2V4AA

Crystal structure of the semet-labeled prolyl-4 hydroxylase (p4h) type i from green algae chlamydomonas reinhardtii.
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
222
structure length
182
Chain Sequence
MVGFGEEWRGEVVHLSWSPRAFLLKNFLSDEECDYIVEKARPKMVKTSTGTWFAKGEDSVISKIEKRVAQVTMIPLENHEGLQVLHYHEHGGQRVVTMLMYLTTVEEGGETVLPNAEQKVTGDGWSECAKRGLAVKPIKGDALMFYSLKPDGSNDPASLHGSCPTLKGDKWSATKWIHVAPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Active Site of an Algal Prolyl 4-Hydroxylase Has a Large Structural Plasticity.
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Hydrolase
molecule keywords PROLYL-4 HYDROXYLASE
total genus 48
structure length 182
sequence length 222
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-06-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 2v4aA00
3GJAA 2G19A 4MHUA 2HBTA 5EP9A 5HV4A 3HQRA 5LBFA 3W20A 4IW3A 3OUIA 3DKQA 5IATA 3MGUA 4NHKA 2RDRA 4NMIA 5HV0A 5L9BA 4NHLA 2HBUA 4J25A 4ZONA 5LATA 5LB6A 5IAXA 4Y5TA 5C5TA 4JZRA 2RDNA 2V4AA 5M0TA 3OUJA 3NNLA 4BQWA 2FCTA 5LASA 4Y5SA 2JIGA 2FCVA 2RG4A 2A1XA 4BQYA 5EPAA 4NHXA 4NHYA 5DAWA 4BQXA 3W21A 3KT7A 5LBCA 5ERLA 4XACA 4NAOA 4XABA 5A3UA 4KBZA 3NNMA 4XCBA 4XCAA 3OBZA 2G1MA 3KT4A 3OUHA 5DAVA 3NNJA 3ITQA 3EMRA 2FCUA 2OPWA 4UWDA 5DAXA 2Y33A 3PL0A 5L9VA 2Y34A 2JIJA 4ZPIA 4XC9A 5IAVA 2RDSA 4XAAA 5LBEA 5L9RA 4NHMA 5DAPA 5DAQA 3NNFA 2RDQA 3GZEA 5C5UA 3GJBA 4MHRA 5EQUA 4Q5OA 5LA9A 3BVCA 3HQUA 5LBBA 3KT1A
chains in the Genus database with same CATH superfamily
2R7EB 2WLPA 3AZYA 3B3QE 4IESA 4TLGA 2YHJA 3WVJA 2CDOA 2DCJA 3H8XA 4GMP3 4YZ4A 2BGPA 2W95A 1AXKA 1NXMA 2D43A 2VMCA 5FUPA 2JXAA 3I2GA 4J6GA 5EYXA 3T2OA 4DNYA 1WUVA 4LPLA 3O0WA 3MGUA 4FT8A 4NHKA 4UFJA 2PHTA 1YQ2A 2HKXA 2VOVA 4CEYC 5ABJC 5CFDC 4AWDA 3RMXA 5L9BA 5CA6A 1ODNA 5JAXA 1MR5A 2CYFA 4Q4X3 4GAZA 2QVSB 3MUZ1 5F2WA 2JD9A 4IE0A 1ULPA 1LHUA 1VRBA 2XJTA 1VALA 1POQA 3KVAA 3M3QA 1WMFA 2MEV2 3NV4A 1H8TC 1F31A 1K5JA 2EXJA 1YJLA 4MVTA 5FYMA 3VKLA 4C0HA 2Y0OA 5FYYA 3W5NA 4BQ4A 1JYVA 3U11A 1DZQA 1J83A 2VZ1A 4MSVA 4JDOA 3ZR5A 3VZJA 2C26A 3V0AB 1UY1A 4AQSA 1Y9QA 1YQCA 1QMJA 1UZZA 4F7ZA 3UL2A 1OFSA 1YHFA 1GUIA 3POFA 5FWJA 1DQ5A 4H2AA 2JX9A 5FKCA 3ZN6A 3KHCA 1HDKA 2BJSA 4XMIA 3B69A 1DG6A 3D82A 3ZYJB 3W21A 1VBA3 2RS33 3WUDA 2GALA 5J96B 2HWD3 1SFPA 2D6MA 2RS52 2VM9A 2LS6A 2DU1A 4EQVA 1APNA 5FP3A 2AEZA 4YYOA 1RUJ2 4K1ZA 2R043 2W5FA 4YW6A 4FPOB 1PMJX 5FV3A 5A6XA 5IK5A 5FYCA 4RA0A 4QPWA 5CG8A 1VAMA 3M4FA 3UESA 3VL9A 2VMHA 1FPN2 1S0JA 3FJSA 3S5AA 4YVWA 5T3NA 5JOYA 2W91A 1XE8A 3SXWA 4BJ0A 5HI0A 3MEPA 3T4VA 2XKOA 1X9PA 3WP5A 2FCUA 3CF6E 4HXCA 4FFIA 4UYBA 4Q29A 2RR12 1WLTA 2ET7A 3MO4A 5FYIA 5FOBB 1L7QA 4AEDC 5BNPA 3HNMA 3O7OA 1UAIA 3I3QA 1ULGA 1DQ6A 5IK4A 3I2FA 1TG7A 4UF0A 1VP6A 2X5IB 1ZA7A 2WNUB 3NNFA 1NQDA 4DQAA 1H0BA 2RM21 1LESA 1HRV2 4Z92B 3NNGA 4O7XA 3PU3A 2J1EA 2UWBA 3WW3A 1BJQA 4OHVA 3WX5A 3ZYPA 5A32A 1ND2B 5F39A 3CIHA 1PM4A 5LW9A 1S0BA 4O9GA 3WQ0A 3VBOA 2WKKA 4DMIA 1QJU1 1NCQA 3HQXA 1F5JA 4N43C 1UMIA 1PO12 1UZ0A 2VL4A 1AR61 1OA2A 2R042 1SCRA 2WWSA 4OUSA 2DVGA 4QB6A 4XUQA 4HVOA 2ZKLA 5CZKA 5FK8A 3IIIA 3BUCA 2RMU2 5HV4A 5CFDB 3ZOIA 1REEA 1UNBA 4OHXA 3TB0A 2XDVA 4EV0A 2WSVA 2XOMA 4XPVA 4YFWA 4QX8A 2AC1A 5FPAA 4PJYA 1ULDA 4MGQA 5BNOC 2YBSA 4KGQA 2QQKA 3ZFFC 4C1XA 2V5DA 4COWA 4QB1A 2HEVF 4NMIA 2WNUA 5L7OC 5EZWA 1QOOA 5FPVA 1NY71 3PMEA 5KWRA 4TXWA 4P00B 2BNMA 1UYYA 2BFUS 3HT2A 4FFFA 1UY4A 1X8MA 3GZTB 4Y5TA 2AYHA 3VBSA 5C5TA 2Q8EA 5IJRA 2BDRA 1RUI3 2JD4A 2R16A 3APBA 5K7PA 2HWE1 1BVVA 3IDAA 3NW4A 1FATA 4GD4A 3KM5A 3O14A 3OUJA 2JWPA 4AVCA 3MPBA 2QE3A 1RUE2 4K40A 5C3QA 4YVWB 2FCTA 1LENA 2JDYA 1COV3 1YIPA 3I2IA 1QH6A 2R061 3M2MA 1BLZA 2W1SA 2ZMKA 5DUUA 4DPNA 1RYYA 1U5IA 1LECA 2RE9A 3CJIC 5EXOA 2UWCA 2W0XA 3HPNA 1PVC3 3I2HA 5KXCA 3NJXA 1PGW1 5FZOB 3ZFGC 4BXFA 5DAWA 2ZHNA 2YU1A 4ZU5A 4IV3C 3O12A 5F5AA 3TEWA 3EO6A 2WWUA 3GDBA 1IG0A 4XACA 4WV8A 3T08A 3WLUA 4AFDA 2DURA 3OY8B 4DXRA 2RVAA 1QJY2 2E31A 3GF6A 3JUUA 1V0AA 2HWF3 1CZSA 2G1MA 3GM8A 4OI2A 3K3NA 4P9LA 5A1FA 3EBRA 5CKNA 4MV2A 1D0HA 1RUG1 4N43A 3URFA 5JZGC 1K5MC 5H9PA 1SQ4A 5F5CA 4UOJA 5FZHA 2RM23 2R6QA 3CMGA 3ZO0B 1TME3 4MO3M 1D2SA 3BOPA 1LB2A 1VBA2 1WBFA 3PL0A 4W65A 4Y20A 3FE5A 3OGRA 1V6NA 1DBNA 4FAHA 1VJ2A 4Y22B 2IWGB 2ARBA 1NT0A 2ZGNA 1W0OA 4MGYE 5F37A 2B8MA 4EWDA 1COV2 2FZ1A 1LHOA 1JYIA 1E5RA 2OS2A 1LNSA 1GNZA 2BNNA 2EA7A 2VNGA 4RGKA 4Y26A 3ZSKA 1LU2A 2DWRA 3VBOC 1FMD3 4L9BA 1MPXA 3A22A 3P3PA 2B5HA 5C5UA 5KHIA 1RXFA 1O4TA 4DEVA 5FY9A 5FMOS 5CU1A 1H6XA 4N7UA 3LGRA 1FMD1 4A2UA 4RL7A 5LBBA 2DCYA 1KS5A 2K46A 1GANA 2ZEWA 4AG4A 4JCKA 3OGJA 3P1IA 3CZJA 4KWUA 1RMU1 3LDKA 5FLHA 3MLJA 1YQ8A 5DUWA 4HSLA 1HB2A 4NO4A 3ACGA 1PO22 1U5YA 4EZ4A 5J09A 1Q3EA 1R64A 2ZGSA 1FOD1 5FYZA 1ULOA 5LK5A 5T55A 3RFRA 2P3IA 4IGPA 1VRH3 3ABZA 2OA2A 3OTFA 4QT6A 1CZTA 3RGBA 5KC6A 1C4RA 3HOBA 4NWVA 5FPXA 1ZRFA 4Q4Y1 3ZKUA 4CU7A 3U78A 2HWC2 4IXLA 2FMDA 2NLRA 4JGYC 3DYPA 5FP8A 1NOVA 5FPBA 5A7WA 4B3NA 4BDVB 5FIXA 4OI1A 1V70A 1YYNA 2XWBB 1VBB2 1O91A 4QMAA 2EF6A 2WN2A 4DOUA 4JV4A 3UGGA 4BQ2A 3LWCA 2VD7A 3A4UA 1IZ3A 1XOYA 4E4DX 5A7QA 4G9SB 2AENA 4IEYA 1OFNA 4YVWC 3H42B 4IE6A 1W6MA 2ILMA 5A80A 2ZTNA 2RS12 2W39A 5ACA2 2ZOEB 5I91A 4MGZE 4XFFA 4UBHA 4CYDA 1C8NA 1NLQA 1UO9A 2ET1A 4RSUA 4FTEA 2X8KA 2WO1A 4IGQA 3MF6A 4A7KA 1PGSA 2HLEA 1OLME 3HT1A 1VBC2 2GNMA 2VNRA 4A7YA 4GZ9A 4K1YA 1V9U2 3ZFGA 4HETA 2VUJA 1PNGA 1NUKA 2YG0A 2PLV1 4KH9A 3NV2A 4C8DA 3USUB 5FO8B 3CQOA 4LBOA 3AJYA 2D3RA 1LOCA 4YVSA 3KWVA 4LEJA 4HN0A 3SISA 4Y4YA 1H8VA 3BPSA 4NHXA 5JWPA 1JYWA 2VMEA 5FOJB 5DDJ1 3ZLIA 4EYUA 3QH6A 1DZRA 4YFZA 1K5MB 3Q9OA 3AMMA 1GOHA 3MV11 1YRZA 2B4KA 2Q4SA 1RUNA 1YFYA 3UT0A 3LPFA 1RUC2 3ETPA 4CCNA 3OG2A 4DZGA 2C9KA 1TZOA 3MLKA 3FHQA 3N3HA 1JOBA 5FZ3A 1SBFA 4A41A 2O8QA 1H2LA 2Z2SB 4UWDA 1QXPA 4OHWA 5FUIA 4AR2A 4BQ5A 1TQ5A 5ACA3 3IAQA 2Y34A 3OPZA 3ZFFA 3MICA 1YFWA 3CBNA 3GYDA 4B1LA 2OQ7A 2BGCA 2ZGQA 4OMDA 4XC9A 3VD9A 1VBD2 4NVPA 2HWF2 2ZX1A 4XAAA 5CBLA 2WNUC 3PUQA 2J7MA 4URTA 5L7OA 1ODMA 2VZTA 3NWKA 2PHFA 4ZS2A 1RUH3 2LRPA 4AEKA 4SLIA 5JSRA 4CDXA 4K3UA 4LOTA 4FBFA 2ENRA 1W2NA 2OUHA 4BU2A 1GBGA 1YC61 3ACHA 3WCRA 2P3KA 3GJBA 3M3CA 4MHRA 5H9QA 2ZABA 4QPIB 2FZ2A 2IXHA 1IGOA 3TRSB 4UAPA 4D6QA 1W9YA 1U5ZA 1CAWA 1RUD1 3VDBA 1DGWX 1KS4A 3Q8CA 3TN92 1RUE1 1SLBA 3WSOA 2YMZA 4Q4X2 1G8WA 2E51A 2VTFA 3M3OA 4ITCA 4Y24A 3PHMA 2BBVA 3CDZB 4D7YA 5EJ1B 4BPZA 4EN0A 1OLRA 1C5HA 1OUXA 1NCRC 5CYYA 1FV3A 2ZEZA 1UWWA 5JR2A 3TEZA 2C4XA 3VD3A 5FMBA 5H9SA 3RZKA 5T5LA 1G9CA 1Y9MA 2XL7A 4X6RB 1R1A2 3USSA 1ZBE2 3ZFFB 2LW8A 3POWA 3U07A 5GLVA 2ERFA 4FPKA 4DUXA 4LIVA 4L2NA 3THCA 3LB9A 3N7KA 4FTBA 5FY5A 4NPRA 4CDXB 4AVVA 4XETA 5EFUA 3P5BA 1LULA 3LFIA 5C8CB 4WVWA 1A8MA 4OFGA 3S6PA 3I2DA 3VKMA 3SITA 1LAJA 4EN7B 4M3CA 4J1WA 1KFUL 3RVHA 3JBG3 3VB9A 2QQJA 3RWNA 5HCHA 3ZVXA 4CCDA 2RS53 3AYEA 5DG1A 3DECA 3T30A 4JRLA 3O1MA 1W6OB 2A3YA 2BW8A 4MXWA 4D8MA 4C91A 1NCRA 2Q1MA 3J8F1 1UOGA 5A3TA 1W06A 2BWAA 3A21A 3GALA 2ARXA 4AHYA 1SPPA 3B9CA 1GKBA 4MXWB 4UT5A 4ZU4A 4NWWA 2W68A 5FZ6A 5JPNB 1NA1C 4PLNA 3WNPA 4AW7A 4MGKE 1HQWA 4KQ7A 1JOPA 1H1AA 5B4NA 4FPYA 5CKQA 4BLJA 4NAMA 4DUWA 2E32A 4LTAA 3LFMA 5LY1A 4M3CB 1C28A 2FDJA 5C8WA 2D5FA 4CP2A 5FPUA 3RZHA 3B9IA 3PIGA 3DUIA 1POV1 3AZZA 3GHNA 3RDIA 2WFF3 1PMIA 2BU9A 4PHZA 4WM8B 1HRI2 3GHMA 3HIFA 1YJKA 1VBE2 4QD2A 2VXRA 3ZIXA 3DEMA 1HXS2 4IE4A 4XF1A 1PGL1 3FBYA 2VO5A 1LGBA 2VU9A 1UIKA 5CIRA 2WAAA 2OPWA 4AVBA 1MQTB 1XYOA 3PTYA 4RQPB 3T0BA 4W6XA 2H6BA 4EJRA 2GP5A 5KC5A 1VRH2 4CDQB 1BEV3 1ZA4A 3AYAA 3ACIA 2R073 1NA1B 1JHJA 3RSJA 2VGDA 5DAQA 4Q26A 2JDAA 2UYBA 1RGSA 2WNOA 2XJUA 4M0HA 4QKBA 4MX3A 1H9WA 2BOIA 5LRRA 1OURA 3AXEA 1OD5A 2WQZC 3HWJA 4P9XA 4GWMA 1RINA 1H6YA 5ISLA 3OEAA 4QQOA 5EIYB 2J1TA 3ZSJA 3B5LB 4QU2A 1XRUA 3A0NA 2VOWA 2Y26A 1SPPB 1XNBA 4EN6B 2CGOA 1OKQA 4FOYA 1DFQA 5KHGA 2Z69A 1QY4A 2RM22 4BISA 4WZFA 4GMP1 3AL6A 2DFCA 2VZSA 1VBC1 2OYZA 4E2GA 1Q8SA 2W08A 4E2QA 2C0ZA 5C33A 1W2UA 4W6WA 2ARAA 5IYYA 5FMDA 5L19A 4PDWB 4CU8A 3N9OA 4IE5A 5DZGA 2ZHKA 4AEMA 1VB2A 2YB7A 4I0BA 3W20A 5LK7B 1W8FA 3DKQA 1PO11 2R30A 1REDA 3ALQA 5DDJ2 4NN0A 4D0QA 2F17A 1S0CA 1XSQA 1N3QA 5D8AB 4KU8A 1UU6A 4DB5A 1D0GA 3ZN5A 3IAPA 5AC92 4Q1PA 2XJVA 3MV01 1AX2A 4JGZA 4QPGB 4CU6A 4YW5A 2MNGA 2JG9C 4N43B 4FPGA 4XJZA 4L92A 1RUOA 3M1HA 4NIGA 2SBAA 4LBQA 5ANQA 1IQAA 2RR13 4JGZB 4QPGA 4Y1YA 2WT1A 4JGYA 5ANNA 1JXNA 5K0UB 1DQ4A 2XHNA 4U36A 4JTOA 3POEA 5FZ8A 5E16A 4LT5A 4I0AA 1O59A 4PT6A 2OXBA 1F5FA 5L73A 5FP4A 3N35A 3ZFEB 1XXNA 2RJ2A 3MIHA 2YGLA 1GZWB 4DRRA 1W3XA 2A6YA 3PLQA 1JI6A 3Q8BA 2Q8DA 1O8SA 1GWKA 2WDBA 1UY3A 4GALA 1WLDA 1CAUB 4BK5A 4XUOA 1EAH2 4Q4V1 4AE2A 5FYTA 1JZ6A 5FQ0A 3JCIA 4FPEA 2PAEA 3JD71 2WNEA 3LSDA 1LRHA 4AAXA 3KT7A 2OX0A 4DXSA 1EYBA 