5GJ6A

Functional and structural characterization of p[19] rotavirus vp8* interaction with histo-blood group antigens
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
160
structure length
160
Chain Sequence
VLDGPYQPVAFKPPNDYWILVNSNSNGVVLEGTNNTDVWVAIISIEPNVNSESRQYSLFGVNKQITVVNTSNKWKFMEMFRNNSNAEFQHKRTLTSSTKLVGILKHGGRLWTYHGETPNATTDYSTTSNLNEISVTTYAEFYIIPRSQESKCTEYINTGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Outer capsid protein VP4
publication title Functional and Structural Characterization of P[19] Rotavirus VP8* Interaction with Histo-blood Group Antigens.
pubmed doi rcsb
source organism Human rotavirus a
total genus 44
structure length 160
sequence length 160
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2016-06-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5gj6A01
2SBAA 1Q8VA 1Q8PA 3ZSMA 1DFQA 4Q27A 1GICA 2D7FA 2P34A 3ZSLA 5IK7A 5GLWA 2EIGA 4ITCA 1QDOA 3A0NA 1G9AA 4AVTA 2ZGMA 2PELA 3VKNA 2DYCA 2WKKA 1SBEA 5T55A 1CVNA 3QLQA 4GKYA 1DBNA 3AYAA 1AX1A 3KM5A 1Q8QA 4Y1ZA 1LHWA 1BZWA 5H9SA 3AYDA 3UL2A 4KBBA 1MR5A 2AGSA 2A6XA 2B7YA 2ZHKA 3PMEA 5IUQA 2LALA 4BLIA 3AJZA 2WJSA 3FFZA 3WG4A 4XJZA 2OUHA 3VUOA 3UK9A 5KXEA 1V6OA 3ENRA 1N3OA 4Y1VA 2AUYA 2NN8A 3U4XA 4WVVA 2YMZA 2D6LX 1GKBA 2VW2A 4YGCA 5E88A 2ERFA 3RS6A 4H55A 1ULDA 1W6MB 1LEDA 3INAA 5F5QA 1S1AA 4ATFA 5SV8A 4U36A 4DQAA 2DV9A 3V65A 3L2YA 5H9PA 3OGGA 5IT6A 1C4RA 1H30A 1W6QB 1N1VA 1QNWA 5GZDA 1IKPA 2CL2A 2ZABA 2DVBA 1MZ5A 1GZWA 2I2SA 3M1HA 1Z0HA 5GLUA 3AP9A 2JJ6A 2ZGUA 1B09A 4JCKA 1GBGA 1LULA 3D5OA 4XIKA 4Y1UA 4YZ1A 1WW4A 4FP2A 1QGLA 4PF5A 3ILFA 2DVAA 1LHNA 2DUOA 5GZCA 4FPJA 2BQPA 3AP5A 3V64A 3WUCA 1LECA 2WT0A 5AVAA 4GWMA 3AZZA 4YG3A 1AXYA 2ZACA 2UWAA 5T5JA 3WUDA 2EXIA 2YY1A 1V6KA 1WW7A 4AVVA 4BOWA 1LENA 4YW3A 1WCSA 3T1MA 4FPGA 3OPZA 1S0JA 1MS4A 3WDXA 4FOVA 1A8DA 3AJYA 5EXOA 3AK0A 1FATA 5L73A 1KDKA 2V73A 5IK8A 1SLIA 4GKXA 3O0WA 5GZFA 4YW5A 4BM8A 4LBQB 1CJPA 2YROA 1JW6A 1CIWA 3ILRA 1W6PB 1DHKB 2AH2A 3RSJA 4WVWA 2UWBA 4TZDA 4AGGA 1W6MA 1WD3A 2GNDA 1QF3A 5H9RA 3ZSJA 2D3PA 4D69A 1CONA 2XB6C 2D3RA 1LESA 1GLHA 2CTVA 2RHPA 2ZHMA 3MW4A 4FPEA 3N3HA 1QNYA 3IMNA 4GWNA 2A70A 5KXCA 1VALA 5DUXA 2P3JA 1Y7BA 4LBLA 4YZ4A 1NXD1 2ZMNA 5LK5A 2PHWA 3SLIA 2CWMA 4Y24A 1DQ6A 3N7KA 1LODA 1SBFA 2AREA 1LOCA 1LOBA 1R1ZA 3PJQA 3ZYPA 1Q8SA 2P2KA 4Q26A 1JOJA 4C1WA 4CRQA 4RA0A 4YG6A 1I1EA 1V6MA 1SLTA 3ASIA 4R9CA 3WZ1A 1X50A 2GALA 3AP6A 1S0FA 1DQ5A 1QOSA 3NV1A 1SCRA 5CA6A 2AR6A 2GMPA 1UKGA 1DZQA 2LTNA 1LU1A 1MS1A 1GYKA 3MPPG 5DUUA 3RG0A 3WCSA 3M3CA 1WBLA 2VH9A 2VW0A 2H0BA 2ZGKA 1DIWA 3ATGA 5H9QA 4XILA 2A71A 1G7YA 1TEIA 1S0CA 1G86A 2ZMKA 1SLCA 4YGEA 1N1YA 2JE9A 2A5ZA 4IQPA 5JMCA 4Y1YA 2EXHA 1AXZA 2OUJA 2A7AA 4XHXA 3AXEA 1EPWA 4I30A 1QOTA 2E7QA 4PBPA 1W6NA 2A3WA 1GZWB 4Q1PA 2UWCA 1J1TA 1G9FA 4AGVA 1SLLA 3IN9A 4ISQA 3APBA 4XTPA 1WUVA 3R4UA 1SACA 1SLAA 1LOFA 3ZPYA 2ZGOA 1A3KA 5JLVA 2JDZA 3RMYA 2EXJA 1KJLA 4YM0A 4YM2A 2YV8A 4FP3A 5T5PA 4XDQA 4YGBA 1ULGA 4UW4A 3TAYA 4L8QA 3IKWA 1ENSA 2FMDA 3WDUA 4GALA 4BQ1A 3FLTA 4JRAA 1DQ2A 4BLJA 2C5DA 2GNTA 3OY8B 3A0KA 3PVOA 1WLCA 4FOQA 1Z78A 1MS0A 4R9BA 4AGRA 4P14A 4XHBA 4Y20B 1W0OA 2ZA9A 5IK4A 3HN1A 4XJAA 4XE9A 4YZ5A 2E7TA 3DGTA 1VLNA 4XBLA 2ZGNA 2WNEA 3O12A 3WOGA 1F9KA 3ZYRA 2DURA 1F31A 3WG1A 1G8WA 1SFYA 4K20A 1RITA 1ONAA 3ZXEA 1O4YA 4CZSA 2ZGQA 5T52A 1V6LA 3WV6A 5JOWA 1AZDA 4FPHA 1V00A 4FOWA 3IPVA 2DUPA 1GZ9A 3VKMA 4M3CB 2DU0A 1JN2P 2V5YA 1UL9A 1GV9A 4YM3A 1CPMA 1QU0A 1W0PA 4NOTA 4YW2A 3WDVA 4K1ZA 2A3XA 3Q9OA 4C1XA 3LSEA 3B3QE 1UN1A 3FLRA 2PHRA 5T5OA 2DU1A 2A3YA 2GMEA 5DZFA 4Q1RA 4R9AA 1YRZA 1LJ7A 3POWA 1ZA4A 4XBQA 1H9WA 1JYCA 3WVJA 1IS3A 2PHUA 1FV3A 1KDMA 1N3PA 1WW5A 1LU2A 2PHTA 2ZHNA 3I4IA 4DPNA 1ULEA 2D6NA 4Y22A 1SCSA 4Y1XA 5GM0A 4ISRA 3D4KA 3ILNA 3OY8A 5GALA 4P9WA 1MS5A 1HLCA 2WSVA 4AWDA 3QCWA 1O4ZA 4Y20A 4LBKA 1MVQA 3LSDA 4Q8LA 2P3IA 2VXRA 3OBTA 3FUOA 3WDYA 2D44A 4SLIA 3WG2A 4DRVA 1W6NB 2W39A 1LTEA 4K21A 2EALA 1IS4A 2GDFA 3AYCA 4UW3A 2WLQA 1BQPA 1YI7A 3OBRA 1FNZA 2ES3A 2GMMA 4WV8A 2ZGTA 3USUB 2GNMA 5FRAA 2ENRA 5BYNA 4BMBA 1C1LA 2G4IA 3IM0A 1APNA 1MACA 3WDWA 3AZVA 4BPZA 2GN7A 4M3CA 1ENQA 1UPSA 1W6OA 3FBYA 4YG0A 3UJQA 1BJQA 2PHFA 2KM2A 1DYPA 3AZYA 4HL0A 4P9XA 1SBDA 4WZFA 5F9TA 4FPOB 3NV3A 2WSUA 3C2UA 1VIWB 3JUUA 4FPLA 5GZEA 4FPFA 3AYEA 4K1YA 1LGBA 1BYHA 3SISA 5JDBA 2VY0A 5HCBA 2VUAA 1V6NA 2D6KA 2SLIA 5CB7A 4XOGA 4FQZA 3WHUA 3FUQA 2JECA 4PCRA 1G9BA 1RINA 1AX2A 3MW3A 2EF6A 3VV1A 5JVVA 3O0VA 2CYFA 1JUIA 2D6MA 4YFWA 5DUWA 1VAVA 5CAZA 3ZXKA 2UURA 4P9YA 5T54A 5EYYA 4NO4A 5E89A 2W68A 3AX4A 3B01A 3IPVB 5DG1A 4AYUA 3BTAA 4FOYA 3AXDA 4XBNA 3USUA 1LGNA 3VKOA 2A6VA 1YXWA 4RL7A 1ZM1A 4UW5A 1KJRA 3M3EA 1BXHA 1UMZA 2ZBJA 1HQLA 3N7JA 4FPYA 1MS3A 3N7LA 3SH5A 3AP4A 5HCFA 1FX5A 1N1TA 1FV2A 1QKQA 1S0BA 3RRDA 3GNEA 1DYKA 1V6JA 4XZPA 5GLTA 1GNZA 4OZXA 4XYXA 3W59A 3ZXJA 3M3OA 2D43A 2XG3A 2ARXA 2DVDA 3UJOA 4XJ9A 1ULFA 2WQZC 2AYHA 3OJBA 2GNBA 1AXKA 4DS0A 1ENRA 4W65A 4Y22B 1LCLA 4ZKTB 4HANA 2NMNA 2HYKA 1DLLA 2A6YA 2JD4A 1AX0A 3ZSKA 1JBCA 4ZXKA 3VKLA 1QMJA 1GSLA 1CESA 1KQRA 3W58A 1MS8A 2ARBA 1UAIA 2P37A 1H9PA 1BKZA 1HQWA 