5GJ6A

Functional and structural characterization of p[19] rotavirus vp8* interaction with histo-blood group antigens
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
160
structure length
160
Chain Sequence
VLDGPYQPVAFKPPNDYWILVNSNSNGVVLEGTNNTDVWVAIISIEPNVNSESRQYSLFGVNKQITVVNTSNKWKFMEMFRNNSNAEFQHKRTLTSSTKLVGILKHGGRLWTYHGETPNATTDYSTTSNLNEISVTTYAEFYIIPRSQESKCTEYINTGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional and Structural Characterization of P[19] Rotavirus VP8* Interaction with Histo-blood Group Antigens.
pubmed doi rcsb
source organism Human rotavirus a
molecule tags Viral protein
molecule keywords Outer capsid protein VP4
total genus 44
structure length 160
sequence length 160
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2016-06-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5gj6A01
2GMPA 1UZYA 3H0OA 3INAA 3SH4A 1ENRA 4XILA 5GLZA 1D0HA 2D6MA 5KXDA 2ZGTA 4GWMA 1WLCA 2D3SA 2E6VA 2E7QA 3N7JA 4YG3A 3ZYRA 1LU2A 4FOVA 2UWCA 1N3QA 4Y1UA 2TEPA 3V0AB 2CTVA 3W58A 1GZ9A 1SLCA 2PHWA 3OY8A 1UMZA 3AYCA 4OZXA 3WG3A 3N36A 1W0OA 4BMEA 1QGLA 3AP9A 2E53A 4DQAA 4GXLA 3AK0A 2NMOA 2P3KA 2P2KA 3NV4A 1N1TA 1PZ9A 3VKLA 5IK7A 2B7YA 1MACA 4LBMA 1N1VA 3ILFA 3B9CA 2WQZC 2GDFA 1JW6A 1LULA 4I30A 3LSEA 1C4RA 2CYFA 2DUPA 3A0KA 2R1DA 4W65A 1JYIA 3B00A 1N1SA 4XTMA 3QCWA 3AXDA 3I4IA 5DUVA 1S0GA 2I2SA 2WNEA 3JUUA 2D44A 5GLWA 1G86A 3ZSMA 4GA9A 2ZABA 4BLIA 1WBLA 2G4IA 3AJYA 3O5SA 3RMYA 2VUAA 2R0FA 3WCRA 3MPPG 1W6PB 4XXPA 3RRDA 2A6WA 4YGDA 4XHXA 1GNHA 2WJSA 1ULDA 3OGGA 5JOWA 4FPJA 2ZGQA 2ARBA 2DTYA 4PF5A 5GZEA 4YW3A 2D6OX 5IK4A 1WW7A 3AYDA 1CIWA 5DUUA 3ZPYA 2A5ZA 1ULEA 4XJAA 1AVBA 1IS4A 1LOFC 4LBJA 4MYEA 2PHTA 3M3OA 1LECA 3IM0A 2ZA9A 4JRAA 3ZXEA 4ASMB 3SH5A 1QNYA 3FUQA 1GANA 2AH2A 3OBRA 4Q26A 4YZ3A 4YGEA 3T1LA 3VKNA 3IPVB 4Y20B 5H9QA 3ZYPA 3I8TA 2DVAA 3R4SA 4FOYA 4Q1RA 5GLTA 1W6MA 4CRQA 4YFZA 1BKZA 2AENA 3MEPA 4AGGA 4M3CB 1WW5A 1H9WA 2ZAAA 1BQPA 1JXNA 4LBLA 5KXCA 5E89A 1V6MA 3C2UA 2A6VA 4H55A 4Q2FA 2LALA 3USUA 4Y24A 5CAZA 1LOFA 1U0AA 3N3HA 4DPNA 2W08A 1GZWA 4BPZA 2NMNA 2AYHA 1Z0HA 2ZMKA 3VKMA 1S0FA 4LBQD 3OYWB 3FFZA 1G9DA 4XJWA 2ARXA 4CZSA 5IUQA 1JUIA 1DQ4A 4U36A 3WCSA 1CPNA 1VAMA 4R9AA 1AF9A 3V0AA 4K21A 3SLIA 2EXIA 2EF6A 4ITCA 4YW5A 1LEDA 2NM1A 3BODA 1DIWA 1Y7BA 4XYXA 1FATA 2D3RA 3HR9A 4GKXA 3B01A 4PQ9A 1UKGA 4LBQB 1KRIA 4WZFA 4UW3A 2OUJA 1MZ6A 3PVOA 5E8AA 1MVQA 1BXHA 1QNWA 1V6JA 1HKDA 1UAIA 4Y1YA 1CESA 4ISRA 2ZGMA 2JE9A 5T5LA 1W6OA 2ZGSA 4FPYA 1ULGA 3BOPA 1ONAA 1FX5A 4YG6A 4IQPA 3UK9A 2YZ4A 3WG1A 1V6KA 1LJ7A 4GALA 1JOJA 3WDXA 1G8WA 3WOGA 4XMIA 1G7YA 4M00A 1YRZA 2CY6A 2D6LX 3BIWE 4M3CE 2JECA 4XJ8A 1F31A 2GMMA 5HCFA 3RSJA 1SCSA 5GZGA 3DUIA 1VLNA 1MS9A 1QOSA 1WW4A 1AZDA 1G9CA 4FQZA 2EXJA 3D4KA 1ULCA 2VW2A 3M3QA 4XOGA 4JC1A 3SITA 4YZ4A 4XIOA 2DU0A 1EPWA 3POWA 3AJZA 2EXKA 4YW1A 5GLUA 3SH3A 4FP3A 4RL7A 3WVJA 1OQ1A 4R9BA 5GALA 1LENA 2WLQA 4LBOA 2UWBA 5F5QA 1I3HA 1Q8PA 5CNAA 5LK5A 1ULFA 4M01A 1YYNA 3A4UA 4BQ1A 1KDKA 2A75A 1WD4A 2PHRA 2JKBA 3OPZA 4FQ4A 3AX4A 4PCRA 3WV6A 2VH9A 4C1XA 2XG3A 1C1LA 1S0EA 1WLDA 1GNZA 5GLVA 2ENRA 1CONA 2ZHMA 2D43A 1X50A 2ZHLA 4NO4A 4RA0A 1RITA 1GZCA 2KM2A 1KDMA 1DQ6A 2ZACA 3KQRA 5T5PA 3WZ1A 5DG1A 3WG2A 1NLSA 1SACA 4PBPA 5JLVA 4K1YA 1N3OA 2R1BA 4FPLA 3ASIA 5KXBA 1LHUA 1JYCA 2GMEA 3WDWA 2FMDA 1GSLA 5L73A 3MW3A 3V0BB 1ZM1A 3UJQA 1GZWB 3VKOA 3O0VA 4FPCA 1AX2A 2YXSA 1FV2A 1UPSA 4WVWA 1ZA4A 1IS5A 1N47A 4U2AA 1LOBA 3QLQA 2GN7A 4L8QA 3OY8B 3W59A 1DLLA 2ZGLA 2D3PA 1DHKB 1DQ1A 1LGNA 2NN8A 1JN2P 3U4XA 1ENQA 4XMAA 2P3JA 1CQ9A 3AXEA 2CNAA 2PHFA 4YZ2A 5HCAA 4HANA 1JHNA 3LSDA 1UZZA 1LHWA 2A6XA 2GNTA 3HMYA 4YW4A 1CJPA 4Y1ZA 3WNXA 5IK5A 3R4UA 2EXHA 2A6YA 1APNA 1FYUA 1LTEA 2DTWA 2GNMA 2WT2A 4FVVA 5H9PA 4ATFA 5EXOA 5GZCA 2D6PA 4YGCA 4ZKTB 3B3QE 1A78A 1V6IA 5GZDA 2ZZJA 3UJOA 3WDVA 1G9BA 2RHPA 5T50A 4M3CA 1N1YA 1UN1A 5CB7A 3ZSJA 2NP0A 1QMJA 1W6OB 1S0CA 3ZXJA 2W52A 4XJZA 2DVBA 1MS5A 3FUOA 4AYUA 3V64A 2YROA 3DGTA 5JDBA 2WT0A 3M2MA 4YLZA 1NXD1 1G9FA 2R0HA 4Y22A 2FHRA 4XDQA 1BYHA 1BZWA 4YM1A 3RMXA 3T2TA 2EALA 2UU8A 3OJBA 1OKQA 2ZGUA 4ZXKA 2DVFA 1Q8OA 3APBA 1R1ZA 5JVVA 2DWRA 1Q56A 3AFKA 1DYPA 1SLBA 3RG0A 2AUYA 3IN9A 4LBKA 3SNMA 4YZ5A 3M3EA 1DQ2A 3N7LA 4LBNA 4DFSA 1GICA 2JDZA 3IMNA 3NV1A 5H9SA 1WUVA 1WLWA 5JMCA 4DRVA 3AYEA 1AXZA 5T55A 2EAKA 5IK8A 1GYKA 3WUCA 3FLPA 1KQRA 2VW1A 2A3YA 2WT1A 2W39A 4DS0A 2C5DA 3TB0A 1MS8A 4DRRA 2R16A 1IKPA 5GM0A 1MZ5A 5F9TA 5EYYA 1W6QA 1W6NA 3AZWA 1LU1A 2GNBA 5GJ6A 2DUOA 2ZGNA 2ZMNA 3AZXA 1UL9A 2GN3A 3HN1A 5KXEA 3VUOA 1GV9A 3CNAA 4AGVA 5JOZA 1QOOA 2E7TA 1SBEA 2YMZA 2VXRA 1Q8SA 2PHUA 1TEIA 2YV8A 2CWSA 2WSUA 3L2YA 3AZVA 1LHOA 2ZGOA 2ZHKA 1QF3A 2ZHNA 4P9YA 2DVDA 4SLIA 3O0XA 4BMBA 2ZKNA 4FOWA 1QU0A 1SLIA 1XQNA 5DZEA 2A3XA 1VALA 3AP6A 4FPKA 2P3IA 5T54A 1FAYA 4ATEA 1VAVA 2UURA 4Y1XA 4Q27A 1LEMA 4BM8A 1QDOA 5DG2A 2A71A 3N7KA 4YFWA 3JU9A 1YI7A 2Q5TA 3SISA 1LHVA 1LHNA 2D6KA 1GKBA 2H0BA 1H30A 5DUXA 1IKQA 3NWKA 3VV1A 1AJKA 1Z78A 1WD3A 4Y20A 3TAYA 2DYCA 1V6NA 1A3KA 2DVGA 3FBYA 5CBLA 4FPOB 1DFQA 1LOEA 1HLCA 2A7AA 3ZXKA 5IT6A 3N7MA 4AGRA 1QDCA 2P34A 4Z8BA 1C57A 3M1HA 