5EZWA

Thiosulfate bound rat cysteine dioxygenase y157h variant
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
187
structure length
187
Chain Sequence
TELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLHSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cysteine dioxygenase type 1
publication title Thiosulfate bound rat cysteine dioxygenase Y157H variant
rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 55
structure length 187
sequence length 187
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2015-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5ezwA00
3C3VA 5EZWA 3GBFA 4QM9A 5I93A 4I09A 4IERA 5FPZA 2Y0OA 1ZZ6A 1RL3A 2XHKA 3H1MA 3FWEA 2K9ZA 5BY5A 2P17A 2XL7A 4AXOA 5J48A 4AVAA 2PHDA 4UBGA 1O7FA 4Q0SA 3LZZA 3FE5A 5CADA 3RPQA 4XEZA 3I59A 4KWKA 3USSA 1OI6A 5KHIA 1O3QA 5F1RA 1ZZCA 1RC6A 2XLGA 5I0UA 3H3ZA 2XLFA 4BHPA 4KU8A 4IEZA 2CAUA 4JV4A 4E2QA 4FAHA 3OCPA 3I54A 1Y9QA 3RDIA 2O8QA 4LTAA 1UD1A 4XFFA 2OZ6A 1YFUA 1Y3TA 3IIAA 3WW4A 1CAUB 3UKVA 3EQEA 1RTVA 4IETA 5LEJA 4QMAA 4EWAA 4YSFA 3CF6E 5FLJA 1CAXB 2KXLA 4TLFA 4PIZA 1UCXA 1X82A 1L3JA 3D0JA 4IEXA 3M3IA 1I5ZA 5FPXA 2F4PA 4META 4F7ZA 1RGSA 3ETQA 4JTNA 2QDRA 1RUNA 3UKNA 4HN0A 4UBHA 4XF4A 1UW8A 4X6RB 2BEOA 1O3TA 2IXKA 4R8HA 1NYWA 5FLHA 1V70A 2E9QA 4XFBA 4AVBA 3NW4A 4HSLA 4KWLA 4L2NA 1ZZBA 2IXCA 3NJZA 1ZRDA 4Q29A 2ATFA 1EP0A 1X7NA 2QCSB 5JSRA 4OLLA 5JR7B 2DCTA 3E5UA 3E5QA 4H7LA 4YNIA 1ZRRA 4BYYA 3B02A 4HVQA 4N9IA 3EBRA 2D40A 4WVZA 3HT2A 3DV8A 1J3PA 1HW5A 2BYVE 3H9AA 4FAGA 3ES1A 4KL1A 1DGRA 4CYDA 2WFPA 4QX5A 3BB6A 3RZZA 3I59B 3ACLA 1YFYA 4LA3A 3FX3A 3E5XA 2Z2SB 4LULA 2O1QA 3VHRA 3D82A 1QXRA 1SFNA 1OD5A 4HSJA 4MZUA 4HZFA 2ZCWA 3SCFA 4IEYA 2FMYA 5KHKA 1Q5OA 3S7EA 2EA7A 4HBNA 2IXLA 4E2GA 3MZHA 1ZZ9A 2B8MA 3JZVA 3R6SA 4YARA 3N4MA 2ET7A 5I8TA 4LEJA 2BNMA 2UYAA 1QXJA 2GC0A 3NSTA 3CO2A 3HT1A 1YWKA 4I0BA 3U0ZA 4E2SA 2XKOA 4WZCA 3BU7A 3M70A 4I3PA 4MH0E 5JSOA 1XE7A 3CLPA 4I0AA 4F8AA 1LKNA 4ORFA 3D0SA 3ROUA 3NL1A 4IESA 3KCCA 2H0VA 4XFGA 3SHRA 2PYTA 4YYOA 3WW2A 5BPXA 1ZRCA 2B9UA 1GQHA 1J58A 4PJYA 5FLIA 2Q30A 1U12A 1UPIA 1IPJA 2GH2A 2EAAA 1LB2A 1GQGA 5JAXA 5FQ0B 2GC2A 3FHIB 2GZWA 1SEFA 1ZNPA 3OF1A 4EROA 4I01A 3TNPB 1H1MA 3MYXA 3BPZA 4EV0A 1CX4A 2GU9A 4X6QB 5E16A 3TNQA 3EHKA 2K0GA 4AQ2A 3CJXA 5C8WA 2QNKA 5E1RA 2ET1A 4JVAA 5JCTA 4MGYE 4B29A 4FT8A 4ZU4A 3WW3A 3CEWA 4N9HA 4BIFA 5JSPA 3EJKA 2IXHA 5FCCA 3H7JA 1DZRA 1OMIA 1ZRFA 2CGPA 1X8EA 3OTFA 5LEKA 1EY2A 1YUDA 1XRUA 4XETA 5BV6A 3QOPA 1DZTA 4MUVA 4IEPA 4Q0PA 1RUOA 2VECA 2CV6A 2PHLA 5BXXA 5KHGA 5I0SA 4YRDA 1VJ2A 2Q0AA 4XF0A 5CU1A 1PM7A 4J1WA 3PLQA 4ONUA 2QVSB 4MGIE 4PIXA 5J7MA 1OFNA 3KSCA 2B5HA 4K8FA 5FQ0A 2IC1A 3GYDA 5I0TA 1EYBA 3WW1A 4Q0UA 4UXAA 2MHFA 2MNGA 2PAKA 5I0RA 4QGMA 1CAVA 4EWDA 3KMHA 4IEOA 1WLTA 1YHFA 4XF1A 3H3UA 5BUVA 3LA7A 3MDPA 3DL3A 4QXKA 2D5HA 3NVCA 4RD7A 1YFWA 2UYBA 1CAWA 2GAUA 4IEUA 5J3UA 1O5LA 1IPKA 1QY4A 4J1XA 2OYZA 1JUHA 4LLOA 3S7IA 3IBMA 3ST7A 4A2UA 4KU7A 4XFHA 5HI0A 2UY8A 3I7DA 5LRSA 2HJIA 2MPFA 3U10A 1ZZ7A 2IXIA 3SCGA 4O9EA 2BNNA 2PAMA 4WBBA 5CVRA 1ZVFA 1FT9A 2UY9A 1ZZ8A 1I6XA 2VPVA 3SMHA 1CGPA 3RYKA 4R52A 3LOIA 3SXWA 4D7SA 3DKWA 4HLTA 4D7TA 3MPBA 4HVOA 5LRRA 4AVCA 4BH9A 3IDBB 5D1IA 3PVBB 2D5FA 1WGPA 2PFWA 2XLAA 4Q0VA 5I91A 3LWCA 4MV2A 3LA2A 1NZCA 2BGCA 4L11A 1PMIA 1J3RA 1O4TA 3H7YA 3PNAA 3EO6A 1YFXA 4Q0QA 1UIJA 3LAGA 3QACA 4IEQA 3H1YA 5KHJA 4XF3A 2BNOA 3UKTA 1O5UA 5EFUA 1Q3EA 3IDCB 5K8SA 4MX3A 1LRHA 3L2HA 3FZ3A 1CAVB 3S0MA 1VP6A 2PAEA 2QJVA 4Z82A 4ZU5A 1O3SA 2PA7A 3BALA 3U11A 2D93A 4GULA 5I8YA 3ELNA 3NKTA 4I02A 2GC1A 3H50A 3OD0A 4XFAA 3KGZA 1NE6A 2EVXA 2I45A 4AQ6A 3FJSA 3G7DA 2IXJA 2OPKA 5KBFA 2HKXA 2V09A 4DINB 4P9GA 4QM8A 1CAWB 1LR5A 3CL1A 2ZKLA 3HIFA 4OFGA 1FXZA 4Z07A 1UIKA 4HVRA 3DN7A 4XFCA 1O3RA 1Q43A 4QGLA 3HQXA 2Q4SA 4MGKE 1NE4A 1ZX5A 4LA2A 4XF9A 2ETEA 3RNSA 4LUKA 1H1IA 1TQ5A 4I2OA 1NXMA 3SCHA 2CAVA 2PQQA 4KWJA 4MGZE 1J1LA 3IWZA 5AVPA 5I8SA 4XFIA 1SQ4A 1DGWA 3E6CC 3E97A 1VR3A 4EWEA 4ZU7A 3O14A 3E6DA 4QGNA 2H6CA 3ZDSA 2Q1ZB 4IEVA 2H6BA 5FDBA 4PIYA 2WC2A 2Z69A 4JTOA 2PTMA 4O9GA 1X8MA 3OGJA 1CAUA 2FQPA 1G6NA 1J59A 2N7GA 4LUMA 5C6CA 4HMZA 4IEWA 1ZREA 4HN1A 2VQAA 1CAXA 3RYRA 2OZJA 3RYPA 1YLLA 3ES4A 4FBFA 1WA4A 1EPZA 1XE8A 3E6BA 5KHHA 3BCWA 3LA3A 2XL9A 3H1WA 4NVPA 3FFQA 2OA2A 1J3QA 2XKPA 2GC3A 1FI2A 1QWRA 5T3NA 2XGXA 3KGLA 3H8UA 2C0ZA
chains in the Genus database with same CATH superfamily
