 5I93A 4CU9A 4QKFA 4BQ2A 3B93A 1AVBA 1LR5A 1W8TA 3QACA 4CA9A 4QHBA 1GOHA 3AVSA 5LBCA 5A3NA 2CAUA 4M0HA 3P6BA 2EA7A 1WMDA 3GZTB 3MV01 4B4QA 4FPKA 1RUJ2 2RMU2 4Z1VA 1IOAA 4KWLA 3RQ0A 4AOCA 4B1MA 3BPZA 2R042 2JDUA 3BALA 2J42A 5JVVA 1GKBA 2IFRA 2A75A 5CU1A 5CFDC 3N3HA 5ANQA 4XF1A 1HB2A 3IT8A 5FY4A 2H0BA 5FZGA 2A3YA 3FUQA 4XHBA 4IV1A 1WZXA 1S0BA 3PMEA 4JDNA 4FOQA 1UWWA 4URTA 4CDQC 3DYPA 3CBNA 1TMF2 1K45A 1XRUA 1T6GC 1VBC1 1R091 2WO3A 2CNAA 2WUHA 4GH4C 1EAH1 4PF1A 4S2HA 4YLZA 3CMGA 5I8SA 4E4HA 4YPJA 2VH9A 1JH5A 4M3CE 2VZ3A 3A22A 5D21A 5BNQA 4OHWA 3LA3A 2ATFA 1YUDA 4I3PA 2EXIA 5BNOA 3KD4A 1HQLA 2W91A 3UJOA 1H2NA 1FPN2 4QPIB 1JZ7A 5HXMA 2JDYA 1CAWA 2K0GA 4Y1UA 5T3NA 4GJZA 2YFUA 1K42A 2GNTA 3HMYA 3C7FA 2CY6A 1ONAA 1UMZA 1ACCA 2R0HA 2WL1A 2QZ2A 3SCGA 5F3CA 4Y26A 4XBLA 3X29B 3WP4A 2HWB1 3MUZ1 4XHXA 1QJZA 5DQ0A 5I8TA 2WZPP 3NO8A 1X9PA 4Q4Y1 4S2FA 3HQXA 1KDMA 2VZUA 2IXJA 2VG9A 3OY8B 4QD2A 4XJAA 1OI6A 4WV8A 1JOPA 1RC6A 2NYYA 3PVEA 3S5AA 1AR93 1XXNA 4QWNA 3OD4A 4AEJA 2OQ7A 4MHUA 3T0BA 4NIGA 1OXCA 3KT1A 4NN0A 4CUGA 2O8OA 1JI6A 2ZGUA 2UY9A 1WLDA 3ON7A 4IEQA 4Q4V1 3AP4A 2YC0A 4XW3A 2H6BA 2YC4A 4QU2A 3SKVA 2B42B 1LESA 2PA7A 2QQOA 2VW2A 4PIZA 4QX0A 5JCTA 4N43C 1VMFA 1RMU3 2X5IA 3PVNA 5FZKA 3THCA 2R0FA 1AL23 2DCTA 3ILFA 5LW9A 1BJQA 2PAEA 2SLIA 4XFGA 3VDCA 3I59B 2VBPA 1GU3A 4IE6A 3FLPA 3VBRC 3BTXA 2JG9B 5IVBA 1AR63 1UZ0A 2OVUA 3I7DA 2Q0AA 3WQ0A 4Q5OA 3CDZB 3MIDA 1IZ3A 3IAQA 3QCWA 2XLAA 3WV6A 4BOWA 1NG0A 2I45A 1DFQA 2OXBA 1U12A 4DUWA 3AP7A 1PO22 1WW5A 4R4XA 4LE4A 4BLJA 4FAHA 1T2XA 3WT3A 1NCRB 4HKLA 4JAAA 4MGYE 2TNFA 4FAGA 4O7XA 4LLFA 3H1WA 4XIKA 2VVFA 4LORA 1QEXA 1ULOA 4N9IA 4NHXA 5LBFA 1O91A 2WYFA 3M8LA 5LBEA 4DB5A 1ULPA 5C7GA 4JGZA 2QQWA 1S4CA 2AEZA 3B69A 5L9BA 4CEWA 3I2FA 2WQ4A 2EIBA 5BNPB 3OOXA 2R1BA 4I0AA 5IK8A 1HRV1 2C6SA 2A70A 4I01A 4L99A 4NIAA 2DVAA 3FX3A 5DDJ1 4AQ6A 3VBUB 4CEYA 4MUVA 1NAEA 3ZYFA 4B8EA 1HN1A 2XL9A 4RHV3 1RUE3 4AWDA 2UU8A 3LOBA 2VXJA 2XVKA 1ZRIA 2VMCA 2Y6JA 4AFDA 4WM8A 2XLGA 3DV8A 2CGOA 2YG0A 1MACA 3B01A 3N9MA 4LXLA 1D4VB 5C3RA 1SPPA 4QPGB 5J37A 2C0ZA 3OSDA 1W06A 4QQ2A 4HFSA 1S0FA 1D0GA 4YFWA 3USUB 1OVSA 1RUC3 1Q43A 1QKQA 1OFSA 2V5YA 1VBC2 2Z42A 1R092 1WCDJ 2JG8A 3EYPA 4KI5M 1EAH2 5A7NA 3ZDSA 5C9AA 1WW4A 1XYOA 1AYN1 4A42A 5C4WB 2J1UA 3KSCA 4FPLA 1O4TA 3LF7A 3PTYA 3OBAA 4EN9B 5M0TA 2VZSA 1DLCA 4YG3A 4JKMA 5BY5A 5FY9A 5EYXA 3TNPB 1UIKA 4AI9A 3TEXA 4YSFA 4JV4A 1QH7A 1RUD1 2WLPA 3B02A 2KXLA 4UFMA 1RUF3 5T55A 4CU8A 1FAYA 1MZ6A 1VBD3 3NNMA 4W6XA 5F5IA 1UYPA 4IXLA 4XMAA 5CFDA 3LEIA 4OLLA 4FI9A 4IV3C 1W3XA 2JXAA 2EXHA 4KBZA 5APAA 2YY1A 3OPTA 3VDDB 4XETA 4H55A 1ZRCA 1QNYA 3I2JA 4RR3B 4UW6A 2O14A 5JIUA 1UCXA 3E5UA 3MW4A 2GMPA 2XJTA 4CDQA 4Q0VA 2HWB2 2QVSB 2DVFA 2VY0A 3T4VA 4AL9A 2D6NA 5DAVA 3W58A 4GH4A 2R30A 1IGOA 1OKOA 1GQHA 3NRUA 4Q4Y2 1ZA7A 4XPVA 2Q8OA 2FDJA 5FYUA 1Q3EA 2FBEA 3AKQA 3BIWE 3VBHC 3HJRA 4FPHA 5EFUA 2XBO1 1CN1A 1LGBA 5C8CC 3MIGA 1VAKA 5H9PA 3TYJA 2WN3A 1UZZA 4WM7A 1KS4A 4JKKA 2ZZJA 1LGCA 3NV1A 3KHBA 2HYKA 4Q4V2 5EQUA 4C0HA 1O3TA 2VZTA 4YM3A 3OJBA 3NW4A 5GLTA 1YCIA 1ULGA 2R071 2Q8EA 4XUTA 5IFPA 2Q1FA 3GM8A 5FLIA 4EYUA 1ZBE1 3I2GA 3SQOA 1UY4A 5IUQA 4Q8LA 4FP2A 3URFA 4H3WA 1HRI1 4CXYA 1QH6A 1X82A 4XACA 1OLMA 5A33B 5KXBA 3T1LA 1IS3A 3GJBA 2RR12 4R8HA 5FUIA 4BXSV 1AR81 3O12A 5SV5A 1W8ZA 3ZR5A 2ZGRA 4XQDA 3SITA 4RA0A 3E6DA 4QM9A 3AL5A 4RS5C 3E5XA 3NKTA 1Q8SA 4X6RB 5T54A 1BBT3 1C1LA 5GLWA 4EJRA 1JZ6A 2RS53 4AHZA 3NJYA 1O3QA 5DPNA 1W6PB 2CV6A 4PDWB 3ZPOA 4URAA 4PJYA 2HYXA 1YQ8A 4I0WB 2WO1A 2VZ1A 1H8VA 4LBJA 5L9RA 3LIHA 3HQRA 1ZZBA 1NXD1 4G4FA 4N43A 3APBA 4YG0A 4LBQB 2WDBA 1YI7A 2VQUA 2Z69A 3HT1A 4QGNA 1RL3A 1HRV2 4DO0A 5F6LB 3PVBB 1R1ZA 5HCFA 5DDJ2 3VBRA 2MEV3 3ZN4A 1W3VA 2XL7A 3SH4A 1KDKA 2XUMA 1AX1A 2XR4A 2VMFA 4N53B 3VZOA 1C57A 2LM3A 4ISRA 4XFCA 