5I8SA 4LA3A 5DZEA 4CDQA 3KF3A 1CESA 1KDMA 1LCLA 2O0OA 2WABA 4FPCA 3V0AA 2YFZA 2Y6FA 3ES4A 4N9HA 1LEDA 4L99A 3E97A 5FY0A 5I8TA 3RZGA 4QPGC 1KITA 3KT4A 1ZRCA 1XE0A 4Q0VA 3UGHA 4WBBA 3L2YA 1HIXA 4GH4A 2R041 2XG3A 3B00A 3BYWA 5LRSA 4BYYA 1N1YA 5DABA 2NPIA 4AI3A 1EV11 3T09A 3PVOA 4KNCA 1XJAA 3AKTA 4IEWA 2Q8OA 5JUVA 1W8ZA 1Y3TA 1WKYA 4ZPIA 1WLCA 3E6DA 2DTYA 2BYVE 1AL23 2RV9A 2XHKA 1OF3A 1MS5A 5C71A 1AR73 5CFDA 1PM7A 3BN6A 4IERA 2NMNA 3I7DA 3V56A 2EIDA 2SLIA 4Y22A 1HB3A 3CJXA 1VPHA 2E6VA 1AL21 3H8UA 3ZPYA 1QJX1 4AI0A 1ND2C 1TME2 1NCQB 4BZ4A 2JB4A 1NCRB 1MS4A 3AK0A 1R081 1W0PA 4OZXA 4I3GA 4UW6A 1UZWA 1JTZX 1RUC3 3E1F1 2AZ5A 1KGYA 1QJX3 3N7MA 4QDRA 1O7FA 4PQ9A 1JUHA 1YUDA 4P9WA 2ZGLA 3LAGA 1JS9A 1WZXA 1F4HA 5FZ9A 1BK1A 1QGLA 1O4YA 3CU7A 4DO0A 2VTXJ 4Q4W1 1OOPC 4TLFA 4CP9A 5FZKA 4LJHA 1OD3A 1HB1A 2AR6A 2P34A 3P6BA 4DFSA 2Y8KA 1CX4A 4V2WA 3VBOB 4LE4A 4LUKA 1UW8A 3I3MA 4Q4W3 1UMZA 5LA1A 1A6CA 2A6VA 2DCTA 4OCTA 3VKOA 4E27A 1TMF1 1A78A 1G9DA 2IXJA 1ULFA 4YARA 4YGDA 1CX1A 3LQCA 2GNDA 3SKJE 3ZYFA 3IIAA 3KMHA 5HCFA 1N47A 5LATA 3KCCA 1OKOA 4QDQA 4AF9A 4BCUA 4I30A 5HBAA 1QJY3 1IG3A 4JAAA 4HOOA 4KWLA 4ZKTB 5JCTA 2JJ6A 1OXCA 1VBE1 2X10A 5M0TA 2YBKA 2XJRA 4YM2A 2ZX4A 5EJZB 5B4XA 1QJU2 1JW6A 4XUNA 1QU0A 5GZDA 2DF7A 2R063 1EPZA 4QXCA 5FZ7A 3BIWE 4GH4B 1W8WA 2XH6A 2XWJB 4DEQA 5FPZA 3O1UA 4TZDA 2BEOA 1OOPB 2FCVA 3AP5A 4C0BA 2CAVA 2NZ9A 4NPMA 3Q8FA 1E57A 1LU1A 2ZZQA 4LBNA 4PLMA 4WM7B 4BQYA 1HKDA 5FZBA 1COV1 3AZXA 4F3JA 4AGGA 2GMMA 3GCXA 1DYOA 2QQWA 3BTAA 1NLRA 2QQPA 2OKXA 3WNKA 2ZAHA 1WA4A 4RR3B 4ZZ8A 3T2TA 1C1FA 3CLPA 3WEZA 3LOBA 4B8EA 5A3UA 5LA0A 1ZREA 4KBZA 2D93A 1BXHA 1NZIA 2VMDA 1S0IA 4UI9L 3ZSLA 2X5IC 4SBVA 1OQ1A 2WZ8A 3TNQA 4BIFA 1MVEA 4M3CF 3A7QA 2HWE2 3E6BA 4QXHA 5A3LA 1SFYA 1Y4WA 5LEJA 4P9GA 3ITQA 1MZ5A 5K0UA 5C70A 4INDA 1MQTC 3U4SA 4FAGA 2VZQA 4IV1A 3VBUC 4FP3A 1H4HA 3ZYGA 3OEBA 4CP1A 1R083 1RHI3 1VE0A 4OQ8A 3OCPA 4ORFA 5D21A 1RUC1 3O1RA 3LIHA 4P14A 1AR92 1XQNA 5LBEA 3UJOA 1UPIA 3VHPA 4NHMA 4EE2A 1YNAA 5C4WB 3R4UA 1A34A 4FPHA 4QX3A 5IW0A 3RJ2X 2YC2A 4FFHA 4EROA 3J7NA 5GLTA 5F5QA 3SLIA 4DIQA 5HCAA 1SG3A 1GP4A 1BKZA 3IWZA 4XURA 1Z0HA 1RJ7A 1TNRA 3NJZA 3ZXJA 1C1LA 1U12A 3J26N 5C3OA 1WCSA 3V65A 3VHRA 3M8LA 1K45A 1UL9A 2ZEXA 1I6XA 5JMOA 1CGPA 1LHNA 2D6OX 2VZVA 4OVEA 1YWKA 1JODA 3NKGA 3HR9A 2WT0A 1ZBE1 4HANA 1GFF2 2I45A 2XONA 4XIOA 1JH5A 4C90A 5BNPB 2IC1A 2AH2A 2HWD2 3B94A 2VC9A 4HSJA 5J98B 5LBFA 1NAEA 1GNYA 2RS32 4HMZA 1ZRDA 5FJHA 3VBHB 4YGEA 3POBA 3HNBM 5FYHA 1EAH1 3OUIA 4QKNA 4LMFA 1K3IA 4D6RA 4JGZC 1GWMA 1KXGA 1J3QA 2DDUA 4L0PA 4FQZA 2W1UA 3MW3A 2CGPA 5FXWA 4MZUA 4CPBA 1K42A 3BODA 4V2VA 1VBB3 3FHAA 1S0DA 4XUTA 3ASIA 2WN3A 4P9IA 2ADDA 1WCDJ 3UGFA 1GZWA 2XVGA 1R1A1 1QEXA 4PBOA 3H8RA 4ASLA 1W6PA 2Y6GA 2E33A 1RUF1 5JZGA 2OPKA 1IPKA 4OULA 4KU7A 1UOJA 3U10A 3MIBA 4UXAA 1GZTA 4CA9A 2JDUA 3SMHA 3U14A 1YQ6A 3VLBB 3H3ZA 2GC2A 4XBNA 5A7SA 4PIYA 1X82A 1ZZ6A 3UK9A 1H8TB 4XZPA 4IV3A 2JIGA 1S2EA 1AX1A 3D6EA 3LEGA 3C8XA 1AUYA 1MEC3 2QKDA 2X29A 4AZZA 2DVDA 2WSUA 3BPZA 1PNFA 5LBCA 1C8M2 3BGAA 3IMNA 5JXGA 2QFEA 2L9LA 3I4IA 1WD3A 5FZEA 4CCEA 5K9YA 2D98A 4GWIA 1GZCA 1NKGA 4XXPA 3WF3A 1OA4A 4ZXEA 2OW4A 5A6QA 4IL7A 5FY7A 2PELA 2IFRA 2FD8A 3AMNA 5D8AA 3GBFA 3RJRA 2RJKA 4YZ5A 4BQ3A 5A3NA 2VZUA 2FDIA 4JQRA 2CGNA 2VOXA 5CAZA 4YW4A 3KV6A 2NYYA 4R9BA 3FL7A 3THDA 3VBSC 5ACA1 4RR3A 2B7YA 2TNFA 3FFZA 2CWMA 3LE0A 3MFCA 4Y33A 1VB4A 3WDVA 4M3CE 4D69A 2P3YA 3LD8A 4AI9A 4XJ9A 3EMRA 3WW4A 5DAXA 1W9WA 2ZGKA 1IHMA 4Z8BA 4CUCA 4X8PA 4OQ9A 2JG9B 3FUQA 2B46X 5I0DA 2ZGPA 1XYPA 3UKNA 4WVMA 5IAVA 2FBEA 5C8CA 4YVSB 2ZX3A 3SCGA 1W8TA 2PHDA 3MIGA 4Y4RA 3ZXLA 4IEZA 5E88A 3BI3A 1Q8PA 2BVBA 2PHWA 2BVVA 1MVQA 2VBDA 4P08A 4R9DA 1YLLA 2W52A 5JI7A 3O1SA 1PO21 1VRH1 2YGMA 4QPIC 4ARYA 1KQRA 4PBPA 2GC0A 4QQPA 3ETQA 3SHRA 3VDAA 1FT9A 1LGCA 1RUJ1 1WD4A 4LKSA 4AAPA 1KRIA 5KHKA 4XF3A 1OLQA 2Q1FA 2R071 3WQ7A 4Q4Y2 4B4PA 4A4AA 3POYA 2Z4FA 2VBPA 1DLLA 2EALA 1RUJ3 2ZHMA 2ZJCA 3KT1A 4NE9A 3VBFB 4DXTA 5C6CA 4BB3A 3FX3A 1GNHA 2XQXA 3IDBB 1AR81 3T2QA 4IGOA 5EP9A 2HBTA 3DPRA 3HNYM 3LEKA 4RHV2 1RUE3 2WUHA 1QNYA 2WA3A 1GZ9A 1I9RA 4QPIA 1F4AA 5FZ1A 1PHMA 1HV0A 1XNCA 2TUNA 2GDFA 3ZXAC 3VDDA 4S2DA 1W0NA 4Z82A 4NIHA 4HL0A 3PVEA 3WHUA 5BNPC 5IFPA 1CPMA 1AXZA 3FUOA 1OVPA 2WRAA 2WA4A 3N9QA 1SLLA 3OPTA 4IEQA 2O1QA 2XLAA 4NHLA 4QKFA 4XHXA 3LKJA 4J25A 5GJ6A 3ZYIB 2DVBA 5C8CC 1Q8VA 3AP9A 3KQ4B 3AFGA 1JZ5A 4PI2A 4Q2FA 5FKBA 3AC0A 5KXDA 3C3VA 4QX7A 3VKFC 1E5IA 1WW5A 3SEEA 4DY3A 2VMFA 3RI8A 5EWSA 4ARXA 1BYHA 4YM1A 2IUWA 2DUQA 2WS92 1I5ZA 4Y1ZA 4DXZA 1PGL2 1PIV2 1RUD2 3BTXA 2XXZA 3NMBA 4XFAA 1XYNA 4PDWA 1O3SA 2P1BA 3JD72 4XYXA 4URAA 5GM0A 4LHKA 3BTYA 1DQ2A 2PMWB 2HWB3 1EUUA 3X29B 3NSTA 2XB6C 1N1SA 5HCBA 2VQUA 4O9EA 4Q8KA 5C3SA 4CXWA 1AVBA 1SZBA 3J8F3 1P8JA 1OA3A 5GALA 2HWB1 1V6LA 3NJVA 4AL9A 1HX6A 3UKVA 4R9AA 3IN9A 5JOWA 4AEDB 3K75B 5BY5A 2ETEA 4U2AA 5HPOA 3RYKA 5C9AA 2O8OA 2QZ2A 3HEIA 1W6QA 1NY72 4YG6A 2MHFA 1B35B 3RMYA 1FAYA 1MS0A 3OBZA 3SC7X 1EV12 1ZZ7A 3USUA 5H9RA 3DCQA 4YZ3A 4OHYA 1YFXA 3FLPA 4K8RB 1QJFA 2PA7A 3R05A 4PF5A 3LOIA 3UYJA 1XB9A 1DLCA 2H0BA 4V1PA 5L36A 5A1AA 2BZDA 5LA2A 2F4LA 2XJQA 2HWD1 3NAPC 1CIWA 1NZCA 4TN7A 1YCIA 3E6CC 1L7RA 5L9VA 3UV9A 1W6MB 1WBLA 5LCWL 3INAA 4KL1A 1LEMA 2D6NA 3J8F2 5GZEA 4AVSA 4CEYA 5ABJA 3RZLA 4CEWA 5EYYA 2W87A 2EAKA 1R1ZA 2YV8A 4IV1C 3WR0A 2E53A 4Q0UA 4CEYB 5ABJB 3VHNA 3H0OA 4AI8A 3MLLA 2DUPA 4JC1A 1DQ0A 3NVCA 4AEDA 3ORJA 1RC6A 1ASJ2 2RDQA 2Y6HA 4BHPA 3GZEA 4QDSA 3PUHA 1OI6A 3KCXA 1S0EA 2AUYA 3LDRA 4I09A 2WZR1 1WGPA 3O1PA 1ASJ3 3AZWA 4Q4W2 4DINB 1S2KA 5FFOC 1JOJA 5SV8A 5JOXA 1BHGA 5LA9A 1J1LA 4UBGA 4AFCA 3PUAA 2GU9A 4EN9B 3SQOA 2HYKA 2ZACA 3H8OA 2QNKA 1UZYA 2WZR3 1HQLA 4XJ8A 1CN1A 1QKQA 5FZMA 2XQRA 4K9SA 1ND3A 5SV5A 3PJYA 2E7AA 2WT2A 3AVRA 1OH3A 4GKXA 4N53B 3F95A 1PO13 1S1AA 4XFBA 4AHZA 1BBT2 1N1TA 3JB4C 4JHTA 4CE8A 4HZFA 2JE8A 4H3WA 1VBC3 5JMCA 1LOEA 4Q4V2 1SDWA 1LJ7A 1TEIA 4IW3A 2VCCA 4N90A 4Q4X1 3WHTA 1DDLA 2Q1ZB 4M4RA 4ISQA 2ADEA 3ZKYA 1EY2A 5HV0A 1O6UA 3QLQA 2VECA 1XU2A 2XBO2 3MYXA 3ZM8A 3POGA 4CRQA 2ZX0A 5FY1A 4AFAA 5JPMB 2WNVA 3IM0A 3T1MA 3SCHA 5IVVA 3AFKA 4I01A 2P6HA 5FK7A 3SEPA 2VZRA 4E2SA 4YLZA 1UPSA 2X09A 2JKBA 5K0UC 3VKNA 5D1IA 3DYOA 2ZGOA 1PX3A 2P4EA 4XBQA 2Q8CA 5C4WC 4FFGA 1BBT3 4Z07A 5J7MA 2OIIA 3SCFA 3DXUA 1H4GA 3D4KA 4X8NA 2NM1A 4AI2A 1RVF1 2R49A 1FX5A 3MDPA 3T4HB 3JD73 3WG2A 1GICA 2D3SA 4Y3OA 1SCSA 4GWJA 5GLUA 4KI5M 1ZRRA 1KFXL 3RYRA 2A75A 1OOPA 2FMYA 5I93A 4ATEA 2YY1A 2N7GA 4AHWA 3AKRA 2PXJA 3SH5A 4W6YA 1BMV2 4XF9A 1CAVA 1Q5OA 1W6PB 1SDDB 4YGCA 4CEWB 5JZGB 2FDFA 4R8HA 4JDMA 4Q4V3 4YRDA 3T2PA 3JB8A 5FXXA 4NPLA 3GBGA 1Y9GA 4B4QA 4CDUB 1KDKA 3T3YA 3U75A 2KD7A 4LR4A 4D3WA 1G9BA 1HV1A 2P37A 5DAVA 4OYUA 4CEWC 1SEFA 1W8OA 1QF3A 3H7YA 4HKLA 5D8AC 4AHXA 1AYM1 4RHV1 1KD7A 4WM7C 1W05A 3LDBA 4MGSA 4R4ZA 2J1VA 5FYSA 3E5XA 1PMHX 4H7MA 1XC6A 4OLLA 5BUVA 5FZGA 3HN3A 1WCUA 1V9U1 1D2QA 3AKQA 1GMMA 1OF4A 4G4FA 2GMPA 2GC1A 2VNVA 1N1VA 4YW7A 4N8MA 1VMFA 3RPQA 1X50A 1GOGA 4LO6B 1DHKB 5KXBA 5EV7A 4PCRA 3ROUA 4XQ4A 1NQJA 3VBRC 1QJU3 1UXZA 2ZGMA 3WNMA 1MZ6A 2LROA 4ZZ5A 3B7MA 3MBWA 1NX9A 4QKDA 1JUIA 1GYKA 5BNNB 2F4PA 2GAUA 2B9VA 3VUOA 4W4ZA 1FPN3 4LLOA 3K46A 1AZDA 1HN1A 3AP6A 1W8HA 4IEUA 3RRDA 5C7GA 1JZ7A 3PVNA 1ZBA3 5FWEA 1PZ8A 1US3A 3IBMA 3CZUA 4PLOA 1VMHA 3ZXEA 4KMQA 1QNWA 2J22A 2GN3A 5LEKA 2WO7A 4CCKA 4BM8A 3HQRA 5FZ0A 3M3IA 1AR63 5HXVA 3WDYA 1OLMA 4R52A 1JBCA 4YPJA 1HJGA 1AYN3 2YC0A 3GGLA 5F3IA 5JOZA 4DY5A 1O5UA 4M0NA 2Q30A 4N53C 4W50A 3VZNA 1W6NB 5FTTC 5LY2A 2EICA 1OVSA 4GXLA 3R6SA 2ARCA 2QQMA 2Y6LA 4B1MA 1U0AA 3MIDA 1IS6A 2VVEA 3ECQA 4G3YC 5I8YA 1GOFA 5F3EA 1QJX2 5LB6A 4RS5B 1MS9A 1H2MA 3VDDC 2Q5TA 2VXJA 5F32A 5BNOB 2RDNA 4QM8A 1W04A 4Q8LA 2YPJA 4ONUA 1X8EA 2YFUA 1UU4A 4LORA 4TYSA 4X6QB 2VCAA 3QD6A 4ASKA 2ZXQA 3OPWA 4FQ4A 4RN5A 4AQTA 4B7EA 3OYWB 1RUI1 1JZ3A 1HRI3 2YXSA 1VBE3 4CDQC 5FCCA 3VDDB 2JDNA 4Y1XA 2BV4A 2CNAA 2Y60A 3D5OA 1AR91 2A1XA 3BALA 4I0WB 5FJKA 1JN2P 2P3JA 3ILRA 3DF0A 3VHOA 4CP0A 2LALA 4GWNA 5K8SA 1OPMA 4GA9A 2XLFA 4XJAA 3VBFA 4RR3C 2RHPA 3LF7A 4HN1A 1WLWA 1WA6X 1X9TA 3CKHA 1UY0A 1IS4A 4XDPA 1J3RA 2D6LX 3ZXFA 3NNMA 3AMPA 1CQ9A 4MG2A 3VBHC 4ES8A 1ZVFA 2PHXA 1CWPA 5FZDA 4BLIA 3N4MA 1QQP2 1BCXA 1Q43A 5FREA 3CJIA 3KF5A 4NIAA 2XPJA 2VE1A 3I2OA 1MEC1 4FOWA 1QIQA 2ZHLA 2WC2A 5IVCA 3ZFEC 2VJXA 1FYUA 2P2KA 4IV1B 5FMCA 2I74A 5A7PA 1RHI1 1CR7A 3RYPA 3WUCA 3R4SA 3V0BA 2DCKA 1AX0A 5CVRA 2GNBA 3N7LA 4WVMB 1LOFC 1MS1A 2Y0IA 3SNMA 3VBRA 3WXPA 4D7TA 2A70A 5BYNA 1JZ2A 1UQXA 5GZFA 5D2AA 5AC93 1TME1 3B02A 4OHZA 3VV1A 4WM8C 3HBKA 3LA7A 4L97A 4YM0A 3W59A 1JZ4A 5A33A 2XBO1 3WG4A 2R072 3C7HA 5K4LA 1RB8G 4JKKA 3LEMA 2CY6A 2MEV1 3MPPG 2D44A 4FXGB 3FMGA 4HK9A 2QQNA 2VUDA 3WDXA 1QDOA 3ZXDA 