1KITA 5DZGA 4XBLA 4XE9A 3USUB 3MW2A 1W0PA 3AYAA 2CL2A 3ILNA 4TYSA 4Q1PA 4YZ1A 1I1EA 4M3CF 3NV3A 2ERFA 3O12A 1IOAA 3WHUA 1O4ZA 1SLLA 2SLIA 4HL0A 4Q8LA 5T5OA 1ENSA 5JOYA 4P9XA 3PVNA 4LBQA 1UX6A 1SCRA 1O4YA 1SBDA 5FRAA 2DUQA 3NV2A 3PVEA 3WHTA 4YW2A 3ZXLA 3AP5A 1V6LA 3Q9OA 5T52A 1CPMA 4Y26A 1WBFA 1JBCA 1MS3A 3AZYA 5DZFA 3RS6A 3IKWA 5H9RA 4AVVA 1S0JA 3ZSLA 3IPVA 1MS4A 2ES3A 1FNYA 4GKYA 4WV8A 1C1FA 1WCSA 2JE7A 4Y1VA 1J1TA 1FNZA 4K1ZA 3KM5A 2AGSA 1HQWA 1IS6A 3WDUA 1W6QB 1QKQA 3BTAA 4ISQA 4AWDA 3N35A 4UW4A 1MS0A 4P9WA 1F5FA 2NYYA 3POSA 2UWAA 2DU1A 1S0IA 1SLAA 4PBOA 1AXKA 2PELA 3ENRA 3WG4A 3ATGA 5SV8A 1RINA 1W6PA 4P14A 3LCPA 2A3WA 5EWSA 1A8DA 1DYKA 3A0NA 1AX1A 5EYXA 3WLUA 1LOAA 1PZ7A 3ZXFA 1F9KA 4C1WA 4R9DA 1URXA 1BJQA 3WUDA 1SBFA 1V6OA 1SLTA 2V73A 2A6ZA 3R05A 4YM0A 3GNEA 2OVUA 1OFSA 4BOWA 1WW6A 2YY1A 1S1AA 2D7FA 2W68A 5CA6A 4CTEA 1B09A 2D6NA 1VIWB 4AVTA 1PZ8A 1DBNA 2ZGPA 3RQ0A 1LGBA 2BQPA 2P37A 2GNDA 3FLTA 2JJ6A 1W6MB 3M3CA 2HYKA 1YXWA 2AREA 2LTNA 3AZZA 5HCBA 4YM3A 1QOTA 4XTPA 4XHBA 4XZPA 4FOQA 1W6NB 2PHXA 3B69A 1GLHA 1S0DA 3GALA 4XJ9A 4XJUA 3AP4A 4BLJA 1Q8VA 1CVNA 1DZQA 3V0BA 2E51A 2Z42A 1DGLA 4UW6A 4FP2A 4XIKA 2CWMA 5GZFA 3ILRA 4TZDA 2V5YA 4XXAA 2SBAA 4AVSA 3WDYA 3PJQA 2A70A 4YGBA 5E88A 3OYWA 1DQ0A 3V65A 4FPHA 1LOCA 4Q8KA 1H9PA 2ZGKA 4YM2A 1YO8A 2OUHA 3POYA 1GBGA 1AX0A 3D5OA 1LOGA 1Q8QA 1LCLA 2WSVA 4F83A 2WKKA 3VKFC 1V00A 3OBTA 4NOTA 1IS3A 1MS1A 1LGCA 1LODA 3AP7A 1KJRA 5FREA 3D6EA 2AR6A 4FPEA 2GALA 4WVVA 5DXDA 3FLRA 5AVAA 5JOXA 2VW0A 2NZ9A 1YIFA 2ZMLA 2VU9A 4FPFA 3O0WA 4K20A 3T1MA 4FPGA 2JD4A 2ZBJA 3UL2A 3WDTA 2C9AA 1DQ5A 1MVEA 4UW5A 1HQLA 2ZGRA 2EIGA 4XBNA 5DUWA 3ZSKA 1RIRA 5T5JA 3PMEA 1FV3A 4KBBA 4R9CA 1AJOA 1SFYA 2R49A 4XBQA 5BYNA 1MR5A 1HDKA 4YG0A 4D69A 1G9AA 3ZVXA 1LESA 2DV9A 1S0BA 2XB6C 1KJLA 2VY0A 4Y22B 4JCKA 1AXYA 2DURA 1N3PA 4GWNA 1CR7A 1D2SA 3MW4A 1CN1A 2OW4A
chains in the Genus database with same CATH superfamily
4BU2A 4XFCA 4CEYA 1BMV2 1UMHA 3J9SA 3HQXA 2XQXA 4WM8C 2D6MA 5KXDA 4S2FA 2XUEA 5A3TA 3E1F1 2XVGA 2ZGTA 1U5IA 1WLCA 2E6VA 3JZVA 4HETA 2UWCA 4CP9A 4Y1UA 5FY0A 3W58A 2RVAA 4F3JA 1YLLA 1U5ZA 2GP3A 4JGZC 3SCHA 1UMZA 5JIUA 1W28A 4OZXA 1SMVA 3MBWA 3GCWA 1W0OA 2R6QA 2OZJA 5FPZA 1GP6A 5I8YA 1Q43A 2NMOA 3NJYA 1WCDJ 4GAZA 4KMQA 4ONUA 3GZUC 2R7EB 4DXTA 2P2KA 3LPFA 3NV4A 1OI6A 2RDSA 3VKLA 4MUVA 2PAKA 2XMLA 1UXZA 4LXLA 1GQGA 1MACA 4LBMA 1S4CA 4QHOA 4AZZA 1Y9QA 3EB7A 4XC9A 4MGYE 1JW6A 5FZBA 4CU8A 1IPSA 1OBNA 1OD3A 1RVF3 1UZVA 4B7KA 2HWE2 1GP5A 3MF9A 2B42B 1S2KA 3N9PA 4H3WA 1QJY2 1JYIA 1HRI2 5KHHA 5FAXA 2ZEZA 4LHSA 3QCWA 3LZZA 2WBKA 5DUVA 4F7ZA 4GMP1 1SFPA 2D44A 1TNRA 5K4LA 3WSOA 5A6ZA 4AI9A 1UF2C 1ZBE3 3ETPA 3SCFA 1R081 5AFBA 3LIGA 5E6HA 5CFCB 3E5UA 3O5SA 4R52A 3ZXDA 4QXHA 2D5FA 1W8FA 3A22A 1O8PA 1TG7A 1ULDA 3VBRB 4FPJA 1RUG1 3PMSA 2CAVA 2D6OX 5A1AA 5IK4A 1LAJA 5CKQA 3VDDC 3HVDA 1CIWA 1HN1A 4QQLA 2FCVA 2J1VA 5ANQA 4OQ9A 1OF4A 4MYEA 4EN9B 1RUH1 2V09A 4LK6A 5FMBA 4EWDA 3ZXEA 1AYN3 4BCUA 4Y33A 2PQSA 5HBAA 5IFTA 3THCA 1JYWA 3H1YA 2VD7A 2FZ2A 1RXFA 3Q8AA 2JICA 2A73B 4Q1RA 5FDBA 1W6MA 4DIQA 4YFZA 4MHUA 4BXFA 1BKZA 3L9JT 5FR3A 3IT8A 1U12A 1H9WA 1O5LA 1UY2A 2ZAAA 2JE8A 4LBLA 1NXMA 5FXVA 3D0JA 1V6MA 3C2UA 3MUY1 2AEZA 2OS2A 2A6VA 2WNUC 2WZEA 2LALA 4Q4Y2 5BPXA 3U0ZA 5CAZA 4WM7B 4QD2A 5DQ0A 3N3HA 4HN1A 5FZCA 3VN4A 2W08A 5CFDB 1UPIA 3K46A 4BPZA 4IV3A 3MV01 3RI8A 1Z0HA 1BVP1 2HEYF 2O14A 2PHLA 3J7HA 2YFUA 3VKMA 5IAXA 1S0FA 1G9DA 3H8UA 3FFZA 3BTYA 5EHDA 2ZCWA 4NN0A 1Z7S1 4BIFA 3WCSA 3I97A 1COV3 2H0VA 2VNGA 2QQWA 3NO8A 1PO11 2WFF2 1CPNA 3K4AA 4R9AA 4S2GA 1I5ZA 5LY1A 4W4ZA 1EAH3 2EF6A 5FPLA 3U10A 2I74A 2OQ6A 3BODA 5FYVA 5I8TA 4Q4W1 3VBHB 1U5XA 5K9YA 5C4WB 3MZHA 2D3RA 4GKXA 2OQ7A 2CDOA 2CU5A 1D4M1 2EIDA 4XUQA 3CIHA 4KU7A 5I8SA 1UOJA 2PN5A 5F1RA 4WZFA 1CIYA 1I9RA 2OUJA 1MZ6A 1DZRA 1W05A 3ACFA 4RFT0 2OPWA 1DGWA 4Y1YA 1V6JA 2QCSB 1HKDA 5E8AA 4A42A 4ISRA 2RM22 2ZGMA 3S5AA 5FZFA 1PGL1 1W8WA 4JGYB 4Q4W3 4QX8A 4B8EA 1FX5A 1EYBA 2F6BA 3IDCB 4YG6A 4XCAA 4QGMA 1LJ7A 1C8M1 2PTMA 3VBUA 2BGCA 1AR91 3ACHA 3NAPB 4IERA 3WOGA 2E33A 1O3TA 2R073 3NSTA 4RS5C 2JECA 1VBE2 4IW3A 1E5SA 3DUIA 3LD8A 4V2WA 5FYBA 3HEIA 1ALYA 2ARAA 4Q4V2 1KD7A 1SDWA 4RFRB 1O91A 1AHSA 4XABA 3RZMA 5KC6A 3VBSC 2ZX4A 2WLPA 2RS12 2XHNA 3GJAA 4NE9A 1UOFA 3POWA 3A7QA 2QDRA 1J83A 2EXKA 3BCWA 4YW1A 4LBOA 2ORZA 2VVEA 4DMIA 1I3HA 1QJEA 1ULFA 4M01A 4XUPA 4QXCA 2A75A 4CUCA 1WD4A 2PHRA 1WGPA 2VCMA 2YGLA 4XETA 5LA0A 3WV6A 4ASMB 2XG3A 1C1LA 1WLDA 3MGUA 4BZ4A 1NUKA 1B35A 2BW8A 4O61A 4NO4A 1GZCA 2ZACA 1KDMA 1DQ6A 1VBB2 5T5PA 3WZ1A 1UX7A 3QACA 4SBVA 4G4FA 3N4MA 3VBSA 1NLSA 5FXWA 3N9MA 1N3OA 1S2BA 4A4AA 3LIHA 2B8MA 3WNNA 2VBPA 5FPAA 3WDWA 1K12A 3RZHA 1VBC3 1ZRDA 4H14A 2ADDA 5FPXA 5A7WB 1GZWB 3Q8EA 4LOSA 4FPCA 3B94A 3SKJE 2HWB2 4CDXC 4QPIA 4CSWA 3RZJA 1IS5A 1OA4A 2VMCA 4INDA 1UU5A 1YEWA 2DBNA 2GN7A 1FT9A 3I59B 4KWLA 3OY8B 4L8QA 4PLMA 3WNLA 1DHKB 1ULOA 1BK1A 1JN2P 2QZ3A 3VBFB 2QQVA 2HWF1 1W9FA 4XMAA 1QJX3 3AXEA 4D0QA 1Y3TA 1UZZA 2RS51 5FPVA 1LHWA 3THPA 3HMYA 3A21A 4UBHA 4Y1ZA 4UOJA 3OEAA 2DTWA 2BOIA 2JB8A 4WVZA 4COWA 2Q8EA 1FPN1 5EXOA 1W8ZA 3SQOA 5CZKA 3FX3A 