2VTXA

Activation of nucleoplasmin, an oligomeric histone chaperone, challenges its stability
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
103
structure length
92
Chain Sequence
DLIWGCELNEQNKTFEFKVCEHQLALRTVCLGDKAKDEFHIVEIVDEKSVPIATLKPSILPMATMVGIELDPPVTFRLKAGSGPLYISGQHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nuclear protein
molecule keywords NPM-A PROTEIN
publication title Activation of Nucleoplasmin, an Oligomeric Histone Chaperone, Challenges its Stability.
pubmed doi rcsb
source organism Xenopus laevis
total genus 17
structure length 92
sequence length 103
chains with identical sequence B, C, D, E, G, H, I, K
ec nomenclature
pdb deposition date 2008-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03066 Nucleoplasmin Nucleoplasmin/nucleophosmin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.340 Mainly Beta Sandwich Jelly Rolls Nucleoplasmin core domain 2vtxA00
4CA9A 3T30A 1XB9A 5EHDA 1XE0A 2VTXA 1NLQA 1K5JA 4N8MA 2P1BA 2VTXJ
chains in the Genus database with same CATH superfamily
2EXJA 3WDXA 2B9VA 4HVQA 3BU7A 2UY8A 3H9AA 3UK9A 2P1BA 1W8WA 1WW7A 3G6JB 3KV4A 5ACA1 1L3JA 5I0TA 1MQTC 2VVDA 3AJYA 4WVWA 4GALA 5DQ0A 2RJ2A 3FLRA 3WUDA 4RR3C 1XB9A 3SITA 5A3PA 1RUD3 1KEXA 2QQIA 3KCXA 2CAUA 2R072 2VTFA 1HRI1 3GBGA 1S0FA 4ONUA 1BVVA 4SBVA 3TN91 4AEDB 5CISA 5FPUA 1WKYA 1UPIA 4XUQA 3RVHA 4XF1A 3WX5A 1LKNA 1N1VA 3I3EA 3NL1A 3VGIA 4QKDA 4B7EA 2ZZJA 3G7DA 3ZXJA 1AL22 2GC1A 5C8CC 4AFMA 5E89A 1WW5A 2ZMLA 2Q8DA 3ZX7A 1D4VB 3ZFGB 4CVUA 1PK6A 4M4PA 4FFGA 5CYYA 3ZFFC 1F5FA 2VU9A 4NPLA 2P3JA 1TE1B 4PJYA 5JOZA 3ZXGA 3B93A 3T1MA 4K6BA 2WSVA 3VBHA 2P3IA 3KV6A 3OEBA 1AYM1 2Y60A 2X09A 1C28A 3WF0A 5IFTA 2D97A 5CNAA 3J26N 4L9BA 2DTWA 2GC3A 3BTAA 5F7UA 2VOWA 1S1AA 5IFPA 2DURA 1PGW2 1CVNA 1T6GC 3QOPA 1GMMA 3DYMA 4KL1A 5G05L 2HWC1 4IV1A 4XUTA 5FXXA 4PT6A 1SLCA 3M3IA 5FYMA 5C3OA 3U10A 4ATEA 2ZGPA 1VALA 2XKOA 2HYXA 4C1XA 3VDBA 4X6RB 5FOBB 3NKTA 4Q2FA 1O3SA 4AXOA 4BOWA 4DMIA 3VBFB 3WF2A 1CAWA 1Y9QA 5GLTA 1PNFA 1VBE2 2E32A 1ENXA 1S0EA 3VZLA 1R64A 4I2OA 3VBRC 3RYKA 3U14A 2BERA 3POIA 5C4WA 3SISA 1RHI3 1KD7A 1D7PM 1HB3A 2P17A 4FFHA 4Z92B 1UKRA 1CAVA 5KXCA 3EYPA 4Q4X2 5DPNA 2OPWA 2Z5WA 2YHJA 5I91A 1XU1A 3TNPB 1IOAA 1RUD1 3ES1A 3LD8A 4HBNA 4O61A 4BJ0A 3TEZA 1A8MA 3Q8EA 2RS53 3FJSA 1XXNA 3IDBB 1FMD3 2AYHA 5F9TA 2CHHA 4UFHA 4KU7A 3VBOA 5FZCA 2LROA 1FOD3 4M01A 1W9WA 1D2QA 4LKSA 4WM7C 1ND3C 3VZOA 1MS0A 1NA1C 2AENA 1IPSA 2BUKA 4U36A 4R9AA 1BXHA 4A42A 1MZ5A 3H0OA 4PLOA 4Q4Y3 1O91A 4MGTA 5EWSA 5FP3A 5AC93 3I2IA 2R062 3MIGA 1S0IA 1YFYA 4M4RA 1MVQA 1WLTA 2IC1A 3OY8A 1BKZA 4KBBA 4NOTA 4HKWA 4Q4V3 4JDNA 5CADA 1H0BA 5FIXA 5A6XA 3U4XA 3B94A 1TG7A 3ZLIA 1OUSA 5FV3A 1HDKA 4FPJA 1AYM2 1I6XA 2VMHA 1BHGA 4PIYA 4Y5Z0 1VBC2 1W6MB 4MVTA 1IPKA 3AMNA 2ZGTA 4ISRA 4LJHA 3K51A 1JU4A 4K8RB 4KI5M 1ZBA3 1BZWA 3O1MA 4QXKA 5APAA 5L36A 4XJWA 1RUOA 1S2EA 4Y22A 4ZXEA 3IMNA 4IE5A 2DVGA 3KVAA 4QX2A 1JOJA 2WS93 1LEDA 2HWC2 2DU0A 1LNSA 3O0XA 1LJ7A 1ULCA 4COVA 3B7MA 5JMOA 1KFUL 5FZFA 1RHI1 5JI7A 5L9RA 3BU0A 4C0BA 5FKBA 3QH7A 2QUOA 1K5MC 2XG3A 4OMCA 3ILFA 4A3XA 2GNDA 1EAH3 3WY6A 1QWRA 3I2OA 2XH6A 4L99A 2GC2A 2DU1A 1EY2A 2XVKA 1UOBA 1GQGA 2RS51 2B7YA 1FMD1 5JIUA 2VW2A 1ZRDA 5SV5A 1FOD1 2JG9B 1OLRA 3J9SA 4M3CE 4Y1XA 4COYA 3AKRA 5C9AC 1W28A 4FPEA 4CTEA 3I2JA 1PVXA 4QQ2A 4V1PA 4AGGA 4K40A 4BMBA 3JBG3 5FZ4A 4D7TA 2LTNA 4E2SA 4YVSC 2W94A 4KWKA 4Q1PA 4JKLA 1OD5A 3N4MA 4XQDA 1O4YA 1AR73 4Q4Y1 3ZIXA 1L7QA 4XMAA 2C24A 2YYOA 3J7MA 3X29B 5J37A 3DPRB 4HN1A 1OFNA 4RS5C 5AC91 1W9TA 2B4KA 1OA4A 5ANQA 1Y3TA 5FDBA 2P4EA 5KHIA 3M1HA 4Q4V1 2BP6A 1W8TA 4IEQA 2R043 4RSUA 4AEKA 5A7OA 2SBAA 4DFSA 3C8XA 2B9UA 3JU9A 3WG4A 1CAXB 4S2GA 2LS6A 1GOHA 3W5NA 1XYPA 1G6NA 3RPQA 2D7FA 3HAGA 4UBHA 3VKMA 1GLHA 3N9MA 3PMEA 2Y6LA 1IS4A 1NE4A 1ZBA1 4Q4W3 3R0RA 4XBQA 2J1UA 4LLFA 2QZ2A 3OBAA 1AJOA 4A4AA 1X82A 2GSYA 2XJRA 3SH4A 5A7NA 2WS91 4WVMA 1OLME 1UXZA 4M3CA 1CX4A 3OGVA 1C8M3 1OT5A 1AR93 4JGZC 5FPZA 5K7PA 2GAUA 2FDFA 1CJDA 1JZ8A 4QB1A 2V5DA 1EAH1 4CCOA 4XIKA 1SDWA 2VXRA 4LHKA 1OA3A 1PIV2 3BTZA 1XE7A 4R9BA 4TXWA 3KVBA 3AXEA 2ETEA 3UGFA 1SMVA 3RZMA 4NRMA 5FYYA 3WG3A 5C7GA 5D8AB 1C8NA 1FNZA 3NJVA 4ASMB 3PURA 5EV7A 3BCWA 5JR7B 5BNOB 3JBG1 1VRH3 1V6KA 3TOJA 1JYXA 2VXJA 3WNXA 2RS52 3V56A 4XZPA 4CUBA 5KHKA 5HV0A 1HB2A 2YXSA 2UYBA 4OMDA 1AR71 4D6RA 2C5DA 5FZBA 2ZXQA 1ZZBA 3N36A 5GALA 3VBSB 4URAA 4UFMA 1WGPA 2KA3A 1WD4A 4GMP0 1ALYA 1QH6A 2W08A 1HN0A 1U12A 2JIJA 2Y38A 4J25A 1OQEA 3MIDA 4LHSA 1G9DA 4WZCA 1OLMA 2R041 2WZR3 3BGAA 1O6UA 5GZGA 2JECA 5FYZA 2A3XA 4Q4Y2 1NY72 3E5UA 1UQXA 5L7OA 1UU5A 1JUIA 4QXCA 1GZCA 2CNAA 5AC92 4QT6A 2IXJA 2XVLA 2H6BA 2A6ZA 3SCHA 2GMMA 2VGDA 3EBRA 2CL2A 2JIGA 1POV3 2P3KA 4LO5B 4Q4W1 2JDHA 3PVEA 2A71A 2OQ6A 2P6HA 2RJKA 4P9LA 4OUSA 4YG0A 3CU7A 1VBB3 2PHRA 3LFMA 1LODA 4LBMA 1ASJ2 3H1YA 1C8M1 1CAUA 3IPVA 3WW3A 5E1RA 5LATA 1AR91 2XXZA 5CFCA 1L7RA 1LESA 4K21A 3W20A 4YM0A 3NV4A 2VCCA 4RFRB 4UFKA 3ZPYA 4CP9A 3E97A 5JOXA 1ENSA 2F6BA 1N47A 5T3NA 1S0JA 2WS92 2VMDA 1K3IA 3BB6A 2VOTA 3BIWE 2G19A 2ZKNA 4ITCA 4JX0A 3AL5A 4MSVA 4BIFA 1QJY2 5ISLA 4CUAA 2ZGRA 4AQ2A 3WQBA 1FYUA 1RGSA 2AZ5A 2J42A 2KXLA 2XQXA 4FAHA 2DFCA 3OD4A 1UMIA 1URXA 4DEQA 4PQ9A 4C90A 4YGDA 1ENRA 1VRH1 2JG8C 5C3RA 1PK6B 2WKKA 1GICA 2QTWB 3PVOA 4XILA 3RJRA 2FMYA 2VQUA 4R9DA 4XURA 5C70A 5CFDC 2BWAA 4QX7A 2W2IA 1JXNA 4PLMA 2VW0A 1MS9A 1OC1A 4XBNA 4XPVA 2Q0AA 1DGWX 4OZOA 4DOUA 5L9VA 4CDQC 4QPGC 4DO0A 3AZYA 5FO8B 1H2MA 2JD9A 2QKDA 2JDAA 1YHFA 4H14A 4NPMA 4QDRA 3KD4A 4Z8BA 3BI3A 1X9PA 3A0NA 2NN8A 2WZR1 1LECA 1QOTA 3DV8A 4LEJA 4FPHA 5FZ1A 1G86A 1NQDA 2BRTA 4HVRA 4MH0E 4Q27A 5A70A 1UN1A 2OVUA 3CLPA 4MLOA 1UIJA 4IV1B 4LK6A 1I1EA 4NWWA 4IDZA 4XFAA 4KG8A 1Q8VA 4UT5A 3S7IA 1QJFA 2XGXA 1LHNA 1VMJA 3OJBA 3M70A 3NNGA 1RUE2 1POV1 3P1IA 1SLLA 3WNKA 1RUF3 1TMF3 3VZNA 4QPIA 1RUH3 2WWJA 5L19A 5FPLA 1VBB1 3N9QA 3E6DA 1G9CA 3LEIA 1W3VA 5FZLA 3WLUA 4UYBA 4D69A 4N9IA 2JDKA 4P08A 4XUNA 5CKMA 1W2TA 3WQ7A 2D43A 1LGCA 1O7FA 4MYEA 4E8CA 1XNCA 3NRUA 2XBO2 4Q4W2 4BH9A 1CAVB 1QXRA 2JKXA 1HRV2 2EXIA 4WVVA 3WVJA 1JYCA 1UO9A 4B3NA 2ZOEB 1UZVA 1GZTA 3WT3A 2ADEA 2DCTA 4IGQA 2VUCA 2JDYA 2WNVC 1AZDA 1AR83 2VOKA 4CYDA 2DCJA 4TZDA 1AR92 5FYTA 4AF9A 4UAPA 1HXS3 2V09A 2ZEWA 4Y1UA 3U1XA 5KC5A 1XJAA 3QD6A 1MS5A 1CESA 4Q8KA 5LWBA 3TB0A 1PM4A 3W9AA 5B4XA 4BQXA 4N53C 2QVSB 3GZTB 4PDWA 4C8DA 1UYXA 2OYZA 3O1OA 2X10A 2VPVA 2VMFA 4EWDA 4D94A 3ZSLA 3ALQA 5AVPA 5FBZA 3T30A 4XUPA 4Y1VA 4BQYA 4Z82A 3RNSA 3VDAA 1DQ4A 2PLV3 3FHIB 1Z7S3 4NHKA 4CEWA 4WM8C 3A4UA 4FPGA 2A5ZA 1ST8A 4RL7A 1MPXA 3N9LA 4QD2A 2Q4SA 3AP4A 3CL1A 1PMIA 1VRH2 3HNYM 1CWPA 1MS1A 4QPYA 4AWDA 3QH6A 3NJXA 1V6NA 3RDIA 3S6PA 4FTBA 5IJRA 4RHV3 3J7NA 2XJSA 3N7LA 3NAPA 3WDWA 5EIYB 3VV1A 2QFEA 1ZBE3 4CCJA 1RUC3 2JXAA 3QACA 3WNOA 1H6YA 1X36A 2RS12 2YC4A 3UGHA 2ORXA 2HYKA 2WNEA 5H9RA 1W6QB 4AGRA 4UFIA 3RSJA 3D5OA 1F5JA 1C5HA 1RUF1 1TMF1 2WZR2 3JXSA 4O65A 4Y22B 1G9FA 5CB7A 3UETA 1RUH1 1W90A 4OHWA 4P9YA 4Q1RA 3VZMA 4CP1A 3ZXDA 2WA4A 1R083 2ARCA 1UF2C 4DUXA 2A3WA 3H8RA 2CTVA 3C7GA 3P6BA 4LKEA 3VBUA 1ZZ7A 1W9YA 2A6XA 5ABJA 4QU2A 2VBBA 2DCYA 3IIIA 2AEYA 2XR4A 2GNBA 4HKOA 4MHRA 2OS2A 3WG1A 4Y5SA 5BYNA 5EPAA 4IEXA 3LOIA 3MV11 1LGBA 2ARAA 2D6NA 2OQ7A 2XB6C 1HKDA 3NVCA 1VBB2 4RQPA 3V0BA 1WBFA 2JEMA 1E5SA 2GALA 1AR81 1TNRA 5CZKA 3E5XA 5GZDA 2Y0IA 2PTMA 4AOCA 4CEYA 1HXS1 5F2SA 3WNLA 5F5AA 1V9U2 2CWSA 4O9EA 1H8TA 1PO23 3HIFA 4HKLA 4OULA 5A7PA 3L2YA 4NAOA 2IXCA 2ZHNA 3GBFA 1U5IA 3MO4A 2IZWA 1N1TA 3B5LB 4LLOA 3AC0A 4HANA 5I0RA 3O5SA 1S2KA 3I3BA 5SV8A 4Y4YA 4EN0A 5BPXA 1ZREA 3LDBA 3K4AA 2PLV1 4BMEA 1Z7S1 1NZIA 4XUOA 3K2OA 5DG2A 2VZPA 4BQ2A 4NWVA 5LZ6A 4JGYA 1J83A 2R073 4MGZE 4JKMA 4XJAA 3PMSA 1SFYA 4GJZA 2B8MA 5J7MA 2J1SA 4QHBA 5FREA 4N7IA 3VKNA 4ARXA 4RHV1 5T55A 4CDXA 1YFWA 1ZBE1 1N1YA 3VHNA 2VR4A 1RUC1 1ZA7A 2BW8A 3KGZA 5I8SA 1FV3A 5IYYA 5JOWA 1O3RA 4L97A 4Y1ZA 4TLGA 4XF3A 2A6VA 4FQZA 2H6CA 5A3NA 1LHOA 4XXAA 5KHHA 3RG0A 5FXWA 2VZUA 2DWRA 4KGGA 4IEUA 4YZ4A 5DDJ2 3INAA 3ZFEC 2WO3A 3RZLA 1VLNA 5JZGA 4FPCA 2DUPA 2AR6A 2XKPA 2HWF2 3DYOA 4A41A 5HCAA 4BISA 3MIBA 1VR3A 5FP7A 4D6QA 3SLIA 1R081 4R8HA 4IE7A 2EVXA 2BBAA 4XJUA 4AR2A 1HJFA 3N3HA 1SEFA 2W1WA 1UX7A 5IVFA 1KS4A 4JTNA 1ND2B 1US3A 5F32A 1OFSA 2BYVE 3LFIA 3T2TA 2XJPA 4UI9L 4A6OA 3BUCA 1UMZA 1AF9A 3I97A 1RUH2 4LUKA 4QKBA 2ZGUA 3ZSKA 1HB1A 2AUYA 1RTVA 4CXXA 5DMYA 1O8PA 4BLJA 1RYYA 