3TOJA 3C3VA 1WCKA 3EXUA 4AGVA 3ZIXA 4NN0A 1C3HA 1ODNA 2WNUC 5BNPB 4YM2A 5FPZA 4BJ0A 2ZGTA 2YGMA 3RZLA 1VBE3 1BHGA 3MIHA 1ZZ6A 4WM8A 3VD4A 3MLLA 3FWEA 2CYFA 3N7LA 5HCBA 1DQ1A 1OPOA 2P17A 3O1RA 1W6MB 4AVAA 2PHDA 3B00A 5J48A 5JOYA 3OD4A 2ILMA 4MHRA 1EUUA 2HWD1 3FE5A 2W1WA 1BEV2 2VZTA 3C7FA 5LBCA 2ZZQA 4XEZA 1UZ0A 4LO4B 1S4CA 4QQPA 2X8KA 2ZHNA 4GD4A 2ENRA 3OEBA 1QJU2 4KWKA 2OS2A 4MG2A 4NIHA 4FP3A 2WL1A 3B01A 1W99A 4A41A 5FBZA 1OI6A 2UURA 1QQP1 1KXGA 1ZZCA 1AHSA 2XUMA 5CYYA 1D7PM 1GP6A 5FYYA 1UKRA 1AR93 2XLGA 4Y1YA 2VUCA 5C4WA 1TEIA 2WRAA 3HOBA 2CAUA 1MVEA 2WFF3 4Y22B 3GCWA 4E2QA 5JOZA 2D44A 3CJIA 2VZ1A 4HL0A 1W28A 1VBB2 1KQRA 3SNMA 4AL9A 4XQWA 3SISA 3OY8B 4OI4A 3FUQA 5L7OA 1WBLA 3K75B 1JOBA 1L7QA 4RGKA 3GZAA 2G1MA 4QDRA 4PDWC 5JZGB 2Y6LA 3DUIA 5C9AB 2VJXA 1C28A 1UO9A 1YFUA 2VCMA 5FZOA 4K6BA 2ZA9A 1BYHA 5FYMA 3MFCA 1N47A 3POEA 3V64A 1B35B 3SITA 3EQEA 4OVEA 4KBZA 4EZHA 2QQVA 1IKPA 3AP7A 3IMNA 1KJLA 4BLJA 1RUE3 5EHDA 1RB8G 1CAXB 5FP9A 1RHI1 4FFFA 1G9CA 1UCXA 2VAUA 3PTRB 1X82A 2DVBA 1JBCA 4AZZA 4IDZA 5FPXA 2F4PA 5FWJA 5F5IA 4GH4B 3RRDA 2KR2A 3BPSA 4UW5A 4F7ZA 1RGSA 1VBC3 4UI9L 4KI5M 1RUD2 1AYM1 3UKNA 1AL0G 2A6ZA 2BEOA 2ZKNA 1WMEA 1IOAA 4Y33A 4CP9B 2GALA 2ID4A 2P6CA 4BQ2A 1B09A 3LKJA 4YW5A 1JMUB 1NAEA 2G4IA 3ASIA 4UW3A 3KT4A 5ANNA 1IQAA 3I3BA 2WLPA 4XUPA 3WR0A 4AVBA 4BPZA 1UX7A 3BIEA 5LK5A 2OIIA 4QPGA 4L2NA 1FV2A 4XUQA 4V1PA 4GXLA 2VZOA 1W9SA 1ZRDA 1DBNA 4FPEA 3VBRB 3EYPA 1W6PB 5CNAA 2DURA 2XBO1 2X09A 3V0AA 3E5UA 3E5QA 5A7OA 1QXPA 4XQ4A 3WINE 5FZ0A 1RMU2 4LBKA 1OFSA 1K3IA 1T2XA 4Q26A 1PO22 5CB7A 2RG4A 3ZMNA 3ZX7A 4ZHNA 3AVRA 1TMF3 3PHMA 3VN4A 1PZ9A 2PXJA 1J3PA 1OLRA 3DV8A 3O12A 4SBVA 1HW5A 2ZOEB 2Q8EA 2QZ3A 3IAPA 1A6CA 4QX5A 2C9KA 1VBE1 3NAPC 1W8OA 2YBPA 1YFYA 1REEA 2RDRA 3GCXA 3VLBB 4KG8A 4KQ7A 2D6OX 2Z2SB 1JZ8A 3BU0A 2BJSA 5A3PA 5DG1A 2W0XA 4FOQA 4AE2A 1TME3 2ZX2A 4NHKA 2W95A 1RINA 1PK6A 1XOYA 4Y1ZA 1T6GC 3KD4A 4NIIA 4H3WA 3FLPA 1OURA 5CA6A 3NWKA 2RS33 3MF9A 1PGL1 4CXWA 1IGOA 4YVSC 4B1LA 5FY0A 1DYOA 2Y8KA 4HZFA 1VRBA 4CZSA 1KS5A 1RHI2 4CTEA 5JXJA 3PJQA 5GZFA 5C70A 2XJTA 1LODA 4Y3OA 5IVBA 1ST8A 4FQ4A 3LFMA 4LLFA 4UYBA 3AX4A 4M01A 1H0BA 1JYCA 1PX3A 3FUOA 1AJOA 1RUH3 1XPWA 2IXLA 5EQUA 3UGFA 4E2GA 3MZHA 1ZZ9A 1SLCA 2B8MA 2W52A 2W47A 3JZVA 1C8M3 3OPWA 2QQUA 5FZIA 1AYM2 3USUA 2JB4A 4YPJA 2TBVA 2ET7A 5I8TA 3O0WA 1GYKA 2UYAA 3K48A 2VCAA 3CO2A 5IFPA 2JJ6A 1DGWX 4I0BA 3WNLA 5LWBA 1HRI3 1P8JA 5KXDA 3BI3A 4CP1A 2QQWA 4I3PA 4NUBA 4XDOA 3ZFGB 4L99A 1Y9GA 1SLTA 1NCRC 1XE7A 3VBSC 3CLPA 3KHBA 4QB1A 3I49A 2WO1A 1V6OA 4ORFA 3D0SA 4AEDA 1M06G 1BVP1 1RUE1 5DG2A 3KM5A 3ROUA 3NL1A 4EJRA 3C8XA 3KCCA 4DMIA 2RMU3 5T50A 2H0VA 1HJFA 3IT8A 3U37A 3SHRA 2PYTA 4YW7A 5FKBA 2DTYA 4GWNA 4ZZ8A 5IVJA 3AL5A 2GH8A 4FOYA 3N9QA 5BPXA 3VBHA 4MGSA 1ZRCA 2BBVA 4Y5Z0 1FMD2 2B9UA 1J58A 1VBC1 2IFRA 3JBG3 3K46A 1ND3A 4OULA 4PJYA 5FLIA 5LA0A 1KDMA 3T0BA 1DQ4A 5J1XA 1UPIA 2GH2A 5D8AA 5DN2A 2EAAA 2WNVC 1LB2A 4M3CA 2JDPA 5FQ0B 4PCRA 5BNOC 5HBAA 5F2SA 2GZWA 5L9VA 4BXFA 4I01A 3TNPB 2OQ7A 3BODA 1H1MA 5AFEA 2WINB 1MQTC 3LPFA 3RMYA 3MYXA 3W58A 4XDQA 4B7EA 5C3OA 4Q4V2 1O4YA 3W9AA 4X6QB 3A22A 1ULDA 4CUAA 3TNQA 2K0GA 3WDYA 3CJXA 1LESA 4DOUA 2W94A 4ARYA 5JCTA 3AL6A 2FCUA 4XAEA 4B29A 2P3JA 4CCNA 4ES9A 2WBKA 4EQVA 4CDXC 5IVCA 4ZU4A 3AMPA 1TMF1 2JENA 2DFCA 2XUEA 3CEWA 2HWF3 3OEAA 1BXHA 4LITA 1HXS2 5K0UB 2VUJA 4XC9A 2EXKA 1N3PA 2VUDA 1UY1A 2CGPA 2F6BA 3AZZA 3LF7A 3OTFA 1UMIA 1ULCA 2ZHLA 3AKPA 5A7PA 4XETA 1W6NB 4E4HA 3QOPA 3LQCA 1QJX3 1WMDA 2QDNA 4IEPA 4Q0PA 2PELA 5BXXA 1IS5A 5KHGA 2XB6C 1A78A 1NCQB 3M3CA 4ZXEA 2WS92 5CFDC 3PUHA 1TME1 4LBQD 1AL21 2Q0AA 5FZ4A 5F8PA 3VBFA 4RFT0 2QVSB 5H9RA 2Q1MA 1POQA 4FI9A 1OFNA 2FDIA 2QBXA 3IKWA 2JD4A 4KMQA 1AR73 4Q27A 3IAQA 3MF6A 5I0TA 3ZPYA 4DY5A 1LGCA 4AK3A 1GUIA 3JD72 4P5HA 4OUMA 2R041 3FFZA 3BTXA 4GZ9A 5IVEA 3WG1A 4IEOA 4LBOA 3LCPA 1RUH1 3ZFEC 2ZAHA 3MHZA 1A34A 2ZGOA 4EN9B 3ABZA 3HD8B 3BOWA 1WD3A 2B46X 3I2JA 3LA7A 3DL3A 2ZABA 2VXJA 3VD5A 3NVCA 5DAVA 1J83A 3P3NA 5FIXA 2WAOA 2Y64A 2WAAA 4N53B 4HONA 1H30A 1EUTA 2ZMKA 3ZOIA 1HX6A 1W2NA 2D97A 4Z2AA 4E4ZA 3OBZA 3ZR6A 1ASJ3 1JYTA 1JUIA 1D4M1 2OYZA 4AFDA 1DQ0A 3GZTB 2MEV3 1FOD2 2RR13 2YMZA 4JQTA 2OKXA 3ST7A 5A3UA 1XU1A 2V72A 2VVEA 3N9MA 2A6WA 3IMMA 5A7WA 5DZFA 5JOXA 4ASKA 3IIIA 5JMCA 4FPLA 4XFHA 2UY8A 4COVA 5HI0A 2RMU1 1GNYA 3U4XA 4BISA 1UOGA 2GSYA 2MPFA 4JAAA 4Q5OA 5BNNC 2BNNA 3KQ4B 2BP6A 2ZEZA 3K51A 5FXZA 1N1TA 3LB9A 3JBG1 1ZVFA 3GNEA 5LASA 1VRH1 2AACA 4M3CE 2F4LA 2JICA 4FPCA 1PHMA 5DAPA 5LY2A 4HT1T 5CFCB 5CEHA 1G9FA 1OA3A 3WG2A 4RFRB 4AI9A 4R52A 1RUC2 4HKWA 3B93A 4LHKA 5GJ6A 2B42B 2WNUB 3DKWA 3PUAA 4CU6A 4CA9A 2XQRA 1SLAA 3N7MA 3AFGA 4BH9A 4NHMA 4LBLA 3IDBB 5FZ3A 3RJ2X 3PVBB 1QMJA 2C24A 2ERFA 4D3WA 1S0IA 1WGPA 2PFWA 4Q0VA 4XZUG 2R071 1V6KA 3LWCA 2JG9B 3LA2A 3U1XA 1QJFA 4GB33 1J1TA 5A6YA 3Q8AA 1CZSA 4Q4X3 1KGYA 4BIOA 2HWF1 3H7YA 5A80A 1PIV1 2FCVA 2P37A 3TRSB 3ZXDA 1LAJA 5FTTC 4P9JA 1YCIA 4QHBA 4KH9A 1ZYBA 3ZYFA 3LAGA 1MS5A 1OPMA 4IEQA 2GP3A 3OUIA 3H1YA 5GLTA 5F7UA 2XJUA 2NLRA 3L9JT 4Q4Y2 2EXIA 4B7KA 4NPMA 2ZGSA 4P08A 2BGPA 2OQ6A 2RVAA 1LCLA 1QJY3 2O0OA 4LO7A 1LRHA 2ORXA 2VL4A 3ZXFA 1U0AA 5EJ3A 4DUXA 3FZ3A 3S0MA 2PAEA 4AG4A 4ZU5A 1WW6A 5FZHA 3U11A 1Z7S1 2X5IA 3LFIA 3DF0A 2GC1A 3C2UA 3H50A 3LEGA 1H9PA 1YEWA 3KCXA 4HOOA 4YG3A 5FJKA 2EVXA 5JMOA 4IV1B 4AQ6A 5JXGA 3G7DA 2IXJA 2R49A 4JRLA 3HWJA 2JG8C 1YJLA 3KF3A 5CKQA 1R083 3ZYGA 4AFAA 1LR5A 1JHNA 4HK8A 4PI2A 3CL1A 3RI9A 2YFZA 3R4UA 4OFGA 1FXZA 2VW2A 1WZXA 2QQNA 2XJVA 4DFSA 1W6MA 3VBOC 1HRV2 3G6JB 3DN7A 4XFCA 3MW2A 1WWYA 1YC61 4OHYA 2YC0A 5JI9A 5EIYB 1Q43A 3RZJA 4QGLA 1DQ6A 1HB3A 3HQXA 4Y20B 3VDCA 2QQOA 2VZUA 3DPRC 2YXSA 1S2KA 1JZ5A 3T3YA 2VBDA 2RM23 1NY72 2D6MA 1POV0 4XF9A 1ZRIA 2ETEA 4QHOA 5LB6A 3RNSA 2R0FA 4XPVA 