2V4AA

Crystal structure of the semet-labeled prolyl-4 hydroxylase (p4h) type i from green algae chlamydomonas reinhardtii.
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
222
structure length
182
Chain Sequence
MVGFGEEWRGEVVHLSWSPRAFLLKNFLSDEECDYIVEKARPKMVKTSTGTWFAKGEDSVISKIEKRVAQVTMIPLENHEGLQVLHYHEHGGQRVVTMLMYLTTVEEGGETVLPNAEQKVTGDGWSECAKRGLAVKPIKGDALMFYSLKPDGSNDPASLHGSCPTLKGDKWSATKWIHVAPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PROLYL-4 HYDROXYLASE
publication title The Active Site of an Algal Prolyl 4-Hydroxylase Has a Large Structural Plasticity.
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
total genus 48
structure length 182
sequence length 222
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-06-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 2v4aA00
4NHYA 5EQUA 5M0TA 3HQRA 2HBUA 4Y5TA 2OPWA 2JIGA 2A1XA 2FCVA 4Q5OA 5L9VA 5L9BA 5A3UA 3NNMA 4XC9A 5EPAA 5LBCA 3GZEA 5DAQA 4BQWA 4NHMA 3NNLA 5EP9A 5DAWA 2G1MA 5LBEA 3OUIA 3PL0A 5HV0A 2JIJA 3BVCA 3ITQA 4IW3A 5LBBA 4NHXA 5L9RA 4XACA 4UWDA 3KT4A 4J25A 3OUJA 4Y5SA 5IATA 4BQXA 2G19A 3NNJA 4JZRA 3OBZA 3GJAA 2HBTA 5LATA 5LA9A 4XCBA 5IAVA 3KT1A 4NMIA 2RDNA 3DKQA 3GJBA 2FCTA 5LB6A 2RG4A 4XAAA 5LBFA 2RDSA 2RDRA 5LASA 3KT7A 3HQUA 5ERLA 3EMRA 2RDQA 3MGUA 5HV4A 4MHRA 5IAXA 5DAXA 2Y34A 2Y33A 3NNFA 2FCUA 5DAVA 3OUHA 3W20A 4BQYA 2V4AA 4ZONA 5DAPA 4XABA 4MHUA 4NHKA 5C5TA 3W21A 4NAOA 4XCAA 4KBZA 4NHLA 4ZPIA 5C5UA
chains in the Genus database with same CATH superfamily
4QX8A 3NO8A 1ND2C 2VD7A 4Y1UA 3J8F3 4QPIA 5FPBA 2VAUA 1VPHA 4PCRA 2VOKA 1UOGA 1UXXX 4UI9L 3ZOIA 4ARXA 3DCQA 1DGWX 1NLSA 1RITA 3THPA 3TEWA 3AP5A 4QXCA 1GBGA 3IN9A 5SV5A 5IFTA 3ON7A 4BQ2A 3I3DA 1NCQC 4KI5M 1R081 3VBUA 3HVDA 2B4KA 4E2QA 5ABJB 4LBOA 5FPZA 1DGRA 4DPNA 2FMDA 4YZ2A 1ZRIA 3DYOA 3RFRA 3APBA 3JD73 4OFGA 1DCSA 1W3XA 2HJIA 3NQHA 4S2GA 2HWC3 3K3NA 4S2FA 1GOGA 2MHFA 2QZ3A 2QQOA 1OBNA 4I30A 4I3GA 1RUE2 3FHQA 4PIXA 4C8DA 3DGTA 2VJXA 4CDWA 1SBEA 2BVVA 5CKQA 5IVBA 2JE7A 1QOSA 1W8HA 4NPMA 4ZU5A 2GH2A 3HNBM 2DDUA 5EYYA 4KMQA 1Q5OA 3KS7A 4IV3B 4ISQA 4A7ZA 2XVKA 4IUGA 1YFYA 1CAVA 4FQ4A 2H6CA 1MZ5A 3VZOA 1ND2A 2XR4A 5A3OA 1G7YA 4OYUA 1WD3A 4ASMB 5KXBA 2BWAA 2D44A 2XG3A 3DEMA 3R0RA 4J25A 5A3TA 1H6YA 3USSA 4KBBA 3A0NA 4LLOA 1SFPA 4BQXA 1CGPA 4RHV3 1SLTA 4QGNA 1LR5A 2QBXA 3UGGA 2EVXA 1NCQA 5D8AC 5BNNC 1OQ1A 3BTXA 5KHGA 3FHIB 2KR2A 2N7GA 3J8F2 1EP0A 1Q8QA 3K77A 5CFDB 1CZSA 1G9FA 1QF3A 4V1PA 3R4UA 3LA3A 5DUUA 3PUIA 3DUIA 4HN0A 4JGYB 4CEWB 5LA1A 4DEVA 5FYHA 4UFHA 5BNOC 4CYDA 2AGSA 2FQPA 2CYFA 4R9AA 2IFRA 4QDQA 3Q8BA 1CZTA 1WLCA 1AR63 4QGLA 1Y9MA 1A78A 5FKCA 3H7YA 3HMYA 4U2AA 3JD72 4CCMA 4HVOA 1CAWB 2HWC2 1DFQA 2ZGMA 1F31A 3E5XA 2GMMA 2WWJA 3O7OA 2VBDA 2RJLA 1IS5A 1QJU3 1X50A 3ACFA 3QBQA 4QXKA 4AE2A 4CDXB 4AOCA 1YO8A 3GZAA 2W9XA 3AK0A 5I0TA 1AYM1 2R042 3ILFA 3U4XA 2CHHA 3AJZA 5FZEA 3SHRA 1I5ZA 2Z69A 3IMMA 3U10A 2B45X 1SLCA 5D8AA 4XCAA 4AFBA 5BNNA 1S0IA 3OGRA 5FDBA 2EXJA 5FPXA 2CY6A 4KWKA 5A7NA 1FAYA 4ZPIA 3IBMA 2IC1A 1PMHX 3P5BA 5FYZA 5C5UA 1QGLA 1W9WA 4LO6B 5H9RA 1WGPA 2C24A 3NV3A 3X29B 1P8JA 3KV9A 4RHV2 4R52A 4AL9A 5BNOA 1NA1B 5EZWA 4N8MA 1SACA 5D2AA 1ZA7A 4PT6A 4XTMA 1O3QA 2GN7A 1V9U3 4QU1A 3OTFA 3I3MA 1MS1A 4HKOA 2WQ4A 4OHXA 4K8FA 3POWA 1Z78A 3EJKA 3JUUA 2ERFA 3ZFEB 1UAIA 2WT0A 3M2MA 5JMCA 2FDFA 2AEZA 4RR3B 5GLZA 3RI9A 3PU8A 1LB2A 3NV2A 5A33A 1Q3EA 2ID4A 2K9ZA 3HPNA 4MLOA 1APNA 4WM7B 5DUWA 3ZSLA 3RZHA 3IT8A 2QTWB 1AR62 4H3WA 4YW7A 3L9JT 2YMZA 2OQ6A 4JKKA 2RS33 2OS2A 3BYWA 1AX2A 4G9SB 1G9BA 1XSRA 4L0PA 1EUUA 2BP6A 3DYMA 4XPVA 1W6NA 2VE1A 5HV0A 2XBO1 2K2SA 2GALA 4IV1C 4J6GA 3J7LA 2YGLA 5I0RA 1QJU2 1NY71 4D94A 4RQPB 2YB7A 4OI2A 1LHWA 2SLIA 1GANA 3WNNA 5BUVA 3E5QA 3HQXA 3VBRA 1F5JA 3S0MA 2QJVA 1AYN1 4XACA 4XIKA 5T5PA 3ZMNA 4ZU4A 3VDBA 5FRAA 5ACA1 4Y5SA 1U5YA 1JYIA 3VDDB 1VP6A 1MS9A 1QJY1 1LEDA 1OT5A 1QDOA 1WMXA 4GWMA 5FLHA 1A8DA 4P9XA 4CU8A 1BEV3 2NLRA 1RUG3 4N43B 2R16A 3IKWA 3N7LA 1R1A3 3ZYHA 3BU0A 1LHOA 5K0UB 2ZXQA 4YWAA 1CONA 5CG8A 1PVC2 1CQ9A 2VUAA 1OH4A 5G04L 1ZRCA 5FK7A 4P5HA 4AK3A 2OW4A 4WM8B 3GJBA 5FMOL 3OGVA 1V9U2 3IB3A 1UY2A 3LIHA 3NVCA 1K3IA 1A6CA 2A6YA 3WNOA 4BWOA 1H8VA 3VD7A 2RDSA 2A7AA 2RM21 3PIJA 5FZMA 5LASA 4DMIA 1YQ5A 1CIYA 1AR83 1PHMA 4V2WA 4MGTA 5AC91 1EV11 3GYDA 1QHDA 2E6VA 4WVMA 1OFNA 3I4IA 5FREA 5FZ7A 1W8FA 2ADDA 2Y33A 2RS32 2HEWF 2W91A 4NPRA 2UYAA 1GWMA 2W47A 4HSLA 4AHWA 1KD7A 1MQTC 2WJSA 3USUB 4LOSA 4QD2A 5JAXA 2VO5A 2XQXA 4JRAA 4UFLA 4O65A 1CIWA 1YIPA 4ES8A 4AFDA 4PQQA 3UT0A 2ZEYA 4NAOA 1WW6A 1O3SA 1RUI3 1J83A 3BB6A 1RUF1 2CGOA 2Y6HA 4BISA 3J26N 3KHCA 4QX0A 5JMOA 2ZX4A 3LQCA 3UETA 4PDWC 4OCTA 2LM3A 3AM2A 5HXMA 4X6RB 3A0KA 3UL2A 4PIYA 1RVF1 4MGSA 2X10A 4Y20B 4NIAA 4GIQA 1GKBA 5FQ0B 1X9PA 4Y33A 1UO9A 5FO9B 1BEV2 1RUG2 3O1RA 3EQEA 1OA2A 3AP6A 5JPMB 1R1A2 4HOOA 4XBNA 4RGKA 5JLVA 2D6PA 5FZKA 5KBFA 4N90A 2WNUC 4XC9A 3RZKA 1HN0A 5EPAA 1JZ6A 1NCRC 3ZXFA 4DXSA 1H2MA 3KCXA 4LORA 1Q8VA 1CPMA 2F6BA 1R083 3MLLA 3G7DA 4QPGC 4EN9B 4C1XA 1MQTA 2YBSA 4GALA 3H9AA 4DRRA 3N7MA 1AR82 2Q1ZB 5KR7A 3V56A 3S7EA 4OULA 1V6IA 3M3CA 1HDKA 3J7HA 2BGCA 3OUIA 1DLCA 3UGFA 4AEDA 4EN0A 4AAXA 5A3UA 2P34A 3OJBA 1R091 3MICA 1NYWA 2I07B 2YC4A 4PDWA 3MYXA 4W6XA 3WLUA 4LQRA 1GWKA 2BNOA 3UK9A 3PTYA 5LCWL 3N36A 4HPKB 3M4FA 5LBBA 4LEJA 4JDMA 1WCSA 3T2OA 2QQKA 4E4ZA 4MZUA 1GNZA 4MUVA 2J1VA 1RUI2 1VIWB 4WZFA 1YYNA 1AR71 3QOPA 4GH4B 3MIGA 5CEHA 2ZGNA 1UY4A 4ES9A 2D5HA 3WSOA 2GP5A 5EXOA 3UJOA 1SBFA 1OLMA 2VUJA 2WNUA 5C3OA 1WMDA 2D6MA 3AJYA 1NCRA 3AKPA 4OI0A 4CUCA 1OOPB 2XLFA 3OBTA 3OBAA 4MG2A 2P6CA 2Y64A 3BIWE 4HMZA 4M0NA 4MYEA 1NXMA 2OX0A 4O7XA 3I54A 4QPGA 1F8VA 4JV4A 4M4PA 2DF7A 2XJSA 5GM0A 2Q30A 5FZ3A 4CEYA 1RB8G 2BRTA 2P6HA 1VB2A 1X36A 2DTYA 5FK8A 1UWWA 3R6SA 1N3OA 1JS9A 2J1RA 3KV4A 1UX7A 4XQWA 3OEBA 5T55A 3MV01 4IE0A 1GNHA 4O9EA 3AMNA 1QXPA 5FZBA 4OQ8A 4GJZA 4YM2A 1VLNA 5F3GA 4BPZA 5CKNA 1MACA 2DBIA 4FPEA 2O14A 1QQP3 1BVP1 4HFSA 4BQYA 1OUSA 2BTVC 1OH3A 4IL7A 3F2ZA 4GXLA 1MS4A 5IHRA 4IGQA 4YVWC 2AREA 2C0ZA 1D4M1 2FHRA 3NV4A 4LBLA 5FUPA 4D3WA 4F83A 4QQHA 4GAZA 5JZGB 5FP9A 1AYM3 2VZTA 2A6ZA 2JDHA 4YRDA 3TNQA 5T3NA 3BTYA 4XJ9A 4XAEA 2E33A 1W05A 2J1AA 3M8LA 2VW1A 2WS91 1HRV3 2G9ZA 1JW6A 4NRMA 2GN3A 2VOWA 1OUXA 4GWIA 5JSOA 1I3HA 2MNGA 2XJQA 3ZM8A 1I1EA 1WLDA 3ZO0B 1GLHA 3ES4A 3C2UA 1W8WA 3N9LA 4Q4W1 5FZCA 1FPN1 4MGZE 4BIFA 2XJTA 4L99A 1T6BX 3MFCA 4Q4X1 4NIGA 2YGMA 2YDEA 1ZREA 3WNKA 1K5MB 2D3SA 2YXSA 3U78A 1QH6A 5F3IA 5H9SA 3T1MA 3LZZA 2VMIA 3CJIC 2HWB1 2WO7A 2QE3A 2UYBA 1Y4WA 3H50A 5DXDA 3SXWA 1TMF3 3WF3A 4ZY9A 1CN1A 3KWVA 1HQNA 4NHMA 4XMIA 2JKBA 3U14A 1Q56A 4ATEA 1M4WA 1ND3C 3RZGA 2R0FA 4DNYA 5FZHA 2MEV1 4TYSA 4YVWA 5FWJA 4GMP3 3WW3A 5F9TA 1QQP2 3ELNA 2HWE2 4KG8A 4A7KA 1BZWA 1UOJA 3AZZA 3D3AA 1N1SA 4TWTA 4DRVA 5L19A 2XBO3 5FBZA 5IYYA 2WT1A 1H8TB 2Y6KA 4ASKA 4B4PA 2ZGSA 5FAXA 4HKWA 2CV6A 3N7JA 4LO8A 4YG3A 5GJ6A 2G4IA 1YFXA 2JECA 3CHXA 3ZYIB 5IT6A 3FBMA 5JSPA 1OLRA 5C9AB 2XXZA 3IDCB 2E53A 2VZ1A 1AYN3 2Q8DA 1C28A 2W95A 3N9OA 2VGDA 1S0BA 2JB4A 1HRV2 4QAWA 5FZFA 5FY5A 3T0BA 4YM3A 5ACA3 1BMV2 2PA7A 4RGAA 1PMIA 2ZTNA 4P9JA 4JGZC 3VHRA 4EJRA 3LOBA 4XFFA 1JYTA 1TG7A 1RUJ3 4WZCA 3ZX7A 4GZ9A 3KT1A 4L2NA 2D6OX 3Q8EA 4Q4V3 4AFAA 4CU9A 3T3YA 4XF1A 1ND3A 5JR7B 1WLWA 2VUCA 4H55A 4CUGA 2P17A 3DF0A 1TMF2 4EZHA 2X8KA 4QKNA 3VZLA 3B93A 1CR7A 1N47A 4I0AA 2EXKA 1T6GC 3PU3A 2QUOA 2RM23 1RIRA 4MHRA 5B4XA 1VBA3 4IXLA 3RVHA 1RINA 2HWF3 2VNGA 1SFNA 1CAXB 1CZVA 4LK7A 3WNPA 1OVPA 4LE3A 4BJ0A 2C26A 4XABA 3MIFA 2R061 2J42A 3AB0A 5C8CB 3Q8FA 4FAHA 2DVBA 2JEMA 3VBFB 4ZZ5A 2IXKA 2OZJA 1IPJA 1V6LA 2X5IA 2XBO2 5EJZB 4P08A 2OIIA 5J96B 3TEXA 5LY1A 3CKHA 4A6SA 1NXD1 3ZXKA 2F4PA 5BV6A 1IPSA 3M7AA 2R073 5FY0A 4IV1B 4AGVA 4KBZA 4ITCA 2EALA 3E6CC 4KGQA 1RYYA 3PJQA 5APAA 1DLLA 3AP9A 2LRPA 2ZMNA 3IDBB 1ZRRA 1W2AX 3WY6A 3FLPA 4NHYA 3VB9A 3SNMA 1TVGA 4Y5TA 5I8SA 2OPWA 2JIGA 4Y5Z0 2PMWB 3SH4A 3OYWB 1RVF3 1RUC3 1V6KA 5KHHA 4CRQA 5ACA2 2JG9B 5BNPA 5C4WC 4XDQA 4CDXA 2QZ2A 1MS0A 2ZOEB 2W1QA 2WWSA 1SMVA 2WZR3 1RUJ2 4XQDA 3ZSEA 1V70A 4LUKA 4XBLA 2GC0A 1S0DA 1MVEA 5FP3A 2E32A 1RL3A 4Q4V2 3GZEA 1W9FA 5DDJ1 5FUNA 2FBEA 1DBNA 1G9DA 1VJ2A 3SQOA 1IS3A 1YQCA 4AVTA 4TN7A 1UZZA 2RS11 5EP9A 4IEXA 4K40A 2D43A 4UYBA 4LBQD 2C9AA 1URXA 2VR4A 1YC61 3TBDA 4Q1RA 3RQ0A 2UY8A 2RM22 4RS5B 1LKNA 4Y1VA 5A7SA 3ZPOA 3PL0A 4JQRA 3S7IA 5L7OA 1QY4A 4AGGA 1VBA2 2ZA9A 1QOOA 1F15A 3MFAA 5AVPA 2HWF2 4AI2A 1ZBE3 2DV9A 2A6WA 5C7GA 1E57A 1WW5A 2R32A 1HV0A 1HLCA 1BCXA 3I2GA 3WP6A 1SDDB 3AYDA 1YQ6A 3OGSA 1TE1B 1OKQA 1R093 2JDPA 5JIAA 3S6PA 3ZFEA 2WYFA 4QB2A 1YI9A 1GP5A 1XYOA 1SZBA 3VBHB 1WUVA 2JJ6A 5KXCA 3UESA 4H2AA 4XETA 2CGNA 2R072 2X53S 5EV7A 2VZPA 3EHKA 4BOWA 2VTFA 3POFA 5L73A 1AR73 3SH3A 3WW1A 2J1SA 