4P00B 4AW7A 5J36A 2XUMA 1YI7A 5JMCA 2VTXJ 1S4CA 5FKCA 4AVSA 4BDVB 1OPMA 4BXFA 2JDNA 3O1SA 5FUIA 1GWKA 1JHJA 1NXMA 4BB3A 3I3MA 1PO21 1W3XA 2PELA 3KF5A 1O5UA 2ZGNA 4OHYA 2C0ZA 1UZZA 2ZGQA 5H9QA 4FBFA 5BNPC 2LRPA 5JSRA 4DXTA 1NXD1 1VBE3 4M00A 4QM9A 2ZKLA 4Y24A 1D2SA 4B29A 1XRUA 3FFQA 4MADA 3OB8A 3HJRA 4QQPA 5FZOA 3WHTA 1AR82 3SC7X 1UL9A 3SKVA 4XAEA 4QGMA 1HXS2 2JB4A 4IEPA 4RGKA 5FZKA 1EUUA 3WNPA 1IZ3A 1CIYA 2XL7A 2AACA 4HN0A 2VZOA 5AVAA 1LOFA 1Q8PA 1W8OA 1H6XA 1QKQA 4ASKA 4N90A 2FQPA 2NMOA 2R071 3APBA 3FE5A 2BNNA 3IZOA 1LOAA 5KBFA 2VBPA 5FO7B 2GN7A 4OZXA 1LTEA 2YG0A 3MW4A 4LBJA 1JYIA 1ULOA 3GDBA 3GYDA 1XSQA 1MQTA 3O1PA 1CZTA 3MPBA 5F3CA 4AVAA 2PLV2 3T4VA 2ADDA 5L7OB 1QF3A 2HH9A 2OX0A 4QHZA 5A3TA 3POWA 4RR3A 1DDLA 3T1LA 5JSOA 5FP9A 4CDWC 5IK4A 3BKZA 2LW8A 3OYWB 1APNA 4BZ4A 4NHYA 4FSJA 2FMDA 2WJSA 2FDJA 4OI1A 2Y6HA 2D3PA 1PZ9A 2Y6GA 2R063 2WO1A 5C8CA 3IPVB 3NV1A 2GNMA 4RA0A 2WDBA 4B4RA 5EQUA 4AI9A 4YSFA 5CFCB 2GZWA 2I74A 5LY2A 4AGVA 2FDIA 1US2A 3AKPA 4XABA 3ZFFA 1DHKB 2BFUS 1PGW1 4QX5A 4CP9B 1JU3A 2YB7A 3KQ4B 1H2KA 3GHNA 4CU8A 4U2AA 1OKOA 1VB4A 1VBC3 3GZEA 2O8OA 4PF5A 4YZ1A 3FFZA 1WA6X 3KB5A 4LQRA 4CU7A 2LALA 4L92A 3RWKX 4ZZ5A 2R30A 3HVDA 1FX5A 1G8WA 2JE8A 3PTYA 3WP6A 4AL9A 3D4KA 5HPOA 2XLAA 4YFWA 1FNYA 1SG3A 2PQQA 5HI0A 2ZAHA 3LSEA 1DGLA 5JXHA 5FK8A 1VBE1 3FUQA 3JUUA 5T54A 4IETA 3WNNA 4EQVA 3LF7A 3W58A 1GZWA 2BFUL 2WBKA 1LENA 1ZM1A 1Q8OA 2BDRA 3FMGA 2YV8A 4LIUA 5CG8A 1LULA 5FUNA 1QOSA 5BNQA 4C0HA 1RUI2 4OVEA 4ET7A 1RMU2 3ZYHA 3NWKA 4BQWA 3BPZA 1R093 4D3WA 2VC9A 3IDCB 1IGOA 4FPFA 4GWMA 2O14A 5JOYA 3B01A 4HPKA 3VBRA 1LGNA 3JQXA 1CIWA 4QHOA 2HWE2 4F83A 1KXGA 2WQ8A 3ILNA 3IAPA 2JDUA 2H0VA 5CKQA 2WA3A 4LIVA 3FUOA 3AYEA 1UYYA 3IAQA 3S57A 1I3HA 4GKXA 2VVFA 3ZYIB 2CGPA 3B3QE 2VZTA 5FYBA 3AZXA 1DQ1A 1DQ2A 1TVGA 4X8PA 4LO8A 3WDYA 2VNOA 2WLPA 4PI0A 4LKDA 1PGL2 1A6CA 2ARXA 4P5HA 1FPN2 2DBIA 4AFAA 1ZRRA 5F3IA 1OSGA 2R061 2Q8OA 4BK4A 5CG9A 5FAXA 4WM7A 1X7NA 2YGMA 3THTA 1AHSA 4QQOA 5FRAA 1ND3A 3ZIWA 4NMIA 1NA1A 3I2FA 1W6NA 4CCDA 4F8AA 4QQLA 3HPNA 4ZU5A 2UWBA 1A34A 5KC6A 1T6BX 3H3UA 3EB7A 3M4FA 1U5YA 4CDUC 1X8MA 1VBC1 2V72A 3AJZA 4LK7A 1O4TA 3GJBA 1F2NA 3M3QA 1QQP3 4ES8A 3USUB 1A3KA 3UGGA 1VMHA 1AR62 5JVVA 1XBFA 3D82A 5A33A 3KCYA 1N1SA 1IPJA 1JZ2A 2PHTA 4IERA 1O3QA 4PDWB 4B1MA 5LEJA 1OOPB 1NCQC 4MXWA 3LOBA 3BTXA 1V0AA 2YMZA 1YWKA 3U4SA 4ZY9A 1V6LA 4BE3A 2C1FA 3A0KA 1NOVA 1DU3D 2OUHA 4TSVA 3THPA 4C91A 1R091 3VUOA 1PIV3 2WFF3 1NT0A 3AP6A 1WWYA 3O14A 4XFHA 5F3EA 3BTYA 2WFPA 3N7MA 3NAPB 3ZSEA 1EP0A 1IQAA 1UY0A 3DUIA 1OH3A 1W9SA 5FZGA 1Q8QA 4PHZA 2BU9A 2P3YA 2ZMKA 5JR2A 1K5MA 2RHPA 1BK1A 1W2UA 1YI9A 2YDEA 1CX1A 2MHFA 1Y9GA 2YPDA 1UW8A 2PA7A 5IAXA 3NW4A 1AJKA 3AMHA 1W8UA 3KT4A 3KT7A 5K0UB 4EWEA 1GR3A 2EXKA 2D5FA 5FZ6A 1JYWA 5LRSA 2R49A 3AMPA 3NSTA 2FZ1A 4OHXA 4TYSA 4X8NA 4YW1A 5FJKA 5FXZA 5C9AA 1YFXA 5LBEA 1JS9A 4LE4A 2DV9A 1JBCA 3VBUB 1W2NA 3PTRB 2J1EA 5D2AA 1LHUA 3EQEA 5D1IA 4QXBA 4YFZA 2EAKA 4YVSA 5FPXA 4K1ZA 5BNNC 4GXLA 4DRVA 1W06A 5AFEA 3MBWA 1JH5A 2XVGA 2DVBA 4N9HA 3T0DA 2YGLA 1WUVA 2XUEA 1RVF2 4PIXA 4AQSA 5LW9A 2QQMA 3V0BB 4MGYE 4LBQD 1UCXA 4OUMA 2ZCWA 2J1AA 3ORJA 1WD3A 4RS5A 2WZ8A 1DGRA 2ZHKA 2PFWA 3RYRA 3NQHA 4DIQA 1UX6A 2BBVA 1QQP1 1ZRIA 1SFNA 3R4DB 1H8TB 4BCUA 1IS3A 4META 1GQPA 5KXBA 2ES3A 3GCXA 2ZEYA 4YW3A 3HQUA 3H50A 3LEGA 4ZU4A 1XNKA 1ASJ3 4R4XA 1EUTA 3FZ3A 4NHMA 3AVRA 1RL3A 2D98A 2J7MA 3KZ4C 4YVWB 3UJQA 5EJZB 2ZJCA 4GH4C 3FBMA 1LEMA 2ZACA 5FBJA 1PX3A 2JDZA 4JGYB 2FCUA 5FPBA 3WCRA 3VHPA 4B7KA 3GALA 1PIV1 1IS6A 1QJX3 1GP4A 5H9SA 2K46A 1LR5A 2WFF1 1AX2A 3BVCA 1QJY3 2DVDA 5J1XA 2FCVA 3PUQA 4QM8A 2QQJA 4HONA 4JGZA 1CN1A 5T5OA 3TNQA 2E53A 4BU2A 4FOWA 1DCSA 2FD8A 4FT8A 1R092 2IXHA 4ZS2A 2WWSA 2X53S 2RMU3 4A7YA 2WN3A 1OKQA 4XJ8A 4ASLA 3AYDA 1PVC3 1S0CA 1ZYBA 3DF0A 3TAYA 2QDRA 1JMUB 1V00A 3RMXA 1IQDC 1O4ZA 4Q0SA 3AKQA 2YPJA 3GHMA 4UXAA 3ZO0B 4COZA 1SACA 2WYSA 1DYPA 3M7AA 4NHXA 4XYXA 1ZRCA 4DZGA 3T0BA 4JQRA 1QMJA 1YCIA 3POJA 4LPLA 1NY71 2WINB 3FC0A 5FZMA 2ATFA 4IL7A 2B45X 4FFFA 5FY9A 5FZ0A 3A23A 1NCRB 1XNTA 2W39A 2XWJB 3MFCA 5C71A 4NVPA 1RUE3 4QMAA 3DEMA 4KBZA 4AEJA 3POSA 2EALA 4IV3B 1IG0A 1SLIA 5HCHA 4BQ1A 5FMOL 3MZHA 3HT1A 2RJLA 5FP4A 5LBBA 2NQYA 3LQCA 5FMCA 4FCAA 4B8EA 2YU2A 1RXFA 1ASJ1 1J1TA 2VTXA 3UL2A 2VZ1A 1QQP2 3VB9A 2XBO3 1J58A 5F2WA 1VPHA 5A32A 4XJZA 1YLLA 1NE6A 1ZZCA 4IESA 1K42A 3ZXEA 1HRV3 3MIFA 4P9XA 3ACHA 4CCKA 3VDDB 1E5HA 4EN9B 2RDQA 2VOXA 2EIBA 3KLSA 1PO13 4N43B 5LASA 3IIAA 5FZ7A 4O7XA 1QJX1 3ASIA 4ZKTB 4FTSA 3LEKA 1QJY1 4DQAA 2DYCA 1Z0HA 5C3PA 1XC6A 2WLQA 3CHXA 5C6CA 2IWGB 4LMFA 4LBLA 4DPNA 1SZBA 3K3NA 1RUG3 4FTEA 1CZVA 4RR3B 3CMGA 2G9GA 1KJRA 2HWD2 3VLBB 2PHUA 3AP7A 3IKWA 1AUYA 4Y33A 4QX0A 2QQUA 5GLVA 1RUJ3 2DTYA 5A7QA 5GZCA 2UYAA 2WFF2 4CCLA 2RMU1 2JB8A 4LBQA 3WF1A 4D0QA 1PVC1 3OEAA 2VL4A 2VULA 1W6PA 4QWNA 1DP0A 3WF4A 3C3VA 3TEXA 3ZYPA 5C8CB 1O5LA 1XE8A 3OF1A 2JX9A 2JG8A 3AL6A 5A3LA 1GV9A 3ZYRA 3ZFFB 2VQAA 3O0VA 2ZGOA 4S2HA 1OUXA 1UIKA 2P37A 5CFDA 2FDKA 2E6VA 5C3QA 4H55A 3VN4A 4NIGA 2RS13 3I3QA 4OHZA 3S5QA 2J1TA 3ZSJA 1SBFA 4QPGA 4CDQA 4RYDA 5E88A 3GZAA 1RUE1 2KD7A 2VECA 3LA2A 3V64A 5TSWA 4KWUA 1GBGA 4Q0UA 1REEA 2UWAA 1H1IA 3I59A 3V65A 5FZEA 4Z2AA 5FYHA 2XWBB 1HV1A 1GFF2 3RZJA 2WL1A 3ZVXA 3GF6A 4X6QB 2XBO1 4E2GA 4HVOA 4MUVA 1HRV1 5JUVA 2CSGA 2PMWB 3IM0A 1VAMA 2YZ4A 3LZZA 4K1YA 1UY3A 1VE0A 3OSDA 1ULDA 3E5QA 3I8TA 1PO11 4XFFA 4D6SA 3ME2A 3MGUA 5DUXA 5FY1A 3RRDA 1JUHA 2E7QA 2PAMA 3D0SA 3F95A 1V9U3 3R4SA 4GB32 2D5HA 3MUZ1 4HT1T 5A3WA 5JSPA 1RUG1 1M4WA 2R1BA 3T2QA 4BQ5A 3CJIC 5IVVA 3LCPA 4NPRA 3ZPOA 3POGA 4JHTA 4PBOA 1QJX2 3SH5A 1RUJ1 4E27A 3BOWA 2RDNA 1HX6A 2WNVA 1T2XA 4RD7A 2GN3A 2Y64A 5K8SA 1PNGA 2ZABA 4HFSA 1ND2C 5IUQA 3N9OA 4NIAA 1N3OA 3HOBA 1F8VA 1OI6A 4WM7B 3TYJA 2ZZQA 3MFAA 3OUIA 4GULA 4N53A 5DAVA 3D0JA 2RMU2 2HEWF 1REFA 3S30A 3ABZA 5BXXA 1PVC2 3VBHB 3EMRA 1B09A 2GP3A 3CIHA 3OGGA 4MOAA 4WM8A 1AXYA 2RS11 2D6OX 2E26A 2HWB3 1QJZA 4CE8A 1JODA 3IBMA 1R1ZA 2AC1A 1JZ7A 2YBKA 5DDJ3 2JWPA 3AK0A 3KV5A 2W1UA 3M3CA 4XFBA 5A33B 2HWF3 2EIGA 1S2BA 1GWLA 1UY4A 4XDPA 1Q3EA 2OZJA 1JZ6A 4BLIA 3OPZA 1VMFA 5FYCA 5JLVA 5JXIA 3D8CA 4MXWB 3VKFC 4EN6B 2PHDA 2NMNA 1BMV1 1NQJA 1YIFA 2EICA 3SEEA 5A1AA 4LULA 3JQWA 4GJYA 4LOTA 5FZ9A 1H4HA 4K7JA 4Y20A 2C4XA 4LA2A 1CAWB 2WSUA 2W87A 3K4ZA 5LA0A 1EYBA 4DRRA 1B35C 4ZU7A 4YGEA 2X8KA 4BQ4A 4AQ6A 2CDOA 5FFOC 2NPIA 4GWNA 4CU6A 5IK8A 5C4WB 5CVRA 3H8OA 3OBZA 5I8TA 1V9U1 3ZKYA 2JD4A 5FR3A 2HJIA 2O1QA 2JDPA 1JZ5A 3MIHA 2ARBA 1DGRN 1ONAA 4CSWA 3SXWA 1VBD2 4BHPA 4HXCA 1PO12 1YJKA 5DAWA 2G4IA 1HB4A 4CP2A 3JCIA 1FV2A 1YUDA 3VBOB 4LBKA 1FI2A 3MUY1 2AGSA 4H3WA 3VZKA 5FCCA 3I2GA 2FZ2A 3AM2A 5FOJB 1NZCA 4MHUA 2I45A 4URTA 5C9AB 4XQ4A 5A6QA 3W59A 4W4ZA 5JWPA 1SPPA 1RUG2 1UZYA 4L11A 4LR4A 2WNUC 4A44A 3H7YA 4E4HA 4HL0A 1RUJ2 2QQNA 3OGRA 1WCQA 4YVSB 4AVTA 2YFZA 2PHFA 1HV0A 1RJ7A 5JCTA 1H1AA 2I2SA 2RE9A 4YG3A 4JAAA 1GOGA 1FT9A 4MV2A 2HWB1 3ROUA 4BYYA 1NLSA 3OY8B 2JKBA 4R9CA 1HQLA 1SBDA 2K0GA 5DDJ1 5J48A 1ZA4A 5G04L 4QB6A 1DGWA 3D3AA 2HWF1 2J1VA 5GLWA 2BZDA 4FP3A 4Y5TA 2E33A 2X5IC 3K4DA 4QDQA 5GLUA 4Z1VA 1ACCA 3MW2A 3AX4A 1BEV3 3UKNA 2N7GA 1DYOA 1POQA 1IHMA 4N7UA 4YM2A 4KNCA 3LE0A 4PI2A 4TWTA 2VY0A 3VZJA 4I3PA 4MGIE 2XJQA 4NN0A 5EJ3A 5JPNB 3ZFEA 2QCSB 4I0BA 3E6CC 3B69A 1A8DA 1Y43B 5HCFA 1Y9MA 5CIRA 3JD73 3OOXA 1TNFA 2TUNA 3KS7A 3EJKA 3POFA 2WZEA 3HWJA 1HW5A 1PZ7A 4DUVA 1BMV2 4CUCA 1YFUA 3POBA 2LM3A 5LBCA 4XE9A 3HD8B 2YUEA 1ZVFA 3WOGA 5CBLA 4AEDC 2B5HA 1NYWA 2EAAA 5AFBA 2WT0A 5JAXA 3A21A 4MO3M 1NUKA 3B9CA 4XBLA 1KRIA 1WCSA 2PXJA 2A73B 2G1MA 4EZHA 3KMHA 3O1TA 3T0AA 4XETA 1J3RA 1RUI3 2G9ZA 4J6GA 4JRLA 1RMU3 4G9SB 4UW6A 3ZFGC 4DB5A 3PVBB 1MS8A 4XZUG 1BLZA 1QJEA 3POEA 2CYFA 5BNPA 2F4PA 3SQOA 1GYKA 1MZEA 1OPOA 4GWJA 1PM7A 2E7AA 3RI8A 1N3QA 1QXPA 3OGSA 2HWE3 1GNYA 2YU1A 3K46A 4XXPA 2OPKA 3I3DA 3PUAA 3ZN6A 3N9PA 2O8QA 4JRAA 1EPZA 2D6PA 2GU9A 3CJXA 1MS3A 4IGOA 1BVP1 4K20A 3IN9A 3C7OA 2Z42A 3SKJE 1DYKA 3ZMNA 4HZFA 2VCMA 5BUVA 1FPN3 4P5YA 1J84A 1VIWB 1OOPC 4MXVA 4UF0A 2XOMA 1DG6A 2Q30A 1CQ9A 2F17A 1BEV1 2HWB2 4UOJA 5DABA 5J96B 4B1LA 2CAVA 2D3RA 1QH7A 3ECQA 5A32B 3VBFC 4CDWA 1SCRA 1ULEA 4HETA 3S5AA 1F9KA 3H7JA 1Q5OA 3Q8FA 3SMHA 1NKGA 3T2OA 1C57A 1K12A 1UOJA 2VD7A 5FWEA 5CKNA 4WVMB 2DUQA 2QQPA 4M3CB 4SLIA 3JD71 4XHXA 3VD7A 2CGOA 1XNDA 1AXZA 3ZXKA 3T08A 4AI2A 1Z78A 2HBUA 1AR63 1ZZ8A 1SCSA 3LPGA 3WP5A 4HSJA 5FY7A 3H3ZA 