3MF9A

Computationally designed endo-1,4-beta-xylanase
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
193
structure length
193
Chain Sequence
GSDTTITQNQTGYDNGYFYSFRTDAPGTVSMTLHSGGSYSTSWRNTGLFVAGKGWSTGGRRTVTYNASFNPSGNARLTLYGWTRNPLVSYHIVESWGTYRPTGTYKGTVTTDGGTYDIYETWRYNAPSIEGTRTYQQFWSVRQQKRTSGTITIGNHFDAWARAGMNLGSHDYQIMATEGYQSSGSSTVSISEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Endo-1,4-beta-xylanase
publication title Computational design of an endo-1,4-{beta}-xylanase ligand binding site.
pubmed doi rcsb
source organism Thermopolyspora flexuosa
total genus 60
structure length 193
sequence length 193
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2010-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3mf9A00
4HK8A 1REDA 3LB9A 3VL9A 3WX5A 2B42B 1XXNA 3AMQA 1QH6A 2D97A 3EXUA 3AKQA 1ENXA 3WP5A 1BVVA 1UU4A 1F5JA 3AKPA 1XNDA 3VGIA 3VZOA 3AKRA 1XYPA 4XQDA 3O7OA 2BW8A 4NPRA 1C5IA 2QZ2A 3VZMA 2DFBA 1T6GC 3VHOA 3VLBB 1HIXA 1TE1B 2DCJA 3WP4A 1H4GA 1W2UA 1PVXA 3WP6A 1UKRA 3B7MA 3M4FA 1C5HA 4HKWA 5EJ3A 2DCZA 2JENA 3LGRA 3WQ1A 1H4HA 1OA4A 1M4WA 2VULA 1NLRA 3HD8B 3MF6A 1HV1A 4H7MA 1QH7A 3VHPA 4HK9A 2B46X 3WY6A 2F6BA 3WQ7A 1OA2A 2C1FA 4S2DA 2VUJA 4IXLA 1H8VA 3MFAA 3VZLA 3VZJA 1AXKA 4XQWA 3VZNA 1BCXA 1OLQA 2DCYA 3AMNA 1H1AA 1HV0A 4S2HA 2DCKA 1KS5A 2NLRA 3AMMA 3ZSEA 2BWCA 2BWAA 5K9YA 4XPVA 3MF9A 5HXVA 1BK1A 3WR0A 2Z79A 3AKTA 1IGOA 2B45X 1OA3A 1OLRA 1XNKA 4S2FA 2BVVA 5K7PA 2VG9A 2NQYA 3B5LB 4S2GA 1XNCA 1XYNA 1XYOA 3AMPA 3RI9A 3AKSA 3WQ0A 3MFCA 4HKOA 3VL8A 3AMHA 1XNBA 1YNAA 3WP3A 3WT3A 1H0BA 2D98A 2JEMA 4XQ4A 3VHNA 1KS4A 4HKLA 3VZKA 1REEA 2QZ3A 2JICA 3RI8A 1UU5A 1UU6A 3WXPA 2VGDA 1REFA 2DFCA
chains in the Genus database with same CATH superfamily
1RUG1 4I30A 4Y5TA 1LGCA 1Q8QA 1SCRA 3ACFA 1SPPA 3LA3A 4DXTA 5CFDC 5E16A 4A45A 2GNDA 3K51A 1DZTA 5J96B 2ZBJA 4KI5M 4AAPA 4BQXA 1OPMA 1PZ7A 4CDWB 3DEMA 5E1RA 3RVHA 5JIUA 3VDBA 1U5ZA 1CVNA 5KHGA 2Y0IA 1TME2 4EWDA 1N1VA 3QOPA 5C7GA 2CHHA 2UYAA 1GZTA 3MLJA 4KU8A 3ZFEC 5B4NA 3ELNA 5IAVA 4IV1B 3AYEA 4OZOA 1RMU1 4AI0A 3PVBB 3KT1A 1C5IA 1JBCA 4FFGA 4I09A 4WM8B 4CU6A 2FDIA 5A3UA 1K12A 1W03A 2WIIB 2HH9A 4RFT0 3S7IA 4F7ZA 5C6CA 5FZ0A 1MACA 4RR3A 3GCXA 2FZ2A 2VQAA 3ACLA 2VMHA 4KGGA 1LJ7A 3LPGA 4P08A 4XJ8A 2A7AA 4R52A 1ZRIA 4JHTA 4LBQA 2SBAA 2ZGQA 4OLLA 3K75B 2WN2A 4AK3A 4L11A 4JHZA 4MX3A 1AR73 5CKNA 1LESA 3PMEA 1W8TA 1OI6A 1HN1A 2C9AA 2F17A 4PF5A 2GNTA 3VB9A 1CAXB 1DGWX 3GALA 3PMSA 4V1PA 1NE6A 5FPBA 1IS5A 1W2NA 2JG9C 1D7PM 5EWSA 4QB6A 1YYNA 2HWD1 2C1FA 1KXGA 3VBFA 3DV8A 4M0HA 2FQPA 4F83A 5B2GB 4A44A 3UGGA 5DG2A 3ETPA 4S2HA 5FDBA 5HI0A 4CEWB 4YGCA 3LCPA 2NLRA 1VPHA 4NAOA 3JB4C 4CDUA 2BWAA 2WO7A 1US2A 4Y1ZA 2HBTA 5FYBA 5HXVA 5FYCA 1DP0A 4A41A 4FXKB 4ARXA 5DZFA 3P3NA 1LGBA 5BPXA 3AKTA 2VZQA 3RZGA 2EIGA 3NV1A 3GF6A 3V0BB 1BEV2 3C7HA 4QX3A 1OLRA 4S2FA 3V0AB 4HVOA 4M01A 1V9U1 1QQP2 3PTRB 1GOGA 1SEFA 4FPJA 1WLTA 3NKGA 4MO3M 1WA6X 1JOPA 2J1AA 1UZZA 1GQPA 5IVVA 1CJPA 4XEZA 3WSOA 2VE1A 3BTXA 1I5PA 1XOYA 2AEYA 3NJVA 2CAUA 3K4ZA 4LOTA 4RA0A 1OF3A 1RUH2 4CUCA 1XJAA 4LLOA 4YW5A 4JQTA 3ST7A 4GD4A 3N9QA 1WLCA 4CYDA 2I45A 4HKLA 1PM4A 4HONA 1AR82 3L2HA 3LEKA 1XU2A 4U36A 1TMF1 3CJIA 5FP9A 1UX6A 4XCAA 4BK4A 1O3QA 2JDZA 1NXMA 1SLIA 3I2DA 3T08A 5BV6A 3JD73 2V09A 3JBG3 4I02A 5C8CB 1A34A 3WW1A 4YVSC 1W0NA 2W91A 2XLAA 5K0UA 1GP5A 4M4PA 3M2MA 4DQAA 2E51A 4Q4W2 5J3UA 3VBSA 2D6OX 5IFTA 1OUXA 4LBNA 5FJHA 3VD3A 1AF9A 5L7OC 4SBVA 2EIBA 1HLCA 2AR6A 2PYTA 1ZNPA 3ZIWA 3NV2A 3ZXFA 3OF1A 4BOWA 3ZMNA 3VBUC 3SH3A 1Q56A 4Y3OA 4COYA 1A78A 1LR5A 4R9BA 1Q5OA 4L97A 2QZ2A 3CLPA 4MH0E 2K9ZA 3KMHA 4Z1VA 2J1TA 5T55A 2HBUA 3N9PA 4XHXA 5AC91 3KWVA 3RMXA 3QACA 1LOBA 1W2UA 1Y7BA 2FDJA 5CFDA 1UF2C 2RJLA 4LTAA 4YRDA 3E1F1 4XXPA 4ZZ8A 5FZ6A 1IG3A 5FZ9A 5C5TA 3O1RA 3N36A 2GDFA 3NNGA 4K3UA 4RQPB 1YCIA 2QQLA 1SFNA 3CU7A 2D6LX 2JDAA 2WZR3 3K3OA 2R30A 4K1YA 5F3GA 1KDMA 4ARYA 1QJX1 4W6YA 4DB5A 1B35C 2B8MA 2VW1A 3SKJE 4FXGB 3OPTA 3H1MA 3FHQA 4ATFA 2DBNA 1H8TC 1DF0A 3ZFEA 3ZYHA 3N9MA 4CCNA 4IE7A 4D7YA 5HV4A 2IWGB 4KH9A 4XUOA 1UAIA 2Q8OA 2CYFA 4DMIA 4XCBA 4N90A 1UX7A 1O59A 3C3VA 5ABJC 4HN1A 3DPRB 1RJ7A 1W05A 1EYBA 2DCYA 5E6HA 2VMFA 3POEA 4XFGA 1QJY1 1J58A 1ODMA 3LZZA 2VOTA 5FJKA 5FZFA 4AEDC 3R6SA 3TYJA 1YQ6A 3RWNA 1UW8A 3E5QA 2PLV3 1ZZ9A 2YFZA 5FYVA 4FQZA 4MYEA 5FZLA 3UL2A 4FPCA 5CEHA 5LEJA 1OQ1A 2JG8C 1AX0A 3GJBA 3HWJA 5LK7B 4QX2A 3WLUA 1F2NA 5LB6A 2JG9A 2YBPA 3ZDSA 4BISA 5IVCA 2HWC3 1OOPB 2RDNA 2BBAA 5H9PA 2PHTA 4R8HA 1OFNA 2XJQA 2RR11 3MPPG 3RZLA 2XR4A 4RYDA 1HXS3 4XURA 5DAPA 3LA7A 3MFCA 4HKOA 4QDQA 4E8CA 3DL3A 4QPIA 1V70A 1Z7S2 2X8KA 1ZZ7A 4JCKA 5A3TA 4RHV2 1W9SA 3J8F3 5FUNA 1BZWA 1NY72 3KQRA 1UY2A 1AR93 2JEMA 2XQRA 2Y6HA 1W6OA 1ND2C 4HG6B 1V6NA 4LR4A 2QZ3A 3IDEA 1KDKA 2DDUA 4OI0A 4MLOA 5FOJB 1AXYA 4ZONA 5APAA 3GBFA 3KCCA 5HXMA 4XC9A 4NHXA 1D4M3 3VUOA 5F8PA 1HRI3 4PDWC 4JC1A 1S4CA 1UN1A 3J7MA 5I91A 4IUGA 1O4ZA 3WP5A 3FLRA 1DYKA 4URAA 3GM8A 5CB7A 1R1A3 2GC1A 2ZX4A 4BMEA 4QXCA 3KGLA 2ZACA 4JDNA 3P3PA 2XVLA 4Q4Y1 3IIAA 2YU1A 1UZYA 2R042 5A32B 3VN4A 3KLSA 5J98B 4E4SA 2YMZA 3OD0A 2E9QA 