3TAYA 4HVOA 3QH6A 1UKGA 1HB3A 4COYA 4DUVA 5F6KA 3QLQA 4OYUA 3WG4A 3MW3A 1POV0 4OVEA 1DQ5A 3KB5A 1TME1 1TNFA 3RZGA 5F3GA 3IDAA 3WNNA 2RJ2A 3ZSJA 4LKEA 4RSUA 1PZ7A 3SISA 4HMZA 4ASKA 3V0BB 5JXHA 4RGKA 1M4WA 2NLRA 2RJLA 3IBMA 3LDKA 2JKXA 1QNWA 4GB31 5K0UB 1SLTA 1W6OA 2A6WA 1V6JA 4OMDA 4YW3A 4JHZA 3VZMA 5L19A 4HN1A 1AYN2 1L7LA 3MLKA 2BRTA 3WINE 3T30A 3AZZA 4CCNA 1LGNA 2LTNA 4DRRA 4DY3A 3MEPA 3OD0A 4RFT0 5AVPA 4UF0A 1MS3A 1XJAA 4M01A 1Q56A 3ZYBA 4BH9A 4JTNA 4BXFA 1RUD2 3PVOA 4IE4A 2X8KA 3PL0A 2WABA 3ETQA 3K51A 4XJUA 2QQUA 4YM2A 5A7OA 2EXJA 4Y20B 2W94A 1JXNA 1V70A 3I2KA 5IVVA 1T6BX 1QOSA 2FCUA 2QQVA 4XUNA 1RITA 4R52A 1KEXA 4AVSA 1VBA1 1SLBA 2RS31 4INDA 2JJ6A 5FZBA 5F1RA 4B7EA 3ZXAC 4CDWB 5C3PA 1AX0A 2R16A 3MIFA 4FVVA 1H4HA 1OHFA 4W6YA 4A7YA 5BUVA 3F2ZA 1NCQC 2W1QA 2GC2A 4QPWA 3Q9OA 1W8HA 1RINA 1LU2A 4DS0A 1F31A 1U5IA 1AF9A 1GNHA 1NXMA 1H2LA 1LCLA 3HT2A 3TN91 3C2UA 1LEMA 4JX0A 2IWGB 4W8JA 3J7NA 4LKSA 1QY4A 2XBO2 5FPAA 2CHHA 2WLQA 2B45X 5CG9A 2RDQA 3AMMA 3KCYA 2HWF1 5I0TA 4XOGA 3NWKA 2RS13 1ZRDA 2PHFA 3UGGA 1FNYA 1BLZA 1U5YA 2Q1MA 2RR13 4QQPA 1QQP1 1WBLA 4LKFA 4ZPIA 5F5AA 3SH3A 4LIVA 4XFAA 4YW2A 1PO13 2W5FA 1NZCA 4YVWC 5DZFA 5ABJA 5FQ0B 1IKQA 3ZX7A 5KR7A 5L73A 2R072 4W65A 3HEIA 1YC61 4AFAA 1IG3A 4L97A 4UYBA 4ZHNA 2A3WA 2VZRA 4KL1A 3WF3A 1H9WA 5JSRA 3NV3A 1ZBE2 1CZTA 4IV3A 3WY6A 3POIA 3WG3A 1KJRA 2RHPA 2ZGMA 3IPVB 2FD8A 2VQ0A 2A73B 3EBRA 4I2OA 1HRI2 2RV9A 1IHMA 1SZBA 5CFCB 1POV3 5FK7A 3RFRA 4A41A 4RQPB 4JCKA 4XXPA 5LA2A 1L3JA 1Q8OA 5FLHA 3MFCA 4JRAA 1AR82 2V09A 1J3QA 2PHTA 2BTVC 3ZFGC 3S0MA 1UD1A 2A71A 1UMIA 4GWMA 3VBHA 2QQIA 4BE3A 4MSVA 1V6OA 5FZFA 5LB6A 2NMNA 4GQ7A 5C8CA 1VPHA 1XOYA 1UY0A 1VLNA 4IESA 2QQPA 4D7SA 2WA4A 1V9U1 1N1SA 1YJLA 2E6VA 4NPMA 4ATFA 5EJ1B 2ZA9A 4E2QA 5KXEA 3WZ1A 1GBGA 2D93A 4BK5A 3ZFEC 2VQAA 4QXKA 4B7KA 2YBPA 2ZGNA 4D69A 1S0GA 1RJ8A 2DFBA 2ET1A 3LIGA 1AUYA 2WJSA 3KV6A 2QE3A 3GBFA 3H8XA 2NQYA 1S0DA 3GGLA 5EV7A 5C71A 1QJX1 4QX1A 5FFOC 2XLFA 4MZUA 4TLFA 3D8CA 1J1LA 4GKXA 4SLIA 4B3NA 4LO7A 2NM1A 2ARBA 1PVC3 3KV9A 4F3JA 1ODNA 3R4SA 5ABJB 3VD3A 3N9LA 5JWPA 1YFUA 4UXAA 3HOBA 3MI8A 4RS5A 4OMCA 5B2GB 3U78A 1GNZA 2TUNA 1DGLA 4AZZA 1TME2 4HL0A 3ZYRA 1MS5A 1NQJA 1IPSA 1RUI1 1W9FA 5DZGA 3D82A 3BCWA 4LIUA 1W2OA 4ZU7A 4GMP1 4GB32 2EALA 3RZMA 1PX4A 3ZN6A 1JZ8A 1GZTA 5G05L 2QNKA 3UKTA 2HWC1 1G7YA 1I1EA 3ZIWA 4M3CB 2ILMA 5CA6A 5LATA 4NIDA 3RZZA 1ZA4A 2WO7A 3L9JT 4YW1A 5JR7B 3RYRA 5FZ3A 5IT6A 2HWE3 1PVXA 2HEWF 5FYCA 4CZSA 2GC1A 3NJVA 1WWYA 5FZEA 5GKAC 3IIAA 3ZN5A 4BM8A 5CNAA 1NLSA 3Q8EA 1KFXL 3CJIB 1V6KA 5JSPA 1VBE3 2ARXA 1JUIA 4EN8B 4D0QA 5CADA 3V0AA 2EVXA 3BGAA 4V2VA 2ZGLA 3ZSLA 3HNYM 2XHKA 4PI0A 3EB7A 1UNBA 1VBA2 2RS32 2XVGA 3VBFB 4DXRA 3VL9A 1IS6A 1WLTA 5JXJA 1OKQA 4IERA 5E1RA 1JOBA 1H2KA 4P9GA 4WBBA 3ZYJB 2GN7A 4CDUC 3MIEA 5HCHA 3MF6A 5FIXA 4Z2WA 5DUVA 1ASJ1 2G9ZA 5LCWL 1R1A3 3BTZA 3TN92 3I4IA 5FXVA 1OUXA 2P3IA 3NSTA 4OI4A 4ZZ8A 3AC0A 1WA6X 3WDVA 2HWF2 1QXPA 1PNGA 1Y4WA 1AR73 1YQ6A 1QQP2 1NY71 1SLCA 1RHI1 1W8NA 2BZDA 2GDFA 2GZWA 4XJZA 3V56A 1RUOA 1FMD1 5A1AA 4LO4B 5KHGA 5E88A 4AVTA 3GDBA 3PUSA 3R0RA 4YVSB 4PT6A 3ZYPA 4C1XA 4NROA 1PIV1 3KQRA 5JLVA 3O1TA 5KHIA 5CEHA 1Y9QA 1UPIA 2J22A 1QXRA 1CZSA 2F4LA 5IAVA 3ACHA 3GBWA 1NCQA 1OPMA 1UXZA 2XMLA 1CJDA 1WKYA 1YHFA 4WZFA 2VCAA 2H0VA 4K6BA 3PUAA 2XKOA 4Q4W3 2PAKA 4NIHA 3AVRA 2EIDA 1LAJA 4ES8A 4L0PA 4LLOA 3PU3A 2G1MA 3FHIB 1WMEA 1V9U2 2GN3A 3J8F1 1Z7S1 4ET7A 1S2KA 2BNOA 1LOAA 4GJYA 3AFKA 1F5JA 1HB4A 4XFHA 2WNUC 2D3SA 1OOPC 2JDMA 5FP9A 4TN7A 4B4RA 3NAPC 3C7GA 1OURA 1STMA 4JGYC 2JB8A 4MGSA 1QJX2 2DU0A 3LSDA 1J1TA 1JYTA 1LHUA 2W46A 1N1TA 1JODA 3MDPA 3W5NA 1P8JA 5BXXA 4YYOA 3IZOA 3CQOA 1RUG1 3RJ2X 4PQ9A 3AKSA 2WQ8A 4NO4A 2ZPXA 4UW3A 4XBQA 2EF6A 5DUWA 3JBG1 3SLIA 3ZFGA 4LITA 1OLME 4ISQA 3POYA 3RYKA 3OUIA 2W95A 