2JDKA 2FDHA 4M0HA 4PI2A 5FPAA 1RUD3 2IXCA 5I0DA 2Y6LA 3MHZA 1OF4A 1VBD1 2W92A 4EWEA 1RUC2 1RVF2 2XHKA 4UW5A 2XMLA 4YZ4A 2D3RA 2ZHKA 3EXUA 1N1YA 2WZR2 4CU7A 1LU1A 2XL9A 4XFBA 2O8QA 2ET7A 4MO3M 4N53C 4K9SA 3QH7A 5LY2A 4E8DA 3SLIA 4AGRA 1U0AA 5F5CA 1OQDA 5F7UA 1F35A 4JQTA 3BUCA 5BNQA 3POIA 3B5LB 2AEYA 2JDUA 4N43A 3PDQA 4ZXKA 1GFF2 2VOXA 2FCUA 3GZTB 2VULA 4LLFA 3POJA 4P9LA 5J3UA 5DAPA 5FZ1A 4LR4A 2LS6A 4OQ9A 4WM8A 5IK4A 1ZBE2 1JZ4A 3POGA 2V5DA 3WG3A 1HB4A 1NQDA 2BUKA 4FPKA 5FY7A 2PTMA 4QPIC 3PURA 3RJRA 5A1FA 2Q1MA 3FFQA 4OUSA 2IFWA 5H9QA 4W6YA 3GCWA 5G05L 2ZEWA 4FPYA 2WLPA 5GZDA 5HCFA 3LEGA 4MXWB 1LHNA 4P9IA 3HT1A 4ARYA 3J9SA 2TUNA 2B7YA 1US2A 2UWAA 1CJPA 3WV6A 4N53A 1RUD2 5FZ4A 2PHFA 4PF1A 3MV11 5L9VA 1Y43B 4F8AA 3WQBA 3ZFFB 4AFMA 1JU3A 1FPN3 2GDFA 2P3IA 4ZXEA 4L11A 4ET7A 1UNBA 4XILA 4YNIA 4CDWC 2P5BA 3ZLIA 4XFAA 1YJLA 3I3EA 2WN2A 2HWB3 4DB5A 2Q0AA 1W03A 2DVGA 1DZQA 2VMEA 1V6MA 1QEXA 1R64A 3T1LA 2Z2SB 4QB1A 5FTTC 3TN93 2H0BA 5LBEA 3SITA 4CDUA 5FZ0A 4Y26A 4M3CA 1QIQA 3AXEA 4ATFA 2FD8A 2C1FA 3POYA 2IZWA 2ZEXA 3I2DA 2W08A 3SC7X 1OKOA 1XB9A 1AUYA 1FNZA 1WBLA 3U11A 1QJEA 3ZSMA 2BOIA 3AP4A 3GXUA 3VHNA 2KD7A 5DUXA 1US3A 3VDCA 2FDKA 1W2TA 3MW2A 3RWNA 4UFMA 3H7JA 3I7DA 1ALYA 4NIDA 1PO23 4PJYA 4NHXA 5FOJB 5JOWA 3W5NA 1POV0 2E63A 3AKRA 4I02A 1UMHA 3POEA 4PLNA 3KT4A 4W8JA 5F2WA 1ONAA 4AQSA 5DZEA 4N7UA 3WDXA 4DIQA 1U5IA 3H0OA 1PIV1 1S2BA 3LCPA 2YBPA 5A3MA 3LDKA 4Q2FA 4UW6A 5LATA 3N35A 1UOBA 1SPPA 2MPFA 1UCXA 3CZUA 4MGIE 1FMD1 3AVSA 4GQ7A 2R49A 1E5IA 2RE9A 3AZXA 3PJYA 4HPKA 1FPN2 3C7GA 4IERA 2ORZA 3IIAA 3O1VA 1L3JA 1LTEA 1W6OB 5E1RA 4D7SA 5HPOA 1AL23 4NIIA 1Z7S1 3FZ3A 4OHYA 1FX5A 3HQUA 2WFF1 2HKXA 3K75B 4HVQA 2HWB2 4HSJA 2NM1A 3UJQA 1UXZA 4XF9A 3CJIB 1KJLA 1Q43A 5DAVA 2BU9A 3TN92 4Z8BA 2R1DA 5FZOA 5FMOS 4RD7A 3QCWA 4BH9A 3E6DA 3U4SA 2R0HA 2WBKA 5GZCA 4YARA 4YSFA 1ZX5A 3H1WA 4NUBA 5CAZA 4LNVA 1IQDC 1S0EA 2W3JA 4YW1A 2R063 3AYCA 2ZX2A 3GGLA 3W21A 3KMHA 1LODA 3ATGA 3MIBA 4W50A 1DHKB 2A5ZA 1UYZA 2WNVB 1UU5A 1ZZ8A 3BTAA 3H1MA 3ZYRA 2YUEA 5JI7A 1RHI1 4AVCA 3V0AB 1IG3A 1PO22 3CU7A 5GALA 1MPXA 1WD4A 3OGGA 2ES3A 5E8AA 1LHVA 3FUQA 2PLV1 2VNOA 5F8PA 5CG9A 1HV1A 1HRI3 3LE0A 2PAMA 4FPLA 3MW4A 5BY5A 1BVVA 3CBNA 3K4DA 3RGBA 3MDPA 3IPVA 1UZYA 2NMNA 1W04A 4YVSB 3OY8A 4IEYA 3PVBB 3WHUA 1A34A 2G9GA 4GULA 4S2HA 2AUYA 1UKGA 4A2UA 1JUHA 3M70A 2C9KA 3PMSA 4UF0B 3VBOA 1UU4A 1U5ZA 4UBHA 1MR5A 5GZEA 3LEKA 1NAEA 3O0VA 3O0WA 3ZR5A 3FX3A 1AL22 3M1HA 1W90A 4AQ6A 1LU2A 4LIVA 2ZKNA 5FR3A 2XOMA 1QNYA 4AI9A 3M3IA 1IKQA 4CP2A 1XXNA 1LNSA 3VBSB 1QDCA 3T2TA 1VALA 1XJAA 4JKLA 4NRQA 1LULA 2D6LX 2F4LA 3SISA 1QMJA 2VM9A 3VBRC 5IVJA 3RDIA 1BBT1 2WO1A 4BXSV 4YLZA 2FZ1A 3Q8AA 5C8WA 1OPOA 3B69A 3SKJE 3QH6A 5F3CA 5FPLA 1OD5A 1LOCA 1OHFA 2WQZC 2X29A 4K1ZA 4NR1A 3BIEA 1K5MA 1QWRA 2JDMA 4UFJA 3KLSA 1PK6B 3PVNA 4CDQC 2IXHA 1POV1 4QU2A 2R062 3T4VA 2W5FA 2YBKA 3NL1A 3DKWA 3FLTA 4XEZA 4Q0PA 1MEC3 4P9WA 1CVNA 2BNNA 5JSRA 2A75A 3RYKA 1IG0A 1VBB1 5FO8B 1HRI2 4KU8A 4MV2A 5LWBA 4KWLA 1ASJ1 4ZHNA 2CU5A 2D6KA 3AKTA 3KZ4C 1SDWA 1G9AA 1FNYA 4LMFA 1MS3A 3WG4A 1V00A 1W6MA 4Y1ZA 1WCKA 4UBGA 2XKOA 1PO11 1JYVA 2C6SA 1GUIA 1GZWA 4LBJA 2E51A 2WYSA 2FCTA 3MZHA 2QQMA 2HLEA 2LALA 3ZSKA 3NAPA 5JWPA 1B35B 1PGL2 2JICA 3ZXJA 3ZFGB 5C6CA 1KS5A 2G9FA 1GMMA 1RJ7A 1W9YA 2RDRA 5C9AA 1CAUB 2YC0A 5GZGA 2VVDA 4XF4A 2VZRA 1YXWA 1EY2A 1KQRA 3DN7A 2DUOA 2RS53 3CEWA 4FP3A 1C8M3 4Q8LA 3KHBA 4QKDA 1XNDA 2DUPA 4CDQA 4Q0VA 3W20A 1XNAA 1RXGA 1FYUA 5A1LA 1VMHA 3LKJA 1Y7BA 1GP6A 3NJVA 4KH9A 4NWVA 4HONA 1V0AA 4JDOA 3VZMA 4CP9B 3KVBA 1XBFA 3SEEA 3V0BB 1BXHA 2XUEA 4CZSA 1VRH1 1X8MA 5ISLA 1RUH3 3GDBA 2JX9A 4IE5A 4MADA 3GNEA 4C90A 1SLLA 3BALA 4R9DA 3U0ZA 5CFCC 4FAGA 1SCSA 4HZFA 2BOJA 1RMU3 1WKYA 2BBAA 1H4GA 5CZKA 2VQ0A 4UAPA 4WBBA 1W99A 2CDOA 1ZBA3 1C5IA 3SCHA 1FXZA 4LXLA 2DVAA 4FOWA 1MEC2 4WVWA 4EN8B 3C7OA 2AZ5A 1JU4A 1F4AA 2P3JA 3HQRA 3LPFA 5LK5A 2FMYA 4GA9A 1X7NA 1PGW2 4R9CA 3HBZA 2ZGKA 1RXFA 1WA4A 4Y4RA 3TRSB 3VLBB 4X8NA 3FWEA 3ZYBA 4TLGA 3DXTA 4LE4A 1JYXA 3NKTA 1O91A 3RWKX 4OMCA 5L9BA 4CTEA 3O1MA 1UKRA 4DEQA 5C71A 1LGBA 1C4RA 2CWSA 4JAAA 2B42B 3URFA 3PLQA 4COUA 3PHMA 1W6PB 3BTZA 1QJX1 3B9CA 3WF0A 1W2NA 4AEDC 3I59A 4M00A 1KXGA 2XPJA 5T52A 2VL4A 4BQWA 3CNAA 2GP3A 3WEZA 3ZR6A 4E4HA 4CCJA 3WP4A 3VD9A 2A6XA 4IEUA 3VZKA 4DXRA 1AVBA 2WZEA 2O0OA 3N9QA 5EHDA 2RS52 4LKSA 1C8M2 5CFCA 1JZ7A 4IGOA 4G3YC 4K7JA 1NQJA 4JKMA 3LGRA 3SMHA 1JN2P 1OVSA 1OA4A 2WO2A 4LHNA 4HLTA 4B1LA 2BBVA 1AR91 1BQPA 3VUOA 2GMEA 3ITQA 3POSA 1IGOA 1QXRA 4BCUA 1RUH2 2YZ4A 5HXVA 4AEMA 3ZN6B 2FDIA 1XU2A 2WUHA 1GSLA 1T2XA 4MOAA 1WMEA 1RTVA 4X6QB 5F32A 4HK8A 1RMU2 1DGRN 1YLLA 5JR2A 4CXYA 2DU1A 1ULPA 2R7EB 5A3LA 4CEYC 3LAGA 1ZBA2 1Q8OA 3T08A 4BE3A 4Q4Y1 1UY0A 2Q8CA 2VECA 1PIV3 5JOZA 1H2NA 4X8PA 3KM5A 2VQTA 5FY4A 4AF9A 3WW2A 1BK1A 2W1WA 3AX4A 2JD9A 1J1LA 3ST7A 3PNAA 4EN7B 1UW8A 1FATA 4CUAA 4QPWA 4M4RA 1ST8A 3BPZA 2XVLA 3J4UH 4YM1A 3PUQA 3VBUB 1PX3A 4PHZA 4E4SA 4OI4A 1N3PA 2HYKA 1G9CA 4XF0A 1QKQA 1XE7A 2ZCWA 1N1TA 2CAUA 3AYAA 3BGAA 2DUQA 3NWKA 2WA4A 3AYEA 4FP2A 1VBE1 5FXZA 1UU6A 4FVVA 4AQ2A 2R1BA 5ERLA 1COV1 2GNBA 2KA3A 3HR9A 3WDWA 1WA6X 1ULOA 1KEXA 3IIIA 4JDNA 3SH5A 2D3PA 2XLGA 5DAXA 3D6EA 4CDWB 3OUHA 4GB31 3DPRB 4XJUA 1KJRA 1J3PA 3JB8A 3KB5A 4PIZA 4XMAA 2B9VA 5FOBB 4BK4A 2A71A 3I2FA 4GWJA 4QT6A 4DUWA 2BPA2 1CAVB 4DFSA 5FZ6A 1TNRA 1NT0A 1ND2B 3KCCA 4AR2A 1JOJA 2B5HA 4AI0A 4FOQA 2RVAA 2BQPA 3O1SA 4LO4B 3HT2A 4D6SA 5I0SA 3WP5A 2ZMLA 2YU2A 4H14A 4NHLA 3B7MA 2TBVA 2XJUA 2XHNA 2VOTA 3Q8CA 2WAOA 4OLLA 1R082 1EAH1 2K0GA 3TWIA 3H3LA 4QQLA 2PHXA 4LOTA 4RFT0 1NCQB 1W39A 2PLV3 2JG8A 3DXUA 3H3UA 5EIYB 5FPUA 3CJXA 5K7PA 2Q1FA 5AFEA 2GMPA 3SCGA 2NYYA 1FV3A 1KFUL 3F95A 2ZGLA 3V64A 3T0AA 5FWEA 2YY1A 5I8YA 4B7EA 1SEFA 4JTOA 4NOTA 3VZJA 1NX9A 3PVEA 3FC0A 4CE8A 3H8OA 3E6BA 1GV9A 3MPBA 4I09A 4YZ3A 1A8MA 3PVOA 5LW9A 1TNFA 1VB4A 3P3PA 4Q0SA 3AMQA 1LCLA 3FLRA 1VRBA 5K8SA 4I2OA 2QCSB 1BYHA 1GQHA 1DZTA 3KGLA 1V6JA 1QU0A 3TEYA 3V65A 4TZDA 1YFUA 1F4HA 1TZOA 1D4VB 5HCHA 1F2NA 3I3QA 5CU1A 3S30A 1IHMA 5ABJC 3RYPA 3KSCA 4BQ5A 3N9NA 3LDBA 1H30A 2ZACA 1YIFA 2E31A 1UF2C 1Z0HA 2XJPA 4Q0QA 5F6KA 3BVCA 4AVVA 1W6QA 4B1MA 1PZ9A 1JOBA 5CISA 3PIGA 2OYZA 4AI3A 2EA7A 3GHMA 3BI3A 1UZWA 2EAAA 3EYPA 2D7FA 3GALA 4LIUA 1WCDJ 4XFGA 5CNAA 5D8AB 4JHTA 5J98B 5BNNB 1R1ZA 1PZ8A 1POV3 2D93A 2JE9A 1BKZA 3D0SA 4IV3C 3KF3A 3WNXA 3NV1A 5FZGA 5F5AA 3EBRA 2BZDA 3JBG1 4QX3A 2W1UA 3H8XA 3H3ZA 2BVBA 1CX4A 1DQ4A 2VNVA 4YW4A 5BNOB 1XOYA 3VDAA 2ARCA 2LW8A 3UNPA 1LENA 4XTPA 3RMXA 4CCKA 1O3RA 2L9LA 1ASJ3 4FCAA 4Y1XA 3ZKUA 1W0NA 1JZ3A 5J48A 2Y6FA 3E5UA 2ZGUA 3HD8B 4E27A 4IGPA 2RG4A 3DECA 2ZGTA 2ADEA 4UW3A 3HWJA 1AL0G 3LEMA 5JXIA 2D98A 1NZIA 1O3TA 2V73A 2BEOA 5ABJA 3PUAA 2D5FA 2GNDA 2Z5WA 4QQPA 2Y60A 5A33B 4Z2AA 3ZXGA 5CFDC 3KT7A 4AFCA 1A3KA 3L2YA 1AYM2 4FBFA 3J8F1 4C0BA 5F1RA 4AEJA 2VG9A 4CEWC 2X5IC 4KQ7A 1H9PA 4GJYA 4EE2A 5HV4A 1J1TA 4WV8A 3PTRB 3UKNA 2P3KA 3VKFC 1QJY3 1W6NB 2V4AA 3C7HA 4QQOA 3O14A 4XBQA 5FYVA 4ZKTB 4BQ4A 5JCTA 5LK7B 1CPNA 3CQOA 4IV3A 5A80A 3GBFA 5C3RA 5LEKA 2JE8A 3RS6A 4PBPA 2ENRA 3JD71 1W8NA 2CSGA 2WABA 5LA2A 2HWC1 1OD3A 3THDA 3VN4A 3WG2A 4CA9A 3H42B 1NKGA 5A6YA 5BNPC 5FXWA 5IVVA 4M3CF 2ZBJA 2AENA 4CDXC 2EF6A 3ZPYA 1MVQA 1U5XA 3P1IA 1IS6A 3B01A 1J59A 4A42A 4QHBA 1QNWA 2HWD1 1AJKA 2R041 2XQRA 1CESA 4YGCA 3GM8A 2DCTA 1EV13 5AC93 1H4HA 4Y4YA 1XYNA 2ZJCA 1JYNA 1W9SA 5IVFA 5FYBA 1UYPA 5CFDA 5FCCA 1HKDA 1DYOA 1HXS1 2OQ7A 4IEQA 1ASJ2 1TQ5A 3P3NA 5KXEA 2VQAA 1U12A 4EYUA 4JGYA 4CEWA 4FFHA 1UN1A 5L7OC 1NA1C 1ENRA 3ORJA 4QXHA 4DY3A 4RHV1 1FV2A 2PXJA 2D40A 1AZDA 4IE7A 4YG6A 3WF2A 3RMYA 2EIDA 1NY72 1E5HA 1CJDA 1ZZ9A 2I74A 2ZGPA 2DCYA 3KCYA 4XVHA 1TEIA 4INDA 1I9RA 1RUF3 4BLIA 4WVMB 3KF5A 1YI7A 2W52A 4F7ZA 1CAWA 4AEKA 1AYN2 3ZFEC 2ARBA 3AKSA 1LGNA 1QJZA 4RR3C 4LJHA 1RUNA 1PNFA 3WCSA 4NO4A 1QJY2 2YG0A 3B94A 2VNRA 3HNYM 3NW4A 4RYDA 2B8MA 3RZLA 2XVGA 4A6OA 1UQXA 4D0QA 1H1AA 3UGHA 4NPLA 4HKLA 3UKVA 2IXLA 4Z92B 2JDAA 3CL1A 1AR93 3LFMA 4HETA 3ZXAC 1OLQA 3OG2A 4U36A 4ZS3A 3O12A 1XPWA 3AZVA 2OUHA 1O4YA 4DQAA 1SLAA 5IATA 2AC1A 3ACLA 4JCKA 2G19A 1D2QA 1O8SA 2QQVA 4RQPC 1QJU1 4N9IA 5FXVA 4K1YA 3IDAA 4Q26A 5IUQA 1LOEA 4QB6A 3RZMA 1NA1A 1QXJA 4Q4Y3 4LA2A 3MEPA 5AC92 1EV12 4YGEA 1VAVA 1YQ2A 4I3PA 3VDDC 3VKOA 1XNKA 4JX0A 2GNMA 2W2IA 2Y26A 2HYXA 2YPDA 2DFCA 5A7OA 3T30A 2CTVA 4CP1A 4N43C 4COYA 5IVEA 3ACIA 5DQ0A 4YG0A 3OGJA 5FJHA 1JHJA 4PF5A 4RR3A 1WCQA 2WIIB 5FMDA 3NRUA 4QXBA 4KG0A 1B09A 1MQTB 1JMUB 1PVC1 1WCUA 4LULA 4WM8C 4WM7A 3BKZA 1SQ4A 3D0JA 3HJRA 3EMRA 3WDYA 3WNMA 1AXKA 3DV8A 5FP8A 1O5LA 1RUF2 1V9U1 3S5AA 2PHLA 3NSTA 1C3HA 4XXAA 4AEDB 4D8MA 2VMCA 2Z42A 2VPVA 3A7QA 3R4SA 3UV9A 3K4AA 4DZGA 2E7TA 5GLVA 5A7WB 2VU9A 5KHJA 1G86A 4GB33 2TEPA 1OFSA 