1Q56A 1VAMA 1D2SA 5T50A 2E53A 1WLWA 2CNAA 3BODA 4R9DA 3WHTA 3ZXFA 5DUVA 5KXDA 3OYWA 4XXPA 3WG3A 4M00A 3ZVXA 4F83A 2GN3A 1FYUA 2DWRA 4Z8BA 2PHXA 5DXDA 1OFSA 3BIWE 2R1BA 2ZHLA 1AF9A 4YFZA 2D3SA 3V0AA 3AP7A 2Q5TA 1LEMA 1W6OB 4TYSA 1WD4A 5FREA 4FVVA 1UX6A 1PZ7A 1AJOA 1IOAA 1DQ4A 3BOPA 3DUIA 3HMYA 3R4SA 1FNYA 2UU8A 3O0XA 4BMEA 1S0EA 1G9DA 1D0HA 3T1LA 3MW2A 3POYA 2WT1A 2DTWA 1GZCA 1S0DA 3B9CA 3O5SA 3R05A 4FPCA 4FQ4A 1JYIA 2NMOA 1AJKA 3GALA 1C1FA 1SLBA 1JHNA 4XMIA 3AZXA 5DZGA 5CBLA 1UZYA 1YIFA 4XXAA 4M3CE 3FLPA 4YW4A 5DZEA 3WLUA 1DGLA 1NLSA 3V0BB 2E51A 1RIRA 2ZGPA 3TB0A 1F5FA 1PZ8A 3NV2A 2OVUA 4LBMA 4YZ2A 4Q2FA 2R16A 4Y26A 2YZ4A 2ZZJA 2NYYA 4GXLA 3I8TA 1I3HA 1V6IA 1CPNA 2CY6A 2W52A 1A78A 4JC1A 4YLZA 3SNMA 4ATEA 1UZZA 3D6EA 3KQRA 5KXBA 2ZGSA 4YZ3A 4LBOA 1CQ9A 1LHUA 4XIOA 1S0GA 5GLVA 3POSA 1OQ1A 2ZGRA 1MZ6A 1KRIA 2A6WA 2ZGLA 5JOYA 2FHRA 4AVSA 1N1SA 2DTYA 2VU9A 3RMXA 1HDKA 2D6PA 3WDTA 1LOGA 1LOFC 1MVEA 5T5LA 3SH4A 1N47A 1AVBA 2YXSA 1HKDA 1DQ1A 2OW4A 1IS5A 3AZWA 3N36A 5EYXA 4LBNA 4ASMB 3HR9A 1URXA 2EXKA 1DQ0A 1LOAA 4CTEA 1G9CA 2WT2A 1Q8OA 1WLDA 3VKFC 5CNAA 4GA9A 4YGDA 3NWKA 1XQNA 2C9AA 4DFSA 4XTMA 5GZGA 2JE7A 1N3QA 3H0OA 2A6ZA 1CR7A 1W6QA 2EAKA 3JU9A 3M2MA 1JXNA 1YO8A 4YM1A 3T2TA 3ZXLA 2NZ9A 2NM1A 1MS9A 2R49A 4Q8KA 2AENA 1LHVA 2R0HA 2W08A 3AFKA 3WNXA 1FAYA 3MEPA 3SH3A 4LBQD 2CWSA 2VW1A 3WCRA 4LBJA 5GJ6A 4M3CF 3V0BA 4U2AA 1OKQA 1WW6A 2R0FA 3SITA 3OYWB 2ZMLA 1ULCA 4DRRA 2DVGA 2DUQA 3B00A 1CN1A 2ZKNA 4MYEA 5JOXA 1GANA 3LCPA 4UW6A 3A4UA 3N35A 1U0AA 1WBFA 2P3KA 3B69A 3V0AB 3CNAA 5E8AA 4M01A 4XJUA 1S0IA 5IK5A 2JKBA 3NV4A 5GLZA 2E6VA 4XJWA 4XJ8A 1PZ9A 3N7MA 2R1DA 5EWSA 4FPKA 1LOEA 1QOOA 1IS6A 2TEPA 4PQ9A 1KITA 3PVNA 4YW1A 1LGCA 5HCAA 2Z42A 2NP0A 4LBQA 1LHOA 1IKQA 1GNHA 1W6PA 2D6OX 4XMAA 5JOZA 5DG2A 1YYNA 3RQ0A 2ZAAA 2DVFA 3PVEA 4PBOA 2A75A 1C57A 1QDCA 3M3QA
chains in the Genus database with same CATH superfamily
4JHTA 2X5IB 1WA6X 1DZTA 1OD5A 2FCVA 1GICA 2VOTA 4Q4V3 3VHPA 3ZSLA 2XPJA 2EIGA 2HWE2 4ITCA 4MOAA 1EV11 3A0NA 3EB7A 4UFIA 5FYBA 5BNPB 4E4ZA 2WNVC 1SBEA 4V2VA 2C6SA 2VZQA 3PUIA 1Q8QA 1E5HA 1LHWA 3PU8A 3LKJA 1BZWA 5FJKA 1O3RA 4DY5A 5J37A 1NQJA 3PUQA 4KBBA 3PMEA 4BLIA 3WQ0A 3AJZA 4MGYE 2VOVA 5CKMA 3POEA 2OKXA 1OFNA 5AC91 2P3YA 5G05L 3USSA 2ZEWA 3LZZA 3OD4A 3UK9A 4XFHA 5KXEA 2VZUA 1N3OA 3HVDA 5L9BA 4BYYA 3RZLA 2NN8A 1HN1A 2R30A 2HWC1 5DMYA 1GKBA 2VW2A 3NL1A 3NNMA 3U37A 4YGCA 2ZEYA 5JIAA 2ERFA 4XW3A 3MGUA 1ND3B 3ROUA 5JZGA 4FFHA 1LEDA 3INAA 2VVEA 2WFF1 4AI2A 1OVSA 5E16A 5B4NA 1W06A 1UKRA 4FI9A 1JMUB 2QUOA 3WINE 5H9PA 4JDOA 1C4RA 1W6QB 1U5XA 1QNWA 1XYPA 2CL2A 4PLNA 2IFRA 3NNFA 1BEV3 2R063 2JJ6A 2Y6FA 5FUIA 4RGGA 3PL0A 3WW1A 4EJRA 5A33A 2OXBA 2WFPA 2R042 2QVSB 1HXS2 3HT2A 3ILFA 4OQ9A 5IVEA 4RR3A 5GZCA 4FPJA 5DAVA 2JG8C 2B46X 3AP5A 1UU4A 3V64A 1LECA 1XU1A 5A6YA 1L7QA 3B7MA 2UWAA 2TNFA 3VD3A 2BNOA 3WUDA 3B94A 2ZEXA 3POJA 4CDQB 4E4SA 2VJXA 5LA1A 5EV7A 1LENA 2UY9A 4BOWA 4K40A 5FZIA 3J8F1 3KSCA 4FTEA 2VMIA 1A8DA 4OHWA 5DABA 1FATA 4LR4A 5FZMA 4WBBA 3BTYA 4P9IA 1VBE2 2Y34A 5IAVA 5IK8A 1SLIA 5GZFA 2XH6A 4YW5A 3J26N 4BM8A 3R6SA 5CU1A 4CCJA 4YWAA 4Q4W3 2YROA 3B9IA 3ILRA 3CJXA 3W21A 4J25A 2AH2A 3IIIA 4AAPA 4O9EA 5A7SA 4GH4B 4AGGA 3WW3A 3WNMA 3FZ3A 4HSLA 2QQOA 5D8AB 1QF3A 4D69A 1CONA 4COUA 4QX1A 2AEYA 1LESA 2RHPA 2LRPA 3K48A 3N3HA 5FZOA 1ZZCA 3I3BA 4JGYC 4GWNA 3RFRA 5DUXA 1ODNA 2P3JA 2D5HA 3SCGA 2X29A 2G9FA 5LK5A 3M3IA 5FZGA 2V09A 1UO9A 4KH9A 4E27A 3N7KA 4GWIA 3TEXA 4C8DA 1UOGA 4N53A 4R8HA 1JOJA 3JB8A 3UESA 3OEBA 4D6SA 1V6MA 3K3OA 1X50A 3JXSA 2GALA 4MLOA 3AP6A 3VBOB 1SCRA 5LEJA 2AR6A 2QQNA 1SEFA 1PHMA 3HN3A 1UKGA 1DZQA 5LBEA 1RB8G 1MS1A 1GYKA 2DCYA 2YG0A 3BCWA 3M3CA 3N4MA 3VBUA 1WBLA 5F1RA 2R043 4Q4X3 3RYRA 4ARXA 1HXS3 2C24A 4I01A 5JZGB 1DGWX 1RUI1 3TBDA 3WW2A 1UXZA 1XE7A 4OZOA 5H9QA 1S0CA 4JKKA 1PGSA 4LA2A 4QQOA 3J7LA 2CV6A 2QE3A 3NMBA 1O7FA 4ES8A 5C4WB 4HMZA 4A6SA 1SQ4A 4I30A 5FY4A 1STMA 3HD8B 4MSVA 1AR73 1W6NA 4Q1PA 3ZIXA 1J1TA 2RDQA 1SLLA 3IN9A 2GP5A 3PUSA 1ZBE2 4ISQA 2VXJA 5AC92 3K2OA 3DPRC 3VD5A 1WUVA 2HEVF 3R4UA 3P3PA 1SACA 1SLAA 2PXJA 4W6XA 4XDOA 2HWC2 5LRSA 1VBE3 4ONUA 2HBUA 4RR3B 5JXGA 5L7OB 5FZDA 5A3OA 1SZBA 4YM0A 1PNFA 3H1WA 3NW4A 2WS91 4FP3A 3KLSA 4XDQA 2JKXA 4UW4A 3TAYA 4RQPC 2JICA 4L8QA 4MVTA 1I5PA 1CJDA 3FE5A 5F3IA 3HBZA 5FLIA 3VGIA 5JR2A 4GALA 3ZFFC 4BQ1A 3FLTA 4JRAA 4O61A 3ZFEB 4JGZC 3TEZA 3LFIA 2GNTA 2Q8DA 2CU5A 2Z79A 5GKAC 3NSTA 1HRV1 4P14A 1ZZ9A 2VM9A 2VZSA 4Y20B 5FPBA 3G7DA 5J09A 1UOBA 3DV8A 2E7TA 3PLQA 1E57A 1X33A 1VLNA 4XBLA 4Z82A 3WOGA 3UNPA 3U1XA 2DURA 2YFUA 2BGPA 3M7AA 5FYVA 5EJ3A 3SCFA 3ZXEA 2ZGQA 3JD71 2P6CA 4NHMA 3WV6A 1V00A 4I0BA 5C7GA 4HLTA 3E97A 5C8WA 3NKGA 2FZ1A 1JN2P 2V5YA 4QDQA 5LW9A 1JYWA 2W5FA 4CEWC 1RL3A 3KB5A 1CPMA 1HB1A 2BBAA 3LWCA 4N53B 3VL8A 4C1XA 4Q0PA 3LSEA 2Z2SB 3FLRA 1ZRDA 5DZFA 4FTSA 4CDWB 3PVBB 3LA3A 1XSQA 3GXUA 4DUWA 1XNDA 1OBNA 1ZA4A 5FZBA 3TRSB 5A70A 3KCYA 4UAPA 5AC93 3ES4A 1KDMA 1NYWA 1ZBE3 3I4IA 1QH7A 2UYAA 1WCQA 3G6JB 1ULEA 2HWF1 4Y22A 1SCSA 3VBUB 3BIEA 2PQSA 1QXPA 4ISRA 2HWC3 3ILNA 3OY8A 3KV6A 5CKNA 1SPPA 5GALA 1EY2A 2YUEA 2QTWB 4P9WA 1Y43B 