3IAPA 1AL21 2ZZJA 3DCQA 1CAVA 2IVJA 1PIV1 2BNNA 3I2DA 3J7NA 4UXAA 2NP0A 1W6OB 4AG4A 5J7MA 2MPFA 2W52A 5FY1A 3T2QA 1R092 5FPBA 1NQDA 3MIHA 3RDIA 2HWD2 4AYUA 5JDBA 2WT0A 1EUUA 3M2MA 4CP2A 5TSWA 4W6WA 4YLZA 4I0AA 1G9FA 4X6RB 4LNVA 4RR3A 5FOJB 4YM1A 1WCKA 3MUZ1 5BNOA 2EALA 1POQA 3OJBA 1BEV2 4ZXKA 3LDRA 5FV3A 2DVFA 3H3LA 2QFEA 3I3DA 4KG8A 1NAEA 3RZLA 4CP9B 2RR13 3VD5A 2VZ3A 1C5IA 3AB0A 1RJ8A 1YJKA 3IN9A 4XQDA 5FKCA 2X5IA 4YZ5A 4E4SA 1DQ2A 2JDZA 3DKQA 4PF1A 4ARYA 5H9SA 1RUC3 3I7DA 3G7DA 3ON7A 1K3IA 3P1IA 1IQAA 2IXLA 3J7MA 5FLHA 5IVJA 4DRVA 1HN0A 3AYEA 5T55A 5FO8B 3B02A 3CJIA 2D5HA 5IK8A 3ZDSA 2PMWB 4NUBA 3WX5A 2GP5A 4E4HA 2WT1A 1YFXA 2C5DA 2ZX1A 1MS8A 2XLGA 2HYXA 3POGA 1AYM3 5KC5A 3MV11 3N9LA 4Q4Y3 2DCYA 5A3OA 1K5MA 3RVHA 1HRV3 3KV5A 3WW2A 4R4XA 4TTGA 3HQRA 5FCCA 2DUOA 2A1XA 4FFHA 4COVA 1UL9A 1F5JA 5J36A 2VMDA 3VUOA 4YVWB 3SCGA 3ITQA 2YMZA 4HK9A 1T6GC 2W91A 3L2YA 4AFMA 1VMFA 3MFAA 2J1UA 3NNLA 3OPTA 1QF3A 1PK6C 5DPNA 1QH6A 3ZYGA 3SEPA 2XLFA 5KWRA 1XQNA 1RUI3 3J8F1 3KV9A 1VALA 3AP6A 2P3IA 1UMIA 4ATEA 1VAVA 3K4ZA 2BZDA 4CCJA 1W2UA 2TUNA 3VGIA 3UKVA 1LEMA 3PUHA 4BM8A 5A33B 4Q4X3 2VVFA 1QJU1 1YCIA 3AKTA 2RMU2 4O9EA 1NA1A 1JU4A 2XWBB 3HT1A 4P08A 1Y43B 1LHVA 1A8MA 2C0ZA 5CKNA 3OEBA 2BFUL 5FYMA 2IUWA 5JXHA 2XJVA 2QQUA 2H0BA 1H30A 3VZNA 3ZXGA 5DUXA 1GUIA 4LLFA 5BNPC 3VV1A 4A6SA 1WD3A 1OKOA 4DEVA 4QGLA 2DYCA 2Y8KA 1V6NA 2CHHA 4LQRA 4OUEA 1JOPA 2RS53 3LEKA 4FFGA 1W39A 4KWUA 1DFQA 1WCQA 3LOBA 4XW3A 3AMPA 3B9IA 1QXRA 4NAMA 4QGNA 2XL9A 1EV12 3I3EA 4BHPA 3M1HA 1KITA 5DZGA 4K40A 1STMA 5JZGA 4KQ7A 4TYSA 1I1EA 4XF9A 5C70A 5I0SA 1I5PA 3NV3A 1D2QA 1R083 4MSVA 4LA2A 4NPRA 1NKGA 3F2ZA 4OI2A 3BTZA 1SLLA 1UZ0A 2SLIA 5T5OA 1ENSA 3BN6A 4CDQA 3UYJA 5HXVA 1UX6A 2JENA 4J25A 2HWC3 1SBDA 3N9OA 3NV2A 3WHTA 4KU8A 5DABA 4IEQA 1V6LA 1JHJA 3CHXA 4I2OA 3VL9A 4Y4RA 4GB32 2BYVE 4UBGA 5DZFA 3RS6A 3VBOC 1H1IA 1GMMA 2BGOA 2IFRA 1S0JA 5H9RA 4AVVA 3JD73 1TME2 4GKYA 4WV8A 1WCSA 4EZHA 5J09A 3FHAA 5JSRA 5JIAA 3RFRA 4JTNA 3ZIWA 1PMHX 2W2IA 3BTAA 1KS4A 1VMJA 4AEJA 1YQ8A 3URFA 1MS0A 4X8PA 1GNYA 3OUHA 1PNGA 2PAEA 2NYYA 4IL7A 4KI5M 2O8QA 3WW4A 2UWAA 2Y6GA 4NIAA 2B9VA 5CADA 2LS6A 4PBOA 3ENRA 2DF7A 2PELA 3EYPA 4J6GA 3ATGA 3B7MA 4I3GA 4ZONA 3IIAA 3VDCA 4P14A 5EWSA 5JSOA 3P3NA 1DYKA 1AX1A 2QTWB 4C1WA 3WUDA 1L3JA 2XR4A 3DF0A 2XJTA 2V73A 2A6ZA 4A41A 1VBB3 3GNEA 1H2KA 1TE1B 2OVUA 2RV9A 4YVSA 5F2SA 2YUEA 4MXWA 4BOWA 3VBHA 5EV7A 1B09A 1YFYA 1VIWB 1HXS2 1PZ8A 5AC91 5D8AA 4ES8A 2ZGPA 2ZS6B 4XURA 4FTBA 1JZ3A 2QZ2A 4QU1A 1VP6A 3MHZA 3O1VA 4MGTA 3W5NA 4QB2A 3FBMA 3AZZA 2G9GA 4CDUB 4BA6A 2XLAA 4FOQA 1W6NB 4DB5A 4ASLA 1HJGA 4QMAA 1RUE1 1XNBA 5BY5A 1CVNA 2Y38A 5FZ9A 5C5TA 1Q3EA 4IEUA 4K8FA 4UW6A 4FP2A 1A34A 1AR71 1EAH1 2WZ8A 3VB9A 5CFCA 2YBSA 4IV3C 3ZFEC 4NIHA 4LHLA 5FMOS 1O6UA 1VAKA 3WF0A 1X82A 1GZTA 3JBG3 2EIBA 5FMCA 4Z2AA 3PVBB 3WF1A 1DQ0A 3I2KA 5A3WA 1UY4A 3VZJA 4Q8KA 3ZFFA 4CDXB 4YM2A 3VBFA 4CXXA 3POYA 1UYYA 1AX0A 3D5OA 1LOGA 5E1RA 1LCLA 1C5HA 2Y60A 4EN8B 2XPJA 4LITA 2E7AA 1MS1A 4CCNA 4FBFA 1LODA 3AP7A 1KJRA 5FREA 5FYTA 3WQ0A 3FLRA 5JOXA 2UY8A 1OXCA 2HEVF 1PO22 1YIFA 3O0WA 1NA1B 2YBPA 3WDTA 1RHI1 2XL7A 4BQWA 1MVEA 3Q8BA 4A7KA 2WR9A 4PIZA 3LEIA 3OBAA 4XBNA 3TOJA 5F3EA 5DUWA 2QDNA 3A23A 4LOTA 3JB8A 4ZZ8A 2ZZQA 4K6BA 1FV3A 4KBBA 5APAA 1SFYA 2R49A 3PLQA 4GH4C 1MR5A 5BYNA 4YG0A 1G9AA 3UNPA 1AYN1 1LESA 1MZEA 4AHXA 1RUH3 1UZWA 3IAQA 1KJLA 3T3YA 2EAAA 4TXWA 1AXYA 4EQVA 4JKMA 5BNNA 5A3UA 5F5IA 4BQ3A 1CN1A 2OW4A 1OT5A 5JXJA 1UZYA 3W5MA 3SH4A 1KGYA 1I6XA 2VMEA 4XILA 1D0HA 4IV1A 5B4XA 4GWMA 4D8MA 2RS13 3NW4A 3OG2A 1RUD1 4XDOA 1PGW1 1H2MA 2E7QA 3KWVA 1LU2A 1VJ2A 2WNOA 3KVAA 3PHMA 3PUQA 4FOVA 4LT5A 2RMU3 4GH4A 3I59A 2Q1FA 1GZ9A 3UETA 3MFCA 2VZVA 2JDMA 3WG3A 5FWJA 2YB7A 2WNUB 4IEXA 1ZYBA 4BMEA 2XBO1 1TMF2 2VE1A 5FLIA 5FOBB 4EYUA 2RR12 2YC0A 2OKXA 4WVMA 1CJDA 1RVF1 2BGPA 1N1TA 1PZ9A 4PIXA 4N43C 1UYXA 2I45A 5IK7A 3H50A 2GDFA 4GB33 3WW3A 2W9XA 4I30A 3W21A 3LSEA 4DO0A 4FSJA 1HJFA 1CAVB 2R1DA 1EV13 3FHIB 4L92A 1ZREA 4QQOA 2ZJCA 2BWCA 2VOTA 1REEA 3AXDA 5C3SA 1QWRA 1S0GA 4Y5SA 3VDDB 5GLWA 1OSGA 5HV4A 5IVVA 3J7LA 3GDBA 4JHTA 3ZSMA 4COUA 5JR2A 2QQLA 4Q4X2 3VZKA 2G4IA 3AJYA 2XQRA 3RMYA 5FZ0A 3SXWA 1B35C 2B5HA 4MZUA 3FWEA 4AEMA 2LROA 2ZEWA 4D6SA 3CKHA 4YGDA 4XHXA 1GNHA 3FE5A 3O1RA 3OGGA 4IE0A 4CPBD 2W92A 5JOWA 1QHDA 3KHCA 4UFLA 3VLBB 4PF5A 1TME1 4DXZA 4YYOA 4YW3A 1OLRA 4HG6B 1OMIA 3AYDA 3POEA 5A7NA 2HKXA 3ZYIB 1ND2C 2A5ZA 1ULEA 2BVVA 1AVBA 3LF7A 3LQCA 4PI2A 4MG2A 5LRSA 3IM0A 4CUAA 4DZGA 4QX0A 1OOPA 3WXPA 1DDLA 3OBRA 4Q0UA 3IPVB 1R1A1 5FZDA 4JRLA 3UESA 3ZYPA 2DVAA 3BU0A 1BEV1 1NYWA 5ACA3 1E5IA 1OH3A 2GSYA 2P6CA 4Z07A 4M3CB 5L9BA 2GC2A 5IVEA 2XDVA 5K7PA 3LFIA 1BQPA 1O7FA 3KSCA 3OF1A 2XJSA 5SV5A 1O4TA 4XFHA 2HWD1 4QWNA 5E89A 3RWNA 4EN7B 1US2A 1ND3B 2RJLA 4Y24A 4ORFA 3MI8A 4A2UA 1U0AA 4RHV2 5C8CB 2GC3A 2WS93 2Q4SA 4P9GA 3NJVA 1V9U3 2Z4FA 1CD3G 4IE7A 1BBT3 3OYWB 4UI9L 2BNOA 5A6QA 4Z82A 1W9YA 4OI4A 4XJWA 2IXKA 2ARXA 2P3YA 5FZKA 4AE2A 5IUQA 1W99A 4CDXA 1XXNA 4U36A 4LO5B 2JDHA 2JDNA 4QX7A 1US3A 4M0HA 4OUSA 3KT4A 4IGPA 1PX4A 3SHRA 4YW5A 1DIWA 5A7PA 1QJY3 2QBXA 2W1WA 1BVVA 1Y7BA 