1H2LA 1H2NA 4K8FA 4L99A 4CSWA 2XJTA 4WM8C 5F3IA 1LAJA 2LM3A 4R9AA 4A2UA 1QNYA 3LWCA 3KS7A 1H4GA 3RSJA 5JMOA 2JIGA 2KM2A 3W9AA 1N1TA 5JXIA 2QVSB 1RINA 4YVSA 4B4RA 3HN1A 4JV4A 2D3RA 2YB7A 1A3KA 4UFHA 2Q1FA 1FNYA 1NE4A 2ZCWA 4XFBA 1GR3A 4YZ4A 5F5AA 5DAXA 5T54A 4CCDA 2D6PA 2X5IA 2XL9A 3NNLA 2RJ2A 4B1MA 1N3QA 1OA4A 4HETA 4YZ1A 1DLCA 1ZYBA 5L7OA 1J84A 1AYM1 1FOD3 4CP0A 3BIEA 3D4KA 1U12A 4GAZA 2Z42A 4Q4X1 1H9PA 5FO9B 5I0DA 3VHPA 4UFMA 4LULA 3CBNA 5FP4A 3BKZA 2L9LA 1ZRCA 2AUYA 1UXZA 1K5JA 5ANNA 4FTEA 1WLWA 2ORXA 1H8VA 1R081 4IE6A 3WZ1A 2XBO1 4CUBA 4XQWA 4AVBA 2R072 4D7SA 1UY1A 1ZZBA 3AK0A 2Q8DA 3RDIA 3I2FA 5FK8A 4LBJA 4XBQA 4FQ4A 5D1IA 5FMOL 3ZYGA 4AHWA 1JYXA 2BQPA 4WVWA 2WN3A 2ZHLA 4CDQB 3MF9A 4XFIA 3FMGA 1PMIA 4IETA 3QCWA 5KXEA 2BBVA 1RUE3 1W6QB 3WR0A 2R32A 5FIXA 2XLGA 1GV9A 3WNXA 1VJ2A 5DABA 2XDVA 2GNMA 3KVBA 1CIYA 2VNVA 1H8TA 1NA1C 5FY0A 1H1MA 5CU1A 2PN5A 2BV4A 1NG0A 4FCAA 5BNPB 4Q5OA 1EV12 3FBMA 1PMHX 1RGSA 2GH2A 3D6EA 3ZR5A 5F5CA 1KRIA 4QGNA 3RYPA 3AFGA 5ABJA 1CONA 4P00B 2PA7A 2ARBA 4JKMA 4Y5Z0 2WNUA 1Y4WA 4GZ9A 3MI8A 4YGBA 1JZ5A 2JJ6A 1ZBE3 4AEDA 1ULOA 3CMGA 1VAKA 1QJU1 4GB31 2VTFA 5LY2A 4PLOA 5JVVA 1T6BX 2VD7A 1ASJ3 2JDUA 3LA2A 5T5JA 2DFCA 3VD5A 3WXPA 4D94A 5BNOC 2JG8A 2RS53 4FBFA 2E7TA 2RS33 4LBKA 2Q5TA 3PUQA 3SNMA 2FDHA 3ZKUA 3FJSA 5C8CC 4JGYB 4JKKA 2QQKA 2PAMA 3AKQA 5D8AB 2BU9A 3O1PA 2ZZJA 3VBSB 4KL1A 1FI2A 3CL1A 3R4SA 1NQDA 2H0BA 1PGSA 2G9ZA 2ZGSA 4J25A 4CA9A 1COV2 1F5JA 3IPVA 1CAVA 1DGRA 3TRSB 2BYVE 5CKQA 1R093 2D3SA 3HNBM 1WMFA 2DURA 4H14A 1ULEA 4BQ5A 1BQPA 3DXTA 3SEEA 1ND2A 1TVGA 1MQTB 5GLVA 4BDVB 2OX0A 4QWNA 1O5UA 4ZHNA 2E53A 1NUKA 1QWRA 3BALA 3I3BA 4KWKA 1NOVA 5F37A 2BNOA 4M3CB 3WF4A 1VBD2 1VP6A 3M3OA 3R05A 2IXKA 1BKZA 1DFQA 2VUDA 4QU2A 2X53S 3RYKA 2RS13 3RFRA 4NRQA 4F8AA 1LKNA 1OLME 1IQAA 3AZXA 5M0TA 3MPBA 2HWB3 1HJFA 2RG4A 1AR71 1ULFA 4QQHA 2HWF2 5FYMA 5HBAA 2W1SA 4YZ5A 1Y9QA 5A3MA 1UZVA 4K7JA 1VBA3 3WHTA 3RZKA 2J1EA 2A1XA 4GULA 3POBA 3NKTA 4LO8A 5ACA3 5FYUA 3U4SA 1N3PA 4QHOA 2OZJA 3B94A 2Y33A 2NPIA 4I01A 2ZMKA 5A70A 4XZPA 2AC1A 3OG2A 4IV1A 3OEAA 1YHFA 4I3PA 1DHKB 1JYVA 2VBPA 5JI7A 2YHJA 4WM8A 2AYHA 2YG0A 2FCTA 4NWWA 2ZPXA 4J1XA 4A4AA 3EMRA 4CDXC 3OUIA 3T4HB 1AYN2 2QUOA 2VTXJ 2VVDA 1AL0G 1QHDA 3BIWE 2W2IA 3ECQA 4GA9A 4O7XA 4COZA 1X9PA 2W47A 2QTWB 1C8M2 1MZFA 4QB1A 4CE8A 5KXDA 2WNOA 4XTPA 1OF4A 3VDDB 2JKBA 1JMUB 1DG6A 1MEC3 3I3DA 5LWBA 1H2MA 1RUG2 1PO22 5FZKA 5JXJA 3SLIA 5LBFA 4QMAA 4WZFA 1QGLA 2Y6GA 3NJZA 1VAVA 1ZM1A 3GHNA 3B5LB 1KJLA 2C26A 4HOOA 2XLFA 5DAQA 2ET1A 1XYOA 5BY5A 4O65A 2B7YA 1OHFA 1FPN2 4HL0A 4YW3A 5GZFA 4A7YA 4X8NA 4BXFA 1XNBA 2IXHA 3RRDA 4XE9A 3MIBA 3USSA 3VHRA 1C4RA 3ZMOA 1VRH2 4DXZA 1ULDA 3URFA 1KS4A 3PUHA 3QLQA 4BLIA 2DVFA 4GKXA 5IYYA 1NYWA 1RUC3 2EXIA 5I0UA 4FPEA 3ZYBA 1OFSA 2YPJA 5LBCA 2QE3A 3JD71 2VZ1A 3JBG1 4XIOA 2JDHA 5JSOA 2C24A 1JZ7A 5DXDA 2XVKA 2Y26A 4XOGA 5EYXA 2K46A 3V0AA 1V00A 3PL0A 3AP9A 1NX9A 5GM0A 4BJ0A 3FN9A 3PJQA 3WNOA 3S7EA 5GLTA 2OA2A 3O5SA 1RVF2 2BTVC 2EIEA 2P6HA 2QCSB 5DUWA 1TME3 3ZO0B 3ZSKA 3OTFA 2G4IA 4ZU5A 1T2XA 3JB8A 2VCMA 4XFAA 1WW6A 2R7EB 3A21A 2ZGTA 1E5HA 3KSCA 1CPNA 4GMP3 1OXCA 1PO12 1ZZ6A 3WOGA 4XFFA 5FYTA 5A3NA 4NMIA 1CIWA 3M7AA 1MR5A 4XACA 5FCCA 3LOIA 3W20A 5FOBB 3VD7A 3LFMA 4NHKA 2BGCA 2PHWA 2VMGA 1LU1A 1QXRA 2XWJB 2WSUA 3VBOC 5C8CA 5JOWA 1NLQA 1F15A 4HZFA 5FLJA 5CAZA 2WZR1 3DGTA 5F39A 1LB2A 4Q26A 3WG2A 3RGBA 1HQWA 1EAH2 2AGSA 4JRLA 1JU4A 1JN2P 4NRMA 2A71A 1H4HA 3U78A 1M4WA 3VBRB 4DZGA 3U4XA 2J7MA 2ZGPA 4AQSA 5I0RA 4DXSA 3VBUB 5A6YA 3M3CA 4PF1A 3ABZA 1BBT2 3SH4A 1W3VA 4L9BA 4AF9A 5DAWA 4I0BA 3WQ7A 1YQ2A 5A3LA 1V9U2 2P4EA 2VH9A 4M4RA 1HQNA 4UW5A 1JZ6A 1I1EA 3ZFFB 1JTZX 5IVFA 2YYOA 4LO6B 2J42A 2ZMLA 3OPZA 1HJGA 4AVSA 1LHNA 5FPXA 4FOQA 1AL22 2EICA 2OPKA 1D2SA 3B00A 1G9FA 3KB5A 1W6MB 2DUQA 3UGHA 4RQPA 3ZSEA 4LUKA 2PLV1 3HR9A 3HVDA 4GWNA 4UBHA 1BVP1 5K9YA 2X05A 5JI9A 3POSA 1B35B 1VB2A 3NW4A 5A1FA 4MHRA 4YLZA 3W59A 4D7TA 2XHKA 1MVQA 3BVCA 2OQ6A 3E6DA 1OPOA 1H8TB 2OXBA 3JZVA 4AGRA 5FQ0A 4OHYA 5IHRA 1DQ1A 4KWLA 3RZZA 4Q27A 2VPVA 1BEV3 5LRRA 1V6OA 2HWC1 3JQXA 3WD5A 1F4HA 1HN0A 3FLTA 3MO4A 3NRUA 3OY8B 4IEYA 1QQP3 4KGQA 3K77A 2QQUA 2VXJA 4NOTA 5A80A 3FL7A 5ABJB 1RUD2 1HXS1 2HEWF 2VCBA 3TAYA 1ZRDA 1ZA7A 5HCAA 3AMPA 4XFCA 3I97A 3IIIA 3MUZ1 4P9LA 3DPRA 5FMDA 1GWKA 1QY4A 4LA3A 4CDXA 1JZ8A 4QGLA 2ETEA 3J8F1 5I93A 1AZDA 4AEDB 1AR91 3WT3A 3OPWA 4P9IA 3E6CC 4A6OA 4OYUA 1F8VA 3OGSA 4XQ4A 3N9NA 4IGPA 5A1LA 2BGOA 1AR83 1CZVA 1DYPA 3Q9OA 2JG8B 4YGEA 4BQ1A 1XRUA 3DF0A 1OKOA 1SLLA 4IEVA 4M0NA 4YSFA 5EIYB 1D4M1 3AZZA 1IS3A 5EYYA 1HRI1 5CIRA 2CU5A 2R49A 3WDVA 3ZYRA 2ZGMA 1EPZA 3RNSA 1PX3A 4EE2A 5A7QA 1DU3D 4E4DX 1ENXA 5D8AC 4EN8B 2YGMA 5FY4A 2GP3A 5FZCA 3LQCA 1QOOA 3JCIA 4Y1YA 5JIAA 2Q8CA 4BCUA 3H8XA 1R1A1 2GZWA 4Q4W3 4ASKA 1O91A 1KFXL 3O0VA 2TEPA 3BTZA 1J3QA 4W6XA 2G9FA 3ZIXA 1QJX2 1UL9A 5FY5A 3VZOA 4FTSA 1WCUA 3CEWA 4AEMA 2JDPA 5EHDA 2ZJCA 3WDYA 2B4KA 3PUSA 1ND2B 1VBB3 3B9IA 3P6BA 4O61A 5CVRA 4YFZA 3LSEA 5F6KA 4E4HA 3CF6E 1MQTC 1MS0A 1V6MA 1ACCA 2A6XA 3Q8CA 2EIDA 2R6QA 5DQ0A 1HIXA 2XH6A 5FY1A 3GZAA 1XC6A 3ZYJB 2W87A 4PDWB 4CU8A 