1W99A 4AK3A 1W2UA 4QQHA 4AWDA 5K7PA 4LBKA 5A3WA 2VXRA 3OBTA 1H8TC 2WZR2 3FUOA 4HK8A 5A3LA 5C8CB 4PT6A 3LDKA 2BTVC 1UMHA 4SLIA 3WG2A 1W6NB 2W39A 3ZDVA 4AFDA 4CP1A 1X8EA 2GDFA 2RJLA 3AYCA 1OLRA 5IAXA 1BQPA 1YI7A 3OBRA 5J3UA 1EYBA 1SFNA 2ES3A 4Y4RA 2MEV1 3KT4A 1C5IA 1C1LA 3PU3A 4AVCA 4JRLA 5FPVA 1DGRN 1BVVA 4TSVA 3SEEA 4QM8A 1RJ7A 1RUI2 2GN7A 4M3CA 1ENQA 4CCEA 1UPSA 3MDPA 3FBYA 2KM2A 4BU2A 1K5MC 4QPGC 4E2SA 2MPFA 5JCTA 3MF9A 2O0OA 4WZFA 3CEWA 3RJ2X 3RI9A 1ZRCA 1WCDJ 3NV3A 3JUUA 1SDWA 1NCQA 4FPFA 2VPVA 1W2NA 5F3GA 5LB6A 3H3LA 3SISA 4EWEA 3NAPC 1PVC1 2VUAA 5M0TA 4YVSA 3SXWA 5JXIA 1J1LA 2BWCA 2JECA 2EIBA 3WNNA 5FYUA 2BP6A 5FAXA 2JG8A 4WM8B 1AX2A 3MW3A 2WS92 5EJZB 2W95A 4LHSA 2EF6A 3VV1A 4CU6A 2CYFA 5LK7B 1W9SA 3PDQA 1CAUB 2J1RA 1LNSA 5ISLA 4NO4A 1BBT1 4ZU4A 4XF3A 2LM3A 4XQDA 3R4DB 3AKSA 2WAOA 4AI1A 3BTAA 4FOYA 4XBNA 5B4XA 3ZFGB 1PX3A 1HRV2 3VKOA 2A6VA 1YXWA 3ST7A 4GJZA 1ZA7A 1KJRA 3M3EA 1BXHA 1UMZA 3N7JA 3K4DA 4XFBA 3CU7A 4S2GA 1EPZA 2X5IC 2BWAA 3MFCA 4RD7A 4UBHA 3IBMA 5HCFA 1FV2A 4ZS2A 4H7LA 2FDHA 2WZR3 4CU9A 1POV3 3ZXJA 1HV1A 3M3OA 3NQHA 2D43A 3ON7A 2RR13 2DVDA 2JWPA 2WC2A 4J1XA 5LBCA 4OHYA 2WA3A 3JD72 5C9AB 3LQCA 4Y22B 1UZVA 1A6CA 2VOWA 4JGYA 2YBPA 4P9GA 4HANA 5FY1A 5G04L 2BPA2 1SPPB 2HYKA 4LE4A 4CCOA 1CX4A 1X82A 2Z5WA 5LA0A 3AKQA 2WNVB 4KI5M 3M70A 4OCTA 3ZSKA 2PAEA 5DQ0A 1RUI3 4JKMA 5FYHA 3DYMA 1KQRA 2J1TA 3RWKX 3W58A 4UFLA 4CEYB 2ARBA 2XWJB 1UAIA 4DXSA 3KV5A 4YW7A 4CDUC 1HQWA 2E53A 1CX1A 2CNAA 5DUVA 3CDZB 5F3CA 3GZEA 1ND3C 2RS11 5KXDA 3IDEA 1WGPA 1UY1A 2XVKA 1JZ4A 1YFYA 1FYUA 2GN3A 2V4VA 5JMOA 4DIQA 3NJYA 1RGSA 1ASJ1 1OFSA 1QJU1 3UT0A 1AF9A 2VBDA 1GP5A 2Q5TA 1VBA1 2EIDA 4TYSA 3UKNA 2PHLA 1PZ7A 3POBA 2HKXA 4PDWA 2WS93 1AJOA 1IOAA 2PTMA 2YGMA 3BOPA 3DUIA 3FN9A 1M06G 1FNYA 1YLLA 2I07B 2HJIA 1G9DA 3T1LA 4HONA 4FPCA 3A23A 2ZTNA 3T2OA 2W3JA 3ZN5A 1F35A 2NMOA 1AJKA 4X6RB 2NQYA 4MGKE 1EP0A 3FFQA 4L11A 3AZXA 2W1SA 4NN0A 2MEV2 5BV6A 1UZYA 4XXAA 2ZX2A 4M3CE 5FLHA 3WW4A 1HRV3 4YW4A 3UGHA 5A3NA 4CPBD 4JHZA 4IUGA 4IEQA 3EBRA 2OPKA 3Q8FA 1OA4A 1ZREA 5CG9A 4LHKA 4MZUA 1Z7S3 4QAWA 1W8OA 3GHMA 4LEJA 4MGZE 2GC0A 3LEKA 3KV4A 4NR1A 4YZ2A 1JYVA 2F17A 5FKBA 4LUMA 4RQPA 2BEOA 1OH4A 1HB2A 1NXMA 2WN3A 2W52A 4YLZA 1A78A 3SNMA 3JD73 2F6BA 1W8FA 3ZFFA 5KXBA 3KQRA 3OGRA 3CJIA 2ZGSA 3WP4A 5FO9B 4ZPIA 3O1SA 4JGZA 4MGIE 4XIOA 4LO7A 5GLVA 1XBFA 3OOXA 3T0DA 4J6GA 1RJ8A 2BYVE 2ZGLA 4QGMA 2FHRA 2FBEA 1N1SA 1VRH1 1WA4A 2DTYA 2VUJA 3N9PA 4RSUA 3WDTA 5FY7A 5FXWA 4MXWB 4DNYA 4JVAA 5DPNA 1N47A 1HKDA 2OW4A 2WYFA 5EYXA 5CFDC 5BPXA 1VB4A 4LBNA 3HR9A 3NNLA 3DEMA 4P9LA 5ACA2 1LOAA 3ZXAC 2CGNA 4ZZ5A 4CTEA 3LIGA 4DOUA 2ZXQA 4I2OA 2CAVA 1WLDA 1BBT2 4XZUG 5CNAA 5D1IA 2BJSA 5JPNB 4AVSA 3ZKUA 1WMFA 4LO4B 4JGYB 4YGDA 3RZHA 2FDKA 4Y5TA 1DZRA 4A3XA 4YM1A 2A6ZA 2EAKA 5FXXA 3VD7A 2XR4A 5A3MA 5IFPA 3FWEA 5FP8A 5I8YA 1ZBA1 4LQRA 2EA7A 2R49A 5CYYA 2H0VA 4Q4V1 3WNXA 1JI6A 4CEWA 2R7EB 4OVEA 4LBQD 5FV3A 2HEYF 1JH5A 1MZFA 4N90A 4RFRB 1OKQA 4UOJA 5IATA 1OVPA 1QY4A 4IEPA 1ULCA 4CCNA 3IMMA 2DUQA 2QBXA 3RI8A 3B00A 1AUYA 1TG7A 3LPFA 2YC0A 3DECA 5JOXA 5C4WC 3N35A 4IXLA 3O1PA 1WBFA 4FXKB 5KR7A 3H3UA 3FHIB 5IVVA 3E6BA 3O1MA 2XMLA 3MIBA 2E6VA 1X8MA 4XJWA 3LE0A 4MGSA 2R1DA 3AMNA 2VNRA 3H7YA 4A2UA 1H8TA 4YW1A 3KCXA 2BU9A 2NP0A 2VUCA 5FZ3A 2BGCA 1C5HA 1IKQA 2RS12 3I3DA 4LK6A 5JOZA 4M4RA 5FK8A 3C8XA 4URTA 5EQUA 2QQKA 2X05A 3DPRB 5EJ1B 2K2SA 1ASJ2 1QJU2 1XYOA 4PBOA 4EYUA 2WKKA 3IT8A 3M3QA 2SBAA 1Q8VA 2R061 2P34A 5IK7A 3ZFEC 1VBA2 5GLWA 1CGPA 3ZMOA 3O1UA 3WF2A 1F4AA 3VKNA 4D0QA 3LDRA 1FT9A 5T55A 1FOD3 3WQBA 4RQPB 1DBNA 4URAA 5ACA3 1K5MA 4QPGA 4L0PA 4MH0E 4LHLA 4JTNA 3ZFFB 1BBT3 5H9SA 1MEC3 3AYDA 5BY5A 2GH2A 4JGZB 4MV2A 2A6XA 2BVVA 3V56A 4D7SA 2LALA 3M4FA 5FYIA 4F8AA 3VBHC 5KHGA 4EN9B 3GJBA 1OA3A 1W8WA 1OI6A 3OF1A 4Y1VA 2AUYA 4HZFA 3U4XA 1GQGA 2YMZA 4IL7A 2D6LX 4B29A 3MLKA 2WN2A 2Q8OA 3F2ZA 4BWOA 3E5XA 2PQQA 2Q0AA 5A7OA 4DXTA 3LFMA 2Z69A 4HVOA 4Q4W1 2DCJA 5T3NA 1YFWA 3DKWA 4U36A 3PHMA 1MQTC 4QX8A 4XACA 3V65A 3OGGA 4K3UA 1O3SA 1B35B 5GZDA 2GC2A 2HWD1 4CDWC 2DVBA 4YYOA 3BOWA 1US2A 4AQ6A 4YSFA 5FY9A 3AP9A 3ZN4A 2VQAA 4JCKA 1LULA 4N7IA 1YC61 4Y1UA 4BDVB 2X5IA 4PF5A 4ZY9A 3EO6A 2DVAA 4PHZA 2DUOA 3ACFA 2ADEA 3AC0A 5BNPA 5C3RA 3H8UA 4GWMA 5A1AA 3AZZA 1DYOA 1AXYA 4RN5A 5FXZA 1V6KA 1E5RA 4IEYA 4FPGA 1ASJ3 1S0JA 4S2HA 3ZDSA 4YW6A 1ZBA2 3AJYA 3GCWA 5JSPA 4HVRA 1R081 1VBA3 4RGKA 3E6CC 2PN5A 2Y64A 2YBKA 1H8TB 4GKXA 2JE8A 2WNOA 1UQXA 3VZMA 2R041 4Q4X1 4Z2AA 2WWSA 4IERA 3WQ7A 1CJPA 1JW6A 3AKPA 4A44A 1DHKB 1AYM2 4C0BA 1RUNA 4QGLA 4WVWA 1ND3A 3MICA 4QXKA 4NHXA 2VO5A 1WD3A 2GAUA 2JDUA 4P5YA 5H9RA 1L7RA 2K9ZA 5FZKA 1HW5A 2GP3A 1AR71 1JZ6A 1GLHA 2CTVA 2ZHMA 3MW4A 4EQVA 1QNYA 3DXTA 1WCKA 1CAXA 1Y7BA 4YZ4A 2B39A 2P6HA 5FZ8A 4QPGB 3RGBA 4KMQA 2I45A 3L2HA 1KFXL 1SBFA 5FZEA 2WZPP 1LOBA 4WM8C 3ZYPA 1XRUA 2P2KA 4Q26A 4YG6A 1SLTA 1W3VA 3B93A 4R52A 3W9AA 3WZ1A 4CDQA 1S0FA 3NAPB 4OI1A 3ZX7A 2GMPA 4FCAA 3PMSA 3UGFA 3FMGA 2LTNA 5C3PA 3ACGA 2EIEA 5IVFA 1X9PA 4XF1A 2MHFA 4BZ4A 5JXHA 2W2IA 2VH9A 1VMFA 4X6QB 2ZGKA 2P1BA 1DIWA 1NE6A 2ETEA 3ATGA 3FHQA 5EP9A 1XJAA 3SKJE 1N1YA 1K45A 4IQPA 3U0ZA 