1FATA 3HR9A 5A33A 4PQ9A 1UKGA 4LBQB 1IZ3A 2WN2A 2JB4A 3NAPC 4MLOA 4NPLA 4JKKA 1PO23 4UW3A 2HWB3 4O65A 5A7OA 3U4SA 1KS5A 5DMYA 1MVQA 1BXHA 2WA3A 2WWUA 1CESA 3WNMA 2DCZA 2JE9A 3EXUA 5T5LA 1W6OA 2VO5A 1D0GA 2ZGSA 1ULGA 2RS33 4XDPA 3BOPA 5LRRA 4N9IA 1UU6A 2WQ4A 1ZZ6A 2OPKA 1HX6A 2YZ4A 3FC0A 1PVC2 1V6KA 4M0NA 4OLLA 1G8WA 2VZOA 3WF2A 4XQWA 1NLQA 2CY6A 4M3CE 5HCFA 1UIJA 1SCSA 5ANNA 4GQ7A 2JIJA 5C6CA 1C3HA 2Y33A 4XF3A 1BLZA 1WW4A 1JZ6A 4CU7A 2BWAA 2WS91 4FQZA 2CDPA 4LHNA 2EXJA 5JAXA 5KHGA 2VW2A 1LR5A 5GKAC 4Z1VA 2QE3A 2DU0A 3RZGA 2Z79A 3JCIA 4MXWB 3AJZA 4BJ0A 1ENXA 2D97A 1RTVA 3BKZA 4AQ2A 1OQ1A 4R9BA 1NE4A 4PI0A 5GALA 4AI0A 5A3PA 4NIGA 3R0RA 4EV0A 1YYNA 1UOBA 1BEV3 4QHBA 4WM7C 4C90A 4RD7A 2RJ2A 4HOOA 5F5CA 3HN3A 3OPZA 2JKBA 3T2PA 1CX1A 2MNGA 2Q8OA 2IXCA 1S0EA 5JR7B 2D43A 2ZHLA 4RA0A 1RITA 1FXZA 2ZXQA 2YPDA 3HBZA 1C28A 2BERA 4V1PA 1SACA 2YGMA 4PBPA 1KXGA 4K1YA 1H6YA 5DDJ3 1NY71 3ZN6A 1W8TA 3ASIA 3T30A 4RSUA 1JYCA 1KFXL 5L73A 1UQXA 3MW3A 3ZFGC 1DCSA 3LA3A 4UFHA 2EIEA 5C8CC 3VKOA 4OYUA 1FV2A 1J59A 5BNPA 5IWFA 1ZA4A 2WZR3 1N47A 4LE3A 1PGW2 3SMHA 3VZMA 4MO3M 2WN3A 2R32A 1AL22 1DQ1A 1LGNA 3BB6A 2N7GA 1O8SA 1H4GA 3THDA 1LNSA 4GIQA 2P3JA 2CNAA 3LDBA 1P8JA 3D8CA 5HCAA 5L7OB 1JHNA 1W03A 2WQ8A 3T09A 5F5AA 3ALQA 4W50A 1YWKA 3KS7A 1CJPA 4GMP0 3WNXA 3E6CC 1AR83 5LW9A 4KL1A 3DPRA 5FZ6A 5C7GA 2WT2A 1FYUA 1XSQA 2GNMA 5HV0A 2NLRA 2D6PA 4BWOA 1YJLA 1RUI2 3B3QE 1V6IA 3I2GA 4IEZA 5GZDA 4NIIA 3AFGA 3QH6A 4CA9A 5IJRA 4M3CA 4P00B 1S0CA 1ASJ3 2VUDA 3E5XA 4XJZA 5BUVA 2DVBA 1JS9A 5M0TA 3GZAA 5FZGA 2K9ZA 2RJKA 5FO9B 2W5FA 1UYZA 2GH2A 3POIA 3NNFA 5HPOA 3RMXA 4AI2A 1BZWA 2VNRA 2NQYA 1VRH2 1NCQC 1NG0A 4FFIA 5FBJA 4R4ZA 4AW7A 1R1ZA 2WS92 2DWRA 2VG9A 4QQPA 2XH6A 1HQNA 2E63A 4QX3A 2V72A 2X53S 1BBT2 2AUYA 4KGQA 4LO6B 4LBKA 2EA7A 1VBE1 2ETEA 3SNMA 3PIJA 3M3EA 3WW1A 1GICA 4NHYA 3IMNA 2OZ6A 4XF1A 1PVC1 2YU1A 1WUVA 1PMJX 2WFPA 1EAH2 4LPLA 4DOUA 3HPNA 1ZZBA 2EAKA 5DAVA 4N53A 1GYKA 3AVRA 5D8AC 1YQ5A 2TBVA 1KQRA 1RUF1 2VW1A 3TYJA 2QQOA 3ZSEA 1XBFA 1JH5A 3RPQA 4EJRA 1YC61 2R16A 1PO21 1QJU3 4A7YA 5C3PA 1AUYA 4ZS2A 3NQHA 1HV1A 2ZAHA 2CGPA 3VDDA 4YW7A 4MGQA 5GJ6A 2ZMNA 3BI3A 1UO9A 2D40A 4OHXA 5C33A 2JDUA 1NOVA 1W06A 1GV9A 2DFBA 1PM7A 2CAUA 3C7HA 2VM9A 3CNAA 4MVTA 5FZOB 3VHOA 1HIXA 2GC0A 1JU3A 1SBEA 2Q1MA 3H7YA 4NWWA 4TLGA 4XAEA 1TEIA 3UKTA 3ZPOA 4D7YA 5A7QA 2YV8A 4GZ9A 1DZTA 3AZVA 5B2GB 1LHOA 4G3YC 2ZHKA 1H6XA 2CGNA 3NKGA 2DVDA 2VQAA 3O0XA 4SLIA 4BMBA 2BDRA 3CJXA 1QU0A 5FO7B 2A3XA 4Z2WA 3OBZA 4OMCA 1FAYA 4HONA 1QDOA 3KV4A 1AYM1 2J1AA 3H3ZA 3SC7X 3D0SA 3D82A 2WYSA 2Y6KA 3PUSA 1YI7A 3SISA 2BUKA 3RZZA 5ACA1 1NA1C 2LRPA 5FUNA 5LASA 3J8F2 2D6KA 1GKBA 4CU6A 1NY72 4XVHA 1IKQA 5A6YA 1Z78A 2J22A 4NWVA 3ZR6A 4AXOA 3VBUB 3S7IA 4ARXA 1X9PA 5CBLA 2W1UA 2VZ1A 4LKEA 4MXVA 2R041 4V2VA 4DUWA 5IT6A 5JXIA 3N7MA 5IVYA 2P34A 4Y4YA 3HT2A 1ZVFA 4DXRA 3HQUA 1YUDA 4IV1C 4XBLA 4FFFA 1O3SA 1W0PA 2VZSA 2Z2SB 5D2AA 4LTAA 5BNOB 4ZU4A 4N43B 3T2OA 1CWPA 5BNPB 1UXXX 3WNPA 1QY4A 2ZX0A 2ERFA 5LBBA 3VBFC 1PVXA 1X33A 3O12A 3WHUA 4K7JA 1O4ZA 5J3UA 4HL0A 5BNNC 5I91A 4UWDA 4P9XA 3VBUC 1CZTA 1EV11 5CU1A 5FRAA 2VTXJ 2FBEA 4L11A 3ZXLA 5CISA 3AP5A 3H42B 4GB31 3Q9OA 1W2OA 5T52A 4A45A 1JBCA 5J48A 3U1XA 2W1SA 3IKWA 4MHRA 2K46A 4WM8A 2E31A 3IPVA 1OC1A 1RUG2 2VAUA 3ZSLA 5FY5A 3WNOA 2HWC1 1UU4A 4Y1VA 3KM5A 2AGSA 1JYXA 4AAPA 3WINE 2J1SA 5ACA2 4MGSA 1QKQA 1UCXA 3AKSA 4BE3A 3N35A 4P9WA 2J7MA 2B4KA 2RMU1 3POSA 5F6LB 5FYUA 2VTXA 3IWZA 1SLAA 1RUD3 2B9UA 4NVPA 1GOGA 4IXLA 3VBOB 1AXKA 3WG4A 1JZ2A 4AHZA 3PTRB 2A3WA 4E8DA 1A8DA 1NLRA 3A0NA 4CCKA 1LOAA 1J3RA 4IE4A 1PZ7A 2XVKA 4AVAA 4IETA 2AZ5A 3ZYBA 2HEWF 4QX1A 4XPVA 1V6OA 1SPPA 4QPWA 5LWBA 4YWAA 3R05A 2VGDA 3LAGA 4D7SA 1OFSA 2YY1A 1S1AA 2W68A 2QNKA 5CA6A 3I3MA 4OMDA 3ZO0B 2D6NA 4LR4A 4JDNA 2LW8A 4AVTA 3THTA 2ZX3A 5JSPA 3VD4A 4URTA 4CDWB 1UKRA 3KHBA 4R8HA 3FZ3A 4UFJA 2IXJA 4I3PA 3RQ0A 1F8VA 2PLV2 5K0UB 2P37A 2GNDA 3FLTA 1W6MB 3C8XA 2LTNA 2HYKA 4YM3A 1GWKA 1V70A 2HWB1 1SZBA 4PDWC 4XZPA 4XJUA 4GJYA 3GALA 1GLHA 1S0DA 4QAWA 1JZ8A 3AP4A 3K3OA 5L36A 1DZQA 2Z5WA 1VB4A 4FTEA 3KF3A 4P9JA 4AHWA 2ID4A 4TZDA 5A1FA 1KEXA 3LA2A 4XXAA 3VL8A 4CEWB 3VD7A 1NE6A 2C1FA 4IV3B 3WDYA 4CDWC 4FO9A 1RUNA 4YGBA 3J26N 1T6BX 4E2SA 1BBT1 5JPNB 4BQYA 2QUOA 3CO2A 3X29B 1GBGA 1K45A 1Q8QA 4F83A 4ZU5A 3RZKA 5L7OA 5F3CA 3OBTA 2QVSB 3AVSA 1VBC2 3D6EA 1ZBA3 2GALA 4WBBA 1MQTA 5AVAA 4CDQB 2VW0A 1ZBE2 2NZ9A 4AQTA 4AVBA 4YW6A 2VU9A 3CEWA 1JYNA 3UL2A 2ZBJA 2C9AA 4O7XA 4UW5A 3UGFA 3LKJA 3WP3A 1YHFA 3RYKA 2XUMA 1CAXB 3POFA 5D21A 2RM23 1XE8A 3CF6E 4GWIA 3JQXA 4QDQA 5T5JA 4B29A 1HXS1 4IESA 5FBZA 3FHQA 1K5MB 3RWKX 1H1MA 5HCHA 4XCBA 3K2OA 3ZVXA 1S0BA 2DV9A 2XB6C 3TWIA 2JEMA 5FQ0A 2VY0A 4NPMA 2YC4A 5C3RA 5EIYB 3EO6A 4GWNA 4CXWA 1CR7A 4QB1A 1D2SA 3NAPA 1MQTC 3DKWA 4MV2A 2ZX2A 1RC6A 3ZX7A 4Q4V3 4C91A 3B5LB 2HWF2 4ZU7A 3H0OA 3INAA 2Y6LA 1QIQA 4N7IA 2WWSA 1H8TC 4L2NA 1SG3A 4CUBA 3BTXA 4B7EA 4RGGA 2X10A 2W87A 2Y6HA 3BGAA 3MLJA 3N7JA 5FTTC 2W3JA 5LEJA 1OLQA 1U5YA 2AACA 3V0AB 1JZ7A 1H8VA 3VBRC 5I0DA 3AYCA 4AGVA 1NT0A 2P17A 5FMDA 4N53B 1PIV3 3ECQA 1QGLA 5HI0A 2E53A 2LUWA 2VOVA 3AK0A 3OGRA 