3DEMA 1R083 5FPLA 1FV2A 1RUI2 4LBNA 1DF0A 3FC0A 3ZMNA 4B29A 2PLV1 3NVCA 2ETEA 5L7OC 1PMJX 2WAOA 4OI2A 3ZFEA 3IAPA 4PHZA 4BCUA 4YW5A 3WQ1A 2XG3A 4AAXA 3K46A 5IYYA 3WDUA 4MOAA 1GOGA 5JDBA 1HLCA 2DU1A 2PHLA 1W9WA 4MGKE 5FO7B 3WNLA 3ZKUA 3W9AA 2HWC2 1HDKA 5A1LA 5LEJA 3UNPA 1IKPA 4PCRA 4N7IA 5DN2A 4OHYA 2OA2A 2ZHKA 3TEWA 1IS4A 1KITA 3M70A 4XUPA 2OPWA 5F7UA 2XJSA 1N1VA 3OGSA 2WAAA 2H6CA 4K3UA 2A1XA 2D5HA 1DQ6A 4KGGA 4YVWB 5DAPA 1WCSA 1QHDA 1BQPA 1VMHA 4YARA 4HANA 1GANA 3ZFFC 2CGNA 4IGOA 5JZGC 2FDKA 1AJOA 4KU7A 3MV11 1LHOA 1SFPA 2IXCA 4CCOA 1MS9A 1LECA 3PUIA 1W2UA 4AW7A 5HI0A 3KF3A 4LHSA 4YWAA 1NYWA 5HXVA 2C9KA 3N4MA 1URXA 4IETA 4FFGA 4QPYA 4XXAA 1ASJ2 1COV1 1RGSA 4JGZC 3ZYIB 1D0HA 3HD8B 1CPMA 2YV8A 3CEWA 3GJAA 3POGA 4MVTA 4XBNA 3SEEA 1GOFA 2C1FA 1DBNA 5FPUA 1XBFA 2P3KA 1CPNA 4AEDC 3GYDA 3ZXKA 1NY72 1RHI2 1W9SA 1YQ2A 3BPSA 4Z07A 5IWFA 3VD7A 3BIEA 1UN1A 3QH7A 1FMD2 2BNNA 3LFIA 1DIWA 1ND2B 1J58A 4Z8BA 2YBKA 4TZDA 1A6CA 1UU6A 4NRQA 5FKCA 1YLLA 5LASA 4ASMB 2BW8A 2CWMA 5LWBA 3T4HB 1PIV2 1LRHA 3T3YA 5FXWA 3D3AA 3LSEA 5FO9B 2G9FA 4LT5A 4BIFA 4CDUA 1A8MA 2AC1A 3I3DA 4GD4A 4WVMB 5EZWA 3AK0A 1GYKA 3LDRA 1X7NA 3WDYA 1H6YA 4UW5A 1MQTB 2W1SA 1UL9A 1IG0A 1XNBA 1ZNPA 1K5JA 2SBAA 4P9IA 4XFBA 1NT0A 2BVVA 2Y26A 2E53A 1ZZ7A 3VZLA 4AQ2A 2GC0A 3TRSB 4NHKA 5A32B 4META 1W05A 2D6OX 2HLEA 2ES3A 3A4UA 4E8DA 2WS93 1QGLA 3J8F2 1Z7S2 4J1XA 1OQ1A 4AG4A 3AYEA 5D1IA 5FDBA 2W0XA 5AFEA 4CP9B 1E5HA 1N47A 2OW4A 5IVJA 1S2EA 1XNKA 1GZWA 4NOTA 3AZXA 3KMHA 5FZIA 1W90A 1D4M1 1WLCA 4AI3A 3JU9A 5HBAA 1OA3A 5EWSA 1UKRA 4DQAA 1UYYA 2GH2A 5F2WA 1JZ3A 3W5MA 5EP9A 3WF2A 4Y4RA 4QB1A 3OGJA 3Q8FA 1EUUA 2PHUA 4Q4X3 2YFZA 3E97A 2ORXA 3EMRA 3LKJA 1ULFA 3WHUA 2VZOA 1RUG2 3FFQA 4NHYA 5JAXA 1PK6B 3THDA 1QU0A 2VOKA 3JBG2 5K9YA 1A78A 1DU3D 1YFYA 2J7MA 1WLWA 3OGVA 5FYVA 1G9BA 3IMNA 2B46X 3H0OA 5ACA1 4LK7A 1C8NA 4LA3A 2I74A 4E8CA 1APNA 1RB8G 2QCSB 2Z2SB 4RFRB 3RJRA 1O7FA 3C3VA 2DYCA 1AYM3 2PLV2 4MH0E 2BBAA 4WM7C 3VHPA 4XF0A 3AZVA 3I49A 5CIRA 2AACA 2WNUA 1OOPA 2A6ZA 3RRDA 1LTEA 5A7WA 5KWRA 3I2OA 5C5TA 1UW8A 4FPJA 4K21A 2XJQA 2KA3A 3NAPA 2ZEWA 4PBPA 1Z78A 3K4AA 3IDCB 4ASLA 2PAMA 3AJZA 4JGYA 2DUPA 4GWIA 2DCJA 4IQPA 5C3QA 4K7JA 3KVAA 1UU5A 3A7QA 3LEMA 4FOVA 1W8FA 4WZCA 1JUHA 4K9SA 5JPMB 3WNKA 2WNVC 3POSA 4CCEA 2ZX3A 2BGPA 4CCCA 2OS2A 1FXZA 3W21A 5LK7B 5AC91 1LENA 2B4KA 3WNXA 3BUCA 2CSGA 1OUSA 2Z79A 2F6BA 5FMDA 1G9DA 1DZQA 5CBLA 1DGWX 1DQ4A 1E5RA 2JENA 3HIFA 4XQWA 5DG2A 3LEKA 3ZXGA 3K3OA 4NAMA 1XNAA 2JDPA 5L7OA 3WCRA 2Y6KA 1VB2A 2VOWA 1KQRA 3AP6A 1HQNA 2RDRA 3H9AA 4XCBA 4YW4A 1GP6A 4ZS3A 1COV2 3N7LA 4QQOA 1YWKA 4IV1B 1DLLA 1W9TA 4G3YC 1QJY1 4ATEA 3HWJA 1HXS1 3PJQA 5TSWA 5FO8B 1YRZA 2VTFA 3BB6A 2VBBA 1C8M3 4XC9A 3WNPA 3H1MA 2QDRA 5FK8A 3VBUA 1CAXA 3LD8A 1W28A 3U14A 4QHOA 4QQLA 4D3WA 1PGSA 4CCJA 4RGAA 5A6QA 1S2BA 2QJVA 3ZFFA 5BNOB 5JZGA 2ZGQA 3WNOA 3AKPA 3I8TA 4NWVA 1SBFA 4UBHA 1CAWB 2AENA 2AZ5A 4K1YA 4Y1VA 3VBOC 3ZXLA 1FI2A 3LZZA 2W3JA 1LHVA 3UL2A 1POQA 1RUJ3 2GP5A 2RMU3 1Y43B 4BB3A 2VECA 3A23A 4JQTA 5A3OA 4BJ0A 4CRQA 5CKMA 2R043 3USUA 2IXKA 4LHNA 4BWOA 3R4UA 3MLLA 3ABZA 3PJYA 2VOTA 3ST7A 1HQWA 3B9IA 3H8OA 1MEC1 2WWUA 4YGEA 1US2A 2Y8KA 3RPQA 5B4NA 4AEDA 3DPRC 3WP5A 4DXSA 1AZDA 1NA1C 2E26A 2XOMA 3I3EA 5T5JA 4K1ZA 3RG0A 1OPOA 2WO2A 1TMF3 2XJPA 3CNAA 2A3XA 3ZVXA 5J09A 2WKKA 5KHHA 3SCHA 4LOTA 3RS6A 3POFA 4E2GA 4E27A 1D4M2 5A7WB 1H2MA 3UYJA 5D8AC 1E5SA 1Y9GA 2X5IB 4TYSA 4Q2FA 5DAQA 3GZUC 4XFIA 3ACGA 3ALQA 2K46A 3OYWB 1W03A 1O6UA 1OF3A 1RUH1 2DWRA 4XDPA 4XMIA 4EQVA 4NJ4A 5FWJA 3M2MA 3U37A 2GMMA 5FP7A 4UFKA 1FPN3 3M4FA 4D6RA 4AHWA 3ZR6A 3IM0A 1L7QA 5C5UA 4PQQA 2VBDA 2W52A 3U11A 1ND3C 3ACFA 5BNNC 4MHRA 2V4VA 1H30A 1FOD1 4XTMA 1XE7A 2EICA 4XJ9A 5FP3A 5ACA2 2ZZQA 4W6WA 4BQYA 4XUQA 1MR5A 3VD9A 1DCSA 4XEZA 1G86A 3VHOA 5ABJC 