5FY8A 3NV1A 4OI0A 1DIWA 2PHTA 3SCHA 1ASJ1 2CAVA 3LDRA 4DXZA 2PQQA 5SV8A 2DU0A 2QTWB 4ET7A 3ALQA 2DVFA 3WG4A 4AOCA 1PO13 1MVQA 5AVPA 1SQ4A 1RVF3 1MS1A 2WZPP 3PUIA 3E6CC 5A3MA 1GNZA 4K40A 4ARXA 2R061 3N36A 1UZYA 2H6CA 3Q8BA 3VDDB 5IK5A 2Q1ZB 4OCTA 2H6BA 4BM8A 5FDBA 5JZGA 1VLNA 1NA1C 3M3EA 1MZEA 5C9AA 5JUVA 4RGAA 2Z69A 4WM7B 1SPPB 4YG6A 3U14A 1O8PA 4GMP3 5IVVA 1UU4A 2ZGUA 4O61A 4UT5A 1AVBA 1V6MA 2BFUL 1RUG3 3QBQA 3VD3A 3ILFA 1GR3A 1OLQA 1DLLA 4N7UA 4HN1A 4KWUA 1OC1A 2VULA 3C7OA 4NE9A 5FYZA 3WXPA 5A32A 1CAXA 2EXHA 3NAPB 1YQ2A 2OZJA 3RYRA 4EE2A 4QPYA 4JKKA 3RYPA 3ES4A 2ZGNA 4Q8KA 1C5HA 1EPZA 1XE8A 3VHNA 3EMRA 2BGOA 1OKQA 3L2YA 4GH4A 4Z8BA 4FOWA 3KQRA 2WN2A 1SBDA 3FFQA 1QH7A 3THDA 2Q1FA 3NO8A 4GB31 4PF5A 2W68A 1J3QA 2GC3A 4YGCA 3PVOA 4RQPC 2Y34A 1LOFC 4Q4X1 4CP9A 2VMGA 3N9NA 1K5JA 2K2SA 4YVSB 1JZ3A 3MIDA 2FHRA 5F6LB 2LM3A 3KGLA 3GJBA 4XCAA 1IG0A 3H8UA 4RS5A 4QPWA 2W1UA 3HQUA 4XBQA 2WIIB 5EZWA 4QM9A 2V73A 1VBB3 3AK0A 2C6SA 1BMV1 2RS51 2Y0OA 4UW4A 3VBRA 1K5MA 3VZOA 5FO9B 1SDDB 3ZR5A 4MXWB 3TYJA 2XHKA 2HWC2 1ZBA1 3CDZB 5LATA 1GWKA 2BERA 2XVLA 2DUQA 5KXCA 2VGDA 4FPFA 4PF1A 3MI8A 1O91A 2W1QA 2YDEA 1LOCA 3WV6A 2WYFA 3PVNA 3RPQA 1A3KA 1NQJA 3TAYA 2XJSA 4S2FA 2ZX0A 1F31A 3D6EA 1EAH1 4QXBA 1GWMA 5A33A 5DAQA 3UV9A 3J7HA 2Z5WA 2B4KA 1NCRB 4IGPA 3USSA 1H2LA 4YG0A 1LNSA 4ZKTB 4CDWC 2A70A 5F1RA 1AR82 1DQ5A 1MZ6A 2HEYF 2W46A 3CNAA 1KITA 1IHMA 2YBKA 3H3ZA 4WZFA 1CESA 1ULOA 4BQ4A 3AZVA 1H2KA 1PVC2 1H8VA 5FZCA 4QU2A 4RN5A 4DUWA 3ZYHA 4FAHA 1Q8PA 2RM21 5CKNA 2V4AA 3RDIA 4K7JA 1GZWB 1GZTA 2O8QA 3HR9A 4AHXA 3WT3A 5F6KA 2R6QA 1LHNA 2WNVB 4XFFA 2OZ6A 4G9SB 1F8VA 1Y3TA 4WVMB 4CCEA 5BNOB 2Z4FA 3NNMA 4Q1PA 1EPWA 3WW4A 1CAUB 1LU2A 1VALA 5IUQA 4CU8A 3ZSMA 5M0TA 2E7QA 1MQTB 3WF3A 4FVVA 3JQWA 4CDQB 4QMAA 4XHBA 1SLLA 5FP7A 4YSFA 4NIGA 2RS12 5FWEA 3CF6E 4XJWA 5FLJA 2KXLA 1ND2A 4RGGA 4YW4A 2QKDA 1OQDA 1ZA4A 2BBAA 4XHXA 3D0JA 1L3JA 4IEXA 4A3ZA 4C1WA 3M3IA 1I5ZA 1LOAA 3IDEA 5LW9A 4CDXB 5GALA 4LT5A 1AYN2 2XWJB 2YHJA 1S0JA 3DECA 4A7YA 3RZGA 1BBT2 3ZFGA 1BMV2 4A6SA 3ATGA 1VB2A 1RUNA 3I2IA 3H3LA 4HN0A 4XF4A 1UW8A 4X6RB 5FYTA 2XWBB 4LIUA 5FZKA 2P3YA 5FZLA 1W0NA 1NYWA 1BEV1 2YU1A 4YW2A 1V9U2 3UNPA 2EIDA 2ZTNA 5FK7A 4TN7A 2GNBA 1PZ7A 1GICA 2D98A 3B9IA 1FYUA 1GP4A 4HSLA 1QJU1 2VMDA 4CUBA 4GAZA 5IK8A 1IS4A 1LENA 1EAH2 1Q8VA 4FTBA 3UJQA 2JB8A 2AGSA 1RHI3 4QKBA 3C7HA 1JYVA 4FP2A 1DZQA 4KBBA 4LIVA 5JR7B 4COUA 4URTA 2JKXA 3I3DA 4C0HA 1HKDA 2VZQA 2WO2A 4WM8C 3GBGA 3JUUA 3MPPG 4HKOA 4E8DA 3EBRA 1H4GA 2D40A 5J09A 3THPA 2X29A 3PJYA 4MXVA 1L7LA 1AYM3 1UU5A 5EV7A 1R092 1VBB1 1F9KA 2JDNA 3OGGA 5F3GA 2I2SA 4CYDA 1BZWA 3RZZA 4XBNA 3VZMA 4OUEA 3VL9A 2LW8A 2VTXJ 1WUVA 3WF0A 3GJAA 3ZXGA 3AZXA 4HG6B 3T2OA 4LULA 4PBOA 1AXZA 4JDOA 1SFNA 2J22A 4CP2A 5K0UA 2RDNA 2XBO3 3BIWE 4HSJA 4QX0A 1UX6A 4DXSA 4C91A 1LEDA 5CBLA 3CJIC 1W6NA 3AP4A 1LJ7A 2ZCWA 4IEYA 3SCFA 5LBEA 5KHKA 4OYUA 5L7OC 3FL7A 3QLQA 3SH5A 2OX0A 3S7EA 2EA7A 1NCQA 3IN9A 1SG3A 2JE8A 5AC92 4JDNA 4JKMA 3MV11 1RUD1 5EJZB 5A1LA 3ETPA 1W39A 3W59A 3INAA 4Y1UA 5BNNB 4NOTA 3ZN5A 4YARA 2YFUA 1LHOA 3ZLIA 3N4MA 4IQPA 4N7IA 2BNMA 4FOVA 4BQ3A 5F5CA 5L36A 1LOBA 2PLV2 4ISRA 3ZVXA 2JDKA 4Y1XA 4ZY9A 4Q4V3 4WZCA 4MADA 4Y4RA 4MYEA 4LK6A 3BU7A 2QQPA 2Y0IA 2TEPA 3H42B 2X10A 4MH0E 5JSOA 1RMU1 3O7OA 1PZ8A 2UWBA 1LKNA 1PO21 1STMA 1OD3A 2VQTA 3SH4A 4IGQA 1A8DA 2Q5TA 4R9CA 1D0HA 3CIHA 5FZMA 3JQXA 2O8OA 1X9TA 2Y60A 3LPGA 2OPWA 5KXEA 1F15A 2A6XA 2HH9A 3WW2A 5B2GB 1I1EA 2VO5A 1O59A 1N1VA 1GQHA 3NNFA 4TWTA 2BZDA 4TZDA 1UL9A 1LECA 1WCUA 1YQ5A 3HN1A 3AFKA 2WS93 1SMVA 3SEEA 2XJQA 4EN6B 1H1AA 2VXRA 4RR3B 1SEFA 3OF1A 2FD8A 2PHUA 3ZMOA 2DBNA 1DYKA 2AH2A 1JZ2A 1NG0A 1GOGA 1GV9A 4FSJA 4PHZA 4EV0A 3WNMA 1H8TB 2Y38A 2WZR2 2GU9A 5HCFA 1W0OA 2VOXA 2Z42A 2BU9A 3EHKA 4A42A 3JD73 5C8WA 5CFCA 4QXHA 4IUGA 4COYA 1W6OB 4BCUA 1GLHA 4HPKB 1HLCA 4AVSA 2WNUA 3AJZA 3I3QA 3RZKA 5FMDA 4BIFA 3WCSA 1WCQA 4AFCA 1PK6C 3H7JA 3SKJE 5GZEA 1ZRFA 5FXWA 4Q2FA 2QQLA 5E88A 2YU2A 2Y26A 5K4LA 1X8EA 5LEKA 3KV6A 1JU4A 3VBOB 3WX5A 4LE3A 2D3RA 1QNWA 1SLBA 2JG9A 1HQWA 2L9LA 4B4QA 3OYWB 2CV6A 2PHLA 5GZCA 3LEMA 4CEWC 2D6NA 3DPRB 4IV3C 2R30A 1XYNA 2W92A 3VB9A 1T6BX 3W5NA 4OMDA 4A7KA 3PLQA 4ONUA 3H8OA 2VR4A 5T52A 1NZIA 4GJYA 4MOAA 4K8FA 1C1FA 4QPIB 2WUHA 1GSLA 2AC1A 2BV4A 1EYBA 2RDSA 2ARCA 2MHFA 2PAKA 1XC6A 5I0RA 3U07A 1JYIA 4AI1A 2BOJA 2SLIA 1FMD1 4L8QA 4W50A 3ZFFA 2H0BA 3H8RA 4NIDA 3KCYA 2BVVA 2VE1A 5FZ1A 4Q8LA 3I2KA 3I4IA 5ABJB 2GNTA 5FZ8A 3QCWA 1YHFA 4FFIA 1HDKA 5EYYA 4UOJA 1NA1B 4AEDC 3MDPA 4XABA 4IV1A 4DO0A 1AL23 2D5HA 2ZBJA 3T0AA 1HN1A 1YFWA 4E27A 2UYBA 2YC2A 4Q4V1 2ZAAA 4IEUA 2WO3A 5B4NA 2XONA 5J3UA 1AX0A 4JQRA 4OUSA 3ZYIB 1NLRA 2FCTA 3RFRA 3VBHC 5JDBA 4N43C 1GWLA 3BOPA 1JUHA 2NMNA 1S0FA 3CMGA 5E8AA 5E6HA 4LLOA 3S7IA 3IBMA 3M4FA 4Y20A 1APNA 5D8AC 1CIWA 2R043 5HCHA 1JODA 4LHLA 3NV2A 5KR7A 4D6SA 3WZ1A 1HXS1 2HJIA 3BN6A 3U10A 2ZHMA 1ZZ7A 4NHXA 1MPXA 2IXIA 4U2AA 1YNAA 3SCGA 5K9YA 1RJ7A 4CEYB 1OSGA 4RQPB 4Q4Y3 2DWRA 3WLUA 4LOTA 5CVRA 5J98B 1Q8SA 1ZZ8A 2DTWA 1VB4A 2WZ8A 5DAWA 3THTA 1C8NA 2JKBA 2WS91 1POV3 4JGYA 3N9OA 4C8DA 1K12A 