5F2SA 4HK8A 4JKMA 3WZ1A 1O3QA 1PVC2 4XDQA 2CV6A 3WNNA 4CDXC 4UW5A 2DVFA 5LZ6A 3THPA 3UETA 5DZFA 2AEYA 4CZSA 4QHZA 1TMF2 5A7WB 2W46A 1GSLA 2NN8A 2PHUA 2ZMNA 4P5YA 4I2OA 1O3RA 5I0RA 4HG6B 1I3HA 3KV4A 2BBAA 1NA1A 2YUEA 5DUVA 1W8NA 3A23A 4Q27A 4QXBA 3VD7A 2HH9A 5F3GA 1BQPA 2XVLA 3B93A 1H8TA 1UIJA 4K6BA 4WM7A 2HWE3 4MLOA 4IETA 2G9GA 4AVAA 5IATA 3ZDVA 3OD4A 2P17A 1ULCA 4GB33 1AJKA 4HVRA 3TAYA 2G4IA 5IK7A 1GWLA 3JXSA 4JX0A 1J58A 1MS8A 3U37A 1ZBA2 5E89A 4A45A 4Q0SA 1ZNPA 3N7JA 2JB8A 5KBFA 3MZHA 2W47A 1DF0A 3D0JA 3ZFEA 4Z2AA 1DU3D 1LODA 5IAXA 4NIDA 2XUEA 1PZ7A 4BE3A 3PJQA 3R4DB 1M4WA 2FDHA 3HN1A 3FLRA 3VZLA 3ZR6A 2WIIB 2IVJA 4YG3A 4CP9B 3PURA 1AYM2 2XGXA 1YI9A 1DYPA 4YZ2A 1QXRA 5A7OA 1RUF3 4EWEA 4L11A 4LK6A 2WNVC 1LKNA 3MFAA 4Y5SA 1DGWA 1W2TA 1WMEA 3H1MA 4MGTA 2C5DA 5T50A 3VBHA 4AOCA 3DYMA 4HPKB 1EUTA 2W2IA 1QJEA 3DXTA 3D8CA 5IHRA 2WS91 3GBWA 2B39A 5F7UA 3ZXGA 1MS3A 3QACA 4JVAA 1UF2C 5EPAA 5FZFA 5C4WA 3WNOA 3I97A 1D4M3 3K3OA 4Z2WA 4I3PA 4N9IA 3AB0A 1POV0 4BQ1A 3KV9A 3J7LA 1UX7A 4TWTA 4IEOA 2VZ3A 4NOTA 3CJIB 3AKSA 4TSVA 2WWJA 5BV6A 1WW7A 3FC0A 3BB6A 3POSA 4GMP0 3AX4A 3C7FA 1SLIA 3OY8A 1FNZA 2HWB2 1KJLA 4BK4A 1GR3A 2IXIA 3KHBA 4BIOA 3EQEA 1QXJA 1RUF2 1VR3A 4AI1A 1IPJA 1JYXA 3NNJA 3TN93 1XNDA 2XVKA 1SACA 1UKGA 3LIGA 5AFEA 5IVFA 2MEV3 3KSCA 1REFA 3O0XA 1FNYA 2OZ6A 2RS13 3FN9A 4LBMA 3ZIWA 2ZPXA 1RUH1 4XFCA 5AVAA 1UY2A 3WV6A 2WQ4A 1CJDA 4XTPA 3WDUA 3WW1A 5FO9B 1H1MA 4JKLA 3OF1A 4MOAA 4NIIA 4I02A 3ILFA 3AM2A 3N9NA 4CCCA 1W9TA 1ZBE3 4WVVA 1IOAA 4JQTA 2J1RA 5FLJA 1NE6A 2BRTA 4CDWB 1GQPA 2QCSB 2DCZA 2YPDA 1FOD3 4RQPA 1RUD3 1I1EA 3DKWA 4IQPA 2PAKA 1G7YA 2VUAA 1Z7S3 4Q5OA 2K9ZA 2VQTA 1URXA 3WF1A 2R1DA 3WQ1A 1UCXA 3C7GA 1ACCA 1R093 2P5BA 3RWKX 1F8VA 4KWJA 1FXZA 3PTRB 4GULA 3ZN6B 1PO23 2PQSA 4GB31 4XEZA 2DUOA 1R092 4QB2A 4AK3A 4LO8A 1W6NA 3N9PA 5APAA 2DBIA 2BGOA 4QQLA 1ZX5A 2OQ6A 2R062 2ZMLA 4PIZA 5BPXA 3VL8A 5J1XA 1JMUB 5G04L 3LA2A 4UFMA 1IKQA 1W28A 4O65A 5FMOL 1PGW2 5FBJA 3NAPA 2GZWA 4GJZA 4XILA 1V6JA 3WP6A 3AMHA 3M3EA 3ST7A 3MUY1 3T0AA 4CPBD 4COYA 5IUQA 3PVBB 3TNPB 1UN1A 2TBVA 2HBUA 3L2HA 4XXAA 3H1YA 2XJSA 3TBDA 1STMA 4AQ2A 4LXLA 3BU7A 3IKWA 1AL22 4FO9A 1J3PA 3I3BA 4IEVA 4RD7A 2K2SA 1J59A 1ND2A 1ENQA 1RVF2 2D6PA 1L7LA 3OGVA 4XW3A 1OC1A 4H55A 4COZA 4HLTA 2YROA 3IT8A 3K4AA 1R082 1GP6A 2A3WA 4E8CA 2C6SA 5JR7B 2Q0AA 1LOFA 4QGLA 2RMU3 3LA3A 3VZMA 4BQWA 2A6WA 1ONAA 2VPVA 3IZOA 3H7JA 2ZZJA 4BWOA 4MXVA 3WY6A 1C8M1 1VIWB 3C7OA 1Y7BA 2RS51 3VBRB 4ZU7A 3VDCA 1ZRIA 5IT6A 2VULA 2WL1A 2JDKA 4E4ZA 1XNTA 3NRUA 1MACA 3WW2A 4HBNA 2BQPA 2WFPA 1S55A 4XJUA 4E8DA 3OJBA 1UOBA 5BNQA 3DPRC 4IDZA 1ULEA 3NQHA 1RITA 3N36A 2X53S 2I2SA 1DZTA 4META 1HN0A 2AACA 3CHXA 3PNAA 2B45X 3SH4A 5T5OA 4QWNA 4B29A 4BMBA 2CWSA 4UW4A 2VY0A 5FXZA 3J4UH 5J48A 2CL2A 2DVAA 4UFKA 4XCBA 2QJVA 4AEJA 4Q0QA 5GLZA 3AVSA 1AXYA 4ASMB 3O1VA 2DV9A 3RG0A 2PN5A 5DQ0A 1M06G 1AR72 4FI9A 1BMV1 3AXDA 1YO8A 5J3UA 2Z5WA 5FZOA 5JVVA 4LO4B 3OGGA 5FR3A 4NR1A 1CPNA 3GNEA 4Z1VA 3FWEA 2EXHA 2EIGA 3NAPB 5FAXA 1PIV1 1FOD2 2IVIB 2QDRA 5F1RA 1D4M2 4N7IA 3GXUA 1CVNA 3GZUC 2WAOA 4XUPA 4AGRA 3BU0A 4CTEA 4LBJA 4KGGA 3A0KA 2K0GA 4QAWA 3K4DA 4K8FA 1LR5A 1G6NA 4FXKB 4S2HA 1FI2A 3AJZA 3AZVA 2IZWA 4YG0A 1BVP1 3AP4A 1KEXA 2WO3A 3WP3A 1ENRA 5E1RA 2UY9A 1H9PA 4KG0A 3ZPOA 5KR7A 3HJRA 1ND3C 1UMHA 5DPNA 1AYM3 4RS5A 1T2XA 4CXXA 1F2NA 5IVYA 4D7SA 3VN4A 2JG9A 4XDOA 4C1WA 3KD4A 1YFUA 3S0MA 4XF0A 1UYXA 4LIUA 4EWAA 3HQUA 3WD5A 4LLFA 1G9FA 4YWAA 5BNNA 3L9JT 1SBDA 2A73B 4JGYB 1RJ8A 3M7AA 3GJAA 3ZMOA 3LZZA 3HAGA 5A3OA 4P9JA 4XJWA 4B7KA 5JDBA 1F9KA 2UURA 3VBUB 4AQ6A 1Q8OA 5I0UA 3SH3A 2LTNA 4YW2A 3JBG1 1CAXB 2BWCA 2IXCA 3GZAA 4CVUA 3IMMA 2E7TA 2X05A 4HFSA 1UXXX 1K12A 1H2NA 1EPWA 2RDRA 1AR82 1W8UA 1DCSA 4IEPA 2PQQA 3WOGA 1C3HA 2J1UA 3UJQA 3EB7A 5JI9A 3KS7A 3OSDA 2QQOA 2QQIA 2R1BA 4Y1UA 4CU9A 4LHNA 3H1WA 3WNLA 4BA6A 1K5MA 2Y38A 4JZRA 2ZGUA 3ZXKA 3QH7A 1AYN1 3G7DA 1ZZBA 1E5SA 2V5YA 2Y6KA 3N9LA 3NO8A 4COVA 1RVF3 1ST8A 3NNLA 1YXWA 5FZ4A 4A3ZA 5JLVA 1H30A 2RR11 3C7EA 2BTVC 2VOTA 1W90A 3ZMNA 3NJYA 3QOPA 2QUOA 4LKFA 4D94A 3ME2A 2WJSA 1BBT1 2RS31 1QJY1 2BNOA 3MW4A 2WFF1 4JDNA 4MADA 2QQUA 3EHKA 3U4XA 2B42B 3WG3A 2GH2A 2HEWF 2W92A 2XJPA 3ZX7A 4KG8A 4NHYA 4H14A 4UFLA 4BQXA 5T5PA 1MEC2 4CDWA 3FFQA 3EYPA 3T0DA 5E6HA 2EIEA 2VCBA 4OZOA 4UW3A 5I0TA 3RZZA 1SLTA 2YYOA 4XQWA 1NCQC 4NUBA 1UOFA 1GQGA 1PK6A 2BOJA 4QQHA 1HJFA 3DN7A 4A7ZA 4HVQA 2QQVA 5F9TA 1VBA1 5FPLA 1V6MA 3IDCB 3VGIA 1BEV1 1IKPA 2XLGA 3OBRA 4CDUC 1IS3A 1PX4A 3JZVA 5DXDA 5A6YA 2VH9A 4XZUG 3E5QA 4YW1A 1WW4A 4K7JA 1ZZ8A 4LOSA 3H3UA 2QQLA 3GCWA 1S2BA 2Y33A 1ASJ1 1J84A 3ES1A 5KHHA 3POJA 5F8PA 5B2GB 1TE1B 1OHFA 1JU4A 1W3VA 2JDZA 4FOQA 4OMCA 4PI0A 4RHV3 3WDWA 1XNKA 4YNIA 3SKVA 5BNOA 3K51A 2W9XA 5L9RA 4YVSC 1RHI2 4E4HA 4CXYA 4XVHA 4QU1A 4YZ1A 2FDGA 1V9U3 2EVXA 1UZVA 2ZA9A 4QQ2A 1O3TA 5A3WA 3RNSA 4LK7A 5G05L 3RS6A 2PYTA 4Y20B 2HYXA 2WNVB 4LKDA 3VD4A 1U5XA 2J1SA 2V72A 3W58A 1G86A 3D0SA 3OD0A 1W6OA 4XOGA 3KQRA 1LOBA 3H50A 4YW3A 4LQRA 2J1AA 2GH8A 2PTMA 3P3NA 4HKOA 3ZYRA 4P5HA 3ZFGB 1S0GA 4LO5B 3S57A 4LITA 5F6KA 2IXKA 4H7LA 2ZKNA 2BFUL 5GKAC 2HWC1 3AL5A 1F15A 1ALYA 5FY8A 1DGRN 5IVEA 4WVZA 2EIBA 2WZR2 2F6BA 4MHUA 3WT3A 5T5JA 1ZBA1 4LBQD 2CDPA 2HWC3 5HXMA 1QOTA 1W2AX 2Y64A 3DPRB 3U0ZA 4GQ7A 2ZAAA 4F83A 2A7AA 3MI8A 5A32B 2A6XA 3CL1A 5JIAA 2WYSA 1LOGA 1RMU3 3RI9A 1S0FA 1WMDA 4CSWA 1LGNA 1RXGA 1V6OA 4QXKA 3WF0A 5DG2A 4AFMA 4NRPA 5CNAA 2UU8A 2A6ZA 4CCLA 1TMF3 2R32A 3RZMA 4XFIA 3ZYBA 5CEHA 3I49A 3I59A 4COUA 1RUG2 3H3LA 2UY8A 4AXOA 4CDUA 4RFRB 1GU3A 3QCWA 1AL0G 3TEXA 1HRI1 2DBNA 2WZEA 1KJRA 5T54A 4A3XA 3DL3A 2P6CA 5JXJA 1JZ8A 3I8TA 3AP7A 1AHSA 1D4VB 1SHWB 2JG8C 1O8PA 3VZKA 4XTMA 4BOWA 3BTZA 2CU5A 2EXKA 3MF9A 1CAVB 3CEWA 1Q56A 1UD1A 1CD3G 5JIUA 3K2OA 4XE9A 5C9AB 5GZCA 4CDWC 5FXVA 5J36A 4CCJA 4XMAA 2YBPA 5FZLA 4ES9A 1X7NA 2FHRA 1VLNA 2H0VA 3LCPA 1DYKA 4LO7A 2VNOA 5LWBA 1UYZA 2HEYF 1NE4A 2OVUA 3WP4A 4QX0A 5EHDA 4LNVA 3I59B 1OQEA 1BZWA 3OBAA 4OUMA 4ZHNA 2FDKA 5AVPA 4J1XA 3JQWA 2AREA 1CAWB 2ES3A 3PDQA 4LUMA 4XABA 5FYBA 3VBSB 3ZSMA 5A33B 2CTVA 4AFBA 4LA2A 1QHDA 5I0SA 1VAVA 4QM9A 1FMD2 2HJIA 1RIRA 4OUEA 4S2GA 5FP7A 1F35A 1VBD3 1DGRA 5F3CA 3S30A 2C1FA 1CZVA 1O4ZA 2DFBA 4QX2A 3LEIA 4DS0A 5FYUA 3KGLA 1XU1A 2HWF1 2VQAA 1OSGA 2FQPA 1OH4A 2JG8B 4IEXA 1RUG3 3OBTA 4PDWC 1HXS3 3EXUA 2D7FA 2KR2A 3G6JB 4RQPC 1NXD1 2RJLA 2JDPA 1GLHA 1CONA 2YC4A 2JG8A 3VD5A 3JBG2 4FCAA 2XBO3 2OUJA 2QZ3A 2W3JA 1FPN1 5IVBA 3KZ4C 5JXHA 4LHSA 2RDSA 4R9CA 5FZAA 5DUXA 3ZYHA 1W03A 1QJZA 4MYEA 4EN8B 4IE7A 5AC91 1NG0A 3TN91 4RYDA 4GB32 3MHZA 3ATGA 4WZCA 1JYTA 4Q1RA 3U1XA 1JYCA 4HKWA 2BP6A 2O14A 2R0FA 3E5UA 5FBZA 2RS11 3WNXA 5EQUA 1A3KA 1EP0A 5CISA 5FP9A 4PQQA 2EXIA 1B09A 4RGAA 2G9FA 1H1IA 2JE9A 4JTNA 4XIKA 1QQP1 3T1LA 4JRAA 3ZDSA 2Z42A 4LBLA 1OUSA 5CADA 4RS5C 1LHWA 4BXSV 3PMSA 3ACFA 1HW5A 4Q4Y3 2VOKA 2PLV2 4QX1A 4QX5A 2C9AA 2VQ0A 2GN7A 4A6OA 1ZM1A 4A44A 3JU9A 1L3JA 1W9FA 3OOXA 4XAEA 4A6SA 2BPA2 3POIA 1Z7S2 2GMEA 4XHBA 3WF2A 5A7NA 2ZEYA 2W1QA 1R091 5IK8A 5J37A 4YM3A 1AR62 1AJOA 5TSWA 1PVXA 1XBFA 3MIFA 3TOJA 2DYCA 2C24A 2PAMA 4RGGA 3C2UA 1H2KA 4JHZA 5FQ0B 2ZGRA 4QGMA 1A8DA 1ZZ9A 1CAUA 2VCMA 4YGBA 3O0VA 2NMOA 1OT5A 3MW2A 1BEV2 3NL1A 5IFTA 1AR93 1V00A 3KVBA 4GH4C 2MPFA 3ELNA 4GJYA 4BMEA 2GC3A 3I2JA 1MQTA 1UYPA 2YDEA 1JU3A 1PVC1 3N9MA 4M00A 5IWFA 1YQ5A 2VW2A 4MGIE 4HONA 5T52A 3S5QA 1GP5A 5A6ZA 4DRVA 3ACLA 5JSPA 2PLV3 4QHBA 1DIWA 4CUBA 3D3AA 5LASA 2XL9A 1QDCA 1QOSA 2EAAA 1W2OA 3O5SA 2E9QA 1RTVA 1X33A 1VBD1 2AGSA 2VAUA 4GKYA 3CO2A 1XPWA 3FLTA 5DDJ3 5FUNA 5C3RA 5L7OB 5DMYA 2E63A 1RL3A 4LBKA 2V4VA 2CAUA 1OMIA 3UKTA 2KM2A 4YSFA 1RUI2 1B35A 2CHHA 2UWAA 4F8AA 4IUGA 3HVDA 2WO2A 3IB3A 3QBQA 2WS93 3Q8EA 1ENXA 1JHNA 1HXS1 2R0HA 2VUCA 2ZGTA 4NAOA 1CAXA 3J9SA 3NV3A 2YZ4A 5FDBA 3KGZA 4UF0B 3WQBA 3OGSA 3RZJA 1D4M1 1S4CA 4D6SA 1T6BX 4MUVA 3S7EA 5KXEA 3BIEA 1ND3B 2G9ZA 2VTXA 4CCMA 4FPLA 2BERA 4OI0A 5C9AC 3FZ3A 3KV5A 2GSYA 3JQXA 3UNPA 3I2KA 1XNAA 2JDHA 3OUHA 3R0RA 5F6LB 3S7IA 1NLSA 2VG9A 2KA3A 5CB7A 2H6CA 5CFCC 1E5HA 4FOVA 2JDMA 1LTEA 1FV2A 2ATFA 4NROA 2ZCWA 3ON7A 1POV3 5F5IA 4ZXKA 1IPSA 1LOAA 4N53A 4LHLA 4BH9A 3BOWA 4B4RA 2WYFA 2D5HA 1QQP3 4EZHA 1TNFA 2XMLA 3RQ0A 2PHLA 5DAPA 5JXIA 1IS5A 4NJ4A 5CFCA 1HQNA 1J1TA 2JEMA 3BCWA 2QBXA 3ENRA 2XR4A 1NYWA 1C57A 1PIV3 1RMU2 2WQ8A 2WZPP 3KLSA 2QTWB 4ISRA 3I3DA 4P02B 2GNTA 3B01A 4W8JA 5FRAA 1EAH3 1CJPA 3J7HA 4HT1T 4L8QA 4LE3A 3BVCA 4P9YA 4ET7A 2B9UA 3ILNA 3OYWA 2ORXA 3F2ZA 1OBNA 3DV8A 2ORZA 4LKEA 2I07B 4ZS3A 4A42A 3DGTA 4FSJA 3IPVB 4MH0E 4M01A 4PF1A 2PFWA 1US2A 4QPYA 4S2FA 1SFNA 3ZSEA 2A5ZA 5C3PA 2D40A 2G19A 3K77A 4DUVA 4K20A 4E4SA 5AFBA 1JYNA 1HLCA 1VBB1 1DQ1A 1Q8QA 1SLCA 3IPVA 1Z78A 5BNNC 3WG1A 2W1WA 1DGLA 1GV9A 3AYDA 1R1A3 3LSEA 3V64A 