5LATA 3UT0A 3AMMA 1V0AA 2JIGA 3TN92 3ZFEB 4EN6B 1ODNA 2YBKA 4DEQA 1PO12 2JDAA 2XOMA 4CCCA 2B7YA 4NRMA 3ILFA 4HVOA 1DYOA 2WQZC 1B35B 1LULA 2PYTA 3EJKA 1OA2A 1C4RA 2DUPA 1QJX1 3A0KA 5DN2A 4XFFA 2QQJA 4W65A 1QJFA 2FDJA 3B00A 3JQWA 3BUCA 4UFIA 4COZA 2NPIA 1N1SA 2HH9A 3CQOA 3VDAA 1OA3A 1OQDA 2I2SA 3JUUA 2VMHA 2VQUA 2E26A 4GA9A 1WBLA 3ES4A 3NL1A 5FZ8A 1LRHA 5A7WA 3GBGA 4NHKA 2RDNA 4EN0A 2VUAA 3WCRA 4DNYA 2RS11 1W6PB 4XXPA 1VBC1 4GMP3 2AEYA 3RRDA 1R64A 1UIKA 1XU2A 2L9LA 4GD4A 3U75A 3DV8A 3H9AA 1WA6X 3H8XA 2ZGQA 1OUSA 2ARBA 2DTYA 2WRAA 4PDWB 5LA1A 1CAWA 4O9GA 4QU2A 4XFAA 5DUUA 4LKFA 4XJAA 1IS4A 5LBEA 2MEV3 2PHTA 4E9KA 2WYFA 2WZPP 3JD72 3M4FA 4AOCA 5IVBA 3C7GA 2AH2A 4YGEA 1AR63 2RG4A 1L7QA 2XKOA 4QDSA 5L9VA 3W9AA 1OOPC 5H9QA 3U14A 2VXJA 3I8TA 4FOYA 4HMZA 1SHWB 5FZIA 1W3VA 3S7EA 2AENA 4HFSA 3OOXA 5E16A 1TZOA 1VRBA 1DGRA 1LB2A 1GFF2 4RGAA 2ZEYA 3AL6A 1JXNA 3KB5A 4L0PA 2VMGA 5FP7A 4UF0B 3WT3A 1YQCA 4H55A 3F95A 4LA3A 4OVEA 3USUA 2DCTA 3I49A 2BNMA 5AC92 1H0BA 1RUI1 1ND3C 3J8F3 5CIRA 3O1MA 4IGQA 5EPAA 1GQHA 5CG8A 1NCRC 2G9FA 3VZOA 2HWE1 2IZWA 2ZMKA 1WA4A 5DAWA 2PFWA 3O14A 4LBQD 3CMGA 3H8OA 1SDDB 1PNFA 2DCKA 1QQP3 2Q1ZB 3POJA 1HW5A 4IE6A 1GOHA 3VHNA 4RN5A 2X5IB 3WQ1A 4XFIA 1C8M3 1VAMA 2ADEA 5FZLA 1AF9A 1W8UA 5LZ6A 2EXIA 1LEDA 2NM1A 4YVSB 4CUGA 4NHLA 4JDMA 1Y9MA 4Q0PA 4Q0SA 5IVFA 3B01A 1RUE3 2X09A 3UKNA 4Q4Y1 5FY7A 5JXGA 4WZCA 5ISLA 5D8AB 4QPYA 1QJU2 3PJYA 1CAXA 3DPRC 5FZMA 5EJ3A 3ZYJB 1QNWA 3RJRA 1UAIA 1HB3A 2VOXA 2BJSA 5BXXA 2OX0A 2WO1A 3CU7A 1R1A2 1ONAA 2D93A 5F8PA 4C8DA 1BMV1 2HWC2 4IQPA 3UK9A 2KA3A 1UOGA 2O8OA 2XKPA 4GALA 3WG1A 5FP4A 4LULA 1COV1 2Y26A 4YARA 5CKMA 2OT7A 1G7YA 1H1AA 4M00A 1Z7S3 1YRZA 4N53C 4XMIA 3JXSA 2D6LX 1XNDA 4XJ8A 4META 3V56A 3CJIC 1K5JA 1QOSA 4QPGB 1AZDA 1G9CA 3NKTA 4XEZA 5LCWL 2JG9A 1UW8A 3S5QA 3D4KA 5FYSA 1F2NA 4JC1A 5A32B 4XIOA 1EPWA 2ZPXA 4JKLA 3ZM8A 4UFMA 4C0BA 1EP0A 4YVSC 3WVJA 4A3ZA 4RL7A 2TNFA 3LOIA 1IQDC 5CYYA 4HPKB 3VBHC 4DY3A 3CLPA 5F5QA 2UWBA 1XB9A 3ZN5A 4LLOA 3A4UA 4L97A 5IYYA 5JPMB 4S2DA 4FQ4A 3L2HA 3ZKYA 3ZFGB 1FPN3 4A3XA 4AFCA 3E6DA 4LKDA 2VH9A 2JWPA 1GU3A 1GNZA 5GLVA 4Q5OA 1CONA 4K3UA 3QD6A 1IPKA 1ST8A 5L9RA 2KD7A 4CU9A 3HNBM 2JX9A 4AF9A 3HNMA 1RMU1 5FMOL 5DG1A 2XJPA 4Q0QA 3WG2A 1COV2 2PHDA 3ACLA 4BISA 4D6QA 1RUG3 3FN9A 1XYNA 2P4EA 2WO2A 2HWF3 2XXZA 4JHZA 2R1BA 3MDPA 4J1XA 5FZHA 3CZUA 1LHUA 2GMEA 2K0GA 3UGGA 4P5HA 1ZRCA 2FCUA 3ZN4A 4B1LA 3V0BB 2H6BA 1UD1A 4IV1B 1ZM1A 3S6PA 3MYXA 3HBKA 4H2AA 5CFDC 5FK8A 3O0VA 1AX2A 1AYM2 2YXSA 3LEGA 1UPSA 3NRUA 5F39A 3NVCA 4WVWA 3H7JA 1VE0A 1W8OA 1XJAA 2XONA 5F32A 1LOBA 4DINB 3S0MA 5CG9A 4G9SB 1PIV2 4XAAA 2ZOEB 4TSVA 3RYPA 1DLLA 2ZGLA 2D3PA 3ZDVA 5KBFA 2NN8A 1ZZ9A 3KCXA 2WNUA 4KG0A 3U4XA 3NNGA 1PM4A 3GCXA 4FTSA 3AM2A 1JYVA 3VD3A 3LSDA 5FZ4A 1RMU3 5J96B 4ES9A 5FP3A 2A6XA 4YW4A 3AKPA 5IK5A 1LKNA 4K8RB 1O5UA 1YFWA 1DLCA 1APNA 1LTEA 2DDUA 1Y9GA 4ZS3A 4I0WB 4ATFA 5C9AC 1CGPA 1CZSA 2ET7A 4YGCA 5ERLA 2VBBA 4RHV1 4NRQA 2XBO2 3WDVA 1UYPA 3N9QA 1DF0A 2RHPA 2Y64A 5T50A 4CDUC 1G9BA 1J58A 5CB7A 2C26A 2EVXA 2GAUA 4FXKB 3OUIA 3WP5A 3ZXJA 5IHRA 5JWPA 4JV4A 1MS5A 3FUOA 4KWKA 1RHI2 3PU3A 3V64A 2HJIA 4BK5A 3DGTA 4MGKE 4PLOA 2OYZA 3OPWA 5C71A 1ZZCA 3FL7A 3OB8A 1OPOA 4HK8A 1NXD1 1X36A 2R0HA 4MX3A 2FHRA 4RQPB 3T2TA 1XOYA 2UU8A 4N43A 1DP0A 1OKQA 2ZGUA 4RS5B 4D6RA 1Q8OA 1G6NA 3APBA 5JVVA 2H6CA 1Q56A 1DYPA 5FY9A 3RG0A 2R043 5K0UC 4AL9A 1YQ2A 3K75B 4OFGA 1L7LA 5FZ1A 5JUVA 5EJZB 2VTFA 5EP9A 2W94A 1C8NA 4L99A 2B46X 5I0UA 4LBNA 4BH9A 1AYN2 2WWJA 4EWAA 2WL1A 3NV1A 1FMD2 1WLWA 5JMOA 1HXS3 1OFNA 3P3PA 1MQTB 1AXZA 2R063 4YVWC 1T2XA 2V5DA 1ULPA 2C4XA 2PLV3 4OHWA 5DAQA 2RM21 3KT7A 1NQJA 4WM8B 2QQMA 3USSA 1JMUB 1H8TB 3T4VA 1PK6B 1GQPA 4DRRA 1IKPA 1FOD2 4B4QA 1RJ7A 3GM8A 5F9TA 5EYYA 3HWJA 5FKBA 1CX4A 1W6NA 2VQTA 3POBA 5IW0A 4LE4A 2ZGNA 3AZXA 3MICA 4HVQA 3ABZA 1RUC1 3BYWA 1QXJA 1O59A 3MLLA 5FQ0B 2JKXA 3CL1A 5KXEA 1O3QA 3DEMA 1YIPA 4KH9A 1PO13 1J3QA 3O7OA 3ZN6B 1XNKA 2GZWA 5JOZA 2QQPA 2E7TA 2PA7A 1OH4A 2VXRA 4COYA 1Z7S2 4OI1A 3HAGA 4HN0A 3MW4A 1C8M2 1QH7A 1RVF2 4CEYB 1F4HA 2ZGOA 2ZHNA 2RR11 1TVGA 4P9YA 4PDWA 3ROUA 2ZKNA 4FI9A 1OHFA 1YQ6A 4AQSA 3IDBB 5DZEA 2BFUS 3CBNA 4W6YA 5F3IA 3ZMNA 4FT8A 4OULA 4FPKA 1SPPB 2W0XA 2ET1A 2UURA 3OGJA 4X6QB 4Q27A 5A3MA 4IDZA 5FJKA 3GZEA 2PAMA 4LEJA 3KMHA 5JI9A 4OZOA 4CDWA 3I2OA 3JU9A 3PNAA 4LK7A 2VZPA 1XC6A 1VB2A 5CFCC 5EQUA 3ZFEA 1LHNA 1YNAA 3BPZA 4PLNA 4RHV3 3NJXA 1AR61 4BQ2A 3NWKA 2FZ1A 2K2SA 3Q8CA 4Y20A 1W9SA 3QOPA 4JGYC 4B4PA 4X8NA 4JX0A 1A3KA 3KCYA 2WABA 4LO8A 2X8KA 1LOEA 2UYBA 3IDEA 5BNNB 2WFF3 3ME2A 2A7AA 3VZLA 2I07B 4AI3A 4CEWA 4CPBA 2R30A 4AGRA 2WNVC 1C57A 1WMEA 1PHMA 4QXBA 3VDBA 5KHKA 2BV4A 3MW2A 5KHJA 5KHIA 2CL2A 5A3NA 4YZ1A 4PT6A 2VR4A 1XRUA 3M3IA 2O0OA 1XYPA 1REFA 1ZBE1 3WQBA 1Y4WA 2VNOA 3T0AA 1IG0A 5JCTA 1RYYA 4KWJA 4RGKA 2XJRA 1NX9A 4QX5A 1OLMA 2IFWA 4TN7A 2VVDA 4CCMA 2IWGB 4JGZB 3WF3A 1OD5A 4CYDA 3MIGA 4QKFA 1O4YA 4HZFA 3PVEA 3KD4A 4YW2A 3MF6A 1AR81 2VUJA 1CPMA 5CVRA 3LEMA 4IEOA 1MS3A 4HXCA 4CP1A 3ACGA 4NAOA 4XZUG 1X9TA 5DDJ2 2ES3A 1FNYA 4HKWA 2VULA 2FDIA 1C1FA 3WP6A 2BU9A 2JE7A 4AEDA 1J1TA 4QKDA 1FNZA 2JG8A 