5JMCA 5F2WA 1AXZA 5FBZA 1EUTA 3A21A 2QJVA 2UWCA 2VD7A 2RV9A 3JCIA 5D8AA 2ZJCA 1PM4A 3VZLA 3APBA 3U75A 4CA9A 1ZBA3 2WDBA 1OMIA 2J42A 3MIGA 1HB4A 4COWA 3O1TA 3S57A 2VVDA 3ZLIA 4NMIA 3AVRA 4A7YA 1A3KA 4NHLA 4SBVA 3RMYA 2EXJA 2QDNA 5CFDA 2RS53 2XDVA 2W1QA 1OF4A 1Y3TA 4GAZA 3ZMNA 4A4AA 4DEVA 4Z2WA 4YM2A 3ZR5A 4Q4W2 1AYM3 2FMYA 4CEYC 5FY8A 1QEXA 2PAMA 4YGBA 1UXXX 2VZTA 3K3NA 2WO1A 2K0GA 5CZKA 5FPZA 3THCA 1ENSA 3WDUA 2HWD2 4N8MA 2JDAA 1GP6A 4CXXA 5F5CA 3GBFA 3PVOA 3A0KA 1ZBE1 1WLCA 2GH8A 4FOQA 4JDNA 3VBOA 4GMP3 4UBGA 1Z78A 2EVXA 3BTZA 3WF4A 5FP9A 5DDJ2 1W05A 4XHBA 1QQP1 1W0OA 3VHNA 1XE0A 4CDUB 5IK4A 2ET7A 5IVBA 4YZ5A 1PMHX 4XUNA 2ZGNA 3BPZA 5FCCA 3O12A 4QM9A 4IE7A 3S5AA 1F31A 3I59B 2JDKA 1G8WA 2XONA 3WG1A 4K20A 1RITA 4DXRA 5C4WA 1I9RA 1RMU2 3RZJA 1QJEA 2ARCA 1ZVFA 4G9SB 5JOWA 1GWKA 4AL9A 5J1XA 1CAXB 1QJY3 4FOWA 5FZ7A 5FMOS 1R082 3WSOA 1GWMA 1TNFA 4G3YC 5A6QA 2DU0A 2XLGA 5FZHA 4IESA 4Q4X2 3RPQA 2WNUB 1GV9A 1O91A 4EN8B 1QU0A 4TN7A 5L7OA 3BB6A 5DAQA 2Y6JA 3WDVA 2Q1MA 3ZOIA 2A3XA 2VECA 2ZCWA 5IJRA 3B3QE 3O1VA 5L36A 2PHRA 5T5OA 2DU1A 2A3YA 4K8RB 4R9AA 4AW7A 4UFMA 5IHRA 1AR72 3AL5A 1IQDC 1XC6A 1JYCA 3WVJA 1IS3A 1UYYA 1WW5A 1JUHA 1LU2A 2PHTA 1CAVA 3U4SA 4DPNA 4B7EA 2D6NA 3TEWA 5GM0A 3TWIA 3POGA 5DAWA 3HQXA 3ZFEA 4KQ7A 1W9FA 2JDNA 2BUKA 1MS5A 1XNBA 1YQCA 2W94A 2QKDA 1NKGA 2Y6KA 1O4ZA 1VP6A 1TQ5A 4Y20A 2DBNA 3FHAA 3LSDA 2ZEZA 4HFSA 1OLMA 3WDYA 2H6CA 3U07A 1XNCA 1LTEA 1J83A 4K21A 2VZPA 2VC9A 1IS4A 1ULPA 4CDXB 2BV4A 2HWD3 3SKVA 2Y6GA 1D2QA 3H42B 3NJVA 3WNLA 1UZWA 4WV8A 3USUB 1XNKA 5C5UA 4Y33A 2ENRA 5BYNA 2JG9C 4IEOA 5FO8B 5K9YA 1V9U1 5JI9A 3PTYA 1APNA 5DDJ3 4NIAA 1DDLA 5CFDB 1W9WA 4WZCA 3AZVA 3WF0A 1JYXA 1OSGA 3CZJA 1W6OA 4CP0A 3H1MA 3OGVA 1PMJX 1BJQA 4GIQA 4PIYA 4QX2A 2PHFA 2WZR1 1ZZ6A 3K4AA 4AI3A 2IXKA 3KVAA 4HL0A 4CP9A 2VQ0A 1POV1 1MQTA 3GDBA 5F9TA 1GQPA 1RMU3 2RR11 5IW0A 4EV0A 5LATA 1F4HA 3JBG2 1W28A 4CDWA 5GZEA 2WO7A 4K1YA 4DMIA 1R083 1O3QA 1VMHA 5CVRA 4A42A 5HCBA 1D7PM 2D6KA 2TUNA 5DAPA 3LEGA 3WHUA 3VLBB 2C0ZA 1OF3A 1RINA 3MO4A 3I97A 4NAMA 1O5UA 1ZNPA 2I74A 5F6KA 2DCKA 2FDFA 5JVVA 4XVHA 2J1UA 1JUIA 5C8CA 4PLOA 1VAVA 3ZXKA 4CXYA 4P9YA 3S30A 5I8SA 5EYYA 5T54A 4L97A 3SMHA 1GOGA 4H14A 1TNRA 1KD7A 1OUXA 2RMU1 1OKOA 1EAH2 2W46A 1QWRA 3NNJA 4XC9A 2XLFA 4QPIC 1IGOA 3PIJA 1DGWA 4BK4A 3I2JA 4OHXA 1QQP2 1AR82 4FPYA 5ABJC 3SH5A 4HVQA 1NUKA 4QDSA 4META 3AP4A 2QQVA 4AVBA 1FX5A 1S0BA 4LTAA 2JX9A 3RRDA 4OZXA 5KBFA 2H6BA 1SFPA 1AR61 1YEWA 5J7MA 2VGDA 3Q8EA 4MGQA 4I02A 1O59A 2BZDA 3WEZA 4NIDA 1CAVB 1RUF1 2CAUA 4W65A 2AEZA 3AMQA 2XJSA 2NMNA 2A1XA 2Y0IA 3SQOA 5LBBA 2A6YA 2JD4A 3O7OA 3QH7A 1RHI1 1CZTA 5F39A 1XSRA 4UFJA 1JBCA 3W20A 1GSLA 1D4M1 2VZ1A 1OQDA 1Z7S1 4WM8A 1D2SA 1W9YA 5A7WB 1UOFA 3VZOA 3WHTA 2WQ8A 4BH9A 1RUH2 3O14A 3VBHB 3PUHA 4UFHA 2P17A 3J9SA 3JBG3 1CAUA 2CDPA 3WG3A 2IXCA 3ZVXA 1YQ8A 4DO0A 3TN93 4A7KA 4NVPA 1ACCA 4CCKA 1AL0G 1B35C 3CQOA 2IXIA 4YFZA 3AP7A 4JZRA 3ZFGA 1LRHA 3EXUA 1OLME 1LEMA 2YBSA 1W6OB 3DYPA 4XURA 5IWFA 5C3QA 3AKRA 5FTTC 1K42A 3E5UA 1YCIA 2PLV2 3TYJA 4CP9B 1LAJA 1MQTB 3HNBM 3O0XA 3MIDA 1S0EA 1U5YA 1S2BA 3VB9A 2WT1A 2DTWA 1GZCA 1VBC2 1ODMA 2VCBA 3O5SA 3R05A 4E2QA 4LA3A 3ZYBA 2W47A 4I09A 2UY8A 1YFXA 3BU0A 1EAH3 2Y8KA 4LO6B 1I6XA 5FYTA 5C9AA 1V9U2 4W6WA 3RNSA 4D6RA 5DZEA 4F3JA 1DGLA 1QQP3 1AR83 2YGLA 5I0SA 2E51A 2WNVA 5BUVA 4LT5A 4QHOA 4LPLA 2OVUA 5I0UA 4CEYA 2XJQA 4OULA 3I8TA 2CY6A 1I3HA 2RR12 1RUOA 1J84A 2E33A 4UYBA 4W50A 2Y6LA 2JDHA 3D6EA 3OGSA 4LBOA 2VG9A 4QKBA 4CVUA 1LHUA 3KS7A 3DL3A 1QXJA 2F4PA 3ZO0B 3GM8A 1KRIA 3ABZA 3VDDB 2A6WA 3UGGA 5JOYA 2VU9A 3RMXA 4XCBA 3ACHA 1LOFC 3NJZA 5IVJA 1OT5A 1MVEA 2V4AA 3SH4A 1DLCA 1AVBA 4CPBA 4A45A 2AACA 1DQ1A 1HRI3 1OD3A 3AZWA 3N36A 4OUMA 3UKTA 3LDBA 2DFCA 1RUE3 1URXA 2R6QA 4ASMB 3ITQA 4QD2A 5FYMA 3GYDA 1RUH3 3IAQA 4MADA 4N43B 3SC7X 2LROA 2RJKA 3VN4A 4DY3A 4IE4A 4GA9A 3WP3A 3WP5A 4E2GA 3NWKA 1XQNA 2C9AA 2VMGA 2RMU2 2WIIB 3CMGA 3OBAA 4XTMA 4DFSA 2JE7A 5GZGA 1EUUA 1N3QA 5FZLA 1FI2A 5A3PA 1YO8A 1POV0 2BGOA 2NZ9A 1S4CA 2JB8A 2NM1A 1MS9A 4Q8KA 2AENA 1NOVA 1NA1C 1PGW1 1FAYA 1JODA 4LORA 3QH6A 3SH3A 2VW1A 2XBO1 4LBJA 5GJ6A 4M3CF 4EZHA 2PLV3 4U2AA 5HXVA 4LULA 1E5SA 2O8QA 1FOD1 2Q4SA 4AOCA 5ACA1 1AR62 1VBC3 4LKSA 5K0UC 3TNPB 2ZKNA 1LB2A 3H9AA 1RUF2 4BQ4A 1MEC1 3NRUA 3A4UA 4UW6A 4ZS3A 4EN0A 4Q0VA 2P3KA 4QU2A 3ZN6B 4UFKA 1RTVA 1V9U3 2J1EA 4W4ZA 5E8AA 2BBVA 1XNTA 1RHI2 2JDMA 5F2SA 2ZS6B 3C7FA 1PZ9A 4P02B 3CLPA 4QDRA 2FDGA 3KHBA 5CEHA 3T30A 5EWSA 1D4M2 3I54A 4MXWA 5FMBA 1Z7S2 2X8KA 1GNYA 4YVWB 4LBQA 2XJVA 1PO13 4HKOA 2C1FA 1BLZA 2B45X 1CD3G 1YYNA 2YB7A 5DG2A 1L3JA 1WKYA 3RQ0A 3ZKYA 3CHXA 4LUKA 1GR3A 1UU5A 2DVFA 4FT8A 2ZAHA 3LF7A 2WA4A 1X9TA 2A75A 1PO21 1IG0A 3M8LA 1QDCA 3ELNA 3C3VA 1HV0A 1Q8PA 3ZSMA 2VULA 4LITA 4BXFA 5DAXA 1G9AA 2PELA 3T08A 3RYPA 2DYCA 4LLFA 2XQRA 4D6QA 4KWJA 2ATFA 2PAKA 2Q1ZB 4GKYA 4JX0A 1AHSA 1AX1A 3KM5A 4EN6B 4Y1ZA 3BGAA 3HEIA 1ALYA 2J22A 4L2NA 3OUHA 1UMIA 2VMFA 4AFCA 1Y9GA 1MR5A 2B7YA 4E9KA 4FFGA 5IUQA 2RMU3 3BI3A 4AEJA 1OA2A 2WL1A 2WJSA 2WO3A 3FFZA 1CZVA 2VZVA 3SHRA 3VBSB 4XJZA 2OUHA 2GC1A 3WG4A 2RG4A 2VCCA 1KXGA 1V6OA 3ENRA 1C28A 