4M4PA 2VVFA 3PUSA 5GLWA 4WM8A 1WWYA 2PHRA 5EJ3A 3Q8AA 1YEWA 1C5IA 2YU2A 3NKTA 5BXXA 3FHIB 1HRV3 1G9AA 2DU0A 1W9SA 2LM3A 2V09A 2ID4A 2WBKA 5FYVA 5A3PA 3HMYA 2VMGA 3I54A 1V6IA 4FPFA 2WR9A 4NRMA 1ZZCA 3AYCA 1UU5A 2JKXA 2D6KA 2VZPA 1YI7A 2QDNA 1HRV1 4ZONA 2JE7A 4QHOA 1XE7A 1BK0A 4FVVA 4R4XA 1MZEA 1O5LA 2TEPA 1W6QB 3KCYA 5CKMA 3O1OA 5CG9A 2V4AA 1WCQA 3J7MA 5JSOA 3PUIA 1UKRA 4AYUA 3MIEA 4XFGA 2JENA 4ZY9A 4AGVA 1IQDC 1Y43B 2VR4A 3VBUA 1AF9A 2GP3A 2JECA 3KB5A 1ZYBA 4Y5Z0 2D97A 4GIQA 3K4ZA 5FLIA 2IFWA 3VBFC 2ZX2A 1CIYA 1B35C 1PZ9A 2RMU1 2NQYA 3K48A 2RG4A 4FPJA 4TTGA 1MZFA 1X36A 4K21A 1VMJA 5A1LA 1C8M3 2VBBA 2ZBJA 3PIJA 2A3XA 4FP2A 4NRQA 5FZCA 4CUGA 2LUWA 1DP0A 2W94A 2JICA 2XKPA 2Z79A 4LULA 5FO7B 1XSRA 3OB8A 4XFHA 5E8AA 2E7QA 1GQHA 3AKPA 5ERLA 2UYAA 3W9AA 3V0BB 2VW1A 3VZOA 4XCAA 1WMXA 2V73A 2OT7A 4UFIA 4HPKA 2WFF2 4PIXA 4OI4A 2D3PA 4XBLA 1PK6B 4ATFA 1RUH2 3WDTA 4IV3B 4Q0PA 1TVGA 3THTA 2X5IA 3TWIA 3PU8A 3HBZA 1T6GC 1I5PA 2KXLA 3BKZA 3LPGA 2VVDA 1ENSA 2VW0A 4E9KA 4CUAA 2WLQA 2A71A 2JIJA 2VZOA 1Z7S1 1OQDA 3AMQA 3M70A 2IXLA 1W39A 3TEYA 3ZN4A 1OPOA 4CCOA 5CFCB 4O61A 3FBMA 1QWRA 5A3MA 3EJKA 2Y6JA 4RFT0 3O1TA 1WW6A 1WCKA 1QH7A 4XQDA 1SMVA 5GZGA 2J42A 1W99A 2E26A 1N3OA 1SBEA 2VMIA 1V6KA 5FZIA 3TYJA 1LHVA 1AR83 3W5MA 1HB4A 4XF4A 3WINE 3WCSA 1SLAA 4FTSA 1EV13 3WF4A 2BUKA 4Y1VA 4LBQB 5DN2A 5IVJA 2WINB 1VAKA 4KBBA 1AYN2 2CSGA 1UX6A 1D7PM 4UFHA 4QGNA 5FY4A 2XUMA 3NV1A 5KHJA 1PK6C 1AR71 3IDEA 2DTWA 3H9AA 2ZS6B 3CNAA 3HD8B 4KWKA 2OZJA 3I3EA 1N3PA 2NP0A 5A70A 4AVTA 1YIFA
chains in the Genus database with same CATH topology
3GJAA 2G19A 4MHUA 2HBTA 5EP9A 5HV4A 3HQRA 5LBFA 3W20A 4IW3A 3OUIA 3DKQA 5IATA 3MGUA 4NHKA 2RDRA 4NMIA 5HV0A 5L9BA 4NHLA 2HBUA 4J25A 4ZONA 5LATA 5LB6A 5IAXA 4Y5TA 5C5TA 4JZRA 2RDNA 2V4AA 5M0TA 3OUJA 3NNLA 4BQWA 2FCTA 5LASA 4Y5SA 2JIGA 2FCVA 2RG4A 2A1XA 4BQYA 5EPAA 4NHXA 4NHYA 5DAWA 4BQXA 3W21A 3KT7A 5LBCA 5ERLA 4XACA 4NAOA 4XABA 5A3UA 4KBZA 3NNMA 4XCBA 4XCAA 3OBZA 2G1MA 3KT4A 3OUHA 5DAVA 3NNJA 3ITQA 3EMRA 2FCUA 2OPWA 4UWDA 5DAXA 2Y33A 3PL0A 5L9VA 2Y34A 2JIJA 4ZPIA 4XC9A 5IAVA 2RDSA 4XAAA 5LBEA 5L9RA 4NHMA 5DAPA 5DAQA 3NNFA 2RDQA 3GZEA 5C5UA 3GJBA 4MHRA 5EQUA 4Q5OA 5LA9A 3BVCA 3HQUA 5LBBA 3KT1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GJA A;  2G19 A;  4MHU A;  2HBT A;  5EP9 A;  5HV4 A;  3HQR A;  5LBF A;  3W20 A;  4IW3 A;  3OUI A;  3DKQ A;  5IAT A;  3MGU A;  4NHK A;  2RDR A;  4NMI A;  5HV0 A;  5L9B A;  4NHL A;  2HBU A;  4J25 A;  4ZON A;  5LAT A;  5LB6 A;  5IAX A;  4Y5T A;  5C5T A;  4JZR A;  2RDN A;  2V4A A;  5M0T A;  3OUJ A;  3NNL A;  4BQW A;  2FCT A;  5LAS A;  4Y5S A;  2JIG A;  2FCV A;  2RG4 A;  2A1X A;  4BQY A;  5EPA A;  4NHX A;  4NHY A;  5DAW A;  4BQX A;  3W21 A;  3KT7 A;  5LBC A;  5ERL A;  4XAC A;  4NAO A;  4XAB A;  5A3U A;  4KBZ A;  3NNM A;  4XCB A;  4XCA A;  3OBZ A;  2G1M A;  3KT4 A;  3OUH A;  5DAV A;  3NNJ A;  3ITQ A;  3EMR A;  2FCU A;  2OPW A;  4UWD A;  5DAX A;  2Y33 A;  3PL0 A;  5L9V A;  2Y34 A;  2JIJ A;  4ZPI A;  4XC9 A;  5IAV A;  2RDS A;  4XAA A;  5LBE A;  5L9R A;  4NHM A;  5DAP A;  5DAQ A;  3NNF A;  2RDQ A;  3GZE A;  5C5U A;  3GJB A;  4MHR A;  5EQU A;  4Q5O A;  5LA9 A;  3BVC A;  3HQU A;  5LBB A;  3KT1 A; 
#chains in the Genus database with same CATH topology
 2R7E B;  2WLP A;  3AZY A;  3B3Q E;  4IES A;  4TLG A;  2YHJ A;  3WVJ A;  2CDO A;  2DCJ A;  3H8X A;  4GMP 3;  4YZ4 A;  2BGP A;  2W95 A;  1AXK A;  1NXM A;  2D43 A;  2VMC A;  5FUP A;  2JXA A;  3I2G A;  4J6G A;  5EYX A;  3T2O A;  4DNY A;  1WUV A;  4LPL A;  3O0W A;  3MGU A;  4FT8 A;  4NHK A;  4UFJ A;  2PHT A;  1YQ2 A;  2HKX A;  2VOV A;  4CEY C;  5ABJ C;  5CFD C;  4AWD A;  3RMX A;  5L9B A;  5CA6 A;  1ODN A;  5JAX A;  1MR5 A;  2CYF A;  4Q4X 3;  4GAZ A;  2QVS B;  3MUZ 1;  5F2W A;  2JD9 A;  4IE0 A;  1ULP A;  1LHU A;  1VRB A;  2XJT A;  1VAL A;  1POQ A;  3KVA A;  3M3Q A;  1WMF A;  2MEV 2;  3NV4 A;  1H8T C;  1F31 A;  1K5J A;  2EXJ A;  1YJL A;  4MVT A;  5FYM A;  3VKL A;  4C0H A;  2Y0O A;  5FYY A;  3W5N A;  4BQ4 A;  1JYV A;  3U11 A;  1DZQ A;  1J83 A;  2VZ1 A;  4MSV A;  4JDO A;  3ZR5 A;  3VZJ A;  2C26 A;  3V0A B;  1UY1 A;  4AQS A;  1Y9Q A;  1YQC A;  1QMJ A;  1UZZ A;  4F7Z A;  3UL2 A;  1OFS A;  1YHF A;  1GUI A;  3POF A;  5FWJ A;  1DQ5 A;  4H2A A;  2JX9 A;  5FKC A;  3ZN6 A;  3KHC A;  1HDK A;  2BJS A;  4XMI A;  3B69 A;  1DG6 A;  3D82 A;  3ZYJ B;  3W21 A;  1VBA 3;  2RS3 3;  3WUD A;  2GAL A;  5J96 B;  2HWD 3;  1SFP A;  2D6M A;  2RS5 2;  2VM9 A;  2LS6 A;  2DU1 A;  4EQV A;  1APN A;  5FP3 A;  2AEZ A;  4YYO A;  1RUJ 2;  4K1Z A;  2R04 3;  2W5F A;  4YW6 A;  4FPO B;  1PMJ X;  5FV3 A;  5A6X A;  5IK5 A;  5FYC A;  4RA0 A;  4QPW A;  5CG8 A;  1VAM A;  3M4F A;  3UES A;  3VL9 A;  2VMH A;  1FPN 2;  1S0J A;  3FJS A;  3S5A A;  4YVW A;  5T3N A;  5JOY A;  2W91 A;  1XE8 A;  3SXW A;  4BJ0 A;  5HI0 A;  3MEP A;  3T4V A;  2XKO A;  1X9P A;  3WP5 A;  2FCU A;  3CF6 E;  4HXC A;  4FFI A;  4UYB A;  4Q29 A;  2RR1 2;  1WLT A;  2ET7 A;  3MO4 A;  5FYI A;  5FOB B;  1L7Q A;  4AED C;  5BNP A;  3HNM A;  3O7O A;  1UAI A;  3I3Q A;  1ULG A;  1DQ6 A;  5IK4 A;  3I2F A;  1TG7 A;  4UF0 A;  1VP6 A;  2X5I B;  1ZA7 A;  2WNU B;  3NNF A;  1NQD A;  4DQA A;  1H0B A;  2RM2 1;  1LES A;  1HRV 2;  4Z92 B;  3NNG A;  4O7X A;  3PU3 A;  2J1E A;  2UWB A;  3WW3 A;  1BJQ A;  4OHV A;  3WX5 A;  3ZYP A;  5A32 A;  1ND2 B;  5F39 A;  3CIH A;  1PM4 A;  5LW9 A;  1S0B A;  4O9G A;  3WQ0 A;  3VBO A;  2WKK A;  4DMI A;  1QJU 1;  1NCQ A;  3HQX A;  1F5J A;  4N43 C;  1UMI A;  1PO1 2;  1UZ0 A;  2VL4 A;  1AR6 1;  1OA2 A;  2R04 2;  1SCR A;  2WWS A;  4OUS A;  2DVG A;  4QB6 A;  4XUQ A;  4HVO A;  2ZKL A;  5CZK A;  5FK8 A;  3III A;  3BUC A;  2RMU 2;  5HV4 A;  5CFD B;  3ZOI A;  1REE A;  1UNB A;  4OHX A;  3TB0 A;  2XDV A;  4EV0 A;  2WSV A;  2XOM A;  4XPV A;  4YFW A;  4QX8 A;  2AC1 A;  5FPA A;  4PJY A;  1ULD A;  4MGQ A;  5BNO C;  2YBS A;  4KGQ A;  2QQK A;  3ZFF C;  4C1X A;  2V5D A;  4COW A;  4QB1 A;  2HEV F;  4NMI A;  2WNU A;  5L7O C;  5EZW A;  1QOO A;  5FPV A;  1NY7 1;  3PME A;  5KWR A;  4TXW A;  4P00 B;  2BNM A;  1UYY A;  2BFU S;  3HT2 A;  4FFF A;  1UY4 A;  1X8M A;  3GZT B;  4Y5T A;  2AYH A;  3VBS A;  5C5T A;  2Q8E A;  5IJR A;  2BDR A;  1RUI 3;  2JD4 A;  2R16 A;  3APB A;  5K7P A;  2HWE 1;  1BVV A;  3IDA A;  3NW4 A;  1FAT A;  4GD4 A;  3KM5 A;  3O14 A;  3OUJ A;  2JWP A;  4AVC A;  3MPB A;  2QE3 A;  1RUE 2;  4K40 A;  5C3Q A;  4YVW B;  2FCT A;  1LEN A;  2JDY A;  1COV 3;  1YIP A;  3I2I A;  1QH6 A;  2R06 1;  3M2M A;  1BLZ A;  2W1S A;  2ZMK A;  5DUU A;  4DPN A;  1RYY A;  1U5I A;  1LEC A;  2RE9 A;  3CJI C;  5EXO A;  2UWC A;  2W0X A;  3HPN A;  1PVC 3;  3I2H A;  5KXC A;  3NJX A;  1PGW 1;  5FZO B;  3ZFG C;  4BXF A;  5DAW A;  2ZHN A;  2YU1 A;  4ZU5 A;  4IV3 C;  3O12 A;  5F5A A;  3TEW A;  3EO6 A;  2WWU A;  3GDB A;  1IG0 A;  4XAC A;  4WV8 A;  3T08 A;  3WLU A;  4AFD A;  2DUR A;  3OY8 B;  4DXR A;  2RVA A;  1QJY 2;  2E31 A;  3GF6 A;  3JUU A;  1V0A A;  2HWF 3;  1CZS A;  2G1M A;  3GM8 A;  4OI2 A;  3K3N A;  4P9L A;  5A1F A;  3EBR A;  5CKN A;  4MV2 A;  1D0H A;  1RUG 1;  4N43 A;  3URF A;  5JZG C;  1K5M C;  5H9P A;  1SQ4 A;  5F5C A;  4UOJ A;  5FZH A;  2RM2 3;  2R6Q A;  3CMG A;  3ZO0 B;  1TME 3;  4MO3 M;  1D2S A;  3BOP A;  1LB2 A;  1VBA 2;  1WBF A;  3PL0 A;  4W65 A;  4Y20 A;  3FE5 A;  3OGR A;  1V6N A;  1DBN A;  4FAH A;  1VJ2 A;  4Y22 B;  2IWG B;  2ARB A;  1NT0 A;  2ZGN A;  1W0O A;  4MGY E;  5F37 A;  2B8M A;  4EWD A;  1COV 2;  2FZ1 A;  1LHO A;  1JYI A;  1E5R A;  2OS2 A;  1LNS A;  1GNZ A;  2BNN A;  2EA7 A;  2VNG A;  4RGK A;  4Y26 A;  3ZSK A;  1LU2 A;  2DWR A;  3VBO C;  1FMD 3;  4L9B A;  1MPX A;  3A22 A;  3P3P A;  2B5H A;  5C5U A;  5KHI A;  1RXF A;  1O4T A;  4DEV A;  5FY9 A;  5FMO S;  5CU1 A;  1H6X A;  4N7U A;  3LGR A;  1FMD 1;  4A2U A;  4RL7 A;  5LBB A;  2DCY A;  1KS5 A;  2K46 A;  1GAN A;  2ZEW A;  4AG4 A;  4JCK A;  3OGJ A;  3P1I A;  3CZJ A;  4KWU A;  1RMU 1;  3LDK A;  5FLH A;  3MLJ A;  1YQ8 A;  5DUW A;  4HSL A;  1HB2 A;  4NO4 A;  3ACG A;  1PO2 2;  1U5Y A;  4EZ4 A;  5J09 A;  1Q3E A;  1R64 A;  2ZGS A;  1FOD 1;  5FYZ A;  1ULO A;  5LK5 A;  5T55 A;  3RFR A;  2P3I A;  4IGP A;  1VRH 3;  3ABZ A;  2OA2 A;  3OTF A;  4QT6 A;  1CZT A;  3RGB A;  5KC6 A;  1C4R A;  3HOB A;  4NWV A;  5FPX A;  1ZRF A;  4Q4Y 1;  3ZKU A;  4CU7 A;  3U78 A;  2HWC 2;  4IXL A;  2FMD A;  2NLR A;  4JGY C;  3DYP A;  5FP8 A;  1NOV A;  5FPB A;  5A7W A;  4B3N A;  4BDV B;  5FIX A;  4OI1 A;  1V70 A;  1YYN A;  2XWB B;  1VBB 2;  1O91 A;  4QMA A;  2EF6 A;  2WN2 A;  4DOU A;  4JV4 A;  3UGG A;  4BQ2 A;  3LWC A;  2VD7 A;  3A4U A;  1IZ3 A;  1XOY A;  4E4D X;  5A7Q A;  4G9S B;  2AEN A;  4IEY A;  1OFN A;  4YVW C;  3H42 B;  4IE6 A;  1W6M