1ODNA 5C70A 4PDWB 3WQ1A 1ENSA 3I2OA 1UIJA 4LBNA 2PN5A 1OSGA 2ETEA 2OPKA 4TXWA 4XUQA 3TB0A 2BFUL 4RQPA 1C1LA 2ZAAA 3HOBA 4XHXA 5FXXA 1XSQA 4AHXA 2J1UA 4DY5A 4IQPA 2RS31 3WUCA 3WX5A 3OPTA 2VZQA 3IMNA 2WWUA 3VDDA 2W39A 1YNAA 2E7QA 2WNUB 4QX2A 4A44A 5F37A 3VHOA 3WINE 1DZRA 2ORXA 1NCRB 2VBBA 2HBUA 1VAKA 1NUKA 1EAH3 3I8TA 5K0UA 2FCVA 2NP0A 2CL2A 3AZYA 3RNSA 2VTXA 4QPGB 1W28A 5A6XA 1W9TA 1W3VA 2EIEA 2GNTA 3O0XA 4XJAA 2A3XA 4S2DA 1V6NA 4CEYB 3HBKA 5B2GB 2OXBA 3VD5A 1JUIA 5A6ZA 4CDUC 3KV5A 3AFGA 3BODA 1KFXL 2QQLA 1R092 1W2OA 2EXIA 4DOUA 1VBC1 2XH6A 1BEV1 4CU6A 1RUG1 3OPWA 1D4M3 5GKAC 1LOGA 4M01A 3VV1A 1S0CA 1YWKA 3TOJA 3NNLA 1OI6A 4JRLA 2QFEA 3IWZA 4W4ZA 2W68A 3FHAA 4LO7A 2DCKA 1UYXA 5FY9A 5DZFA 2WS93 5GLUA 3H1YA 1AR72 3JU9A 2DVFA 3UKTA 3ZXLA 4AAPA 3BCWA 3M3QA 1HIXA 2JB8A 2WLQA 3LA2A 3LSEA 4XJZA 5GLWA 3USUA 4FFIA 3O1PA 1W0OA 3JQWA 4GB32 4Q4W3 4P02B 4Q4X3 1W6PA 4FPCA 5IW0A 4YYOA 1AR81 2W94A 4XURA 4ZU7A 2PAEA 1F9KA 1CX1A 1X8EA 2VXRA 1SLIA 2WN3A 5FP7A 3U1XA 2JENA 3NJZA 4XIOA 2VVFA 1DYPA 1RJ8A 2XB6C 1S2EA 3MLKA 1CD3G 4Y24A 4LT5A 3K4ZA 5H9PA 2C5DA 4XDPA 4Y20A 1POQA 5CADA 2HBTA 5FQ0A 3WW4A 1UZVA 1L7LA 3JBG3 5F5IA 1UPIA 4ORFA 3KGZA 3ASIA 2ZHLA 4P00B 1GP4A 5CYYA 4OZOA 5JVVA 2MEV3 1O4ZA 2VVEA 4GH4C 5LRRA 4NMIA 3NKGA 4XFHA 3WDVA 3WQ7A 4BHPA 1RUI1 4JVAA 1NE6A 1O59A 2A3YA 4L9BA 3VHPA 1W8OA 1OLME 3BPSA 1ENXA 3DYPA 3INAA 4K8RB 2RR11 3B3QE 2Y6JA 2E7AA 3CF6E 1AX0A 3I2KA 1M06G 1ZRDA 4KGGA 3GF6A 4MGYE 5F2SA 5JOYA 2UURA 2Z4FA 4D6RA 4SBVA 3R4DB 2VMHA 4URTA 3VD3A 3ZYJB 1D4M2 2XWJB 1BK0A 3NJYA 3W58A 1SHWB 4FPFA 1S55A 4YVWB 2ZX1A 3MGUA 1AXYA 1HN1A 4QMAA 3HN1A 5A3NA 3QACA 5CKMA 2WSUA 2EIGA 3AMHA 3AP7A 5CA6A 3MLJA 3LD8A 1J3QA 3MIHA 3WDUA 3C8XA 2WS92 4D6QA 3ZMOA 3AZWA 2DVDA 5IK5A 3T0DA 3AMPA 3K48A 4FFGA 2JXAA 3JQXA 4ISRA 4LBMA 3MIEA 2ZZQA 4FPGA 1GYKA 5TSWA 3W5MA 4Q4W2 1DIWA 1G6NA 1PGSA 3C3VA 1C8NA 3JXSA 4Q4X2 4XE9A 2VW2A 4LO5B 5FLIA 1OXCA 5IVYA 3WD5A 1Y3TA 5FY1A 5J37A 1CWPA 5I91A 4Y22B 1SG3A 5FUIA 4CCOA 2CWMA 1GR3A 2GZWA 3BOWA 4GH4A 4IEPA 3WUDA 2BV4A 3I2JA 4YW3A 4XJWA 4DS0A 5EQUA 3VBOC 4Q8KA 1GU3A 4GMP0 2WNEA 3ETPA 3T09A 2PQQA 2OUJA 5JZGC 2B39A 3DPRA 1GICA 5FYMA 4YW6A 5ANQA 1HJGA 1D0HA 1OOPA 2HWD3 1DF0A 2GC1A 3JBG2 5SV8A 2X05A 2R043 1L7RA 4R4XA 3U75A 5ANNA 3U07A 2CDPA 4FTEA 1S1AA 2YU1A 2MEV2 3ZYFA 4BMEA 2GU9A 3CIHA 1ND3B 5LBCA 4MGKE 5F5QA 5DG1A 1HXS3 1OURA 4D69A 2FDGA 1YRZA 3OCPA 1ZM1A 2WAAA 4H7LA 4YM0A 5JI9A 2UY9A 2BNMA 2PHTA 2VMGA 3MF9A 5DAWA 1K5MC 1Y9GA 1JI6A 1ZNPA 2UWBA 1OF3A 4QKFA 5CVRA 1UX6A 5E88A 4E2GA 2J1EA 2JKXA 2NMOA 2QQPA 2JIJA 3N7KA 4NE9A 1JYWA 5IK8A 3NNGA 1NG0A 5FYCA 2YFUA 1ULFA 3G6JB 4URAA 4UFKA 3AKQA 1WW7A 2X5IB 3A23A 3T2PA 4A45A 4YZ1A 5IVCA 5C3PA 1BHGA 3HAGA 4I0WB 1MZEA 4EZ4A 1O7FA 1W8TA 1XNCA 4L8QA 5JZGA 5A32B 5IK7A 2QQNA 4JGZB 5A70A 5KHIA 4RA0A 5DDJ3 1O5UA 1QQP1 2HH9A 2RMU1 2HWE1 1NOVA 1VMFA 1IKPA 1H8TC 3CDZB 1ZZ7A 3WZ1A 3I49A 3MF6A 2WQ8A 1XE0A 1C1FA 3OD4A 3GJAA 3NAPC 3N9PA 1O8PA 2WKKA 4AW7A 2D97A 4B4RA 4BU2A 5BNPB 2RS13 2VCAA 5IAVA 1UL9A 4EV0A 4XUPA 4YW2A 1D7PM 4NROA 5C9AC 5E89A 3WDTA 2HWD2 3SCFA 4FXKB 4L92A 4LBQB 4BQ3A 5FFOC 4FT8A 1DGWA 4LKFA 1D0GA 4PI0A 1YUDA 5LBFA 2A73B 1K12A 1H1MA 1HRV1 4XOGA 1HXS2 4YFWA 1BMV1 2ZX0A 3K51A 3IAPA 2RV9A 2OKXA 4QKBA 1HQLA 4UXAA 4K3UA 2WZPP 1W2UA 5FYUA 1ULCA 5F3EA 1AHSA 3E1F1 3KQRA 4OMDA 2Y0OA 4BXFA 5L7OB 1PVC3 1AF9A 2VOVA 1QJFA 3QLQA 4JC1A 1J84A 3E97A 1S0JA 5DUVA 4RSUA 3N3HA 1ULEA 1XC6A 4C1WA 1HW5A 3LB9A 1PM7A 4LBKA 4GD4A 1LECA 1TMF1 3AXDA 5DPNA 1SLBA 1VBD3 1H8TA 3GBWA 4EN6B 5GLTA 2H0VA 2PFWA 3H8UA 3FFZA 4NRPA 4XUOA 4XYXA 3ZIXA 3B00A 1Q8SA 2Y8KA 3OF1A 1PZ7A 3C7FA 4QX1A 3WP3A 5C4WB 4IEVA 1LOAA 1TME1 4JHZA 2KM2A 1EYBA 1PMJX 2W46A 4HL0A 4IEWA 4IETA 4V2VA 5C8CC 3ALQA 3D8CA 4XZPA 4GMP1 3VBFC 1JZ5A 5DDJ2 3RPQA 4DUVA 4AYUA 2ZAHA 1PM4A 1NLRA 4XXPA 5C3QA 2GC2A 4UFIA 1W8UA 2XL7A 4Y1YA 3NJXA 3SEPA 5A6QA 1EPWA 3ILNA 2RS12 5FP4A 2XGXA 3ZDVA 4EWAA 3DL3A 3O1UA 4LA3A 2JDYA 4COVA 2IVIB 1WW4A 2IUWA 4IEZA 1UZ0A 4XQ4A 3T4HB 4RGGA 1WWYA 3CO2A 3N4MA 2W1SA 5LRSA 2QDNA 5EFUA 5A7PA 3S57A 1VAMA 2JG9C 5DAQA 4YGDA 3WT3A 5HCBA 4FXGB 4HT1T 4AZZA 3GCXA 4AHZA 1OA3A 1YHFA 4FI9A 4BB3A 4HVRA 2Y38A 2LTNA 1GOHA 1VBC3 4AHYA 1OQEA 3AL6A 3ROUA 1LGCA 4AXOA 1RUJ1 3QD6A 4YGBA 2K46A 5FPVA 5K9YA 4IDZA 4Q4V1 4XW3A 1JH5A 2QQUA 3ME2A 3N9MA 3ES1A 1CAXA 2A6VA 2PQSA 1UY1A 2YHJA 2JDNA 1XNBA 1DG6A 2Y6GA 1I5PA 2Q5TA 2VMFA 5KWRA 5C8CA 3CZJA 4B4QA 3VBFA 1DQ1A 2C4XA 4Z1VA 3A21A 5FZDA 4D7TA 4FOVA 4IW3A 4RS5C 1VBD2 4GWNA 1IS4A 2A3WA 2ATFA 5EWSA 1PNGA 1YJKA 4IV1A 4ZS2A 4BLJA 3A22A 2AH2A 1KGYA 2XJRA 4RN5A 1VBA1 1LJ7A 2HWF1 2BGOA 2GC3A 2WC2A 4XDOA 2QQWA 4ASLA 2YV8A 4XFIA 3KD4A 2P3YA 5LA9A 1ODMA 2DWRA 4N53B 3VBHC 4IEOA 4LHSA 3D82A 3OYWA 4XFCA 5J36A 1REDA 2JG9A 2RJ2A 3W59A 3HNMA 4FPHA 2WFPA 2ILMA 2VZVA 2F17A 2DCZA 5J09A 2B9UA 2RDNA 2VMDA 4K21A 1S0FA 2EICA 1O4TA 2R071 3FJSA 5LB6A 4RFRB 3HN3A 3RSJA 1H1IA 1UPSA 5BXXA 4QDSA 5DMYA 5JXHA 1FOD1 4N9HA 4BQ1A 2VCMA 5C33A 2BDRA 3KVAA 1JBCA 4Q0UA 2HEVF 2RR13 3K46A 3R05A 4I0BA 3ZKYA 3FUOA 2J22A 3OB8A 2IWGB 3VGIA 3B02A 4META 4YW5A 3ZXDA 4BK5A 1FT9A 1RUC1 4CDUB 2QVSB 2ZZJA 5IAXA 1VBC2 4M3CB 2V09A 1NE4A 3AC0A 2WZR1 4RS5A 2PHRA 4KWJA 4QPIB 5K4LA 2Q8OA 4DXTA 1F5FA 4ZZ8A 3M3OA 2ZX3A 4KL1A 2PHUA 2LUWA 2VCBA 2ZABA 1GNYA 1K45A 2GSYA 3S5QA 2P4EA 3EB7A 1NLQA 4L97A 4NHKA 1IOAA 2QDRA 1FMD3 4CCNA 2JG8C 2BGPA 5JXGA 2JDZA 4QQ2A 3VBHA 3VD4A 3KV6A 3WOGA 1BJQA 2OVUA 2P1BA 5IJRA 1N1VA 3RZJA 1Z7S3 3M3EA 1ZBE1 3IAQA 1C5HA 2VH9A 2WFF3 4QM8A 1SPPB 4E2SA 3B9IA 4QPYA 1JODA 3FMGA 5FLJA 3OPZA 1ULDA 1N3QA 5A7WA 2LROA 3TNPB 4MGQA 1H2LA 3NNMA 5IFPA 1IPKA 4OUMA 1JHNA 2PYTA 3HEIA 4Y3OA 4LHKA 3MW3A 1XYPA 5F39A 1IZ3A 1JZ2A 4FOYA 3ZXEA 1Q8PA 2WSVA 4CCDA 3RJ2X 4LKDA 5FO7B 5JUVA 3VKNA 3GZUC 1LAJA 3LIGA 1RUD1 1KDMA 1PX4A 3ECQA 2RR12 3VKMA 5I8TA 1YFWA 1GWLA 2GH8A 3ZFFC 4YZ5A 2CGPA 1RHI3 5T5OA 4UOJA 3THCA 4YFZA 5FZOB 1WBFA 3NMBA 3VZNA 2XWBB 3MPPG 1W0PA 4A4AA 1RUOA 3WF4A 2B46X 2OZ6A 1DDLA 2ZPXA 1PIV2 4B8EA 2Q8EA 1YEWA 1L7QA 2IXIA 2VZSA 1UYYA 5DZGA 1LOBA 1JYCA 1XQNA 3OSDA 3ZIWA 4XF3A 3ZYPA 3VL8A 2PHWA 4COWA 4FSJA 4LPLA 3RRDA 4M3CE 5EYXA 5JIUA 1FMD2 1KDKA 5L9RA 1PVXA 4A3XA 1X33A 4UWDA 5FMCA 2FDJA 1JXNA 4OVEA 4FPOB 4COZA 2ZGQA 2DU0A 4J1WA 2EAKA 5KC5A 3T2QA 3NNJA 2R30A 4MXWA 3IPVB 2RMU3 1REEA 4N7IA 2HWE3 2V5YA 3OY8B 1Z7S2 2VZ3A 2WFF2 1GOFA 3CMGA 5LA0A 5T5LA 4WVVA 4BZ4A 4OHWA 4Z07A 4W6WA 5IWFA 2FZ2A 2R6QA 3ZFFA 3K2OA 1BBT3 4LUMA 4QDRA 4RL7A 1GQGA 1HB3A 5BPXA 3VBOB 5FV3A 2NPIA 3O5SA 5T5JA 2WR9A 3FL7A 3JZVA 5FZLA 1RUE1 1SFYA 5JXJA 5FYTA 1H2KA 3WXPA 5T50A 4XJ8A 1X82A 3I2HA 3O1OA 2RDQA 3RI8A 4OHVA 1HQWA 5FZ8A 3PUSA 1RHI2 1ZYBA 4XHBA 1C57A 3NNFA 3GHNA 4ZONA 2PLV2 3OOXA 1VBB3 2YPJA 2WINB 1FI2A 2XONA 4AG4A 4MHUA 5J7MA 1XU1A 1BLZA 2BWCA 5C5TA 2J7MA 5LZ6A 4JTNA 1ZA4A 2VW0A 1PO13 4NWWA 5E16A 3MIDA 2ET1A 2WO3A 4EWDA 3TN91 1KS4A 4BYYA 2H6BA 3GBGA 4P14A 2V72A 4R4ZA 5DN2A 3WCRA 1DGLA 1MZ6A 3CLPA 4ONUA 5FY8A 1TME3 4JGYC 1AXZA 2W87A 5FIXA 4CPBA 5F6LB 1JTZX 2WNVC 2NQYA 4LITA 4EQVA 3EO6A 4KNCA 2A1XA 2EIBA 2RMU2 1W6MB 4OUEA 3H8RA 2BFUS 3WNLA 5HCAA 4CCEA 2JD4A 4UT5A 1GZWB 1PO21 3K3OA 4OZXA 4E9KA 2VUDA 3C7EA 4C0HA 5JPNB 4MVTA 2QKDA 3NAPB 4CPBD 4HANA 4O61A 3A4UA 1BBT2 1ACCA 1J3RA 1VMJA 3MO4A 4YVSC 1VRH3 1W6OA 2XKPA 4FQZA 3VBRB 3WHTA 2HEYF 2I2SA 4Y22A 3MUY1 1LOFC 2VQUA 5J1XA 3ZDSA 4NJ4A 1GQPA 2G1MA 5L36A 3CJIA 4PLMA 4R9BA 2VZUA 1XE8A 4K20A 2PHDA 4CDQB 4CP0A 1H6XA 3LF7A 3JCIA 2P2KA 1W8ZA 1DQ6A 4QM9A 2AYHA 4QWNA 1H0BA 1VBB2 2DURA 1AL21 4DXZA 2PELA 3TYJA 3VBSC 4NN0A 4G4FA 5FMBA 4BMBA 4O9GA 3ZN5A 2EXHA 4FTBA 3I97A 2WNVA 3ZN4A 4C91A 3O1TA 4FTSA 4R8HA 1PO12 2A70A 2E26A 5C3SA 3V0AA 2ZKLA 3LDRA 5I93A 1WMFA 5LEJA 4AWDA 3U37A 2NN8A 1QJX3 2VTXJ 1LRHA 1GZCA 4HG6B 4OI1A 3LEIA 2V4VA 1PK6C 5FYSA 5FJKA 3OBRA 4B29A 1EUTA 2QQJA 3OBZA 4DO0A 2CNAA 4BIOA 1TME2 2ZS6B 5CIRA 4J1XA 2O1QA 1Y9QA 2X09A 4PBOA 1AX1A 4YVSA 1LEMA 1ULGA 4QHZA 3VKLA 2WRAA 1MS8A 1ZVFA 4WM7C 2PAKA 3WQ0A 3TAYA 1JOPA 1LOFA 2OT7A 3ETQA 4FFFA 4IE4A 4K6BA 3Q9OA 4CUBA 5A3PA 1K42A 2I45A 1ZRFA 4CCCA 4UF0A 4TTGA 1G8WA 1ZZBA 4I01A 4LTAA 1AR61 2XUMA 4CP9A 1VE0A 1HRI1 3I59B 1JZ8A 5A32A 5FYYA 2ZGRA 4NVPA 4JGZA 1DP0A 2OA2A 1FOD3 1VRH2 5E6HA 2DBNA 2TNFA 3AVRA 4BM8A 4DUXA 1HX6A 1REFA 1OC1A 2ZEZA 1ZZ6A 1RC6A 2Q4SA 5FYIA 4TLFA 5DG2A 5FZ9A 1B35C 4SLIA 3VBSA 5CFCB 4Z82A 5EJ3A 3ZFGC 2BW8A 3I3BA 4A41A 5JDBA 5I0UA 3RZZA 3ZYGA 3LOIA 1PGL1 2WDBA 4QX7A 4OHZA 1MS5A 3UYJA 3LFIA 1DYKA 2E9QA 3LA7A 1SCRA 1S0GA 1HB2A 3MBWA 4LBQA 1E5SA 4AQTA 4KWUA 1UMIA 2D6NA 1PK6A 3ZVXA 4AI1A 1KITA 1IQAA 3VL9A 4PQ9A 1ZZCA 5K0UC 5FZIA 1YCIA 1QH7A 3WR0A 1S2KA 4TSVA 3P6BA 4A3ZA 4MH0E 2Z79A 3ZSJA 1QJX2 3FBYA 5M0TA 1DU3D 1WLTA 4KU7A 1VBE3 3D4KA 4UW4A 1COV3 2UWCA 1J58A 1UOFA 2VBPA 4HBNA 4Q5OA 