1XU2A 5C5TA 1W90A 3EQEA 2G9GA 4AEDC 3DYOA 1IPSA 3CZUA 5E88A 1FMD3 5FOJB 5FR3A 1O8PA 4H55A 1ULDA 2PYTA 1JU3A 1AR63 1W6MB 2WNUC 4BQWA 4KG8A 5F5QA 1YQ5A 4ATFA 1H0BA 4CE8A 2C9KA 4DQAA 1GOHA 1RUF3 2DV9A 2Q1FA 2XVLA 5IT6A 2WWUA 3HIFA 3H7JA 4FSJA 4XQ4A 1N1VA 1ZZ8A 1GZWA 2I2SA 3DPRA 4QPIA 1Z0HA 1RHI3 5GLUA 5K4LA 4BQ3A 3LPGA 3U14A 5ABJA 2ZGUA 5LY1A 3D5OA 4YZ1A 4XIKA 5C3OA 5KWRA 1WW4A 4FP2A 1QGLA 5FDBA 1D4M3 1I5ZA 2P4EA 2DFBA 2YPJA 4QPWA 4AQTA 1SMVA 3D82A 3H8OA 1BK1A 1T6GC 3IIAA 1O3TA 4Z07A 2WT0A 5BXXA 2WAAA 2XWBB 2WO2A 1MPXA 4RYDA 4TWTA 3RJRA 2WRAA 4AHWA 4OHVA 4NJ4A 5BNNC 5FPUA 1K3IA 4XCAA 2RJ2A 3BPSA 4AVVA 2W87A 4HSJA 1GFF2 1WCSA 3T1MA 4CDXC 3OPZA 5E6HA 5FP4A 1W2OA 5JIUA 4AZZA 2CDOA 3AK0A 4IGOA 5BNQA 2BW8A 2YU2A 1PGW2 3PNAA 5L73A 1KDKA 2GSYA 1PM7A 2XBO2 3MBWA 2J7MA 4LBQB 4GULA 4OLLA 4ZHNA 5B2GB 2HEWF 3T4HB 1R64A 4E4DX 4ES9A 1FOD2 5LWBA 1W9TA 4M0HA 3RSJA 4Y5Z0 3VL9A 2X09A 2UWBA 4ET7A 3IAPA 3WQ1A 5CISA 1MEC2 2GNDA 2D3PA 3THTA 2JG9B 5FPAA 2D3RA 2WUHA 3J7MA 2QQIA 4PI2A 5FUNA 1O6UA 5C71A 1B35A 1YFUA 3KT1A 5L9VA 2C26A 5KXCA 1H8VA 2A70A 1VALA 1UWWA 4M0NA 2TBVA 1BVP1 5HXMA 1NXD1 2Z4FA 4H7MA 4KNCA 4M4PA 3CL1A 4WVZA 1PGL2 3POFA 2CWMA 2RS51 1TVGA 1RUC3 1YJLA 3JQXA 4KBZA 1LOCA 3PJQA 3VHOA 1AYM1 2BFUL 3C7GA 3THDA 4AVAA 1XXNA 3KVBA 4ARYA 4CRQA 1I1EA 4R9CA 4Q0SA 4Z1VA 1DQ5A 3GGLA 3NV1A 1PO22 5CA6A 1OUSA 3OD0A 4NRPA 1LU1A 2Y0OA 1OC1A 1W8UA 1ZRRA 4QQ2A 4QHZA 4LIVA 1H2NA 3IB3A 4GMP1 1ZRIA 5HBAA 4QB1A 3IDBB 1RUD3 2WZEA 2VW0A 1VRBA 2H0BA 3LEIA 4MUVA 4S2DA 5TSWA 3KF3A 4A6OA 5IVCA 4XILA 2A71A 1G7YA 1TEIA 2ZMKA 1G86A 3URFA 1SLCA 4YGEA 2JE9A 4TXWA 4Y1YA 1NZCA 4XHXA 2A7AA 2ZPXA 5EZWA 4PBPA 2FZ2A 2E7AA 2A3WA 1GZWB 2XHKA 3KZ4C 4QPIB 3RWNA 4AGVA 3MZHA 1KEXA 5ABJB 4CYDA 4MXVA 1QJY1 2Y60A 4XTPA 4NUBA 2DF7A 1LOFA 4AF9A 2RS32 2ZGOA 2XBO3 4CXWA 1VAKA 3O1RA 3JQWA 4A7ZA 3AFGA 4XAEA 5FZ4A 1NAEA 1QJX1 2Y26A 4PQQA 5T5PA 5F7UA 2JIGA 2ADDA 4XFFA 2P5BA 3GBGA 3NNGA 4L9BA 2FMDA 5FMCA 2OX0A 3VD4A 4Q4Y1 1VPHA 2VNGA 2VNOA 1UCXA 1NZIA 2C5DA 5KHJA 3LIHA 4FTBA 3I2FA 3NAPA 2BERA 3LEMA 4AGRA 4R9BA 1BCXA 3K51A 4XFAA 3MIEA 2F4LA 3ECQA 2VNVA 2CHHA 1X36A 2VQUA 2XUMA 3EHKA 3GCXA 2ZX3A 5K0UA 3UETA 3CF6E 4BQXA 4WVMA 1K12A 3K4ZA 4CCMA 1ONAA 3KHCA 1O4YA 1V6LA 2XXZA 4HPKB 1PO23 4LHNA 3RZZA 2YYOA 2E32A 4MO3M 2DUPA 1GZ9A 2JIJA 1YHFA 1HIXA 2D5FA 1H6YA 2ID4A 2OZ6A 1WLTA 2B42B 2J1AA 5HPOA 5DDJ1 2V72A 2G9ZA 1UL9A 1C8M2 2W9XA 4AQSA 3I3QA 1JZ2A 4QHBA 4WM7B 4K1ZA 3Q9OA 1ZZ7A 4X8NA 2WBKA 3ZXDA 4B1LA 5F5AA 3FJSA 4Q1RA 1FXZA 1YRZA 2QDRA 3POWA 4HK9A 4OMCA 1OOPB 4QX7A 3RYKA 3ZIWA 4Y3OA 4AG4A 1H9WA 1RMU1 2BOIA 2WWJA 2PHUA 1N3PA 4BIOA 4MHUA 5FIXA 3LAGA 5FK7A 1VBB2 4PI0A 1XB9A 1UOJA 4MGTA 3E6DA 1T2XA 1TZOA 2RS33 2PA7A 3VBRC 4NHKA 4MX3A 3VDDC 4PJYA 3N9QA 1BK0A 2RS52 3RDIA 4LK7A 4CDUA 4Q8LA 2P3IA 5FZ9A 3T4VA 3DF0A 3R0RA 2D44A 4DRVA 2QQLA 4RFT0 5IYYA 1KFUL 2YU1A 4CUAA 3I59A 2B9VA 4N43C 4I0AA 2VBPA 3OGJA 2GNMA 3N9NA 1H2LA 1ND2C 5FRAA 2DDUA 3IM0A 1J3RA 3H50A 1H1AA 5LZ6A 1MACA 1UIJA 2VZ3A 5AFBA 4NAOA 4BPZA 5F3EA 5FZ1A 1H6XA 1UX7A 4OI2A 1XYNA 2R071 1CWPA 4NHYA 1REFA 1U12A 2WNUA 2OYZA 3ME2A 2O8OA 1DYPA 5A6XA 3W5MA 3AZYA 1QH6A 4S2FA 5HCHA 2VOXA 3KCCA 1DG6A 1UF2C 4OUEA 3C2UA 1VIWB 3WY6A 4FPLA 4INDA 2HH9A 2FCTA 3FL7A 4CU7A 1LGBA 1QJY2 4RHV1 1NA1B 3KMHA 5IVYA 3HJRA 5JDBA 2VY0A 4H3WA 2BOJA 4AR2A 4BE3A 1V6NA 1US3A 4CCCA 4HKLA 4V1PA 4XOGA 4FQZA 5CB7A 4E4HA 4PCRA 4R4ZA 1G9BA 1C8M3 4XUPA 1QJX2 5K0UB 2XJPA 4IGQA 4UI9L 5FO7B 2D6MA 3GZUC 3DN7A 4GMP0 4WVMB 4YFWA 5BNNA 5KHIA 5CAZA 2UURA 4YVWC 3BYWA 5APAA 4Q4Y2 5E89A 2IC1A 2W68A 4I3PA 3AX4A 4CDXA 3B01A 3JBG1 5DG1A 4AYUA 4F7ZA 1VBB3 1H4GA 4XAAA 4NIHA 3AXDA 5FP7A 4QX5A 3TN91 4AHZA 5EIYB 3USUA 1LGNA 3U78A 4COZA 3LOBA 5IFTA 4QB6A 4D8MA 3ZYGA 4BQ5A 1HQLA 5F32A 1MS3A 2QZ2A 3N7LA 4J1WA 2D97A 1WMXA 4FXGB 4A41A 1L7LA 1N1TA 1QKQA 3K77A 4LJHA 1RYYA 5AFEA 3WR0A 5BNOC 2A73B 2ZX1A 1DYKA 4XZPA 4BCUA 1R1A1 1GNZA 4IE5A 5FZ0A 4DUVA 4AEMA 2XG3A 4LKDA 1IPJA 2ARXA 4W6YA 2B8MA 3ZM8A 2WQZC 2LS6A 1NT0A 3OJBA 3HQRA 4IEVA 3VDAA 2GNBA 4HN1A 4DS0A 2RM21 1R093 5JSOA 4BJ0A 4QXBA 5FQ0B 1HQNA 1JHJA 3VDCA 3HT1A 1EAH1 2XLAA 3BALA 3K46A 4PIXA 3MV11 3HWJA 3IDAA 3OB8A 3VBSC 3SEPA 3C7OA 1LR5A 4ZU5A 1AR81 1QMJA 5CG8A 1CESA 3MHZA 4P08A 4QKFA 1H9PA 1BKZA 1W0NA 2OA2A 1PK6B 4R9DA 1WLWA 2B5HA 3MLLA 4OI4A 4UWDA 3I2HA 3S7IA 4IGPA 3ZXFA 2VR4A 2XGXA 3PIGA 4NE9A 5JSRA 2XKPA 4XXPA 1VBD2 2DBIA 2E9QA 5ERLA 3T0BA 5JAXA 3QACA 1DU3D 5I91A 3ZXGA 4IEXA 2PHXA 3BIWE 3MFAA 1FPN1 2D3SA 4AEDB 5LASA 2J1SA 4XABA 3AM2A 5FREA 1WD4A 3P6BA 4FVVA 2BRTA 3MLJA 4LE3A 1UX6A 5FZAA 2VUDA 2ORZA 5J98B 4CSWA 1COV2 1QJX3 2Y38A 1DQ4A 3E1F1 1HRI1 2VTXA 5FJHA 1XOYA 3JB4C 1RUE1 5FWEA 3MW2A 1GMMA 3POYA 1S0DA 1JYIA 1RUH1 4Q4Y3 3GALA 1C3HA 2VE1A 1SLBA 1NY71 4XMIA 5DZGA 5EPAA 2Q8CA 1NCQC 1DP0A 2JDYA 3FLPA 1PIV1 3IDCB 3GZTB 1YUDA 2V5DA 4I3GA 1UYPA 2VAUA 5EFUA 3WLUA 3OUJA 5JR7B 4YVSC 4OQ8A 3V0BB 3VBFB 2W92A 1OURA 2R072 2KR2A 2BNMA 1F5FA 4QWNA 5BNNB 2W1UA 2QQPA 4CU8A 4HXCA 2PLV1 2R16A 2O14A 2ZZJA 4B3NA 4GXLA 5KC6A 5E1RA 5A7WA 1V6IA 4ATEA 3OCPA 1VBC1 1RUG2 3D0JA 3S5QA 4JTOA 4YZ3A 3VBHA 3T2PA 4RHV2 1QJFA 3POSA 3UV9A 