2MHFA 2IXCA 4CCMA 3DECA 4UW6A 3GZUC 3WDXA 5A6ZA 2WDBA 4NIHA 3M4FA 1C5HA 2JB8A 1O4YA 5F3CA 1QJY2 2UURA 3QH6A 5H9RA 1PX4A 4MADA 3T2TA 2DUPA 4FP2A 3SEPA 3H3UA 3SQOA 3IBMA 4EN0A 1FOD1 1VRBA 3GBGA 1EY2A 2FZ1A 2W52A 4N7UA 5I0TA 3K4AA 4D8MA 1N47A 5A33B 2W1WA 3H3ZA 4AVCA 2D40A 2ID4A 2BJSA 3OYWB 4BQ4A 1D4VB 5T5LA 3MZHA 4PT6A 1U5XA 3A0NA 1C3HA 4GALA 2B46X 2ZS6B 5A32A 2VZTA 4XF0A 1HRV3 2ZGOA 4S2DA 4I2OA 1UPSA 2O14A 1SBDA 3A22A 4Y4YA 3RG0A 4EN7B 4AXOA 1VALA 5FY9A 2RR12 2JD4A 4FFHA 1OLQA 1RITA 1XNAA 4BIOA 3U10A 3NWKA 5E89A 5FZMA 2XMLA 4QM9A 5DZGA 5I8SA 1MZ5A 4AWDA 1F5FA 3R4DB 2E6VA 4OFGA 4OHWA 1RUE1 3GZTB 4XDOA 5A7NA 4LK7A 4AE2A 4FAGA 1HW5A 2CGNA 2WQZC 4IEZA 4NHYA 3VDDC 4BHPA 3BU0A 4XILA 1PGL1 1EP0A 5LATA 3USUB 5LEKA 4B3NA 5FZAA 4QHZA 1DQ2A 4B7EA 5GZEA 5AFBA 5C3OA 2ZKNA 5T5PA 1UCXA 2P1BA 3E6BA 4RL7A 5IK7A 4BE3A 4KBZA 5F5QA 3BB6A 4Q4V3 4CEYC 2ZMNA 1HKDA 1WD3A 1OUSA 1QOSA 1Z7S3 1ZBE1 3GJAA 3MLLA 5FBZA 4RHV3 4MXWA 1PK6C 3FHAA 4Q4Y2 4EN9B 1UYZA 3APBA 2PELA 2TNFA 4CDQA 3KV5A 1CX4A 1U5YA 2XJPA 4FPOB 4LBMA 5FV3A 4CP1A 1ASJ1 1ZA4A 1W6QA 2RS51 1W6NB 2Z2SB 4JDOA 1G9DA 2CSGA 1YI9A 1IQDC 2RS31 3C7GA 3ZSMA 1NA1B 2QDRA 4RD7A 1R64A 2UWAA 2WFF2 1PMJX 4ET7A 1CZSA 2XGXA 2YBKA 2B42B 1LCLA 1QJFA 4BM8A 1JHJA 2GAUA 4KG8A 5BNPA 1B09A 1LGNA 3I2IA 4K1ZA 3ZFGC 1PGW2 3HOBA 4LQRA 3O12A 4AL9A 2GMEA 1JYWA 1LHVA 1V6IA 3UT0A 1R091 3KV4A 4XUTA 2VMEA 2VZOA 4HXCA 4Q4X2 2CWMA 2TBVA 4NPRA 3HBZA 3MYXA 2R043 5FZIA 5L73A 1HB3A 2PXJA 4X6RB 3ZYPA 4LORA 2DFBA 2G9GA 3UETA 2CY6A 5BNOB 1VE0A 1JZ4A 1TE1B 4Q1RA 3IAQA 2VNGA 2P37A 2VMCA 3Q8BA 1MS9A 1SCSA 3I54A 5J7MA 4IQPA 5G05L 2P6CA 2RS11 3ZKYA 4PBPA 2VW2A 2V4VA 4JRAA 3X29B 1JYTA 3WNMA 5I0SA 5FMCA 4JGYA 2HWB1 1PZ8A 1SG3A 5D8AA 2RM21 1LOGA 4LHSA 2R1DA 1RUF2 3ZSLA 3M3IA 3MW3A 5CNAA 1Q8PA 2HEVF 1VBA1 3BODA 1AJKA 2D5HA 1UIKA 3MGUA 4IE0A 2ADEA 3I59A 4AG4A 5ACA1 2NP0A 1PVC3 1CAWB 3AP5A 3VBRC 4Q0VA 3T2QA 3ES4A 3A0KA 3HD8B 1GLHA 2VMIA 1OKQA 3GZEA 2QQOA 4ZPIA 3FC0A 3KD4A 3OBZA 3VBHC 2BOIA 4TWTA 1XQNA 4HLTA 2XKPA 2EAKA 2VCCA 1MQTA 4PHZA 4UT5A 5H9SA 4YM3A 2NN8A 3HEIA 3ZFFC 1NT0A 2Y38A 2W08A 3JXSA 4K9SA 1FMD2 1GMMA 1X33A 2WC2A 4Q0UA 3WQBA 1ZBA2 1LHOA 2R073 3IAPA 4M3CA 4NROA 3BU7A 5FZ4A 1J1LA 1KS5A 1SACA 2ZGNA 3ON7A 4XBNA 5EFUA 5L9BA 4AFBA 3V56A 2A6WA 4COVA 3N7MA 4EZHA 2Y0OA 1JU3A 1MS1A 3ASIA 3K48A 1Z78A 3LAGA 1GP6A 4AI1A 4IERA 5FQ0B 4Y1UA 4GKYA 3LEGA 1MEC1 4QB2A 5BUVA 2P17A 1OA3A 4Y4RA 1ONAA 3AYCA 2VQTA 3N9OA 1UZ0A 1OH4A 1XNKA 2Y6JA 2YGLA 3GNEA 4XDQA 5JSRA 2IZWA 5F9TA 5K7PA 2GP5A 3AP7A 5EV7A 2E7QA 2PAEA 4C1XA 3BTYA 2NQYA 1EV13 5GLUA 4RN5A 3WVJA 3GHMA 4IEPA 1VBE3 2VQ0A 5EXOA 4DY3A 4CDXB 3THPA 1QU0A 1IG0A 1WCKA 2P34A 5FPUA 4C1WA 2E7AA 4Y33A 1YEWA 2WT2A 2LW8A 3NL1A 3U37A 3T4VA 1PIV3 3D0JA 2W0XA 1RIRA 4A42A 1ULCA 2WWSA 4C90A 3C8XA 4AOCA 1RUC1 4LXLA 2GMPA 4ZXKA 3TN92 3S5QA 4OHVA 1O3TA 1LEMA 1REFA 3OJBA 3VDDA 5IVJA 1YJKA 3PURA 5FKBA 2XVGA 3CHXA 5KHKA 4LNVA 1W8WA 4FPHA 4QKBA 2VW0A 2QQJA 4OMCA 4DNYA 1LNSA 4CUAA 4NN0A 4HT1T 2A73B 2C9KA 2YV8A 1VBC2 3AVSA 1TME1 2LUWA 1SLCA 3AB0A 3C7EA 3C7OA 1F4AA 1JH5A 4P14A 1COV3 2C5DA 4XVHA 1O6UA 3UKVA 4DRVA 4E9KA 3A4UA 1H6XA 1XYPA 4QX0A 2X10A 4GMP1 4NO4A 4OZXA 3DYOA 1S2BA 5F5IA 3R4UA 3IT8A 5DN2A 4NHMA 4TYSA 4HPKA 1RUNA 2B9UA 4Y1XA 3FX3A 2MEV2 1W0OA 4K8RB 1T6GC 4YPJA 1WLDA 4X6QB 4FOVA 3UGFA 2J1RA 2QFEA 4R9DA 1QJZA 2ZX3A 1VBD3 3WP6A 2HWE2 2H6BA 4IESA 5KC5A 3F2ZA 1HB1A 4YVWC 5JXGA 1AVBA 4GWIA 1HQLA 2XJVA 3PVNA 2IXLA 1ULPA 5FZ7A 5FTTC 1AX1A 5A3PA 4MGZE 2HWF3 3WQ1A 1JZ2A 1JYCA 3E5XA 4E2QA 3CO2A 1JOJA 1Q8SA 3OD4A 4XW3A 1JHNA 3LE0A 1POV0 1QH7A 1PHMA 2OVUA 4YZ3A 3ILNA 5DZEA 3IDAA 4EQVA 3KV9A 3LIHA 4YW2A 1E5RA 4CCOA 5C9AB 1CJDA 5DPNA 2W68A 1J83A 1RUOA 1LHUA 3IMNA 2AACA 3VZLA 3H9AA 4MGIE 2QDNA 4XIKA 3VZNA 3DYMA 3TEXA 3VBOB 4AI2A 3T0AA 1S0DA 1UY0A 2JWPA 1LOFC 2DCKA 1RB8G 1AYN3 2R062 3OUJA 1GQHA 1ENSA 4N53B 1BMV2 1VMJA 3AMMA 3MIHA 4JTNA 4QQPA 4ZU7A 1RC6A 2VOKA 4LEJA 5FPAA 5KHIA 2IXIA 4XJUA 2A3XA 3EBRA 4CRQA 1APNA 3LKJA 1C8M3 4LHLA 2PHLA 3OGRA 5JAXA 1GUIA 3VBRA 5JDBA 1BEV1 1LTEA 4V2WA 3UKTA 3V65A 3VBUA 4QGMA 3JD72 3TEWA 3JBG2 3B69A 2NM1A 3VBHA 1PO23 1QQP1 4PCRA 5DUXA 3WW4A 1UYPA 4OHXA 3OUHA 3POYA 4AYUA 3B02A 4KBBA 2F4LA 1GZWA 4LOSA 5CG8A 2ZGRA 3ZFFA 2P3KA 1S0JA 1DQ4A 3FHIB 1TZOA 3RI9A 1AR62 2RMU2 4IV3C 4NJ4A 4GH4C 2ZEWA 1FPN3 5FLIA 1H2KA 4MXWB 3NAPC 3DYPA 4KG0A 4ZS2A 3SITA 3WG1A 3HNMA 3NNJA 2ZGLA 3JU9A 1H0BA 1VRH3 1GFF2 2VY0A 1W6MA 3O14A 3PU3A 3VHNA 1Y9GA 2W92A 1AR81 4JAAA 2ZABA 3KV6A 2PMWB 2GALA 1B35A 1GQGA 3K2OA 4C8DA 2D6MA 5GLWA 1UU6A 4UW3A 3U11A 1NLSA 2VR4A 2ARXA 4QKFA 4HK8A 2CV6A 4RS5C 3WX5A 1EUTA 4FI9A 4LE3A 4Q29A 1V6KA 2JB4A 4IE4A 3J7HA 4XXAA 3WUDA 2X09A 5IFPA 1QH6A 5EPAA 1QXPA 2XG3A 3OY8A 5C3SA 3S30A 3GYDA 1X82A 4Q4W1 3H0OA 2GN7A 1ZRFA 3D0SA 1ZZ8A 2OPWA 2PQQA 4AAXA 2EA7A 1RVF3 2O1QA 2HKXA 4QQOA 1UMIA 1XB9A 3KF3A 2BFUS 2CTVA 3AKPA 5C4WC 3ZXAC 1ZVFA 1W28A 1XNDA 1WMDA 2ADDA 1XSRA 1JYIA 4F3JA 5L19A 1YIFA 2OT7A 1VBB1 3I3QA 4JX0A 1SZBA 1W9TA 5T3NA 2ZA9A 4QPWA 4HBNA 1CAUB 1YJLA 4QXBA 1GYKA 3SCFA 5JXHA 1J3RA 4MGKE 1YIPA 2BVBA 5IVYA 3U07A 3I2OA 2RDRA 3A23A 4WVZA 2O0OA 