3J8F2 3O1RA 5DUWA 1OMIA 1PX4A 4ATFA 1KITA 2VNGA 4HSLA 4Q26A 2IFWA 4YZ3A 5K0UC 1AYN2 1CPMA 1C5IA 3ZSMA 2V4AA 4RN5A 4LBQB 4PF1A 3UKTA 1WLCA 4GZ9A 1G7YA 1RUI1 4ZPIA 3KQRA 5T5PA 1RMU1 1WCDJ 3L2HA 1GZ9A 2FHRA 2JICA 3PJQA 4GA9A 1OF3A 5IVCA 3MW3A 1E5IA 3MHZA 3RQ0A 2ZGKA 2IVIB 4CU9A 2BVBA 3M3OA 1DQ0A 2HWE1 4A7KA 5CFDB 3H3LA 3AMQA 2DUOA 2VCAA 2Z4FA 2BNMA 2WNOA 3KT1A 2GDFA 1OHFA 3LEMA 4QPGB 4M0HA 4CDQB 1CGPA 4OCTA 2ZHMA 3C2UA 2C6SA 3KSCA 4AVVA 3ATGA 5CA6A 4P9JA 2PAEA 5IW0A 4KGQA 3N35A 1PGL1 3D6EA 4QGNA 5IHRA 4I01A 1FPN1 4H2AA 5KR7A 2E31A 4W65A 3I59B 4YVWC 1YQ5A 4CCCA 2CV6A 3AZWA 4UFLA 2PQSA 4GWIA 4Y4RA 4YGCA 3Q8BA 1RUNA 3S7EA 2YC0A 1I5PA 3SNMA 1K45A 4FPOB 4BQ3A 4LHNA 1ZRFA 5IK7A 2P6CA 5DZEA 3SCGA 3UNPA 2AEZA 1SHWB 2Z69A 1RVF3 2V73A 2W91A 4LBNA 5CU1A 1JOPA 5FYIA 4AEMA 1CAUB 3AP5A 1XYOA 2JDMA 1BEV2 2XONA 3BOPA 2MNGA 2VOVA 2D6MA 1AR61 4FP2A 1XYNA 3ITQA 1Y4WA 5F5CA 5I93A 4FI9A 1S0GA 5LK7B 4NIDA 4IEZA 3NV2A 1LHVA 3I2HA 4JTOA 3AVSA 1WA4A 4KWLA 1YC61 5HV4A 1W8FA 3O12A 5J98B 2DBNA 1F4AA 4CDUA 2JG9C 3JD72 5JDBA 1RINA 2WNVB 4V2VA 2ET7A 4DY3A 4EZ4A 3JB4C 2J1RA 1TME3 4Q0VA 5H9PA 3N7JA 2B42B 2YC2A 2XPJA 1O8SA 3I7DA 1HN1A 4YARA 1WW6A 4XFIA 2BOIA 3LWCA 2QDNA 3AXDA 1WW4A 1Y7BA 1W2OA 2NZ9A 4N53B 1OQDA 3CO2A 4EYUA 1BBT3 2QQWA 5I0SA 3J7HA 1EPWA 3DPRC 1JZ3A 1G9AA 1NCQA 2D6LX 1XPWA 1NCRC 2W92A 1JYNA 3OBRA 2HEYF 1QHDA 2UY9A 4W6WA 4WM8B 3FLTA 1UAIA 2JJ6A 2XDVA 2VBDA 3U37A 4IV3C 4YM3A 4E8DA 2NP0A 2BOJA 5FZIA 4ARYA 3LPFA 4EV0A 2VQTA 4WV8A 3FHAA 2RS33 4JDMA 3ZKUA 1HQWA 3UV9A 1LU2A 5F1RA 3KF3A 5A3UA 3AZVA 4NIHA 1GP5A 2G9FA 4CXYA 1CZSA 2GMPA 2RVAA 1DQ5A 5FP8A 1X50A 4P9GA 2R0HA 1RIRA 3TEYA 2WN2A 4XTMA 4AFBA 1GP6A 5E8AA 1QU0A 1O59A 1WZXA 3UT0A 3DKWA 4D7SA 5DAQA 1W8NA 3VDDC 4QPIB 1D0GA 1XNAA 2Y6FA 3KCCA 4N43C 2VUJA 4Y20B 3WV6A 1E5RA 3JB8A 1RVF1 4E4ZA 4FPYA 1L7LA 3ACFA 3FHQA 4NO4A 4CRQA 2C26A 2VUAA 2OZ6A 1DIWA 2FBEA 1W8HA 3OCPA 2TBVA 3SHRA 3H42B 3IT8A 1VBA2 4XW3A 5C5UA 4LBOA 2W1SA 5BNNA 3FN9A 5FY8A 2VJXA 3OUHA 3HN3A 4LO4B 5L73A 2D6KA 4FQ4A 2VZVA 2R1DA 2IXLA 4MX3A 3PUSA 4JVAA 5F5QA 3TRSB 2E51A 3I54A 1UYZA 3ENRA 5D8AC 4IEOA 3HEIA 1QNWA 1TME1 3U75A 4B4QA 5BNOC 3ZYFA 3MV01 2AH2A 4TLFA 2GP5A 3RZHA 1SPPB 5BV6A 4XF0A 2DDUA 5DN2A 4OHVA 1YQCA 1H9PA 1BBT1 1COV3 3CF6E 4AHXA 4DY5A 2GH8A 3VBSC 4CEWB 4GH4A 1UU6A 1WBLA 1ZNPA 4FPLA 1SLBA 4NRPA 2HWD3 2O0OA 2TEPA 4L8QA 5FY5A 1ULPA 4A45A 4AHWA 4J1WA 4LXLA 1GOFA 1UKGA 2J22A 3OUJA 2GH2A 3CQOA 5FLJA 4AI3A 2RS31 3KWVA 1F35A 3NV3A 2SLIA 3NJZA 3IDAA 1J1LA 2WO2A 4ORFA 2K2SA 4INDA 4LORA 4QX1A 2C9AA 1PHMA 5EP9A 3W21A 1H9WA 4CCMA 1ODNA 2A1XA 2ZEZA 4FO9A 4I09A 3FWEA 1JTZX 5DZGA 4PBPA 4YM1A 3MLLA 5FQ0A 1G9BA 4ZXKA 1MEC3 1ODMA 3WR0A 5FYUA 4LA3A 3ZFEB 2VG9A 3AZZA 4WVZA 2BEOA 1RXGA 3VKLA 2EIDA 1JW6A 4Q8LA 3U07A 3WQ1A 1UOGA 2WQZC 3RYPA 5CAZA 4IEYA 5ABJB 4YLZA 5FYSA 4OI4A 1UYPA 4E2QA 5F6LB 1OLQA 4GKYA 1BQPA 5I0DA 3AP9A 3BN6A 3MEPA 2A70A 1OURA 2BGOA 1LOBA 1W0PA 2AREA 2PYTA 2W52A 2XJVA 2YFUA 3PU8A 4RQPB 2CU5A 4ZS3A 3WF3A 5ACA2 1UU4A 1H8VA 2NYYA 4F7ZA 1ENQA 4CCNA 3AFKA 3LAGA 1FAYA 4CEYB 3MF9A 1SFPA 2ZGSA 4LHLA 1QGLA 2UWCA 3DYPA 4OUEA 3DN7A 2F4LA 3GZUC 3GXUA 4A3ZA 1W03A 1ZX5A 4P9WA 5LA2A 1ZZ6A 1F4HA 2DF7A 2ZMNA 1PK6C 3LIHA 1XSRA 1QJU3 1HRI2 3GM8A 3TN92 4AI1A 1GQHA 2Y6JA 2QQVA 4OFGA 3WZ1A 1K5JA 2PHXA 5BNPB 5I8YA 2HKXA 3ZDSA 3QLQA 3WW1A 4AQTA 4XQWA 3VBHC 1COV1 4DINB 3WINE 3EXUA 2ZEXA 4I02A 4GB33 4XFGA 3RWNA 1BCXA 1H1MA 2ENRA 1TME2 3NMBA 4G3YC 3ZR6A 4XOGA 3Q9OA 3ZN6B 4M3CF 3VL8A 4MGQA 3FBYA 1JYTA 2HWD1 4QPWA 3WXPA 1WLWA 2ID4A 3C7EA 3F2ZA 3HNBM 2IXKA 4COWA 3NNMA 2H0BA 2WUHA 1BBT2 1YYNA 2RDSA 2ET1A 3NO8A 4CDXB 2XLFA 2A7AA 3UJOA 4H7LA 4IV1C 2FDHA 2WT2A 4OYUA 2DVAA 1Q8SA 4UF0B 2Q8EA 4J1XA 1MS4A 4S2FA 1P8JA 2Q1MA 5FZAA 1W6QA 2OIIA 5A1LA 5C3SA 2RR13 2WC2A 5LRRA 2QNKA 1W2AX 1KFXL 5F37A 5IVBA 2WQ4A 5BY5A 4XF4A 4CDWB 1GKBA 1MEC1 3QCWA 4Q4X1 3M3EA 5JZGB 2DVFA 2RS32 1QXJA 1XOYA 5DAXA 4PLNA 2WYFA 3I2KA 1IG3A 5A7WA 2VE1A 5FZHA 3RMYA 4BM8A 4EWAA 5C33A 2W46A 2TNFA 1KJLA 3K3OA 4FXKB 5C4WC 2WO7A 2R16A 5FMOS 5IWFA 3PIGA 5T5LA 3MDPA 1A78A 5B4NA 1REDA 2WWUA 1RJ8A 3O1VA 1FXZA 4XHBA 2VM9A 5EJ1B 3WD5A 1OXCA 3ES4A 3PUHA 3LDRA 4I0AA 3AYAA 1R1A3 1S0BA 3VD5A 3V0AA 3VBOC 4HG6B 5FYVA 4MG2A 3B02A 4AFDA 4BPZA 3ETQA 1GNZA 2QQKA 4GQ7A 3PJYA 2WR9A 1HJGA 1WCUA 4LE3A 1UZWA 3HR9A 1LHWA 1IKPA 5T50A 4YRDA 1W6OA 4ISQA 3HBKA 4CCEA 1RUD2 2ZTNA 1QJU1 4YG6A 3L9JT 2BWCA 1J59A 4QU1A 1WMXA 2ERFA 3UKVA 1NAEA 5FZOB 2QQLA 3CEWA 4IGPA 4M0NA 3WDTA 3WSOA 2VAUA 3MPPG 1QEXA 1TZOA 1RITA 1I9RA 3ZOIA 4GB31 1OQ1A 1LOCA 1SQ4A 2ZA9A 4P9IA 4DXZA 1OH4A 2RDRA 4FXGB 2ILMA 4S2DA 5C5TA 4XMIA 1VBD3 2W47A 3OBTA 3ZMOA 5JIAA 3N9NA 4AYUA 1H4GA 4LO7A 3LKJA 4JKKA 3KM5A 3WCSA 1COV2 1MQTB 5DZFA 1VAKA 4A6SA 4IUGA 2IXIA 3A7QA 3Q8AA 3RZGA 1MZFA 1E57A 2EIEA 2XJUA 3ETPA 2OA2A 3IMMA 1AXKA 1UWWA 1YNAA 4CXWA 4LT5A 5JXJA 2PHLA 2RR11 4A2UA 3ZR5A 3CJIA 1JZ4A 2VO5A 3THDA 4KMQA 3LB9A 3ACLA 3DCQA 3LDKA 4LNVA 2ORZA 5I0UA 4C1WA 1UXXX 1BJQA 3I4IA 4XFCA 1UPSA 4IEWA 2A75A 2Q5TA 2PHWA 4NJ4A 3LGRA 3ZM8A 4I0WB 5A6ZA 1ND2A 3BIEA 3TEWA 5A80A 3GCWA 2VMIA 1AX1A 2KR2A 3VD4A 1POV0 1V6IA 2R6QA 1V6OA 4XC9A 1MEC2 3CKHA 5IVYA 3GBWA 4YPJA 5FMBA 1I5ZA 1R1A1 3FLPA 1W8ZA 3OD0A 3RZKA 4IE4A 1LOEA 4CDUB 4RFT0 2ZX3A 2QZ3A 1Q56A 1RHI2 1U0AA 2ZS6B 2MPFA 3SH3A 1ZZ9A 4CUGA 3CBNA 4F3JA 1DFQA 4DEVA 1LU1A 5KXEA 2VMCA 4FOYA 1NG0A 1GNHA 4XDOA 4DNYA 3BPSA 4YWAA 2DCZA 5T5JA 3HQXA 1FMD2 1DQ6A 3H8UA 1JI6A 2OT7A 4NROA 3U11A 1GZWB 1UY1A 3J7LA 5FY0A 3QBQA 2JE9A 4I3GA 4NRQA 2YBSA 3USSA 3VL9A 1FOD2 1IKQA 1NCQB 1LCLA 2YY1A 2UU8A 2WIIB 5JI9A 4Y3OA 1YQ8A 2D93A 4KU8A 2IFRA 2MEV3 5KHGA 2ZGMA 3T2PA 2D3SA 3ZYGA 1QJU2 1V6MA 1VBD1 3PU3A 4YW6A 5IK5A 2QJVA 3BALA 1B35A 1U5ZA 3OPWA 4LITA 4HPKB 3VBRB 5FPAA 1YXWA 3O1UA 3E6BA 4XF9A 1J3PA 2BNOA 2WAAA 5FZ3A 2VQ0A 4GIQA 3HMYA 3NNJA 2XHNA 4JV4A 4Q4V2 4XDQA 5EXOA 5F39A 2CGNA 2Y26A 2BVVA 3B9IA 3OYWA 5ANNA 4Z2WA 1JYVA 1SDDB 3E1F1 3OPTA 3RZZA 1OF4A 3CZJA 2JE7A 4GMP3 3SEPA 1XU2A 4XCAA 3VD9A 4NR1A 4AI0A 4FVVA 2RR12 1ZBA2 5FLHA 5L9BA 1ND3B 2VNVA 2WNUA 2WRAA 4AK3A 1NA1B 4IE6A 1YRZA 4QQHA 4A7ZA 5FWJA 1W6NB 2VZ3A 3MI8A 2W95A 5BNNB 3GJAA 1KS5A 3KHBA 3K75B 1NX9A 5GJ6A 2OUJA 2R0FA 4LOSA 1LOGA 3ELNA 5FY4A 3KV9A 2BTVC 5FZDA 3BYWA 2V4VA 2EA7A 2BJSA 4HLTA 5K4LA 4AHZA 1DBNA 2VMGA 4CPBD 4UWDA 3H1MA 4NIIA 1EAH2 2RG4A 4AAPA 1W0NA 4NHLA 4OI0A 1R1A2 2X5IA 3MLJA 4JHZA 3AKTA 4PQQA 2QE3A 1X33A 1PGSA 3DXUA 3GGLA 4UBGA 3WDUA 4LO6B 4LUMA 3HT2A 5A1FA 3P3NA 4GH4B 4MGSA 4Q5OA 4CA9A 3C7HA 1LAJA 3J8F3 4ZONA 5F8PA 4Q29A 3JBG2 2MEV1 4GAZA 4JDOA 4KH9A 4NAMA 4EN8B 5J09A 1AYN3 5LEKA 5J3UA 1CJPA 4AHYA 5L7OC 4E4DX 1AR72 2RM23 2ZX2A 5FXVA 2XL9A 3NNLA 4KQ7A 3W5MA 1X9TA 1DF0A 2W5FA 4W6YA 3DXTA 2GMEA 2BGPA 3MICA 3PHMA 5HCBA 1GWMA 3O7OA 1K5MB 1IS5A 4WBBA 2XLGA 2W0XA 3WQ0A 2A3YA 4AEDA 3ST7A 4XIOA 2VVEA 5EFUA 4IE0A 1VP6A 2R042 1DLLA 5FQ0B 1AL0G 3WUCA 2LUWA 1KQRA 1BK0A 4AVBA 4GMP1 1KGYA 2WZPP 3VDCA 5CFCC 3ZXAC 4K3UA 3ZFGA 3LA7A 3AYCA 4QDSA 3LA3A 3HN1A 1HLCA 3PDQA 5CEHA 1YO8A 5JPMB 3ZYJB 2QQOA 2NLRA 2HLEA 4DUWA 4H7MA 2WT1A 2IVJA 2Y8KA 1DZQA 1UMHA 2V5YA 4Y26A 5GZFA 1C8M2 3DKQA 4W8JA 4CP0A 4MGKE 3PUIA 4RS5B 1V70A 3AKSA 1QNYA 4AAXA 3USUA 3B00A 3NJYA 3PL0A 2ZX1A 3ZYBA 4Z07A 3SCFA 3RI9A 5F3GA 3WP4A 2R7EB 3ZXFA 1NLRA 2B39A 4AZZA 4AG4A 1D0HA 1F31A 2W68A 4MZUA 2EF6A 2VUDA 1OOPA 4D8MA 5A3OA 1ULGA 5F6KA 4UW5A 2QBXA 4QKNA 5C8WA 1UOFA 3P5BA 1EV13 2P34A 3K48A 3S0MA 5K9YA 3I2DA 2OXBA 3VBFA 3J8F1 1XQNA 1W04A 4OQ9A 3WW2A 1WLDA 5LY1A 5D21A 3VKOA 2XHKA 1O3TA 1AYN1 4HK9A 5GKAC 3GNEA 4L2NA 2W1QA 3LSDA 5HXVA 3EHKA 4JCKA 4QX3A 1GUIA 4AI8A 2RM21 3ZXLA 4EROA 4JGZB 4YYOA 1V6JA 4EN7B 4AE2A 1U5XA 3PIJA 1SLAA 4BXSV 2Q1ZB 3AMMA 2MEV2 3M2MA 3M8LA 1FATA 2Y0OA 4EJRA 1J3QA 3PNAA 4LKFA 4QPIC 3R6SA 3CZUA 4RGGA 5KHJA 3PLQA 5K0UA 4AFCA 5EHDA 4O9GA 3HNMA 2Y33A 2ZX0A 4XACA 3ZN5A 1M06G 5A7WB 3T3YA 3MLKA 4W6XA 3URFA 4NE9A 2E63A 4CPBA 2BGCA 1KDMA 3AB0A 1DLCA 2E7TA 2KM2A 2X29A 1VRBA 1C1FA 1CR7A 1KDKA 1OVPA 1TQ5A 1W0OA 4DXSA 5A6YA 3KHCA 4ZHNA 4WZFA 4XCBA 3LIGA 1JOBA 2ZBJA 3V0AB 5LK5A 1XE0A 2ZHLA 4I30A 2FCTA 5EYXA 1YJLA 5LA9A 4XJ9A 5FJHA 1WMEA 2WABA 1D4M3 3EO6A 3AFGA 3DGTA 3DL3A 3P3PA 4BA6A 1OD3A 3MF6A 3THCA 3WDVA 1W6OB 4PDWC 1YEWA 5M0TA 1OVSA 2VZSA 4BIOA 4YW7A 1WMFA 1QOOA 1QY4A 3T4HB 3RJ2X 1W6MA 3ON7A 1MZ6A 1OA2A 4YVWA 3K77A 4FOVA 4L0PA 4CEWC 5KWRA 1MACA 3WW4A 1ULFA 4UW4A 1EV11 4DS0A 1OBNA 1VBA3 2W9XA 4OLLA 4XAAA 1YQ2A 2NM1A 