2SBAA 2J1TA 3FE5A 3RYRA 1QOTA 5BYNA 4WVZA 2BJSA 1H9WA 4H7MA 5JOXA 3IZOA 2VY0A 2ZHMA 3ABZA 2WL1A 4AVBA 5HBAA 1RGSA 1KRIA 1MEC1 3WVJA 1B35A 4QHOA 1UD1A 4BDVB 3ACHA 4MX3A 3ZFGA 4AVSA 2WA3A 2Y0IA 1AR92 5C4WA 4E8CA 5FZAA 5A1AA 1ENQA 1PGW1 3J7NA 3POBA 4Q1PA 1CAUA 5KXDA 1AJOA 1FOD2 1LHUA 4FO9A 1YQ8A 1W06A 4HN1A 3THTA 4EROA 2O8OA 2WT2A 3D5OA 4NAMA 2IXJA 1NZCA 4CSWA 3IM0A 1UMZA 4DINB 4XUTA 1XRUA 4CXXA 5CBLA 2UU8A 3ILRA 4A7YA 2BERA 1SBDA 3IDEA 1UIKA 2AR6A 3ENRA 4GKYA 4IESA 4MXVA 4Q27A 4W65A 3PMEA 3WF1A 2VCCA 4Q4Y2 2WZ8A 5KC6A 3V0BA 1HJFA 3BOPA 4LK6A 4QGMA 2IVJA 3LPGA 3L2HA 2DYCA 1DQ5A 2DTWA 2RJKA 3AMMA 4P9GA 3I2IA 4BA6A 2ARAA 1S4CA 3OD0A 2RS51 3RG0A 4YPJA 1C8M1 2AACA 2P37A 3OUJA 2XDVA 5HI0A 2ZGOA 3LWCA 1LESA 1R1A1 4LHLA 2XLAA 1OMIA 4Q29A 3TEZA 3BN6A 4CXWA 1K5JA 2ZMKA 4JZRA 2JG8B 5D1IA 2QQIA 2QNKA 2YROA 4GKXA 4XCBA 1VBE2 3MI8A 4HK9A 1COV2 1RUH1 3OEAA 1DQ0A 4B7KA 5CB7A 4Z2WA 2W0XA 1V6OA 3DKQA 3J7MA 2BYVE 1RMU1 1E5RA 4P5YA 4LKEA 5T54A 2YYOA 5B4NA 1D2SA 4XAAA 3SKVA 2YFZA 5FKBA 1DQ2A 1ZBA1 3AL5A 1WZXA 2VC9A 5DABA 4B3NA 2XJVA 4D7YA 5EJ1B 1GZ9A 5AFBA 1STMA 4MSVA 4AVAA 1OPMA 3JB4C 3AFKA 3W9AA 4CCLA 1VR3A 1GZTA 2CAVA 4PLOA 2YC2A 2VZOA 1RUE3 4QX5A 5KHKA 3WG1A 2ZHNA 3VBUC 3ACGA 1HB1A 2KXLA 4P9YA 4XZUG 5FBJA 1XNTA 2Y34A 3KQ4B 5AVAA 3HIFA 2GAUA 4XUNA 1W6QB 3LSDA 2JWPA 4IE6A 1EAH2 2ARXA 3FN9A 3MUZ1 2VXJA 3PUHA 1O6UA 4F3JA 5A3WA 1UY3A 1X9TA 2DCJA 4HXCA 3DPRC 5D21A 3BU7A 1I6XA 1MZFA 1OOPC 2RHPA 3ZN6A 2WNOA 4AI8A 4NIHA 4FPJA 2NZ9A 2DFBA 1EPZA 4E4DX 5GZFA 5A7QA 4CVUA
chains in the Genus database with same CATH topology
4NHYA 5EQUA 5M0TA 3HQRA 2HBUA 4Y5TA 2OPWA 2JIGA 2A1XA 2FCVA 4Q5OA 5L9VA 5L9BA 5A3UA 3NNMA 4XC9A 5EPAA 5LBCA 3GZEA 5DAQA 4BQWA 4NHMA 3NNLA 5EP9A 5DAWA 2G1MA 5LBEA 3OUIA 3PL0A 5HV0A 2JIJA 3BVCA 3ITQA 4IW3A 5LBBA 4NHXA 5L9RA 4XACA 4UWDA 3KT4A 4J25A 3OUJA 4Y5SA 5IATA 4BQXA 2G19A 3NNJA 4JZRA 3OBZA 3GJAA 2HBTA 5LATA 5LA9A 4XCBA 5IAVA 3KT1A 4NMIA 2RDNA 3DKQA 3GJBA 2FCTA 5LB6A 2RG4A 4XAAA 5LBFA 2RDSA 2RDRA 5LASA 3KT7A 3HQUA 5ERLA 3EMRA 2RDQA 3MGUA 5HV4A 4MHRA 5IAXA 5DAXA 2Y34A 2Y33A 3NNFA 2FCUA 5DAVA 3OUHA 3W20A 4BQYA 2V4AA 4ZONA 5DAPA 4XABA 4MHUA 4NHKA 5C5TA 3W21A 4NAOA 4XCAA 4KBZA 4NHLA 4ZPIA 5C5UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NHY A;  5EQU A;  5M0T A;  3HQR A;  2HBU A;  4Y5T A;  2OPW A;  2JIG A;  2A1X A;  2FCV A;  4Q5O A;  5L9V A;  5L9B A;  5A3U A;  3NNM A;  4XC9 A;  5EPA A;  5LBC A;  3GZE A;  5DAQ A;  4BQW A;  4NHM A;  3NNL A;  5EP9 A;  5DAW A;  2G1M A;  5LBE A;  3OUI A;  3PL0 A;  5HV0 A;  2JIJ A;  3BVC A;  3ITQ A;  4IW3 A;  5LBB A;  4NHX A;  5L9R A;  4XAC A;  4UWD A;  3KT4 A;  4J25 A;  3OUJ A;  4Y5S A;  5IAT A;  4BQX A;  2G19 A;  3NNJ A;  4JZR A;  3OBZ A;  3GJA A;  2HBT A;  5LAT A;  5LA9 A;  4XCB A;  5IAV A;  3KT1 A;  4NMI A;  2RDN A;  3DKQ A;  3GJB A;  2FCT A;  5LB6 A;  2RG4 A;  4XAA A;  5LBF A;  2RDS A;  2RDR A;  5LAS A;  3KT7 A;  3HQU A;  5ERL A;  3EMR A;  2RDQ A;  3MGU A;  5HV4 A;  4MHR A;  5IAX A;  5DAX A;  2Y34 A;  2Y33 A;  3NNF A;  2FCU A;  5DAV A;  3OUH A;  3W20 A;  4BQY A;  2V4A A;  4ZON A;  5DAP A;  4XAB A;  4MHU A;  4NHK A;  5C5T A;  3W21 A;  4NAO A;  4XCA A;  4KBZ A;  4NHL A;  4ZPI A;  5C5U A; 
#chains in the Genus database with same CATH topology
 4QX8 A;  3NO8 A;  1ND2 C;  2VD7 A;  4Y1U A;  3J8F 3;  4QPI A;  5FPB A;  2VAU A;  1VPH A;  4PCR A;  2VOK A;  1UOG A;  1UXX X;  4UI9 L;  3ZOI A;  4ARX A;  3DCQ A;  1DGW X;  1NLS A;  1RIT A;  3THP A;  3TEW A;  3AP5 A;  4QXC A;  1GBG A;  3IN9 A;  5SV5 A;  5IFT A;  3ON7 A;  4BQ2 A;  3I3D A;  1NCQ C;  4KI5 M;  1R08 1;  3VBU A;  3HVD A;  2B4K A;  4E2Q A;  5ABJ B;  4LBO A;  5FPZ A;  1DGR A;  4DPN A;  2FMD A;  4YZ2 A;  1ZRI A;  3DYO A;  3RFR A;  3APB A;  3JD7 3;  4OFG A;  1DCS A;  1W3X A;  2HJI A;  3NQH A;  4S2G A;  2HWC 3;  3K3N A;  4S2F A;  1GOG A;  2MHF A;  2QZ3 A;  2QQO A;  1OBN A;  4I30 A;  4I3G A;  1RUE 2;  3FHQ A;  4PIX A;  4C8D A;  3DGT A;  2VJX A;  4CDW A;  1SBE A;  2BVV A;  5CKQ A;  5IVB A;  2JE7 A;  1QOS A;  1W8H A;  4NPM A;  4ZU5 A;  2GH2 A;  3HNB M;  2DDU A;  5EYY A;  4KMQ A;  1Q5O A;  3KS7 A;  4IV3 B;  4ISQ A;  4A7Z A;  2XVK A;  4IUG A;  1YFY A;  1CAV A;  4FQ4 A;  2H6C A;  1MZ5 A;  3VZO A;  1ND2 A;  2XR4 A;  5A3O A;  1G7Y A;  4OYU A;  1WD3 A;  4ASM B;  5KXB A;  2BWA A;  2D44 A;  2XG3 A;  3DEM A;  3R0R A;  4J25 A;  5A3T A;  1H6Y A;  3USS A;  4KBB A;  3A0N A;  4LLO A;  1SFP A;  4BQX A;  1CGP A;  4RHV 3;  1SLT A;  4QGN A;  1LR5 A;  2QBX A;  3UGG A;  2EVX A;  1NCQ A;  5D8A C;  5BNN C;  1OQ1 A;  3BTX A;  5KHG A;  3FHI B;  2KR2 A;  2N7G A;  3J8F 2;  1EP0 A;  1Q8Q A;  3K77 A;  5CFD B;  1CZS A;  1G9F A;  1QF3 A;  4V1P A;  3R4U A;  3LA3 A;  5DUU A;  3PUI A;  3DUI A;  4HN0 A;  4JGY B;  4CEW B;  5LA1 A;  4DEV A;  5FYH A;  4UFH A;  5BNO C;  4CYD A;  2AGS A;  2FQP A;  2CYF A;  4R9A A;  2IFR A;  4QDQ A;  3Q8B A;  1CZT A;  1WLC A;  1AR6 3;  4QGL A;  1Y9M A;  1A78 A;  5FKC A;  3H7Y A;  3HMY A;  4U2A A;  3JD7 2;  4CCM A;  4HVO A;  1CAW B;  2HWC 2;  1DFQ A;  2ZGM A;  1F31 A;  3E5X A;  2GMM A;  2WWJ A;  3O7O A;  2VBD A;  2RJL A;  1IS5 A;  1QJU 3;  1X50 A;  3ACF A;  3QBQ A;  4QXK A;  4AE2 A;  4CDX B;  4AOC A;  1YO8 A;  3GZA A;  2W9X A;  3AK0 A;  5I0T A;  1AYM 1;  2R04 2;  3ILF A;  3U4X A;  2CHH A;  3AJZ A;  5FZE A;  3SHR A;  1I5Z A;  2Z69 A;  3IMM A;  3U10 A;  2B45 X;  1SLC A;  5D8A A;  4XCA A;  4AFB A;  5BNN A;  1S0I A;  3OGR A;  5FDB A;  2EXJ A;  5FPX A;  2CY6 A;  4KWK A;  5A7N A;  1FAY A;  4ZPI A;  3IBM A;  2IC1 A;  1PMH X;  3P5B A;  5FYZ A;  5C5U A;  1QGL A;  1W9W A;  4LO6 B;  5H9R A;  1WGP A;  2C24 A;  3NV3 A;  3X29 B;  1P8J A;  3KV9 A;  4RHV 2;  4R52 A;  4AL9 A;  5BNO A;  1NA1 B;  5EZW A;  4N8M A;  1SAC A;  5D2A A;  1ZA7 A;  4PT6 A;  4XTM A;  1O3Q A;  2GN7 A;  1V9U 3;  4QU1 A;  3OTF A;  3I3M A;  1MS1 A;  4HKO A;  2WQ4 A;  4OHX A;  4K8F A;  3POW A;  1Z78 A;  3EJK A;  3JUU A;  2ERF A;  3ZFE B;  1UAI A;  2WT0 A;  3M2M A;  5JMC A;  2FDF A;  2AEZ A;  4RR3 B;  5GLZ A;  3RI9 A;  3PU8 A;  1LB2 A;  3NV2 A;  5A33 A;  1Q3E A;  2ID4 A;  2K9Z A;  3HPN A;  4MLO A;  1APN A;  4WM7 B;  5DUW A;  3ZSL A;  3RZH A;  3IT8 A;  2QTW B;  1AR6 2;  4H3W A;  4YW7 A;  3L9J T;  2YMZ A;  2OQ6 A;  4JKK A;  2RS3 3;  2OS2 A;  3BYW A;  1AX2 A;  4G9S B;  1G9B A;  1XSR A;  4L0P A;  1EUU A;  2BP6 A;  3DYM A;  4XPV A;  1W6N A;  2VE1 A;  5HV0 A;  2XBO 1;  2K2S A;  2GAL A;  4IV1 C;  4J6G A;  3J7L A;  2YGL A;  5I0R A;  1QJU 2;  1NY7 1;  4D94 A;  4RQP B;  2YB7 A;  4OI2 A;  1LHW A;  2SLI A;  1GAN A;  3WNN A;  5BUV A;  3E5Q A;  3HQX A;  3VBR A;  1F5J A;  3S0M A;  2QJV A;  1AYN 1;  4XAC A;  4XIK A;  5T5P A;  3ZMN A;  4ZU4 A;  3VDB A;  5FRA A;  5ACA 1;  4Y5S A;  1U5Y A;  1JYI A;  3VDD B;  1VP6 A;  1MS9 A;  1QJY 1;  1LED A;  1OT5 A;  1QDO A;  1WMX A;  4GWM A;  5FLH A;  1A8D A;  4P9X A;  4CU8 A;  1BEV 3;  2NLR A;  1RUG 3;  4N43 B;  2R16 A;  3IKW A;  3N7L A;  1R1A 3;  3ZYH A;  3BU0 A;  1LHO A;  5K0U B;  2ZXQ A;  4YWA A;  1CON A;  5CG8 A;  1PVC 2;  1CQ9 A;  2VUA A;  1OH4 A;  5G04 L;  1ZRC A;  5FK7 A;  4P5H A;  4AK3 A;  2OW4 A;  4WM8 B;  3GJB A;  5FMO L;  3OGV A;  1V9U 2;  3IB3 A;  1UY2 A;  3LIH A;  3NVC A;  1K3I A;  1A6C A;  2A6Y A;  3WNO A;  4BWO A;  1H8V A;  3VD7 A;  2RDS A;  2A7A A;  2RM2 1;  3PIJ A;  5FZM A;  5LAS A;  4DMI A;  1YQ5 A;  1CIY A;  1AR8 3;  1PHM A;  4V2W A;  4MGT A;  5AC9 1;  1EV1 1;  3GYD A;  1QHD A;  2E6V A;  4WVM A;  1OFN A;  3I4I A;  5FRE A;  5FZ7 A;  1W8F A;  2ADD A;  2Y33 A;  2RS3 2;  2HEW F;  2W91 A;  4NPR A;  2UYA A;  1GWM A;  2W47 A;  4HSL A;  4AHW A;  1KD7 A;  1MQT C;  2WJS A;  3USU B;  4LOS A;  4QD2 A;  5JAX A;  2VO5 A;  2XQX A;  4JRA A;  4UFL A;  4O65 A;  1CIW A;  1YIP A;  4ES8 A;  4AFD A;  4PQQ A;  3UT0 A;  2ZEY A;  4NAO A;  1WW6 A;  1O3S A;  1RUI 3;  1J83 A;  3BB6 A;  1RUF 1;  2CGO A;  2Y6H A;  4BIS A;  3J26 N;  3KHC A;  4QX0 A;  5JMO A;  2ZX4 A;  3LQC A;  3UET A;  4PDW C;  4OCT A;  2LM3 A;  3AM2 A;  5HXM A;  4X6R B;  3A0K A;  3UL2 A;  4PIY A;  1RVF 1;  4MGS A;  2X10 A;  4Y20 B;  4NIA A;  4GIQ A;  1GKB A;  5FQ0 B;  1X9P A;  4Y33 A;  1UO9 A;  5FO9 B;  1BEV 2;  1RUG 2;  3O1R A;  3EQE A;  1OA2 A;  3AP6 A;  5JPM B;  1R1A 2;  4HOO A;  4XBN A;  4RGK A;  5JLV A;  2D6P A;  5FZK A;  5KBF A;  4N90 A;  2WNU C;  4XC9 A;  3RZK A;  1HN0 A;  5EPA A;  1JZ6 A;  1NCR C;  3ZXF A;  4DXS A;  1H2M A;  3KCX A;  4LOR A;  1Q8V A;  1CPM A;  2F6B A;  1R08 3;  3MLL A;  3G7D A;  4QPG C;  4EN9 B;  4C1X A;  1MQT A;  2YBS A;  4GAL A;  3H9A A;  4DRR A;  3N7M A;  1AR8 2;  2Q1Z B;  5KR7 A;  3V56 A;  3S7E A;  4OUL A;  1V6I A;  3M3C A;  1HDK A;  3J7H A;  2BGC A;  3OUI A;  1DLC A;  3UGF A;  4AED A;  4EN0 A;  4AAX A;  