4AGGA 1X7NA 2OKXA 2DCJA 1SDWA 2A3YA 2A75A 2BERA 5GKAC 2R0HA 1H9WA 4WVVA 2OZ6A 2QQVA 1SLTA 3I2HA 2MPFA 1L7RA 3AZYA 1RUI2 1W2TA 4IL7A 4CP9A 1UPIA 3ZXEA 5LZ6A 1EAH3 1ULGA 3AC0A 4B8EA 3I59B 3IM0A 3PLQA 1A6CA 3LDBA 4RGKA 2RVAA 2JE7A 2V72A 5JR2A 2XB6C 4AGVA 4ZU4A 4JTOA 3TB0A 1NLRA 3OGVA 1C1LA 3HQXA 3I8TA 4XTMA 1HRV1 4FPGA 4HK9A 1BBT3 5CFCB 1W2OA 2Q1ZB 2WS92 1LEDA 2D44A 1RUJ2 3HQUA 5FY7A 4NRPA 3KQ4B 2JDKA 3K46A 5IAXA 2VJXA 4H3WA 5FWEA 3VZJA 3HBKA 4D6RA 1KITA 5HCFA 3ZSJA 4CCCA 1S1AA 5ERLA 5IATA 1DGLA 3HT1A 2DU1A 1H1AA 3NVCA 4PDWA 1FNZA 5KHJA 1BJQA 2CAVA 4TSVA 1PM7A 3POJA 4YVWA 3T0DA 2EXJA 1AL23 2GC2A 3PUIA 3WG3A 2RM23 1W39A 1UXXX 3H7YA 3WNPA 1FV2A 5ISLA 5FP8A 3O1VA 2E63A 4IEOA 2W1UA 3KHBA 4PIXA 2OW4A 4BWOA 2UY9A 5A33A 1S0IA 3T2PA 2DVDA 4G9SB 1GKBA 1UYXA 4CCEA 1JS9A 5DDJ3 4B4PA 3OYWA 2J1SA 4E8DA 5HV0A 3RJRA 1YRZA 5CA6A 4QXHA 2W3JA 3UK9A 2BVVA 2PHXA 2ZAHA 1YFWA 3PNAA 4N9HA 4HANA 3KCXA 2DTYA 2OS2A 2Q30A 4MUVA 4QU1A 4FOYA 4HVQA 2F4PA 4LE4A 2YY1A 1RUD3 1KJRA 4Q4V1 5FK7A 1L7QA 3M3EA 2YU2A 3AKSA 5JOXA 2A6ZA 2FMDA 2YUEA 2ZEZA 1Z7S1 3AZVA 3AP6A 2BEOA 5CBLA 2WZ8A 3ITQA 4RHV1 1LOFA 1QMJA 3WP3A 4B7KA 1NY71 4NR1A 1N1YA 2GU9A 1J3PA 1POQA 4QQLA 2DU0A 2W39A 1GICA 1ENRA 3H8RA 4GXLA 4HSLA 4IE5A 1RHI2 4HFSA 4IGOA 3J7NA 2VVFA 1GNHA 1YO8A 4BPZA 3I3MA 3SH5A 3WINE 1REDA 1V6LA 4ITCA 2WINB 3OCPA 1GZCA 4NE9A 3AP4A 4P9GA 3LOBA 4EV0A 1IPSA 3M8LA 4L92A 3USUA 5IK8A 4TTGA 1O3SA 2DVBA 4XMAA 4XAAA 5FP7A 1LOEA 5JOYA 1LOAA 2Y34A 1QEXA 1XBFA 5FXWA 3EO6A 2UU8A 3FBYA 4UF0A 4CEYB 1NQJA 1WW5A 4YW1A 2JECA 2NMNA 3LF7A 3I3EA 2VC9A 4N7IA 4W4ZA 4E4ZA 2OUJA 1PK6B 3NAPA 1JYNA 1UQXA 3ZR6A 1W8HA 4EROA 1NXD1 2R041 3O7OA 4HPKB 3W5MA 1SLAA 4OCTA 1RMU2 4XMIA 3R0RA 3WUCA 2AEZA 4JVAA 1UIJA 2ZTNA 1UMHA 3HIFA 3N7LA 5T50A 2WYSA 4PLMA 1W6NA 3VHOA 4GWMA 4XJAA 3WCSA 4RS5A 1NA1A 4HMZA 2ZX0A 4QHBA 1IOAA 1SBFA 3RZJA 3P5BA 1QNWA 3D5OA 3ZFGB 1PZ9A 2VECA 5FPLA 4N43C 2IFWA 3U14A 3LGRA 2JENA 3M3QA 4CUGA 3BTAA 4DXRA 3O1SA 1DDLA 3DUIA 1PVC1 2V4AA 2YPDA 2J1VA 3WF1A 4GMP0 2CGPA 4XJWA 1ENQA 1NCRC 1AUYA 2WNVC 4MVTA 1FAYA 4MGQA 1ZREA 2W5FA 1X8MA 1IS6A 3TOJA 5CADA 3WY6A 2ZHMA 3L9JT 2LRPA 5LA0A 2EXHA 4ASMB 2HWD2 3KGZA 4IXLA 1OURA 4IW3A 4UOJA 2VVEA 3PIGA 4GJZA 1Y9MA 5C9AC 5BNOA 5A7WA 3UKNA 1AXKA 2CNAA 2FCVA 1OMIA 2R071 2QJVA 3H3LA 2A6YA 4Q0PA 2KR2A 3DN7A 5FKCA 5C3RA 1QXJA 1D0GA 1E5SA 4N53C 3K3NA 4EJRA 2ZAAA 1OVSA 3AXEA 3RYRA 2BP6A 5JZGC 1RYYA 2GC0A 3U1XA 3VKFC 2WSVA 5GLZA 3E5UA 2RS52 1CAWA 2C0ZA 3VBHB 5FPZA 3SXWA 2FDFA 2CDPA 5FBJA 2NYYA 2ET7A 1EV11 2WAOA 1DGRN 2D7FA 3IN9A 4ZS3A 1GZWB 5LA9A 1P8JA 2RV9A 1C57A 1VBE1 1X36A 1ND3B 4KNCA 3FFQA 3J4UH 4UFLA 1HDKA 4YG0A 4BK5A 2OIIA 5IWFA 1OLMA 1YFXA 2PHRA 2WQ8A 3VL8A 2BOJA 1JI6A 1PIV1 5F7UA 1CQ9A 1VMHA 5EZWA 1A8MA 1U0AA 4P9WA 4BQWA 4DEQA 2WNEA 2JX9A 4Z07A 3POWA 3VZKA 2C4XA 3WNNA 1Q43A 4DUVA 2LALA 4H2AA 1TMF2 1MZEA 3OGGA 1GSLA 1AXZA 1W8FA 2ZZQA 3O1MA 1BLZA 2WFF3 1XXNA 1CPMA 5K8SA 3NV3A 1WBLA 1BK0A 3EXUA 3RJ2X 1K42A 5JPNB 4LHNA 4XBLA 1GWLA 2HWB2 4L0PA 3SCGA 3D8CA 2ZHKA 1COV1 1UU4A 1UOGA 2WLPA 4PQ9A 1SHWB 4OI2A 2RDSA 3BCWA 1N1SA 5FO8B 4IEUA 3VGIA 1RUH3 2ZX2A 5CISA 4LBOA 1K5MC 3KM5A 4AEKA 2IC1A 1RL3A 1DQ5A 1W3XA 5C8WA 5F2SA 4ES9A 4G3YC 5T52A 2TUNA 2P3IA 4FO9A 1XE7A 1OSGA 3VLBB 2PHDA 3BN6A 2JIJA 3WDWA 3N7JA 4G4FA 3ZXLA 4Q0QA 2Z5WA 1VBD1 1SDDB 4XABA 3T09A 5AC92 3O1TA 1G86A 1RXGA 4CP9B 1LENA 3VDAA 2WZEA 2YROA 3NNMA 2VBDA 3ZYIB 3CZJA 4COUA 3HAGA 5EJ3A 3MHZA 2FDGA 4TLGA 2BPA2 2DCZA 5A7SA 4OQ9A 2HWF1 1ST8A 1MVEA 4URTA 4YFWA 1PNGA 1LULA 1WMEA 4TZDA 2ZEXA 2CWSA 1UY3A 1OD3A 2VULA 4ONUA 4Y1VA 3C7FA 1MEC2 4UWDA 3KVAA 4CPBD 3TBDA 4TXWA 5K4LA 1SBEA 5CFCC 4DS0A 2DVGA 1VAMA 2WL1A 2VUJA 4XDPA 1YWKA 3CDZB 5K0UC 4CZSA 4Q1PA 2ILMA 2IUWA 2WR9A 2D5FA 3GCWA 3KZ4C 1FMD3 2AENA 2WO1A 1AYN1 1E57A 4Z92B 1GNYA 1ZBA3 4YVWB 1PNFA 1DQ6A 2XUMA 2FDKA 2H0VA 3VD9A 1S0EA 3CIHA 3EYPA 4NIIA 3KCYA 2RJKA 4N43A 5FUPA 3ACGA 1C8M1 2P3JA 2Y6LA 4AHYA 5SV5A 3B9CA 2WZPP 1H30A 4PQQA 2Z79A 4LA2A 3ACHA 4Y22A 1O5LA 1G6NA 1IGOA 3CQOA 3ZN4A 3ZPOA 1NCRA 1O7FA 1UD1A 2WNVA 1L7LA 1WW4A 4FTBA 3MEPA 4YW6A 1PO21 2GN3A 3TEYA 1HB2A 2Y64A 1CESA 4LUMA 4MV2A 3EHKA 4WVMA 3SHRA 3BPSA 1S0CA 3N9LA 4W50A 1FXZA 4E2SA 2WUHA 4M3CE 4P5HA 4XJ9A 5A7PA 4S2GA 4AFMA 3NO8A 1RJ8A 5C9AA 5JR7B 4KU7A 3MIFA 2KA3A 1S0GA 2QQIA 3MW4A 4AI9A 1FPN1 3RPQA 1TNRA 3VBOA 4EYUA 5C33A 1FYUA 1W6PA 3OGJA 2ZHNA 1DLLA 4NWVA 5IJRA 1EPWA 1VRH1 3NJXA 3SISA 1W8OA 4IGQA 4QPGC 2A5ZA 1Q8OA 4N53A 1OBNA 1W06A 5LASA 1W2AX 2BGPA 5GALA 2ARAA 1GU3A 4LJHA 4QKNA 3TN93 3ZN6B 4BB3A 2XONA 2VGDA 3WP4A 5JZGA 1SLBA 1G8WA 3LFIA 4Y5SA 4I0WB 4Z2WA 2WAAA 1GZ9A 5FYIA 1WD4A 1TEIA 3WF0A 3WG4A 1BXHA 1UOBA 1TG7A 1JOBA 1U5IA 4ISQA 3WEZA 3UV9A 1RVF1 3GBWA 4MGSA 1UOFA 4UF0B 3JUUA 2H6CA 3H1YA 1VBC3 4RGAA 5FZHA 1VB4A 4IV3B 3QH7A 2QQNA 1X9TA 4GH4B 1GBGA 2V73A 3NAPB 3AKRA 3H42B 4UFIA 4ES8A 4D3WA 5J1XA 2R0FA 3IDCB 2BW8A 1PO11 3H8UA 4NIDA 2BNMA 2DWRA 2FHRA 4BU2A 3MIEA 4CCLA 2MEV3 4COWA 4RS5B 3N35A 2LROA 4QQ2A 5J37A 3HJRA 5IW0A 3HT2A 3OBTA 3T0BA 4QPIC 3MDPA 2DUOA 1QKQA 1UKRA 2HWE3 4A6SA 3B7MA 5GZCA 3N4MA 1EUUA 2OQ7A 2PQSA 3Q8EA 4XHBA 1EAH1 3ES1A 