4N8MA 5A7SA 2P2KA 2D40A 2D44A 1C1LA 5EZWA 5LBFA 1BYHA 5GLZA 4OI2A 2GNTA 2RV9A 3ACIA 3NAPC 2VZQA 4R52A 5F5IA 4XEZA 1N3PA 1UD1A 5FO9B 1QIQA 2XMLA 1MR5A 2A6WA 2R32A 2UURA 1AL23 1PMHX 2GC0A 4K9SA 4FAGA 2ZPXA 3WHUA 3ZDVA 4W50A 4E4SA 1RB8G 3PVNA 5DUVA 1C4RA 4FFIA 5LCWL 5FK7A 4ZZ8A 3CJIB 2CY6A 1CD3G 4JQTA 5FTTC 2FDGA 2Z2SB 2JG9A 4DXRA 4TN7A 5IATA 2RM22 2X05A 3VD3A 4QGLA 1NLQA 2DCKA 1W6PB 3R05A 2VMEA 1GSLA 3VBUC 1QDOA 1VAVA 4YW4A 3UESA 1W9FA 5ABJC 2A6YA 5IVJA 5A3MA 1UNBA 5E6HA 1DZTA 1CONA 1STMA 2JG8B 4G4FA 1RUF2 1TMF2 4IQPA 4IW3A 4P14A 4PCRA 4PIZA 1W05A 5IAVA 4YGBA 4RQPC 5HXMA 5FZ8A 2B46X 2XQRA 1GANA 1H2LA 3CNAA 3DPRA 3FX3A 3UYJA 3HBZA 1NCRA 2YROA 4CEYC 4V2WA 2VZRA 3U78A 1C3HA 4D7YA 1JN2P 3BODA 1H8TC 1SBEA 4IV3A 2I07B 1WCKA 5EYYA 1D4M1 3CDZB 5DAPA 4OQ8A 3H8XA 4HOOA 4YW5A 4ES9A 5JXGA 4YZ5A 2BV4A 1HIXA 2CDPA 3DECA 3A22A 3ILRA 1CAXA 1UY2A 1W99A 4UFJA 2Q1FA 4NUBA 5DG1A 2BPA2 1WMDA 1YQ6A 4KG0A 1GU3A 3MIEA 3IB3A 4Y1YA 3NNFA 2JENA 2HEVF 3HQRA 2Q8CA 2W3JA 4KWJA 2EXHA 3RGBA 4TTGA 4R4ZA 5KXDA 4Q4X3 4IXLA 1JHNA 2VW1A 4JGYC 1VBA1 1MVEA 4YNIA 3J4UH 4QAWA 3WG2A 3ACGA 3VDDA 3VHRA 5T52A 4N43A 5ACA3 2ZX4A 4FOQA 4P02B 3FL7A 1AX0A 4CDXC 5FLIA 4EE2A 1B35B 3POYA 4BK5A 3NKGA 1TEIA 3IDEA 3TWIA 4CZSA 2VCBA 2L9LA 2ZGLA 4COUA 2YBPA 3U0ZA 1Z7S2 3IWZA 3RFRA 1EV12 3T09A 1LB2A 1AL21 4XTPA 3MYXA 4BWOA 4HMZA 1H2NA 1VB2A 1HRI3 3TN93 3C7FA 4Q0QA 1AVBA 3WP3A 2PN5A 1QDCA 2K9ZA 3VHOA 2VH9A 5JZGC 4RHV2 4HK8A 4E9KA 1CPNA 1HQNA 1PZ8A 4JZRA 1ZBE2 1RUC2 2ZAAA 2XJTA 5D8AA 5FMDA 3TBDA 2HBTA 2Y34A 1W39A 4YW2A 4LTAA 4YZ2A 5BNOA 5GM0A 5HBAA 5LB6A 3KGLA 1LRHA 1YIPA 2P5BA 1XNBA 3Q8CA 4GD4A 4QB2A 5LA1A 2E9QA 1VJ2A 5FPVA 2IUWA 5FUPA 3R4UA 2WNUB 5IVEA 2BQPA 2DFBA 1X8EA 4Q0PA 3I49A 1S55A 5B2GB 4JC1A 3VBSA 1AYM3 3OG2A 1R082 5E16A 5GZEA 1S0DA 1SLTA 1PMJX 2VNRA 3N7KA 1DZRA 2Y6KA 2Z79A 1UZ0A 4K8FA 4QKFA 5ERLA 4AVCA 4QX8A 2C9KA 1Q43A 4QXHA 3O0WA 1H30A 3OGJA 2OW4A 3H1WA 2HWC3 3WNMA 5DUUA 4UW3A 4RGAA 4FPKA 5DXDA 3RS6A 3JZVA 3OTFA 1F15A 2X5IB 4IEVA 3ZN4A 2PAKA 2OKXA 1RC6A 4B4PA 1LOFC 3WEZA 4XVHA 2WAOA 5IT6A 1D4M2 2CWMA 1PO22
chains in the Genus database with same CATH topology
4CA9A 3T30A 1XB9A 5EHDA 1XE0A 2VTXA 1NLQA 1K5JA 4N8MA 2P1BA 2VTXJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CA9 A;  3T30 A;  1XB9 A;  5EHD A;  1XE0 A;  2VTX A;  1NLQ A;  1K5J A;  4N8M A;  2P1B A;  2VTX J; 
#chains in the Genus database with same CATH topology
 2EXJ A;  3WDX A;  2B9V A;  4HVQ A;  3BU7 A;  2UY8 A;  3H9A A;  3UK9 A;  2P1B A;  1W8W A;  1WW7 A;  3G6J B;  3KV4 A;  5ACA 1;  1L3J A;  5I0T A;  1MQT C;  2VVD A;  3AJY A;  4WVW A;  4GAL A;  5DQ0 A;  2RJ2 A;  3FLR A;  3WUD A;  4RR3 C;  1XB9 A;  3SIT A;  5A3P A;  1RUD 3;  1KEX A;  2QQI A;  3KCX A;  2CAU A;  2R07 2;  2VTF A;  1HRI 1;  3GBG A;  1S0F A;  4ONU A;  1BVV A;  4SBV A;  3TN9 1;  4AED B;  5CIS A;  5FPU A;  1WKY A;  1UPI A;  4XUQ A;  3RVH A;  4XF1 A;  3WX5 A;  1LKN A;  1N1V A;  3I3E A;  3NL1 A;  3VGI A;  4QKD A;  4B7E A;  2ZZJ A;  3G7D A;  3ZXJ A;  1AL2 2;  2GC1 A;  5C8C C;  4AFM A;  5E89 A;  1WW5 A;  2ZML A;  2Q8D A;  3ZX7 A;  1D4V B;  3ZFG B;  4CVU A;  1PK6 A;  4M4P A;  4FFG A;  5CYY A;  3ZFF C;  1F5F A;  2VU9 A;  4NPL A;  2P3J A;  1TE1 B;  4PJY A;  5JOZ A;  3ZXG A;  3B93 A;  3T1M A;  4K6B A;  2WSV A;  3VBH A;  2P3I A;  3KV6 A;  3OEB A;  1AYM 1;  2Y60 A;  2X09 A;  1C28 A;  3WF0 A;  5IFT A;  2D97 A;  5CNA A;  3J26 N;  4L9B A;  2DTW A;  2GC3 A;  3BTA A;  5F7U A;  2VOW A;  1S1A A;  5IFP A;  2DUR A;  1PGW 2;  1CVN A;  1T6G C;  3QOP A;  1GMM A;  3DYM A;  4KL1 A;  5G05 L;  2HWC 1;  4IV1 A;  4XUT A;  5FXX A;  4PT6 A;  1SLC A;  3M3I A;  5FYM A;  5C3O A;  3U10 A;  4ATE A;  2ZGP A;  1VAL A;  2XKO A;  2HYX A;  4C1X A;  3VDB A;  4X6R B;  5FOB B;  3NKT A;  4Q2F A;  1O3S A;  4AXO A;  4BOW A;  4DMI A;  3VBF B;  3WF2 A;  1CAW A;  1Y9Q A;  5GLT A;  1PNF A;  1VBE 2;  2E32 A;  1ENX A;  1S0E A;  3VZL A;  1R64 A;  4I2O A;  3VBR C;  3RYK A;  3U14 A;  2BER A;  3POI A;  5C4W A;  3SIS A;  1RHI 3;  1KD7 A;  1D7P M;  1HB3 A;  2P17 A;  4FFH A;  4Z92 B;  1UKR A;  1CAV A;  5KXC A;  3EYP A;  4Q4X 2;  5DPN A;  2OPW A;  2Z5W A;  2YHJ A;  5I91 A;  1XU1 A;  3TNP B;  1IOA A;  1RUD 1;  3ES1 A;  3LD8 A;  4HBN A;  4O61 A;  4BJ0 A;  3TEZ A;  1A8M A;  3Q8E A;  2RS5 3;  3FJS A;  1XXN A;  3IDB B;  1FMD 3;  2AYH A;  5F9T A;  2CHH A;  4UFH A;  4KU7 A;  3VBO A;  5FZC A;  2LRO A;  1FOD 3;  4M01 A;  1W9W A;  1D2Q A;  4LKS A;  4WM7 C;  1ND3 C;  3VZO A;  1MS0 A;  1NA1 C;  2AEN A;  1IPS A;  2BUK A;  4U36 A;  4R9A A;  1BXH A;  4A42 A;  1MZ5 A;  3H0O A;  4PLO A;  4Q4Y 3;  1O91 A;  4MGT A;  5EWS A;  5FP3 A;  5AC9 3;  3I2I A;  2R06 2;  3MIG A;  1S0I A;  1YFY A;  4M4R A;  1MVQ A;  1WLT A;  2IC1 A;  3OY8 A;  1BKZ A;  4KBB A;  4NOT A;  4HKW A;  4Q4V 3;  4JDN A;  5CAD A;  1H0B A;  5FIX A;  5A6X A;  3U4X A;  3B94 A;  1TG7 A;  3ZLI A;  1OUS A;  5FV3 A;  1HDK A;  4FPJ A;  1AYM 2;  1I6X A;  2VMH A;  1BHG A;  4PIY A;  4Y5Z 0;  1VBC 2;  1W6M B;  4MVT A;  1IPK A;  3AMN A;  2ZGT A;  4ISR A;  4LJH A;  3K51 A;  1JU4 A;  4K8R B;  4KI5 M;  1ZBA 3;  1BZW A;  3O1M A;  4QXK A;  5APA A;  5L36 A;  4XJW A;  1RUO A;  1S2E A;  4Y22 A;  4ZXE A;  3IMN A;  4IE5 A;  2DVG A;  3KVA A;  4QX2 A;  1JOJ A;  2WS9 3;  1LED A;  2HWC 2;  2DU0 A;  1LNS A;  3O0X A;  1LJ7 A;  1ULC A;  4COV A;  3B7M A;  5JMO A;  1KFU L;  5FZF A;  1RHI 1;  5JI7 A;  5L9R A;  3BU0 A;  4C0B A;  5FKB A;  3QH7 A;  2QUO A;  1K5M C;  2XG3 A;  4OMC A;  3ILF A;  4A3X A;  2GND A;  1EAH 3;  3WY6 A;  1QWR A;  3I2O A;  2XH6 A;  4L99 A;  2GC2 A;  2DU1 A;  1EY2 A;  2XVK A;  1UOB A;  1GQG A;  2RS5 1;  2B7Y A;  1FMD 1;  5JIU A;  2VW2 A;  1ZRD A;  5SV5 A;  1FOD 1;  2JG9 B;  1OLR A;  3J9S A;  4M3C E;  4Y1X A;  4COY A;  3AKR A;  5C9A C;  1W28 A;  4FPE A;  4CTE A;  3I2J A;  1PVX A;  4QQ2 A;  4V1P A;  4AGG A;  4K40 A;  4BMB A;  3JBG 3;  5FZ4 A;  4D7T A;  2LTN A;  4E2S A;  4YVS C;  2W94 A;  4KWK A;  4Q1P A;  4JKL A;  1OD5 A;  3N4M A;  4XQD A;  1O4Y A;  1AR7 3;  4Q4Y 1;  3ZIX A;  1L7Q A;  4XMA A;  2C24 A;  2YYO A;  3J7M A;  3X29 B;  5J37 A;  3DPR B;  4HN1 A;  1OFN A;  4RS5 C;  5AC9 1;  1W9T A;  2B4K A;  1OA4 A;  5ANQ A;  1Y3T A;  5FDB A;  2P4E A;  5KHI A;  3M1H A;  4Q4V 1;  2BP6 A;  1W8T A;  4IEQ A;  2R04 3;  4RSU A;  4AEK A;  5A7O A;  2SBA A;  4DFS A;  3C8X A;  2B9U A;  3JU9 A;  3WG4 A;  1CAX B;  4S2G A;  2LS6 A;  1GOH A;  3W5N A;  1XYP A;  1G6N A;  3RPQ A;  2D7F A;  3HAG A;  4UBH A;  3VKM A;  1GLH A;  3N9M A;  3PME A;  2Y6L A;  1IS4 A;  1NE4 A;  1ZBA 1;  4Q4W 3;  3R0R A;  4XBQ A;  2J1U A;  4LLF A;  2QZ2 A;  3OBA A;  1AJO A;  4A4A A;  1X82 A;  2GSY A;  2XJR A;  3SH4 A;  5A7N A;  2WS9 1;  4WVM A;  1OLM E;  1UXZ A;  4M3C A;  1CX4 A;  3OGV A;  1C8M 3;  1OT5 A;  1AR9 3;  4JGZ C;  5FPZ A;  5K7P A;  2GAU A;  2FDF A;  1CJD A;  1JZ8 A;  4QB1 A;  2V5D A;  1EAH 1;  4CCO A;  4XIK A;  1SDW A;  2VXR A;  4LHK A;  1OA3 A;  1PIV 2;  3BTZ A;  1XE7 A;  4R9B A;  4TXW A;  3KVB A;  3AXE A;  2ETE A;  3UGF A;  1SMV A;  3RZM A;  4NRM A;  5FYY A;  3WG3 A;  5C7G A;  5D8A B;  1C8N A;  1FNZ A;  3NJV A;  4ASM B;  3PUR A;  5EV7 A;  3BCW A;  5JR7 B;  5BNO B;  3JBG 1;  1VRH 3;  1V6K A;  3TOJ A;  1JYX A;  2VXJ A;  3WNX A;  2RS5 2;  3V56 A;  4XZP A;  4CUB A;  5KHK A;  5HV0 A;  1HB2 A;  2YXS A;  2UYB A;  4OMD A;  1AR7 1;  4D6R A;  2C5D A;  5FZB A;  2ZXQ A;  1ZZB A;  3N36 A;  5GAL A;  3VBS B;  4URA A;  4UFM A;  1WGP A;  2KA3 A;  1WD4 A;  4GMP 0;  1ALY A;  1QH6 A;  2W08 A;  1HN0 A;  1U12 A;  2JIJ A;  2Y38 A;  4J25 A;  1OQE A;  3MID A;  4LHS A;  1G9D A;  4WZC A;  1OLM A;  2R04 1;  2WZR 3;  3BGA A;  1O6U A;  5GZG A;  2JEC A;  5FYZ A;  2A3X A;  4Q4Y 2;  1NY7 2;  3E5U A;  1UQX A;  5L7O A;  1UU5 A;  1JUI A;  4QXC A;  1GZC A;  2CNA A;  5AC9 2;  4QT6 A;  2IXJ A;  2XVL A;  2H6B A;  2A6Z A;  3SCH A;  2GMM A;  2VGD A;  3EBR A;  2CL2 A;  2JIG A;  1POV 3;  2P3K A;  4LO5 B;  4Q4W 1;  2JDH A;  3PVE A;  2A71 A;  2OQ6 A;  2P6H A;  2RJK A;  4P9L A;  4OUS A;  4YG0 A;  3CU7 A;  1VBB 3;  2PHR A;  3LFM A;  1LOD A;  4LBM A;  1ASJ 2;  3H1Y A;  1C8M 1;  1CAU A;  3IPV A;  3WW3 A;  5E1R A;  5LAT A;  1AR9 1;  2XXZ A;  5CFC A;  1L7R A;  1LES A;  4K21 A;  3W20 A;  4YM0 A;  3NV4 A;  2VCC A;  4RFR B;  4UFK A;  3ZPY A;  4CP9 A;  3E97 A;  5JOX A;  1ENS A;  2F6B A;  1N47 A;  5T3N A;  1S0J A;  2WS9 2;  2VMD A;  1K3I A;  3BB6 