5A3U A;  2P34 A;  3OJB A;  1R09 1;  3MIC A;  1NYW A;  2I07 B;  2YC4 A;  4PDW A;  3MYX A;  4W6X A;  3WLU A;  4LQR A;  1GWK A;  2BNO A;  3UK9 A;  3PTY A;  5LCW L;  3N36 A;  4HPK B;  3M4F A;  5LBB A;  4LEJ A;  4JDM A;  1WCS A;  3T2O A;  2QQK A;  4E4Z A;  4MZU A;  1GNZ A;  4MUV A;  2J1V A;  1RUI 2;  1VIW B;  4WZF A;  1YYN A;  1AR7 1;  3QOP A;  4GH4 B;  3MIG A;  5CEH A;  2ZGN A;  1UY4 A;  4ES9 A;  2D5H A;  3WSO A;  2GP5 A;  5EXO A;  3UJO A;  1SBF A;  1OLM A;  2VUJ A;  2WNU A;  5C3O A;  1WMD A;  2D6M A;  3AJY A;  1NCR A;  3AKP A;  4OI0 A;  4CUC A;  1OOP B;  2XLF A;  3OBT A;  3OBA A;  4MG2 A;  2P6C A;  2Y64 A;  3BIW E;  4HMZ A;  4M0N A;  4MYE A;  1NXM A;  2OX0 A;  4O7X A;  3I54 A;  4QPG A;  1F8V A;  4JV4 A;  4M4P A;  2DF7 A;  2XJS A;  5GM0 A;  2Q30 A;  5FZ3 A;  4CEY A;  1RB8 G;  2BRT A;  2P6H A;  1VB2 A;  1X36 A;  2DTY A;  5FK8 A;  1UWW A;  3R6S A;  1N3O A;  1JS9 A;  2J1R A;  3KV4 A;  1UX7 A;  4XQW A;  3OEB A;  5T55 A;  3MV0 1;  4IE0 A;  1GNH A;  4O9E A;  3AMN A;  1QXP A;  5FZB A;  4OQ8 A;  4GJZ A;  4YM2 A;  1VLN A;  5F3G A;  4BPZ A;  5CKN A;  1MAC A;  2DBI A;  4FPE A;  2O14 A;  1QQP 3;  1BVP 1;  4HFS A;  4BQY A;  1OUS A;  2BTV C;  1OH3 A;  4IL7 A;  3F2Z A;  4GXL A;  1MS4 A;  5IHR A;  4IGQ A;  4YVW C;  2ARE A;  2C0Z A;  1D4M 1;  2FHR A;  3NV4 A;  4LBL A;  5FUP A;  4D3W A;  4F83 A;  4QQH A;  4GAZ A;  5JZG B;  5FP9 A;  1AYM 3;  2VZT A;  2A6Z A;  2JDH A;  4YRD A;  3TNQ A;  5T3N A;  3BTY A;  4XJ9 A;  4XAE A;  2E33 A;  1W05 A;  2J1A A;  3M8L A;  2VW1 A;  2WS9 1;  1HRV 3;  2G9Z A;  1JW6 A;  4NRM A;  2GN3 A;  2VOW A;  1OUX A;  4GWI A;  5JSO A;  1I3H A;  2MNG A;  2XJQ A;  3ZM8 A;  1I1E A;  1WLD A;  3ZO0 B;  1GLH A;  3ES4 A;  3C2U A;  1W8W A;  3N9L A;  4Q4W 1;  5FZC A;  1FPN 1;  4MGZ E;  4BIF A;  2XJT A;  4L99 A;  1T6B X;  3MFC A;  4Q4X 1;  4NIG A;  2YGM A;  2YDE A;  1ZRE A;  3WNK A;  1K5M B;  2D3S A;  2YXS A;  3U78 A;  1QH6 A;  5F3I A;  5H9S A;  3T1M A;  3LZZ A;  2VMI A;  3CJI C;  2HWB 1;  2WO7 A;  2QE3 A;  2UYB A;  1Y4W A;  3H50 A;  5DXD A;  3SXW A;  1TMF 3;  3WF3 A;  4ZY9 A;  1CN1 A;  3KWV A;  1HQN A;  4NHM A;  4XMI A;  2JKB A;  3U14 A;  1Q56 A;  4ATE A;  1M4W A;  1ND3 C;  3RZG A;  2R0F A;  4DNY A;  5FZH A;  2MEV 1;  4TYS A;  4YVW A;  5FWJ A;  4GMP 3;  3WW3 A;  5F9T A;  1QQP 2;  3ELN A;  2HWE 2;  4KG8 A;  4A7K A;  1BZW A;  1UOJ A;  3AZZ A;  3D3A A;  1N1S A;  4TWT A;  4DRV A;  5L19 A;  2XBO 3;  5FBZ A;  5IYY A;  2WT1 A;  1H8T B;  2Y6K A;  4ASK A;  4B4P A;  2ZGS A;  5FAX A;  4HKW A;  2CV6 A;  3N7J A;  4LO8 A;  4YG3 A;  5GJ6 A;  2G4I A;  1YFX A;  2JEC A;  3CHX A;  3ZYI B;  5IT6 A;  3FBM A;  5JSP A;  1OLR A;  5C9A B;  2XXZ A;  3IDC B;  2E53 A;  2VZ1 A;  1AYN 3;  2Q8D A;  1C28 A;  2W95 A;  3N9O A;  2VGD A;  1S0B A;  2JB4 A;  1HRV 2;  4QAW A;  5FZF A;  5FY5 A;  3T0B A;  4YM3 A;  5ACA 3;  1BMV 2;  2PA7 A;  4RGA A;  1PMI A;  2ZTN A;  4P9J A;  4JGZ C;  3VHR A;  4EJR A;  3LOB A;  4XFF A;  1JYT A;  1TG7 A;  1RUJ 3;  4WZC A;  3ZX7 A;  4GZ9 A;  3KT1 A;  4L2N A;  2D6O X;  3Q8E A;  4Q4V 3;  4AFA A;  4CU9 A;  3T3Y A;  4XF1 A;  1ND3 A;  5JR7 B;  1WLW A;  2VUC A;  4H55 A;  4CUG A;  2P17 A;  3DF0 A;  1TMF 2;  4EZH A;  2X8K A;  4QKN A;  3VZL A;  3B93 A;  1CR7 A;  1N47 A;  4I0A A;  2EXK A;  1T6G C;  3PU3 A;  2QUO A;  2RM2 3;  1RIR A;  4MHR A;  5B4X A;  1VBA 3;  4IXL A;  3RVH A;  1RIN A;  2HWF 3;  2VNG A;  1SFN A;  1CAX B;  1CZV A;  4LK7 A;  3WNP A;  1OVP A;  4LE3 A;  4BJ0 A;  2C26 A;  4XAB A;  3MIF A;  2R06 1;  2J42 A;  3AB0 A;  5C8C B;  3Q8F A;  4FAH A;  2DVB A;  2JEM A;  3VBF B;  4ZZ5 A;  2IXK A;  2OZJ A;  1IPJ A;  1V6L A;  2X5I A;  2XBO 2;  5EJZ B;  4P08 A;  2OII A;  5J96 B;  3TEX A;  5LY1 A;  3CKH A;  4A6S A;  1NXD 1;  3ZXK A;  2F4P A;  5BV6 A;  1IPS A;  3M7A A;  2R07 3;  5FY0 A;  4IV1 B;  4AGV A;  4KBZ A;  4ITC A;  2EAL A;  3E6C C;  4KGQ A;  1RYY A;  3PJQ A;  5APA A;  1DLL A;  3AP9 A;  2LRP A;  2ZMN A;  3IDB B;  1ZRR A;  1W2A X;  3WY6 A;  3FLP A;  4NHY A;  3VB9 A;  3SNM A;  1TVG A;  4Y5T A;  5I8S A;  2OPW A;  2JIG A;  4Y5Z 0;  2PMW B;  3SH4 A;  3OYW B;  1RVF 3;  1RUC 3;  1V6K A;  5KHH A;  4CRQ A;  5ACA 2;  2JG9 B;  5BNP A;  5C4W C;  4XDQ A;  4CDX A;  2QZ2 A;  1MS0 A;  2ZOE B;  2W1Q A;  2WWS A;  1SMV A;  2WZR 3;  1RUJ 2;  4XQD A;  3ZSE A;  1V70 A;  4LUK A;  4XBL A;  2GC0 A;  1S0D A;  1MVE A;  5FP3 A;  2E32 A;  1RL3 A;  4Q4V 2;  3GZE A;  1W9F A;  5DDJ 1;  5FUN A;  2FBE A;  1DBN A;  1G9D A;  1VJ2 A;  3SQO A;  1IS3 A;  1YQC A;  4AVT A;  4TN7 A;  1UZZ A;  2RS1 1;  5EP9 A;  4IEX A;  4K40 A;  2D43 A;  4UYB A;  4LBQ D;  2C9A A;  1URX A;  2VR4 A;  1YC6 1;  3TBD A;  4Q1R A;  3RQ0 A;  2UY8 A;  2RM2 2;  4RS5 B;  1LKN A;  4Y1V A;  5A7S A;  3ZPO A;  3PL0 A;  4JQR A;  3S7I A;  5L7O A;  1QY4 A;  4AGG A;  1VBA 2;  2ZA9 A;  1QOO A;  1F15 A;  3MFA A;  5AVP A;  2HWF 2;  4AI2 A;  1ZBE 3;  2DV9 A;  2A6W A;  5C7G A;  1E57 A;  1WW5 A;  2R32 A;  1HV0 A;  1HLC A;  1BCX A;  3I2G A;  3WP6 A;  1SDD B;  3AYD A;  1YQ6 A;  3OGS A;  1TE1 B;  1OKQ A;  1R09 3;  2JDP A;  5JIA A;  3S6P A;  3ZFE A;  2WYF A;  4QB2 A;  1YI9 A;  1GP5 A;  1XYO A;  1SZB A;  3VBH B;  1WUV A;  2JJ6 A;  5KXC A;  3UES A;  4H2A A;  4XET A;  2CGN A;  2R07 2;  2X53 S;  5EV7 A;  2VZP A;  3EHK A;  4BOW A;  2VTF A;  3POF A;  5L73 A;  1AR7 3;  3SH3 A;  3WW1 A;  2J1S A;  2JDK A;  2FDH A;  4M0H A;  4PI2 A;  5FPA A;  1RUD 3;  2IXC A;  5I0D A;  2Y6L A;  3MHZ A;  1OF4 A;  1VBD 1;  2W92 A;  4EWE A;  1RUC 2;  1RVF 2;  2XHK A;  4UW5 A;  2XML A;  4YZ4 A;  2D3R A;  2ZHK A;  3EXU A;  1N1Y A;  2WZR 2;  4CU7 A;  1LU1 A;  2XL9 A;  4XFB A;  2O8Q A;  2ET7 A;  4MO3 M;  4N53 C;  4K9S A;  3QH7 A;  5LY2 A;  4E8D A;  3SLI A;  4AGR A;  1U0A A;  5F5C A;  1OQD A;  5F7U A;  1F35 A;  4JQT A;  3BUC A;  5BNQ A;  3POI A;  3B5L B;  2AEY A;  2JDU A;  4N43 A;  3PDQ A;  4ZXK A;  1GFF 2;  2VOX A;  2FCU A;  3GZT B;  2VUL A;  4LLF A;  3POJ A;  4P9L A;  5J3U A;  5DAP A;  5FZ1 A;  4LR4 A;  2LS6 A;  4OQ9 A;  4WM8 A;  5IK4 A;  1ZBE 2;  1JZ4 A;  3POG A;  2V5D A;  3WG3 A;  1HB4 A;  1NQD A;  2BUK A;  4FPK A;  5FY7 A;  2PTM A;  4QPI C;  3PUR A;  3RJR A;  5A1F A;  2Q1M A;  3FFQ A;  4OUS A;  2IFW A;  5H9Q A;  4W6Y A;  3GCW A;  5G05 L;  2ZEW A;  4FPY A;  2WLP A;  5GZD A;  5HCF A;  3LEG A;  4MXW B;  1LHN A;  4P9I A;  3HT1 A;  4ARY A;  3J9S A;  2TUN A;  2B7Y A;  1US2 A;  2UWA A;  1CJP A;  3WV6 A;  4N53 A;  1RUD 2;  5FZ4 A;  2PHF A;  4PF1 A;  3MV1 1;  5L9V A;  1Y43 B;  4F8A A;  3WQB A;  3ZFF B;  4AFM A;  1JU3 A;  1FPN 3;  2GDF A;  2P3I A;  4ZXE A;  4L11 A;  4ET7 A;  1UNB A;  4XIL A;  4YNI A;  4CDW C;  2P5B A;  3ZLI A;  4XFA A;  1YJL A;  3I3E A;  2WN2 A;  2HWB 3;  4DB5 A;  2Q0A A;  1W03 A;  2DVG A;  1DZQ A;  2VME A;  1V6M A;  1QEX A;  1R64 A;  3T1L A;  2Z2S B;  4QB1 A;  5FTT C;  3TN9 3;  2H0B A;  5LBE A;  3SIT A;  4CDU A;  5FZ0 A;  4Y26 A;  4M3C A;  1QIQ A;  3AXE A;  4ATF A;  2FD8 A;  2C1F A;  3POY A;  2IZW A;  2ZEX A;  3I2D A;  2W08 A;  3SC7 X;  1OKO A;  1XB9 A;  1AUY A;  1FNZ A;  1WBL A;  3U11 A;  1QJE A;  3ZSM A;  2BOI A;  3AP4 A;  3GXU A;  3VHN A;  2KD7 A;  5DUX A;  1US3 A;  3VDC A;  2FDK A;  1W2T A;  3MW2 A;  3RWN A;  4UFM A;  3H7J A;  3I7D A;  1ALY A;  4NID A;  1PO2 3;  4PJY A;  4NHX A;  5FOJ B;  5JOW A;  3W5N A;  1POV 0;  2E63 A;  3AKR A;  4I02 A;  1UMH A;  3POE A;  4PLN A;  3KT4 A;  4W8J A;  5F2W A;  1ONA A;  4AQS A;  5DZE A;  4N7U A;  3WDX A;  4DIQ A;  1U5I A;  3H0O A;  1PIV 1;  1S2B A;  3LCP A;  2YBP A;  5A3M A;  3LDK A;  4Q2F A;  4UW6 A;  5LAT A;  3N35 A;  1UOB A;  1SPP A;  2MPF A;  1UCX A;  3CZU A;  4MGI E;  1FMD 1;  3AVS A;  4GQ7 A;  2R49 A;  1E5I A;  2RE9 A;  3AZX A;  3PJY A;  4HPK A;  1FPN 2;  3C7G A;  4IER A;  2ORZ A;  3IIA A;  3O1V A;  1L3J A;  1LTE A;  1W6O B;  5E1R A;  4D7S A;  5HPO A;  1AL2 3;  4NII A;  1Z7S 1;  3FZ3 A;  4OHY A;  1FX5 A;  3HQU A;  2WFF 1;  2HKX A;  3K75 B;  4HVQ A;  2HWB 2;  4HSJ A;  2NM1 A;  3UJQ A;  1UXZ A;  4XF9 A;  3CJI B;  1KJL A;  1Q43 A;  5DAV A;  2BU9 A;  3TN9 2;  4Z8B A;  2R1D A;  5FZO A;  5FMO S;  4RD7 A;  3QCW A;  4BH9 A;  3E6D A;  3U4S A;  2R0H A;  2WBK A;  5GZC A;  4YAR A;  4YSF A;  1ZX5 A;  3H1W A;  4NUB A;  5CAZ A;  4LNV A;  1IQD C;  1S0E A;  2W3J A;  4YW1 A;  2R06 3;  3AYC A;  2ZX2 A;  3GGL A;  3W21 A;  3KMH A;  1LOD A;  3ATG A;  3MIB A;  4W50 A;  1DHK B;  2A5Z A;  1UYZ A;  2WNV B;  1UU5 A;  1ZZ8 A;  3BTA A;  3H1M A;  3ZYR A;  2YUE A;  5JI7 A;  1RHI 1;  4AVC A;  3V0A B;  1IG3 A;  1PO2 2;  3CU7 A;  5GAL A;  1MPX A;  1WD4 A;  3OGG A;  2ES3 A;  5E8A A;  1LHV A;  3FUQ A;  2PLV 1;  2VNO A;  5F8P A;  5CG9 A;  1HV1 A;  1HRI 3;  3LE0 A;  2PAM A;  4FPL A;  3MW4 A;  5BY5 A;  1BVV A;  3CBN A;  3K4D A;  3RGB A;  3MDP