4Q8KA 4UXAA 1NZCA 1CN1A 3ZLIA 3PHMA 3WW3A 2B9VA 2W9XA 4CVUA 5C4WB 4FOWA 3BOWA 4XUPA 5DMYA 3ZM8A 1NAEA 5I8YA 2UWBA 2JDMA 5FMOS 2WA4A 1UY4A 1AYM2 2VTXA 1R1ZA 5F6LB 1YQ8A 3ZYFA 5IT6A 1K5MA 1BBT1 3MF6A 1FT9A 1K45A 5A7OA 3SC7X 5FZGA 1CAUA 3ZXDA 4AW7A 2G1MA 2N7GA 4QKDA 4RGGA 5EP9A 4YW4A 5A7WB 5FRAA 5E8AA 5HCHA 1OQEA 3IWZA 3LEMA 1R082 2VM9A 4H7LA 4N8MA 2XBO2 5F1RA 2WWJA 4D6QA 1MS3A 3EQEA 1C8NA 1UOJA 4OMDA 2D6NA 1W99A 5B4XA 4IEWA 1AL21 4MGTA 4B1LA 2R063 5F2WA 5KWRA 3UNPA 1UNBA 3PDQA 3I49A 1KGYA 1NCQC 1Y3TA 2EXKA 3DKQA 3OB8A 4JZRA 4QX7A 4WM7C 4DY5A 5G04L 5IK4A 3POGA 1NKGA 2HJIA 3HNYM 2FMYA 3HPNA 2J22A 5HCBA 3WNLA 1KQRA 3JQWA 5BNNB 3O1UA 1JXNA 2B45X 5DDJ1 2HLEA 4R9CA 4LKDA 4LO5B 4LITA 1UMZA 2GNBA 4OULA 5CFCA 4C91A 3AX4A 4C0BA 1RUD1 5FUIA 1ND3C 3RZMA 4AFAA 2A3WA 1ODNA 1XNCA 1VLNA 2EF6A 1XYNA 2R16A 4K21A 3BI3A 1YLLA 2X5IC 1OH3A 5KXCA 3O0XA 1AR63 2PFWA 2RMU3 1MS4A 4LT5A 4CXXA 3I2JA 2BDRA 3Q8AA 3PTYA 4INDA 1XE8A 1UKGA 4MHUA 3F95A 2VXRA 4ZXEA 2Q1MA 4A3ZA 1X50A 1VBB2 1C1FA 5JOZA 4AVVA 1MZ6A 1QJU2 4GB32 1I3HA 2HYXA 4DUXA 3ILRA 2J1UA 4QM8A 3VKLA 4XZUG 1XU1A 2W46A 5LW9A 3TEZA 4KWUA 4WBBA 5KC6A 4SLIA 1I9RA 1NZIA 2DV9A 2BRTA 2D97A 2O8OA 1SFPA 5BNPC 1KFUL 3LDKA 5I8TA 2Z4FA 1IKPA 4QX1A 4XF3A 3ORJA 4LHKA 3S0MA 2C6SA 3ROUA 2W95A 1W9YA 1D2QA 3ALQA 3ZX7A 4E27A 1O8PA 5JLVA 4QPGA 4ZKTB 2WBKA 4LK6A 3GDBA 2FBEA 4KMQA 4E2GA 4JQRA 4Z8BA 1GANA 3NNFA 1HRV2 2GC3A 5A3WA 5FREA 1ZZCA 2BZDA 4YWAA 3GGLA 1WBFA 2I2SA 1LECA 1IZ3A 3CZUA 1Y43B 2WO2A 4FPFA 4HVRA 2VNRA 2RHPA 2WNUC 3M1HA 5DUUA 4V2VA 3ZPYA 4Z82A 2Q4SA 1RUI3 5BYNA 3LEIA 2ORZA 1WCDJ 4AI3A 4QT6A 3B01A 1AR72 4KQ7A 5A6QA 3H1WA 2D43A 5FZ1A 4CEYA 2ZGKA 4WZCA 2ATFA 2AREA 1W0PA 1W8NA 2LS6A 4JGZB 2ZX1A 4FPLA 2WQ4A 5LK5A 3FLPA 1PK6A 2NMOA 1DZRA 1W04A 3IB3A 4GJYA 2Q0AA 4OUEA 2YC2A 5DUVA 1DQ0A 4DOUA 4AFCA 5IVBA 1JODA 3W5NA 1WGPA 3UJOA 2E32A 3LD8A 4RFRB 2WS93 4ZY9A 1RUJ3 4DIQA 3VKMA 2PTMA 1LOCA 3M70A 4P9XA 1UYYA 4Y20A 5FFOC 3IDBB 1JW6A 4Q4V2 3FE5A 2JE8A 3AMNA 3S5AA 2ZOEB 3PIJA 3W21A 4AQ6A 1W9FA 4LO7A 5J48A 4N43B 2GH8A 1HB4A 2BWCA 3ZFGA 4P9JA 3OBRA 1MPXA 4XPVA 4XFHA 4YYOA 4BQYA 4NUBA 4Y22B 2Y60A 2WT0A 1NCRB 2WNVB 2HYKA 1YXWA 4O9GA 5TSWA 2Y6KA 1SPPB 4LKEA 1FATA 2YBSA 4FFIA 4WVMB 5C3PA 2Z69A 5LY1A 3DCQA 3ENRA 4WV8A 4AEJA 3WDUA 2X29A 2YC4A 1J1TA 5AVPA 4CDWC 1OD5A 1CWPA 1YFYA 5KBFA 1Z0HA 5GZGA 2ERFA 1VR3A 4XAEA 1W6PB 3I2GA 2ZKLA 3ILFA 4CPBA 3AMHA 5IK5A 1TQ5A 1YNAA 3FWEA 3TNQA 4CXYA 3NMBA 3ACIA 3WW2A 2ZXQA 5FZEA 4DPNA 1IHMA 1W8ZA 2DF7A 2Q8EA 1NCQA 1S0FA 4AHXA 4IV1C 5FPVA 1RHI3 1REEA 4WM7A 5JZGB 4PI2A 1UU5A 1KEXA 5FP3A 4RR3B 1POV3 2WFF1 5CZKA 5AFEA 3D3AA 3VL9A 5J36A 1RUG3 1WWYA 5EJ1B 1AX2A 4W65A 3WV6A 5KXBA 4IDZA 4YG6A 1GWMA 2WLQA 5FYZA 3VD4A 4M00A 4LBQB 1PGW1 1ND3A 2YDEA 2QQPA 1BVVA 2O8QA 4J6GA 2YFUA 5F32A 4NPMA 1US3A 1OVPA 5FZ3A 3PVEA 3BOPA 1RUH1 2IFRA 4AQ2A 1PVC2 2JXAA 4AVAA 2OUHA 4OI4A 4CU9A 2B39A 4YM1A 2WABA 3AJZA 3I4IA 5FO7B 4BLJA 4EWEA 4NIAA 5JMCA 1D0HA 2PHFA 4QX5A 1HX6A 2WKKA 3POIA 4AR2A 1BHGA 5D2AA 4META 1RMU3 3VBFB 3VZMA 5FYSA 4IEQA 3SKVA 1J59A 1F35A 1N3OA 2YZ4A 4LMFA 4FVVA 1G9BA 2D6KA 1FV3A 3CJXA 2XUEA 3AVRA 3KT4A 3LSDA 3LPFA 3NQHA 1PVXA 4BMBA 2QKDA 3QD6A 2XOMA 1S2KA 2A70A 3U0ZA 2XPJA 1X8EA 2AH2A 4CDUB 4CEWC 3O0WA 2WZR2 1YQ5A 2K2SA 1RUF1 1IPKA 1XPWA 2VZUA 3EJKA 1CD3G 1XNTA 3J26N 3THTA 5F3EA 3U75A 2DTWA 2XKOA 3RS6A 1IPJA 2EALA 1ALYA 1K5MB 2CGOA 2UYBA 2K0GA 4H7MA 5BXXA 5C71A 3E97A 1JZ3A 2DCTA 2F6BA 2JKXA 2YC0A 1PO13 4J1WA 4K6BA 4RSUA 5H9QA 1UZWA 4NPLA 3THDA 2HWD3 5FYYA 3HQRA 4K20A 1VBE2 1FMD1 2RE9A 2XQXA 4YNIA 2VZRA 1LU2A 1ZBA1 2WRAA 4UFKA 4YGDA 3WDTA 4OI1A 3AXDA 1HV0A 1UWWA 4Q0SA 4EZ4A 1RXFA 1DIWA 5JWPA 3MIDA 4ZZ5A 2R1BA 3ZOIA 4PI0A 1PIV2 3CKHA 3N7KA 2EVXA 4B29A 4LBLA 3ME2A 2PLV2 4ISRA 4XF1A 3THCA 4B4QA 4OUSA 4CXWA 2PHUA 2GSYA 4L2NA 3MBWA 5E88A 5LBEA 2D3PA 3IMMA 3S57A 3CJIB 1V6JA 3I2KA 4OUMA 2VCAA 4PLNA 2JD9A 5BNNC 2VZPA 2WWUA 3QBQA 2YXSA 3KT7A 1CR7A 1TNFA 3LDRA 4M3CF 1QOTA 3EB7A 3T3YA 4YARA 1XE0A 1AJOA 4N9IA 1LODA 2HWC2 3WCRA 1OC1A 4LPLA 5K0UB 1V9U3 2DVAA 3POFA 1HXS2 4QDSA 2XL7A 1GOFA 3MICA 5CYYA 3WQ0A 3BUCA 4MGYE 3NSTA 2VZ3A 3IKWA 3J8F2 2QQWA 3MV11 4D0QA 1AR92 4OQ8A 2E31A 4I0AA 3WF3A 3O1OA 3TN91 5FZOA 3AYDA 4AZZA 4LBQD 1ZRRA 4AFDA 2KXLA 2ES3A 1LRHA 1UO9A 1VMFA 2VUCA 3BGAA 1IKQA 4X8PA 3J9SA 4XUNA 3MLKA 1K3IA 1TMF3 3T1LA 1CZTA 3NJYA 1D4M2 2B5HA 3UJQA 5CFDB 2D93A 5KR7A 1HRI2 1AHSA 4ASLA 2KD7A 5FLHA 2VZVA 5CG9A 2XXZA 1QF3A 4GQ7A 4CCKA 1G9CA 1VBC1 2I74A 3DKWA 4KWJA 4RQPC 4CDWA 5T5OA 4CP2A 3HMYA 4Y24A 3B3QE 1R1A2 3BYWA 3VKOA 4QPGB 3ZFEB 3ZXGA 4DO0A 3RZHA 1O3RA 1DBNA 5LA1A 1I5ZA 4DINB 4NHLA 3KHCA 2MEV1 1YUDA 4FPKA 3ZN6A 4BH9A 3G7DA 2JE9A 1STMA 5LA2A 1YI7A 2VO5A 3L2YA 3DPRC 2W1QA 2HWE1 5AC93 5JUVA 5L36A 4MG2A 3AYAA 4FPYA 4JKLA 5GZDA 1CGPA 4A7KA 1GOHA 4HN0A 5FZ8A 4FSJA 3AFKA 5KHHA 4O9EA 2QQMA 2MNGA 3FFZA 4BIFA 4Q8LA 4IV3A 2AZ5A 2XJSA 1FOD2 2DBIA 3Q8FA 4GH4A 1QJX3 2G19A 3INAA 4JGZC 3SCHA 5FYHA 2VAUA 2JG9B 2V5YA 4YW7A 4P9YA 3C2UA 1SFYA 1CAXA 4YG3A 4AVTA 3N3HA 1VIWB 1YC61 4UW4A 4Y20B 1OOPC 3TNPB 2QBXA 4R4ZA 4NAMA 5FXZA 2ZGUA 4D69A 3MUY1 4XF4A 3WHUA 4MXVA 1SQ4A 