1UPSA 4P00B 3P3PA 4QX3A 3DYPA 3FLTA 4LHNA 3ZXJA 1GBGA 4HLTA 1BJQA 1D4M3 2KM2A 2VBBA 3VDDA 3MPBA 4D7TA 1AR61 1FX5A 5LRRA 3NNLA 2JECA 2J1VA 4L92A 1TNRA 2XJPA 2XOMA 5FZ7A 2XLAA 4WM7A 5I91A 1SPPA 2VQ0A 4YVWA 1PNFA 4RYDA 3JD71 1E57A 5T5LA 5H9QA 1V6NA 1ENQA 4DRVA 3T08A 1VMFA 1MEC2 3ZYBA 1RUF2 4JC1A 2VBPA 1HRV3 1R1A2 5A3WA 4ISQA 4MHUA 1SCRA 1VRH3 3VBFC 2Z79A 5FZ6A 4BQ5A 2P34A 1UOBA 1GU3A 2AEZA 4AF9A 2A3YA 3JU9A 4DB5A 4IGOA 5IJRA 1TNFA 1O5UA 5DPNA 3DEMA 4OHWA 3WNPA 2A7AA 4BZ4A 3FHQA 4R9BA 4MX3A 4X8PA 2E63A 4UFIA 1VP6A 4AGGA 3WCRA 1FOD1 4YVSA 2R073 1S2BA 3VL8A 4R9DA 2PA7A 2UWAA 4GULA 3OGSA 5I8YA 3NKTA 2BW8A 4WV8A 4YZ1A 4FPHA 5FZAA 5JI7A 2JE9A 4G4FA 4W6YA 4DY3A 1XXNA 3HMYA 1NE6A 2QQMA 3D3AA 2DCJA 4XTMA 3FJSA 3ZYJB 3WNKA 1PIV3 3ZXAC 4EN8B 2D6PA 5KBFA 2HKXA 2ZGQA 2A1XA 4LKSA 5FP8A 2VQUA 4MXWA 4QM8A 4AHWA 2FDGA 1EV11 2VNRA 2ZKLA 5FAXA 5A3NA 5J36A 4BMBA 2PN5A 4GWJA 5C71A 5DUWA 5HCAA 3PVEA 1AZDA 3B3QE 3K4ZA 5FY9A 3ZXLA 1RUC1 5F37A 2BTVC 3LIGA 1Q8OA 4M0NA 1QNYA 4AWDA 1DYPA 1ZX5A 2R0HA 4LA2A 4Y24A 2IZWA 2LS6A 4N8MA 5LA2A 1AR92 1BVVA 1NCRA 1ULEA 2C5DA 2WT1A 3PDQA 4P9LA 5K7PA 1AR62 1TQ5A 1E5SA 1CR7A 2HLEA 1LEMA 1NXMA 1W2OA 1Z7S3 2B7YA 2CNAA 4Y1VA 4ZS2A 4AI3A 3I2OA 5GKAC 4KWJA 3ACGA 1J1LA 3POYA 2WFF2 3TBDA 5HXMA 2D7FA 1WW5A 3LSDA 3KB5A 1W3XA 4LHSA 4W65A 5FBJA 3S5AA 2E53A 5A3TA 2OUJA 2QUOA 3UK9A 3T4HB 1VR3A 5GLUA 2DYCA 4FQZA 4EWEA 2VMEA 3E6DA 1NOVA 2WR9A 1KEXA 2WSUA 1GZWA 3VHPA 2VH9A 1PMJX 4Q4Y1 3B5LB 2WQZC 1E5RA 1DLCA 4PIYA 4UWDA 2WNVA 4WM8B 4IE4A 4Y4YA 3VKOA 2WC2A 5BNOA 4JTOA 3O0XA 4JHTA 1CAUA 2FQPA 1N3OA 5LA9A 1OF3A 1HQNA 3ZSLA 1POV1 1KD7A 2VW0A 3TEYA 1WD4A 2JDUA 3SLIA 2ZEXA 2VOKA 4CDQA 1LHUA 1W03A 3Q9OA 1G7YA 1H6YA 1OOPC 4HXCA 5FYBA 3KLSA 1YLLA 4FBFA 3MBWA 1WA4A 4LK7A 2WT2A 4XMIA 4AR2A 5HV0A 2B9VA 1JHJA 1JZ7A 2XL9A 1BLZA 3J4UH 2VCCA 3K2OA 3VBUC 4AEKA 5A6ZA 2R063 2OA2A 2W2IA 3AYDA 3HNMA 3KV5A 4KNCA 5C33A 3P5BA 1HRV1 1AR83 1EV12 1FI2A 2BUKA 3ACHA 5FZDA 1QOOA 1XNDA 3FMGA 2HYKA 3SH3A 2RE9A 1PNGA 5T3NA 2ADDA 1OVSA 1UMZA 2ZX4A 3J9SA 1QOSA 2C0ZA 2X5IC 1FPN1 4NRQA 1NLQA 4LJHA 5L7OB 3WDXA 3GBFA 4CVUA 5I93A 1NY71 1IS3A 2HWE2 3AKRA 1GKBA 3HBKA 2HEWF 1XB9A 2R7EB 3ENRA 1E5HA 1MS0A 1RL3A 4YM1A 5FRAA 3H1MA 1WMXA 1W9TA 2XQXA 2VMCA 4XW3A 1SFPA 2LALA 4LNVA 5EPAA 4XJ8A 4AXOA 3HNBM 4I0WB 4BWOA 3NJVA 1C5IA 1S55A 1O4ZA 1O7FA 4EN7B 3FC0A 3LZZA 5FZEA 1TE1B 2CY6A 5FYSA 3N9LA 4V2WA 2VY0A 4GQ7A 4HFSA 4YM0A 3MIFA 3DYOA 2DV9A 4CE8A 3B9CA 1YRZA 3WEZA 5KHIA 3LE0A 1OH3A 4JGZA 1G86A 1Z78A 1AYN3 1ULGA 2DCYA 2OT7A 4QD2A 2RS32 4YGEA 4AYUA 1YQ6A 4CCLA 4QHZA 4IE6A 2RS53 4XTPA 5TSWA 3V56A 2XLFA 3ACIA 4BHPA 4D6RA 5F3EA 1ZA7A 2VU9A 1H6XA 2Y6JA 4FPKA 4IEZA 4KU8A 5DUUA 4GIQA 4JV4A 5G04L 1ZBA3 3ZN6A 1KFUL 4CDUC 1UNBA 1MS3A 3CHXA 1RUJ1 1UAIA 1V9U3 1Y9QA 3I54A 2YB7A 3OCPA 3ZYRA 5IK4A 4YZ5A 1PGW2 1UYPA 3PU3A 3NJYA 4LTAA 1F35A 4PDWB 4G3YC 1C8M2 1UD1A 5BNPA 4M00A 2G9ZA 4Z1VA 3MGUA 1EAH3 4QX8A 4UF0B 5F9TA 2AENA 4AI0A 1GANA 2EF6A 4K9SA 1WCSA 3WDUA 1HRI2 3H0OA 4DXTA 3OUJA 1S1AA 4IE0A 3I2DA 4CU7A 3ZO0B 2VW1A 4PIZA 2RDQA 2VC9A 3VD9A 1FPN2 4META 1ALYA 1F2NA 1HJGA 1RXGA 3ON7A 3WDVA 3CU7A 3O1VA 3ILRA 1ZBE2 2HBUA 1F4HA 1OQEA 2HWC1 4QX7A 2QDRA 2P3KA 4UBHA 1O3TA 1WW7A 1GOHA 2JDZA 4HETA 4WVWA 2IXKA 2RJKA 5FZFA 2G9GA 2P1BA 3NKGA 2K46A 5FMOL 1VBA2 5A7SA 1UOFA 1G9DA 1UZZA 2XG3A 4W6XA 5FUNA 4RS5C 1F4AA 2Y6GA 3ZKUA 3O1SA 4Y22A 4CEWB 2W1SA 4KWLA 4IV3B 4R4ZA 3UJOA 4D7YA 4GA9A 2I07B 4Q29A 2E26A 1ULFA 3OY8A 5IATA 3WQ1A 3VBRC 1X7NA 1K5MC 1RUI1 1GQPA 2GNMA 2QCSB 4SLIA 5JSRA 1AR81 4YNIA 3PIGA 3J26N 5C7GA 4BYYA 1QDOA 3USUB 1IKQA 4HVQA 4RHV2 4XURA 5AC93 1OBNA 4WVZA 4NROA 4RR3A 5FKCA 3HT2A 3WF2A 4AFMA 4AW7A 1DGRN 1B35A 1MR5A 1PVC1 3MW4A 2SBAA 2UU8A 1Y7BA 2BYVE 3H9AA 4FAGA 2E7AA 1H8TA 3JB4C 4EN0A 3ES1A 4KL1A 3NNGA 1OHFA 2WFPA 3BB6A 3OGVA 2PLV3 3I59B 2YC4A 1BEV3 5FY1A 2JIGA 2J1EA 1RUJ2 3FX3A 2TUNA 3N3HA 3E5XA 4P9IA 2YV8A 2XVKA 4HPKA 2CHHA 3VD7A 1QJU3 1OH4A 3TN92 3AP5A 2EAKA 3VHRA 3D82A 3N7KA 3O1TA 2R32A 2XJRA 2P2KA 4BB3A 4L0PA 1OD5A 3WG3A 3QH7A 4OQ9A 4XAAA 5T5OA 3POGA 2RS11 2IVJA 4ATFA 2A71A 4MZUA 4BQWA 3VBOA 2J7MA 2VMIA 2WDBA 1CPMA 3VBHB 4JDMA 4N43B 2ARXA 2FMYA 4LR4A 5FPAA 3OYWA 5FYIA 1AYN1 2YG0A 3HPNA 3WUDA 5C8CC 1NLSA 1BBT1 1DP0A 4M3CB 4ZPIA 4HBNA 1XNTA 1AR72 5FMCA 1W6PA 3PIJA 1MS9A 4R4XA 3ORJA 3R6SA 2Y6KA 4QPIA 2WYSA 4DUVA 4ZZ5A 4LQRA 4RL7A 4LEJA 5IW0A 1V9U1 3O5SA 2GC0A 1OA2A 3OOXA 1HV1A 2FZ1A 1GP5A 4XUNA 1WCDJ 1ND2C 2ARBA 1YWKA 2W91A 3GALA 3OUHA 4DEVA 3CZUA 3T1MA 4K1YA 1UZWA 5DZGA 2BQPA 1BQPA 2WZR3 3CKHA 3MIBA 4FFHA 4FXKB 3AMMA 2IUWA 3M70A 1WLDA 2JX9A 3ZFGC 5ABJA 3VBSB 4QT6A 3PMEA 4L97A 5J37A 1PM4A 1RUI2 2FBEA 3CBNA 4F8AA 5BYNA 2J1TA 5A70A 4Y5TA 2CWSA 2WNEA 4GJZA 4XVHA 4IE5A 2Q8OA 3UGGA 3QD6A 4IESA 4QB2A 1OUXA 2F17A 2VZVA 5FY4A 3ZDVA 1RUD3 4YFZA 4UFMA 3ZXKA 4IW3A 1UXZA 2JE7A 1R091 2C26A 2V5YA 3U75A 1SZBA 4BE3A 2FDKA 2JD9A 1RXFA 5FUPA 4A4AA 1S0GA 1AXYA 2YZ4A 4R9AA 3O1MA 2P5BA 1DFQA 5EWSA 4BA6A 2BOIA 2RHPA 4K21A 3GHNA 1REFA 4W4ZA 5LBBA 1U5XA 4CU9A 2Q30A 5FP3A 2WABA 3POSA 4YW3A 2OW4A 2WZEA 5LA1A 3MUZ1 4PBPA 4JKLA 3FHIB 2W3JA 4D0QA 4XDPA 