A;  2ILM A;  5A80 A;  2ZTN A;  2RS1 2;  2W39 A;  5ACA 2;  2ZOE B;  5I91 A;  4MGZ E;  4XFF A;  4UBH A;  4CYD A;  1C8N A;  1NLQ A;  1UO9 A;  2ET1 A;  4RSU A;  4FTE A;  2X8K A;  2WO1 A;  4IGQ A;  3MF6 A;  4A7K A;  1PGS A;  2HLE A;  1OLM E;  3HT1 A;  1VBC 2;  2GNM A;  2VNR A;  4A7Y A;  4GZ9 A;  4K1Y A;  1V9U 2;  3ZFG A;  4HET A;  2VUJ A;  1PNG A;  1NUK A;  2YG0 A;  2PLV 1;  4KH9 A;  3NV2 A;  4C8D A;  3USU B;  5FO8 B;  3CQO A;  4LBO A;  3AJY A;  2D3R A;  1LOC A;  4YVS A;  3KWV A;  4LEJ A;  4HN0 A;  3SIS A;  4Y4Y A;  1H8V A;  3BPS A;  4NHX A;  5JWP A;  1JYW A;  2VME A;  5FOJ B;  5DDJ 1;  3ZLI A;  4EYU A;  3QH6 A;  1DZR A;  4YFZ A;  1K5M B;  3Q9O A;  3AMM A;  1GOH A;  3MV1 1;  1YRZ A;  2B4K A;  2Q4S A;  1RUN A;  1YFY A;  3UT0 A;  3LPF A;  1RUC 2;  3ETP A;  4CCN A;  3OG2 A;  4DZG A;  2C9K A;  1TZO A;  3MLK A;  3FHQ A;  3N3H A;  1JOB A;  5FZ3 A;  1SBF A;  4A41 A;  2O8Q A;  1H2L A;  2Z2S B;  4UWD A;  1QXP A;  4OHW A;  5FUI A;  4AR2 A;  4BQ5 A;  1TQ5 A;  5ACA 3;  3IAQ A;  2Y34 A;  3OPZ A;  3ZFF A;  3MIC A;  1YFW A;  3CBN A;  3GYD A;  4B1L A;  2OQ7 A;  2BGC A;  2ZGQ A;  4OMD A;  4XC9 A;  3VD9 A;  1VBD 2;  4NVP A;  2HWF 2;  2ZX1 A;  4XAA A;  5CBL A;  2WNU C;  3PUQ A;  2J7M A;  4URT A;  5L7O A;  1ODM A;  2VZT A;  3NWK A;  2PHF A;  4ZS2 A;  1RUH 3;  2LRP A;  4AEK A;  4SLI A;  5JSR A;  4CDX A;  4K3U A;  4LOT A;  4FBF A;  2ENR A;  1W2N A;  2OUH A;  4BU2 A;  1GBG A;  1YC6 1;  3ACH A;  3WCR A;  2P3K A;  3GJB A;  3M3C A;  4MHR A;  5H9Q A;  2ZAB A;  4QPI B;  2FZ2 A;  2IXH A;  1IGO A;  3TRS B;  4UAP A;  4D6Q A;  1W9Y A;  1U5Z A;  1CAW A;  1RUD 1;  3VDB A;  1DGW X;  1KS4 A;  3Q8C A;  3TN9 2;  1RUE 1;  1SLB A;  3WSO A;  2YMZ A;  4Q4X 2;  1G8W A;  2E51 A;  2VTF A;  3M3O A;  4ITC A;  4Y24 A;  3PHM A;  2BBV A;  3CDZ B;  4D7Y A;  5EJ1 B;  4BPZ A;  4EN0 A;  1OLR A;  1C5H A;  1OUX A;  1NCR C;  5CYY A;  1FV3 A;  2ZEZ A;  1UWW A;  5JR2 A;  3TEZ A;  2C4X A;  3VD3 A;  5FMB A;  5H9S A;  3RZK A;  5T5L A;  1G9C A;  1Y9M A;  2XL7 A;  4X6R B;  1R1A 2;  3USS A;  1ZBE 2;  3ZFF B;  2LW8 A;  3POW A;  3U07 A;  5GLV A;  2ERF A;  4FPK A;  4DUX A;  4LIV A;  4L2N A;  3THC A;  3LB9 A;  3N7K A;  4FTB A;  5FY5 A;  4NPR A;  4CDX B;  4AVV A;  4XET A;  5EFU A;  3P5B A;  1LUL A;  3LFI A;  5C8C B;  4WVW A;  1A8M A;  4OFG A;  3S6P A;  3I2D A;  3VKM A;  3SIT A;  1LAJ A;  4EN7 B;  4M3C A;  4J1W A;  1KFU L;  3RVH A;  3JBG 3;  3VB9 A;  2QQJ A;  3RWN A;  5HCH A;  3ZVX A;  4CCD A;  2RS5 3;  3AYE A;  5DG1 A;  3DEC A;  3T30 A;  4JRL A;  3O1M A;  1W6O B;  2A3Y A;  2BW8 A;  4MXW A;  4D8M A;  4C91 A;  1NCR A;  2Q1M A;  3J8F 1;  1UOG A;  5A3T A;  1W06 A;  2BWA A;  3A21 A;  3GAL A;  2ARX A;  4AHY A;  1SPP A;  3B9C A;  1GKB A;  4MXW B;  4UT5 A;  4ZU4 A;  4NWW A;  2W68 A;  5FZ6 A;  5JPN B;  1NA1 C;  4PLN A;  3WNP A;  4AW7 A;  4MGK E;  1HQW A;  4KQ7 A;  1JOP A;  1H1A A;  5B4N A;  4FPY A;  5CKQ A;  4BLJ A;  4NAM A;  4DUW A;  2E32 A;  4LTA A;  3LFM A;  5LY1 A;  4M3C B;  1C28 A;  2FDJ A;  5C8W A;  2D5F A;  4CP2 A;  5FPU A;  3RZH A;  3B9I A;  3PIG A;  3DUI A;  1POV 1;  3AZZ A;  3GHN A;  3RDI A;  2WFF 3;  1PMI A;  2BU9 A;  4PHZ A;  4WM8 B;  1HRI 2;  3GHM A;  3HIF A;  1YJK A;  1VBE 2;  4QD2 A;  2VXR A;  3ZIX A;  3DEM A;  1HXS 2;  4IE4 A;  4XF1 A;  1PGL 1;  3FBY A;  2VO5 A;  1LGB A;  2VU9 A;  1UIK A;  5CIR A;  2WAA A;  2OPW A;  4AVB A;  1MQT B;  1XYO A;  3PTY A;  4RQP B;  3T0B A;  4W6X A;  2H6B A;  4EJR A;  2GP5 A;  5KC5 A;  1VRH 2;  4CDQ B;  1BEV 3;  1ZA4 A;  3AYA A;  3ACI A;  2R07 3;  1NA1 B;  1JHJ A;  3RSJ A;  2VGD A;  5DAQ A;  4Q26 A;  2JDA A;  2UYB A;  1RGS A;  2WNO A;  2XJU A;  4M0H A;  4QKB A;  4MX3 A;  1H9W A;  2BOI A;  5LRR A;  1OUR A;  3AXE A;  1OD5 A;  2WQZ C;  3HWJ A;  4P9X A;  4GWM A;  1RIN A;  1H6Y A;  5ISL A;  3OEA A;  4QQO A;  5EIY B;  2J1T A;  3ZSJ A;  3B5L B;  4QU2 A;  1XRU A;  3A0N A;  2VOW A;  2Y26 A;  1SPP B;  1XNB A;  4EN6 B;  2CGO A;  1OKQ A;  4FOY A;  1DFQ A;  5KHG A;  2Z69 A;  1QY4 A;  2RM2 2;  4BIS A;  4WZF A;  4GMP 1;  3AL6 A;  2DFC A;  2VZS A;  1VBC 1;  2OYZ A;  4E2G A;  1Q8S A;  2W08 A;  4E2Q A;  2C0Z A;  5C33 A;  1W2U A;  4W6W A;  2ARA A;  5IYY A;  5FMD A;  5L19 A;  4PDW B;  4CU8 A;  3N9O A;  4IE5 A;  5DZG A;  2ZHK A;  4AEM A;  1VB2 A;  2YB7 A;  4I0B A;  3W20 A;  5LK7 B;  1W8F A;  3DKQ A;  1PO1 1;  2R30 A;  1RED A;  3ALQ A;  5DDJ 2;  4NN0 A;  4D0Q A;  2F17 A;  1S0C A;  1XSQ A;  1N3Q A;  5D8A B;  4KU8 A;  1UU6 A;  4DB5 A;  1D0G A;  3ZN5 A;  3IAP A;  5AC9 2;  4Q1P A;  2XJV A;  3MV0 1;  1AX2 A;  4JGZ A;  4QPG B;  4CU6 A;  4YW5 A;  2MNG A;  2JG9 C;  4N43 B;  4FPG A;  4XJZ A;  4L92 A;  1RUO A;  3M1H A;  4NIG A;  2SBA A;  4LBQ A;  5ANQ A;  1IQA A;  2RR1 3;  4JGZ B;  4QPG A;  4Y1Y A;  2WT1 A;  4JGY A;  5ANN A;  1JXN A;  5K0U B;  1DQ4 A;  2XHN A;  4U36 A;  4JTO A;  3POE A;  5FZ8 A;  5E16 A;  4LT5 A;  4I0A A;  1O59 A;  4PT6 A;  2OXB A;  1F5F A;  5L73 A;  5FP4 A;  3N35 A;  3ZFE B;  1XXN A;  2RJ2 A;  3MIH A;  2YGL A;  1GZW B;  4DRR A;  1W3X A;  2A6Y A;  3PLQ A;  1JI6 A;  3Q8B A;  2Q8D A;  1O8S A;  1GWK A;  2WDB A;  1UY3 A;  4GAL A;  1WLD A;  1CAU B;  4BK5 A;  4XUO A;  1EAH 2;  4Q4V 1;  4AE2 A;  5FYT A;  1JZ6 A;  5FQ0 A;  3JCI A;  4FPE A;  2PAE A;  3JD7 1;  2WNE A;  3LSD A;  1LRH A;  4AAX A;  3KT7 A;  2OX0 A;  4DXS A;  1EYB A;  5I8S A;  4LA3 A;  5DZE A;  4CDQ A;  3KF3 A;  1CES A;  1KDM A;  1LCL A;  2O0O A;  2WAB A;  4FPC A;  3V0A A;  2YFZ A;  2Y6F A;  3ES4 A;  4N9H A;  1LED A;  4L99 A;  3E97 A;  5FY0 A;  5I8T A;  3RZG A;  4QPG C;  1KIT A;  3KT4 A;  1ZRC A;  1XE0 A;  4Q0V A;  3UGH A;  4WBB A;  3L2Y A;  1HIX A;  4GH4 A;  2R04 1;  2XG3 A;  3B00 A;  3BYW A;  5LRS A;  4BYY A;  1N1Y A;  5DAB A;  2NPI A;  4AI3 A;  1EV1 1;  3T09 A;  3PVO A;  4KNC A;  1XJA A;  3AKT A;  4IEW A;  2Q8O A;  5JUV A;  1W8Z A;  1Y3T A;  1WKY A;  4ZPI A;  1WLC A;  3E6D A;  2DTY A;  2BYV E;  1AL2 3;  2RV9 A;  2XHK A;  1OF3 A;  1MS5 A;  5C71 A;  1AR7 3;  5CFD A;  1PM7 A;  3BN6 A;  4IER A;  2NMN A;  3I7D A;  3V56 A;  2EID A;  2SLI A;  4Y22 A;  1HB3 A;  3CJX A;  1VPH A;  2E6V A;  1AL2 1;  3H8U A;  3ZPY A;  1QJX 1;  4AI0 A;  1ND2 C;  1TME 2;  1NCQ B;  4BZ4 A;  2JB4 A;  1NCR B;  1MS4 A;  3AK0 A;  1R08 1;  1W0P A;  4OZX A;  4I3G A;  4UW6 A;  1UZW A;  1JTZ X;  1RUC 3;  3E1F 1;  2AZ5 A;  1KGY A;  1QJX 3;  3N7M A;  4QDR A;  1O7F A;  4PQ9 A;  1JUH A;  1YUD A;  4P9W A;  2ZGL A;  3LAG A;  1JS9 A;  1WZX A;  1F4H A;  5FZ9 A;  1BK1 A;  1QGL A;  1O4Y A;  3CU7 A;  4DO0 A;  2VTX J;  4Q4W 1;  1OOP C;  4TLF A;  4CP9 A;  5FZK A;  4LJH A;  1OD3 A;  1HB1 A;  2AR6 A;  2P34 A;  3P6B A;  4DFS A;  2Y8K A;  1CX4 A;  4V2W A;  3VBO B;  4LE4 A;  4LUK A;  1UW8 A;  3I3M A;  4Q4W 3;  1UMZ A;  5LA1 A;  1A6C A;  2A6V A;  2DCT A;  4OCT A;  3VKO A;  4E27 A;  1TMF 1;  1A78 A;  1G9D A;  2IXJ A;  1ULF A;  4YAR A;  4YGD A;  1CX1 A;  3LQC A;  2GND A;  3SKJ E;  3ZYF A;  3IIA A;  3KMH A;  5HCF A;  1N47 A;  5LAT A;  3KCC A;  1OKO A;  4QDQ A;  4AF9 A;  4BCU A;  4I30 A;  5HBA A;  1QJY 3;  1IG3 A;  4JAA A;  4HOO A;  4KWL A;  4ZKT B;  5JCT A;  2JJ6 A;  1OXC A;  1VBE 1;  2X10 A;  5M0T A;  2YBK A;  2XJR A;  4YM2 A;  2ZX4 A;  5EJZ B;  5B4X A;  1QJU 2;  1JW6 A;  4XUN A;  1QU0 A;  5GZD A;  2DF7 A;  2R06 3;  1EPZ A;  4QXC A;  5FZ7 A;  3BIW E;  4GH4 B;  1W8W A;  2XH6 A;  2XWJ B;  4DEQ A;  5FPZ A;  3O1U A;  4TZD A;  2BEO A;  1OOP B;  2FCV A;  3AP5 A;  4C0B A;  2CAV A;  2NZ9 A;  4NPM A;  3Q8F A;  1E57 A;  1LU1 A;  2ZZQ A;  4LBN A;  4PLM A;  4WM7 B;  4BQY A;  1HKD A;  5FZB A;  1COV 1;  3AZX A;  4F3J A;  4AGG A;  2GMM A;  3GCX A;  1DYO A;  2QQW A;  3BTA A;  1NLR A;  2QQP A;  2OKX A;  3WNK A;  2ZAH A;  1WA4 A;  4RR3 B;  4ZZ8 A;  3T2T A;  1C1F A;  3CLP A;  3WEZ A;  3LOB A;  4B8E A;  5A3U A;  5LA0 A;  1ZRE A;  4KBZ A;  2D93 A;  1BXH A;  1NZI A;  2VMD A;  1S0I A;  4UI9 L;  3ZSL A;  2X5I C;  4SBV A;  1OQ1 A;  2WZ8 A;  3TNQ A;  4BIF A;  1MVE A;  4M3C F;  3A7Q A;  2HWE 2;  3E6B A;  4QXH A;  5A3L A;  1SFY A;  1Y4W A;  5LEJ A;  4P9G A;  3ITQ A;  1MZ5 A;  5K0U A;  5C70 A;  4IND A;  1MQT C;  3U4S A;  4FAG A;  2VZQ A;  4IV1 A;  3VBU C;  4FP3 A;  1H4H A;  3ZYG A;  3OEB A;  4CP1 A;  1R08 3;  1RHI 3;  1VE0 A;  4OQ8 A;  3OCP A;  4ORF A;  5D21 A;  1RUC 1;  3O1R A;  3LIH A;  4P14 A;  1AR9 2;  1XQN A;  5LBE A;  3UJO A;  1UPI A;  3VHP A;  4NHM A;  4EE2 A;  1YNA A;  5C4W B;  3R4U A;  1A34 A;  4FPH A;  4QX3 A;  5IW0 A;  3RJ2 X;  2YC2 A;  4FFH A;  4ERO A;  3J7N A;  5GLT A;  5F5Q A;  3SLI A;  4DIQ A;  5HCA A;  1SG3 A;  1GP4 A;  1BKZ A;  3IWZ A;  4XUR A;  1Z0H A;  1RJ7 A;  1TNR A;  3NJZ A;  3ZXJ A;  1C1L A;  1U12 A;  3J26 N;  5C3O A;  1WCS A;  3V65 A;  3VHR A;  3M8L A;  1K45 A;  1UL9 A;  2ZEX