5HPOA 4QPIB 1BCXA 1OT5A 1Q8VA 4NIGA 2DYCA 2R061 3W58A 4ATEA 1BMV1 3UYJA 1QJY3 4CEWA 2GMMA 4DRRA 1W6OB 1WMXA 3FUOA 3PU8A 4YZ2A 1WZXA 3KF5A 1RUE2 2VMDA 4XF9A 5FZBA 3GXUA 5C4WA 4UI9L 2PAKA 3MV01 3ZDVA 5L9RA 1H1IA 1CX1A 3I7DA 2ARCA 2IVJA 1PGL2 2BNNA 4MSVA 5DG1A 4FAHA 3WF2A 1S55A 1WCQA 1A8DA 3TWIA 1WW7A 3VDCA 3V0BA 3H50A 1V0AA 4LKSA 2CL2A 2FCUA 4UYBA 4BQ2A 2EAAA 2ZEYA 1G7YA 2VU9A 3AZWA 3D82A 3ETQA 5D21A 3WNKA 4DFSA 2VUAA 5JCTA 4XETA 1GP4A 1AR61 2RR13 3SMHA 2RMU1 2SLIA 4BA6A 4XUQA 1W8UA 5FAXA 4HSJA 2VOXA 1QIQA 3AM2A 1C28A 3ZXKA 1MS8A 1WUVA 1ZBE2 1NCQB 2D98A 3T2OA 3FZ3A 2LTNA 4WM7B 4H55A 1BYHA 5A6XA 2JICA 1ASJ2 1F9KA 3RI8A 5GJ6A 2A6VA 2WJSA 3V64A 1QDCA 2RS32 4RR3C 4OHZA 5BNNA 3LB9A 3AL5A 4CTEA 1ZX5A 2UWCA 5C5UA 2JDNA 4FFFA 4YVSB 5C3QA 1JUIA 3AMQA 2WA3A 1DCSA 4UBGA 4UFJA 4AHZA 4BZ4A 3NV4A 1M06G 4U2AA 4FP3A 5SV8A 2X5IB 3A7QA 1O4TA 1W9WA 2NZ9A 5L7OB 4QD2A 2BUKA 3B93A 5ANQA 2ENRA 4I3GA 3K4DA 1R092 2VOWA 4LLFA 4XQDA 4P5YA 5JPMB 3T30A 4Q4Y3 4C0HA 1SMVA 1H6YA 2P2KA 2VNOA 1WKYA 3BPZA 5L9VA 4TN7A 2WO3A 3CNAA 1MS5A 4YM0A 2VL4A 3VBFC 3J7LA 5CKMA 4IEXA 1DYOA 3G6JB 5FWJA 3MIGA 1F31A 4PIYA 4Q2FA 1OQDA 4BQ3A 4GIQA 5A3OA 2VQUA 4QXKA 2XJRA 2RS12 1RUI1 5FXXA 1RTVA 1W90A 2BFUL 4HKWA 3PVOA 4CDUC 1QJEA 4MOAA 4W8JA 1WA4A 2RM22 2WFPA 1L3JA 1IS4A 1G9AA 4CDQC 3OOXA 5LCWL 1VBA2 1WCSA 2W94A 3AL6A 5J09A 5LBBA 5JSPA 5IUQA 5BNQA 4LIVA 5AVAA 5ACA2 2Y8KA 2FD8A 3MW2A 4BXSV 1AYM3 4TLFA 4Q4X3 1HV1A 5DDJ2 2XWBB 1S0BA 2VZSA 2WS91 1OA2A 1RUJ1 3IZOA 4JDMA 4PJYA 4FT8A 4ORFA 1S2EA 3MFAA 4Z2AA 5DAVA 3T1MA 1R083 3ZVXA 2XBO3 1E5IA 2E33A 1QDOA 4QX8A 4QDRA 3VV1A 2XJUA 2VOVA 2QNKA 2WNUB 1I6XA 3AJYA 5LRSA 5FZDA 4XJZA 4CU7A 5FY8A 4A7ZA 2P5BA 1YFUA 4PBOA 2HEYF 3LIGA 1RUF3 3RMYA 1KD7A 5A1AA 4MZUA 1BK1A 3ZXJA 3FUQA 3OBAA 3HN3A 3PJYA 2IXJA 3CJIC 5FR3A 4UAPA 4EN6B 4LIUA 5FXVA 4CCJA 2JDYA 4P02B 3OEBA 4R4XA 4JGZA 1XSQA 4K40A 4QAWA 4QPYA 4PIZA 4W6WA 1JUHA 3ATGA 4Y26A 3OSDA 4A3XA 4D6SA 4XYXA 3DXUA 2VG9A 1URXA 2P3YA 4JGYC 4AI8A 1GNZA 4GWJA 2OYZA 3UESA 1OOPA 2Y6FA 3VBSC 4AQTA 5FMBA 1YQCA 4DUWA 3IPVB 3RQ0A 2I07B 2XHNA 3H7JA 1DGWA 4NVPA 1CAVB 3VKNA 2VBBA 5IVEA 4DEVA 3RWKX 1Q3EA 2CDOA 5EJZB 5EQUA 3P1IA 4L8QA 1O8SA 2UY8A 2WT1A 4OVEA 5FZOB 5C70A 2RDQA 2WYFA 1RHI1 1FX5A 2IVIB 2E26A 1LHWA 1RUC2 4LKFA 3ZN5A 4EWAA 2V5DA 4BYYA 4LO4B 1QJU3 4GB33 1DZQA 1POV1 3S6PA 3H8OA 4YM2A 3PUAA
chains in the Genus database with same CATH topology
1RUG1 4I30A 1LGCA 1Q8QA 1SCRA 3LA3A 5CFDC 5E16A 2GNDA 3K51A 1DZTA 5J96B 2ZBJA 1OPMA 1PZ7A 4CDWB 5E1RA 5JIUA 1U5ZA 1CVNA 5KHGA 2Y0IA 1TME2 4EWDA 1N1VA 3QOPA 2UYAA 3MLJA 4KU8A 3ZFEC 3ELNA 4IV1B 3AYEA 4AI0A 1RMU1 3PVBB 3KT1A 1C5IA 1JBCA 4I09A 4WM8B 2WIIB 3S7IA 4RFT0 4F7ZA 5C6CA 1MACA 4RR3A 2FZ2A 2VQAA 3ACLA 2VMHA 4KGGA 1LJ7A 4XJ8A 2A7AA 4R52A 4LBQA 2SBAA 2ZGQA 4OLLA 4AK3A 4L11A 4MX3A 1AR73 1LESA 3PMEA 1OI6A 2C9AA 4PF5A 2GNTA 1CAXB 1DGWX 3GALA 3PMSA 4V1PA 1NE6A 1IS5A 2JG9C 5EWSA 1YYNA 2HWD1 2C1FA 1KXGA 3VBFA 3DV8A 4M0HA 2FQPA 4F83A 5B2GB 5DG2A 4S2HA 5FDBA 5HI0A 4CEWB 4YGCA 3LCPA 2NLRA 4CDUA 3JB4C 2BWAA 4Y1ZA 5HXVA 4FXKB 5DZFA 3P3NA 1LGBA 5BPXA 3AKTA 2EIGA 3NV1A 3GF6A 3V0BB 1BEV2 1OLRA 4S2FA 3V0AB 4HVOA 4M01A 1V9U1 1QQP2 1SEFA 4FPJA 1WLTA 3NKGA 1UZZA 1CJPA 4XEZA 2CAUA 4RA0A 1RUH2 4LLOA 4YW5A 3ST7A 1WLCA 4CYDA 2I45A 4HKLA 1AR82 3L2HA 1XU2A 4U36A 1TMF1 3CJIA 1UX6A 1O3QA 2JDZA 1NXMA 1SLIA 3I2DA 5BV6A 3JD73 2V09A 3JBG3 4I02A 5C8CB 3WW1A 4YVSC 2XLAA 5K0UA 3M2MA 4DQAA 2E51A 4Q4W2 5J3UA 3VBSA 2D6OX 4LBNA 1AF9A 5L7OC 4SBVA 1HLCA 2AR6A 2PYTA 1ZNPA 3ZIWA 3NV2A 3ZXFA 3OF1A 4BOWA 3ZMNA 3VBUC 3SH3A 1Q56A 4COYA 1A78A 1LR5A 4R9BA 1Q5OA 4L97A 2QZ2A 3CLPA 4MH0E 2K9ZA 3KMHA 4Z1VA 4XHXA 5AC91 3RMXA 3QACA 1LOBA 1W2UA 1Y7BA 5CFDA 1UF2C 2RJLA 4LTAA 4YRDA 4XXPA 3N36A 2GDFA 4K3UA 4RQPB 1YCIA 1SFNA 3CU7A 2D6LX 2WZR3 2R30A 4K1YA 1KDMA 1QJX1 4W6YA 4DB5A 1B35C 2B8MA 2VW1A 4FXGB 3H1MA 4ATFA 1H8TC 1DF0A 3ZFEA 4D7YA 2IWGB 4KH9A 1UAIA 2Q8OA 2CYFA 4DMIA 4N90A 3C3VA 5ABJC 4HN1A 3DPRB 1RJ7A 1EYBA 2DCYA 4XFGA 1QJY1 1J58A 3LZZA 4AEDC 3R6SA 3TYJA 3RWNA 1UW8A 3E5QA 2PLV3 1ZZ9A 4FQZA 4MYEA 3UL2A 4FPCA 5LEJA 1OQ1A 2JG8C 1AX0A 3HWJA 5LK7B 3WLUA 1F2NA 2JG9A 3ZDSA 2HWC3 1OOPB 5H9PA 2PHTA 4R8HA 1OFNA 2XJQA 2RR11 3MPPG 1HXS3 3LA7A 3MFCA 4HKOA 3DL3A 4QPIA 1V70A 1Z7S2 2X8KA 1ZZ7A 4JCKA 4RHV2 3J8F3 1BZWA 1NY72 3KQRA 1AR93 2JEMA 1W6OA 1ND2C 1V6NA 4LR4A 2QZ3A 3IDEA 1KDKA 4OI0A 4MLOA 5FOJB 1AXYA 3GBFA 3KCCA 1D4M3 3VUOA 1HRI3 4PDWC 4JC1A 1UN1A 5I91A 1O4ZA 3WP5A 3FLRA 1DYKA 5CB7A 1R1A3 2GC1A 2ZX4A 4BMEA 3KGLA 2ZACA 4JDNA 3P3PA 2XVLA 4Q4Y1 3IIAA 1UZYA 2R042 5A32B 3VN4A 3KLSA 5J98B 4E4SA 2YMZA 3OD0A 2E9QA 1H2LA 1H2NA 4K8FA 4L99A 2XJTA 4WM8C 2LM3A 4R9AA 4A2UA 1QNYA 3LWCA 3KS7A 1H4GA 3RSJA 2KM2A 3W9AA 1N1TA 2QVSB 1RINA 4YVSA 4B4RA 3HN1A 4JV4A 2D3RA 5T55A 1A3KA 4XFBA 1FNYA 1NE4A 2ZCWA 1GR3A 4YZ4A 5T54A 2D6PA 2X5IA 2XL9A 1N3QA 1OA4A 4HETA 4YZ1A 1ZYBA 5L7OA 1FOD3 1AYM1 4CP0A 3D4KA 1U12A 4Q4X1 2Z42A 1H9PA 5FO9B 3VHPA 4LULA 1ZRCA 2AUYA 4FTEA 1WLWA 1H8VA 1R081 3WZ1A 2XBO1 4XQWA 4AVBA 2R072 4D7SA 1ZZBA 3AK0A 3RDIA 4LBJA 4XBQA 4FQ4A 5D1IA 5FMOL 3ZYGA 4AHWA 2BQPA 4WVWA 2ZHLA 