2Q8EA 2VMDA 1DGRA 2HWE3 1JOBA 2BNNA 2D6PA 2OS2A 1W2TA 2GU9A 4XPVA 3QD6A 2YXSA 4LO5B 4QB2A 3B02A 4JQTA 4AAXA 1D4VB 2JD9A 5FZCA 1X7NA 4N9HA 1PO11 5DN2A 3MPBA 4EWDA 3VKFC 4RS5C 1VBD3 3P3NA 2QNKA 4GZ9A 3HNMA 3ES1A 3KD4A 4H2AA 3H0OA 3TN92 1CR7A 3VZJA 3ALQA 3JU9A 3MUZ1 3S7EA 1JXNA 3T2TA 2QFEA 3WXPA 3U11A 4FBFA 1JOPA 3GZAA 4GB31 1NG0A 2VL4A 1KGYA 1LHVA 3AFKA 2W08A 1AR91 2YDEA 2ZX4A 3MEPA 5FKCA 5FPLA 5K8SA 1TMF2 5LBFA 3AMMA 1COV3 4HOOA 4D7YA 1R1A2 1WW6A 3AMHA 5F5IA 3SITA 4DRRA 3UKVA 3VHRA 2XQXA 2DVGA 2PMWB 1QIQA 2ZOEB 3GJAA 1CN1A 4PF1A 4MYEA 4GQ7A 3LCPA 2RM22 1VJ2A 1ENXA 1REDA 1U0AA 5C3SA 4Y4YA 5FUPA 1H1MA 5JUVA 4Q0QA 1UU6A 5IK5A 4XJUA 3NV4A 1EV12 1CIYA 3VBRA 1E5IA 1NCRC 3VDDA 2YFZA 2EAAA 2R073 4OUSA 3H3ZA 1YJKA 1LGCA 4PDWC 2Q30A 1FMD1 4IW3A 1JU4A 1NQDA 5A7PA 2PFWA 1H2KA 4PIZA 1W6PA 2D6OX 4XMAA 4C91A 2GZWA 5A32A 4ASLA 3HAGA 1RUG3 4N43A 3KWVA 4K8FA 1GUIA 2FQPA 4G4FA 1ND2A 4RHV3 2KD7A 3PVEA 1C57A 1FPN2 3BKZA 4HG6B 3CO2A 4LBLA 4V2WA 5A33B 1JYTA 1DFQA 4Q27A 2D7FA 4AXOA 1QDOA 1IG3A 1QHDA 3OBZA 2X10A 4AVTA 2ZGMA 3C7HA 1HRI2 3I3MA 1CVNA 3QLQA 3T2QA 1RUE2 3AYAA 2KXLA 4BIFA 2WFF2 2VCMA 1IPKA 1NY72 3UL2A 2FCUA 4LKFA 2AGSA 1LKNA 2ZHKA 4R4XA 4UF0A 2JEMA 5FLJA 1JTZX 1SG3A 4JKLA 3CJIC 2WLPA 3CKHA 2QQUA 3VUOA 1PIV2 4IEWA 4QQLA 3ZN6A 1GOFA 5KHHA 5KHKA 3F95A 5A3UA 2XJTA 2AC1A 5J96B 4WVVA 1CAWA 2YHJA 2VZOA 1TMF3 1WMEA 2W1WA 5JI7A 4AEKA 5J48A 4NRMA 4AFAA 1R1A3 3RS6A 3BN6A 4N9IA 1U5IA 3S6PA 3I3EA 1S1AA 4YVWA 4GWJA 5SV8A 1UIKA 4WM7C 4XFCA 2WQ4A 1RUJ1 3KV9A 3BU7A 1IZ3A 2RM23 3L2YA 4E8CA 1Q5OA 1HX6A 5EHDA 4AI0A 1U5ZA 1H30A 3J8F2 1W2AX 3H1YA 5FZOB 1IKPA 1HJGA 2HLEA 2ZABA 4NWWA 1MZ5A 5I93A 3H8RA 3M1HA 1OOPC 4IEUA 4KU8A 4XUQA 1EV13 2IVIB 1B09A 1GBGA 2IXLA 5D21A 2VMEA 2B4KA 3NVCA 3QOPA 5BNOA 1LHNA 3OG2A 4NPRA 3VZKA 2BQPA 3WUCA 4ZXEA 5AVAA 1PO12 2XUEA 1RUC1 4YG3A 4DEQA 4Q5OA 2QCSB 2ZACA 5T5JA 4IV1C 3LOIA 5CADA 2EXIA 2VTXJ 2YY1A 4C90A 1WW7A 4B4QA 5HV4A 5FBJA 3RVHA 4BQYA 4O65A 4YW3A 2QZ3A 1REEA 4XFGA 5LA9A 1GQHA 3THPA 1MS4A 3WDXA 1FPN3 1NLRA 5CFCC 4FOVA 2AZ5A 3I2KA 4GB32 5EXOA 3VBRB 2DCZA 3VBSA 2QQJA 4I0WB 2OIIA 4EROA 5I0DA 1AR92 4ZONA 4CCDA 2V73A 3O0WA 2NLRA 3N9MA 1RUD1 3ZYFA 2CGPA 3NKTA 4HT1T 1CIWA 1W6PB 2IXJA 2WFF3 2WABA 1JYNA 5A32B 2O1QA 1XE8A 2BDRA 2ZZQA 4TZDA 2HBTA 1W6MA 4CP2A 3PTRB 3WX5A 4A3ZA 1ND2B 3ZSJA 4JQRA 3T3YA 4D94A 2XB6C 4KWKA 4XEZA 5A7NA 2YPDA 4FPEA 2D98A 4Q29A 1PIV3 4FAHA 3IMNA 1BMV1 2JXAA 1JZ3A 3Q8BA 1AYN1 4QX0A 2C4XA 1XNAA 2ZMNA 3NO8A 3SLIA 1UY0A 2PHWA 4L92A 3U10A 5HV0A 1K5JA 1FMD2 4Y24A 1A34A 1DQ6A 4MHRA 1LODA 2AREA 4QT6A 1OH3A 1R1ZA 3HOBA 3KT7A 4XUTA 5F6LB 1Q8SA 4UF0B 3WNPA 4B4RA 4C1WA 1RVF1 4RA0A 3AMPA 2QQWA 1W39A 3ASIA 4OMDA 3J8F3 4ORFA 1QOSA 1GZTA 3MF6A 5DUUA 1DF0A 3MPPG 1BHGA 2XHNA 3ORJA 3RG0A 1CAWB 1UYZA 3T09A 3WCSA 2G1MA 5SV5A 4QU1A 1GP4A 2KA3A 1JZ8A 1GWLA 1JS9A 4B4PA 3LGRA 3MUY1 1PGL1 3POIA 4LOSA 4DZGA 3PJYA 2A5ZA 2D93A 2EXHA 2OUJA 3BTXA 3AXEA 1EPWA 1QOTA 2E7QA 3OEAA 1P8JA 5FYSA 5A80A 4IV3C 1G9FA 2XVGA 1ZZBA 2JG9A 1RC6A 4BB3A 2LW8A 1O4TA 3J4UH 4GB33 3CIHA 2OPWA 5A7QA 1AR93 3ZPYA 5CKQA 5BNOB 5FZ6A 4EN7B 5JLVA 2JDZA 2HWB1 2IUWA 1UD1A 3P5BA 1KJLA 3WT3A 3EYPA 5AVPA 2WZ8A 3LA2A 5BNPC 2YV8A 2OZJA 3A7QA 1KS4A 1ULGA 5C70A 1RUJ2 4RS5A 4AE2A 1PK6C 2FD8A 3IKWA 4C0HA 4XETA 1WMDA 1DQ2A 4BLJA 3I2DA 3OY8B 3UYJA 3ZSEA 4YARA 3D3AA 1UY4A 1MS0A 5FP3A 1OXCA 2ORXA 4NPLA 3WF1A 5LRRA 3HPNA 1T6BX 3KQ4B 2ZA9A 4L99A 2L9LA 2RS31 4LO8A 3HN1A 4XJAA 4XE9A 3I2OA 3BVCA 4COYA 4P9JA 2VOKA 3DGTA 4XQWA 3K75B 1RUC2 2WNEA 1H1IA 4NPMA 1F9KA 3VZNA 3ZYRA 4AFMA 3IWZA 1SFYA 1KS5A 5FYCA 1W8ZA 4K6BA 3VD9A 3VDBA 4CZSA 4FFIA 2VQTA 4K9SA 1HN0A 5T52A 4ASKA 5J36A 1AZDA 3OPWA 4FPHA 2N7GA 2HWF2 3IPVA 3GHNA 4BK5A 5I8TA 3W5NA 2IVJA 4N7UA 3I7DA 2VZRA 3VKMA 2EICA 1NCRA 4M3CB 5FXVA 3T0AA 2WINB 3PURA 1RUD2 5A1FA 4TTGA 4YM3A 1JZ5A 1W0PA 1AL21 3IZOA 4NOTA 4YW2A 1YQ2A 4FAGA 4ZZ8A 4IDZA 4XDPA 3VBFC 4AFBA 5F8PA 1UN1A 1UZ0A 3WF3A 5F37A 1G6NA 4YNIA 5LCWL 2GMEA 3FX3A 3MI8A 1F8VA 1LJ7A 1ZYBA 1YNAA 1NCQB 4XBQA 4CDQC 1FV3A 4CUBA 2ZHNA 1BMV2 2ILMA 4FO9A 4Y1XA 4YVSB 3D4KA 1AYN2 2VVFA 1JZ7A 2JG8B 1O5LA 3N9LA 1HLCA 3AB0A 2WSVA 5KC5A 2Y33A 1ULOA 1UW8A 1WZXA 2D40A 3QCWA 1MVQA 2PHDA 4IE0A 3WD5A 4BHPA 1C8M1 3WP6A 2W91A 2YC2A 1Q43A 3ZYHA 4DXZA 3DKQA 5FZFA 1RUJ3 1RVF2 1VR3A 2EALA 4X8PA 1F5JA 4UW3A 1OPOA 2X53S 5FMDA 2WLQA 4GH4C 5L9RA 3KGZA 1FNZA 4QQPA 2GMMA 2ZGTA 5D8AC 2RDNA 3ETQA 4JDMA 5FOBB 4HPKA 4BMBA 5I0RA 1PVC2 1VBB1 2ZKLA 3TNQA 2G4IA 3KF5A 3AKTA 1PMIA 4BA6A 1OPMA 2RDSA 4EZ4A 3WDWA 1ZRFA 3OSDA 2FDIA 4TLGA 3HQUA 1YI9A 1YQ6A 4PLMA 1IQAA 1IHMA 4XFIA 4YG0A 3UJQA 1PX4A 4RS5B 5JPMB 3HBKA 3MIFA 5FY0A 3TEYA 4P9XA 4WM7A 1SBDA 3ZYJB 5L19A 4FPOB 1VE0A 3AL6A 3RZGA 4K7JA 2WSUA 2XL9A 1TME1 1VMJA 3NJXA 2HWF3 1OOPA 3L9JT 3AYEA 4BISA 4HN0A 1BYHA 1R091 4IEZA 5C6CA 3VBOC 1OHFA 3MYXA 2XJUA 2SLIA 2HWB2 3MIHA 5ANNA 5FY5A 3FUQA 4QXCA 3KGLA 1WCUA 2IZWA 2MNGA 5A1LA 2XKOA 4ZU7A 3I2IA 3O0VA 5JZGC 5I0TA 4O9GA 4IV1A 2FDJA 2VTFA 5DUWA 1YWKA 4B1MA 3EMRA 4JAAA 3H8XA 3IPVB 2MEV3 3OTFA 3PUAA 4NROA 4O7XA 5CFCA 4OI0A 1NCRB 2RVAA 3C7EA 1AYN3 4RL7A 1ZM1A 4UW5A 2ZBJA 4PDWB 1PNGA 1MZEA 4RR3C 