A;  2VOT A;  3BIW E;  2G19 A;  2ZKN A;  4ITC A;  4JX0 A;  3AL5 A;  4MSV A;  4BIF A;  1QJY 2;  5ISL A;  4CUA A;  2ZGR A;  4AQ2 A;  3WQB A;  1FYU A;  1RGS A;  2AZ5 A;  2J42 A;  2KXL A;  2XQX A;  4FAH A;  2DFC A;  3OD4 A;  1UMI A;  1URX A;  4DEQ A;  4PQ9 A;  4C90 A;  4YGD A;  1ENR A;  1VRH 1;  2JG8 C;  5C3R A;  1PK6 B;  2WKK A;  1GIC A;  2QTW B;  3PVO A;  4XIL A;  3RJR A;  2FMY A;  2VQU A;  4R9D A;  4XUR A;  5C70 A;  5CFD C;  2BWA A;  4QX7 A;  2W2I A;  1JXN A;  4PLM A;  2VW0 A;  1MS9 A;  1OC1 A;  4XBN A;  4XPV A;  2Q0A A;  1DGW X;  4OZO A;  4DOU A;  5L9V A;  4CDQ C;  4QPG C;  4DO0 A;  3AZY A;  5FO8 B;  1H2M A;  2JD9 A;  2QKD A;  2JDA A;  1YHF A;  4H14 A;  4NPM A;  4QDR A;  3KD4 A;  4Z8B A;  3BI3 A;  1X9P A;  3A0N A;  2NN8 A;  2WZR 1;  1LEC A;  1QOT A;  3DV8 A;  4LEJ A;  4FPH A;  5FZ1 A;  1G86 A;  1NQD A;  2BRT A;  4HVR A;  4MH0 E;  4Q27 A;  5A70 A;  1UN1 A;  2OVU A;  3CLP A;  4MLO A;  1UIJ A;  4IV1 B;  4LK6 A;  1I1E A;  4NWW A;  4IDZ A;  4XFA A;  4KG8 A;  1Q8V A;  4UT5 A;  3S7I A;  1QJF A;  2XGX A;  1LHN A;  1VMJ A;  3OJB A;  3M70 A;  3NNG A;  1RUE 2;  1POV 1;  3P1I A;  1SLL A;  3WNK A;  1RUF 3;  1TMF 3;  3VZN A;  4QPI A;  1RUH 3;  2WWJ A;  5L19 A;  5FPL A;  1VBB 1;  3N9Q A;  3E6D A;  1G9C A;  3LEI A;  1W3V A;  5FZL A;  3WLU A;  4UYB A;  4D69 A;  4N9I A;  2JDK A;  4P08 A;  4XUN A;  5CKM A;  1W2T A;  3WQ7 A;  2D43 A;  1LGC A;  1O7F A;  4MYE A;  4E8C A;  1XNC A;  3NRU A;  2XBO 2;  4Q4W 2;  4BH9 A;  1CAV B;  1QXR A;  2JKX A;  1HRV 2;  2EXI A;  4WVV A;  3WVJ A;  1JYC A;  1UO9 A;  4B3N A;  2ZOE B;  1UZV A;  1GZT A;  3WT3 A;  2ADE A;  2DCT A;  4IGQ A;  2VUC A;  2JDY A;  2WNV C;  1AZD A;  1AR8 3;  2VOK A;  4CYD A;  2DCJ A;  4TZD A;  1AR9 2;  5FYT A;  4AF9 A;  4UAP A;  1HXS 3;  2V09 A;  2ZEW A;  4Y1U A;  3U1X A;  5KC5 A;  1XJA A;  3QD6 A;  1MS5 A;  1CES A;  4Q8K A;  5LWB A;  3TB0 A;  1PM4 A;  3W9A A;  5B4X A;  4BQX A;  4N53 C;  2QVS B;  3GZT B;  4PDW A;  4C8D A;  1UYX A;  2OYZ A;  3O1O A;  2X10 A;  2VPV A;  2VMF A;  4EWD A;  4D94 A;  3ZSL A;  3ALQ A;  5AVP A;  5FBZ A;  3T30 A;  4XUP A;  4Y1V A;  4BQY A;  4Z82 A;  3RNS A;  3VDA A;  1DQ4 A;  2PLV 3;  3FHI B;  1Z7S 3;  4NHK A;  4CEW A;  4WM8 C;  3A4U A;  4FPG A;  2A5Z A;  1ST8 A;  4RL7 A;  1MPX A;  3N9L A;  4QD2 A;  2Q4S A;  3AP4 A;  3CL1 A;  1PMI A;  1VRH 2;  3HNY M;  1CWP A;  1MS1 A;  4QPY A;  4AWD A;  3QH6 A;  3NJX A;  1V6N A;  3RDI A;  3S6P A;  4FTB A;  5IJR A;  4RHV 3;  3J7N A;  2XJS A;  3N7L A;  3NAP A;  3WDW A;  5EIY B;  3VV1 A;  2QFE A;  1ZBE 3;  4CCJ A;  1RUC 3;  2JXA A;  3QAC A;  3WNO A;  1H6Y A;  1X36 A;  2RS1 2;  2YC4 A;  3UGH A;  2ORX A;  2HYK A;  2WNE A;  5H9R A;  1W6Q B;  4AGR A;  4UFI A;  3RSJ A;  3D5O A;  1F5J A;  1C5H A;  1RUF 1;  1TMF 1;  2WZR 2;  3JXS A;  4O65 A;  4Y22 B;  1G9F A;  5CB7 A;  3UET A;  1RUH 1;  1W90 A;  4OHW A;  4P9Y A;  4Q1R A;  3VZM A;  4CP1 A;  3ZXD A;  2WA4 A;  1R08 3;  2ARC A;  1UF2 C;  4DUX A;  2A3W A;  3H8R A;  2CTV A;  3C7G A;  3P6B A;  4LKE A;  3VBU A;  1ZZ7 A;  1W9Y A;  2A6X A;  5ABJ A;  4QU2 A;  2VBB A;  2DCY A;  3III A;  2AEY A;  2XR4 A;  2GNB A;  4HKO A;  4MHR A;  2OS2 A;  3WG1 A;  4Y5S A;  5BYN A;  5EPA A;  4IEX A;  3LOI A;  3MV1 1;  1LGB A;  2ARA A;  2D6N A;  2OQ7 A;  2XB6 C;  1HKD A;  3NVC A;  1VBB 2;  4RQP A;  3V0B A;  1WBF A;  2JEM A;  1E5S A;  2GAL A;  1AR8 1;  1TNR A;  5CZK A;  3E5X A;  5GZD A;  2Y0I A;  2PTM A;  4AOC A;  4CEY A;  1HXS 1;  5F2S A;  3WNL A;  5F5A A;  1V9U 2;  2CWS A;  4O9E A;  1H8T A;  1PO2 3;  3HIF A;  4HKL A;  4OUL A;  5A7P A;  3L2Y A;  4NAO A;  2IXC A;  2ZHN A;  3GBF A;  1U5I A;  3MO4 A;  2IZW A;  1N1T A;  3B5L B;  4LLO A;  3AC0 A;  4HAN A;  5I0R A;  3O5S A;  1S2K A;  3I3B A;  5SV8 A;  4Y4Y A;  4EN0 A;  5BPX A;  1ZRE A;  3LDB A;  3K4A A;  2PLV 1;  4BME A;  1Z7S 1;  1NZI A;  4XUO A;  3K2O A;  5DG2 A;  2VZP A;  4BQ2 A;  4NWV A;  5LZ6 A;  4JGY A;  1J83 A;  2R07 3;  4MGZ E;  4JKM A;  4XJA A;  3PMS A;  1SFY A;  4GJZ A;  2B8M A;  5J7M A;  2J1S A;  4QHB A;  5FRE A;  4N7I A;  3VKN A;  4ARX A;  4RHV 1;  5T55 A;  4CDX A;  1YFW A;  1ZBE 1;  1N1Y A;  3VHN A;  2VR4 A;  1RUC 1;  1ZA7 A;  2BW8 A;  3KGZ A;  5I8S A;  1FV3 A;  5IYY A;  5JOW A;  1O3R A;  4L97 A;  4Y1Z A;  4TLG A;  4XF3 A;  2A6V A;  4FQZ A;  2H6C A;  5A3N A;  1LHO A;  4XXA A;  5KHH A;  3RG0 A;  5FXW A;  2VZU A;  2DWR A;  4KGG A;  4IEU A;  4YZ4 A;  5DDJ 2;  3INA A;  3ZFE C;  2WO3 A;  3RZL A;  1VLN A;  5JZG A;  4FPC A;  2DUP A;  2AR6 A;  2XKP A;  2HWF 2;  3DYO A;  4A41 A;  5HCA A;  4BIS A;  3MIB A;  1VR3 A;  5FP7 A;  4D6Q A;  3SLI A;  1R08 1;  4R8H A;  4IE7 A;  2EVX A;  2BBA A;  4XJU A;  4AR2 A;  1HJF A;  3N3H A;  1SEF A;  2W1W A;  1UX7 A;  5IVF A;  1KS4 A;  4JTN A;  1ND2 B;  1US3 A;  5F32 A;  1OFS A;  2BYV E;  3LFI A;  3T2T A;  2XJP A;  4UI9 L;  4A6O A;  3BUC A;  1UMZ A;  1AF9 A;  3I97 A;  1RUH 2;  4LUK A;  4QKB A;  2ZGU A;  3ZSK A;  1HB1 A;  2AUY A;  1RTV A;  4CXX A;  5DMY A;  1O8P A;  4BLJ A;  1RYY A;  4P00 B;  4AW7 A;  5J36 A;  2XUM A;  1YI7 A;  5JMC A;  2VTX J;  1S4C A;  5FKC A;  4AVS A;  4BDV B;  1OPM A;  4BXF A;  2JDN A;  3O1S A;  5FUI A;  1GWK A;  1JHJ A;  1NXM A;  4BB3 A;  3I3M A;  1PO2 1;  1W3X A;  2PEL A;  3KF5 A;  1O5U A;  2ZGN A;  4OHY A;  2C0Z A;  1UZZ A;  2ZGQ A;  5H9Q A;  4FBF A;  5BNP C;  2LRP A;  5JSR A;  4DXT A;  1NXD 1;  1VBE 3;  4M00 A;  4QM9 A;  2ZKL A;  4Y24 A;  1D2S A;  4B29 A;  1XRU A;  3FFQ A;  4MAD A;  3OB8 A;  3HJR A;  4QQP A;  5FZO A;  3WHT A;  1AR8 2;  3SC7 X;  1UL9 A;  3SKV A;  4XAE A;  4QGM A;  1HXS 2;  2JB4 A;  4IEP A;  4RGK A;  5FZK A;  1EUU A;  3WNP A;  1IZ3 A;  1CIY A;  2XL7 A;  2AAC A;  4HN0 A;  2VZO A;  5AVA A;  1LOF A;  1Q8P A;  1W8O A;  1H6X A;  1QKQ A;  4ASK A;  4N90 A;  2FQP A;  2NMO A;  2R07 1;  3APB A;  3FE5 A;  2BNN A;  3IZO A;  1LOA A;  5KBF A;  2VBP A;  5FO7 B;  2GN7 A;  4OZX A;  1LTE A;  2YG0 A;  3MW4 A;  4LBJ A;  1JYI A;  1ULO A;  3GDB A;  3GYD A;  1XSQ A;  1MQT A;  3O1P A;  1CZT A;  3MPB A;  5F3C A;  4AVA A;  2PLV 2;  3T4V A;  2ADD A;  5L7O B;  1QF3 A;  2HH9 A;  2OX0 A;  4QHZ A;  5A3T A;  3POW A;  4RR3 A;  1DDL A;  3T1L A;  5JSO A;  5FP9 A;  4CDW C;  5IK4 A;  3BKZ A;  2LW8 A;  3OYW B;  1APN A;  4BZ4 A;  4NHY A;  4FSJ A;  2FMD A;  2WJS A;  2FDJ A;  4OI1 A;  2Y6H A;  2D3P A;  1PZ9 A;  2Y6G A;  2R06 3;  2WO1 A;  5C8C A;  3IPV B;  3NV1 A;  2GNM A;  4RA0 A;  2WDB A;  4B4R A;  5EQU A;  4AI9 A;  4YSF A;  5CFC B;  2GZW A;  2I74 A;  5LY2 A;  4AGV A;  2FDI A;  1US2 A;  3AKP A;  4XAB A;  3ZFF A;  1DHK B;  2BFU S;  1PGW 1;  4QX5 A;  4CP9 B;  1JU3 A;  2YB7 A;  3KQ4 B;  1H2K A;  3GHN A;  4CU8 A;  4U2A A;  1OKO A;  1VB4 A;  1VBC 3;  3GZE A;  2O8O A;  4PF5 A;  4YZ1 A;  3FFZ A;  1WA6 X;  3KB5 A;  4LQR A;  4CU7 A;  2LAL A;  4L92 A;  3RWK X;  4ZZ5 A;  2R30 A;  3HVD A;  1FX5 A;  1G8W A;  2JE8 A;  3PTY A;  3WP6 A;  4AL9 A;  3D4K A;  5HPO A;  2XLA A;  4YFW A;  1FNY A;  1SG3 A;  2PQQ A;  5HI0 A;  2ZAH A;  3LSE A;  1DGL A;  5JXH A;  5FK8 A;  1VBE 1;  3FUQ A;  3JUU A;  5T54 A;  4IET A;  3WNN A;  4EQV A;  3LF7 A;  3W58 A;  1GZW A;  2BFU L;  2WBK A;  1LEN A;  1ZM1 A;  1Q8O A;  2BDR A;  3FMG A;  2YV8 A;  4LIU A;  5CG8 A;  1LUL A;  5FUN A;  1QOS A;  5BNQ A;  4C0H A;  1RUI 2;  4OVE A;  4ET7 A;  1RMU 2;  3ZYH A;  3NWK A;  4BQW A;  3BPZ A;  1R09 3;  4D3W A;  2VC9 A;  3IDC B;  1IGO A;  4FPF A;  4GWM A;  2O14 A;  5JOY A;  3B01 A;  4HPK A;  3VBR A;  1LGN A;  3JQX A;  1CIW A;  4QHO A;  2HWE 2;  4F83 A;  1KXG A;  2WQ8 A;  3ILN A;  3IAP A;  2JDU A;  2H0V A;  5CKQ A;  2WA3 A;  4LIV A;  3FUO A;  3AYE A;  1UYY A;  3IAQ A;  3S57 A;  1I3H A;  4GKX A;  2VVF A;  3ZYI B;  2CGP A;  3B3Q E;  2VZT A;  5FYB A;  3AZX A;  1DQ1 A;  1DQ2 A;  1TVG A;  4X8P A;  4LO8 A;  3WDY A;  2VNO A;  2WLP A;  4PI0 A;  4LKD A;  1PGL 2;  1A6C A;  2ARX A;  4P5H A;  1FPN 2;  2DBI A;  4AFA A;  1ZRR A;  5F3I A;  1OSG A;  2R06 1;  2Q8O A;  4BK4 A;  5CG9 A;  5FAX A;  4WM7 A;  1X7N A;  2YGM A;  3THT A;  1AHS A;  4QQO A;  5FRA A;  1ND3 A;  3ZIW A;  4NMI A;  1NA1 A;  3I2F A;  1W6N A;  4CCD A;  4F8A A;  4QQL A;  3HPN A;  4ZU5 A;  2UWB A;  1A34 A;  5KC6 A;  1T6B X;  3H3U A;  3EB7 A;  3M4F A;  1U5Y A;  4CDU C;  1X8M A;  1VBC 1;  2V72 A;  3AJZ A;  4LK7 A;  1O4T A;  3GJB A;  1F2N A;  3M3Q A;  1QQP 3;  4ES8 A;  3USU B;  1A3K A;  3UGG A;  1VMH A;  1AR6 2;  5JVV A;  1XBF A;  3D82 