A;  3IPV A;  1UZY A;  2NMN A;  1W04 A;  4YVS B;  3OY8 A;  4IEY A;  3PVB B;  3WHU A;  1A34 A;  2G9G A;  4GUL A;  4S2H A;  2AUY A;  1UKG A;  4A2U A;  1JUH A;  3M70 A;  2C9K A;  3PMS A;  4UF0 B;  3VBO A;  1UU4 A;  1U5Z A;  4UBH A;  1MR5 A;  5GZE A;  3LEK A;  1NAE A;  3O0V A;  3O0W A;  3ZR5 A;  3FX3 A;  1AL2 2;  3M1H A;  1W90 A;  4AQ6 A;  1LU2 A;  4LIV A;  2ZKN A;  5FR3 A;  2XOM A;  1QNY A;  4AI9 A;  3M3I A;  1IKQ A;  4CP2 A;  1XXN A;  1LNS A;  3VBS B;  1QDC A;  3T2T A;  1VAL A;  1XJA A;  4JKL A;  4NRQ A;  1LUL A;  2D6L X;  2F4L A;  3SIS A;  1QMJ A;  2VM9 A;  3VBR C;  5IVJ A;  3RDI A;  1BBT 1;  2WO1 A;  4BXS V;  4YLZ A;  2FZ1 A;  3Q8A A;  5C8W A;  1OPO A;  3B69 A;  3SKJ E;  3QH6 A;  5F3C A;  5FPL A;  1OD5 A;  1LOC A;  1OHF A;  2WQZ C;  2X29 A;  4K1Z A;  4NR1 A;  3BIE A;  1K5M A;  1QWR A;  2JDM A;  4UFJ A;  3KLS A;  1PK6 B;  3PVN A;  4CDQ C;  2IXH A;  1POV 1;  4QU2 A;  2R06 2;  3T4V A;  2W5F A;  2YBK A;  3NL1 A;  3DKW A;  3FLT A;  4XEZ A;  4Q0P A;  1MEC 3;  4P9W A;  1CVN A;  2BNN A;  5JSR A;  2A75 A;  3RYK A;  1IG0 A;  1VBB 1;  5FO8 B;  1HRI 2;  4KU8 A;  4MV2 A;  5LWB A;  4KWL A;  1ASJ 1;  4ZHN A;  2CU5 A;  2D6K A;  3AKT A;  3KZ4 C;  1SDW A;  1G9A A;  1FNY A;  4LMF A;  1MS3 A;  3WG4 A;  1V00 A;  1W6M A;  4Y1Z A;  1WCK A;  4UBG A;  2XKO A;  1PO1 1;  1JYV A;  2C6S A;  1GUI A;  1GZW A;  4LBJ A;  2E51 A;  2WYS A;  2FCT A;  3MZH A;  2QQM A;  2HLE A;  2LAL A;  3ZSK A;  3NAP A;  5JWP A;  1B35 B;  1PGL 2;  2JIC A;  3ZXJ A;  3ZFG B;  5C6C A;  1KS5 A;  2G9F A;  1GMM A;  1RJ7 A;  1W9Y A;  2RDR A;  5C9A A;  1CAU B;  2YC0 A;  5GZG A;  2VVD A;  4XF4 A;  2VZR A;  1YXW A;  1EY2 A;  1KQR A;  3DN7 A;  2DUO A;  2RS5 3;  3CEW A;  4FP3 A;  1C8M 3;  4Q8L A;  3KHB A;  4QKD A;  1XND A;  2DUP A;  4CDQ A;  4Q0V A;  3W20 A;  1XNA A;  1RXG A;  1FYU A;  5A1L A;  1VMH A;  3LKJ A;  1Y7B A;  1GP6 A;  3NJV A;  4KH9 A;  4NWV A;  4HON A;  1V0A A;  4JDO A;  3VZM A;  4CP9 B;  3KVB A;  1XBF A;  3SEE A;  3V0B B;  1BXH A;  2XUE A;  4CZS A;  1VRH 1;  1X8M A;  5ISL A;  1RUH 3;  3GDB A;  2JX9 A;  4IE5 A;  4MAD A;  3GNE A;  4C90 A;  1SLL A;  3BAL A;  4R9D A;  3U0Z A;  5CFC C;  4FAG A;  1SCS A;  4HZF A;  2BOJ A;  1RMU 3;  1WKY A;  2BBA A;  1H4G A;  5CZK A;  2VQ0 A;  4UAP A;  4WBB A;  1W99 A;  2CDO A;  1ZBA 3;  1C5I A;  3SCH A;  1FXZ A;  4LXL A;  2DVA A;  4FOW A;  1MEC 2;  4WVW A;  4EN8 B;  3C7O A;  2AZ5 A;  1JU4 A;  1F4A A;  2P3J A;  3HQR A;  3LPF A;  5LK5 A;  2FMY A;  4GA9 A;  1X7N A;  1PGW 2;  4R9C A;  3HBZ A;  2ZGK A;  1RXF A;  1WA4 A;  4Y4R A;  3TRS B;  3VLB B;  4X8N A;  3FWE A;  3ZYB A;  4TLG A;  3DXT A;  4LE4 A;  1JYX A;  3NKT A;  1O91 A;  3RWK X;  4OMC A;  5L9B A;  4CTE A;  3O1M A;  1UKR A;  4DEQ A;  5C71 A;  1LGB A;  1C4R A;  2CWS A;  4JAA A;  2B42 B;  3URF A;  3PLQ A;  4COU A;  3PHM A;  1W6P B;  3BTZ A;  1QJX 1;  3B9C A;  3WF0 A;  1W2N A;  4AED C;  3I59 A;  4M00 A;  1KXG A;  2XPJ A;  5T52 A;  2VL4 A;  4BQW A;  3CNA A;  2GP3 A;  3WEZ A;  3ZR6 A;  4E4H A;  4CCJ A;  3WP4 A;  3VD9 A;  2A6X A;  4IEU A;  3VZK A;  4DXR A;  1AVB A;  2WZE A;  2O0O A;  3N9Q A;  5EHD A;  2RS5 2;  4LKS A;  1C8M 2;  5CFC A;  1JZ7 A;  4IGO A;  4G3Y C;  4K7J A;  1NQJ A;  4JKM A;  3LGR A;  3SMH A;  1JN2 P;  1OVS A;  1OA4 A;  2WO2 A;  4LHN A;  4HLT A;  4B1L A;  2BBV A;  1AR9 1;  1BQP A;  3VUO A;  2GME A;  3ITQ A;  3POS A;  1IGO A;  1QXR A;  4BCU A;  1RUH 2;  2YZ4 A;  5HXV A;  4AEM A;  3ZN6 B;  2FDI A;  1XU2 A;  2WUH A;  1GSL A;  1T2X A;  4MOA A;  1WME A;  1RTV A;  4X6Q B;  5F32 A;  4HK8 A;  1RMU 2;  1DGR N;  1YLL A;  5JR2 A;  4CXY A;  2DU1 A;  1ULP A;  2R7E B;  5A3L A;  4CEY C;  3LAG A;  1ZBA 2;  1Q8O A;  3T08 A;  4BE3 A;  4Q4Y 1;  1UY0 A;  2Q8C A;  2VEC A;  1PIV 3;  5JOZ A;  1H2N A;  4X8P A;  3KM5 A;  2VQT A;  5FY4 A;  4AF9 A;  3WW2 A;  1BK1 A;  2W1W A;  3AX4 A;  2JD9 A;  1J1L A;  3ST7 A;  3PNA A;  4EN7 B;  1UW8 A;  1FAT A;  4CUA A;  4QPW A;  4M4R A;  1ST8 A;  3BPZ A;  2XVL A;  3J4U H;  4YM1 A;  3PUQ A;  3VBU B;  1PX3 A;  4PHZ A;  4E4S A;  4OI4 A;  1N3P A;  2HYK A;  1G9C A;  4XF0 A;  1QKQ A;  1XE7 A;  2ZCW A;  1N1T A;  2CAU A;  3AYA A;  3BGA A;  2DUQ A;  3NWK A;  2WA4 A;  3AYE A;  4FP2 A;  1VBE 1;  5FXZ A;  1UU6 A;  4FVV A;  4AQ2 A;  2R1B A;  5ERL A;  1COV 1;  2GNB A;  2KA3 A;  3HR9 A;  3WDW A;  1WA6 X;  1ULO A;  1KEX A;  3III A;  4JDN A;  3SH5 A;  2D3P A;  2XLG A;  5DAX A;  3D6E A;  4CDW B;  3OUH A;  4GB3 1;  3DPR B;  4XJU A;  1KJR A;  1J3P A;  3JB8 A;  3KB5 A;  4PIZ A;  4XMA A;  2B9V A;  5FOB B;  4BK4 A;  2A71 A;  3I2F A;  4GWJ A;  4QT6 A;  4DUW A;  2BPA 2;  1CAV B;  4DFS A;  5FZ6 A;  1TNR A;  1NT0 A;  1ND2 B;  3KCC A;  4AR2 A;  1JOJ A;  2B5H A;  4AI0 A;  4FOQ A;  2RVA A;  2BQP A;  3O1S A;  4LO4 B;  3HT2 A;  4D6S A;  5I0S A;  3WP5 A;  2ZML A;  2YU2 A;  4H14 A;  4NHL A;  3B7M A;  2TBV A;  2XJU A;  2XHN A;  2VOT A;  3Q8C A;  2WAO A;  4OLL A;  1R08 2;  1EAH 1;  2K0G A;  3TWI A;  3H3L A;  4QQL A;  2PHX A;  4LOT A;  4RFT 0;  1NCQ B;  1W39 A;  2PLV 3;  2JG8 A;  3DXU A;  3H3U A;  5EIY B;  5FPU A;  3CJX A;  5K7P A;  2Q1F A;  5AFE A;  2GMP A;  3SCG A;  2NYY A;  1FV3 A;  1KFU L;  3F95 A;  2ZGL A;  3V64 A;  3T0A A;  5FWE A;  2YY1 A;  5I8Y A;  4B7E A;  1SEF A;  4JTO A;  4NOT A;  3VZJ A;  1NX9 A;  3PVE A;  3FC0 A;  4CE8 A;  3H8O A;  3E6B A;  1GV9 A;  3MPB A;  4I09 A;  4YZ3 A;  1A8M A;  3PVO A;  5LW9 A;  1TNF A;  1VB4 A;  3P3P A;  4Q0S A;  3AMQ A;  1LCL A;  3FLR A;  1VRB A;  5K8S A;  4I2O A;  2QCS B;  1BYH A;  1GQH A;  1DZT A;  3KGL A;  1V6J A;  1QU0 A;  3TEY A;  3V65 A;  4TZD A;  1YFU A;  1F4H A;  1TZO A;  1D4V B;  5HCH A;  1F2N A;  3I3Q A;  5CU1 A;  3S30 A;  1IHM A;  5ABJ C;  3RYP A;  3KSC A;  4BQ5 A;  3N9N A;  3LDB A;  1H30 A;  2ZAC A;  1YIF A;  2E31 A;  1UF2 C;  1Z0H A;  2XJP A;  4Q0Q A;  5F6K A;  3BVC A;  4AVV A;  1W6Q A;  4B1M A;  1PZ9 A;  1JOB A;  5CIS A;  3PIG A;  2OYZ A;  4AI3 A;  2EA7 A;  3GHM A;  3BI3 A;  1UZW A;  2EAA A;  3EYP A;  2D7F A;  3GAL A;  4LIU A;  1WCD J;  4XFG A;  5CNA A;  5D8A B;  4JHT A;  5J98 B;  5BNN B;  1R1Z A;  1PZ8 A;  1POV 3;  2D93 A;  2JE9 A;  1BKZ A;  3D0S A;  4IV3 C;  3KF3 A;  3WNX A;  3NV1 A;  5FZG A;  5F5A A;  3EBR A;  2BZD A;  3JBG 1;  4QX3 A;  2W1U A;  3H8X A;  3H3Z A;  2BVB A;  1CX4 A;  1DQ4 A;  2VNV A;  4YW4 A;  5BNO B;  1XOY A;  3VDA A;  2ARC A;  2LW8 A;  3UNP A;  1LEN A;  4XTP A;  3RMX A;  4CCK A;  1O3R A;  2L9L A;  1ASJ 3;  4FCA A;  4Y1X A;  3ZKU A;  1W0N A;  1JZ3 A;  5J48 A;  2Y6F A;  3E5U A;  2ZGU A;  3HD8 B;  4E27 A;  4IGP A;  2RG4 A;  3DEC A;  2ZGT A;  2ADE A;  4UW3 A;  3HWJ A;  1AL0 G;  3LEM A;  5JXI A;  2D98 A;  1NZI A;  1O3T A;  2V73 A;  2BEO A;  5ABJ A;  3PUA A;  2D5F A;  2GND A;  2Z5W A;  4QQP A;  2Y60 A;  5A33 B;  4Z2A A;  3ZXG A;  5CFD C;  3KT7 A;  4AFC A;  1A3K A;  3L2Y A;  1AYM 2;  4FBF A;  3J8F 1;  4C0B A;  5F1R A;  4AEJ A;  2VG9 A;  4CEW C;  2X5I C;  4KQ7 A;  1H9P A;  4GJY A;  4EE2 A;  5HV4 A;  1J1T A;  4WV8 A;  3PTR B;  3UKN A;  2P3K A;  3VKF C;  1QJY 3;  1W6N B;  2V4A A;  3C7H A;  4QQO A;  3O14 A;  4XBQ A;  5FYV A;  4ZKT B;  4BQ4 A;  5JCT A;  5LK7 B;  1CPN A;  3CQO A;  4IV3 A;  5A80 A;  3GBF A;  5C3R A;  5LEK A;  2JE8 A;  3RS6 A;  4PBP A;  2ENR A;  3JD7 1;  1W8N A;  2CSG A;  2WAB A;  5LA2 A;  2HWC 1;  1OD3 A;  3THD A;  3VN4 A;  3WG2 A;  4CA9 A;  3H42 B;  1NKG A;  5A6Y A;  5BNP C;  5FXW A;  5IVV A;  4M3C F;  2ZBJ A;  2AEN A;  4CDX C;  2EF6 A;  3ZPY A;  1MVQ A;  1U5X A;  3P1I A;  1IS6 A;  3B01 A;  1J59 A;  4A42 A;  4QHB A;  1QNW A;  2HWD 1;  1AJK A;  2R04 1;  2XQR A;  1CES A;  4YGC A;  3GM8 A;  2DCT A;  1EV1 3;  5AC9 3;  1H4H A;  4Y4Y A;  1XYN A;  2ZJC A;  1JYN A;  1W9S A;  5IVF A;  5FYB A;  1UYP A;  5CFD A;  5FCC A;  1HKD A;  1DYO A;  1HXS 1;  2OQ7 A;  4IEQ A;  1ASJ 2;  1TQ5 A;  3P3N A;  5KXE A;  2VQA A;  1U12 A;  4EYU A;  4JGY A;  4CEW A;  4FFH A;  1UN1 A;  5L7O C;  1NA1 C;  1ENR A;  3ORJ A;  4QXH A;  4DY3 A;  4RHV 1;  1FV2 A;  2PXJ A;  2D40 A;  1AZD A;  4IE7 A;  4YG6 A;  3WF2 A;  3RMY A;  2EID A;  1NY7 2;  1E5H A;  1CJD A;  1ZZ9 A;  2I74 A;  2ZGP A;  2DCY A;  3KCY A;  4XVH A;  1TEI A;  4IND A;  1I9R A;  1RUF 3;  4BLI A;  4WVM B;  3KF5 A;  1YI7 A;  2W52 A;  4F7Z A;  1CAW A;  4AEK A;  1AYN 2;  3ZFE C;  2ARB A;  3AKS A;  1LGN A;  1QJZ A;  4RR3 C;  4LJH A;  1RUN A;  1PNF A;  3WCS A;  4NO4 A;  1QJY 2;  2YG0 A;  3B94 A;  2VNR A;  3HNY M;  3NW4 A;  4RYD A;  2B8M A;  3RZL A;  2XVG A;  4A6O A;  1UQX A;  4D0Q A;  1H1A A;  3UGH A;  4NPL A;  4HKL A;  3UKV A;  2IXL A;  4Z92 B;  2JDA A;  3CL1 A;  1AR9 3;  3LFM A;  4HET A;  3ZXA C;  1OLQ A;  3OG2 A;  4U36 A;  4ZS3 A;  3O12 A;  1XPW A;  3AZV A;  2OUH A;  1O4Y A;  4DQA A;  1SLA A;  5IAT A;  2AC1 A;  3ACL