1MVEA 2D3RA 4FTEA 2HWD1 1FYUA 2D44A 4D6QA 2CTVA 5FTTC 4CEWB 5T50A 4QXCA 4AVVA 2P1BA 4QX5A 2WR9A 5HPOA 5IW0A 5JIAA 4CEYB 3CLPA 2VOXA 5A33A 4P9LA 1WA4A 5AC92 3M3QA 4OULA 5FZOA 3KS7A 4LBOA 3KCCA 4Q0QA 4DINB 1YFWA 4I09A 1ZVFA 4UFLA 3QD6A 2PFWA 4WM8B 1EUTA 2BQPA 2PELA 2FQPA 4Y5TA 5F32A 3CF6E 4Y3OA 1SPPB 1XU1A 3HBZA 5GZEA 2DURA 3FL7A 2ZGKA 2CL2A 1JBCA 3T0AA 3JQXA 2WNEA 5KXCA 4PLMA 5ERLA 1EY2A 1SDDB 1PO23 1Y9MA 3LA2A 5FZHA 1PM4A 2W68A 2I2SA 3SHRA 3UESA 3ZSEA 5A6ZA 2PMWB 1I5ZA 3RMYA 2JG8B 4Q0PA 1RVF1 5C9AB 4JRLA 5I8YA 1IQAA 3ACLA 2Y6HA 3JD71 2JDHA 3JCIA 1OF4A 2LALA 2WFF1 1ULCA 2WNVA 5DMYA 1GUIA 1MS1A 1VBB1 2B39A 2YMZA 2UWBA 3FLTA 1DGRA 2WC2A 3H1YA 2XWBB 3NMBA 3AKRA 3WG1A 1GZ9A 3ZLIA 4DY5A 3C7EA 4QXBA 5A7SA 5JOXA 2FDIA 3ITQA 4FPEA 4D94A 5JXIA 2ARCA 4A4AA 4C1WA 4IDZA 4BQWA 5H9SA 1Q8QA 5CFDB 1XC6A 1MVQA 2X29A 3O1PA 1Q8VA 2BOJA 5FY5A 5GZDA 1BMV1 1JS9A 1S0JA 5LA1A 2AUYA 2F17A 2AGSA 1Y3TA 4CDQB 3HBKA 2E7AA 3W59A 4GH4B 3OUJA 1MEC2 4XE9A 3GZEA 4NE9A 4I3GA 1XYPA 4CYDA 1CD3G 4Q0UA 4DEVA 2WZR1 3JXSA 4ZKTB 4R9BA 2CAVA 3P3PA 5FP4A 3VB9A 2WFPA 1SMVA 2DVBA 4QDRA 1QJU1 1SHWB 2E31A 1W2AX 1VBC3 3WSOA 1MS4A 1R093 1WCQA 1EAH3 4IEXA 3WHTA 1DQ0A 3KZ4C 1OT5A 3U75A 3OEAA 4OUEA 4Y20A 1NE4A 1XB9A 3EHKA 3N9QA 2ERFA 3CZJA 3Q8BA 3VBOA 1RUH2 5FY1A 4IEZA 1YXWA 1BEV1 2PHDA 4IEPA 2VUCA 3DL3A 2BJSA 3LEGA 4H7LA 2J1SA 3BU7A 3MFAA 4NRPA 4AGRA 1ZREA 1GR3A 1IPKA 4UWDA 4JVAA 5CVRA 1VB4A 2VGDA 1ZZ9A 3I3QA 1FOD2 4GA9A 1CX1A 2X10A 2BEOA 3DPRA 1JYCA 1UOGA 1EV11 2PHRA 4Q26A 1QOTA 1NKGA 1NA1A 5EYYA 5A1FA 4A6OA 2HWB3 3HNBM 3PUQA 2VC9A 3KGZA 4Q4Y3 3JZVA 5FZMA 2UURA 4LBLA 4PI2A 2FCVA 4AQSA 2OUHA 3BKZA 1V6IA 1IPJA 2R32A 2KM2A 2VW1A 5D8AA 2HWD2 2ZMLA 4N43B 4JTOA 1RIRA 5LEKA 2ZEZA 3WCSA 4Z92B 1OH3A 5GLZA 5FZCA 4YGBA 4V2WA 4I02A 2LW8A 4Q4V3 3SC7X 2E33A 3VBRB 4COUA 2DDUA 1OA2A 5FJKA 5A3LA 5CFCA 1PM7A 2D6KA 3J7MA 4MGIE 3RZJA 1XE0A 1ND3A 1W04A 5BNNA 2Y6FA 3J7LA 4WVMA 2VNOA 3N7MA 1LOCA 3AZWA 5BV6A 3GCXA 4AEMA 3A0KA 4CDXC 3QBQA 4FSJA 1O8SA 1R64A 1CVNA 1YQCA 2HEYF 4EZHA 1K5MC 5KC6A 2J1AA 2P5BA 4XJWA 1RTVA 4BIOA 2VMEA 4QB6A 4YFZA 1H1AA 1NZIA 2VW0A 1D7PM 1MZEA 1O5LA 3A0NA 3CJXA 2XHNA 3VN4A 3WP6A 2D97A 5FPZA 1Y7BA 1PGW1 4XF4A 5GLVA 1W6OB 2ADEA 4B4PA 3FUOA 5FYTA 1RVF2 4RL7A 3WF4A 2XH6A 4FT8A 2YPDA 4MGTA 4L9BA 3NV2A 2C26A 3AB0A 5E8AA 5I91A 2YHJA 2ZAHA 1J59A 2EIEA 1O5UA 1UZWA 3JD72 5LBBA 2WFF2 3TEYA 5GZFA 3B00A 1VBB2 4MG2A 1ULDA 2R49A 1B35C 3KT4A 4UF0B 1CIWA 3WW2A 2RM21 1FATA 1LOFC 1HRV3 1VR3A 2J1EA 4OHZA 3UKNA 3OPZA 5DDJ3 3ZSKA 2Y0OA 4FXGB 3OB8A 4IGPA 4HK8A 1VRH1 4LO8A 3J9SA 2TEPA 4WVZA 3WD5A 5AFBA 1NUKA 2YU2A 4MO3M 4KU8A 5CYYA 3R05A 3VBSC 1BMV2 3WVJA 2GNBA 2VJXA 1SG3A 1WD4A 2ZS6B 3FMGA 4O9GA 1Q8PA 4WVVA 1O4YA 3USSA 1JZ2A 3FFZA 4AFMA 3AMHA 5IVFA 2OX0A 4BLIA 2PN5A 4CP2A 2D5FA 5A6XA 4E9KA 1ULEA 1G6NA 1X9TA 3S6PA 1ZBA1 2ENRA 2BV4A 2WZR2 5KHJA 2TBVA 1OQDA 2BWAA 4GULA 1S55A 3DXUA 4KH9A 1F4HA 3WX5A 2R061 1OQEA 2A7AA 2Y60A 1QJU2 4KWJA 3ZIXA 4J6GA 3TOJA 2FCTA 1V0AA 3O5SA 4EROA 1AYN3 4WVWA 3OGGA 3CJIA 3FJSA 2LRPA 2OZ6A 1H6XA 2PQSA 1W6NA 1I3HA 3UKVA 1NOVA 4P9XA 3VBFA 2WIIB 2J1RA 4IV3B 5T5LA 3SXWA 3M1HA 2DFCA 3JUUA 1RUD3 1UZYA 3P3NA 4OI0A 1BEV2 4IE5A 4LEJA 4AYUA 2CU5A 3RSJA 1SFNA 1REEA 1TNRA 3KGLA 4LPLA 3LB9A 1G9CA 5DXDA 3E5QA 1S1AA 4B1LA 2VO5A 4R4ZA 1LOBA 5A3WA 3VBHB 4DRVA 1FNZA 4XUOA 1H8TC 1X8MA 4TTGA 2OIIA 1EV12 2BFUL 3BTAA 4TSVA 3T2TA 4CTEA 5A7PA 5C8CB 4XF9A 1W6QA 3DGTA 3LAGA 3QOPA 5LRRA 4QKNA 2VVDA 1H0BA 4W50A 5IHRA 2D40A 1X50A 2V5DA 1BHGA 2IZWA 5GALA 4CXXA 2P2KA 3Q8CA 4AGVA 2XBO3 1KRIA 5FZ0A 4CUAA 5J36A 2DTYA 3MZHA 2KR2A 3WXPA 4BQ1A 3CL1A 3FHQA 3O1OA 3WW3A 1GNYA 1C5HA 1SBEA 1X8EA 1ZX5A 2ADDA 3D4KA 3JQWA 4PLNA 5F2SA 3DYOA 1QMJA 3PURA 3WF0A 3D0SA 3R6SA 3LE0A 4NR1A 1UIJA 4DFSA 1BXHA 2R073 2C9AA 4X8NA 3GZAA 3U07A 1W8WA 3VUOA 