1BCXA 3AMNA 4I01A 4K1ZA 3ETQA 1PGL2 2WAOA 1X8EA 1W6QB 1RUE2 1NZIA 3I54A 4BDVB 4ISQA 4AWDA 1IGOA 1J84A 1F5FA 2WZR1 3I2JA 4XF4A 4UF0A 2DU1A 4LUKA 4E2GA 2VZTA 1D4M2 3PL0A 2JG9B 4RS5A 4Q29A 1DGRN 5SV8A 2F4LA 1RINA 4Q4W2 5FUPA 1WKYA 2C9KA 4I09A 1ZZ8A 1XSRA 3ZR5A 2WO3A 2JXAA 1K5MC 3ZXFA 1F9KA 1TNFA 4R9DA 1URXA 1WWYA 1BJQA 1X7NA 3B93A 5FZEA 1SBFA 1YFUA 2VL4A 2R071 3C7FA 3OSDA 1AR93 1QQP2 2P6HA 4YM0A 4AVCA 4LKSA 5A3LA 1S55A 1M4WA 4IUGA 4D7TA 2D7FA 3SKVA 3ZFGA 3AL5A 3WF4A 3TEYA 5FK7A 3CJIB 3NMBA 4N90A 2ZEXA 1JUHA 3VBSB 5J1XA 2JJ6A 4ZXEA 4AFAA 1YXWA 2HBTA 3PTYA 3U11A 4XHBA 2PHXA 3MPBA 3MO4A 1M06G 5D1IA 1ZBA1 1Q8VA 3EBRA 1QXPA 1VBA2 4NR1A 5T3NA 3V0BA 1TMF3 2E51A 2Z42A 1DGLA 2LM3A 4XIKA 1ND3A 4EE2A 3TN93 1PX3A 2RE9A 3ILRA 5C8CA 1GWMA 2V5YA 3IBMA 4OHVA 2SBAA 4OUMA 2WNVB 1KFUL 3PJQA 2A70A 3U07A 1POV1 1OLME 3OYWA 2V4VA 4Y5TA 2X05A 3ST7A 3V65A 4FPHA 1LOCA 2W46A 4PQQA 2HWE3 5FXXA 2FDGA 2HBUA 4M4RA 1CZVA 2WKKA 1V00A 2R062 4NOTA 1IS3A 5C3QA 2RS31 1LGCA 5L7OC 4ET7A 5DXDA 4MH0E 3OTFA 1OVSA 1SFNA 4FPFA 3OD4A 4K20A 4FXGB 4HT1T 4YRDA 5F6KA 3T1MA 5C4WC 4KNCA 1RUF3 2EIGA 1GWLA 2VNVA 1RIRA 2J1EA 3HIFA 3E5QA 4AFBA 1QJY1 3DPRB 1CAUA 2BRTA 3GHNA 2XJQA 3PMEA 4QPIC 5ABJC 2GC1A 1PVC3 3C7OA 4D69A 5I0TA 3EMRA 5KR7A 4N9HA 2MEV1 4RQPA 3GHMA 2DURA 1VBE3 5FYZA 4XF0A 1VBD2 4MGIE 4OCTA 2GMPA 1TQ5A 2VOWA 1ENRA 5GLZA 1D4VB 5A80A 5G04L 3U78A 1ZRRA 3EQEA 2D3SA 4YG3A 1DGWX 3IMMA 4QPGC 3W20A 2WC2A 4QPIB 3DYOA 3ZYRA 2HWD3 1N3QA 3E97A 2TEPA 4HLTA 2CTVA 5DAXA 4F8AA 1ZRFA 1SLCA 2PHWA 3OY8A 2FDFA 3N36A 2X29A 1ND2B 1VRH3 3AP9A 3ZYFA 4HSJA 4RQPC 2FD8A 1WLTA 4YNIA 4DQAA 4GXLA 2FDHA 4EZ4A 2P3KA 4CXYA 1WZXA 4RR3C 1W0NA 3K4DA 3KCCA 2AC1A 5BNOC 5K8SA 2XHKA 2QJVA 1N1VA 2RS52 3B9CA 4HSLA 3GF6A 3PDQA 1AR82 3FFQA 4EROA 3K77A 5C8WA 2CYFA 3CDZB 2Y6JA 3TEWA 1UY1A 4OQ8A 4CVUA 3ZLIA 4XTMA 1ACCA 3I4IA 4P9IA 1YI9A 2ORXA 2WNEA 4QKNA 1XE0A 1G86A 4QM9A 4ASKA 2ZABA 4BLIA 4RR3B 4UYBA 3KF5A 2WZR2 4DUVA 2R0FA 3KVBA 3MPPG 1RUF2 3ORJA 2A6WA 5A32A 4CCLA 2ZTNA 5A6XA 2WJSA 4CCDA 5FFOC 4Q4V1 4FAHA 2IVIB 4S2HA 1MEC3 5DDJ1 5GZEA 1BK0A 1WW7A 4H7MA 1W3XA 5FYCA 3ZPYA 2G1MA 1LOFC 3PURA 4LBJA 3GGLA 2VCAA 1AR92 3M8LA 3M3OA 4GULA 1JOBA 1LECA 2VC9A 2ZA9A 3LE0A 4JAAA 4JRAA 1QNYA 3FUQA 1GANA 3HNYM 5AVPA 4YZ3A 3SH5A 1FMD3 4Q26A 3T1LA 3VKNA 5C9AB 3ZFFC 4Y20B 2WA4A 3KV6A 3R4SA 5GLTA 2YG0A 3MIDA 4CRQA 1OPMA 1ZX5A 1PK6A 4K9SA 4P02B 2FDKA 4BK4A 2G9ZA 3MEPA 4I02A 3WR0A 4AGGA 1WW5A 1W8HA 5ABJB 1HB4A 4ZHNA 4QX2A 1R091 3WNKA 5KXCA 2VOKA 1RXGA 2VMFA 4Q2FA 1GOFA 1X8MA 3BVCA 4PIYA 1HRV2 1LOFA 2OXBA 2RDQA 4DPNA 2JDKA 1GZWA 1FPN2 2NMNA 4MADA 2AYHA 2FMYA 4QQHA 2Q8DA 4NRPA 4BIOA 5FY8A 5JZGC 4CZSA 1OURA 3U37A 2CSGA 1SEFA 1JUIA 1DQ4A 2OA2A 3OUJA 4UFKA 4JGZA 3ZMOA 5FYYA 3V0AA 4K21A 3K48A 3SLIA 4ITCA 5FPUA 3IB3A 1RUJ1 1WMXA 3S57A 3BU7A 4LMFA 1HRI3 4XYXA 4W8JA 5C5UA 3DYMA 2B45X 5L19A 1WMDA 4RYDA 1W8NA 3DYPA 1KRIA 2W47A 5K0UA 2E32A 1FOD3 3T0BA 1NCQB 2QQKA 1W9TA 2KR2A 3PVOA 4J1WA 3I2FA 1VBA3 1CAUB 2BVBA 4FPYA 4JZRA 1RUJ3 3KZ4C 2Q30A 5J98B 2VZUA 1W2AX 4E8CA 2YFZA 1JOJA 3WDXA 4CDQC 3JBG2 2Q8CA 1POV3 1VPHA 1MZFA 3BIWE 4PJYA 3RSJA 1F31A 2GMMA 1RB8G 2BBAA 4DUXA 5GZGA 5LB6A 1VLNA 4CEYC 1MS9A 2P1BA 5JZGB 1GP4A 3WEZA 3VBOA 1NZCA 4A7ZA 1E57A 4NROA 5FYHA 2GH8A 4JTOA 1XNTA 4XFBA 1ULCA 3SITA 2JD9A 3M3QA 4XOGA 5EZWA 4YZ4A 4Y3OA 1UY3A 3JB4C 4CCOA 4CCEA 3K3NA 4NMIA 5GLUA 2DFCA 3SH3A 4FP3A 3HD8B 4LHKA 3BPSA 3TEZA 1LENA 2WLQA 5LK5A 3AKQA 3LGRA 1Q8PA 2YYOA 2XVLA 5CNAA 4AQ6A 1UNBA 5LY2A 4BQ1A 1KDKA 4B3NA 2VBDA 4Z92B 1FMD1 3AX4A 4PCRA 2WUHA 4N7UA 4XQ4A 2ENRA 2ZHMA 1X50A 2WDBA 4NHMA 4MGZE 2KM2A 3R4DB 5FUIA 3TBDA 3KQRA 3I3QA 4OI0A 3J4UH 3TNPB 4P5YA 2WINB 5JLVA 4QT6A 1TME3 3AC0A 4KGGA 4FAGA 3PUAA 4FPLA 5KXBA 5F2WA 2WNVA 5BNQA 2FMDA 1GSLA 5FZ3A 1GR3A 2KXLA 3OGVA 2Q0AA 3T4HB 4CP0A 2PXJA 1ZBA2 4BB3A 3ZFFB 3UJQA 5LK7B 3ES1A 3LFMA 1REDA 2CGOA 2P5BA 1E5HA 4IEWA 4U2AA 3QLQA 4N8MA 3SEEA 3W59A 1AL0G 4IE5A 3FJSA 4H7LA 4B4RA 4HBNA 4NJ4A 1ENQA 2FCTA 2J1RA 1W2TA 1CQ9A 4XUTA 2PHFA 1VBD1 1IHMA 3T08A 4YZ2A 4HANA 4A6OA 3MLKA 2W1QA 1W9WA 1H2NA 2GNTA 5IVCA 2R072 2VJXA 4ZZ5A 1OOPB 3R4UA 2EXHA 1XE7A 2A6YA 1W90A 3ACIA 4FVVA 4NHXA 5H9PA 5GZCA 2O1QA 2Y34A 3GZTB 1RGSA 4ZKTB 1JTZX 3R6SA 2BP6A 1A78A 4GJZA 4XFGA 4AK3A 4BXSV 4TWTA 3UJOA 2Z69A 3UV9A 3ZIXA 3GBWA 3HOBA 1N1YA 1UN1A 2PQQA 3ZSJA 1O3RA 1QMJA 1J1LA 4CDUA 4JGYA 3NNJA 1BHGA 1ZNPA 2YROA 1FI2A 3TRSB 2Y6FA 1E5RA 3MIEA 4Y22A 5JMCA 4XDQA 1BYHA 2DBIA 4FCAA 2RDRA 4GWJA 4IEPA 1JODA 5F7UA 1IPJA 4E4ZA 3AFKA 4QM8A 1SLBA 1RUH2 2YU2A 2F17A 3PUIA 4LO7A 3TNQA 3VBRA 1Q5OA 2MEV2 1CAWB 2HLEA 3N7LA 4DFSA 2YHJA 1JZ4A 3PIGA 3RYRA 5I93A 3H1WA 1OF3A 1VBA1 1W04A 3DXTA 4AEKA 3G6JB 3WUCA 3FLPA 3WY6A 2A3YA 1F15A 3UGHA 1R082 2W39A 4DS0A 3TB0A 3VHPA 3O1TA 5DAPA 3P6BA 4Q4X1 5GM0A 1OUXA 3DN7A 4HVRA 4QDRA 5LBFA 1MZ5A 2CV6A 5FZAA 3ZOIA 1W6QA 4BYYA 3I2IA 2BOJA 3AZWA 2FQPA 3LWCA 1JI6A 1HRI1 1LU1A 5FIXA 2GNBA 2IXIA 4A44A 5LEKA 4WM7A 2GN3A 3HN1A 3E6BA 4DY5A 4BQ4A 5JI7A 1HB1A 2OIIA 1QOOA 4XUNA 1Q8SA 2GU9A 2PHUA 3PU8A 1HV0A 4JQTA 1H2LA 2CWSA 2WSUA 2JDYA 3JBG1 4Q0VA 5EJ1B 3GYDA 1EUTA 1V9U1 5LA2A 5F37A 3BIEA 4FOWA 3TN91 1SLIA 