A;  5A33 A;  3KCY A;  1N1S A;  1IPJ A;  1JZ2 A;  2PHT A;  4IER A;  1O3Q A;  4PDW B;  4B1M A;  5LEJ A;  1OOP B;  1NCQ C;  4MXW A;  3LOB A;  3BTX A;  1V0A A;  2YMZ A;  1YWK A;  3U4S A;  4ZY9 A;  1V6L A;  4BE3 A;  2C1F A;  3A0K A;  1NOV A;  1DU3 D;  2OUH A;  4TSV A;  3THP A;  4C91 A;  1R09 1;  3VUO A;  1PIV 3;  2WFF 3;  1NT0 A;  3AP6 A;  1WWY A;  3O14 A;  4XFH A;  5F3E A;  3BTY A;  2WFP A;  3N7M A;  3NAP B;  3ZSE A;  1EP0 A;  1IQA A;  1UY0 A;  3DUI A;  1OH3 A;  1W9S A;  5FZG A;  1Q8Q A;  4PHZ A;  2BU9 A;  2P3Y A;  2ZMK A;  5JR2 A;  1K5M A;  2RHP A;  1BK1 A;  1W2U A;  1YI9 A;  2YDE A;  1CX1 A;  2MHF A;  1Y9G A;  2YPD A;  1UW8 A;  2PA7 A;  5IAX A;  3NW4 A;  1AJK A;  3AMH A;  1W8U A;  3KT4 A;  3KT7 A;  5K0U B;  4EWE A;  1GR3 A;  2EXK A;  2D5F A;  5FZ6 A;  1JYW A;  5LRS A;  2R49 A;  3AMP A;  3NST A;  2FZ1 A;  4OHX A;  4TYS A;  4X8N A;  4YW1 A;  5FJK A;  5FXZ A;  5C9A A;  1YFX A;  5LBE A;  1JS9 A;  4LE4 A;  2DV9 A;  1JBC A;  3VBU B;  1W2N A;  3PTR B;  2J1E A;  5D2A A;  1LHU A;  3EQE A;  5D1I A;  4QXB A;  4YFZ A;  2EAK A;  4YVS A;  5FPX A;  4K1Z A;  5BNN C;  4GXL A;  4DRV A;  1W06 A;  5AFE A;  3MBW A;  1JH5 A;  2XVG A;  2DVB A;  4N9H A;  3T0D A;  2YGL A;  1WUV A;  2XUE A;  1RVF 2;  4PIX A;  4AQS A;  5LW9 A;  2QQM A;  3V0B B;  4MGY E;  4LBQ D;  1UCX A;  4OUM A;  2ZCW A;  2J1A A;  3ORJ A;  1WD3 A;  4RS5 A;  2WZ8 A;  1DGR A;  2ZHK A;  2PFW A;  3RYR A;  3NQH A;  4DIQ A;  1UX6 A;  2BBV A;  1QQP 1;  1ZRI A;  1SFN A;  3R4D B;  1H8T B;  4BCU A;  1IS3 A;  4MET A;  1GQP A;  5KXB A;  2ES3 A;  3GCX A;  2ZEY A;  4YW3 A;  3HQU A;  3H50 A;  3LEG A;  4ZU4 A;  1XNK A;  1ASJ 3;  4R4X A;  1EUT A;  3FZ3 A;  4NHM A;  3AVR A;  1RL3 A;  2D98 A;  2J7M A;  3KZ4 C;  4YVW B;  3UJQ A;  5EJZ B;  2ZJC A;  4GH4 C;  3FBM A;  1LEM A;  2ZAC A;  5FBJ A;  1PX3 A;  2JDZ A;  4JGY B;  2FCU A;  5FPB A;  3WCR A;  3VHP A;  4B7K A;  3GAL A;  1PIV 1;  1IS6 A;  1QJX 3;  1GP4 A;  5H9S A;  2K46 A;  1LR5 A;  2WFF 1;  1AX2 A;  3BVC A;  1QJY 3;  2DVD A;  5J1X A;  2FCV A;  3PUQ A;  4QM8 A;  2QQJ A;  4HON A;  4JGZ A;  1CN1 A;  5T5O A;  3TNQ A;  2E53 A;  4BU2 A;  4FOW A;  1DCS A;  2FD8 A;  4FT8 A;  1R09 2;  2IXH A;  4ZS2 A;  2WWS A;  2X53 S;  2RMU 3;  4A7Y A;  2WN3 A;  1OKQ A;  4XJ8 A;  4ASL A;  3AYD A;  1PVC 3;  1S0C A;  1ZYB A;  3DF0 A;  3TAY A;  2QDR A;  1JMU B;  1V00 A;  3RMX A;  1IQD C;  1O4Z A;  4Q0S A;  3AKQ A;  2YPJ A;  3GHM A;  4UXA A;  3ZO0 B;  4COZ A;  1SAC A;  2WYS A;  1DYP A;  3M7A A;  4NHX A;  4XYX A;  1ZRC A;  4DZG A;  3T0B A;  4JQR A;  1QMJ A;  1YCI A;  3POJ A;  4LPL A;  1NY7 1;  2WIN B;  3FC0 A;  5FZM A;  2ATF A;  4IL7 A;  2B45 X;  4FFF A;  5FY9 A;  5FZ0 A;  3A23 A;  1NCR B;  1XNT A;  2W39 A;  2XWJ B;  3MFC A;  5C71 A;  4NVP A;  1RUE 3;  4QMA A;  3DEM A;  4KBZ A;  4AEJ A;  3POS A;  2EAL A;  4IV3 B;  1IG0 A;  1SLI A;  5HCH A;  4BQ1 A;  5FMO L;  3MZH A;  3HT1 A;  2RJL A;  5FP4 A;  5LBB A;  2NQY A;  3LQC A;  5FMC A;  4FCA A;  4B8E A;  2YU2 A;  1RXF A;  1ASJ 1;  1J1T A;  2VTX A;  3UL2 A;  2VZ1 A;  1QQP 2;  3VB9 A;  2XBO 3;  1J58 A;  5F2W A;  1VPH A;  5A32 A;  4XJZ A;  1YLL A;  1NE6 A;  1ZZC A;  4IES A;  1K42 A;  3ZXE A;  1HRV 3;  3MIF A;  4P9X A;  3ACH A;  4CCK A;  3VDD B;  1E5H A;  4EN9 B;  2RDQ A;  2VOX A;  2EIB A;  3KLS A;  1PO1 3;  4N43 B;  5LAS A;  3IIA A;  5FZ7 A;  4O7X A;  1QJX 1;  3ASI A;  4ZKT B;  4FTS A;  3LEK A;  1QJY 1;  4DQA A;  2DYC A;  1Z0H A;  5C3P A;  1XC6 A;  2WLQ A;  3CHX A;  5C6C A;  2IWG B;  4LMF A;  4LBL A;  4DPN A;  1SZB A;  3K3N A;  1RUG 3;  4FTE A;  1CZV A;  4RR3 B;  3CMG A;  2G9G A;  1KJR A;  2HWD 2;  3VLB B;  2PHU A;  3AP7 A;  3IKW A;  1AUY A;  4Y33 A;  4QX0 A;  2QQU A;  5GLV A;  1RUJ 3;  2DTY A;  5A7Q A;  5GZC A;  2UYA A;  2WFF 2;  4CCL A;  2RMU 1;  2JB8 A;  4LBQ A;  3WF1 A;  4D0Q A;  1PVC 1;  3OEA A;  2VL4 A;  2VUL A;  1W6P A;  4QWN A;  1DP0 A;  3WF4 A;  3C3V A;  3TEX A;  3ZYP A;  5C8C B;  1O5L A;  1XE8 A;  3OF1 A;  2JX9 A;  2JG8 A;  3AL6 A;  5A3L A;  1GV9 A;  3ZYR A;  3ZFF B;  2VQA A;  3O0V A;  2ZGO A;  4S2H A;  1OUX A;  1UIK A;  2P37 A;  5CFD A;  2FDK A;  2E6V A;  5C3Q A;  4H55 A;  3VN4 A;  4NIG A;  2RS1 3;  3I3Q A;  4OHZ A;  3S5Q A;  2J1T A;  3ZSJ A;  1SBF A;  4QPG A;  4CDQ A;  4RYD A;  5E88 A;  3GZA A;  1RUE 1;  2KD7 A;  2VEC A;  3LA2 A;  3V64 A;  5TSW A;  4KWU A;  1GBG A;  4Q0U A;  1REE A;  2UWA A;  1H1I A;  3I59 A;  3V65 A;  5FZE A;  4Z2A A;  5FYH A;  2XWB B;  1HV1 A;  1GFF 2;  3RZJ A;  2WL1 A;  3ZVX A;  3GF6 A;  4X6Q B;  2XBO 1;  4E2G A;  4HVO A;  4MUV A;  1HRV 1;  5JUV A;  2CSG A;  2PMW B;  3IM0 A;  1VAM A;  2YZ4 A;  3LZZ A;  4K1Y A;  1UY3 A;  1VE0 A;  3OSD A;  1ULD A;  3E5Q A;  3I8T A;  1PO1 1;  4XFF A;  4D6S A;  3ME2 A;  3MGU A;  5DUX A;  5FY1 A;  3RRD A;  1JUH A;  2E7Q A;  2PAM A;  3D0S A;  3F95 A;  1V9U 3;  3R4S A;  4GB3 2;  2D5H A;  3MUZ 1;  4HT1 T;  5A3W A;  5JSP A;  1RUG 1;  1M4W A;  2R1B A;  3T2Q A;  4BQ5 A;  3CJI C;  5IVV A;  3LCP A;  4NPR A;  3ZPO A;  3POG A;  4JHT A;  4PBO A;  1QJX 2;  3SH5 A;  1RUJ 1;  4E27 A;  3BOW A;  2RDN A;  1HX6 A;  2WNV A;  1T2X A;  4RD7 A;  2GN3 A;  2Y64 A;  5K8S A;  1PNG A;  2ZAB A;  4HFS A;  1ND2 C;  5IUQ A;  3N9O A;  4NIA A;  1N3O A;  3HOB A;  1F8V A;  1OI6 A;  4WM7 B;  3TYJ A;  2ZZQ A;  3MFA A;  3OUI A;  4GUL A;  4N53 A;  5DAV A;  3D0J A;  2RMU 2;  2HEW F;  1REF A;  3S30 A;  3ABZ A;  5BXX A;  1PVC 2;  3VBH B;  3EMR A;  1B09 A;  2GP3 A;  3CIH A;  3OGG A;  4MOA A;  4WM8 A;  1AXY A;  2RS1 1;  2D6O X;  2E26 A;  2HWB 3;  1QJZ A;  4CE8 A;  1JOD A;  3IBM A;  1R1Z A;  2AC1 A;  1JZ7 A;  2YBK A;  5DDJ 3;  2JWP A;  3AK0 A;  3KV5 A;  2W1U A;  3M3C A;  4XFB A;  5A33 B;  2HWF 3;  2EIG A;  1S2B A;  1GWL A;  1UY4 A;  4XDP A;  1Q3E A;  2OZJ A;  1JZ6 A;  4BLI A;  3OPZ A;  1VMF A;  5FYC A;  5JLV A;  5JXI A;  3D8C A;  4MXW B;  3VKF C;  4EN6 B;  2PHD A;  2NMN A;  1BMV 1;  1NQJ A;  1YIF A;  2EIC A;  3SEE A;  5A1A A;  4LUL A;  3JQW A;  4GJY A;  4LOT A;  5FZ9 A;  1H4H A;  4K7J A;  4Y20 A;  2C4X A;  4LA2 A;  1CAW B;  2WSU A;  2W87 A;  3K4Z A;  5LA0 A;  1EYB A;  4DRR A;  1B35 C;  4ZU7 A;  4YGE A;  2X8K A;  4BQ4 A;  4AQ6 A;  2CDO A;  5FFO C;  2NPI A;  4GWN A;  4CU6 A;  5IK8 A;  5C4W B;  5CVR A;  3H8O A;  3OBZ A;  5I8T A;  1V9U 1;  3ZKY A;  2JD4 A;  5FR3 A;  2HJI A;  2O1Q A;  2JDP A;  1JZ5 A;  3MIH A;  2ARB A;  1DGR N;  1ONA A;  4CSW A;  3SXW A;  1VBD 2;  4BHP A;  4HXC A;  1PO1 2;  1YJK A;  5DAW A;  2G4I A;  1HB4 A;  4CP2 A;  3JCI A;  1FV2 A;  1YUD A;  3VBO B;  4LBK A;  1FI2 A;  3MUY 1;  2AGS A;  4H3W A;  3VZK A;  5FCC A;  3I2G A;  2FZ2 A;  3AM2 A;  5FOJ B;  1NZC A;  4MHU A;  2I45 A;  4URT A;  5C9A B;  4XQ4 A;  5A6Q A;  3W59 A;  4W4Z A;  5JWP A;  1SPP A;  1RUG 2;  1UZY A;  4L11 A;  4LR4 A;  2WNU C;  4A44 A;  3H7Y A;  4E4H A;  4HL0 A;  1RUJ 2;  2QQN A;  3OGR A;  1WCQ A;  4YVS B;  4AVT A;  2YFZ A;  2PHF A;  1HV0 A;  1RJ7 A;  5JCT A;  1H1A A;  2I2S A;  2RE9 A;  4YG3 A;  4JAA A;  1GOG A;  1FT9 A;  4MV2 A;  2HWB 1;  3ROU A;  4BYY A;  1NLS A;  3OY8 B;  2JKB A;  4R9C A;  1HQL A;  1SBD A;  2K0G A;  5DDJ 1;  5J48 A;  1ZA4 A;  5G04 L;  4QB6 A;  1DGW A;  3D3A A;  2HWF 1;  2J1V A;  5GLW A;  2BZD A;  4FP3 A;  4Y5T A;  2E33 A;  2X5I C;  3K4D A;  4QDQ A;  5GLU A;  4Z1V A;  1ACC A;  3MW2 A;  3AX4 A;  1BEV 3;  3UKN A;  2N7G A;  1DYO A;  1POQ A;  1IHM A;  4N7U A;  4YM2 A;  4KNC A;  3LE0 A;  4PI2 A;  4TWT A;  2VY0 A;  3VZJ A;  4I3P A;  4MGI E;  2XJQ A;  4NN0 A;  5EJ3 A;  5JPN B;  3ZFE A;  2QCS B;  4I0B A;  3E6C C;  3B69 A;  1A8D A;  1Y43 B;  5HCF A;  1Y9M A;  5CIR A;  3JD7 3;  3OOX A;  1TNF A;  2TUN A;  3KS7 A;  3EJK A;  3POF A;  2WZE A;  3HWJ A;  1HW5 A;  1PZ7 A;  4DUV A;  1BMV 2;  4CUC A;  1YFU A;  3POB A;  2LM3 A;  5LBC A;  4XE9 A;  3HD8 B;  2YUE A;  1ZVF A;  3WOG A;  5CBL A;  4AED C;  2B5H A;  1NYW A;  2EAA A;  5AFB A;  2WT0 A;  5JAX A;  3A21 A;  4MO3 M;  1NUK A;  3B9C A;  4XBL A;  1KRI A;  1WCS A;  2PXJ A;  2A73 B;  2G1M A;  4EZH A;  3KMH A;  3O1T A;  3T0A A;  4XET A;  1J3R A;  1RUI 3;  2G9Z A;  4J6G A;  4JRL A;  1RMU 3;  4G9S B;  4UW6 A;  3ZFG C;  4DB5 A;  3PVB B;  1MS8 A;  4XZU G;  1BLZ A;  1QJE A;  3POE A;  2CYF A;  5BNP A;  2F4P A;  3SQO A;  1GYK A;  1MZE A;  1OPO A;  4GWJ A;  1PM7 A;  2E7A A;  3RI8 A;  1N3Q A;  1QXP A;  3OGS A;  2HWE 3;  1GNY A;  2YU1 A;  3K46 A;  4XXP A;  2OPK A;  3I3D A;  3PUA A;  3ZN6 