A;  4JCK A;  2G19 A;  1D2Q A;  1O8S A;  2QQV A;  4RQP C;  1QJU 1;  4N9I A;  5FXV A;  4K1Y A;  3IDA A;  4Q26 A;  5IUQ A;  1LOE A;  4QB6 A;  3RZM A;  1NA1 A;  1QXJ A;  4Q4Y 3;  4LA2 A;  3MEP A;  5AC9 2;  1EV1 2;  4YGE A;  1VAV A;  1YQ2 A;  4I3P A;  3VDD C;  3VKO A;  1XNK A;  4JX0 A;  2GNM A;  2W2I A;  2Y26 A;  2HYX A;  2YPD A;  2DFC A;  5A7O A;  3T30 A;  2CTV A;  4CP1 A;  4N43 C;  4COY A;  5IVE A;  3ACI A;  5DQ0 A;  4YG0 A;  3OGJ A;  5FJH A;  1JHJ A;  4PF5 A;  4RR3 A;  1WCQ A;  2WII B;  5FMD A;  3NRU A;  4QXB A;  4KG0 A;  1B09 A;  1MQT B;  1JMU B;  1PVC 1;  1WCU A;  4LUL A;  4WM8 C;  4WM7 A;  3BKZ A;  1SQ4 A;  3D0J A;  3HJR A;  3EMR A;  3WDY A;  3WNM A;  1AXK A;  3DV8 A;  5FP8 A;  1O5L A;  1RUF 2;  1V9U 1;  3S5A A;  2PHL A;  3NST A;  1C3H A;  4XXA A;  4AED B;  4D8M A;  2VMC A;  2Z42 A;  2VPV A;  3A7Q A;  3R4S A;  3UV9 A;  3K4A A;  4DZG A;  2E7T A;  5GLV A;  5A7W B;  2VU9 A;  5KHJ A;  1G86 A;  4GB3 3;  2TEP A;  1OFS A;  1ODN A;  5C70 A;  4PDW B;  3WQ1 A;  1ENS A;  3I2O A;  1UIJ A;  4LBN A;  2PN5 A;  1OSG A;  2ETE A;  2OPK A;  4TXW A;  4XUQ A;  3TB0 A;  2BFU L;  4RQP A;  1C1L A;  2ZAA A;  3HOB A;  4XHX A;  5FXX A;  1XSQ A;  4AHX A;  2J1U A;  4DY5 A;  4IQP A;  2RS3 1;  3WUC A;  3WX5 A;  3OPT A;  2VZQ A;  3IMN A;  2WWU A;  3VDD A;  2W39 A;  1YNA A;  2E7Q A;  2WNU B;  4QX2 A;  4A44 A;  5F37 A;  3VHO A;  3WIN E;  1DZR A;  2ORX A;  1NCR B;  2VBB A;  2HBU A;  1VAK A;  1NUK A;  1EAH 3;  3I8T A;  5K0U A;  2FCV A;  2NP0 A;  2CL2 A;  3AZY A;  3RNS A;  2VTX A;  4QPG B;  1W28 A;  5A6X A;  1W9T A;  1W3V A;  2EIE A;  2GNT A;  3O0X A;  4XJA A;  2A3X A;  4S2D A;  1V6N A;  4CEY B;  3HBK A;  5B2G B;  2OXB A;  3VD5 A;  1JUI A;  5A6Z A;  4CDU C;  3KV5 A;  3AFG A;  3BOD A;  1KFX L;  2QQL A;  1R09 2;  1W2O A;  2EXI A;  4DOU A;  1VBC 1;  2XH6 A;  1BEV 1;  4CU6 A;  1RUG 1;  3OPW A;  1D4M 3;  5GKA C;  1LOG A;  4M01 A;  3VV1 A;  1S0C A;  1YWK A;  3TOJ A;  3NNL A;  1OI6 A;  4JRL A;  2QFE A;  3IWZ A;  4W4Z A;  2W68 A;  3FHA A;  4LO7 A;  2DCK A;  1UYX A;  5FY9 A;  5DZF A;  2WS9 3;  5GLU A;  3H1Y A;  1AR7 2;  3JU9 A;  2DVF A;  3UKT A;  3ZXL A;  4AAP A;  3BCW A;  3M3Q A;  1HIX A;  2JB8 A;  2WLQ A;  3LA2 A;  3LSE A;  4XJZ A;  5GLW A;  3USU A;  4FFI A;  3O1P A;  1W0O A;  3JQW A;  4GB3 2;  4Q4W 3;  4P02 B;  4Q4X 3;  1W6P A;  4FPC A;  5IW0 A;  4YYO A;  1AR8 1;  2W94 A;  4XUR A;  4ZU7 A;  2PAE A;  1F9K A;  1CX1 A;  1X8E A;  2VXR A;  1SLI A;  2WN3 A;  5FP7 A;  3U1X A;  2JEN A;  3NJZ A;  4XIO A;  2VVF A;  1DYP A;  1RJ8 A;  2XB6 C;  1S2E A;  3MLK A;  1CD3 G;  4Y24 A;  4LT5 A;  3K4Z A;  5H9P A;  2C5D A;  4XDP A;  4Y20 A;  1POQ A;  5CAD A;  2HBT A;  5FQ0 A;  3WW4 A;  1UZV A;  1L7L A;  3JBG 3;  5F5I A;  1UPI A;  4ORF A;  3KGZ A;  3ASI A;  2ZHL A;  4P00 B;  1GP4 A;  5CYY A;  4OZO A;  5JVV A;  2MEV 3;  1O4Z A;  2VVE A;  4GH4 C;  5LRR A;  4NMI A;  3NKG A;  4XFH A;  3WDV A;  3WQ7 A;  4BHP A;  1RUI 1;  4JVA A;  1NE6 A;  1O59 A;  2A3Y A;  4L9B A;  3VHP A;  1W8O A;  1OLM E;  3BPS A;  1ENX A;  3DYP A;  3INA A;  4K8R B;  2RR1 1;  3B3Q E;  2Y6J A;  2E7A A;  3CF6 E;  1AX0 A;  3I2K A;  1M06 G;  1ZRD A;  4KGG A;  3GF6 A;  4MGY E;  5F2S A;  5JOY A;  2UUR A;  2Z4F A;  4D6R A;  4SBV A;  3R4D B;  2VMH A;  4URT A;  3VD3 A;  3ZYJ B;  1D4M 2;  2XWJ B;  1BK0 A;  3NJY A;  3W58 A;  1SHW B;  4FPF A;  1S55 A;  4YVW B;  2ZX1 A;  3MGU A;  1AXY A;  1HN1 A;  4QMA A;  3HN1 A;  5A3N A;  3QAC A;  5CKM A;  2WSU A;  2EIG A;  3AMH A;  3AP7 A;  5CA6 A;  3MLJ A;  3LD8 A;  1J3Q A;  3MIH A;  3WDU A;  3C8X A;  2WS9 2;  4D6Q A;  3ZMO A;  3AZW A;  2DVD A;  5IK5 A;  3T0D A;  3AMP A;  3K48 A;  4FFG A;  2JXA A;  3JQX A;  4ISR A;  4LBM A;  3MIE A;  2ZZQ A;  4FPG A;  1GYK A;  5TSW A;  3W5M A;  4Q4W 2;  1DIW A;  1G6N A;  1PGS A;  3C3V A;  1C8N A;  3JXS A;  4Q4X 2;  4XE9 A;  2VW2 A;  4LO5 B;  5FLI A;  1OXC A;  5IVY A;  3WD5 A;  1Y3T A;  5FY1 A;  5J37 A;  1CWP A;  5I91 A;  4Y22 B;  1SG3 A;  5FUI A;  4CCO A;  2CWM A;  1GR3 A;  2GZW A;  3BOW A;  4GH4 A;  4IEP A;  3WUD A;  2BV4 A;  3I2J A;  4YW3 A;  4XJW A;  4DS0 A;  5EQU A;  3VBO C;  4Q8K A;  1GU3 A;  4GMP 0;  2WNE A;  3ETP A;  3T09 A;  2PQQ A;  2OUJ A;  5JZG C;  2B39 A;  3DPR A;  1GIC A;  5FYM A;  4YW6 A;  5ANQ A;  1HJG A;  1D0H A;  1OOP A;  2HWD 3;  1DF0 A;  2GC1 A;  3JBG 2;  5SV8 A;  2X05 A;  2R04 3;  1L7R A;  4R4X A;  3U75 A;  5ANN A;  3U07 A;  2CDP A;  4FTE A;  1S1A A;  2YU1 A;  2MEV 2;  3ZYF A;  4BME A;  2GU9 A;  3CIH A;  1ND3 B;  5LBC A;  4MGK E;  5F5Q A;  5DG1 A;  1HXS 3;  1OUR A;  4D69 A;  2FDG A;  1YRZ A;  3OCP A;  1ZM1 A;  2WAA A;  4H7L A;  4YM0 A;  5JI9 A;  2UY9 A;  2BNM A;  2PHT A;  2VMG A;  3MF9 A;  5DAW A;  1K5M C;  1Y9G A;  1JI6 A;  1ZNP A;  2UWB A;  1OF3 A;  4QKF A;  5CVR A;  1UX6 A;  5E88 A;  4E2G A;  2J1E A;  2JKX A;  2NMO A;  2QQP A;  2JIJ A;  3N7K A;  4NE9 A;  1JYW A;  5IK8 A;  3NNG A;  1NG0 A;  5FYC A;  2YFU A;  1ULF A;  3G6J B;  4URA A;  4UFK A;  3AKQ A;  1WW7 A;  2X5I B;  3A23 A;  3T2P A;  4A45 A;  4YZ1 A;  5IVC A;  5C3P A;  1BHG A;  3HAG A;  4I0W B;  1MZE A;  4EZ4 A;  1O7F A;  1W8T A;  1XNC A;  4L8Q A;  5JZG A;  5A32 B;  5IK7 A;  2QQN A;  4JGZ B;  5A70 A;  5KHI A;  4RA0 A;  5DDJ 3;  1O5U A;  1QQP 1;  2HH9 A;  2RMU 1;  2HWE 1;  1NOV A;  1VMF A;  1IKP A;  1H8T C;  3CDZ B;  1ZZ7 A;  3WZ1 A;  3I49 A;  3MF6 A;  2WQ8 A;  1XE0 A;  1C1F A;  3OD4 A;  3GJA A;  3NAP C;  3N9P A;  1O8P A;  2WKK A;  4AW7 A;  2D97 A;  4B4R A;  4BU2 A;  5BNP B;  2RS1 3;  2VCA A;  5IAV A;  1UL9 A;  4EV0 A;  4XUP A;  4YW2 A;  1D7P M;  4NRO A;  5C9A C;  5E89 A;  3WDT A;  2HWD 2;  3SCF A;  4FXK B;  4L92 A;  4LBQ B;  4BQ3 A;  5FFO C;  4FT8 A;  1DGW A;  4LKF A;  1D0G A;  4PI0 A;  1YUD A;  5LBF A;  2A73 B;  1K12 A;  1H1M A;  1HRV 1;  4XOG A;  1HXS 2;  4YFW A;  1BMV 1;  2ZX0 A;  3K51 A;  3IAP A;  2RV9 A;  2OKX A;  4QKB A;  1HQL A;  4UXA A;  4K3U A;  2WZP P;  1W2U A;  5FYU A;  1ULC A;  5F3E A;  1AHS A;  3E1F 1;  3KQR A;  4OMD A;  2Y0O A;  4BXF A;  5L7O B;  1PVC 3;  1AF9 A;  2VOV A;  1QJF A;  3QLQ A;  4JC1 A;  1J84 A;  3E97 A;  1S0J A;  5DUV A;  4RSU A;  3N3H A;  1ULE A;  1XC6 A;  4C1W A;  1HW5 A;  3LB9 A;  1PM7 A;  4LBK A;  4GD4 A;  1LEC A;  1TMF 1;  3AXD A;  5DPN A;  1SLB A;  1VBD 3;  1H8T A;  3GBW A;  4EN6 B;  5GLT A;  2H0V A;  2PFW A;  3H8U A;  3FFZ A;  4NRP A;  4XUO A;  4XYX A;  3ZIX A;  3B00 A;  1Q8S A;  2Y8K A;  3OF1 A;  1PZ7 A;  3C7F A;  4QX1 A;  3WP3 A;  5C4W B;  4IEV A;  1LOA A;  1TME 1;  4JHZ A;  2KM2 A;  1EYB A;  1PMJ X;  2W46 A;  4HL0 A;  4IEW A;  4IET A;  4V2V A;  5C8C C;  3ALQ A;  3D8C A;  4XZP A;  4GMP 1;  3VBF C;  1JZ5 A;  5DDJ 2;  3RPQ A;  4DUV A;  4AYU A;  2ZAH A;  1PM4 A;  1NLR A;  4XXP A;  5C3Q A;  2GC2 A;  4UFI A;  1W8U A;  2XL7 A;  4Y1Y A;  3NJX A;  3SEP A;  5A6Q A;  1EPW A;  3ILN A;  2RS1 2;  5FP4 A;  2XGX A;  3ZDV A;  4EWA A;  3DL3 A;  3O1U A;  4LA3 A;  2JDY A;  4COV A;  2IVI B;  1WW4 A;  2IUW A;  4IEZ A;  1UZ0 A;  4XQ4 A;  3T4H B;  4RGG A;  1WWY A;  3CO2 A;  3N4M A;  2W1S A;  5LRS A;  2QDN A;  5EFU A;  5A7P A;  3S57 A;  1VAM A;  2JG9 C;  5DAQ A;  4YGD A;  3WT3 A;  5HCB A;  4FXG B;  4HT1 T;  4AZZ A;  3GCX A;  4AHZ A;  1OA3 A;  1YHF A;  4FI9 A;  4BB3 A;  4HVR A;  2Y38 A;  2LTN A;  1GOH A;  1VBC 3;  4AHY A;  1OQE A;  3AL6 A;  3ROU A;  1LGC A;  4AXO A;  1RUJ 1;  3QD6 A;  4YGB A;  2K46 A;  5FPV A;  5K9Y A;  4IDZ A;  4Q4V 1;  4XW3 A;  1JH5 A;  2QQU A;  3ME2 A;  3N9M A;  3ES1 A;  1CAX A;  2A6V A;  2PQS A;  1UY1 A;  2YHJ A;  2JDN A;  1XNB A;  1DG6 A;  2Y6G A;  1I5P A;  2Q5T A;  2VMF A;  5KWR A;  5C8C A;  3CZJ A;  4B4Q A;  3VBF A;  1DQ1 A;  2C4X A;  4Z1V A;  3A21 A;  5FZD A;  4D7T A;  4FOV A;  4IW3 A;  4RS5 C;  1VBD 2;  4GWN A;  1IS4 A;  2A3W A;  2ATF A;  5EWS A;  1PNG A;  1YJK A;  4IV1 A;  4ZS2 A;  4BLJ A;  3A22 A;  2AH2 A;  1KGY A;  2XJR A;  4RN5 A;  1VBA 1;  1LJ7 A;  2HWF 1;  2BGO A;  2GC3 A;  2WC2 A;  4XDO A;  2QQW A;  4ASL A;  2YV8 A;  4XFI A;  3KD4 A;  2P3Y A;  5LA9 A;  1ODM A;  2DWR A;  4N53 B;  3VBH C;  4IEO A;  4LHS A;  3D82 A;  3OYW A;  4XFC A;  5J36 A;  1RED A;  2JG9 A;  2RJ2 A;  3W59 A;  3HNM A;  4FPH A;  2WFP A;  2ILM A;  2VZV A;  2F17 A;  2DCZ A;  5J09 A;  2B9U A;  2RDN A;  2VMD A;  4K21 A;  1S0F A;  2EIC A;  1O4T A;  2R07 1;  3FJS A;  5LB6 A;  4RFR B;  3HN3 A;  3RSJ A;  1H1I A;  1UPS A;  5BXX A;  4QDS A;  5DMY A;  5JXH A;  1FOD 1;  4N9H A;  4BQ1 A;  2VCM A;  5C33 A;  2BDR A;  3KVA A;  1JBC A;  4Q0U A;  2HEV F;  2RR1 3;  3K46 A;  3R05 A;  4I0B A;  3ZKY A;  3FUO A;  2J22 A;  3OB8 A;  2IWG B;  3VGI A;  3B02 A;  4MET A;  4YW5 A;  3ZXD A;  4BK5 A;  1FT9 A;  1RUC 1;  4CDU B;  2QVS B;  2ZZJ A;  5IAX A;  1VBC 2;  4M3C B;  2V09 A;  1NE4 A;  3AC0 A;  