1AR73 1AR62 5A70A 1DU3D 2YPJA 5T54A 1TMF1 1HRV1 3M70A 5IFPA 4E4DX 4QXKA 4Y1XA 4OHYA 1R093 4P9LA 3Q8FA 5DG2A 4AFDA 4D3WA 3WQ7A 4DXSA 2A71A 3N7KA 2VMIA 4YPJA 1ND2A 1RUD2 4YFWA 3TEXA 1ASJ1 2VUCA 3K51A 1NCRA 2Q5TA 2UYAA 4AR2A 1EPZA 3RJ2X 3OGSA 2ARCA 4QQ2A 4WVMB 5G05L 1R1A3 3GBFA 5AC93 3P5BA 4MOAA 5FLJA 5ABJA 2MHFA 4I0BA 2G19A 1QJZA 4KBZA 4LUMA 5A1LA 1AJKA 3O1UA 4JDOA 1UY0A 2J42A 1VBB1 3TAYA 3HJRA 1XYOA 1RUOA 2DVGA 3AMHA 3FBYA 4FPOB 3N9NA 5FXZA 1VBD3 1HLCA 1QEXA 1MEC1 5B4NA 3ZXKA 1ZRIA 4LO4B 1ZA7A 2VZQA 2IXHA 4Z8BA 1QDCA 3EHKA 4M4PA 1DG6A 3H1MA 4IEYA 1H4HA 4CEWC 4L9BA 4XE9A 4ZY9A 3USUB 4B1MA 1OQEA 2JDPA 3AYAA 3ILNA 1XNCA 1JZ5A 4Q1PA 5CEHA 4M3CF 3IZOA 3T0DA 3IIIA 4LIVA 3QBQA 2X5IC 1SQ4A 2ATFA 1IOAA 2VPVA 4XUOA 4Q8LA 4TLFA 5JOYA 1VMHA 3PVNA 4HPKA 4LBQA 4JQRA 5LBCA 1AL23 1MPXA 2E9QA 4IGOA 1SCRA 2DUQA 4IEVA 1NCQA 3JD71 2B39A 3AMQA 5EFUA 5C4WA 5A7SA 3OCPA 4Y26A 1W2NA 1F35A 1WBFA 2Y0IA 3AZYA 2JG9C 5IATA 4AAXA 1MS4A 1H8TA 3FMGA 5AFEA 2C6SA 3RGBA 4EWEA 3KGZA 3QH7A 1AR72 2XBO3 2YDEA 1HQWA 1IS6A 1VRH1 3WDUA 4AEDC 4E27A 2QQIA 2JG8C 3ELNA 3DL3A 1PMIA 2F4PA 4UW4A 4NIDA 2C24A 3BOWA 5J37A 1A6CA 3C3VA 1J3PA 3NJZA 3OD0A 1S0IA 2ILMA 3GJBA 1F4AA 1RUJ2 1D7PM 1W6PA 4AI8A 2QQNA 3LCPA 3H8RA 3WLUA 3LDKA 5EYXA 4LORA 1MEC2 4GH4B 1QJX2 4JVAA 4LJHA 1V9U2 3I3BA 4QKBA 2WO7A 2WFF1 4QPGA 4W6XA 3ZXAC 4YSFA 3D3AA 2BTVC 4AHYA 1SLTA 3LA7A 3C7EA 2YC2A 5HXMA 3ZKUA 2VCCA 1WW6A 2WAAA 1UWWA 4OHZA 4CTEA 2W95A 1JYTA 1RUC2 3KQ4B 3O1SA 2XJUA 3O1PA 1RL3A 1DBNA 1POV0 2BEOA 1ASJ2 2D98A 3H3UA 1LGBA 2BQPA 5IAVA 2EICA 3GXUA 3M3CA 5C3OA 2AREA 1FOD1 1RHI3 2ZKLA 5FP8A 5HCBA 1QOTA 3KLSA 1EY2A 4XTPA 5FWEA 4AI1A 2UY9A 3B69A 4XJ9A 2BBVA 2Y0OA 1VR3A 4BLJA 1WCUA 3VD9A 3KGLA 4HKOA 3O1OA 2RS32 3LB9A 5GZFA 2CWMA 3ZYHA 2VCBA 5FZOA 5CFDA 3I2HA 5BV6A 3AKRA 3WD5A 3KT1A 2DCJA 1S2EA 2VQ0A 4AVSA 4ZPIA 1K42A 1RMU2 5E88A 5I0RA 1PGSA 3VHRA 1L7RA 5FZ7A 3RNSA 1H9PA 2XGXA 2XWJB 2ZGKA 1ODMA 1YO8A 2OUHA 2IC1A 5FJHA 1OVPA 4E2QA 5FY4A 4Y5Z0 2WSVA 4UT5A 4D94A 3VKFC 4QHZA 4URAA 4HKLA 3IDAA 4BQ5A 2AR6A 1XNAA 1WMFA 4FPEA 4QB6A 3BALA 4WVVA 4XACA 5FP9A 5LA9A 4CE8A 2ZMLA 3WP4A 1XU1A 3CZJA 4FPGA 2JD4A 1NCRB 5F3GA 5C9AA 3LPGA 1DQ5A 3NNMA 1ZZ7A 1HQLA 1D4M3 2J1TA 2ZGRA 3M7AA 2BPA2 2PLV1 3ZSKA 2QKDA 3DXUA 3DECA 2R061 4C0HA 4R9CA 1AJOA 4XBQA 2WIIB 3RI9A 4PHZA 3S30A 1HDKA 4BQXA 5FYIA 4UAPA 4AEDB 2R042 2VZRA 2JG8B 4Y22B 1HB2A 3MIBA 4JCKA 1QQP1 1N3PA 4LIUA 4YVWA 1XPWA 2V4AA 1IG3A 4C1XA 3MIFA 2VECA
chains in the Genus database with same CATH topology
4XFCA 4CEYA 1BMV2 3J9SA 3HQXA 4WM8C 2D6MA 5KXDA 4S2FA 2XVGA 2ZGTA 1U5IA 1WLCA 2E6VA 3JZVA 4HETA 2UWCA 4Y1UA 3W58A 4F3JA 1YLLA 1U5ZA 4JGZC 3SCHA 5JIUA 1UMZA 4OZXA 1SMVA 1W0OA 2R6QA 2OZJA 5FPZA 5I8YA 1Q43A 2NMOA 1WCDJ 4ONUA 3GZUC 2P2KA 3NV4A 1OI6A 3VKLA 4MUVA 2PAKA 1GQGA 1MACA 4LBMA 1Y9QA 4MGYE 1JW6A 1RVF3 4B7KA 2HWE2 3MF9A 2B42B 1S2KA 4H3WA 1QJY2 1JYIA 1HRI2 5KHHA 5FAXA 3QCWA 3LZZA 5DUVA 4F7ZA 4GMP1 2D44A 1TNRA 1UF2C 1ZBE3 3SCFA 1R081 5AFBA 5CFCB 3E5UA 3O5SA 4R52A 3ZXDA 2D5FA 1ULDA 3VBRB 4FPJA 1RUG1 3PMSA 2CAVA 2D6OX 5IK4A 3VDDC 1CIWA 4QQLA 4MYEA 4EN9B 1RUH1 2V09A 4EWDA 3ZXEA 1AYN3 4BCUA 5HBAA 3H1YA 2FZ2A 2JICA 2A73B 4Q1RA 5FDBA 1W6MA 4YFZA 1BKZA 3L9JT 3IT8A 1U12A 1H9WA 1O5LA 2ZAAA 4LBLA 1NXMA 3D0JA 1V6MA 3C2UA 2A6VA 2WNUC 4Q4Y2 2LALA 5BPXA 3U0ZA 5CAZA 4WM7B 4QD2A 3N3HA 4HN1A 3VN4A 5CFDB 2W08A 1UPIA 4BPZA 4IV3A 3RI8A 1Z0HA 1BVP1 2HEYF 2PHLA 3VKMA 1S0FA 1G9DA 3H8UA 3FFZA 2ZCWA 4NN0A 1Z7S1 4BIFA 3WCSA 1COV3 2H0VA 2VNGA 3NO8A 1PO11 2WFF2 1CPNA 4R9AA 4S2GA 1I5ZA 1EAH3 2EF6A 3U10A 2I74A 3BODA 5I8TA 4Q4W1 3VBHB 1U5XA 5K9YA 5C4WB 2D3RA 4GKXA 1D4M1 4KU7A 5I8SA 2PN5A 5F1RA 4WZFA 1I9RA 2OUJA 1MZ6A 1DZRA 5E8AA 4RFT0 1DGWA 4Y1YA 1V6JA 2QCSB 1HKDA 4ISRA 2RM22 2ZGMA 1PGL1 4JGYB 4Q4W3 4B8EA 1FX5A 1EYBA 2F6BA 3IDCB 4YG6A 4QGMA 1LJ7A 1C8M1 2PTMA 3VBUA 2BGCA 1AR91 3WOGA 3NAPB 4IERA 1O3TA 2R073 3NSTA 4RS5C 2JECA 1VBE2 3DUIA 1ALYA 4Q4V2 1KD7A 1SDWA 1O91A 1AHSA 5KC6A 3VBSC 2ZX4A 2WLPA 2RS12 3POWA 2QDRA 2EXKA 3BCWA 4YW1A 4LBOA 2VVEA 4DMIA 1I3HA 1ULFA 4M01A 2A75A 1WD4A 2PHRA 1WGPA 2YGLA 4XETA 3WV6A 2XG3A 1C1LA 1WLDA 3MGUA 4BZ4A 1B35A 2BW8A 4NO4A 1GZCA 2ZACA 1KDMA 1DQ6A 1VBB2 5T5PA 3WZ1A 4SBVA 3QACA 3N4MA 4G4FA 3VBSA 1NLSA 1N3OA 1S2BA 2B8MA 3WDWA 1VBC3 1ZRDA 4H14A 5FPXA 1GZWB 4FPCA 3B94A 2HWB2 4CDXC 4QPIA 1IS5A 1OA4A 4INDA 1UU5A 2GN7A 3I59B 1FT9A 4L8QA 4KWLA 3OY8B 4PLMA 1DHKB 2QZ3A 1BK1A 1JN2P 3VBFB 2HWF1 4XMAA 1QJX3 3AXEA 1Y3TA 1UZZA 2RS51 1LHWA 3THPA 3HMYA 4UBHA 4Y1ZA 2DTWA 4WVZA 4COWA 1FPN1 5EXOA 3FX3A 1AL21 2ZZJA 1CAVA 1PIV1 2BNNA 3I2DA 4UXAA 2NP0A 1W6OB 4AG4A 5J7MA 2MPFA 2W52A 1R092 1NQDA 3MIHA 3RDIA 2HWD2 4AYUA 5JDBA 2WT0A 3M2MA 4CP2A 5TSWA 4W6WA 4YLZA 4I0AA 1G9FA 4X6RB 4LNVA 4RR3A 5FOJB 4YM1A 1WCKA 5BNOA 2EALA 3OJBA 1BEV2 4ZXKA 2DVFA 2QFEA 4KG8A 2RR13 1C5IA 3AB0A 1RJ8A 1YJKA 3IN9A 4XQDA 2X5IA 4YZ5A 4E4SA 1DQ2A 2JDZA 5H9SA 1RUC3 3I7DA 3G7DA 1IQAA 2IXLA 5FLHA 5JMCA 4DRVA 3AYEA 5T55A 5FO8B 3B02A 3CJIA 2D5HA 5IK8A 3ZDSA 3WX5A 2WT1A 1YFXA 2ZX1A 2C5DA 1MS8A 2XLGA 1AYM3 5KC5A 4Q4Y3 2DCYA 1K5MA 3WW2A 1HRV3 4R4XA 5FCCA 2DUOA 4COVA 1UL9A 1F5JA 5J36A 