A;  3N9P A;  2O8Q A;  4JRA A;  1EPZ A;  2D6P A;  2GU9 A;  3CJX A;  1MS3 A;  4IGO A;  1BVP 1;  4K20 A;  3IN9 A;  3C7O A;  2Z42 A;  3SKJ E;  1DYK A;  3ZMN A;  4HZF A;  2VCM A;  5BUV A;  1FPN 3;  4P5Y A;  1J84 A;  1VIW B;  1OOP C;  4MXV A;  4UF0 A;  2XOM A;  1DG6 A;  2Q30 A;  1CQ9 A;  2F17 A;  1BEV 1;  2HWB 2;  4UOJ A;  5DAB A;  5J96 B;  4B1L A;  2CAV A;  2D3R A;  1QH7 A;  3ECQ A;  5A32 B;  3VBF C;  4CDW A;  1SCR A;  1ULE A;  4HET A;  3S5A A;  1F9K A;  3H7J A;  1Q5O A;  3Q8F A;  3SMH A;  1NKG A;  3T2O A;  1C57 A;  1K12 A;  1UOJ A;  2VD7 A;  5FWE A;  5CKN A;  4WVM B;  2DUQ A;  2QQP A;  4M3C B;  4SLI A;  3JD7 1;  4XHX A;  3VD7 A;  2CGO A;  1XND A;  1AXZ A;  3ZXK A;  3T08 A;  4AI2 A;  1Z78 A;  2HBU A;  1AR6 3;  1ZZ8 A;  1SCS A;  3LPG A;  3WP5 A;  4HSJ A;  5FY7 A;  3H3Z A;  3J8F 2;  3O1R A;  5DUW A;  1OMI A;  1PX4 A;  4ATF A;  1KIT A;  2VNG A;  4HSL A;  4Q26 A;  2IFW A;  4YZ3 A;  5K0U C;  1AYN 2;  1CPM A;  1C5I A;  3ZSM A;  2V4A A;  4RN5 A;  4LBQ B;  4PF1 A;  3UKT A;  1WLC A;  4GZ9 A;  1G7Y A;  1RUI 1;  4ZPI A;  3KQR A;  5T5P A;  1RMU 1;  1WCD J;  3L2H A;  1GZ9 A;  2FHR A;  2JIC A;  3PJQ A;  4GA9 A;  1OF3 A;  5IVC A;  3MW3 A;  1E5I A;  3MHZ A;  3RQ0 A;  2ZGK A;  2IVI B;  4CU9 A;  2BVB A;  3M3O A;  1DQ0 A;  2HWE 1;  4A7K A;  5CFD B;  3H3L A;  3AMQ A;  2DUO A;  2VCA A;  2Z4F A;  2BNM A;  2WNO A;  3KT1 A;  2GDF A;  1OHF A;  3LEM A;  4QPG B;  4M0H A;  4CDQ B;  1CGP A;  4OCT A;  2ZHM A;  3C2U A;  2C6S A;  3KSC A;  4AVV A;  3ATG A;  5CA6 A;  4P9J A;  2PAE A;  5IW0 A;  4KGQ A;  3N35 A;  1PGL 1;  3D6E A;  4QGN A;  5IHR A;  4I01 A;  1FPN 1;  4H2A A;  5KR7 A;  2E31 A;  4W65 A;  3I59 B;  4YVW C;  1YQ5 A;  4CCC A;  2CV6 A;  3AZW A;  4UFL A;  2PQS A;  4GWI A;  4Y4R A;  4YGC A;  3Q8B A;  1RUN A;  3S7E A;  2YC0 A;  1I5P A;  3SNM A;  1K45 A;  4FPO B;  4BQ3 A;  4LHN A;  1ZRF A;  5IK7 A;  2P6C A;  5DZE A;  3SCG A;  3UNP A;  2AEZ A;  1SHW B;  2Z69 A;  1RVF 3;  2V73 A;  2W91 A;  4LBN A;  5CU1 A;  1JOP A;  5FYI A;  4AEM A;  1CAU B;  3AP5 A;  1XYO A;  2JDM A;  1BEV 2;  2XON A;  3BOP A;  2MNG A;  2VOV A;  2D6M A;  1AR6 1;  4FP2 A;  1XYN A;  3ITQ A;  1Y4W A;  5F5C A;  5I93 A;  4FI9 A;  1S0G A;  5LK7 B;  4NID A;  4IEZ A;  3NV2 A;  1LHV A;  3I2H A;  4JTO A;  3AVS A;  1WA4 A;  4KWL A;  1YC6 1;  5HV4 A;  1W8F A;  3O12 A;  5J98 B;  2DBN A;  1F4A A;  4CDU A;  2JG9 C;  3JD7 2;  5JDB A;  1RIN A;  2WNV B;  4V2V A;  2ET7 A;  4DY3 A;  4EZ4 A;  3JB4 C;  2J1R A;  1TME 3;  4Q0V A;  5H9P A;  3N7J A;  2B42 B;  2YC2 A;  2XPJ A;  1O8S A;  3I7D A;  1HN1 A;  4YAR A;  1WW6 A;  4XFI A;  2BOI A;  3LWC A;  2QDN A;  3AXD A;  1WW4 A;  1Y7B A;  1W2O A;  2NZ9 A;  4N53 B;  1OQD A;  3CO2 A;  4EYU A;  1BBT 3;  2QQW A;  5I0S A;  3J7H A;  1EPW A;  3DPR C;  1JZ3 A;  1G9A A;  1NCQ A;  2D6L X;  1XPW A;  1NCR C;  2W92 A;  1JYN A;  3OBR A;  2HEY F;  1QHD A;  2UY9 A;  4W6W A;  4WM8 B;  3FLT A;  1UAI A;  2JJ6 A;  2XDV A;  2VBD A;  3U37 A;  4IV3 C;  4YM3 A;  4E8D A;  2NP0 A;  2BOJ A;  5FZI A;  4ARY A;  3LPF A;  4EV0 A;  2VQT A;  4WV8 A;  3FHA A;  2RS3 3;  4JDM A;  3ZKU A;  1HQW A;  3UV9 A;  1LU2 A;  5F1R A;  3KF3 A;  5A3U A;  3AZV A;  4NIH A;  1GP5 A;  2G9F A;  4CXY A;  1CZS A;  2GMP A;  2RVA A;  1DQ5 A;  5FP8 A;  1X50 A;  4P9G A;  2R0H A;  1RIR A;  3TEY A;  2WN2 A;  4XTM A;  4AFB A;  1GP6 A;  5E8A A;  1QU0 A;  1O59 A;  1WZX A;  3UT0 A;  3DKW A;  4D7S A;  5DAQ A;  1W8N A;  3VDD C;  4QPI B;  1D0G A;  1XNA A;  2Y6F A;  3KCC A;  4N43 C;  2VUJ A;  4Y20 B;  3WV6 A;  1E5R A;  3JB8 A;  1RVF 1;  4E4Z A;  4FPY A;  1L7L A;  3ACF A;  3FHQ A;  4NO4 A;  4CRQ A;  2C26 A;  2VUA A;  2OZ6 A;  1DIW A;  2FBE A;  1W8H A;  3OCP A;  2TBV A;  3SHR A;  3H42 B;  3IT8 A;  1VBA 2;  4XW3 A;  5C5U A;  4LBO A;  2W1S A;  5BNN A;  3FN9 A;  5FY8 A;  2VJX A;  3OUH A;  3HN3 A;  4LO4 B;  5L73 A;  2D6K A;  4FQ4 A;  2VZV A;  2R1D A;  2IXL A;  4MX3 A;  3PUS A;  4JVA A;  5F5Q A;  3TRS B;  2E51 A;  3I54 A;  1UYZ A;  3ENR A;  5D8A C;  4IEO A;  3HEI A;  1QNW A;  1TME 1;  3U75 A;  4B4Q A;  5BNO C;  3ZYF A;  3MV0 1;  2AH2 A;  4TLF A;  2GP5 A;  3RZH A;  1SPP B;  5BV6 A;  4XF0 A;  2DDU A;  5DN2 A;  4OHV A;  1YQC A;  1H9P A;  1BBT 1;  1COV 3;  3CF6 E;  4AHX A;  4DY5 A;  2GH8 A;  3VBS C;  4CEW B;  4GH4 A;  1UU6 A;  1WBL A;  1ZNP A;  4FPL A;  1SLB A;  4NRP A;  2HWD 3;  2O0O A;  2TEP A;  4L8Q A;  5FY5 A;  1ULP A;  4A45 A;  4AHW A;  4J1W A;  4LXL A;  1GOF A;  1UKG A;  2J22 A;  3OUJ A;  2GH2 A;  3CQO A;  5FLJ A;  4AI3 A;  2RS3 1;  3KWV A;  1F35 A;  3NV3 A;  2SLI A;  3NJZ A;  3IDA A;  1J1L A;  2WO2 A;  4ORF A;  2K2S A;  4IND A;  4LOR A;  4QX1 A;  2C9A A;  1PHM A;  5EP9 A;  3W21 A;  1H9W A;  4CCM A;  1ODN A;  2A1X A;  2ZEZ A;  4FO9 A;  4I09 A;  3FWE A;  1JTZ X;  5DZG A;  4PBP A;  4YM1 A;  3MLL A;  5FQ0 A;  1G9B A;  4ZXK A;  1MEC 3;  1ODM A;  3WR0 A;  5FYU A;  4LA3 A;  3ZFE B;  2VG9 A;  3AZZ A;  4WVZ A;  2BEO A;  1RXG A;  3VKL A;  2EID A;  1JW6 A;  4Q8L A;  3U07 A;  3WQ1 A;  1UOG A;  2WQZ C;  3RYP A;  5CAZ A;  4IEY A;  5ABJ B;  4YLZ A;  5FYS A;  4OI4 A;  1UYP A;  4E2Q A;  5F6L B;  1OLQ A;  4GKY A;  1BQP A;  5I0D A;  3AP9 A;  3BN6 A;  3MEP A;  2A70 A;  1OUR A;  2BGO A;  1LOB A;  1W0P A;  2ARE A;  2PYT A;  2W52 A;  2XJV A;  2YFU A;  3PU8 A;  4RQP B;  2CU5 A;  4ZS3 A;  3WF3 A;  5ACA 2;  1UU4 A;  1H8V A;  2NYY A;  4F7Z A;  1ENQ A;  4CCN A;  3AFK A;  3LAG A;  1FAY A;  4CEY B;  3MF9 A;  1SFP A;  2ZGS A;  4LHL A;  1QGL A;  2UWC A;  3DYP A;  4OUE A;  3DN7 A;  2F4L A;  3GZU C;  3GXU A;  4A3Z A;  1W03 A;  1ZX5 A;  4P9W A;  5LA2 A;  1ZZ6 A;  1F4H A;  2DF7 A;  2ZMN A;  1PK6 C;  3LIH A;  1XSR A;  1QJU 3;  1HRI 2;  3GM8 A;  3TN9 2;  4AI1 A;  1GQH A;  2Y6J A;  2QQV A;  4OFG A;  3WZ1 A;  1K5J A;  2PHX A;  5BNP B;  5I8Y A;  2HKX A;  3ZDS A;  3QLQ A;  3WW1 A;  4AQT A;  4XQW A;  3VBH C;  1COV 1;  4DIN B;  3WIN E;  3EXU A;  2ZEX A;  4I02 A;  4GB3 3;  4XFG A;  3RWN A;  1BCX A;  1H1M A;  2ENR A;  1TME 2;  3NMB A;  4G3Y C;  3ZR6 A;  4XOG A;  3Q9O A;  3ZN6 B;  4M3C F;  3VL8 A;  4MGQ A;  3FBY A;  1JYT A;  2HWD 1;  4QPW A;  3WXP A;  1WLW A;  2ID4 A;  3C7E A;  3F2Z A;  3HNB M;  2IXK A;  4COW A;  3NNM A;  2H0B A;  2WUH A;  1BBT 2;  1YYN A;  2RDS A;  2ET1 A;  3NO8 A;  4CDX B;  2XLF A;  2A7A A;  3UJO A;  4H7L A;  4IV1 C;  2FDH A;  2WT2 A;  4OYU A;  2DVA A;  1Q8S A;  4UF0 B;  2Q8E A;  4J1X A;  1MS4 A;  4S2F A;  1P8J A;  2Q1M A;  5FZA A;  1W6Q A;  2OII A;  5A1L A;  5C3S A;  2RR1 3;  2WC2 A;  5LRR A;  2QNK A;  1W2A X;  1KFX L;  5F37 A;  5IVB A;  2WQ4 A;  5BY5 A;  4XF4 A;  4CDW B;  1GKB A;  1MEC 1;  3QCW A;  4Q4X 1;  3M3E A;  5JZG B;  2DVF A;  2RS3 2;  1QXJ A;  1XOY A;  5DAX A;  4PLN A;  2WYF A;  3I2K A;  1IG3 A;  5A7W A;  2VE1 A;  5FZH A;  3RMY A;  4BM8 A;  4EWA A;  5C33 A;  2W46 A;  2TNF A;  1KJL A;  3K3O A;  4FXK B;  5C4W C;  2WO7 A;  2R16 A;  5FMO S;  5IWF A;  3PIG A;  5T5L A;  3MDP A;  1A78 A;  5B4N A;  1RED A;  2WWU A;  1RJ8 A;  3O1V A;  1FXZ A;  4XHB A;  2VM9 A;  5EJ1 B;  3WD5 A;  1OXC A;  3ES4 A;  3PUH A;  3LDR A;  4I0A A;  3AYA A;  1R1A 3;  1S0B A;  3VD5 A;  3V0A A;  3VBO C;  4HG6 B;  5FYV A;  4MG2 A;  3B02 A;  4AFD A;  4BPZ A;  3ETQ A;  1GNZ A;  2QQK A;  4GQ7 A;  3PJY A;  2WR9 A;  1HJG A;  1WCU A;  4LE3 A;  1UZW A;  3HR9 A;  1LHW A;  1IKP A;  5T50 A;  4YRD A;  1W6O A;  4ISQ A;  3HBK A;  4CCE A;  1RUD 2;  2ZTN A;  1QJU 1;  4YG6 A;  3L9J T;  2BWC A;  1J59 A;  4QU1 A;  1WMX A;  2ERF A;  3UKV A;  1NAE A;  5FZO B;  2QQL A;  3CEW A;  4IGP A;  4M0N A;  3WDT A;  3WSO A;  2VAU A;  3MPP G;  1QEX A;  1TZO A;  1RIT A;  1I9R A;  3ZOI A;  4GB3 1;  1OQ1 A;  1LOC A;  1SQ4 A;  2ZA9 A;  4P9I A;  4DXZ A;  1OH4 A;  2RDR A;  4FXG B;  2ILM A;  4S2D A;  5C5T A;  4XMI A;  1VBD 3;  2W47 A;  3OBT A;  3ZMO A;  5JIA A;  3N9N A;  4AYU A;  1H4G A;  4LO7 A;  3LKJ A;  4JKK A;  3KM5 A;  3WCS A;  1COV 2;  1MQT B;  5DZF A;  1VAK A;  4A6S A;  4IUG A;  2IXI A;  3A7Q A;  3Q8A A;  3RZG A;  1MZF A;  1E57 A;  2EIE A;  2XJU A;  3ETP A;  2OA2 A;  3IMM A;  1AXK A;  1UWW A;  1YNA A;  4CXW A;  4LT5 A;  5JXJ A;  2PHL A;  2RR1 1;  4A2U A;  3ZR5 A;  3CJI A;  1JZ4 A;  2VO5 A;  3THD A;  4KMQ A;  3LB9 A;  3ACL A;  3DCQ A;  3LDK A;  4LNV A;  2ORZ A;  5I0U A;  4C1W A;  1UXX X;  1BJQ A;  3I4I A;  4XFC A;  1UPS A;  4IEW A;  2A75 A;  2Q5T A;  2PHW A;  4NJ4 A;  3LGR A;  3ZM8 A;  4I0W B;  5A6Z A;  1ND2 A;  