2WZR 1;  4RS5 A;  2PHR A;  4KWJ A;  4QPI B;  5K4L A;  2Q8O A;  4DXT A;  1F5F A;  4ZZ8 A;  3M3O A;  2ZX3 A;  4KL1 A;  2PHU A;  2LUW A;  2VCB A;  2ZAB A;  1GNY A;  1K45 A;  2GSY A;  3S5Q A;  2P4E A;  3EB7 A;  1NLQ A;  4L97 A;  4NHK A;  1IOA A;  2QDR A;  1FMD 3;  4CCN A;  2JG8 C;  2BGP A;  5JXG A;  2JDZ A;  4QQ2 A;  3VBH A;  3VD4 A;  3KV6 A;  3WOG A;  1BJQ A;  2OVU A;  2P1B A;  5IJR A;  1N1V A;  3RZJ A;  1Z7S 3;  3M3E A;  1ZBE 1;  3IAQ A;  1C5H A;  2VH9 A;  2WFF 3;  4QM8 A;  1SPP B;  4E2S A;  3B9I A;  4QPY A;  1JOD A;  3FMG A;  5FLJ A;  3OPZ A;  1ULD A;  1N3Q A;  5A7W A;  2LRO A;  3TNP B;  4MGQ A;  1H2L A;  3NNM A;  5IFP A;  1IPK A;  4OUM A;  1JHN A;  2PYT A;  3HEI A;  4Y3O A;  4LHK A;  3MW3 A;  1XYP A;  5F39 A;  1IZ3 A;  1JZ2 A;  4FOY A;  3ZXE A;  1Q8P A;  2WSV A;  4CCD A;  3RJ2 X;  4LKD A;  5FO7 B;  5JUV A;  3VKN A;  3GZU C;  1LAJ A;  3LIG A;  1RUD 1;  1KDM A;  1PX4 A;  3ECQ A;  2RR1 2;  3VKM A;  5I8T A;  1YFW A;  1GWL A;  2GH8 A;  3ZFF C;  4YZ5 A;  2CGP A;  1RHI 3;  5T5O A;  4UOJ A;  3THC A;  4YFZ A;  5FZO B;  1WBF A;  3NMB A;  3VZN A;  2XWB B;  3MPP G;  1W0P A;  4A4A A;  1RUO A;  3WF4 A;  2B46 X;  2OZ6 A;  1DDL A;  2ZPX A;  1PIV 2;  4B8E A;  2Q8E A;  1YEW A;  1L7Q A;  2IXI A;  2VZS A;  1UYY A;  5DZG A;  1LOB A;  1JYC A;  1XQN A;  3OSD A;  3ZIW A;  4XF3 A;  3ZYP A;  3VL8 A;  2PHW A;  4COW A;  4FSJ A;  4LPL A;  3RRD A;  4M3C E;  5EYX A;  5JIU A;  1FMD 2;  1KDK A;  5L9R A;  1PVX A;  4A3X A;  1X33 A;  4UWD A;  5FMC A;  2FDJ A;  1JXN A;  4OVE A;  4FPO B;  4COZ A;  2ZGQ A;  2DU0 A;  4J1W A;  2EAK A;  5KC5 A;  3T2Q A;  3NNJ A;  2R30 A;  4MXW A;  3IPV B;  2RMU 3;  1REE A;  4N7I A;  2HWE 3;  2V5Y A;  3OY8 B;  1Z7S 2;  2VZ3 A;  2WFF 2;  1GOF A;  3CMG A;  5LA0 A;  5T5L A;  4WVV A;  4BZ4 A;  4OHW A;  4Z07 A;  4W6W A;  5IWF A;  2FZ2 A;  2R6Q A;  3ZFF A;  3K2O A;  1BBT 3;  4LUM A;  4QDR A;  4RL7 A;  1GQG A;  1HB3 A;  5BPX A;  3VBO B;  5FV3 A;  2NPI A;  3O5S A;  5T5J A;  2WR9 A;  3FL7 A;  3JZV A;  5FZL A;  1RUE 1;  1SFY A;  5JXJ A;  5FYT A;  1H2K A;  3WXP A;  5T50 A;  4XJ8 A;  1X82 A;  3I2H A;  3O1O A;  2RDQ A;  3RI8 A;  4OHV A;  1HQW A;  5FZ8 A;  3PUS A;  1RHI 2;  1ZYB A;  4XHB A;  1C57 A;  3NNF A;  3GHN A;  4ZON A;  2PLV 2;  3OOX A;  1VBB 3;  2YPJ A;  2WIN B;  1FI2 A;  2XON A;  4AG4 A;  4MHU A;  5J7M A;  1XU1 A;  1BLZ A;  2BWC A;  5C5T A;  2J7M A;  5LZ6 A;  4JTN A;  1ZA4 A;  2VW0 A;  1PO1 3;  4NWW A;  5E16 A;  3MID A;  2ET1 A;  2WO3 A;  4EWD A;  3TN9 1;  1KS4 A;  4BYY A;  2H6B A;  3GBG A;  4P14 A;  2V72 A;  4R4Z A;  5DN2 A;  3WCR A;  1DGL A;  1MZ6 A;  3CLP A;  4ONU A;  5FY8 A;  1TME 3;  4JGY C;  1AXZ A;  2W87 A;  5FIX A;  4CPB A;  5F6L B;  1JTZ X;  2WNV C;  2NQY A;  4LIT A;  4EQV A;  3EO6 A;  4KNC A;  2A1X A;  2EIB A;  2RMU 2;  1W6M B;  4OUE A;  3H8R A;  2BFU S;  3WNL A;  5HCA A;  4CCE A;  2JD4 A;  4UT5 A;  1GZW B;  1PO2 1;  3K3O A;  4OZX A;  4E9K A;  2VUD A;  3C7E A;  4C0H A;  5JPN B;  4MVT A;  2QKD A;  3NAP B;  4CPB D;  4HAN A;  4O61 A;  3A4U A;  1BBT 2;  1ACC A;  1J3R A;  1VMJ A;  3MO4 A;  4YVS C;  1VRH 3;  1W6O A;  2XKP A;  4FQZ A;  3VBR B;  3WHT A;  2HEY F;  2I2S A;  4Y22 A;  3MUY 1;  1LOF C;  2VQU A;  5J1X A;  3ZDS A;  4NJ4 A;  1GQP A;  2G1M A;  5L36 A;  3CJI A;  4PLM A;  4R9B A;  2VZU A;  1XE8 A;  4K20 A;  2PHD A;  4CDQ B;  4CP0 A;  1H6X A;  3LF7 A;  3JCI A;  2P2K A;  1W8Z A;  1DQ6 A;  4QM9 A;  2AYH A;  4QWN A;  1H0B A;  1VBB 2;  2DUR A;  1AL2 1;  4DXZ A;  2PEL A;  3TYJ A;  3VBS C;  4NN0 A;  4G4F A;  5FMB A;  4BMB A;  4O9G A;  3ZN5 A;  2EXH A;  4FTB A;  3I97 A;  2WNV A;  3ZN4 A;  4C91 A;  3O1T A;  4FTS A;  4R8H A;  1PO1 2;  2A70 A;  2E26 A;  5C3S A;  3V0A A;  2ZKL A;  3LDR A;  5I93 A;  1WMF A;  5LEJ A;  4AWD A;  3U37 A;  2NN8 A;  1QJX 3;  2VTX J;  1LRH A;  1GZC A;  4HG6 B;  4OI1 A;  3LEI A;  2V4V A;  1PK6 C;  5FYS A;  5FJK A;  3OBR A;  4B29 A;  1EUT A;  2QQJ A;  3OBZ A;  4DO0 A;  2CNA A;  4BIO A;  1TME 2;  2ZS6 B;  5CIR A;  4J1X A;  2O1Q A;  1Y9Q A;  2X09 A;  4PBO A;  1AX1 A;  4YVS A;  1LEM A;  1ULG A;  4QHZ A;  3VKL A;  2WRA A;  1MS8 A;  1ZVF A;  4WM7 C;  2PAK A;  3WQ0 A;  3TAY A;  1JOP A;  1LOF A;  2OT7 A;  3ETQ A;  4FFF A;  4IE4 A;  4K6B A;  3Q9O A;  4CUB A;  5A3P A;  1K42 A;  2I45 A;  1ZRF A;  4CCC A;  4UF0 A;  4TTG A;  1G8W A;  1ZZB A;  4I01 A;  4LTA A;  1AR6 1;  2XUM A;  4CP9 A;  1VE0 A;  1HRI 1;  3I59 B;  1JZ8 A;  5A32 A;  5FYY A;  2ZGR A;  4NVP A;  4JGZ A;  1DP0 A;  2OA2 A;  1FOD 3;  1VRH 2;  5E6H A;  2DBN A;  2TNF A;  3AVR A;  4BM8 A;  4DUX A;  1HX6 A;  1REF A;  1OC1 A;  2ZEZ A;  1ZZ6 A;  1RC6 A;  2Q4S A;  5FYI A;  4TLF A;  5DG2 A;  5FZ9 A;  1B35 C;  4SLI A;  3VBS A;  5CFC B;  4Z82 A;  5EJ3 A;  3ZFG C;  2BW8 A;  3I3B A;  4A41 A;  5JDB A;  5I0U A;  3RZZ A;  3ZYG A;  3LOI A;  1PGL 1;  2WDB A;  4QX7 A;  4OHZ A;  1MS5 A;  3UYJ A;  3LFI A;  1DYK A;  2E9Q A;  3LA7 A;  1SCR A;  1S0G A;  1HB2 A;  3MBW A;  4LBQ A;  1E5S A;  4AQT A;  4KWU A;  1UMI A;  2D6N A;  1PK6 A;  3ZVX A;  4AI1 A;  1KIT A;  1IQA A;  3VL9 A;  4PQ9 A;  1ZZC A;  5K0U C;  5FZI A;  1YCI A;  1QH7 A;  3WR0 A;  1S2K A;  4TSV A;  3P6B A;  4A3Z A;  4MH0 E;  2Z79 A;  3ZSJ A;  1QJX 2;  3FBY A;  5M0T A;  1DU3 D;  1WLT A;  4KU7 A;  1VBE 3;  3D4K A;  4UW4 A;  1COV 3;  2UWC A;  1J58 A;  1UOF A;  2VBP A;  4HBN A;  4Q5O A;  2SBA A;  2J1T A;  3FE5 A;  3RYR A;  1QOT A;  5BYN A;  4WVZ A;  2BJS A;  1H9W A;  4H7M A;  5JOX A;  3IZO A;  2VY0 A;  2ZHM A;  3ABZ A;  2WL1 A;  4AVB A;  5HBA A;  1RGS A;  1KRI A;  1MEC 1;  3WVJ A;  1B35 A;  4QHO A;  1UD1 A;  4BDV B;  3ACH A;  4MX3 A;  3ZFG A;  4AVS A;  2WA3 A;  2Y0I A;  1AR9 2;  5C4W A;  4E8C A;  5FZA A;  5A1A A;  1ENQ A;  1PGW 1;  3J7N A;  3POB A;  4Q1P A;  1CAU A;  5KXD A;  1AJO A;  1FOD 2;  1LHU A;  4FO9 A;  1YQ8 A;  1W06 A;  4HN1 A;  3THT A;  4ERO A;  2O8O A;  2WT2 A;  3D5O A;  4NAM A;  2IXJ A;  1NZC A;  4CSW A;  3IM0 A;  1UMZ A;  4DIN B;  4XUT A;  1XRU A;  4CXX A;  5CBL A;  2UU8 A;  3ILR A;  4A7Y A;  2BER A;  1SBD A;  3IDE A;  1UIK A;  2AR6 A;  3ENR A;  4GKY A;  4IES A;  4MXV A;  4Q27 A;  4W65 A;  3PME A;  3WF1 A;  2VCC A;  4Q4Y 2;  2WZ8 A;  5KC6 A;  3V0B A;  1HJF A;  3BOP A;  4LK6 A;  4QGM A;  2IVJ A;  3LPG A;  3L2H A;  2DYC A;  1DQ5 A;  2DTW A;  2RJK A;  3AMM A;  4P9G A;  3I2I A;  4BA6 A;  2ARA A;  1S4C A;  3OD0 A;  2RS5 1;  3RG0 A;  4YPJ A;  1C8M 1;  2AAC A;  2P37 A;  3OUJ A;  2XDV A;  5HI0 A;  2ZGO A;  3LWC A;  1LES A;  1R1A 1;  4LHL A;  2XLA A;  1OMI A;  4Q29 A;  3TEZ A;  3BN6 A;  4CXW A;  1K5J A;  2ZMK A;  4JZR A;  2JG8 B;  5D1I A;  2QQI A;  2QNK A;  2YRO A;  4GKX A;  4XCB A;  1VBE 2;  3MI8 A;  4HK9 A;  1COV 2;  1RUH 1;  3OEA A;  1DQ0 A;  4B7K A;  5CB7 A;  4Z2W A;  2W0X A;  1V6O A;  3DKQ A;  3J7M A;  2BYV E;  1RMU 1;  1E5R A;  4P5Y A;  4LKE A;  5T54 A;  2YYO A;  5B4N A;  1D2S A;  4XAA A;  3SKV A;  2YFZ A;  5FKB A;  1DQ2 A;  1ZBA 1;  3AL5 A;  1WZX A;  2VC9 A;  5DAB A;  4B3N A;  2XJV A;  4D7Y A;  5EJ1 B;  1GZ9 A;  5AFB A;  1STM A;  4MSV A;  4AVA A;  1OPM A;  3JB4 C;  3AFK A;  3W9A A;  4CCL A;  1VR3 A;  1GZT A;  2CAV A;  4PLO A;  2YC2 A;  2VZO A;  1RUE 3;  4QX5 A;  5KHK A;  3WG1 A;  2ZHN A;  3VBU C;  3ACG A;  1HB1 A;  2KXL A;  4P9Y A;  4XZU G;  5FBJ A;  1XNT A;  2Y34 A;  3KQ4 B;  5AVA A;  3HIF A;  2GAU A;  4XUN A;  1W6Q B;  3LSD A;  2JWP A;  4IE6 A;  1EAH 2;  2ARX A;  3FN9 A;  3MUZ 1;  2VXJ A;  3PUH A;  1O6U A;  4F3J A;  5A3W A;  1UY3 A;  1X9T A;  2DCJ A;  4HXC A;  3DPR C;  5D21 A;  3BU7 A;  1I6X A;  1MZF A;  1OOP C;  2RHP A;  3ZN6 A;  2WNO A;  4AI8 A;  4NIH A;  4FPJ A;  2NZ9 A;  2DFB A;  1EPZ A;  4E4D X;  5GZF A;  5A7Q A;  4CVU A; 
#chains in the Genus database with same CATH homology
 4NHY A;  5EQU A;  5M0T A;  3HQR A;  2HBU A;  4Y5T A;  2OPW A;  2JIG A;  2A1X A;  2FCV A;  4Q5O A;  5L9V A;  5L9B A;  5A3U A;  3NNM A;  4XC9 A;  5EPA A;  5LBC A;  3GZE A;  5DAQ A;  4BQW A;  4NHM A;  3NNL A;  5EP9 A;  5DAW A;  2G1M A;  5LBE A;  3OUI A;  3PL0 A;  5HV0 A;  2JIJ A;  3BVC A;  3ITQ A;  4IW3 A;  5LBB A;  4NHX A;  5L9R A;  4XAC A;  4UWD A;  3KT4 A;  4J25 A;  3OUJ A;  4Y5S A;  5IAT A;  4BQX A;  2G19 A;  3NNJ A;  4JZR A;  3OBZ A;  3GJA A;  2HBT A;  5LAT A;  5LA9 A;  4XCB A;  5IAV A;  3KT1 A;  4NMI A;  2RDN A;  3DKQ A;  3GJB A;  2FCT A;  5LB6 A;  2RG4 A;  4XAA A;  5LBF A;  2RDS A;  2RDR A;  5LAS A;  3KT7 A;  3HQU A;  5ERL A;  3EMR A;  2RDQ A;  3MGU A;  5HV4 A;  4MHR A;  5IAX A;  5DAX A;  2Y34 A;  2Y33 A;  3NNF A;  2FCU A;  5DAV A;  3OUH A;  3W20 A;  4BQY A;  2V4A A;  4ZON A;  5DAP A;  4XAB A;  4MHU A;  4NHK A;  5C5T A;  3W21 A;  4NAO A;  4XCA A;  4KBZ A;  4NHL A;  4ZPI A;  5C5U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...