4CDQB 3MF9A 4XFIA 3FMGA 1PMIA 4IETA 3QCWA 5KXEA 2BBVA 1RUE3 1W6QB 3WR0A 2R32A 2XLGA 1GV9A 3WNXA 1VJ2A 2GNMA 1H8TA 1NA1C 1H1MA 5CU1A 2PN5A 1NG0A 4FCAA 5BNPB 1EV12 3FBMA 1RGSA 2GH2A 3D6EA 1KRIA 4QGNA 3RYPA 3AFGA 5ABJA 1CONA 2PA7A 2ARBA 4Y5Z0 2WNUA 3MI8A 4YGBA 2JJ6A 1ZBE3 4AEDA 1VAKA 1QJU1 4GB31 4PLOA 5JVVA 3WXPA 5T5JA 1ASJ3 3LA2A 4D94A 2DFCA 5BNOC 2JG8A 2RS53 4FBFA 2E7TA 2RS33 4LBKA 2Q5TA 3SNMA 5C8CC 3FJSA 4JGYB 3AKQA 2PAMA 5D8AB 2ZZJA 3VBSB 4KL1A 1FI2A 3CL1A 3R4SA 1NQDA 2H0BA 1PGSA 2ZGSA 1COV2 1F5JA 3IPVA 1CAVA 1DGRA 3TRSB 2BYVE 1R093 2D3SA 1WMFA 2DURA 4H14A 1ULEA 1BQPA 1ND2A 1MQTB 5GLVA 1O5UA 2E53A 1QWRA 3BALA 4KWKA 1NOVA 2BNOA 4M3CB 1VBD2 1VP6A 3M3OA 3R05A 2IXKA 1BKZA 1DFQA 4QU2A 2X53S 3RYKA 2RS13 4F8AA 1LKNA 1IQAA 3AZXA 3MPBA 2HWB3 4QQHA 1AR71 1ULFA 5HBAA 2HWF2 4YZ5A 1Y9QA 5A3MA 4K7JA 1VBA3 3WHTA 4GULA 3NKTA 4LO8A 5ACA3 1N3PA 2OZJA 3B94A 2NPIA 4I01A 2ZMKA 4XZPA 4IV1A 1YHFA 4I3PA 1DHKB 5JI7A 2YHJA 4WM8A 2AYHA 4NWWA 2ZPXA 4J1XA 4CDXC 1AYN2 2QUOA 2VVDA 1AL0G 1QHDA 3BIWE 3ECQA 4GA9A 4COZA 1C8M2 1MZFA 5KXDA 4XTPA 3VDDB 2JKBA 1DG6A 1MEC3 1H2MA 1RUG2 1PO22 3SLIA 4QMAA 4WZFA 1QGLA 3NJZA 1VAVA 1ZM1A 3GHNA 3B5LB 1KJLA 2XLFA 5BY5A 2ET1A 1XYOA 2B7YA 1OHFA 1FPN2 4HL0A 4YW3A 5GZFA 4A7YA 4X8NA 1XNBA 2IXHA 3RRDA 4XE9A 3MIBA 3USSA 3VHRA 1C4RA 3ZMOA 1VRH2 4DXZA 1ULDA 3URFA 1KS4A 3QLQA 4BLIA 2DVFA 4GKXA 1NYWA 1RUC3 2EXIA 5I0UA 4FPEA 1OFSA 2YPJA 2QE3A 3JD71 3JBG1 4XIOA 5JSOA 5DXDA 2XVKA 2Y26A 4XOGA 5EYXA 3V0AA 1V00A 3AP9A 5GM0A 3PJQA 3S7EA 5GLTA 2OA2A 3O5SA 1RVF2 2BTVC 2QCSB 5DUWA 3ZO0B 3ZSKA 1TME3 3OTFA 2G4IA 4ZU5A 3JB8A 4XFAA 1WW6A 2ZGTA 3KSCA 1CPNA 4GMP3 1PO12 3WOGA 1ZZ6A 4XFFA 1CIWA 3M7AA 1MR5A 5FCCA 5FOBB 3LOIA 4NHKA 2BGCA 2PHWA 2VMGA 1LU1A 1QXRA 2XWJB 2WSUA 3VBOC 5C8CA 5JOWA 4HZFA 5FLJA 5CAZA 2WZR1 3DGTA 1LB2A 4Q26A 3WG2A 1HQWA 1EAH2 2AGSA 4JRLA 1JN2P 2A71A 1H4HA 1M4WA 3VBRB 4DZGA 3U4XA 2ZGPA 4AQSA 3VBUB 3M3CA 1BBT2 3SH4A 4L9BA 4AF9A 4I0BA 3WQ7A 5A3LA 1V9U2 2VH9A 1HQNA 4UW5A 1I1EA 3ZFFB 1JTZX 2YYOA 4LO6B 2ZMLA 3OPZA 4AVSA 1LHNA 5FPXA 4FOQA 1AL22 2OPKA 3B00A 1D2SA 3KB5A 1G9FA 1W6MB 2DUQA 3ZSEA 4RQPA 4LUKA 2PLV1 3HR9A 4GWNA 4UBHA 5K9YA 1BVP1 5JI9A 3POSA 1B35B 1VB2A 3NW4A 4YLZA 3W59A 4D7TA 2XHKA 1MVQA 3E6DA 3JZVA 4AGRA 1OPOA 1H8TB 5FQ0A 4OHYA 1DQ1A 4KWLA 3RZZA 4Q27A 2VPVA 1BEV3 5LRRA 1V6OA 2HWC1 3JQXA 3WD5A 3FLTA 5BNPC 3OY8B 4IEYA 4KGQA 1QQP3 4NOTA 5ABJB 1RUD2 1HXS1 2HEWF 3TAYA 1ZRDA 5HCAA 3AMPA 4XFCA 3TNQA 5I93A 4P9LA 3DPRA 1QY4A 4LA3A 4CDXA 4QGLA 2ETEA 3J8F1 1AZDA 4AEDB 1AR91 3WT3A 3E6CC 4P9IA 1F8VA 4XQ4A 1AR83 1DYPA 3Q9OA 2JG8B 4YGEA 4BQ1A 1XRUA 3DF0A 1SLLA 4IEVA 4M0NA 4YSFA 1D4M1 3AZZA 1IS3A 5EYYA 1HRI1 5CIRA 2R49A 3WDVA 3ZYRA 2ZGMA 1EPZA 3RNSA 1DU3D 4E4DX 1ENXA 5D8AC 4EN8B 2YGMA 1QOOA 3JCIA 4Y1YA 5JIAA 4BCUA 1R1A1 2GZWA 4Q4W3 1O91A 1KFXL 3O0VA 2TEPA 1J3QA 4W6XA 2G9FA 3ZIXA 1QJX2 1UL9A 3VZOA 4FTSA 3CEWA 4AEMA 2ZJCA 3WDYA 1ND2B 1VBB3 3B9IA 5CVRA 4YFZA 3LSEA 5F6KA 3CF6E 1MQTC 1MS0A 1V6MA 2A6XA 2R6QA 1HIXA 2XH6A 3GZAA 3ZYJB 4PDWB 2MHFA 2IXCA 3WDXA 4UW6A 3GZUC 3M4FA 1C5HA 1O4YA 1QJY2 2UURA 3QH6A 5H9RA 3T2TA 2DUPA 4FP2A 3H3UA 4EN0A 3IBMA 1FOD1 3GBGA 1EY2A 2FZ1A 2W52A 4N7UA 5I0TA 1N47A 5A33B 3H3ZA 4AVCA 2D40A 3OYWB 1D4VB 5T5LA 3MZHA 1U5XA 3A0NA 1C3HA 4GALA 2B46X 2ZS6B 5A32A 4XF0A 1HRV3 2ZGOA 4S2DA 4I2OA 1UPSA 1SBDA 3RG0A 4Y4YA 4EN7B 4AXOA 1VALA 2RR12 2JD4A 1OLQA 1RITA 4BIOA 3U10A 3NWKA 5E89A 4QM9A 5DZGA 5I8SA 1MZ5A 4AWDA 1F5FA 3R4DB 2E6VA 4OFGA 4OHWA 1RUE1 3GZTB 5I0RA 4AE2A 4FAGA 1HW5A 2CGNA 2WQZC 4IEZA 3VDDC 4BHPA 4XILA 1PGL1 1EP0A 3USUB 5LEKA 4B3NA 1DQ2A 4B7EA 5GZEA 5AFBA 2ZKNA 5T5PA 1UCXA 3E6BA 4RL7A 5IK7A 4BE3A 5F5QA 3BB6A 4Q4V3 4CEYC 2ZMNA 1HKDA 1WD3A 1QOSA 1Z7S3 1ZBE1 3MLLA 5FBZA 4RHV3 4MXWA 1PK6C 4Q4Y2 4EN9B 3APBA 2PELA 2TNFA 4CDQA 1CX4A 1U5YA 2XJPA 4FPOB 4LBMA 4CP1A 1ASJ1 1ZA4A 1W6QA 2RS51 1W6NB 2Z2SB 4JDOA 1G9DA 2RS31 1YI9A 3ZSMA 1NA1B 2QDRA 4RD7A 2UWAA 2WFF2 2XGXA 2B42B 1LCLA 4BM8A 2GAUA 4KG8A 5BNPA 1B09A 1LGNA 4K1ZA 3ZFGC 1PGW2 3O12A 2GMEA 1LHVA 1V6IA 1R091 4Q4X2 2CWMA 2TBVA 4NPRA 3HBZA 3MYXA 2R043 5L73A 4X6RB 3ZYPA 2DFBA 2G9GA 2CY6A 5BNOB 1TE1B 4Q1RA 2VNGA 2P37A 1MS9A 1SCSA 3I54A 5J7MA 4IQPA 2RS11 4PBPA 2VW2A 4JRAA 3X29B 5I0SA 4JGYA 2HWB1 1PZ8A 5D8AA 2RM21 1LOGA 2R1DA 1RUF2 3ZSLA 3M3IA 3MW3A 5CNAA 1Q8PA 2HEVF 1VBA1 3BODA 1AJKA 2D5HA 1UIKA 3MGUA 3I59A 4AG4A 5ACA1 2NP0A 1PVC3 1CAWB 3AP5A 3VBRC 4Q0VA 3ES4A 3A0KA 3HD8B 1GLHA 2VMIA 1OKQA 3FC0A 3KD4A 3VBHC 4TWTA 1XQNA 4HLTA 2XKPA 2EAKA 5H9SA 1MQTA 4YM3A 2NN8A 3ZFFC 2Y38A 2W08A 4K9SA 1FMD2 1X33A 4Q0UA 2WC2A 1ZBA2 1LHOA 2R073 4M3CA 3BU7A 1J1LA 1KS5A 1SACA 2ZGNA 4XBNA 5EFUA 4AFBA 3V56A 2A6WA 4COVA 3N7MA 2Y0OA 1MS1A 3K48A 3ASIA 1Z78A 3LAGA 4AI1A 4IERA 5FQ0B 4Y1UA 4GKYA 1MEC1 5BUVA 2P17A 1OA3A 1ONAA 3AYCA 1XNKA 5JSRA 2YGLA 3GNEA 4XDQA 2IZWA 5F9TA 5K7PA 5EV7A 3AP7A 2E7QA 2PAEA 4C1XA 2NQYA 1EV13 3WVJA 3GHMA 4IEPA 1VBE3 2VQ0A 5EXOA 4DY3A 4CDXB 3THPA 1QU0A 1WCKA 2P34A 4C1WA 2E7AA 2WT2A 3NL1A 1PIV3 3D0JA 2W0XA 1RIRA 1ULCA 2WWSA 4C90A 1RUC1 2GMPA 4ZXKA 3TN92 4OHVA 1O3TA 1LEMA 1REFA 3OJBA 3VDDA 1YJKA 2XVGA 5KHKA 4LNVA 4FPHA 2VW0A 4DNYA 