5L7OC 3GNEA 4AI9A 3BUCA 5GLTA 1V6JA 2VBBA 4XYXA 3W59A 3ZR6A 1RVF3 3N9OA 3UJOA 4XJ9A 1ULFA 2K46A 2AYHA 4HBNA 3LD8A 3FBMA 1AXKA 1F15A 1ENRA 3I49A 4NIGA 1LCLA 1W8NA 3JZVA 4ZKTB 2RE9A 1PVC3 1W3XA 4BQ2A 1DLLA 1WWYA 4LXLA 1BEV1 2WYSA 2BVBA 1AX0A 1NA1A 2JDPA 4XUOA 4EWAA 5A6ZA 4ZXKA 3VKLA 1S2EA 1ST8A 1AL22 4QKDA 4YPJA 1MS8A 1Y9MA 4LLOA 4IETA 2P37A 1Q56A 4IE6A 1M4WA 1VAMA 5FFOC 1CZSA 5T50A 4B8EA 1XPWA 3BODA 1HB3A 2OQ7A 3WNKA 3CJIB 3OYWA 4CUCA 1S2KA 5FWJA 3B5LB 4M00A 4F83A 5JXJA 2B9UA 2DWRA 4XF4A 4Z8BA 1W8TA 1SHWB 3RZKA 2JB4A 3ETPA 5DXDA 2R1BA 4UT5A 2ZHLA 3V0AA 3I2GA 2HWB3 2VMCA 4KG0A 2G19A 2HWE1 2HYXA 1NLQA 4GD4A 1RXGA 4LOTA 3R4SA 4QX3A 3HMYA 1TE1B 2UU8A 4BMEA 1UPIA 4KU7A 1D0HA 2XJRA 4FQ4A 1UY2A 3B9CA 1F2NA 2OQ6A 1QXRA 5CIRA 5LA2A 4N53C 4KL1A 4AQ2A 4IV3A 2OT7A 4NRQA 1C1FA 1OLQA 2NPIA 1VBD1 1JHNA 4EE2A 3E5QA 1W03A 2IWGB 3EJKA 5CBLA 1YIFA 4KGQA 1C8NA 3J7NA 1VRH2 4CEWB 4LNVA 4QXHA 5FQ0A 2W0XA 1NLSA 3A22A 5FYYA 3VBUC 2BFUS 3RZMA 2JENA 1J3PA 1RIRA 2ZGPA 3TB0A 5A3TA 3NV2A 1PZ8A 4LBMA 2YC4A 4IV1B 1COV1 4LMFA 1J3QA 1UYXA 4Q2FA 2CSGA 2RS13 3Q8CA 2YZ4A 4Q0UA 2NYYA 4Y26A 4XF0A 4BXSV 5C33A 3OUIA 1PK6A 5C8CC 2IFWA 4QMAA 1CPNA 4JC1A 1O8SA 3ACLA 1RXFA 1UZZA 1TME2 2GC3A 3ACIA 4YRDA 5CFCB 3S0MA 3AVSA 4LKEA 1CQ9A 4GJYA 5D2AA 1R092 1QJU3 1S55A 1S0GA 2CGOA 2VCAA 1OQ1A 2ZGRA 1MZ6A 3D0SA 1DCSA 2XL7A 2XOMA 2RDRA 3GBWA 3LA7A 1UY3A 4W8JA 4Q4V2 4AHYA 3FC0A 1HDKA 3LB9A 4AI8A 1LOGA 4DUXA 4XF9A 1NE4A 4AEDA 5T5LA 1AL23 2E26A 4COVA 1HXS1 1IS5A 5FMOL 4CCLA 4D3WA 2UYBA 3Q8AA 4JV4A 2EXKA 1DQ0A 2VMHA 4P5HA 4OHZA 1A8MA 2DCTA 1G9CA 2WT2A 1Q8OA 4KWLA 1V0AA 4UXAA 5HI0A 4QPYA 1POQA 4NWVA 1GU3A 3D8CA 1ZX5A 2ET1A 3TOJA 4HETA 4AHXA 1RUG1 4LIUA 2ZX0A 3SCHA 4DB5A 2ARAA 3DCQA 4D7TA 3M2MA 1SDDB 1W6QA 3WNOA 3HNYM 4FFFA 3ZXLA 4Y5SA 2QQMA 5LY2A 1HJFA 2R0HA 1W04A 3ZYIB 4CUGA 1UNBA 1D0GA 1VBE1 2CWSA 3WCRA 3X29B 1K5MB 3GF6A 4QKNA 3CBNA 2Y6HA 4E8DA 3ZPOA 4KWUA 3VBFA 3V0BA 4OFGA 4OYUA 2R0FA 4QGNA 3MV01 3OYWB 2ZMLA 4MG2A 4HKWA 3O1OA 5LEKA 1GANA 1Y9QA 2E63A 4P00B 3DXUA 1NX9A 2J1VA 4B7KA 3B69A 3V0AB 3CNAA 1BEV2 4M01A 5FPXA 1S0IA 1VB2A 1J58A 1Q3EA 1VRH3 2JKBA 2R062 1H4HA 5GLZA 4XJ8A 5FYZA 3N7MA 3ZFGC 2IXHA 4FPKA 1LOEA 1PVXA 1IS6A 1QOOA 4TLFA 1W8HA 1YIPA 2TEPA 4PQ9A 1KITA 3PVNA 1TMF1 5ANQA 5HCAA 2Z42A 1OQEA 1V70A 2E31A 1LHOA 1QJZA 1GNHA 2R32A 4IV3B 5JWPA 2ZAAA 4GH4A 2LUWA 1TME3 4NIIA 4Z92B 1J59A 3QBQA 3J7HA 3OPTA 4KGGA 1H2MA 3P1IA 4DINB 2WR9A 5C9AC 4RGAA 1Y4WA
chains in the Genus database with same CATH topology
2X5IB 1DZTA 1OD5A 4Q4V3 1GICA 3ZSLA 3VHPA 2XPJA 2EIGA 2HWE2 4ITCA 1EV11 3A0NA 5BNPB 4E4ZA 2WNVC 1SBEA 1Q8QA 1LHWA 3LKJA 1BZWA 1O3RA 4DY5A 5J37A 1NQJA 4KBBA 3PMEA 4BLIA 3WQ0A 3AJZA 4MGYE 2VOVA 1OFNA 5AC91 3USSA 3LZZA 3OD4A 3UK9A 5KXEA 4XFHA 1N3OA 4BYYA 2NN8A 2R30A 2HWC1 1GKBA 2VW2A 3NL1A 4YGCA 5JIAA 2ERFA 4XW3A 3MGUA 1ND3B 3ROUA 5JZGA 1LEDA 3INAA 2VVEA 2WFF1 4AI2A 5E16A 1UKRA 2QUOA 3WINE 5H9PA 4JDOA 1C4RA 1W6QB 1U5XA 1QNWA 1XYPA 2CL2A 4PLNA 2IFRA 1BEV3 2R063 2JJ6A 4RGGA 3WW1A 5A33A 2WFPA 2R042 2QVSB 1HXS2 3HT2A 3ILFA 4RR3A 5GZCA 4FPJA 2JG8C 2B46X 3AP5A 1UU4A 3V64A 1LECA 1XU1A 3B7MA 2UWAA 2TNFA 4CDQB 2BNOA 3WUDA 3B94A 4E4SA 5EV7A 1LENA 2UY9A 4BOWA 4K40A 3J8F1 3KSCA 4FTEA 2VMIA 1A8DA 4OHWA 1FATA 4LR4A 4WBBA 4P9IA 1VBE2 5IK8A 1SLIA 5GZFA 2XH6A 4YW5A 3J26N 4BM8A 3R6SA 5CU1A 4Q4W3 2YROA 3B9IA 3ILRA 3CJXA 2AH2A 4O9EA 4GH4B 4AGGA 3WW3A 3FZ3A 4HSLA 5D8AB 1QF3A 4D69A 1CONA 4COUA 1LESA 2RHPA 3K48A 3N3HA 1ZZCA 4JGYC 4GWNA 5DUXA 2P3JA 2D5HA 3SCGA 2X29A 2G9FA 5LK5A 3M3IA 2V09A 4KH9A 4E27A 3N7KA 4N53A 4R8HA 1JOJA 3JB8A 1V6MA 1X50A 2GALA 4MLOA 3AP6A 3VBOB 1SCRA 5LEJA 2AR6A 1SEFA 1PHMA 1UKGA 1DZQA 1RB8G 1MS1A 1GYKA 2DCYA 3BCWA 3M3CA 3N4MA 3VBUA 1WBLA 5F1RA 2R043 4Q4X3 3RYRA 1HXS3 4I01A 5JZGB 1DGWX 1RUI1 3TBDA 3WW2A 1XE7A 5H9QA 1S0CA 1PGSA 4LA2A 4QQOA 4ES8A 2CV6A 2QE3A 1O7FA 5C4WB 4HMZA 1SQ4A 4I30A 3HD8B 4MSVA 1AR73 1W6NA 4Q1PA 3ZIXA 1J1TA 5AC92 1SLLA 3IN9A 4ISQA 1ZBE2 3DPRC 1WUVA 2HEVF 3R4UA 3P3PA 1SACA 1SLAA 4W6XA 2HWC2 5LRSA 1VBE3 4ONUA 4RR3B 5L7OB 4YM0A 1PNFA 3H1WA 3NW4A 2WS91 4FP3A 3KLSA 4XDQA 4UW4A 3TAYA 4RQPC 2JICA 4L8QA 4MVTA 1CJDA 3FE5A 5FLIA 3HBZA 3VGIA 4GALA 3ZFFC 4BQ1A 3FLTA 4JRAA 3ZFEB 4JGZC 2GNTA 2Z79A 5GKAC 3NSTA 1HRV1 4P14A 1ZZ9A 4Y20B 3G7DA 5J09A 3DV8A 2E7TA 3PLQA 1E57A 1X33A 1VLNA 4XBLA 4Z82A 3WOGA 2DURA 3M7AA 5EJ3A 3SCFA 3ZXEA 2ZGQA 3JD71 4NHMA 3WV6A 1V00A 4I0BA 4HLTA 3E97A 5C8WA 3NKGA 2FZ1A 1JN2P 2V5YA 4CEWC 1RL3A 3KB5A 1CPMA 3LWCA 4N53B 3VL8A 4C1XA 4Q0PA 3LSEA 2Z2SB 3FLRA 1ZRDA 5DZFA 4FTSA 4CDWB 3PVBB 3LA3A 1XNDA 1ZA4A 3TRSB 3KCYA 5AC93 3ES4A 1KDMA 1NYWA 1ZBE3 3I4IA 1QH7A 2UYAA 3G6JB 1ULEA 2HWF1 4Y22A 1SCSA 3VBUB 4ISRA 1QXPA 2HWC3 3ILNA 3OY8A 5GALA 1EY2A 2YUEA 4P9WA 1Y43B 4AK3A 4AWDA 1W2UA 4QQHA 5K7PA 4LBKA 2VXRA 3OBTA 1H8TC 2WZR2 3FUOA 4HK8A 5A3LA 5C8CB 2BTVC 4SLIA 3WG2A 1W6NB 2W39A 4AFDA 4CP1A 1X8EA 2GDFA 2RJLA 3AYCA 1OLRA 1BQPA 1YI7A 3OBRA 5J3UA 1EYBA 1SFNA 2ES3A 2MEV1 3KT4A 1C5IA 1C1LA 4AVCA 4JRLA 1DGRN 1BVVA 4TSVA 4QM8A 1RJ7A 1RUI2 2GN7A 4M3CA 1ENQA 1UPSA 3MDPA 3FBYA 2KM2A 1K5MC 4QPGC 4E2SA 2MPFA 5JCTA 3MF9A 2O0OA 4WZFA 