1CR7A 4QU1A 3U0ZA 3H7JA 1DZRA 1ZBE3 5FAXA 2ZX2A 4HVQA 5H9QA 2FDGA 4OFGA 3MICA 4HKOA 1SCSA 1BZWA 3KVBA 3WF1A 4YZ5A 1HRI3 4L2NA 2XGXA 2MNGA 2XDVA 3L2HA 4RS5B 1BCXA 5A6YA 1O3RA 3P1IA 4AQTA 4Y33A 4AK3A 1NE6A 4HPKA 4HK9A 4YW7A 1W99A 4Q0SA 1AR83 5C3SA 4Q27A 1OD3A 5FMCA 2ID4A 1QJFA 3OPWA 2ZHNA 3VLBB 1V6LA 2FMYA 4SBVA 3DXTA 2DF7A 4LO5B 1PGW2 1S0EA 3ZN6B 4QPIC 3RZKA 1ENSA 1GWMA 5KHKA 2HKXA 1XSQA 4LUMA 4Y22A 5EHDA 2Q30A 2RDSA 2QQMA 3WW1A 2JX9A 2RM22 2Z5WA 2IXLA 2ZHLA 4I0BA 5F5QA 1AR91 1VAVA 1MZ5A 2WA3A 3DECA 3S7EA 3BI3A 3V0AB 1DYPA 3WG2A 2HEVF 4ONUA 4CDXA 2VTXJ 5CB7A 5KXDA 1K5MA 1X33A 3ZYHA 1RMU1 5LY1A 1MS8A 4IEYA 1AL21 2ZGTA 1ENQA 4UAPA 1O3SA 2Q8CA 5F3IA 1BVP1 5GZCA 5JMCA 1TME3 1VRBA 3M3CA 5CKQA 1YQ5A 1C5IA 4ES9A 1S0IA 1AR61 1EYBA 1ZBA2 2EAKA 1CAUA 4D7TA 1LB2A 1OMIA 3IN9A 4DZGA 3U4XA 2ZEXA 4AE2A 3E6CC 4KWKA 5FY7A 2R062 2Z4FA 1W39A 4GB33 2OPKA 4LK6A 3H8RA 2JG9C 1AX2A 3K3NA 1B35A 4GKYA 1UYXA 4M0NA 4QKDA 4ZONA 4E4ZA 5FXZA 1IQDC 1JTZX 1LOFA 1SACA 2JE8A 4S2GA 3VKFC 2O8QA 1N3PA 3O1UA 3T2OA 3FBYA 4HT1T 3RI8A 4A45A 4YNIA 2DCZA 3RWKX 2W1WA 3O7OA 1JN2P 3KHCA 1HJGA 1C1FA 3NL1A 4O61A 3WLUA 4GWJA 2BERA 4AGGA 3VHNA 4HONA 3VBSA 1NCRC 4OCTA 5JI9A 4RGGA 2D6MA 1PMIA 2O1QA 1NCQB 1WCUA 5IJRA 3WQBA 4L8QA 1VBA3 2RS33 5D2AA 2J1VA 4QX2A 4W4ZA 2DUQA 1W6MA 1ALYA 2VZQA 4FOYA 5A3MA 5BNPC 4OUMA 5BPXA 4RHV1 1RUE1 3FN9A 4Q1PA 3O1RA 3VKNA 3RZLA 4CCDA 3CO2A 1DDLA 3RWNA 3CIHA 4MXWA 5I0DA 2WSVA 2P37A 3VBUC 3JB4C 3HPNA 3POBA 3TN93 4KQ7A 1FV3A 4YGDA 1RXFA 3UV9A 3S30A 5JI7A 3G7DA 4GMP0 2HWF3 3NV4A 2NPIA 3OF1A 2YU1A 3TNQA 1N3QA 4OZXA 1YI9A 3KWVA 3PUHA 4FOWA 5IK4A 1QQP3 4KG0A 3HQUA 4AI1A 2BDRA 4DEQA 1RUC1 1D2QA 2ZBJA 4QPGC 5IFTA 3EQEA 5EIYB 2LS6A 3G6JB 3SKJE 3HN3A 2BVBA 2DVDA 2FZ1A 4OQ9A 4PF5A 4N90A 2W1UA 3T08A 2XKPA 4AVBA 3BODA 3ZFGB 3ACIA 4AI2A 5FLJA 4FPOB 1CAVA 1HJFA 4NRMA 1H8TA 1AXKA 2IVJA 2YPJA 4CPBD 3FWEA 5F9TA 1RUF1 3K48A 4CUBA 1VBD1 2VZVA 2CWSA 1N3OA 4IE7A 4PLOA 2D43A 4KG8A 2DCKA 3H3UA 3ZFEB 2LROA 2V72A 2AR6A 4L11A 4RYDA 4ZU5A 3ZXDA 2JDKA 4AFCA 4QB2A 4XVHA 1V9U3 4BA6A 3W20A 3VGIA 5FCCA 4EV0A 2FZ2A 1EPZA 2B5HA 3O0XA 4HLTA 2UWCA 1A3KA 1UY1A 3S5QA 3VDDC 3MW2A 3PU8A 4UFIA 2XJUA 4RR3C 2UYBA 4LJHA 5FZDA 3EO6A 1AR92 1DQ2A 3D0JA 3KLSA 4LA2A 5FP8A 4K40A 1F15A 1NQDA 2ZMKA 3ECQA 4XF3A 1QJX3 4C8DA 3BU0A 4P00B 2QQLA 3IB3A 2X05A 2NP0A 3GNEA 3VZKA 1RMU2 4ORFA 3L2YA 2XB6C 5FOJB 1DGRN 3DKQA 4J1WA 4QKBA 1AL22 2VR4A 4MLOA 2BWCA 4FXKB 3VD5A 3T0DA 4LNVA 1RXGA 5LK5A 1SEFA 1RUI3 4QPIA 1AR62 4UFHA 4GWNA 3CKHA 2YB7A 1KD7A 3C8XA 5FZ8A 4YZ3A 2VMDA 2XONA 5L9VA 4GMP3 2N7GA 4S2DA 3DUIA 4KWUA 4D8MA 1QDOA 5BYNA 3FE5A 3GXUA 4OI1A 4M3CF 4BISA 2HWC3 1BBT1 4CU7A 3J7HA 1SDWA 1H9PA 2RS51 3LWCA 2YYOA 2ZX0A 5FRAA 4LBQD 1YIPA 3OY8A 2B8MA 1MPXA 1AHSA 3OGRA 3RNSA 4YRDA 4EN0A 4Q29A 4EN6B 1GLHA 4KGQA 1U5XA 4CDUB 4PDWC 4NMIA 5FPXA 5K4LA 5EXOA 1FX5A 1LKNA 2MEV1 2C4XA 1ZM1A 2W08A 4MGZE 1BK1A 2FHRA 3M7AA 3VZJA 2GNDA 1RUE2 1TVGA 4RHV2 2ZEYA 1J3PA 1WMXA 3I59A 5FMBA 1ASJ3 2VAUA 2JG9A 1BVVA 3PLQA 3MIBA 2Y64A 3INAA 3U4SA 4CP1A 1OD5A 1UOFA 1DYKA 4N53C 4YW6A 1GZWB 3T2QA 1HN0A 1ST8A 1OLQA 3WW4A 1MZFA 5CZKA 5FR3A 2D6PA 1SCRA 1JYVA 1RHI3 1JOJA 2DBNA 2Y6LA 1RUC2 4YG6A 3ILRA 3GCWA 1NCRA 4QX3A 1FMD3 2YDEA 1DYOA 2PXJA 3ZMOA 5FYIA 2QQJA 1HIXA 4NHLA 4N8MA 2QQKA 4FQ4A 2VCMA 3NNLA 1PIV3 2R1DA 4AAPA 5K0UC 5CG8A 3P5BA 1UAIA 3WDTA 2V73A 3ZO0B 4QQHA 1SLAA 4Y1ZA 5DABA 5BNPA 5FOBB 5FZ4A 1UOBA 2W2IA 4U36A 1MS0A 1UOJA 3O0VA 3VV1A 4FBFA 5DZEA 2QUOA 1RUF2 1VBD2 1ENRA 5T5OA 3AMPA 1UYZA 5F37A 4XAAA 3SCFA 1U0AA 1WW7A 4Y1XA 2WNUB 2JB4A 1OOPB 4GZ9A 1XU2A 4IL7A 2X09A 5EPAA 3NAPB 3J8F3 1Z7S3 4ARXA 1F4AA 1LJ7A 4FPGA 5FMOS 2XPJA 3WUDA 4JGYB 4LULA 4QPGA 3OYWA 4FPFA 4E4DX 5JSOA 1GFF2 2VNGA 1DG6A 2R7EB 4CDWC 2IXHA 4H14A 4XJ8A 2OYZA 3POJA 2YROA 2NN8A 3J4UH 5FBZA 2RS11 5FKBA 