3VUOA 4YVWB 3SCGA 2YMZA 4HK9A 1T6GC 3L2YA 4AFMA 3MFAA 1QF3A 1PK6C 1QH6A 3ZYGA 5KWRA 2XLFA 1XQNA 1RUI3 3J8F1 1VALA 3AP6A 2P3IA 4ATEA 1VAVA 1W2UA 2TUNA 3VGIA 3UKVA 1LEMA 4BM8A 5A33B 4Q4X3 2VVFA 1QJU1 1YCIA 3AKTA 2RMU2 4O9EA 1NA1A 2XWBB 3HT1A 1Y43B 1LHVA 1A8MA 2C0ZA 2BFUL 2XJVA 2H0BA 1H30A 3VZNA 3ZXGA 5DUXA 4LLFA 5BNPC 3VV1A 1WD3A 4QGLA 2DYCA 1V6NA 2RS53 1W39A 1DFQA 3LOBA 4XW3A 3AMPA 3B9IA 1QXRA 4QGNA 2XL9A 1EV12 4BHPA 3M1HA 1KITA 5DZGA 4K40A 5JZGA 4KQ7A 4TYSA 1I1EA 4XF9A 5I0SA 3NV3A 1D2QA 1R083 4MSVA 4LA2A 4NPRA 4OI2A 1SLLA 2SLIA 5T5OA 1ENSA 4CDQA 5HXVA 1UX6A 2JENA 2HWC3 1SBDA 3NV2A 3WHTA 4KU8A 4IEQA 1V6LA 4I2OA 3VL9A 4GB32 2BYVE 4UBGA 5DZFA 3RS6A 3VBOC 1H1IA 2IFRA 5H9RA 4AVVA 1S0JA 3JD73 1TME2 4GKYA 4WV8A 1WCSA 5J09A 5JSRA 5JIAA 4JTNA 3ZIWA 3BTAA 1KS4A 4AEJA 3URFA 1MS0A 4X8PA 4IL7A 1PNGA 2PAEA 2NYYA 2O8QA 3WW4A 2UWAA 5CADA 4PBOA 3ENRA 2DF7A 2PELA 4J6GA 3ATGA 3B7MA 4I3GA 3IIAA 4P14A 5EWSA 5JSOA 3P3NA 1DYKA 1AX1A 4C1WA 3WUDA 1L3JA 3DF0A 2XJTA 2V73A 2A6ZA 1VBB3 3GNEA 1H2KA 1TE1B 2OVUA 4BOWA 4YVSA 2YUEA 4MXWA 3VBHA 5EV7A 1B09A 1YFYA 1VIWB 1HXS2 1PZ8A 5AC91 5D8AA 4ES8A 2ZGPA 2ZS6B 4FTBA 2QZ2A 1VP6A 3FBMA 3AZZA 2G9GA 4CDUB 4BA6A 2XLAA 4FOQA 1W6NB 4DB5A 4ASLA 4QMAA 1RUE1 1XNBA 5BY5A 1CVNA 2Y38A 1Q3EA 4IEUA 4K8FA 4UW6A 4FP2A 1AR71 1EAH1 5CFCA 4IV3C 3ZFEC 4LHLA 5FMOS 1VAKA 1X82A 3JBG3 3PVBB 1DQ0A 3VZJA 4Q8KA 3ZFFA 4CDXB 4YM2A 3VBFA 3POYA 1AX0A 3D5OA 1LOGA 5E1RA 1LCLA 1C5HA 4EN8B 2XPJA 2E7AA 1MS1A 4FBFA 1LODA 3AP7A 1KJRA 5FREA 3WQ0A 3FLRA 5JOXA 2UY8A 2HEVF 1PO22 1YIFA 3O0WA 1NA1B 3WDTA 1RHI1 2XL7A 1MVEA 4A7KA 4PIZA 4XBNA 3TOJA 5DUWA 2QDNA 3JB8A 2ZZQA 4K6BA 1FV3A 4KBBA 1SFYA 2R49A 3PLQA 4GH4C 1MR5A 5BYNA 4YG0A 1G9AA 1AYN1 1LESA 1MZEA 4AHXA 1RUH3 1KJLA 2EAAA 1AXYA 5BNNA 1CN1A 2OW4A 1UZYA 3SH4A 4XILA 1I6XA 1D0HA 4IV1A 4GWMA 2RS13 3NW4A 1RUD1 1PGW1 1H2MA 2E7QA 1LU2A 1VJ2A 4FOVA 4LT5A 3PHMA 2RMU3 4GH4A 3I59A 1GZ9A 3MFCA 3WG3A 2WNUB 4IEXA 1ZYBA 4BMEA 2XBO1 1TMF2 5FLIA 5FOBB 2RR12 2YC0A 4WVMA 1CJDA 1RVF1 1N1TA 1PZ9A 4PIXA 4N43C 2I45A 5IK7A 3H50A 2GDFA 4GB33 3WW3A 4I30A 3LSEA 4FSJA 1CAVB 2R1DA 1EV13 3FHIB 4L92A 1ZREA 4QQOA 2ZJCA 2BWCA 1REEA 3AXDA 1QWRA 1S0GA 3VDDB 5GLWA 1OSGA 3ZSMA 4COUA 3VZKA 4Q4X2 2G4IA 3AJYA 3RMYA 3SXWA 1B35C 2B5HA 4MZUA 3FWEA 4AEMA 4YGDA 4XHXA 1GNHA 3FE5A 3OGGA 5JOWA 1QHDA 3VLBB 4DXZA 4PF5A 1TME1 4YYOA 4YW3A 1OLRA 1OMIA 3AYDA 3ZYIB 2HKXA 1ND2C 2A5ZA 1ULEA 2BVVA 1AVBA 5LRSA 3IM0A 4DZGA 1DDLA 1OOPA 3WXPA 3OBRA 4Q0UA 3IPVB 1R1A1 4JRLA 3ZYPA 2DVAA 1BEV1 1NYWA 5ACA3 2GSYA 4Z07A 4M3CB 2GC2A 5K7PA 1BQPA 1O7FA 3KSCA 3OF1A 2XJSA 5SV5A 1O4TA 4XFHA 2HWD1 5E89A 3RWNA 4EN7B 1ND3B 2RJLA 4Y24A 4ORFA 3MI8A 4A2UA 1U0AA 4RHV2 5C8CB 2GC3A 2WS93 2Q4SA 4P9GA 1V9U3 1CD3G 1BBT3 3OYWB 2BNOA 4Z82A 4AE2A 4OI4A 4XJWA 2IXKA 2ARXA 4CDXA 5IUQA 1XXNA 4U36A 4LO5B 4M0HA 4OUSA 3KT4A 3SHRA 4YW5A 1DIWA 1QJY3 1BVVA 1Y7BA 1FATA 3HR9A 5A33A 4PQ9A 1UKGA 4LBQB 1IZ3A 3NAPC 4MLOA 1PO23 4UW3A 2HWB3 1KS5A 1MVQA 1BXHA 2WA3A 1CESA 2DCZA 2JE9A 3EXUA 5T5LA 1W6OA 1D0GA 2ZGSA 1ULGA 2RS33 5LRRA 3BOPA 4N9IA 1UU6A 2WQ4A 1ZZ6A 2OPKA 1HX6A 2YZ4A 3FC0A 1PVC2 1V6KA 4M0NA 4OLLA 1G8WA 4XQWA 2CY6A 4M3CE 5HCFA 1UIJA 1SCSA 4GQ7A 5C6CA 1C3HA 4XF3A 1WW4A 2BWAA 2WS91 4FQZA 4LHNA 2EXJA 5JAXA 5KHGA 2VW2A 1LR5A 5GKAC 4Z1VA 2QE3A 2DU0A 2Z79A 3JCIA 4MXWB 3AJZA 1ENXA 2D97A 1RTVA 4AQ2A 1OQ1A 4R9BA 1NE4A 5GALA 4AI0A 3R0RA 4EV0A 1YYNA 4WM7C 1BEV3 4QHBA 4C90A 4RD7A 3OPZA 2JKBA 2MNGA 2Q8OA 2IXCA 1S0EA 5JR7B 2D43A 2ZHLA 4RA0A 1RITA 1FXZA 3HBZA 1C28A 4V1PA 1SACA 2YGMA 4PBPA 1KXGA 4K1YA 5DDJ3 1NY71 3ZN6A 3ASIA 4RSUA 1JYCA 1KFXL 5L73A 3MW3A 3ZFGC 3LA3A 5C8CC 3VKOA 1FV2A 1J59A 5BNPA 1ZA4A 2WZR3 1N47A 4LE3A 1PGW2 3SMHA 3VZMA 2R32A 1AL22 1DQ1A 1LGNA 3BB6A 2N7GA 1H4GA 4GIQA 2P3JA 2CNAA 3D8CA 5HCAA 5L7OB 1JHNA 3ALQA 1YWKA 3KS7A 1CJPA 4GMP0 3WNXA 3E6CC 1AR83 4KL1A 3DPRA 2WT2A 1FYUA 2GNMA 2NLRA 2D6PA 4BWOA 1YJLA 1RUI2 3B3QE 1V6IA 4IEZA 5GZDA 3AFGA 3QH6A 4M3CA 1S0CA 1ASJ3 3E5XA 4XJZA 5BUVA 2DVBA 3GZAA 2K9ZA 2RJKA 5FO9B 2GH2A 3RMXA 4AI2A 1BZWA 2VNRA 2NQYA 1VRH2 1NCQC 1NG0A 4R4ZA 4AW7A 1R1ZA 2WS92 2DWRA 2VG9A 4QQPA 2XH6A 1HQNA 2E63A 2X53S 4KGQA 1BBT2 2AUYA 4LO6B 4LBKA 2EA7A 1VBE1 2ETEA 3SNMA 3M3EA 3WW1A 1GICA 3IMNA 2OZ6A 4XF1A 1PVC1 1WUVA 2WFPA 1EAH2 4DOUA 1ZZBA 2EAKA 4N53A 1GYKA 5D8AC 2TBVA 1KQRA 1RUF1 2VW1A 3TYJA 3ZSEA 1JH5A 3RPQA 4EJRA 2R16A 1PO21 1QJU3 4A7YA 1AUYA 1HV1A 2ZAHA 2CGPA 3VDDA 5GJ6A 2ZMNA 4OHXA 2D40A 5C33A 1NOVA 2DFBA 1GV9A 1PM7A 2CAUA 3CNAA 4MVTA 3VHOA 4AGVA 2Q1MA 1HIXA 1SBEA 2GC0A 3H7YA 4NWWA 3UKTA 4D7YA 1TEIA 2YV8A 1DZTA 3AZVA 5B2GB 1LHOA 4G3YC 2ZHKA 2CGNA 3NKGA 4SLIA 2DVDA 2VQAA 3O0XA 4BMBA 3CJXA 1QU0A 5FO7B 2A3XA 4Z2WA 1FAYA 1QDOA 1AYM1 3H3ZA 3D0SA 3D82A 1YI7A 3SISA 2BUKA 3RZZA 5ACA1 1NA1C 3J8F2 2D6KA 1GKBA 1NY72 1IKQA 1Z78A 4NWVA 4AXOA 3VBUB 3S7IA 5CBLA 4MXVA 2R041 5IT6A 3N7MA 2P34A 4Y4YA 3HT2A 1ZVFA 1YUDA 4IV1C 4XBLA 1O3SA 1W0PA 2Z2SB 5BNOB 4LTAA 4ZU4A 4N43B 5BNPB 1QY4A 2ZX0A 2ERFA 3VBFC 1PVXA 1X33A 3O12A 3WHUA 4K7JA 1O4ZA 5J3UA 4HL0A 5BNNC 5I91A 4P9XA 3VBUC 1EV11 5CU1A 5FRAA 2FBEA 4L11A 3ZXLA 3AP5A 4GB31 3Q9OA 5T52A 1JBCA 5J48A 3IKWA 4WM8A