A;  1I6X A;  5JMO A;  1CGP A;  1LHN A;  2D6O X;  2VZV A;  4OVE A;  1YWK A;  1JOD A;  3NKG A;  3HR9 A;  2WT0 A;  1ZBE 1;  4HAN A;  1GFF 2;  2I45 A;  2XON A;  4XIO A;  1JH5 A;  4C90 A;  5BNP B;  2IC1 A;  2AH2 A;  2HWD 2;  3B94 A;  2VC9 A;  4HSJ A;  5J98 B;  5LBF A;  1NAE A;  1GNY A;  2RS3 2;  4HMZ A;  1ZRD A;  5FJH A;  3VBH B;  4YGE A;  3POB A;  3HNB M;  5FYH A;  1EAH 1;  3OUI A;  4QKN A;  4LMF A;  1K3I A;  4D6R A;  4JGZ C;  1GWM A;  1KXG A;  1J3Q A;  2DDU A;  4L0P A;  4FQZ A;  2W1U A;  3MW3 A;  2CGP A;  5FXW A;  4MZU A;  4CPB A;  1K42 A;  3BOD A;  4V2V A;  1VBB 3;  3FHA A;  1S0D A;  4XUT A;  3ASI A;  2WN3 A;  4P9I A;  2ADD A;  1WCD J;  3UGF A;  1GZW A;  2XVG A;  1R1A 1;  1QEX A;  4PBO A;  3H8R A;  4ASL A;  1W6P A;  2Y6G A;  2E33 A;  1RUF 1;  5JZG A;  2OPK A;  1IPK A;  4OUL A;  4KU7 A;  1UOJ A;  3U10 A;  3MIB A;  4UXA A;  1GZT A;  4CA9 A;  2JDU A;  3SMH A;  3U14 A;  1YQ6 A;  3VLB B;  3H3Z A;  2GC2 A;  4XBN A;  5A7S A;  4PIY A;  1X82 A;  1ZZ6 A;  3UK9 A;  1H8T B;  4XZP A;  4IV3 A;  2JIG A;  1S2E A;  1AX1 A;  3D6E A;  3LEG A;  3C8X A;  1AUY A;  1MEC 3;  2QKD A;  2X29 A;  4AZZ A;  2DVD A;  2WSU A;  3BPZ A;  1PNF A;  5LBC A;  1C8M 2;  3BGA A;  3IMN A;  5JXG A;  2QFE A;  2L9L A;  3I4I A;  1WD3 A;  5FZE A;  4CCE A;  5K9Y A;  2D98 A;  4GWI A;  1GZC A;  1NKG A;  4XXP A;  3WF3 A;  1OA4 A;  4ZXE A;  2OW4 A;  5A6Q A;  4IL7 A;  5FY7 A;  2PEL A;  2IFR A;  2FD8 A;  3AMN A;  5D8A A;  3GBF A;  3RJR A;  2RJK A;  4YZ5 A;  4BQ3 A;  5A3N A;  2VZU A;  2FDI A;  4JQR A;  2CGN A;  2VOX A;  5CAZ A;  4YW4 A;  3KV6 A;  2NYY A;  4R9B A;  3FL7 A;  3THD A;  3VBS C;  5ACA 1;  4RR3 A;  2B7Y A;  2TNF A;  3FFZ A;  2CWM A;  3LE0 A;  3MFC A;  4Y33 A;  1VB4 A;  3WDV A;  4M3C E;  4D69 A;  2P3Y A;  3LD8 A;  4AI9 A;  4XJ9 A;  3EMR A;  3WW4 A;  5DAX A;  1W9W A;  2ZGK A;  1IHM A;  4Z8B A;  4CUC A;  4X8P A;  4OQ9 A;  2JG9 B;  3FUQ A;  2B46 X;  5I0D A;  2ZGP A;  1XYP A;  3UKN A;  4WVM A;  5IAV A;  2FBE A;  5C8C A;  4YVS B;  2ZX3 A;  3SCG A;  1W8T A;  2PHD A;  3MIG A;  4Y4R A;  3ZXL A;  4IEZ A;  5E88 A;  3BI3 A;  1Q8P A;  2BVB A;  2PHW A;  2BVV A;  1MVQ A;  2VBD A;  4P08 A;  4R9D A;  1YLL A;  2W52 A;  5JI7 A;  3O1S A;  1PO2 1;  1VRH 1;  2YGM A;  4QPI C;  4ARY A;  1KQR A;  4PBP A;  2GC0 A;  4QQP A;  3ETQ A;  3SHR A;  3VDA A;  1FT9 A;  1LGC A;  1RUJ 1;  1WD4 A;  4LKS A;  4AAP A;  1KRI A;  5KHK A;  4XF3 A;  1OLQ A;  2Q1F A;  2R07 1;  3WQ7 A;  4Q4Y 2;  4B4P A;  4A4A A;  3POY A;  2Z4F A;  2VBP A;  1DLL A;  2EAL A;  1RUJ 3;  2ZHM A;  2ZJC A;  3KT1 A;  4NE9 A;  3VBF B;  4DXT A;  5C6C A;  4BB3 A;  3FX3 A;  1GNH A;  2XQX A;  3IDB B;  1AR8 1;  3T2Q A;  4IGO A;  5EP9 A;  2HBT A;  3DPR A;  3HNY M;  3LEK A;  4RHV 2;  1RUE 3;  2WUH A;  1QNY A;  2WA3 A;  1GZ9 A;  1I9R A;  4QPI A;  1F4A A;  5FZ1 A;  1PHM A;  1HV0 A;  1XNC A;  2TUN A;  2GDF A;  3ZXA C;  3VDD A;  4S2D A;  1W0N A;  4Z82 A;  4NIH A;  4HL0 A;  3PVE A;  3WHU A;  5BNP C;  5IFP A;  1CPM A;  1AXZ A;  3FUO A;  1OVP A;  2WRA A;  2WA4 A;  3N9Q A;  1SLL A;  3OPT A;  4IEQ A;  2O1Q A;  2XLA A;  4NHL A;  4QKF A;  4XHX A;  3LKJ A;  4J25 A;  5GJ6 A;  3ZYI B;  2DVB A;  5C8C C;  1Q8V A;  3AP9 A;  3KQ4 B;  3AFG A;  1JZ5 A;  4PI2 A;  4Q2F A;  5FKB A;  3AC0 A;  5KXD A;  3C3V A;  4QX7 A;  3VKF C;  1E5I A;  1WW5 A;  3SEE A;  4DY3 A;  2VMF A;  3RI8 A;  5EWS A;  4ARX A;  1BYH A;  4YM1 A;  2IUW A;  2DUQ A;  2WS9 2;  1I5Z A;  4Y1Z A;  4DXZ A;  1PGL 2;  1PIV 2;  1RUD 2;  3BTX A;  2XXZ A;  3NMB A;  4XFA A;  1XYN A;  4PDW A;  1O3S A;  2P1B A;  3JD7 2;  4XYX A;  4URA A;  5GM0 A;  4LHK A;  3BTY A;  1DQ2 A;  2PMW B;  2HWB 3;  1EUU A;  3X29 B;  3NST A;  2XB6 C;  1N1S A;  5HCB A;  2VQU A;  4O9E A;  4Q8K A;  5C3S A;  4CXW A;  1AVB A;  1SZB A;  3J8F 3;  1P8J A;  1OA3 A;  5GAL A;  2HWB 1;  1V6L A;  3NJV A;  4AL9 A;  1HX6 A;  3UKV A;  4R9A A;  3IN9 A;  5JOW A;  4AED B;  3K75 B;  5BY5 A;  2ETE A;  4U2A A;  5HPO A;  3RYK A;  5C9A A;  2O8O A;  2QZ2 A;  3HEI A;  1W6Q A;  1NY7 2;  4YG6 A;  2MHF A;  1B35 B;  3RMY A;  1FAY A;  1MS0 A;  3OBZ A;  3SC7 X;  1EV1 2;  1ZZ7 A;  3USU A;  5H9R A;  3DCQ A;  4YZ3 A;  4OHY A;  1YFX A;  3FLP A;  4K8R B;  1QJF A;  2PA7 A;  3R05 A;  4PF5 A;  3LOI A;  3UYJ A;  1XB9 A;  1DLC A;  2H0B A;  4V1P A;  5L36 A;  5A1A A;  2BZD A;  5LA2 A;  2F4L A;  2XJQ A;  2HWD 1;  3NAP C;  1CIW A;  1NZC A;  4TN7 A;  1YCI A;  3E6C C;  1L7R A;  5L9V A;  3UV9 A;  1W6M B;  1WBL A;  5LCW L;  3INA A;  4KL1 A;  1LEM A;  2D6N A;  3J8F 2;  5GZE A;  4AVS A;  4CEY A;  5ABJ A;  3RZL A;  4CEW A;  5EYY A;  2W87 A;  2EAK A;  1R1Z A;  2YV8 A;  4IV1 C;  3WR0 A;  2E53 A;  4Q0U A;  4CEY B;  5ABJ B;  3VHN A;  3H0O A;  4AI8 A;  3MLL A;  2DUP A;  4JC1 A;  1DQ0 A;  3NVC A;  4AED A;  3ORJ A;  1RC6 A;  1ASJ 2;  2RDQ A;  2Y6H A;  4BHP A;  3GZE A;  4QDS A;  3PUH A;  1OI6 A;  3KCX A;  1S0E A;  2AUY A;  3LDR A;  4I09 A;  2WZR 1;  1WGP A;  3O1P A;  1ASJ 3;  3AZW A;  4Q4W 2;  4DIN B;  1S2K A;  5FFO C;  1JOJ A;  5SV8 A;  5JOX A;  1BHG A;  5LA9 A;  1J1L A;  4UBG A;  4AFC A;  3PUA A;  2GU9 A;  4EN9 B;  3SQO A;  2HYK A;  2ZAC A;  3H8O A;  2QNK A;  1UZY A;  2WZR 3;  1HQL A;  4XJ8 A;  1CN1 A;  1QKQ A;  5FZM A;  2XQR A;  4K9S A;  1ND3 A;  5SV5 A;  3PJY A;  2E7A A;  2WT2 A;  3AVR A;  1OH3 A;  4GKX A;  4N53 B;  3F95 A;  1PO1 3;  1S1A A;  4XFB A;  4AHZ A;  1BBT 2;  1N1T A;  3JB4 C;  4JHT A;  4CE8 A;  4HZF A;  2JE8 A;  4H3W A;  1VBC 3;  5JMC A;  1LOE A;  4Q4V 2;  1SDW A;  1LJ7 A;  1TEI A;  4IW3 A;  2VCC A;  4N90 A;  4Q4X 1;  3WHT A;  1DDL A;  2Q1Z B;  4M4R A;  4ISQ A;  2ADE A;  3ZKY A;  1EY2 A;  5HV0 A;  1O6U A;  3QLQ A;  2VEC A;  1XU2 A;  2XBO 2;  3MYX A;  3ZM8 A;  3POG A;  4CRQ A;  2ZX0 A;  5FY1 A;  4AFA A;  5JPM B;  2WNV A;  3IM0 A;  3T1M A;  3SCH A;  5IVV A;  3AFK A;  4I01 A;  2P6H A;  5FK7 A;  3SEP A;  2VZR A;  4E2S A;  4YLZ A;  1UPS A;  2X09 A;  2JKB A;  5K0U C;  3VKN A;  5D1I A;  3DYO A;  2ZGO A;  1PX3 A;  2P4E A;  4XBQ A;  2Q8C A;  5C4W C;  4FFG A;  1BBT 3;  4Z07 A;  5J7M A;  2OII A;  3SCF A;  3DXU A;  1H4G A;  3D4K A;  4X8N A;  2NM1 A;  4AI2 A;  1RVF 1;  2R49 A;  1FX5 A;  3MDP A;  3T4H B;  3JD7 3;  3WG2 A;  1GIC A;  2D3S A;  4Y3O A;  1SCS A;  4GWJ A;  5GLU A;  4KI5 M;  1ZRR A;  1KFX L;  3RYR A;  2A75 A;  1OOP A;  2FMY A;  5I93 A;  4ATE A;  2YY1 A;  2N7G A;  4AHW A;  3AKR A;  2PXJ A;  3SH5 A;  4W6Y A;  1BMV 2;  4XF9 A;  1CAV A;  1Q5O A;  1W6P B;  1SDD B;  4YGC A;  4CEW B;  5JZG B;  2FDF A;  4R8H A;  4JDM A;  4Q4V 3;  4YRD A;  3T2P A;  3JB8 A;  5FXX A;  4NPL A;  3GBG A;  1Y9G A;  4B4Q A;  4CDU B;  1KDK A;  3T3Y A;  3U75 A;  2KD7 A;  4LR4 A;  4D3W A;  1G9B A;  1HV1 A;  2P37 A;  5DAV A;  4OYU A;  4CEW C;  1SEF A;  1W8O A;  1QF3 A;  3H7Y A;  4HKL A;  5D8A C;  4AHX A;  1AYM 1;  4RHV 1;  1KD7 A;  4WM7 C;  1W05 A;  3LDB A;  4MGS A;  4R4Z A;  2J1V A;  5FYS A;  3E5X A;  1PMH X;  4H7M A;  1XC6 A;  4OLL A;  5BUV A;  5FZG A;  3HN3 A;  1WCU A;  1V9U 1;  1D2Q A;  3AKQ A;  1GMM A;  1OF4 A;  4G4F A;  2GMP A;  2GC1 A;  2VNV A;  1N1V A;  4YW7 A;  4N8M A;  1VMF A;  3RPQ A;  1X50 A;  1GOG A;  4LO6 B;  1DHK B;  5KXB A;  5EV7 A;  4PCR A;  3ROU A;  4XQ4 A;  1NQJ A;  3VBR C;  1QJU 3;  1UXZ A;  2ZGM A;  3WNM A;  1MZ6 A;  2LRO A;  4ZZ5 A;  3B7M A;  3MBW A;  1NX9 A;  4QKD A;  1JUI A;  1GYK A;  5BNN B;  2F4P A;  2GAU A;  2B9V A;  3VUO A;  4W4Z A;  1FPN 3;  4LLO A;  3K46 A;  1AZD A;  1HN1 A;  3AP6 A;  1W8H A;  4IEU A;  3RRD A;  5C7G A;  1JZ7 A;  3PVN A;  1ZBA 3;  5FWE A;  1PZ8 A;  1US3 A;  3IBM A;  3CZU A;  4PLO A;  1VMH A;  3ZXE A;  4KMQ A;  1QNW A;  2J22 A;  2GN3 A;  5LEK A;  2WO7 A;  4CCK A;  4BM8 A;  3HQR A;  5FZ0 A;  3M3I A;  1AR6 3;  5HXV A;  3WDY A;  1OLM A;  4R52 A;  1JBC A;  4YPJ A;  1HJG A;  1AYN 3;  2YC0 A;  3GGL A;  5F3I A;  5JOZ A;  4DY5 A;  1O5U A;  4M0N A;  2Q30 A;  4N53 C;  4W50 A;  3VZN A;  1W6N B;  5FTT C;  5LY2 A;  2EIC A;  1OVS A;  4GXL A;  3R6S A;  2ARC A;  2QQM A;  2Y6L A;  4B1M A;  1U0A A;  3MID A;  1IS6 A;  2VVE A;  3ECQ A;  4G3Y C;  5I8Y A;  1GOF A;  5F3E A;  1QJX 2;  5LB6 A;  4RS5 B;  1MS9 A;  1H2M A;  3VDD C;  2Q5T A;  2VXJ A;  5F32 A;  5BNO B;  2RDN A;  4QM8 A;  1W04 A;  4Q8L A;  2YPJ A;  4ONU A;  1X8E A;  2YFU A;  1UU4 A;  4LOR A;  4TYS A;  4X6Q B;  2VCA A;  3QD6 A;  4ASK A;  2ZXQ A;  3OPW A;  4FQ4 A;  4RN5 A;  4AQT A;  4B7E A;  3OYW B;  1RUI 1;  1JZ3 A;  1HRI 3;  2YXS A;  1VBE 3;  4CDQ C;  5FCC A;  3VDD B;  2JDN A;  4Y1X A;  2BV4 A;  2CNA A;  2Y60 A;  3D5O A;  1AR9 1;  2A1X A;  3BAL A;  4I0W B;  5FJK A;  1JN2 P;  2P3J A;  3ILR A;  3DF0 A;  3VHO A;  4CP0 A;  2LAL A;  4GWN A;  5K8S A;  1OPM A;  4GA9 A;  2XLF A;  4XJA A;  3VBF A;  4RR3 C;  2RHP A;  3LF7 A;  4HN1 A;  1WLW A;  