2Y6HA 3POFA 4CEYA 1RMU3 5C5TA 2O14A 3OPTA 4RQPA 1CX1A 1PO23 2VNOA 3ZSJA 3A7QA 4B4RA 1JU3A 2GMMA 4XJAA 2QNKA 1HN0A 1Z0HA 1X50A 2ET1A 2R1DA 5AC91 2D6LX 2DVGA 2J1UA 3KS7A 4GKXA 1AXKA 3ZSKA 3RSJA 3T2PA 3WW3A 4DRRA 5C3RA 3DCQA 1VBD1 5CISA 3RWNA 4GALA 3EJKA 5JSPA 4CRQA 3FBMA 3JCIA 3LSEA 4DIQA 1D4VB 4NO4A 5HV4A 1W6QB 3OBTA 2PLV1 2NN8A 1YUDA 1XRUA 3KZ4C 1JYWA 3AYAA 4C1XA 1URXA 1F5FA 3J8F2 3ZXEA 1CQ9A 5AFBA 1RUOA 1WBFA 3MUY1 3PMSA 3BKZA 4Q4W2 5CFDB 2X05A 1VIWB 5A7WB 3HN3A 4J25A 3ZM8A 5CU1A 5DMYA 1A8MA 1PM7A 5FZ9A 2E33A 4MGIE 3T2TA 5J96B 4PIXA 3T09A 4YW6A 3NNJA 4QQHA 5J7MA 1QJY2 5FPLA 2VZ3A 5EYXA 3KSCA 2B5HA 1UKGA 5FQ0A 2JDYA 1U5IA 1XNCA 3WW1A 4UXAA 1QHDA 4LBMA 4OMCA 3ZYPA 4DNYA 4TTGA 4QGMA 3ZIWA 4XCBA 4BU2A 1UN1A 5E89A 2P3IA 4XXPA 2E7TA 3HBZA 1W04A 3KMHA 4P9XA 3UGHA 4KGGA 1OXCA 3ZFEB 5ACA2 3N35A 2WQ4A 5IVYA 1J84A 3THCA 5I0DA 4XF1A 2VVDA 1R082 1LTEA 1GNHA 1CN1A 5BUVA 5EJ1B 3GF6A 3E1F1 1IQDC 4QXKA 3WP3A 4UFKA 3T0DA 4M4RA 5FYVA 1H4HA 5C4WC 5FPVA 2GAUA 1JH5A 2WZR1 5DDJ2 1SDWA 5FREA 3AXDA 3GZEA 4LMFA 4A3XA 5GLVA 1YO8A 2DUPA 2A6VA 2DF7A 2QQIA 2J1RA 1OOPB 4FTEA 4ASLA 2EIEA 2QE3A 1MEC3 1OF4A 3LD8A 1RUF3 2VG9A 1C57A 1MACA 1E5IA 1FMD3 1GOFA 5A3OA 3I7DA 3BTYA 5DQ0A 3UETA 3P1IA 1N1SA 5ANQA 1SBFA 2ZGMA 3MIEA 4X8NA 3VBUB 2EICA 4ZS3A 4CUGA 3KHCA 1VBD2 3AVSA 4O9EA 5JPNB 2PAMA 5DZEA 3WDWA 1PO12 4BLIA 1KS4A 3A0NA 2VVFA 1RVF2 1FT9A 2RJLA 3K4DA 4PQ9A 5BNQA 1DG6A 2VPVA 1QF3A 3AZWA 4BQ1A 1CGPA 3RYKA 1W06A 1RITA 3GM8A 1XBFA 4H14A 1R1ZA 1US2A 5FZGA 5CFCC 3LOIA 3SXWA 4D7SA 2A75A 3IPVB 2HWB2 4JZRA 1S0BA 2ES3A 4UFHA 4QWNA 4AVCA 1W8FA 1SHWB 5D1IA 1RUG2 2B45X 2D5FA 4ZONA 1LHVA 1AX2A 2ZMNA 1AJKA 1JOPA 2VZSA 1HXS3 4N53A 3WY6A 4E8CA 2DVDA 3MFAA 2JG9C 2P6HA 1NXD1 4LBJA 2CDPA 2YPJA 4QPGC 3I2HA 1PMIA 1SFYA 1NUKA 1BK1A 3KVAA 3TB0A 3IB3A 5FR3A 3LGRA 2PQSA 3RG0A 4L9BA 3M2MA 1UMHA 1UIJA 4QAWA 3QACA 4BOWA 1JZ6A 3BUCA 3VGIA 3OJBA 4A45A 3NV3A 5EFUA 1QU0A 3IDCB 4NRPA 4CXYA 1F5JA 3A4UA 3A21A 1AR63 1VAKA 2ZGKA 3KWVA 3L2HA 5IHRA 2NM1A 3S6PA 1L7RA 1CAVB 2ZGPA 1QKQA 2W9XA 5C5UA 4GMP0 2YBSA 5GZDA 3ZFFC 1R64A 1XNAA 3VKFC 4TXWA 4CDUB 4URAA 4LE4A 1O3SA 1KRIA 3VZKA 1I3HA 2D93A 4NWWA 5FPBA 5GLWA 2QZ2A 4I02A 3N9PA 1YQCA 4AVVA 4COWA 5A1AA 3LEKA 5C3SA 3WP6A 5FO8B 1GMMA 2VOVA 1COV2 4IV1C 1IS6A 2GN7A 2OPKA 5H9PA 2JG8B 4B8EA 1QDCA 2WO7A 3RS6A 1NT0A 4P9GA 1CAWB 4UAPA 5F5QA 4Z07A 4HVRA 1ONAA 2VNVA 1QOTA 1V6IA 1JS9A 1LGBA 1REDA 2AYHA 2BWCA 5A32B 3Q8FA 1O3RA 2ZX1A 2VMFA 1OKOA 1D2QA 3VHOA 2ZX3A 3MIGA 1MS4A 2Q4SA 1SBEA 1NE4A 4FO9A 2CGOA 3AM2A 4OI1A 1FOD3 2ZZJA 3S57A 2AUYA 2C4XA 4DS0A 1H1IA 4E4SA 2JDHA 2EALA 4FCAA 4MGZE 5IWFA 3W5MA 1DQ2A 5FOBB 1MEC1 1RUF1 3I2GA 4S2GA 3UL2A 3O1UA 4RS5B 1R1A1 2HWD2 1EV13 5IFTA 5IYYA 4JGYC 1Q8QA 4UW6A 3ZKYA 2DUOA 4XJ9A 4ZU7A 2ZHKA 3MV01 1QH6A 3O14A 2E31A 1M4WA 3VDDC 4DEQA 1K5MB 2YUEA 1RUC3 2BDRA 4XACA 4IEVA 4PDWA 5EP9A 2WN3A 3IM0A 2Y33A 1XNBA 4XIOA 2HWE3 1QQP2 4FPYA 4AI2A 4WM7C 2PTMA 1U5ZA 4UF0A 4W8JA 4YVWC 1VAVA 1G6NA 1W8TA 1N3QA 2N7GA 5L73A 5T5PA 1LOGA 3DGTA 4QQLA 5A1FA 2GMPA 1YIFA 1MZFA 2WQ8A 4IEWA 2LROA 3J7MA 4TYSA 5A33B 1BKZA 1ND3C 2BRTA 5CKMA 4XMAA 4NWVA 4PLNA 4Z2WA 4P02B 4S2DA 2D3SA 2JXAA 2NZ9A 4NRMA 3WNOA 3E6BA 5KHHA 3BCWA 1QIQA 3H1WA 1I9RA 1OUSA 4NPRA 2JDMA 1UY4A 3OB8A 2DBIA 2KD7A 5A6XA 5FMOS 4A44A 1QWRA 5F32A 1VPHA 4IE7A 1JXNA 3GZUC 4YGBA 5FO7B 3VZJA 5LY1A 3KVBA 3I3EA 3ZPOA 5C8CB 1X9PA 4CEWA 4XQDA 4OI2A 4IV3A 4AEMA 1YI9A 2VNGA 4I09A 4IERA 1AR91 2V5DA 1KJRA 4P14A 5GLZA 3HNYM 4QX2A 3UT0A 3WQ0A 2D6KA 1CWPA 2PHWA 2K9ZA 2WFF1 5T5JA 5BY5A 5LZ6A 2XL7A 3OG2A 4LBQB 4UBGA 4C0BA 2BFUS 2JEMA 1JW6A 4Q0SA 4FTSA 1ND2B 3Q8CA 2I74A 5CADA 3MW3A 3DYMA 4D94A 2GP5A 3OBRA 4OQ8A 3TEWA 1LOEA 3IDAA 3NAPA 4NMIA 4PQQA 2OXBA 1W05A 3I59A 1S2EA 3TEZA 4DPNA 3K3OA 3JXSA 4KGQA 3T2QA 4CDWB 1X33A 1YYNA 4Y5SA 1FPN3 2CU5A 4AVTA 1O3QA 2XBO2 4QXCA 1RC6A 2VTFA 1CJPA 1HQLA 1ZBE3 2IWGB 4K20A 3C7EA 4KG0A 5I0UA 1OT5A 3AYCA 2DU1A 2XXZA 3V0BB 1NQDA 3AKSA 4LOSA 4MVTA 2D43A 5FXXA 4TLGA 3R4DB 4M0HA 3HVDA 1VBA3 2A6YA 4N43A 4O65A 4CPBD 3HJRA 1VBE2 4D8MA 1UXXX 2D3PA 3AXEA 5DXDA 2TNFA 2X53S 3VKLA 4CCKA 1UYXA 3N7JA 1K42A 3IIAA 2BVBA 5T55A 1TG7A 3WNXA 2BPA2 3VKMA 3UKVA 1AX1A 1RTVA 3FHAA 3GBWA 1KDKA 4IETA 5LEJA 4RHV3 4BMEA 3M1HA 4CDQC 4EWAA 3CZJA 4FXGB 2E6VA 1W2TA 4TLFA 3AP6A 2EXJA 1PGL2 1CD3G 1XSRA 1YI7A 2A3XA 5SV5A 3TWIA 1LGNA 1V6JA 2HWE1 2YPDA 2W08A 4YM3A 3VZNA 1W8WA 2ZMLA 3VDAA 4AHYA 1I5PA 3DKQA 4K3UA 3T1LA 4P9WA 2A5ZA 3ETQA 4YGDA 1RUJ3 3VBSA 3DXTA 3AMHA 3GGLA 4JCKA 4JTNA 5F3CA 3HQRA 5IK7A 2PMWB 5ERLA 1TZOA 1D0GA 3WF1A 4FPJA 3TN93 2ORZA 4R8HA 3GHMA 5FLHA 1V70A 2E9QA 2GN3A 3LDBA 3RJRA 3VKNA 4PLOA 1OA4A 5FOJB 1AF9A 3R05A 3OBAA 4XFBA 3WOGA 3NW4A 1UYYA 3POJA 4LKFA 1CJDA 1X36A 2XDVA 1UY2A 5CAZA 2ARAA 2WA3A 4BK5A 1ZZBA 2IXCA 3NJZA 3NQHA 5CIRA 3B69A 5G05L 3UYJA 2ATFA 3ECQA 1EP0A 4EYUA 2R1BA 2WWUA 4OLLA 2DCTA 1ULPA 4H7LA 1ZRRA 1OVPA 2IFWA 2RS31 3A0KA 3B02A 4WVMA 4OHZA 4N9IA 5C3QA 4MLOA 1ODMA 1Y9MA 3O0VA 1JI6A 1HB2A 1RUE2 4JRAA 2B39A 4IL7A 1DHKB 4AEJA 4TSVA 2HWC3 1MQTA 3FN9A 3AJYA 5FUIA 2VM9A 3BTZA 1VE0A 1DGRA 2PHRA 3POWA 1PGW1 4MO3M 