4QGLA 5JMOA 4FO9A 3SNMA 1CWPA 2RR11 3B7MA 1Q5OA 3H50A 3NJXA 1F9KA 4UT5A 4EN7B 4C90A 5C4WA 2GALA 1PO11 2I07B 2JD4A 1A8DA 2EIGA 3N9OA 4UOJA 2UY8A 5GM0A 1RUG3 2GNMA 4OQ8A 2ZXQA 3JBG3 3ROUA 1V6NA 5L7OB 3CHXA 3N7JA 2XUEA 3VKOA 1GQGA 4JDMA 1V00A 2ET7A 2PHWA 5E89A 2MPFA 1POV1 1UPSA 2B7YA 2VU9A 3ZXJA 2PLV3 5FYYA 4CPBA 3OBZA 1KXGA 1PX3A 3VDDA 3WQ7A 4D6SA 1HB1A 3TBDA 1W0PA 4RR3A 3HR9A 3AMNA 2WRAA 5CFCC 1CAXB 1BBT2 2VCCA 4MGQA 4MADA 4RQPC 5CAZA 2Q5TA 1N1YA 2RS52 5G04L 4AF9A 1JW6A 2HBTA 4HBNA 1X36A 4JDOA 3ZFFB 4XABA 2C24A 5JZGB 1CJPA 1AXZA 2K2SA 2ZKNA 5FYMA 3M3EA 2WT1A 1J3RA 2VMIA 4CUCA 3ME2A 2E51A 4JKLA 4BQ5A 1YJKA 3LOIA 2CGPA 2G9GA 3OBTA 3AYDA 2EAAA 4A7KA 1W8UA 3D6EA 5DAWA 4DXZA 2D3PA 3EXUA 4M4PA 2MEV2 1SLIA 1JYWA 2VMHA 4JGZB 4OUSA 1KGYA 5FUPA 4HZFA 4BZ4A 4IW3A 4RD7A 2VM9A 5C8WA 1PVC1 5IAXA 1I9RA 3KM5A 1DQ1A 2DCYA 4AEDB 1COV3 4F7ZA 2IC1A 2GP3A 2BYVE 4COWA 4FP3A 2BP6A 3S7IA 2JDZA 3TB0A 4ZU4A 2C5DA 4NWWA 4Y5Z0 3IWZA 3MPBA 4BMBA 3MPPG 4NVPA 5DUUA 3O1MA 1C4RA 1UX6A 1REFA 1ZZCA 1UQXA 2P3JA 4M00A 4BK4A 2BU9A 3U10A 1UO9A 1W6PA 1PZ9A 4PDWA 2WBKA 1H1MA 3POEA 5GJ6A 3B3QE 4XCAA 4XDQA 3VKMA 3ZM8A 1QJY2 5B4XA 1UMHA 2GU9A 1HXS2 4LBQA 5IVEA 3RDIA 1YIFA 2HWE1 5FUNA 2FDHA 4LOSA 3C7OA
chains in the Genus database with same CATH topology
4AEKA 3LGRA 4V1PA 2JECA 4QMAA 1VBE1 4XQ4A 1IS5A 1ZRRA 4N53A 4P9WA 4P5HA 3TWIA 3CJIC 1G9FA 4HSLA 1PNFA 4C91A 2E63A 5K8SA 1RUNA 3AJYA 4P9JA 3AXDA 3VBFC 4XZPA 4IEOA 1BYHA 1R1A1 3ENRA 3V0BA 3H7YA 4XIOA 1D4M3 2CYFA 2RS12 5K0UA 1AR71 2G4IA 2WQZC 5FMOL 3FZ3A 3T1MA 3BOWA 1PO12 3RYPA 4R9CA 2YGLA 4ITCA 3CU7A 1OA4A 1VP6A 4WM7B 5J96B 4Q8KA 2YZ4A 4A7ZA 4K8FA 3H3ZA 5ACA3 3V64A 3ES1A 2GC3A 1G9AA 1WMFA 3AMQA 4FPCA 4YVSC 4IEWA 3B9CA 4AI0A 4NHMA 1TE1B 4CDWA 4HN0A 2BFUS 2RJKA 4Q4W1 1QOOA 4LHKA 4X6QB 2ZKLA 4YZ2A 1ZZ8A 2ZACA 2WNVB 3GHNA 2QFEA 5JOZA 1YYNA 1PGL1 3AP5A 2QZ3A 4N7UA 1OLRA 3AP9A 3GF6A 3LA7A 4BMEA 2BGCA 2ZABA 4BHPA 5AC93 1C3HA 1YNAA 3PHMA 2JE9A 3ZXEA 4COZA 4E4SA 4R9DA 3ZYGA 3UK9A 5FQ0A 2B9UA 3RI9A 2LUWA 1VAMA 4YZ4A 4L92A 1PVC2 3IPVA 2ZCWA 4LTAA 4MXVA 1ZZ6A 3GBGA 1F5FA 5JOYA 4EWAA 2EXKA 2K9ZA 2ZOEB 1BKZA 1QJY3 1ENXA 1RJ7A 5LEJA 5C33A 1LODA 1HXS3 2ZMNA 2GMEA 4RQPA 4LHLA 1R081 4IEUA 1LHWA 1LOEA 4F83A 1B09A 2GH8A 2WWSA 3EJKA 4XFFA 4DMIA 4N9HA 3VBOB 1U5ZA 4PIYA 4TWTA 4E2SA 1NLRA 4LO6B 1LEDA 3IKWA 1O4ZA 4I30A 1QWRA 4PIXA 4HKWA 2HWE2 2Y0IA 2VPVA 1LU1A 1I6XA 3HAGA 3N7KA 2BBVA 1WUVA 1V6MA 1H1IA 2HJIA 1VBE2 5DUXA 3DPRB 5I0RA 5AVAA 1NA1B 5T5PA 3POWA 4LR4A 1WGPA 3WR0A 5IK5A 2VUJA 4HVRA 4LBMA 5HCAA 2W39A 1MEC3 3MLJA 1W0OA 4FCAA 5LRSA 2AH2A 1SQ4A 5D8AB 2IFWA 3B5LB 3ATGA 4DPNA 4AFBA 1R1A2 3WUCA 1FT9A 2D6LX 3AX4A 3WOGA 2ZX4A 4GALA 2VMGA 3IDEA 2WSUA 5T52A 4EWEA 4MV2A 1REDA 1AR72 1GICA 5EJ3A 4BPZA 1RUH3 1LULA 1ND3B 5BNNB 5J48A 2A5ZA 4M3CA 1HKDA 4Q1RA 3FLRA 4AHXA 3VHRA 1DHKB 2VVEA 1AJKA 4QM8A 3B94A 1WBFA 1FOD3 2BNMA 1KJLA 3UJQA 5ABJB 5I0SA 1VIWB 1ND2C 3DN7A 4U2AA 1CESA 2Y38A 3N35A 3SH5A 2P34A 2QKDA 1LHNA 1XNCA 4Q4W2 3OTFA 1SFYA 1ZYBA 5FREA 1TEIA 5HCBA 3ASIA 2HWD3 3H8UA 2E9QA 2WS91 1MQTC 2JKBA 4X8PA 1PGL2 2E7QA 5H9RA 3WDXA 2P17A 2DTWA 2AYHA 2WT2A 3ZSMA 3DF0A 4A2UA 3E6BA 4D7YA 1D2SA 2ZTNA 1KS5A 5JOWA 2IXIA 4Q4X1 2NMOA 4KNCA 4LE3A 1SLLA 5GZGA 3MF9A 4YVSA 2XWJB 2MHFA 3M3IA 1OSGA 1QDCA 4QGMA 4GXLA 1HW5A 4BYYA 1R082 2PTMA 2WT0A 2ZGOA 2PHXA 3ZXFA 1RVF3 2VUAA 1PK6C 1WCKA 1AYM1 1EP0A 1HX6A 1GZCA 3JD73 1Z0HA 4XYXA 2JICA 2BPA2 2WFF3 1VBB3 2A6XA 1W6NB 5I0UA 3AM2A 3ILNA 4LBKA 2VXRA 2PYTA 1F2NA 1PHMA 3N36A 1G8WA 2WINB 1PZ8A 4QT6A 4MX3A 3NJZA 3VZNA 3AYCA 3DKWA 4YGCA 4F8AA 1WW6A 2YGMA 5L36A 4Y1YA 1XQNA 3WP3A 1W6QB 1GV9A 4G9SB 1S0CA 2VOVA 5E16A 2DVGA 1DGWA 3BOPA 2WZR3 4DOUA 4UBGA 2PQQA 3ELNA 1VRH2 2XJVA 1QJU3 2GAUA 4ZXKA 2GSYA 4Z82A 4P9YA 4AHYA 2X53S 3VKLA 4H7MA 5GLUA 2D7FA 2JEMA 2ZGSA 