1WA6 X;  1X9T A;  3CKH A;  1UY0 A;  1IS4 A;  4XDP A;  1J3R A;  2D6L X;  3ZXF A;  3NNM A;  3AMP A;  1CQ9 A;  4MG2 A;  3VBH C;  4ES8 A;  1ZVF A;  2PHX A;  1CWP A;  5FZD A;  4BLI A;  3N4M A;  1QQP 2;  1BCX A;  1Q43 A;  5FRE A;  3CJI A;  3KF5 A;  4NIA A;  2XPJ A;  2VE1 A;  3I2O A;  1MEC 1;  4FOW A;  1QIQ A;  2ZHL A;  2WC2 A;  5IVC A;  3ZFE C;  2VJX A;  1FYU A;  2P2K A;  4IV1 B;  5FMC A;  2I74 A;  5A7P A;  1RHI 1;  1CR7 A;  3RYP A;  3WUC A;  3R4S A;  3V0B A;  2DCK A;  1AX0 A;  5CVR A;  2GNB A;  3N7L A;  4WVM B;  1LOF C;  1MS1 A;  2Y0I A;  3SNM A;  3VBR A;  3WXP A;  4D7T A;  2A70 A;  5BYN A;  1JZ2 A;  1UQX A;  5GZF A;  5D2A A;  5AC9 3;  1TME 1;  3B02 A;  4OHZ A;  3VV1 A;  4WM8 C;  3HBK A;  3LA7 A;  4L97 A;  4YM0 A;  3W59 A;  1JZ4 A;  5A33 A;  2XBO 1;  3WG4 A;  2R07 2;  3C7H A;  5K4L A;  1RB8 G;  4JKK A;  3LEM A;  2CY6 A;  2MEV 1;  3MPP G;  2D44 A;  4FXG B;  3FMG A;  4HK9 A;  2QQN A;  2VUD A;  3WDX A;  1QDO A;  3ZXD A;  5F2S A;  4HK8 A;  4JKM A;  3WZ1 A;  1O3Q A;  1PVC 2;  4XDQ A;  2CV6 A;  3WNN A;  4CDX C;  4UW5 A;  2DVF A;  5LZ6 A;  3THP A;  3UET A;  5DZF A;  2AEY A;  4CZS A;  4QHZ A;  1TMF 2;  5A7W B;  2W46 A;  1GSL A;  2NN8 A;  2PHU A;  2ZMN A;  4P5Y A;  4I2O A;  1O3R A;  5I0R A;  4HG6 B;  1I3H A;  3KV4 A;  2BBA A;  1NA1 A;  2YUE A;  5DUV A;  1W8N A;  3A23 A;  4Q27 A;  4QXB A;  3VD7 A;  2HH9 A;  5F3G A;  1BQP A;  2XVL A;  3B93 A;  1H8T A;  1UIJ A;  4K6B A;  4WM7 A;  2HWE 3;  4MLO A;  4IET A;  2G9G A;  4AVA A;  5IAT A;  3ZDV A;  3OD4 A;  2P17 A;  1ULC A;  4GB3 3;  1AJK A;  4HVR A;  3TAY A;  2G4I A;  5IK7 A;  1GWL A;  3JXS A;  4JX0 A;  1J58 A;  1MS8 A;  3U37 A;  1ZBA 2;  5E89 A;  4A45 A;  4Q0S A;  1ZNP A;  3N7J A;  2JB8 A;  5KBF A;  3MZH A;  2W47 A;  1DF0 A;  3D0J A;  3ZFE A;  4Z2A A;  1DU3 D;  1LOD A;  5IAX A;  4NID A;  2XUE A;  1PZ7 A;  4BE3 A;  3PJQ A;  3R4D B;  1M4W A;  2FDH A;  3HN1 A;  3FLR A;  3VZL A;  3ZR6 A;  2WII B;  2IVJ A;  4YG3 A;  4CP9 B;  3PUR A;  1AYM 2;  2XGX A;  1YI9 A;  1DYP A;  4YZ2 A;  1QXR A;  5A7O A;  1RUF 3;  4EWE A;  4L11 A;  4LK6 A;  2WNV C;  1LKN A;  3MFA A;  4Y5S A;  1DGW A;  1W2T A;  1WME A;  3H1M A;  4MGT A;  2C5D A;  5T50 A;  3VBH A;  4AOC A;  3DYM A;  4HPK B;  1EUT A;  2W2I A;  1QJE A;  3DXT A;  3D8C A;  5IHR A;  2WS9 1;  3GBW A;  2B39 A;  5F7U A;  3ZXG A;  1MS3 A;  3QAC A;  4JVA A;  1UF2 C;  5EPA A;  5FZF A;  5C4W A;  3WNO A;  3I97 A;  1D4M 3;  3K3O A;  4Z2W A;  4I3P A;  4N9I A;  3AB0 A;  1POV 0;  4BQ1 A;  3KV9 A;  3J7L A;  1UX7 A;  4TWT A;  4IEO A;  2VZ3 A;  4NOT A;  3CJI B;  3AKS A;  4TSV A;  2WWJ A;  5BV6 A;  1WW7 A;  3FC0 A;  3BB6 A;  3POS A;  4GMP 0;  3AX4 A;  3C7F A;  1SLI A;  3OY8 A;  1FNZ A;  2HWB 2;  1KJL A;  4BK4 A;  1GR3 A;  2IXI A;  3KHB A;  4BIO A;  3EQE A;  1QXJ A;  1RUF 2;  1VR3 A;  4AI1 A;  1IPJ A;  1JYX A;  3NNJ A;  3TN9 3;  1XND A;  2XVK A;  1SAC A;  1UKG A;  3LIG A;  5AFE A;  5IVF A;  2MEV 3;  3KSC A;  1REF A;  3O0X A;  1FNY A;  2OZ6 A;  2RS1 3;  3FN9 A;  4LBM A;  3ZIW A;  2ZPX A;  1RUH 1;  4XFC A;  5AVA A;  1UY2 A;  3WV6 A;  2WQ4 A;  1CJD A;  4XTP A;  3WDU A;  3WW1 A;  5FO9 B;  1H1M A;  4JKL A;  3OF1 A;  4MOA A;  4NII A;  4I02 A;  3ILF A;  3AM2 A;  3N9N A;  4CCC A;  1W9T A;  1ZBE 3;  4WVV A;  1IOA A;  4JQT A;  2J1R A;  5FLJ A;  1NE6 A;  2BRT A;  4CDW B;  1GQP A;  2QCS B;  2DCZ A;  2YPD A;  1FOD 3;  4RQP A;  1RUD 3;  1I1E A;  3DKW A;  4IQP A;  2PAK A;  1G7Y A;  2VUA A;  1Z7S 3;  4Q5O A;  2K9Z A;  2VQT A;  1URX A;  3WF1 A;  2R1D A;  3WQ1 A;  1UCX A;  3C7G A;  1ACC A;  1R09 3;  2P5B A;  3RWK X;  1F8V A;  4KWJ A;  1FXZ A;  3PTR B;  4GUL A;  3ZN6 B;  1PO2 3;  2PQS A;  4GB3 1;  4XEZ A;  2DUO A;  1R09 2;  4QB2 A;  4AK3 A;  4LO8 A;  1W6N A;  3N9P A;  5APA A;  2DBI A;  2BGO A;  4QQL A;  1ZX5 A;  2OQ6 A;  2R06 2;  2ZML A;  4PIZ A;  5BPX A;  3VL8 A;  5J1X A;  1JMU B;  5G04 L;  3LA2 A;  4UFM A;  1IKQ A;  1W28 A;  4O65 A;  5FMO L;  1PGW 2;  5FBJ A;  3NAP A;  2GZW A;  4GJZ A;  4XIL A;  1V6J A;  3WP6 A;  3AMH A;  3M3E A;  3ST7 A;  3MUY 1;  3T0A A;  4CPB D;  4COY A;  5IUQ A;  3PVB B;  3TNP B;  1UN1 A;  2TBV A;  2HBU A;  3L2H A;  4XXA A;  3H1Y A;  2XJS A;  3TBD A;  1STM A;  4AQ2 A;  4LXL A;  3BU7 A;  3IKW A;  1AL2 2;  4FO9 A;  1J3P A;  3I3B A;  4IEV A;  4RD7 A;  2K2S A;  1J59 A;  1ND2 A;  1ENQ A;  1RVF 2;  2D6P A;  1L7L A;  3OGV A;  4XW3 A;  1OC1 A;  4H55 A;  4COZ A;  4HLT A;  2YRO A;  3IT8 A;  3K4A A;  1R08 2;  1GP6 A;  2A3W A;  4E8C A;  2C6S A;  5JR7 B;  2Q0A A;  1LOF A;  4QGL A;  2RMU 3;  3LA3 A;  3VZM A;  4BQW A;  2A6W A;  1ONA A;  2VPV A;  3IZO A;  3H7J A;  2ZZJ A;  4BWO A;  4MXV A;  3WY6 A;  1C8M 1;  1VIW B;  3C7O A;  1Y7B A;  2RS5 1;  3VBR B;  4ZU7 A;  3VDC A;  1ZRI A;  5IT6 A;  2VUL A;  2WL1 A;  2JDK A;  4E4Z A;  1XNT A;  3NRU A;  1MAC A;  3WW2 A;  4HBN A;  2BQP A;  2WFP A;  1S55 A;  4XJU A;  4E8D A;  3OJB A;  1UOB A;  5BNQ A;  3DPR C;  4IDZ A;  1ULE A;  3NQH A;  1RIT A;  3N36 A;  2X53 S;  2I2S A;  1DZT A;  4MET A;  1HN0 A;  2AAC A;  3CHX A;  3PNA A;  2B45 X;  3SH4 A;  5T5O A;  4QWN A;  4B29 A;  4BMB A;  2CWS A;  4UW4 A;  2VY0 A;  5FXZ A;  3J4U H;  5J48 A;  2CL2 A;  2DVA A;  4UFK A;  4XCB A;  2QJV A;  4AEJ A;  4Q0Q A;  5GLZ A;  3AVS A;  1AXY A;  4ASM B;  3O1V A;  2DV9 A;  3RG0 A;  2PN5 A;  5DQ0 A;  1M06 G;  1AR7 2;  4FI9 A;  1BMV 1;  3AXD A;  1YO8 A;  5J3U A;  2Z5W A;  5FZO A;  5JVV A;  4LO4 B;  3OGG A;  5FR3 A;  4NR1 A;  1CPN A;  3GNE A;  4Z1V A;  3FWE A;  2EXH A;  2EIG A;  3NAP B;  5FAX A;  1PIV 1;  1FOD 2;  2IVI B;  2QDR A;  5F1R A;  1D4M 2;  4N7I A;  3GXU A;  1CVN A;  3GZU C;  2WAO A;  4XUP A;  4AGR A;  3BU0 A;  4CTE A;  4LBJ A;  4KGG A;  3A0K A;  2K0G A;  4QAW A;  3K4D A;  4K8F A;  1LR5 A;  1G6N A;  4FXK B;  4S2H A;  1FI2 A;  3AJZ A;  3AZV A;  2IZW A;  4YG0 A;  1BVP 1;  3AP4 A;  1KEX A;  2WO3 A;  3WP3 A;  1ENR A;  5E1R A;  2UY9 A;  1H9P A;  4KG0 A;  3ZPO A;  5KR7 A;  3HJR A;  1ND3 C;  1UMH A;  5DPN A;  1AYM 3;  4RS5 A;  1T2X A;  4CXX A;  1F2N A;  5IVY A;  4D7S A;  3VN4 A;  2JG9 A;  4XDO A;  4C1W A;  3KD4 A;  1YFU A;  3S0M A;  4XF0 A;  1UYX A;  4LIU A;  4EWA A;  3HQU A;  3WD5 A;  4LLF A;  1G9F A;  4YWA A;  5BNN A;  3L9J T;  1SBD A;  2A73 B;  4JGY B;  1RJ8 A;  3M7A A;  3GJA A;  3ZMO A;  3LZZ A;  3HAG A;  5A3O A;  4P9J A;  4XJW A;  4B7K A;  5JDB A;  1F9K A;  2UUR A;  3VBU B;  4AQ6 A;  1Q8O A;  5I0U A;  3SH3 A;  2LTN A;  4YW2 A;  3JBG 1;  1CAX B;  2BWC A;  2IXC A;  3GZA A;  4CVU A;  3IMM A;  2E7T A;  2X05 A;  4HFS A;  1UXX X;  1K12 A;  1H2N A;  1EPW A;  2RDR A;  1AR8 2;  1W8U A;  1DCS A;  4IEP A;  2PQQ A;  3WOG A;  1C3H A;  2J1U A;  3UJQ A;  3EB7 A;  5JI9 A;  3KS7 A;  3OSD A;  2QQO A;  2QQI A;  2R1B A;  4Y1U A;  4CU9 A;  4LHN A;  3H1W A;  3WNL A;  4BA6 A;  1K5M A;  2Y38 A;  4JZR A;  2ZGU A;  3ZXK A;  3QH7 A;  1AYN 1;  3G7D A;  1ZZB A;  1E5S A;  2V5Y A;  2Y6K A;  3N9L A;  3NO8 A;  4COV A;  1RVF 3;  1ST8 A;  3NNL A;  1YXW A;  5FZ4 A;  4A3Z A;  5JLV A;  1H30 A;  2RR1 1;  3C7E A;  2BTV C;  2VOT A;  1W90 A;  3ZMN A;  3NJY A;  3QOP A;  2QUO A;  4LKF A;  4D94 A;  3ME2 A;  2WJS A;  1BBT 1;  2RS3 1;  1QJY 1;  2BNO A;  3MW4 A;  2WFF 1;  4JDN A;  4MAD A;  2QQU A;  3EHK A;  3U4X A;  2B42 B;  3WG3 A;  2GH2 A;  2HEW F;  2W92 A;  2XJP A;  3ZX7 A;  4KG8 A;  4NHY A;  4H14 A;  4UFL A;  4BQX A;  5T5P A;  1MEC 2;  4CDW A;  3FFQ A;  3EYP A;  3T0D A;  5E6H A;  2EIE A;  2VCB A;  4OZO A;  4UW3 A;  5I0T A;  3RZZ A;  1SLT A;  2YYO A;  4XQW A;  1NCQ C;  4NUB A;  1UOF A;  1GQG A;  1PK6 A;  2BOJ A;  4QQH A;  1HJF A;  3DN7 A;  4A7Z A;  4HVQ A;  2QQV A;  5F9T A;  1VBA 1;  5FPL A;  1V6M A;  3IDC B;  3VGI A;  1BEV 1;  1IKP A;  2XLG A;  3OBR A;  4CDU C;  1IS3 A;  1PX4 A;  3JZV A;  5DXD A;  5A6Y A;  2VH9 A;  4XZU G;  3E5Q A;  4YW1 A;  1WW4 A;  4K7J A;  1ZZ8 A;  4LOS A;  3H3U A;  2QQL A;  3GCW A;  1S2B A;  2Y33 A;  1ASJ 1;  1J84 A;  3ES1 A;  5KHH A;  3POJ A;  5F8P A;  5B2G B;  1TE1 B;  1OHF A;  1JU4 A;  1W3V A;  2JDZ A;  4FOQ A;  4OMC A;  4PI0 A;  4RHV 3;  3WDW A;  1XNK A;  4YNI A;  3SKV A;  5BNO A;  3K51 A;  2W9X A;  5L9R A;  4YVS C;  1RHI 2;  4E4H A;  4CXY A;  4XVH A;  4QU1 A;  4YZ1 A;  2FDG A;  1V9U 3;  2EVX A;  1UZV A;  2ZA9 A;  4QQ2 A;  1O3T A;  5A3W A;  3RNS A;  4LK7 A;  5G05 L;  3RS6 A;  2PYT A;  4Y20 B;  2HYX A;  2WNV B;  4LKD A;  3VD4 A;  1U5X A;  2J1S A;  2V72 A;  3W58 A;  1G86 A;  3D0S A;  3OD0 A;  1W6O A;  4XOG A;  3KQR A;  1LOB A;  3H50 A;  4YW3 A;  4LQR A;  2J1A A;  2GH8 A;  2PTM A;  3P3N A;  4HKO A;  3ZYR A;  4P5H A;  3ZFG B;  1S0G A;  4LO5 B;  3S57 A;  4LIT A;  5F6K A;  2IXK A;  4H7L A;  2ZKN A;  2BFU L;  5GKA C;  2HWC 1;  3AL5 A;  1F15 A;  1ALY A;  5FY8 A;  1DGR N;  5IVE A;  4WVZ A;  2EIB A;  