3CEWA 3RJ2X 3RI9A 1ZRCA 1WCDJ 3NV3A 3JUUA 1SDWA 1NCQA 4FPFA 2VPVA 3SISA 4EWEA 3NAPC 1PVC1 2VUAA 4YVSA 3SXWA 1J1LA 2BWCA 2JECA 5FAXA 2JG8A 4WM8B 1AX2A 3MW3A 2WS92 2EF6A 3VV1A 2CYFA 5LK7B 1CAUB 4NO4A 1BBT1 4ZU4A 4XF3A 2LM3A 4XQDA 3R4DB 3AKSA 4AI1A 3BTAA 4FOYA 4XBNA 3ZFGB 1HRV2 3VKOA 2A6VA 1YXWA 3ST7A 1KJRA 3M3EA 1BXHA 1UMZA 3N7JA 4XFBA 3CU7A 4S2GA 1EPZA 2X5IC 2BWAA 3MFCA 4RD7A 4UBHA 3IBMA 5HCFA 1FV2A 4H7LA 2WZR3 1POV3 3ZXJA 1HV1A 3M3OA 2D43A 2RR13 2DVDA 2WC2A 4J1XA 4OHYA 2WA3A 3JD72 5C9AB 4Y22B 4P9GA 1A6CA 2VOWA 4JGYA 4HANA 2BPA2 2HYKA 4LE4A 1CX4A 1X82A 2Z5WA 3AKQA 2WNVB 3M70A 3ZSKA 2PAEA 1RUI3 1KQRA 4CEYB 3W58A 2ARBA 2XWJB 1UAIA 4CDUC 1HQWA 2E53A 2CNAA 5DUVA 5KXDA 1ND3C 2RS11 3IDEA 1WGPA 2XVKA 1YFYA 1FYUA 2GN3A 1RGSA 1ASJ1 1OFSA 1QJU1 1AF9A 2Q5TA 1VBA1 4TYSA 3UKNA 2PHLA 1PZ7A 4PDWA 2HKXA 2WS93 1AJOA 1IOAA 2PTMA 2YGMA 3BOPA 3DUIA 1M06G 1FNYA 1YLLA 2I07B 2HJIA 1G9DA 3T1LA 4FPCA 2ZTNA 3ZN5A 2NMOA 1AJKA 4X6RB 2NQYA 4MGKE 1EP0A 3FFQA 4L11A 3AZXA 4NN0A 2MEV2 5BV6A 1UZYA 4XXAA 2ZX2A 4M3CE 5FLHA 3WW4A 1HRV3 4YW4A 4IEQA 3EBRA 2OPKA 1OA4A 1ZREA 5CG9A 4LHKA 4MZUA 1Z7S3 3GHMA 4LEJA 4MGZE 2GC0A 4YZ2A 4NR1A 4LUMA 4RQPA 2BEOA 1NXMA 4YLZA 2W52A 3SNMA 1A78A 3JD73 2F6BA 3ZFFA 5KXBA 3KQRA 3WP4A 3CJIA 2ZGSA 5FO9B 4JGZA 4MGIE 4XIOA 4LO7A 5GLVA 4J6GA 1RJ8A 2BYVE 2ZGLA 4QGMA 2FBEA 2FHRA 1N1SA 1VRH1 1WA4A 2DTYA 2VUJA 4RSUA 3WDTA 4AVSA 4DNYA 5CADA 4MXWB 4JVAA 1N47A 1HKDA 2OW4A 5EYXA 5CFDC 5BPXA 1VB4A 4LBNA 3HR9A 4P9LA 5ACA2 1LOAA 3ZXAC 2CGNA 4CTEA 4DOUA 4I2OA 2CAVA 1WLDA 1BBT2 5D1IA 5CNAA 5JPNB 1WMFA 4LO4B 4JGYB 4YGDA 1DZRA 4A3XA 4YM1A 2A6ZA 2EAKA 5A3MA 3FWEA 5I8YA 1ZBA1 2EA7A 2R49A 2H0VA 4Q4V1 3WNXA 4CEWA 4OVEA 4LBQD 2HEYF 1JH5A 1MZFA 4N90A 1OKQA 4IEPA 1QY4A 1ULCA 2DUQA 3RI8A 3B00A 1AUYA 5JOXA 2YC0A 5C4WC 3N35A 4IXLA 1WBFA 4FXKB 3H3UA 3FHIB 3E6BA 3MIBA 2E6VA 1X8MA 4XJWA 2R1DA 3AMNA 2VNRA 3H7YA 4A2UA 1H8TA 4YW1A 3KCXA 2NP0A 2BGCA 1C5HA 1IKQA 2RS12 5JOZA 4URTA 3DPRB 2K2SA 1ASJ2 1QJU2 1XYOA 4PBOA 2WKKA 3IT8A 3M3QA 2SBAA 1Q8VA 2R061 2P34A 5IK7A 3ZFEC 1VBA2 5GLWA 1CGPA 3ZMOA 3VKNA 1FT9A 5T55A 1FOD3 4RQPB 1DBNA 5ACA3 1K5MA 4QPGA 4MH0E 4LHLA 4JTNA 3ZFFB 1BBT3 5H9SA 1MEC3 3AYDA 5BY5A 2GH2A 4JGZB 4MV2A 2A6XA 2BVVA 3V56A 4D7SA 2LALA 3M4FA 4F8AA 3VBHC 5KHGA 4EN9B 1OA3A 1OI6A 3OF1A 4Y1VA 2AUYA 4HZFA 3U4XA 1GQGA 2YMZA 4IL7A 2D6LX 4B29A 3MLKA 2Q8OA 4BWOA 3E5XA 2PQQA 2Q0AA 2Z69A 4HVOA 4Q4W1 2DCJA 5T3NA 1YFWA 3DKWA 4U36A 3PHMA 1MQTC 3V65A 3OGGA 4K3UA 1O3SA 1B35B 5GZDA 2GC2A 2HWD1 4CDWC 2DVBA 4YYOA 3BOWA 4AQ6A 4YSFA 3AP9A 3ZN4A 2VQAA 4JCKA 1LULA 4N7IA 4Y1UA 2X5IA 4PF5A 3EO6A 2DVAA 2DUOA 5BNPA 3H8UA 4GWMA 3AZZA 1AXYA 1V6KA 4IEYA 4FPGA 1ASJ3 1S0JA 4S2HA 3ZDSA 1ZBA2 3AJYA 5JSPA 4HVRA 1R081 1VBA3 3E6CC 2PN5A 1H8TB 4GKXA 3VZMA 2R041 4Q4X1 2WWSA 4IERA 3WQ7A 1CJPA 1JW6A 3AKPA 1DHKB 1AYM2 4C0BA 1RUNA 4QGLA 4WVWA 1ND3A 3MICA 4QXKA 1WD3A 2GAUA 5H9RA 2K9ZA 1HW5A 1AR71 1GLHA 2CTVA 2ZHMA 3MW4A 1QNYA 1WCKA 1CAXA 1Y7BA 4YZ4A 2B39A 4QPGB 2I45A 3L2HA 1KFXL 1SBFA 2WZPP 1LOBA 4WM8C 3ZYPA 1XRUA 2P2KA 4Q26A 4YG6A 1SLTA 3W9AA 3B93A 4R52A 3WZ1A 4CDQA 1S0FA 3NAPB 4OI1A 3ZX7A 2GMPA 4FCAA 3PMSA 3FMGA 2LTNA 4XF1A 2MHFA 4BZ4A 2VH9A 4X6QB 2ZGKA 1DIWA 1NE6A 2ETEA 3ATGA 3U0ZA 1N1YA 4IQPA 5JMCA 1AXZA 5FBZA 2QJVA 2UWCA 3JCIA 5D8AA 2ZJCA 3VZLA 3APBA 1ZBA3 1OMIA 3MIGA 4COWA 2VVDA 4A7YA 1A3KA 4NHLA 4SBVA 3RMYA 2EXJA 2QDNA 5CFDA 2RS53 4Z2WA 1Y3TA 3ZMNA 4YM2A 4Q4W2 1AYM3 2FMYA 4CEYC 2PAMA 4YGBA 2K0GA 5FPZA 1ENSA 3WDUA 2HWD2 3GBFA 3PVOA 3A0KA 1ZBE1 1WLCA 2GH8A 4FOQA 4JDNA 3VBOA 4GMP3 4UBGA 1Z78A 2EVXA 5DDJ2 4XHBA 1QQP1 1W0OA 3VHNA 4CDUB 5IK4A 2ET7A 4YZ5A 2ZGNA 3BPZA 5FCCA 3O12A 4QM9A 1F31A 3I59B 3WG1A 1G8WA 4K20A 1RITA 5C4WA 1I9RA 1RMU2 1ZVFA 4G9SB 5JOWA 1CAXB 1QJY3 4FOWA 5FMOS 1R082 1TNFA 4G3YC 2DU0A 2XLGA 4IESA 4Q4X2 3RPQA 2WNUB 1GV9A 1O91A 4EN8B 1QU0A 5L7OA 3BB6A 3WDVA 2Q1MA 2A3XA 2VECA 2ZCWA 3B3QE 5L36A 2PHRA 5T5OA 2DU1A 2A3YA 4R9AA 1AR72 3WVJA 1JYCA 1IS3A 1JUHA 1WW5A 1LU2A 2PHTA 1CAVA 4DPNA 4B7EA 2D6NA 5GM0A 3TWIA 3HQXA 3ZFEA 4KQ7A 2BUKA 1MS5A 1XNBA 2QKDA 1O4ZA 1VP6A 1TQ5A 4Y20A 3LSDA 4HFSA 3WDYA 2H6CA 3U07A 1XNCA 1LTEA 4K21A 4CDXB 1IS4A 2HWD3 1D2QA 3USUB 4WV8A 1XNKA 2ENRA 5BYNA 2JG9C 4IEOA 5FO8B 5K9YA 1V9U1 5JI9A 3PTYA 1APNA 5DDJ3 1DDLA 5CFDB 4WZCA 3AZVA 1OSGA 1W6OA 4CP0A 3H1MA 1BJQA 4GIQA 4PIYA 4AI3A 2PHFA 2WZR1 1ZZ6A 2IXKA 4HL0A 5F9TA 2VQ0A 1POV1 1MQTA 1RMU3 2RR11 4EV0A 3JBG2 4CDWA 5GZEA 4K1YA 4DMIA 1R083 1O3QA 5CVRA 5HCBA 2D6KA 2TUNA 3WHUA 3VLBB 2C0ZA 1RINA 1O5UA 1ZNPA 2I74A 5F6KA 2DCKA 5JVVA 1JUIA 5C8CA 4PLOA 1VAVA 3ZXKA 4P9YA 3S30A 5I8SA 5EYYA 5T54A 4L97A 3SMHA 4H14A 1TNRA 1KD7A 2RMU1 1EAH2 1QWRA 2XLFA 4QPIC 1IGOA 1DGWA 4OHXA 1QQP2 1AR82 4FPYA 5ABJC 3SH5A 4HVQA 4META 3AP4A 4AVBA 1FX5A 1S0BA 4LTAA 2JX9A 3RRDA 4OZXA 5KBFA 2H6BA 1AR61 5J7MA 2VGDA 4I02A 1CAVB 1RUF1 2CAUA 4W65A 3AMQA 2XJSA 2NMNA 2Y0IA 2A6YA 2JD4A 3O7OA 3QH7A 1RHI1 1JBCA 1GSLA 1D4M1 1OQDA 1Z7S1 4WM8A 1D2SA 3WHTA 3VZOA 4BH9A 1RUH2 3O14A 3VBHB 2P17A 3J9SA 3JBG3 1CAUA 3WG3A 2IXCA 3ZVXA 3TN93 4A7KA 4NVPA 1AL0G 1B35C 2IXIA 4YFZA 3AP7A 3ZFGA 1LRHA 3EXUA 1LEMA 1W6OB 3AKRA 5FTTC 3E5UA </