2ADEA 3BGAA 4HK9A 3AYEA 3ACLA 1VBC2 2W5FA 4LA3A 1C8M1 2RV9A 2WT0A 4XJUA 5FY7A 2JDAA 4CDXA 4JGZC 3SC7X 3X29B 5FMBA 2OUHA 3I8TA 4CSWA 1VAMA 2O1QA 1HB1A 3FLRA 3GDBA 4H2AA 1UF2C 4P9YA 3SQOA 1QXRA 5FY5A 4NPLA 2GMEA 5HXVA 1HRI1 1RUI3 3OSDA 4CCOA 5C4WB 4Y26A 3R4SA 5JR2A 1W6QA 5DUXA 3CJIB 2YYOA 4NR1A 2CDOA 1W8ZA 2QFEA 2CWMA 1YQ8A 4XUTA 4XE9A 1PVC3 1ENXA 2QQJA 3ZN4A 4C90A 3I2FA 1OQ1A 1Q5OA 1XSQA 4MGQA 1UYZA 4QKFA 5CFDA 1ZBE1 4M3CF 4BDVB 4O7XA 5FZOB 5BNPC 1N1YA 3BVCA 4ASMB 1VMHA 4YZ2A 1TMF2 3AKTA 3PURA 4EZ4A 5FPUA 3T4VA 3R0RA 3F2ZA 3QH6A 5FJHA 1VBA1 1LU1A 2GDFA 1QXJA 3NSTA 3HT1A 1HB4A 3T30A 4U36A 1WW4A 2GNDA 3PU8A 4QDSA 5D2AA 5FZBA 4P5YA 5L9BA 2AEYA 2XKOA 4OHVA 4J6GA 4E2SA 2RS13 4NAMA 1FATA 1UWWA 1W2AX 5JWPA 3KV4A 2XMLA 4UFJA 1W2UA 3MLJA 3WD5A 3ZFEA 4AQSA 1TME2 4BK4A 1AL22 2HBTA 4W6WA 3ITQA 4RHV1 2VOWA 2XVGA 4I0AA 3OPZA 4F3JA 1JTZX 2LTNA 1BBT3 3KV9A 1FNZA 2W87A 3A23A 5A6QA 3O1OA 1W9YA 4QKNA 3WF4A 4ES8A 4XFGA 1UOJA 1NX9A 1S0CA 2VCBA 4QPGB 4YYOA 3K77A 1W90A 2R042 5FV3A 1OOPA 2DDUA 1UY3A 3J8F3 1RUH2 1UQXA 1U12A 3D8CA 4Q4W3 3V0AB 1IPJA 4M4PA 4IXLA 5JZGC 2KA3A 3TN91 1GQGA 2AR6A 4CCMA 5C9AC 1D2SA 5JAXA 3KF5A 5GM0A 1ENSA 2BWAA 2GC2A 3C7GA 3DXUA 3M3OA 4RR3C 1QJX1 1ZNPA 3VBUA 3VV1A 4EROA 4F83A 1JYXA 5T54A 2JIJA 2CTVA 1B35C 5BNNA 5F3IA 2XPJA 1GFF2 2WKKA 1Q56A 3AMQA 1QJEA 3AMNA 3BPZA 3D5OA 1H8TC 1FNYA 1CX4A 5JXIA 2VZPA 3ZFFB 3LIHA 4GKYA 5E16A 4AQ2A 1JZ4A 2AZ5A 1ENRA 3UESA 1YXWA 1D4M2 1W9WA 1R093 2ZGLA 3POBA 1NKGA 4JVAA 4MGYE 5E1RA 3RMXA 4FT8A 4JX0A 3I97A 1AR71 1PVXA 4NJ4A 4GH4C 5ACA3 3WP4A 4AFBA 3IPVA 1PGSA 2J1SA 3IZOA 1C1LA 2VMHA 4N9HA 2RMU2 3ILNA 1PK6B 2IXHA 3D4KA 2DVAA 5FCCA 3AC0A 1DZRA 1OMIA 2ZXQA 5L9RA 4B4PA 2WWJA 4HKLA 1SACA 2E51A 4N90A 4OHXA 4QU1A 1EY2A 5BV6A 3PUQA 1DZTA 3JBG2 4MUVA 1TVGA 1JOJA 4I30A 4QX1A 4YZ4A 4D6QA 1VRH2 2VECA 5DDJ3 4AAXA 1W0PA 4XBLA 4AI8A 1RYYA 5AVAA 3LDKA 5I0SA 3AP9A 4YRDA 3U0ZA 1VJ2A 2QQKA 4FFGA 4OZOA 4XF0A 4YW1A 4J1WA 3TEXA 1RIRA 3RGBA 4MSVA 4CUCA 5EXOA 4BXSV 5JXHA 4YWAA 2YROA 3BTAA 3S30A 1CIYA 3K4AA 4JHZA 1XE0A 1PMHX 2Y6FA 1W8HA 3JB8A 3NMBA 4QPIC 5IT6A 2JWPA 2IC1A 2YGLA 3BYWA 3GYDA 2MEV1 2HEVF 4Q0UA 2RR11 4XUOA 2ZPXA 3POIA 1VBD3 2MNGA 1Y43B 2R072 1XYPA 1XNKA 4K8RB 1JYNA 2ZEYA 1CAVA 4YZ3A 4EWDA 4JGYB 4S2HA 5JLVA 2FDHA 4B3NA 1CPNA 2A73B 4CDUA 1XYOA 3HAGA 5FK8A 3MO4A 2HWF2 1WLTA 2WJSA 1CZVA 1PIV2 1S0EA 1LHWA 1O6UA 3OGRA 5ABJC 3RZMA 1W6OA 3H3UA 4PT6A 3LEIA 3RZHA 3M8LA 1Y4WA 1V6LA 2ZEWA 4AEDB 2HWB3 4V2VA 5JVVA 2YY1A 2J42A 4RD7A 4YVWB 5A7NA 2JG8A 4NAOA 1S0DA 1SCSA 1QJX2 4BQYA 1BCXA 4MGTA 5FYUA 3P6BA 5FXVA 1CAWA 2FMDA 2ZS6B 4FPGA 4Q1RA 4H7MA 1O5LA 1W8NA 1IPKA 1UZVA 1QY4A 4J1XA 3J7LA 1QEXA 3AKQA 1DF0A 1HV0A 3URFA 4LKEA 4A6OA 1ND3B 4FPOB 2CSGA 4QQOA 3ME2A 3SKVA 3WHTA 4A2UA 4KU7A 5D8AB 1FAYA 4AAPA 1G8WA 1Z7S2 2DCZA 3DPRA 3KT7A 4H55A 4RSUA 2VUAA 5HPOA 4CCDA 3RVHA 4I3GA 5LRSA 4QDQA 4UFLA 2WWSA 5FYHA 5JOWA 4CEYC 1XQNA 4WBBA 1IG3A 4PI0A 1HIXA 2ZGRA 2ZJCA 2UY9A 3J8F1 3PTYA 5FP4A 3O1PA 1I6XA 3SMHA 1QGLA 2G9FA 3WHUA 3WVJA 4Q4W1 5DUVA 4CP0A 5DAXA 2A3WA 2XHNA 3RQ0A 4NHYA 4OZXA 5CZKA 5A7QA 3APBA 2J1AA 3VDBA 5CG9A 1QJY1 2NPIA 3KT1A 1U5YA 4HVOA 3B94A 1XU2A 1W3VA 1K45A 1NA1A 1COV3 2VTXA 1G9BA 1RJ8A 4BQXA 2EIGA 1H9WA 1ASJ2 3HEIA 4MV2A 1PX4A 1FV3A 4CPBA 2MEV2 2W39A 1NZCA 2RR12 2VZRA 3CQOA 3WDTA 4AQTA 4LXLA 2BGCA 3K3NA 4YLZA 4L11A 2EIBA 5ACA1 1J3RA 4XYXA 1O4TA 4QKDA 5F39A 3WNNA 3VBFB 3PNAA 3EO6A 1YFXA 1R081 3MICA 4Q0QA 4DQAA 1H2NA 2R062 4LPLA 4QQ2A 2CL2A 4XIKA 3PUSA 4LKDA 3W20A 4CCJA 5KHJA 4GWIA 4XF3A 2AREA 2BNOA 4LO8A 3I3MA 1UU6A 3UKTA 5GZGA 5LK7B 3U4SA 2NP0A 1Q3EA 1OLMA 2LRPA 4DZGA 5DDJ1 4LO6B 5K8SA 2V4VA 4CXXA 5L19A 1LOFA 3WSOA 3PL0A 2Q8DA 3U78A 2QJVA 4Z82A 1ACCA 5CG8A 3J7NA 4K1ZA 2NQYA 2XR4A 3BALA 1CONA 2DCKA 3ELNA 1IPSA 2E32A 1BK0A 2HWD3 3Q8EA 4XILA 5C8CA 1YJKA 3OD0A 4XFAA 3KGZA 5LCWL 4GWMA 5APAA 2I45A 3WUCA 4D69A 1UY0A 5D21A 5LBFA 3W21A 4LBNA 1C4RA 1PO11 2V09A 4DINB 3MEPA 4AHZA 1CVNA 5K0UC 2ZACA 1RVF1 4GB32 2C1FA 3HIFA 1QQP3 5ISLA 5IVFA 1UIKA 2PHXA 4LBQA 4Q4X2 1ZM1A 4XOGA 3ZSEA 3S5QA 5B4XA 4XJZA 4LORA 2PHFA 3AB0A 1YIPA 5KC5A 1NCQC 2FDFA 2HWB1 4MGKE 4ITCA 3V65A 4GMP1 1QJZA 1DU3D 2FZ2A 4XXAA 4LO5B 3RWKX 1RUG1 4LUKA 2RS52 4CDWA 4I2OA 5IAXA 3NJXA 3EB7A 2WSVA 4NIAA 4XZPA 1CZTA 3WP5A 1ZBA2 1WMFA 3VUOA 5H9SA 3NV4A 3H8XA 3IWZA 3V0BA 1G9AA 4B1MA 2IVIB 4XFIA 5I8SA 3WQBA 1DGWA 1WA6X 4Z92B 1JN2P 1W8UA 1DGLA 3M7AA 3LOBA 3E97A 3RI8A 1LULA 5KC6A 1IZ3A 4QGNA 2HYXA 5JIAA 3NRUA 4QB6A 1SLIA 3ZDSA 2RJ2A 2G19A 5FFOC 1O8SA 1V00A 2WLQA 4O9GA 1X8MA 2WA4A 1DCSA 3OGJA 4ZXKA 1VMJA 2VOTA 4N53C 1J59A 2CGNA 5IAVA 4LUMA 2LUWA 4YFWA 5C6CA 4HMZA 1GZ9A 1ZREA 1MS8A 4CCCA 1US3A 2Q8CA 3MLKA 2VQAA 4DXRA 5A3LA 5F5AA 3B7MA 1GZCA 3F95A 1WKYA 4ATEA 2RM22 4INDA 3VZLA 5JIUA 1COV1 1WLWA 2NYYA 5C3PA 2NMOA 3FBYA 1R1A3 4RA0A 3ACFA 2OVUA 3LA3A 1MZ5A 4JGZB 2XH6A 2WNOA 5DABA 4HANA 2C9AA 4E4DX 3M3QA 4A7ZA 3GXUA 5KWRA 4NVPA 3SEPA 1V0AA 2R16A 1WLCA 5KXBA 2XKPA 1KFXL 5JPMB 1AUYA 2P4EA 2DFBA 4NHLA 5F2WA 2UWCA 3ZN6B 1XJAA 1W9FA 4WVVA 3AZYA 4AGRA 2FDJA 2XGXA 3WQ7A 1H2MA 1DDLA 4COZA 2VD7A 4PLMA 2X5IB 5FYCA 1OLME 4E9KA