2WZR 2;  2F6B A;  4MHU A;  3WT3 A;  5T5J A;  1ZBA 1;  4LBQ D;  2CDP A;  2HWC 3;  5HXM A;  1QOT A;  1W2A X;  2Y64 A;  3DPR B;  3U0Z A;  4GQ7 A;  2ZAA A;  4F83 A;  2A7A A;  3MI8 A;  5A32 B;  2A6X A;  3CL1 A;  5JIA A;  2WYS A;  1LOG A;  1RMU 3;  3RI9 A;  1S0F A;  1WMD A;  4CSW A;  1LGN A;  1RXG A;  1V6O A;  4QXK A;  3WF0 A;  5DG2 A;  4AFM A;  4NRP A;  5CNA A;  2UU8 A;  2A6Z A;  4CCL A;  1TMF 3;  2R32 A;  3RZM A;  4XFI A;  3ZYB A;  5CEH A;  3I49 A;  3I59 A;  4COU A;  1RUG 2;  3H3L A;  2UY8 A;  4AXO A;  4CDU A;  4RFR B;  1GU3 A;  3QCW A;  1AL0 G;  3TEX A;  1HRI 1;  2DBN A;  2WZE A;  1KJR A;  5T54 A;  4A3X A;  3DL3 A;  2P6C A;  5JXJ A;  1JZ8 A;  3I8T A;  3AP7 A;  1AHS A;  1D4V B;  1SHW B;  2JG8 C;  1O8P A;  3VZK A;  4XTM A;  4BOW A;  3BTZ A;  2CU5 A;  2EXK A;  3MF9 A;  1CAV B;  3CEW A;  1Q56 A;  1UD1 A;  1CD3 G;  5JIU A;  3K2O A;  4XE9 A;  5C9A B;  5GZC A;  4CDW C;  5FXV A;  5J36 A;  4CCJ A;  4XMA A;  2YBP A;  5FZL A;  4ES9 A;  1X7N A;  2FHR A;  1VLN A;  2H0V A;  3LCP A;  1DYK A;  4LO7 A;  2VNO A;  5LWB A;  1UYZ A;  2HEY F;  1NE4 A;  2OVU A;  3WP4 A;  4QX0 A;  5EHD A;  4LNV A;  3I59 B;  1OQE A;  1BZW A;  3OBA A;  4OUM A;  4ZHN A;  2FDK A;  5AVP A;  4J1X A;  3JQW A;  2ARE A;  1CAW B;  2ES3 A;  3PDQ A;  4LUM A;  4XAB A;  5FYB A;  3VBS B;  3ZSM A;  5A33 B;  2CTV A;  4AFB A;  4LA2 A;  1QHD A;  5I0S A;  1VAV A;  4QM9 A;  1FMD 2;  2HJI A;  1RIR A;  4OUE A;  4S2G A;  5FP7 A;  1F35 A;  1VBD 3;  1DGR A;  5F3C A;  3S30 A;  2C1F A;  1CZV A;  1O4Z A;  2DFB A;  4QX2 A;  3LEI A;  4DS0 A;  5FYU A;  3KGL A;  1XU1 A;  2HWF 1;  2VQA A;  1OSG A;  2FQP A;  1OH4 A;  2JG8 B;  4IEX A;  1RUG 3;  3OBT A;  4PDW C;  1HXS 3;  3EXU A;  2D7F A;  2KR2 A;  3G6J B;  4RQP C;  1NXD 1;  2RJL A;  2JDP A;  1GLH A;  1CON A;  2YC4 A;  2JG8 A;  3VD5 A;  3JBG 2;  4FCA A;  2XBO 3;  2OUJ A;  2QZ3 A;  2W3J A;  1FPN 1;  5IVB A;  3KZ4 C;  5JXH A;  4LHS A;  2RDS A;  4R9C A;  5FZA A;  5DUX A;  3ZYH A;  1W03 A;  1QJZ A;  4MYE A;  4EN8 B;  4IE7 A;  5AC9 1;  1NG0 A;  3TN9 1;  4RYD A;  4GB3 2;  3MHZ A;  3ATG A;  4WZC A;  1JYT A;  4Q1R A;  3U1X A;  1JYC A;  4HKW A;  2BP6 A;  2O14 A;  2R0F A;  3E5U A;  5FBZ A;  2RS1 1;  3WNX A;  5EQU A;  1A3K A;  1EP0 A;  5CIS A;  5FP9 A;  4PQQ A;  2EXI A;  1B09 A;  4RGA A;  2G9F A;  1H1I A;  2JE9 A;  4JTN A;  4XIK A;  1QQP 1;  3T1L A;  4JRA A;  3ZDS A;  2Z42 A;  4LBL A;  1OUS A;  5CAD A;  4RS5 C;  1LHW A;  4BXS V;  3PMS A;  3ACF A;  1HW5 A;  4Q4Y 3;  2VOK A;  2PLV 2;  4QX1 A;  4QX5 A;  2C9A A;  2VQ0 A;  2GN7 A;  4A6O A;  1ZM1 A;  4A44 A;  3JU9 A;  1L3J A;  1W9F A;  3OOX A;  4XAE A;  4A6S A;  2BPA 2;  3POI A;  1Z7S 2;  2GME A;  4XHB A;  3WF2 A;  5A7N A;  2ZEY A;  2W1Q A;  1R09 1;  5IK8 A;  5J37 A;  4YM3 A;  1AR6 2;  1AJO A;  5TSW A;  1PVX A;  1XBF A;  3MIF A;  3TOJ A;  2DYC A;  2C24 A;  2PAM A;  4RGG A;  3C2U A;  1H2K A;  4JHZ A;  5FQ0 B;  2ZGR A;  4QGM A;  1A8D A;  1ZZ9 A;  1CAU A;  2VCM A;  4YGB A;  3O0V A;  2NMO A;  1OT5 A;  3MW2 A;  1BEV 2;  3NL1 A;  5IFT A;  1AR9 3;  1V00 A;  3KVB A;  4GH4 C;  2MPF A;  3ELN A;  4GJY A;  4BME A;  2GC3 A;  3I2J A;  1MQT A;  1UYP A;  2YDE A;  1JU3 A;  1PVC 1;  3N9M A;  4M00 A;  5IWF A;  1YQ5 A;  2VW2 A;  4MGI E;  4HON A;  5T52 A;  3S5Q A;  1GP5 A;  5A6Z A;  4DRV A;  3ACL A;  5JSP A;  2PLV 3;  4QHB A;  1DIW A;  4CUB A;  3D3A A;  5LAS A;  2XL9 A;  1QDC A;  1QOS A;  2EAA A;  1W2O A;  3O5S A;  2E9Q A;  1RTV A;  1X33 A;  1VBD 1;  2AGS A;  2VAU A;  4GKY A;  3CO2 A;  1XPW A;  3FLT A;  5DDJ 3;  5FUN A;  5C3R A;  5L7O B;  5DMY A;  2E63 A;  1RL3 A;  4LBK A;  2V4V A;  2CAU A;  1OMI A;  3UKT A;  2KM2 A;  4YSF A;  1RUI 2;  1B35 A;  2CHH A;  2UWA A;  4F8A A;  4IUG A;  3HVD A;  2WO2 A;  3IB3 A;  3QBQ A;  2WS9 3;  3Q8E A;  1ENX A;  1JHN A;  1HXS 1;  2R0H A;  2VUC A;  2ZGT A;  4NAO A;  1CAX A;  3J9S A;  3NV3 A;  2YZ4 A;  5FDB A;  3KGZ A;  4UF0 B;  3WQB A;  3OGS A;  3RZJ A;  1D4M 1;  1S4C A;  4D6S A;  1T6B X;  4MUV A;  3S7E A;  5KXE A;  3BIE A;  1ND3 B;  2G9Z A;  2VTX A;  4CCM A;  4FPL A;  2BER A;  4OI0 A;  5C9A C;  3FZ3 A;  3KV5 A;  2GSY A;  3JQX A;  3UNP A;  3I2K A;  1XNA A;  2JDH A;  3OUH A;  3R0R A;  5F6L B;  3S7I A;  1NLS A;  2VG9 A;  2KA3 A;  5CB7 A;  2H6C A;  5CFC C;  1E5H A;  4FOV A;  2JDM A;  1LTE A;  1FV2 A;  2ATF A;  4NRO A;  2ZCW A;  3ON7 A;  1POV 3;  5F5I A;  4ZXK A;  1IPS A;  1LOA A;  4N53 A;  4LHL A;  4BH9 A;  3BOW A;  4B4R A;  2WYF A;  2D5H A;  1QQP 3;  4EZH A;  1TNF A;  2XML A;  3RQ0 A;  2PHL A;  5DAP A;  5JXI A;  1IS5 A;  4NJ4 A;  5CFC A;  1HQN A;  1J1T A;  2JEM A;  3BCW A;  2QBX A;  3ENR A;  2XR4 A;  1NYW A;  1C57 A;  1PIV 3;  1RMU 2;  2WQ8 A;  2WZP P;  3KLS A;  2QTW B;  4ISR A;  3I3D A;  4P02 B;  2GNT A;  3B01 A;  4W8J A;  5FRA A;  1EAH 3;  1CJP A;  3J7H A;  4HT1 T;  4L8Q A;  4LE3 A;  3BVC A;  4P9Y A;  4ET7 A;  2B9U A;  3ILN A;  3OYW A;  2ORX A;  3F2Z A;  1OBN A;  3DV8 A;  2ORZ A;  4LKE A;  2I07 B;  4ZS3 A;  4A42 A;  3DGT A;  4FSJ A;  3IPV B;  4MH0 E;  4M01 A;  4PF1 A;  2PFW A;  1US2 A;  4QPY A;  4S2F A;  1SFN A;  3ZSE A;  2A5Z A;  5C3P A;  2D40 A;  2G19 A;  3K77 A;  4DUV A;  4K20 A;  4E4S A;  5AFB A;  1JYN A;  1HLC A;  1VBB 1;  1DQ1 A;  1Q8Q A;  1SLC A;  3IPV A;  1Z78 A;  5BNN C;  3WG1 A;  2W1W A;  1DGL A;  1GV9 A;  3AYD A;  1R1A 3;  3LSE A;  3V64 A;  4M4P A;  2VVF A;  3PUS A;  5GLW A;  4WM8 A;  1WWY A;  2PHR A;  5EJ3 A;  3Q8A A;  1YEW A;  1C5I A;  2YU2 A;  3NKT A;  5BXX A;  3FHI B;  1HRV 3;  1G9A A;  2DU0 A;  1W9S A;  2LM3 A;  2V09 A;  2ID4 A;  2WBK A;  5FYV A;  5A3P A;  3HMY A;  2VMG A;  3I54 A;  1V6I A;  4FPF A;  2WR9 A;  4NRM A;  1ZZC A;  3AYC A;  1UU5 A;  2JKX A;  2D6K A;  2VZP A;  1YI7 A;  2QDN A;  1HRV 1;  4ZON A;  2JE7 A;  4QHO A;  1XE7 A;  1BK0 A;  4FVV A;  4R4X A;  1MZE A;  1O5L A;  2TEP A;  1W6Q B;  3KCY A;  5CKM A;  3O1O A;  5CG9 A;  2V4A A;  1WCQ A;  3J7M A;  5JSO A;  3PUI A;  1UKR A;  4AYU A;  3MIE A;  4XFG A;  2JEN A;  4ZY9 A;  4AGV A;  1IQD C;  1Y43 B;  2VR4 A;  3VBU A;  1AF9 A;  2GP3 A;  2JEC A;  3KB5 A;  1ZYB A;  4Y5Z 0;  2D97 A;  4GIQ A;  3K4Z A;  5FLI A;  2IFW A;  3VBF C;  2ZX2 A;  1CIY A;  1B35 C;  1PZ9 A;  2RMU 1;  2NQY A;  3K48 A;  2RG4 A;  4FPJ A;  4TTG A;  1MZF A;  1X36 A;  4K21 A;  1VMJ A;  5A1L A;  1C8M 3;  2VBB A;  2ZBJ A;  3PIJ A;  2A3X A;  4FP2 A;  4NRQ A;  5FZC A;  4CUG A;  2LUW A;  1DP0 A;  2W94 A;  2JIC A;  2XKP A;  2Z79 A;  4LUL A;  5FO7 B;  1XSR A;  3OB8 A;  4XFH A;  5E8A A;  2E7Q A;  1GQH A;  3AKP A;  5ERL A;  2UYA A;  3W9A A;  3V0B B;  2VW1 A;  3VZO A;  4XCA A;  1WMX A;  2V73 A;  2OT7 A;  4UFI A;  4HPK A;  2WFF 2;  4PIX A;  4OI4 A;  2D3P A;  4XBL A;  1PK6 B;  4ATF A;  1RUH 2;  3WDT A;  4IV3 B;  4Q0P A;  1TVG A;  3THT A;  2X5I A;  3TWI A;  3PU8 A;  3HBZ A;  1T6G C;  1I5P A;  2KXL A;  3BKZ A;  3LPG A;  2VVD A;  1ENS A;  2VW0 A;  4E9K A;  4CUA A;  2WLQ A;  2A71 A;  2JIJ A;  2VZO A;  1Z7S 1;  1OQD A;  3AMQ A;  3M70 A;  2IXL A;  1W39 A;  3TEY A;  3ZN4 A;  1OPO A;  4CCO A;  5CFC B;  4O61 A;  3FBM A;  1QWR A;  5A3M A;  3EJK A;  2Y6J A;  4RFT 0;  3O1T A;  1WW6 A;  1WCK A;  1QH7 A;  4XQD A;  1SMV A;  5GZG A;  2J42 A;  1W99 A;  2E26 A;  1N3O A;  1SBE A;  2VMI A;  1V6K A;  5FZI A;  3TYJ A;  1LHV A;  1AR8 3;  3W5M A;  1HB4 A;  4XF4 A;  3WIN E;  3WCS A;  1SLA A;  4FTS A;  1EV1 3;  3WF4 A;  2BUK A;  4Y1V A;  4LBQ B;  5DN2 A;  5IVJ A;  2WIN B;  1VAK A;  4KBB A;  1AYN 2;  2CSG A;  1UX6 A;  1D7P M;  4UFH A;  4QGN A;  5FY4 A;  2XUM A;  3NV1 A;  5KHJ A;  1PK6 C;  1AR7 1;  3IDE A;  2DTW A;  3H9A A;  2ZS6 B;  3CNA A;  3HD8 B;  4KWK A;  2OZJ A;  3I3E A;  1N3P A;  2NP0 A;  5A70 A;  4AVT A;  1YIF A; 
#chains in the Genus database with same CATH homology
 3GJA A;  2G19 A;  4MHU A;  2HBT A;  5EP9 A;  5HV4 A;  3HQR A;  5LBF A;  3W20 A;  4IW3 A;  3OUI A;  3DKQ A;  5IAT A;  3MGU A;  4NHK A;  2RDR A;  4NMI A;  5HV0 A;  5L9B A;  4NHL A;  2HBU A;  4J25 A;  4ZON A;  5LAT A;  5LB6 A;  5IAX A;  4Y5T A;  5C5T A;  4JZR A;  2RDN A;  2V4A A;  5M0T A;  3OUJ A;  3NNL A;  4BQW A;  2FCT A;  5LAS A;  4Y5S A;  2JIG A;  2FCV A;  2RG4 A;  2A1X A;  4BQY A;  5EPA A;  4NHX A;  4NHY A;  5DAW A;  4BQX A;  3W21 A;  3KT7 A;  5LBC A;  5ERL A;  4XAC A;  4NAO A;  4XAB A;  5A3U A;  4KBZ A;  3NNM A;  4XCB A;  4XCA A;  3OBZ A;  2G1M A;  3KT4 A;  3OUH A;  5DAV A;  3NNJ A;  3ITQ A;  3EMR A;  2FCU A;  2OPW A;  4UWD A;  5DAX A;  2Y33 A;  3PL0 A;  5L9V A;  2Y34 A;  2JIJ A;  4ZPI A;  4XC9 A;  5IAV A;  2RDS A;  4XAA A;  5LBE A;  5L9R A;  4NHM A;  5DAP A;  5DAQ A;  3NNF A;  2RDQ A;  3GZE A;  5C5U A;  3GJB A;  4MHR A;  5EQU A;  4Q5O A;  5LA9 A;  3BVC A;  3HQU A;  5LBB A;  3KT1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...