5J98B 1C8M1 2NZ9A 2E7TA 2BUKA 3RMXA 4IV1C 5SV8A 1CQ9A 4C0BA 4CP0A 2DUOA 2ZGPA 3OCPA 1BEV3 3M3OA 3AFGA 2A6VA 4FQZA 2D98A 1LOGA 1VALA 2JE7A 4MYEA 4UW4A 4HPKB 3AXEA 1AXYA 5C6CA 1JHNA 1UU4A 4JQRA 4LUKA 4YVWA 4JC1A 1EV13 3SMHA 4XILA 3V65A 5BNOC 1DZTA 1UF2C 1RUJ1 3AKTA 3ES4A 4PBOA 4NPRA 2RMU1 5JPNB 4XTPA 3FBMA 1E57A 2R041 4AI8A 4AVAA 3THTA 4Y22B 2ZX1A 3GHMA 5KC5A 3ZPYA 4FTSA 2VULA 2WS92 2XVLA 2YUEA 3PMSA 1QF3A 1TMF1 4P14A 4CDXB 2Q1ZB 2FMDA 1AL0G 4K20A 1C28A 1K5MB 4YZ1A 4Y24A 2ZHMA 2F4PA 2ZJCA 3O14A 2ZAAA 3WDWA 1ND2A 4IEVA 1XNDA 2RE9A 3I54A 4Q4X2 5J3UA 2XJRA 1H4GA 2R6QA 3LCPA 1FPN1 2X5IC 1CAUB 4FTBA 5IK7A 2QDNA 4KBBA 1XYNA 2OZJA 4OHXA 1YFXA 4WVMA 4HETA 4HSJA 3AYAA 4Y4YA 1CONA 2UYAA 1B35B 1MQTA 4A3XA 2YXSA 1AYM2 3D5OA 2Q4SA 3IDBB 4OHVA 4FPYA 5C4WC 3VL8A 5A32A 4COVA 4R9AA 5DG1A 1GSLA 2RM23 4AVCA 2AREA 1OFNA 1F8VA 2VNRA 3NKGA 3VBSB 3THPA 5KBFA 1XE8A 1ZRFA 1WD3A 1YO8A 3MIHA 1CGPA 2DV9A 1VRH3 4DNYA 3J26N 4EWDA 3O0WA 4YM1A 4YM0A 1HV1A 1W6MB 4CEWC 2O0OA 1M06G 3OBRA 4MXWB 2UWAA 3KCXA 4CEYC 3KT7A 1PK6A 1ZBA3 1JYIA 3R4DB 1TQ5A 2R063 4AXOA 4WM8C 4O9EA 1VJ2A 3HN1A 5J7MA 1PO21 5K7PA 1EPWA 1CX4A 3PNAA 1SBDA 3GALA 4GIQA 1C8M2 1QXJA 1HV0A 3MGUA 3MYXA 2A6YA 3JB8A 1CAVB 1H8TB 2JG8C 3I2DA 5C9AC 1KFUL 3AZYA 2OUJA 5I93A 3B93A 1AVBA 1LR5A 3QACA 4QHBA 2CAUA 4M0HA 2EA7A 1WMDA 3GZTB 4B4QA 4FPKA 1RUJ2 2RMU2 4Z1VA 1IOAA 4KWLA 3RQ0A 3BPZA 2R042 3BALA 5JVVA 1GKBA 2IFRA 2A75A 5CU1A 5CFDC 3N3HA 4XF1A 3IT8A 2H0BA 2A3YA 3FUQA 4XHBA 4IV1A 4URTA 1S0BA 3PMEA 4JDNA 4FOQA 4CDQC 1TMF2 1T6GC 1VBC1 1XRUA 1R091 4GH4C 2CNAA 4S2HA 4YLZA 1EAH1 5I8SA 2VH9A 1JH5A 4M3CE 5BNQA 4OHWA 3LA3A 2ATFA 1YUDA 4I3PA 2EXIA 5BNOA 3KD4A 1HQLA 3UJOA 1H2NA 1FPN2 4QPIB 1CAWA 2K0GA 4Y1UA 5T3NA 2GNTA 3HMYA 2CY6A 1ONAA 1UMZA 2WL1A 2R0HA 2QZ2A 3SCGA 4Y26A 4XBLA 3X29B 3WP4A 2HWB1 4XHXA 1QJZA 5I8TA 2WZPP 3NO8A 4Q4Y1 4S2FA 3HQXA 1KDMA 3OY8B 2IXJA 2VG9A 4QD2A 4XJAA 1OI6A 4WV8A 1RC6A 2NYYA 3PVEA 1AR93 1XXNA 4AEJA 3OD4A 3KT1A 4NN0A 2O8OA 2ZGUA 2UY9A 1WLDA 4Q4V1 4IEQA 4XW3A 3AP4A 2YC0A 2H6BA 4QU2A 2B42B 1LESA 2PA7A 2VW2A 4PIZA 5JCTA 4N43C 2X5IA 1RMU3 3PVNA 2R0FA 1AL23 2DCTA 3ILFA 1BJQA 2PAEA 2SLIA 4XFGA 3I59B 3FLPA 3VBRC 2JG9B 1AR63 3I7DA 2OVUA 2Q0AA 3WQ0A 3MIDA 1IZ3A 3QCWA 2XLAA 3WV6A 4BOWA 1NG0A 2I45A 1DFQA 1U12A 3AP7A 1PO22 1WW5A 4R4XA 4LE4A 4BLJA 4FAHA 3WT3A 1NCRB 4HKLA 4JAAA 4MGYE 2TNFA 4FAGA 4LLFA 3H1WA 4XIKA 2VVFA 4N9IA 1O91A 3M8LA 4DB5A 4JGZA 3B69A 4CEWA 2WQ4A 5BNPB 2R1BA 4I0AA 5IK8A 1HRV1 2A70A 4I01A 4L99A 2DVAA 3FX3A 5DDJ1 4AQ6A 3VBUB 4CEYA 4MUVA 4B8EA 2XL9A 4RHV3 1RUE3 4AWDA 2UU8A 3LOBA 2XVKA 4AFDA 4WM8A 2XLGA 3DV8A 2CGOA 1MACA 3B01A 1D4VB 4QPGB 5J37A 2C0ZA 4QQ2A 4HFSA 1S0FA 1D0GA 4YFWA 3USUB 1RUC3 1Q43A 1QKQA 1OFSA 2V5YA 1VBC2 2Z42A 1R092 1WCDJ 2JG8A 3ZDSA 1EAH2 5C9AA 1WW4A 1XYOA 1AYN1 5C4WB 3KSCA 4FPLA 1O4TA 3PTYA 4EN9B 4YG3A 5BY5A 5EYXA 3TNPB 1UIKA 4YSFA 4JV4A 1QH7A 1RUD1 2WLPA 3B02A 2KXLA 1RUF3 5T55A 1FAYA 1MZ6A 1VBD3 4W6XA 4IXLA 4XMAA 5CFDA 4OLLA 4IV3C 2JXAA 2EXHA 2YY1A 3VDDB 4XETA 4H55A 1ZRCA 1QNYA 4UW6A 4RR3B 5JIUA 1UCXA 3E5UA 3MW4A 2GMPA 2XJTA 4CDQA 4Q0VA 2HWB2 2QVSB 2DVFA 2VY0A 2D6NA 3W58A 4GH4A 2R30A 1IGOA 4Q4Y2 1GQHA 2Q8OA 4XPVA 1Q3EA 2FBEA 3AKQA 3BIWE 3VBHC 4FPHA 5EFUA 2XBO1 1CN1A 1LGBA 5C8CC 3MIGA 1VAKA 5H9PA 3TYJA 1UZZA 4WM7A 1KS4A 2ZZJA 1LGCA 3NV1A 4Q4V2 2HYKA 4C0HA 1O3TA 4YM3A 3OJBA 3NW4A 5GLTA 1YCIA 1ULGA 2R071 5FLIA 1ZBE1 5IUQA 4Q8LA 4FP2A 3URFA 4H3WA 1HRI1 1QH6A 1X82A 5A33B 5KXBA 3T1LA 1IS3A 2RR12 4R8HA 1AR81 3O12A 5SV5A 2ZGRA 4XQDA 3SITA 4RA0A 3E6DA 4QM9A 4RS5C 3E5XA 3NKTA 1Q8SA 4X6RB 5T54A 1BBT3 1C1LA 5GLWA 4EJRA 2RS53 4AHZA 1O3QA 1W6PB 2CV6A 4PDWB 4PJYA 4I0WB 1H8VA 4LBJA 1ZZBA 1NXD1 4G4FA 4N43A 3APBA 4YG0A 4LBQB 1YI7A 2Z69A 3HT1A 4QGNA 1RL3A 1HRV2 5F6LB 3PVBB 1R1ZA 5HCFA 5DDJ2 3VBRA 2MEV3 3ZN4A 