chains in the Genus database with same CATH topology
3TOJA 3C3VA 1WCKA 3EXUA 4AGVA 3ZIXA 4NN0A 1C3HA 5BNPB 2WNUC 4YM2A 5FPZA 2ZGTA 2YGMA 1VBE3 3MIHA 1ZZ6A 4WM8A 3MLLA 3FWEA 2CYFA 3N7LA 5HCBA 1DQ1A 1OPOA 2P17A 1W6MB 4AVAA 2PHDA 3B00A 5J48A 5JOYA 3OD4A 2ILMA 2HWD1 3FE5A 1BEV2 2ZZQA 4XEZA 4LO4B 4QQPA 2X8KA 2ZHNA 2ENRA 1QJU2 4KWKA 4FP3A 2WL1A 3B01A 5FBZA 1OI6A 2UURA 1QQP1 1KXGA 1ZZCA 1AHSA 2XUMA 1UKRA 1AR93 2XLGA 4Y1YA 5C4WA 1TEIA 2CAUA 1MVEA 2WFF3 4Y22B 4E2QA 5JOZA 2D44A 3CJIA 4HL0A 1VBB2 1KQRA 3SNMA 4XQWA 3SISA 3OY8B 4OI4A 3FUQA 5L7OA 1WBLA 3GZAA 4PDWC 5JZGB 5C9AB 3DUIA 1C28A 1YFUA 4K6BA 2ZA9A 1BYHA 3MFCA 1N47A 3V64A 1B35B 3SITA 3EQEA 4OVEA 1IKPA 3AP7A 3IMNA 1KJLA 4BLJA 1RUE3 1RB8G 1CAXB 1RHI1 1G9CA 1UCXA 1X82A 2DVBA 1JBCA 5FPXA 2F4PA 4GH4B 3RRDA 4UW5A 4F7ZA 1RGSA 1VBC3 1RUD2 1AYM1 3UKNA 1AL0G 2A6ZA 2BEOA 2ZKNA 1WMEA 1IOAA 2GALA 1B09A 3LKJA 4YW5A 2G4IA 3ASIA 4UW3A 3KT4A 3WR0A 1IQAA 4BPZA 2WLPA 4AVBA 5LK5A 2OIIA 4QPGA 4L2NA 1FV2A 4V1PA 4GXLA 1ZRDA 1DBNA 4FPEA 3VBRB 1W6PB 5CNAA 2DURA 2XBO1 3V0AA 3E5UA 3E5QA 3WINE 1QXPA 4XQ4A 1RMU2 4LBKA 1OFSA 4Q26A 1PO22 5CB7A 3ZMNA 3ZX7A 3PHMA 1TMF3 3VN4A 1PZ9A 3DV8A 1J3PA 1OLRA 3O12A 4SBVA 1HW5A 2ZOEB 2QZ3A 1A6CA 4QX5A 1VBE1 3NAPC 1YFYA 1REEA 3VLBB 4KG8A 4KQ7A 2D6OX 2Z2SB 5DG1A 2W0XA 4FOQA 4AE2A 1TME3 2ZX2A 4NHKA 1RINA 1PK6A 4Y1ZA 1T6GC 3KD4A 4H3WA 3FLPA 5CA6A 3NWKA 2RS33 3MF9A 1PGL1 1IGOA 4YVSC 4HZFA 4CZSA 1KS5A 1RHI2 4CTEA 3PJQA 5GZFA 2XJTA 1LODA 4FQ4A 4LLFA 3AX4A 4M01A 1H0BA 1JYCA 3FUOA 1AJOA 1RUH3 2IXLA 4E2GA 3MZHA 1ZZ9A 1SLCA 2B8MA 2W52A 1JYIA 3JZVA 1C8M3 3USUA 1AYM2 2TBVA 2ET7A 5I8TA 3O0WA 1GYKA 2UYAA 3K48A 3CO2A 2JJ6A 1DGWX 4I0BA 1HRI3 5KXDA 4CP1A 4I3PA 3ZFGB 4L99A 1SLTA 1NCRC 1XE7A 3VBSC 3CLPA 1V6OA 4ORFA 3D0SA 4AEDA 1M06G 1BVP1 1RUE1 5DG2A 3KM5A 3ROUA 3NL1A 4EJRA 3KCCA 4DMIA 2RMU3 5T50A 2H0VA 3IT8A 3SHRA 2PYTA 2DTYA 4GWNA 2GH8A 4FOYA 5BPXA 1ZRCA 3VBHA 2BBVA 4Y5Z0 1FMD2 2B9UA 1J58A 1VBC1 2IFRA 3JBG3 4PJYA 1ND3A 4OULA 5FLIA 1KDMA 1DQ4A 1UPIA 2GH2A 5D8AA 2EAAA 2WNVC 1LB2A 4M3CA 5FQ0B 4PCRA 5BNOC 5HBAA 2GZWA 4I01A 3TNPB 3BODA 1H1MA 5AFEA 2WINB 1MQTC 3RMYA 3W58A 3MYXA 4B7EA 4XDQA 4Q4V2 1O4YA 3W9AA 4X6QB 1ULDA 3TNQA 2K0GA 3WDYA 3CJXA 1LESA 4DOUA 5JCTA 4B29A 2P3JA 4ES9A 4CDXC 4ZU4A 3AMPA 1TMF1 2JENA 2DFCA 3CEWA 2HWF3 1BXHA 1HXS2 5K0UB 2VUJA 2EXKA 1N3PA 2CGPA 2F6BA 3AZZA 3OTFA 1ULCA 2ZHLA 3AKPA 4XETA 1W6NB 3QOPA 1QJX3 1WMDA 2QDNA 4IEPA 4Q0PA 2PELA 5BXXA 1IS5A 5KHGA 2XB6C 1A78A 1NCQB 3M3CA 5CFDC 2WS92 1TME1 4LBQD 1AL21 2Q0AA 3VBFA 4RFT0 2QVSB 5H9RA 2Q1MA 1OFNA 3IKWA 4Q27A 2JD4A 1AR73 3MF6A 5I0TA 3ZPYA 4DY5A 1LGCA 4AK3A 3JD72 4P5HA 4OUMA 2R041 3FFZA 3WG1A 4IEOA 4LBOA 3LCPA 1RUH1 3ZFEC 2ZAHA 2ZGOA 4EN9B 3HD8B 3BOWA 1WD3A 2B46X 3LA7A 3DL3A 2ZABA 3NVCA 3P3NA 4N53B 1H30A 2ZMKA 1HX6A 2D97A 4E4ZA 1ASJ3 1JUIA 1D4M1 2OYZA 4AFDA 1DQ0A 3GZTB 2MEV3 1FOD2 2RR13 2YMZA 3ST7A 1XU1A 2VVEA 2A6WA 5DZFA 5JOXA 5JMCA 4FPLA 4XFHA 2UY8A 4COVA 5HI0A 2RMU1 3U4XA 2MPFA 2GSYA 4JAAA 5BNNC 2BNNA 3K51A 1N1TA 3LB9A 3JBG1 1ZVFA 3GNEA 1VRH1 4M3CE 2JICA 4FPCA 1PHMA 5CFCB 4HT1T 1G9FA 1OA3A 3WG2A 4R52A 1RUC2 4HKWA 3B93A 4LHKA 5GJ6A 2B42B 2WNUB 3DKWA 3N7MA 1SLAA 3AFGA 4BH9A 4NHMA 4LBLA 3IDBB 3RJ2X 3PVBB 1QMJA 2ERFA 4D3WA 1S0IA 1WGPA 2PFWA 4Q0VA 2R071 1V6KA 3LWCA 2JG9B 3LA2A 4GB33 1J1TA 4Q4X3 4BIOA 2HWF1 3H7YA 3TRSB 1PIV1 2P37A 3ZXDA 5FTTC 4P9JA 1YCIA 4QHBA 4KH9A 1ZYBA 3LAGA 1MS5A 1OPMA 4IEQA 3H1YA 5GLTA 2XJUA 2NLRA 3L9JT 4Q4Y2 2EXIA 4B7KA 2ZGSA 1LCLA 1QJY3 2O0OA 4LO7A 1LRHA 3ZXFA 1U0AA 5EJ3A 3FZ3A 3S0MA 2PAEA 4AG4A 4ZU5A 1WW6A 3U11A 1Z7S1 2X5IA 3DF0A 2GC1A 3C2UA 3H50A 1H9PA 3KCXA 4YG3A 2EVXA 4IV1B 4AQ6A 3G7DA 2IXJA 2R49A 4JRLA 3HWJA 2JG8C 1YJLA 4AFAA 3ZYGA 1R083 1LR5A 1JHNA 4HK8A 3RI9A 3CL1A 3R4UA 4OFGA 1FXZA 2VW2A 2XJVA 4DFSA 1W6MA 3VBOC 1HRV2 3G6JB 3DN7A 4XFCA 3MW2A 4OHYA 2YC0A 5JI9A 1Q43A 4QGLA 1DQ6A 3HQXA 4Y20B 3DPRC 2YXSA 1S2KA 2RM23 1NY72 2D6MA 1POV0 4XF9A 2ETEA 3RNSA 2R0FA 4XPVA 3NV1A 4OI0A 1DIWA 2PHTA 3SCHA 1ASJ1 2CAVA 4DXZA 2PQQA 5SV8A 2DU0A 3ALQA 2DVFA 3WG4A 1PO13 1MVQA 5AVPA 1SQ4A 1RVF3 1MS1A 2WZPP 3E6CC 5A3MA 1GNZA 4K40A 2R061 3N36A 1UZYA 2H6CA 3VDDB 5IK5A 2Q1ZB 5FDBA 2H6BA 4BM8A 5JZGA 1VLNA 1NA1C 3M3EA 1MZEA 5C9AA 4RGAA 2Z69A 4WM7B 4YG6A 4GMP3 1UU4A 2ZGUA 1AVBA 1V6MA 2BFUL 1RUG3 3QBQA 3ILFA 1GR3A 1OLQA 1DLLA 4N7UA 4HN1A 2VULA 3WXPA 5A32A 1CAXA 2EXHA 3NAPB 3RYRA 2OZJA 4QPYA 3RYPA 3ES4A 2ZGNA 4Q8KA 1C5HA 1EPZA 1XE8A 3VHNA 1OKQA 3L2YA 4GH4A 4Z8BA 4FOWA 3KQRA 1SBDA 3FFQA 1QH7A 3NO8A 4GB31 4PF5A 2W68A 1J3QA 2GC3A 4YGCA 3PVOA 4RQPC 4Q4X1 1LOFC 2VMGA 2K2SA 4YVSB 3MIDA 2FHRA 5F6LB 2LM3A 3KGLA 3H8UA 4RS5A 4XBQA 2WIIB 5EZWA 4QM9A 2V73A 1VBB3 3AK0A 1BMV1 2RS51 2Y0OA 4UW4A 3VBRA 1K5MA 3VZOA 5FO9B 4MXWB 3TYJA 2XHKA 2HWC2 1ZBA1 2XVLA 2DUQA 5KXCA 2VGDA 4FPFA 3MI8A 1O91A 2YDEA 1LOCA 3WV6A 3PVNA 3RPQA 1A3KA 1NQJA 3TAYA 2XJSA 4S2FA 2ZX0A 1F31A 3D6EA 1EAH1 5A33A 3UV9A 2Z5WA 1NCRB 3USSA 1H2LA 4YG0A 4ZKTB 4CDWC 2A70A 5F1RA 1AR82 1DQ5A 1MZ6A 2HEYF 3CNAA 1KITA 1IHMA 3H3ZA 4WZFA 1CESA 3AZVA 1H2KA 1PVC2 1H8VA 4QU2A 4FAHA 1Q8PA 2RM21 3RDIA 4K7JA 1GZWB 