4NN0A 4HT1T 2A73B 2YV8A 1VBC2 1TME1 2LUWA 1SLCA 3AB0A 4P14A 1JH5A 1COV3 2C5DA 4DRVA 3UKVA 4E9KA 3A4UA 1XYPA 4GMP1 4NO4A 4OZXA 1S2BA 3R4UA 3IT8A 4NHMA 4TYSA 4HPKA 1RUNA 2B9UA 4Y1XA 3FX3A 2MEV2 1W0OA 1T6GC 1WLDA 4X6QB 4FOVA 2QFEA 4R9DA 1QJZA 2ZX3A 1VBD3 3WP6A 2HWE2 2H6BA 4IESA 5KC5A 4YVWC 1AVBA 1HQLA 2XJVA 3PVNA 2IXLA 5FTTC 1AX1A 4MGZE 2HWF3 3WQ1A 1JYCA 3E5XA 4E2QA 3CO2A 1JOJA 1Q8SA 3OD4A 4XW3A 1JHNA 5DZEA 1POV0 1QH7A 1PHMA 2OVUA 4YZ3A 3ILNA 4YW2A 5C9AB 1CJDA 2W68A 1RUOA 1LHUA 3IMNA 3VZLA 3H9AA 4MGIE 2QDNA 4XIKA 3VZNA 3VBOB 4AI2A 1S0DA 1RB8G 1LOFC 2DCKA 1AYN3 2R062 1GQHA 1ENSA 4N53B 1BMV2 3AMMA 3MIHA 4JTNA 4QQPA 4ZU7A 1RC6A 2VOKA 4LEJA 5KHIA 2IXIA 4XJUA 2A3XA 3EBRA 4CRQA 1APNA 3LKJA 1C8M3 4LHLA 2PHLA 5JAXA 3VBRA 5JDBA 1BEV1 1LTEA 3UKTA 3V65A 3VBUA 4QGMA 3JD72 3JBG2 3B69A 2NM1A 3VBHA 1PO23 1QQP1 4PCRA 5DUXA 3WW4A 4OHXA 3POYA 4AYUA 3B02A 4KBBA 1GZWA 5CG8A 2ZGRA 3ZFFA 2P3KA 1S0JA 1DQ4A 3FHIB 3RI9A 1AR62 2RMU2 4IV3C 4GH4C 1FPN3 5FLIA 1H2KA 4MXWB 3NAPC 4KG0A 3SITA 3WG1A 3O14A 5GLUA 2ZGLA 3JU9A 1H0BA 1VRH3 1GFF2 2VY0A 1W6MA 3VHNA 4JAAA 1AR81 2ZABA 2GALA 1B35A 1GQGA 2D6MA 5GLWA 1UU6A 4UW3A 3U11A 1NLSA 2ARXA 4HK8A 2CV6A 4RS5C 3WX5A 4LE3A 4Q29A 1V6KA 3WUDA 4XXAA 1QH6A 1QXPA 2XG3A 3OY8A 3S30A 3GYDA 1X82A 4Q4W1 3H0OA 2GN7A 1ZRFA 3D0SA 1ZZ8A 2PQQA 2EA7A 1RVF3 2O1QA 2HKXA 4QQOA 5I8YA 2BFUS 2CTVA 3AKPA 5C4WC 3ZXAC 1ZVFA 1XNDA 1WMDA 1JYIA 4F3JA 5L19A 1YIFA 1VBB1 5T3NA 2ZA9A 4HBNA 1CAUB 1YJLA 1GYKA 3SCFA 1J3RA 4MGKE 1YIPA 2BVBA 3U07A 4WVZA 2O0OA 4AGGA 1X7NA 2DCJA 1SDWA 2A3YA 2A75A 5GKAC 2R0HA 1H9WA 4WVVA 2OZ6A 1SLTA 2MPFA 4IL7A 3AZYA 1RUI2 1UPIA 3ZXEA 1EAH3 1ULGA 4B8EA 3I59B 3IM0A 3PLQA 1A6CA 2JE7A 2XB6C 4AGVA 4ZU4A 4JTOA 3TB0A 1NLRA 1C1LA 3HQXA 3I8TA 4XTMA 1HRV1 4FPGA 4HK9A 1BBT3 5CFCB 2Q1ZB 2WS92 1LEDA 2D44A 1RUJ2 4H3WA 3VZJA 1KITA 5HCFA 3ZSJA 1S1AA 1DGLA 3HT1A 2DU1A 1H1AA 3NVCA 4PDWA 1FNZA 5KHJA 1BJQA 2CAVA 4TSVA 1PM7A 4YVWA 2EXJA 1AL23 2GC2A 3WG3A 2RM23 1W39A 3H7YA 1FV2A 2E63A 4IEOA 4PIXA 2OW4A 4BWOA 2UY9A 5A33A 1S0IA 2DVDA 4G9SB 1GKBA 5DDJ3 4B4PA 3OYWA 3RJRA 1YRZA 5CA6A 3UK9A 2BVVA 2PHXA 2ZAHA 1YFWA 3PNAA 4N9HA 4HANA 3KCXA 2DTYA 2Q30A 4MUVA 4HVQA 4FOYA 2F4PA 4LE4A 2YY1A 1RUD3 1KJRA 4Q4V1 3M3EA 3AKSA 5JOXA 2A6ZA 2FMDA 2YUEA 1Z7S1 3AZVA 3AP6A 2BEOA 5CBLA 4RHV1 4B7KA 1LOFA 1QMJA 3WP3A 1NY71 4NR1A 1N1YA 2GU9A 1J3PA 4QQLA 2DU0A 2W39A 1GICA 1ENRA 4GXLA 4HSLA 1RHI2 4HFSA 2VVFA 1GNHA 1YO8A 4BPZA 3SH5A 3WINE 1REDA 1V6LA 4ITCA 2WINB 3OCPA 1GZCA 3LOBA 3AP4A 4P9GA 4EV0A 3M8LA 4L92A 3USUA 5IK8A 1O3SA 2DVBA 4XMAA 1LOEA 5JOYA 1LOAA 3EO6A 2UU8A 3FBYA 4CEYB 1NQJA 1WW5A 4YW1A 2JECA 2NMNA 4N7IA 4E4ZA 2OUJA 1PK6B 3NAPA 4EROA 1NXD1 2R041 3O7OA 4HPKB 1SLAA 1RMU2 4XMIA 3R0RA 3WUCA 4JVAA 1UIJA 2ZTNA 3HIFA 3N7LA 5T50A 3VHOA 4PLMA 3WCSA 1W6NA 4GWMA 4XJAA 4RS5A 1NA1A 4HMZA 2ZX0A 4QHBA 1IOAA 1SBFA 1QNWA 3D5OA 3ZFGB 1PZ9A 2VECA 4N43C 2IFWA 3LGRA 2JENA 3M3QA 3BTAA 1DDLA 3DUIA 1PVC1 4GMP0 2CGPA 4XJWA 1ENQA 1NCRC 1AUYA 2WNVC 4MVTA 1FAYA 1ZREA 1X8MA 1IS6A 3TOJA 5CADA 3WY6A 2ZHMA 3L9JT 2EXHA 4ASMB 2HWD2 3KGZA 4IXLA 5C9AC 2VVEA 5BNOA 3UKNA 1AXKA 2CNAA 2R071 1OMIA 2QJVA 2A6YA 4Q0PA 3DN7A 1QXJA 1D0GA 4N53C 4EJRA 2ZAAA 3AXEA 3RYRA 5JZGC 2GC0A 3VKFC 2WSVA 5GLZA 3E5UA 2RS52 1CAWA 2C0ZA 3VBHB 5FPZA 3SXWA 2NYYA 2ET7A 1EV11 3IN9A 1DGRN 2D7FA 1GZWB 1C57A 1VBE1 1X36A 1ND3B 4KNCA 3FFQA 3J4UH 1HDKA 4YG0A 2OIIA 1YFXA 2PHRA 3VL8A 1PIV1 1CQ9A 5EZWA 1A8MA 1U0AA 4P9WA 2WNEA 2JX9A 4Z07A 3POWA 3VZKA 1Q43A 2LALA 1TMF2 1MZEA 3OGGA 1GSLA 1AXZA 2ZZQA 2WFF3 1XXNA 1CPMA 5K8SA 3NV3A 1WBLA 3RJ2X 3EXUA 5JPNB 4LHNA 4XBLA 2HWB2 3SCGA 3D8CA 2ZHKA 1COV1 1UU4A 2WLPA 4PQ9A 4OI2A 3BCWA 1N1SA 5FO8B 4IEUA 3VGIA 1RUH3 2ZX2A 4LBOA 1K5MC 3KM5A 4AEKA 2IC1A 1RL3A 1DQ5A 5C8WA 4ES9A 4G3YC 5T52A 2TUNA 2P3IA 4FO9A 1XE7A 1OSGA 3VLBB 2PHDA 3WDWA 3N7JA 4G4FA 3ZXLA 4Q0QA 2Z5WA 1VBD1 5AC92 1G86A 1LENA 2YROA 3ZYIB 4COUA 3HAGA 5EJ3A 2BPA2 2DCZA 2HWF1 1MVEA 4URTA 4YFWA 1PNGA 1LULA 1WMEA 4TZDA 2CWSA 2VULA 4ONUA 4Y1VA 1MEC2 3TBDA 1SBEA 5CFCC 4DS0A 2DVGA 1VAMA 2WL1A 2VUJA 1YWKA 5K0UC 4CZSA 4Q1PA 2ILMA 2D5FA 3KZ4C 1FMD3 2AENA 1AYN1 1E57A 4Z92B 1ZBA3 4YVWB 1PNFA 1DQ6A 2XUMA 2H0VA 1S0EA 3KCYA 2RJKA 4N43A 1C8M1 2P3JA 4AHYA 5SV5A 3B9CA 2WZPP 1H30A 2Z79A 4LA2A 4Y22A 1O5LA 1G6NA 1IGOA 3ZN4A 1NCRA 1O7FA 1UD1A 2WNVA 1WW4A 4FTBA 3MEPA 1PO21 2GN3A 1CESA 4LUMA 4MV2A 3EHKA 4WVMA 3SHRA 1S0CA 1FXZA 4E2SA 4M3CE 4P5HA 4XJ9A 4AFMA 5C9AA 4S2GA 3NO8A 1RJ8A 5JR7B 4KU7A 3MIFA 2KA3A 1S0GA 3MW4A 1FPN1 3RPQA 1TNRA 3VBOA 5C33A 1FYUA 1W6PA 3OGJA 2ZHNA 1DLLA 4NWVA 1EPWA 1VRH1 3SISA 4QPGC 2A5ZA 1Q8OA 4N53A 5GALA 3TN93 3ZN6B 2VGDA 3WP4A 5JZGA 1SLBA 1G8WA 4I0WB 4Z2WA 1GZ9A 1WD4A 1TEIA 3WG4A 1BXHA 1U5IA 4ISQA 3UV9A 1RVF1 3GBWA 5JCTA 3JUUA 2H6CA 3H1YA 1VBC3 4RGAA 1VB4A 4IV3B 3QH7A 4GH4B 1GBGA 2V73A 3NAPB 3AKRA 4ES8A 4D3WA 2R0FA 3IDCB 2BW8A 1PO11 3H8UA 2BNMA 2DWRA 2FHRA 3MIEA 2MEV3 4COWA 4RS5B 3N35A 4QQ2A 3HT2A 3OBTA 4QPIC 3MDPA 2DUOA 1QKQA 1UKRA 2HWE3 3N4MA 3B7MA 5GZCA 4XHBA 1EAH1 3ES1A 4Q8KA 4UXAA 1NZCA 1CN1A 5J37A 3PHMA 3WW3A 5C4WB 4FOWA 3BOWA 2UWBA 5FMOS 2WA4A 1AYM2 1R1ZA 5F6LB 5IT6A 1K5MA