2XL7A 3SH4A 1KDKA 2XUMA 1AX1A 3VZOA 4N53B 1C57A 2LM3A 4ISRA 4XFCA 3TAYA 4HVOA 3QH6A 1UKGA 4COYA 5F6KA 3QLQA 3WG4A 3MW3A 1POV0 4OVEA 1DQ5A 3KB5A 1TME1 1TNFA 3ZSJA 4RSUA 3SISA 1PZ7A 3V0BB 4HMZA 1M4WA 2NLRA 2RJLA 3IBMA 1QNWA 4GB31 5K0UB 1SLTA 1W6OA 2A6WA 1V6JA 4YW3A 3VZMA 5L19A 4HN1A 1AYN2 3MLKA 3WINE 3AZZA 1LGNA 2LTNA 4DRRA 4DY3A 3MEPA 3OD0A 4RFT0 5AVPA 1MS3A 4M01A 1Q56A 4BH9A 4JTNA 1RUD2 3PVOA 2X8KA 4XJUA 3K51A 3ETQA 4YM2A 2EXJA 4Y20B 1JXNA 1V70A 1QOSA 4BMBA 1RITA 4R52A 4AVSA 1VBA1 1SLBA 2RS31 4INDA 2JJ6A 5F1RA 4B7EA 3ZXAC 4CDWB 1AX0A 2R16A 3MIFA 4FVVA 1H4HA 1OHFA 4W6YA 4A7YA 5BUVA 1NCQC 2GC2A 3Q9OA 1RINA 1LU2A 4DS0A 1F31A 1U5IA 1AF9A 1GNHA 1NXMA 1H2LA 1LCLA 3HT2A 3TN91 3C2UA 1LEMA 2IWGB 1QY4A 2XBO2 2WLQA 5CG9A 2B45X 3AMMA 3KCYA 2HWF1 5I0TA 4XOGA 3NWKA 2RS13 1ZRDA 2PHFA 1FNYA 1U5YA 2RR13 2Q1MA 4QQPA 1QQP1 1WBLA 3SH3A 4YW2A 4XFAA 5ABJA 1PO13 1NZCA 4YVWC 5DZFA 5FQ0B 1IKQA 3ZX7A 5L73A 2R072 4W65A 4AFAA 4L97A 2A3WA 4KL1A 1H9WA 5JSRA 3NV3A 1ZBE2 4IV3A 3WY6A 3WG3A 1KJRA 2RHPA 2ZGMA 3IPVB 2VQ0A 2A73B 3EBRA 4I2OA 1HRI2 1IHMA 5CFCB 1POV3 4RQPB 4JCKA 4XXPA 1L3JA 1Q8OA 5FLHA 3MFCA 4JRAA 1AR82 2V09A 1J3QA 2PHTA 2BTVC 3ZFGC 3S0MA 1UD1A 2A71A 4GWMA 3VBHA 4BE3A 4MSVA 1V6OA 2NMNA 4GQ7A 5C8CA 2QQPA 1VLNA 4IESA 4D7SA 2WA4A 1V9U1 1N1SA 1YJLA 2E6VA 4ATFA 4E2QA 5KXEA 2ZA9A 3WZ1A 1GBGA 2D93A 3ZFEC 2VQAA 4QXKA 4B7KA 2ZGNA 4D69A 1S0GA 1RJ8A 2DFBA 2ET1A 1AUYA 2WJSA 2QE3A 3GBFA 2NQYA 1S0DA 5EV7A 1QJX1 5FFOC 2XLFA 4MZUA 4TLFA 3D8CA 1J1LA 4GKXA 4SLIA 4B3NA 4LO7A 2NM1A 2ARBA 1PVC3 4F3JA 3R4SA 5JWPA 1YFUA 4UXAA 3MI8A 5B2GB 4RS5A 1GNZA 2TUNA 1DGLA 1TME2 4HL0A 3ZYRA 1MS5A 1NQJA 1RUI1 5DZGA 3D82A 3BCWA 4ZU7A 4GMP1 4GB32 2EALA 3ZN6A 2QNKA 3UKTA 2HWC1 1G7YA 1I1EA 3ZIWA 4M3CB 2ILMA 5CA6A 3RZZA 1ZA4A 4YW1A 3L9JT 5JR7B 3RYRA 5IT6A 2HWE3 1PVXA 2HEWF 4CZSA 2GC1A 5GKAC 3IIAA 3ZN5A 4BM8A 5CNAA 1NLSA 1KFXL 3CJIB 1V6KA 5JSPA 1VBE3 2ARXA 1JUIA 4EN8B 5CADA 3V0AA 2EVXA 2ZGLA 3ZSLA 2XHKA 3VBFB 1VBA2 2RS32 2XVGA 3VL9A 1IS6A 1WLTA 1OKQA 4IERA 5E1RA 1H2KA 4P9GA 4WBBA 2GN7A 4CDUC 3MIEA 3MF6A 4Z2WA 5DUVA 1ASJ1 1R1A3 3TN92 3I4IA 2P3IA 3NSTA 4OI4A 3WDVA 2HWF2 1QXPA 1PNGA 1AR73 1QQP2 1NY71 1SLCA 1RHI1 2GZWA 2GDFA 4XJZA 3V56A 1RUOA 1FMD1 4LO4B 5KHGA 5E88A 4AVTA 3ZYPA 3R0RA 4YVSB 4C1XA 5JLVA 1PIV1 3KQRA 5KHIA 1Y9QA 1UPIA 1QXRA 3GBWA 1NCQA 1OPMA 1CJDA 1YHFA 4WZFA 2H0VA 4K6BA 2XKOA 4Q4W3 2PAKA 4ES8A 4LLOA 3FHIB 1WMEA 1V9U2 2GN3A 3J8F1 1Z7S1 1S2KA 2BNOA 1LOAA 3AFKA 1F5JA 4XFHA 2WNUC 2D3SA 1OOPC 4B4RA 3NAPC 4JGYC 1QJX2 2DU0A 3LSDA 1J1TA 1LHUA 1N1TA 3MDPA 4YYOA 5BXXA 1RUG1 3RJ2X 4PQ9A 3AKSA 4NO4A 4UW3A 2ZPXA 4XBQA 5DUWA 2EF6A 3SLIA 3JBG1 3ZFGA 4ISQA 3POYA 3RYKA 1R083 1FV2A 1RUI2 4LBNA 1DF0A 3FC0A 3ZMNA 4B29A 2PLV1 3NVCA 2ETEA 5L7OC 4OI2A 3ZFEA 4BCUA 4YW5A 3WQ1A 2XG3A 3WDUA 5JDBA 1HLCA 2DU1A 2PHLA 4MGKE 5FO7B 3W9AA 2HWC2 1HDKA 1IKPA 4PCRA 4N7IA 4OHYA 2OA2A 2ZHKA 1IS4A 1KITA 3M70A 2XJSA 1N1VA 2H6CA 4K3UA 2D5HA 1DQ6A 4KGGA 4YVWB 1WCSA 1QHDA 1BQPA 4YARA 4HANA 1GANA 3ZFFC 2CGNA 5JZGC 1AJOA 4KU7A 1LHOA 2IXCA 1MS9A 1LECA 4AW7A 1W2UA 5HI0A 1NYWA 5HXVA 3N4MA 1URXA 4IETA 4QPYA 4XXAA 1ASJ2 1COV1 1RGSA 4JGZC 3ZYIB 1D0HA 3HD8B 1CPMA 2YV8A 3CEWA 4MVTA 4XBNA 2C1FA 1DBNA 2P3KA 1CPNA 4AEDC 3GYDA 3ZXKA 1NY72 1RHI2 4Z07A 1UN1A 3QH7A 1FMD2 2BNNA 1DIWA 1ND2B 1J58A 4Z8BA 4TZDA 1A6CA 1UU6A 1YLLA 4ASMB 2BW8A 2CWMA 1PIV2 1LRHA 3LSEA 5FO9B 2G9FA 4LT5A 4BIFA 4CDUA 1A8MA 4WVMB 5EZWA 3AK0A 1GYKA 1X7NA 3WDYA 4UW5A 1MQTB 1UL9A 1XNBA 2SBAA 1ZNPA 4P9IA 4XFBA 2BVVA 2Y26A 2E53A 1ZZ7A 3VZLA 4AQ2A 2GC0A 3TRSB 4NHKA 5A32B 4META 2D6OX 3A4UA 2ES3A 2WS93 1QGLA 3J8F2 1Z7S2 4J1XA 1OQ1A 4AG4A 3AYEA 5D1IA 5FDBA 2W0XA 5AFEA 1N47A 2OW4A 1XNKA 1GZWA 4NOTA 3AZXA 3KMHA 1WLCA 1D4M1 4AI3A 3JU9A 5HBAA 1OA3A 5EWSA 1UKRA 4DQAA 2GH2A 3OGJA 2PHUA 4Q4X3 3E97A 3LKJA