3BIE A;  3TEW A;  5A80 A;  3GCW A;  2VMI A;  1AX1 A;  2KR2 A;  3VD4 A;  1POV 0;  1V6I A;  2R6Q A;  1V6O A;  4XC9 A;  1MEC 2;  3CKH A;  5IVY A;  3GBW A;  4YPJ A;  5FMB A;  1I5Z A;  1R1A 1;  3FLP A;  1W8Z A;  3OD0 A;  3RZK A;  4IE4 A;  1LOE A;  4CDU B;  4RFT 0;  2ZX3 A;  2QZ3 A;  1Q56 A;  1RHI 2;  1U0A A;  2ZS6 B;  2MPF A;  3SH3 A;  1ZZ9 A;  4CUG A;  3CBN A;  4F3J A;  1DFQ A;  4DEV A;  1LU1 A;  5KXE A;  2VMC A;  4FOY A;  1NG0 A;  1GNH A;  4XDO A;  4DNY A;  3BPS A;  4YWA A;  2DCZ A;  5T5J A;  3HQX A;  1FMD 2;  1DQ6 A;  3H8U A;  1JI6 A;  2OT7 A;  4NRO A;  3U11 A;  1GZW B;  1UY1 A;  3J7L A;  5FY0 A;  3QBQ A;  2JE9 A;  4I3G A;  4NRQ A;  2YBS A;  3USS A;  3VL9 A;  1FOD 2;  1IKQ A;  1NCQ B;  1LCL A;  2YY1 A;  2UU8 A;  2WII B;  5JI9 A;  4Y3O A;  1YQ8 A;  2D93 A;  4KU8 A;  2IFR A;  2MEV 3;  5KHG A;  2ZGM A;  3T2P A;  2D3S A;  3ZYG A;  1QJU 2;  1V6M A;  1VBD 1;  3PU3 A;  4YW6 A;  5IK5 A;  2QJV A;  3BAL A;  1B35 A;  1U5Z A;  3OPW A;  4LIT A;  4HPK B;  3VBR B;  5FPA A;  1YXW A;  3O1U A;  3E6B A;  4XF9 A;  1J3P A;  2BNO A;  2WAA A;  5FZ3 A;  2VQ0 A;  4GIQ A;  3HMY A;  3NNJ A;  2XHN A;  4JV4 A;  4Q4V 2;  4XDQ A;  5EXO A;  5F39 A;  2CGN A;  2Y26 A;  2BVV A;  3B9I A;  3OYW A;  5ANN A;  4Z2W A;  1JYV A;  1SDD B;  3E1F 1;  3OPT A;  3RZZ A;  1OF4 A;  3CZJ A;  2JE7 A;  4GMP 3;  3SEP A;  1XU2 A;  4XCA A;  3VD9 A;  4NR1 A;  4AI0 A;  4FVV A;  2RR1 2;  1ZBA 2;  5FLH A;  5L9B A;  1ND3 B;  2VNV A;  2WNU A;  2WRA A;  4AK3 A;  1NA1 B;  4IE6 A;  1YRZ A;  4QQH A;  4A7Z A;  5FWJ A;  1W6N B;  2VZ3 A;  3MI8 A;  2W95 A;  5BNN B;  3GJA A;  1KS5 A;  3KHB A;  3K75 B;  1NX9 A;  5GJ6 A;  2OUJ A;  2R0F A;  4LOS A;  1LOG A;  3ELN A;  5FY4 A;  3KV9 A;  2BTV C;  5FZD A;  3BYW A;  2V4V A;  2EA7 A;  2BJS A;  4HLT A;  5K4L A;  4AHZ A;  1DBN A;  2VMG A;  4CPB D;  4UWD A;  3H1M A;  4NII A;  1EAH 2;  2RG4 A;  4AAP A;  1W0N A;  4NHL A;  4OI0 A;  1R1A 2;  2X5I A;  3MLJ A;  4JHZ A;  3AKT A;  4PQQ A;  2QE3 A;  1X33 A;  1PGS A;  3DXU A;  3GGL A;  4UBG A;  3WDU A;  4LO6 B;  4LUM A;  3HT2 A;  5A1F A;  3P3N A;  4GH4 B;  4MGS A;  4Q5O A;  4CA9 A;  3C7H A;  1LAJ A;  3J8F 3;  4ZON A;  5F8P A;  4Q29 A;  3JBG 2;  2MEV 1;  4GAZ A;  4JDO A;  4KH9 A;  4NAM A;  4EN8 B;  5J09 A;  1AYN 3;  5LEK A;  5J3U A;  1CJP A;  4AHY A;  5L7O C;  4E4D X;  1AR7 2;  2RM2 3;  2ZX2 A;  5FXV A;  2XL9 A;  3NNL A;  4KQ7 A;  3W5M A;  1X9T A;  1DF0 A;  2W5F A;  4W6Y A;  3DXT A;  2GME A;  2BGP A;  3MIC A;  3PHM A;  5HCB A;  1GWM A;  3O7O A;  1K5M B;  1IS5 A;  4WBB A;  2XLG A;  2W0X A;  3WQ0 A;  2A3Y A;  4AED A;  3ST7 A;  4XIO A;  2VVE A;  5EFU A;  4IE0 A;  1VP6 A;  2R04 2;  1DLL A;  5FQ0 B;  1AL0 G;  3WUC A;  2LUW A;  1KQR A;  1BK0 A;  4AVB A;  4GMP 1;  1KGY A;  2WZP P;  3VDC A;  5CFC C;  3ZXA C;  4K3U A;  3ZFG A;  3LA7 A;  3AYC A;  4QDS A;  3LA3 A;  3HN1 A;  1HLC A;  3PDQ A;  5CEH A;  1YO8 A;  5JPM B;  3ZYJ B;  2QQO A;  2NLR A;  2HLE A;  4DUW A;  4H7M A;  2WT1 A;  2IVJ A;  2Y8K A;  1DZQ A;  1UMH A;  2V5Y A;  4Y26 A;  5GZF A;  1C8M 2;  3DKQ A;  4W8J A;  4CP0 A;  4MGK E;  3PUI A;  4RS5 B;  1V70 A;  3AKS A;  1QNY A;  4AAX A;  3USU A;  3B00 A;  3NJY A;  3PL0 A;  2ZX1 A;  3ZYB A;  4Z07 A;  3SCF A;  3RI9 A;  5F3G A;  3WP4 A;  2R7E B;  3ZXF A;  1NLR A;  2B39 A;  4AZZ A;  4AG4 A;  1D0H A;  1F31 A;  2W68 A;  4MZU A;  2EF6 A;  2VUD A;  1OOP A;  4D8M A;  5A3O A;  1ULG A;  5F6K A;  4UW5 A;  2QBX A;  4QKN A;  5C8W A;  1UOF A;  3P5B A;  1EV1 3;  2P34 A;  3K48 A;  3S0M A;  5K9Y A;  3I2D A;  2OXB A;  3VBF A;  3J8F 1;  1XQN A;  1W04 A;  4OQ9 A;  3WW2 A;  1WLD A;  5LY1 A;  5D21 A;  3VKO A;  2XHK A;  1O3T A;  1AYN 1;  4HK9 A;  5GKA C;  3GNE A;  4L2N A;  2W1Q A;  3LSD A;  5HXV A;  3EHK A;  4JCK A;  4QX3 A;  1GUI A;  4AI8 A;  2RM2 1;  3ZXL A;  4ERO A;  4JGZ B;  4YYO A;  1V6J A;  4EN7 B;  4AE2 A;  1U5X A;  3PIJ A;  1SLA A;  4BXS V;  2Q1Z B;  3AMM A;  2MEV 2;  3M2M A;  3M8L A;  1FAT A;  2Y0O A;  4EJR A;  1J3Q A;  3PNA A;  4LKF A;  4QPI C;  3R6S A;  3CZU A;  4RGG A;  5KHJ A;  3PLQ A;  5K0U A;  4AFC A;  5EHD A;  4O9G A;  3HNM A;  2Y33 A;  2ZX0 A;  4XAC A;  3ZN5 A;  1M06 G;  5A7W B;  3T3Y A;  3MLK A;  4W6X A;  3URF A;  4NE9 A;  2E63 A;  4CPB A;  2BGC A;  1KDM A;  3AB0 A;  1DLC A;  2E7T A;  2KM2 A;  2X29 A;  1VRB A;  1C1F A;  1CR7 A;  1KDK A;  1OVP A;  1TQ5 A;  1W0O A;  4DXS A;  5A6Y A;  3KHC A;  4ZHN A;  4WZF A;  4XCB A;  3LIG A;  1JOB A;  2ZBJ A;  3V0A B;  5LK5 A;  1XE0 A;  2ZHL A;  4I30 A;  2FCT A;  5EYX A;  1YJL A;  5LA9 A;  4XJ9 A;  5FJH A;  1WME A;  2WAB A;  1D4M 3;  3EO6 A;  3AFG A;  3DGT A;  3DL3 A;  3P3P A;  4BA6 A;  1OD3 A;  3MF6 A;  3THC A;  3WDV A;  1W6O B;  4PDW C;  1YEW A;  5M0T A;  1OVS A;  2VZS A;  4BIO A;  4YW7 A;  1WMF A;  1QOO A;  1QY4 A;  3T4H B;  3RJ2 X;  1W6M A;  3ON7 A;  1MZ6 A;  1OA2 A;  4YVW A;  3K77 A;  4FOV A;  4L0P A;  4CEW C;  5KWR A;  1MAC A;  3WW4 A;  1ULF A;  4UW4 A;  1EV1 1;  4DS0 A;  1OBN A;  1VBA 3;  2W9X A;  4OLL A;  4XAA A;  1YQ2 A;  2NM1 A;  4N8M A;  5A7S A;  2P2K A;  2D40 A;  2D44 A;  1C1L A;  5EZW A;  5LBF A;  1BYH A;  5GLZ A;  4OI2 A;  2GNT A;  2RV9 A;  3ACI A;  3NAP C;  2VZQ A;  4R52 A;  5F5I A;  4XEZ A;  1N3P A;  1UD1 A;  5FO9 B;  1QIQ A;  2XML A;  1MR5 A;  2A6W A;  2R32 A;  2UUR A;  1AL2 3;  1PMH X;  2GC0 A;  4K9S A;  4FAG A;  2ZPX A;  3WHU A;  3ZDV A;  4W50 A;  4E4S A;  1RB8 G;  3PVN A;  5DUV A;  1C4R A;  4FFI A;  5LCW L;  5FK7 A;  4ZZ8 A;  3CJI B;  2CY6 A;  1CD3 G;  4JQT A;  5FTT C;  2FDG A;  2Z2S B;  2JG9 A;  4DXR A;  4TN7 A;  5IAT A;  2RM2 2;  2X05 A;  3VD3 A;  4QGL A;  1NLQ A;  2DCK A;  1W6P B;  3R05 A;  2VME A;  1GSL A;  3VBU C;  1QDO A;  1VAV A;  4YW4 A;  3UES A;  1W9F A;  5ABJ C;  2A6Y A;  5IVJ A;  5A3M A;  1UNB A;  5E6H A;  1DZT A;  1CON A;  1STM A;  2JG8 B;  4G4F A;  1RUF 2;  1TMF 2;  4IQP A;  4IW3 A;  4P14 A;  4PCR A;  4PIZ A;  1W05 A;  5IAV A;  4YGB A;  4RQP C;  5HXM A;  5FZ8 A;  2B46 X;  2XQR A;  1GAN A;  1H2L A;  3CNA A;  3DPR A;  3FX3 A;  3UYJ A;  3HBZ A;  1NCR A;  2YRO A;  4CEY C;  4V2W A;  2VZR A;  3U78 A;  1C3H A;  4D7Y A;  1JN2 P;  3BOD A;  1H8T C;  1SBE A;  4IV3 A;  2I07 B;  1WCK A;  5EYY A;  1D4M 1;  3CDZ B;  5DAP A;  4OQ8 A;  3H8X A;  4HOO A;  4YW5 A;  4ES9 A;  5JXG A;  4YZ5 A;  2BV4 A;  1HIX A;  2CDP A;  3DEC A;  3A22 A;  3ILR A;  1CAX A;  1UY2 A;  1W99 A;  4UFJ A;  2Q1F A;  4NUB A;  5DG1 A;  2BPA 2;  1WMD A;  1YQ6 A;  4KG0 A;  1GU3 A;  3MIE A;  3IB3 A;  4Y1Y A;  3NNF A;  2JEN A;  2HEV F;  3HQR A;  2Q8C A;  2W3J A;  4KWJ A;  2EXH A;  3RGB A;  4TTG A;  4R4Z A;  5KXD A;  4Q4X 3;  4IXL A;  1JHN A;  2VW1 A;  4JGY C;  1VBA 1;  1MVE A;  4YNI A;  3J4U H;  4QAW A;  3WG2 A;  3ACG A;  3VDD A;  3VHR A;  5T52 A;  4N43 A;  5ACA 3;  2ZX4 A;  4FOQ A;  4P02 B;  3FL7 A;  1AX0 A;  4CDX C;  5FLI A;  4EE2 A;  1B35 B;  3POY A;  4BK5 A;  3NKG A;  1TEI A;  3IDE A;  3TWI A;  4CZS A;  2VCB A;  2L9L A;  2ZGL A;  4COU A;  2YBP A;  3U0Z A;  1Z7S 2;  3IWZ A;  3RFR A;  1EV1 2;  3T09 A;  1LB2 A;  1AL2 1;  4XTP A;  3MYX A;  4BWO A;  4HMZ A;  1H2N A;  1VB2 A;  1HRI 3;  3TN9 3;  3C7F A;  4Q0Q A;  1AVB A;  3WP3 A;  2PN5 A;  1QDC A;  2K9Z A;  3VHO A;  2VH9 A;  5JZG C;  4RHV 2;  4HK8 A;  4E9K A;  1CPN A;  1HQN A;  1PZ8 A;  4JZR A;  1ZBE 2;  1RUC 2;  2ZAA A;  2XJT A;  5D8A A;  5FMD A;  3TBD A;  2HBT A;  2Y34 A;  1W39 A;  4YW2 A;  4LTA A;  4YZ2 A;  5BNO A;  5GM0 A;  5HBA A;  5LB6 A;  3KGL A;  1LRH A;  1YIP A;  2P5B A;  1XNB A;  3Q8C A;  4GD4 A;  4QB2 A;  5LA1 A;  2E9Q A;  1VJ2 A;  5FPV A;  2IUW A;  5FUP A;  3R4U A;  2WNU B;  5IVE A;  2BQP A;  2DFB A;  1X8E A;  4Q0P A;  3I49 A;  1S55 A;  5B2G B;  4JC1 A;  3VBS A;  1AYM 3;  3OG2 A;  1R08 2;  5E16 A;  5GZE A;  1S0D A;  1SLT A;  1PMJ X;  2VNR A;  3N7K A;  1DZR A;  2Y6K A;  2Z79 A;  1UZ0 A;  4K8F A;  4QKF A;  5ERL A;  4AVC A;  4QX8 A;  2C9K A;  1Q43 A;  4QXH A;  3O0W A;  1H30 A;  3OGJ A;  2OW4 A;  3H1W A;  2HWC 3;  3WNM A;  5DUU A;  4UW3 A;  4RGA A;  4FPK A;  5DXD A;  3RS6 A;  3JZV A;  3OTF A;  1F15 A;  2X5I B;  4IEV A;  3ZN4 A;  2PAK A;  2OKX A;  1RC6 A;  4B4P A;  1LOF C;  3WEZ A;  4XVH A;  2WAO A;  5IT6 A;  1D4M 2;  2CWM A;  1PO2 2; 
#chains in the Genus database with same CATH homology
 4CA9 A;  3T30 A;  1XB9 A;  5EHD A;  1XE0 A;  2VTX A;  1NLQ A;  1K5J A;  4N8M A;  2P1B A;  2VTX J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...