2O8QA 3HR9A 4AHXA 3WT3A 5F6KA 2R6QA 1LHNA 2WNVB 4XFFA 2OZ6A 4G9SB 1F8VA 1Y3TA 4WVMB 5BNOB 4Q1PA 3WW4A 1EPWA 1CAUB 1LU2A 1VALA 5IUQA 3ZSMA 2E7QA 1MQTB 4FVVA 3JQWA 4CDQB 4QMAA 4XHBA 1SLLA 4YSFA 2RS12 3CF6E 4XJWA 5FLJA 2KXLA 1ND2A 4RGGA 4YW4A 2QKDA 1OQDA 1ZA4A 4XHXA 3D0JA 1L3JA 4IEXA 4C1WA 3M3IA 1I5ZA 1LOAA 3IDEA 4LT5A 4CDXB 5GALA 1AYN2 2XWJB 2YHJA 1S0JA 4A7YA 1BBT2 3ZFGA 1BMV2 3ATGA 1VB2A 1RUNA 4HN0A 4XF4A 1UW8A 4X6RB 2XWBB 1NYWA 1BEV1 4YW2A 1V9U2 2ZTNA 2GNBA 1PZ7A 1GICA 2D98A 3B9IA 1FYUA 4HSLA 1QJU1 5IK8A 1IS4A 1LENA 1EAH2 1Q8VA 4FTBA 3UJQA 2AGSA 1RHI3 4FP2A 1DZQA 4KBBA 5JR7B 4COUA 4URTA 4C0HA 1HKDA 4WM8C 3GBGA 3JUUA 3MPPG 4HKOA 3EBRA 1H4GA 2D40A 5J09A 3THPA 2X29A 3PJYA 4MXVA 1AYM3 1UU5A 5EV7A 1R092 1VBB1 1F9KA 3OGGA 2I2SA 4CYDA 1BZWA 3RZZA 4XBNA 3VZMA 3VL9A 1WUVA 3ZXGA 3AZXA 4LULA 4PBOA 1AXZA 4JDOA 1SFNA 4CP2A 5K0UA 2XBO3 3BIWE 4HSJA 1UX6A 4C91A 1LEDA 5CBLA 3CJIC 1W6NA 3AP4A 1LJ7A 2ZCWA 4IEYA 3SCFA 5KHKA 5L7OC 3QLQA 3SH5A 3S7EA 2EA7A 1NCQA 3IN9A 5AC92 4JDNA 1RUD1 1W39A 3W59A 3INAA 4Y1UA 5BNNB 4NOTA 3ZN5A 4YARA 1LHOA 3N4MA 4IQPA 4N7IA 2BNMA 4FOVA 5L36A 1LOBA 2PLV2 4ISRA 3ZVXA 4Y1XA 4Q4V3 4WZCA 4MYEA 3BU7A 2QQPA 2Y0IA 2TEPA 4MH0E 5JSOA 1RMU1 3O7OA 1PZ8A 2UWBA 1LKNA 1PO21 3SH4A 1A8DA 2Q5TA 4R9CA 1D0HA 3JQXA 2O8OA 5KXEA 2A6XA 3WW2A 5B2GB 1I1EA 1N1VA 1GQHA 4TWTA 4TZDA 1UL9A 1LECA 3HN1A 3AFKA 2WS93 1SMVA 2XJQA 4EN6B 1H1AA 2VXRA 4RR3B 1SEFA 3OF1A 2PHUA 3ZMOA 1DYKA 2AH2A 1NG0A 1GV9A 4FSJA 4EV0A 1H8TB 2Y38A 2WZR2 2GU9A 5HCFA 1W0OA 2VOXA 2Z42A 3EHKA 3JD73 5C8WA 5CFCA 4COYA 1W6OB 4BCUA 1GLHA 4HPKB 1HLCA 4AVSA 2WNUA 3AJZA 4BIFA 3WCSA 4AFCA 1PK6C 3H7JA 5GZEA 1ZRFA 4Q2FA 5E88A 2Y26A 1X8EA 5LEKA 3VBOB 3WX5A 4LE3A 2D3RA 1QNWA 1SLBA 2JG9A 1HQWA 4B4QA 3OYWB 2CV6A 2PHLA 5GZCA 4CEWC 2D6NA 3DPRB 4IV3C 2R30A 1XYNA 4A7KA 3PLQA 4ONUA 5T52A 4K8FA 1C1FA 4QPIB 1GSLA 1EYBA 2MHFA 2PAKA 5I0RA 3U07A 4AI1A 2SLIA 1FMD1 4L8QA 3ZFFA 2H0BA 3KCYA 2BVVA 4Q8LA 3I4IA 5ABJB 2GNTA 3QCWA 1YHFA 1HDKA 5EYYA 1NA1B 4AEDC 3MDPA 4IV1A 1AL23 2D5HA 2ZBJA 1YFWA 4E27A 2UYBA 4Q4V1 2ZAAA 4IEUA 5J3UA 1AX0A 4JQRA 4OUSA 3ZYIB 1NLRA 3VBHC 5JDBA 4N43C 5E8AA 3BOPA 1JUHA 2NMNA 1S0FA 4LLOA 3S7IA 3IBMA 3M4FA 4Y20A 1APNA 5D8AC 1CIWA 2R043 4LHLA 3NV2A 3WZ1A 1HXS1 2HJIA 3U10A 2ZHMA 1ZZ7A 2IXIA 4U2AA 1YNAA 3SCGA 5K9YA 1RJ7A 4CEYB 1OSGA 4RQPB 4Q4Y3 2DWRA 3WLUA 5J98B 5CVRA 1Q8SA 1ZZ8A 2DTWA 1VB4A 3THTA 1C8NA 2JKBA 2WS91 1POV3 4JGYA 1UPSA 3P3PA 3FLTA 4LHNA 3ZXJA 1GBGA 4HLTA 1BJQA 1D4M3 2KM2A 4D7TA 3VDDA 3MPBA 1AR61 1FX5A 5LRRA 2JECA 4L92A 1TNRA 2XJPA 2XLAA 4WM7A 5I91A 2VQ0A 4YVWA 1PNFA 3JD71 1E57A 5T5LA 5H9QA 1V6NA 1ENQA 4DRVA 1MEC2 1RUF2 4JC1A 1HRV3 1R1A2 4ISQA 1SCRA 1VRH3 3VBFC 2Z79A 2P34A 4AF9A 2A3YA 3JU9A 4DB5A 1TNFA 1O5UA 4OHWA 2A7AA 4BZ4A 4R9BA 4MX3A 4X8PA 2E63A 1VP6A 4AGGA 3WCRA 1FOD1 4YVSA 2R073 1S2BA 3VL8A 4R9DA 2PA7A 2UWAA 4GULA 5I8YA 3NKTA 2BW8A 4WV8A 4YZ1A 4FPHA 5JI7A 2JE9A 4G4FA 4W6YA 4DY3A 1XXNA 3HMYA 1NE6A 4XTMA 3ZYJB 2DCJA 3FJSA 1PIV3 3ZXAC 4EN8B 2D6PA 5KBFA 2HKXA 2ZGQA 4AHWA 4MXWA 4QM8A 1EV11 2VNRA 2ZKLA 5FAXA 5J36A 4BMBA 2PN5A 5DUWA 5HCAA 3PVEA 1AZDA 3B3QE 3ZXLA 1RUC1 2BTVC 1Q8OA 4M0NA 1QNYA 4AWDA 1DYPA 1ZX5A 2R0HA 4LA2A 4Y24A 2IZWA 2WT1A 1AR92 1BVVA 1NCRA 1ULEA 2C5DA 4P9LA 5K7PA 1AR62 1TQ5A 1Z7S3 1CR7A 1LEMA 1NXMA 2B7YA 4Y1VA 2CNAA 4AI3A 5GKAC 4KWJA 1J1LA 3POYA 2WFF2 3TBDA 2D7FA 1WW5A 3LSDA 3KB5A 4W65A 2E53A 2OUJA 2QUOA 3UK9A 4EWEA 1VR3A 5GLUA 2DYCA 4FQZA 3E6DA 1NOVA 2WSUA 1GZWA 3VHPA 2VH9A 4Q4Y1 3B5LB 2WQZC 4PIYA 4Y4YA 2WNVA 4WM8B 3VKOA 2WC2A 5BNOA 4JTOA 3O0XA 1CAUA 2FQPA 1N3OA 1HQNA 3ZSLA 1POV1 1KD7A 2VW0A 1WD4A 3SLIA 2VOKA 4CDQA 1LHUA 3Q9OA 1G7YA 1OOPC 3KLSA 1YLLA 4FBFA 4XMIA 1WA4A 2WT2A 2XL9A 3J4UH 3VBUC 4AEKA 2R063 2OA2A 3AYDA 4KNCA 5C33A 1HRV1 1AR83 1EV12 1FI2A 2BUKA 1QOOA 1XNDA 3FMGA 2HYKA 3SH3A 2RE9A 1PNGA 5T3NA 2ZX4A 1UMZA 3J9SA 1QOSA 2C0ZA 2X5IC 1FPN1 5L7OB 3WDXA 3GBFA 5I93A 1NY71 1IS3A 2HWE2 3AKRA 1GKBA 2HEWF 3ENRA 1MS0A 1RL3A 4YM1A 5FRAA 3H1MA 4XW3A 2LALA 4LNVA 4XJ8A 4AXOA 4I0WB 4BWOA 1C5IA 1S55A 1O4ZA 1O7FA 4EN7B 3FC0A 3LZZA 1TE1B 2CY6A 2VY0A 4GQ7A 4HFSA 4YM0A 3MIFA 2DV9A 3B9CA 1YRZA 5KHIA 4JGZA 1G86A 1Z78A 1AYN3 1ULGA 2DCYA 4QD2A 2RS32 4YGEA 4AYUA 2RS53 4XTPA 5TSWA 3V56A 2XLFA 4BHPA 2VU9A 4FPKA 4KU8A 4IEZA 5DUUA 4GIQA 4JV4A 3ZN6A 1ZBA3 1KFUL 4CDUC 1MS3A 3I54A 1RUJ1 1UAIA 1V9U3 1Y9QA 3OCPA 3ZYRA 5IK4A 5CG9A 4YZ5A 1PGW2 4LTAA 4PDWB 4G3YC 1C8M2 1UD1A 5BNPA 4M00A 4Z1VA 3MGUA 1EAH3 5F9TA 2AENA 4AI0A 1GANA 2EF6A 4K9SA 1WCSA 3WDUA 1HRI2 3H0OA 1S1AA 3I2DA 3ZO0B 2VW1A 4PIZA 1FPN2 4META 1ALYA 1F2NA 3WDVA 3CU7A 3ILRA 1ZBE2 1OQEA 2HWC1 2QDRA 2P3KA 4UBHA 1O3TA 1WW7A 2JDZA 4HETA 4WVWA 2IXKA 2RJKA 2G9GA 3NKGA 1G9DA 5FMOL 1VBA2 1UZZA 2XG3A 4W6XA 4RS5C 4Y22A 4CEWB 4KWLA 4IV3B 4R4ZA 3UJOA 4D7YA 4GA9A 2I07B 4Q29A 1ULFA 3OY8A 3WQ1A 3VBRC 1X7NA 1K5MC 1RUI1 2GNMA 2QCSB 4SLIA 5JSRA 1AR81 4YNIA 3J26N 4BYYA 1QDOA 3USUB 1IKQA 4HVQA 4RHV2 5AC93 4WVZA 4RR3A 3HT2A 4AFMA 4AW7A 1DGRN 1B35A 1MR5A 1PVC1 3MW4A 2SBAA 2UU8A 1Y7BA 2BYVE 3H9AA 4FAGA 2E7AA 1H8TA 3JB4C 4EN0A 3ES1A 4KL1A 1OHFA 2WFPA 3BB6A 2PLV3 3I59B 1BEV3