2LROA

Solution structure, dynamics and binding studies of ctcbm11
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
172
structure length
172
Chain Sequence
MASAVGEKMLDDFEGVLNWGSYSGEGAKVSTKIVSGKTGNGMEVSYTGTTDGYWGTVYSLPDGDWSKWLKISFDIKSVDGSANEIRFMIAEKSINGVGDGEHWVYSITPDSSWKTIEIPFSSFRRRLDYQPPGQDMSGTLDLDNIDSIHFMYANNKSGKFVVDNIKLIGALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Endoglucanase H
publication title Solution structure, dynamics and binding studies of a family 11 carbohydrate-binding module from Clostridium thermocellum (CtCBM11).
pubmed doi rcsb
source organism Clostridium thermocellum
total genus 29
structure length 172
sequence length 172
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2012-04-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 2lroA01
1W90A 2VXJA 2LROA 3UT0A 1WZXA 2LRPA 4BQ2A 2Q1FA 1W9FA 2C24A 4LK7A 2WYFA 4YWAA 2JWPA 4CP9B 1L7LA 4CP9A 3F95A 2O14A 1HN0A 1V0AA 4LKFA 3ORJA 5D21A 4CPBD 4LJHA 3ZYFA 2K46A 4BQ4A 4AL9A 1GWKA 1W8WA 1OKOA 1W8ZA 1GWMA 3ZYHA 1WCUA 1W8UA 1OH3A 4YW7A 4YW6A 4LK6A 1GWLA 1WMXA 4A6SA 4BQ3A 2KR2A 1UOJA 1W8TA 4LKEA 3ZYBA 4BQ5A 4CPBA 4LKDA
chains in the Genus database with same CATH superfamily
1URXA 2LALA 4LO8A 4ARYA 3A0NA 4BQ2A 4MX3A 2D6LX 2D5HA 1CJPA 1QU0A 2E7TA 3WDVA 1RIRA 4QHZA 4LHNA 2W08A 3A22A 1ULOA 4GIQA 1GQHA 1QXJA 5FBZA 1PIV2 3H8RA 3IMMA 4MGYE 5T5JA 5D21A 5E89A 4ZONA 1GKBA 2W91A 5A7NA 2MHFA 1W6NB 1Y4WA 4Y1XA 1GV9A 1Q8QA 2WQZC 5E88A 4Y20B 3K4ZA 2H6CA 3AJZA 4OUSA 4EZ4A 3NRUA 4IV3C 4EZHA 4Z92B 1AR83 3MV01 1QMJA 1OSGA 3NW4A 5E16A 2JJ6A 2VW1A 3SQOA 1C5IA 5L9BA 4KG8A 4NVPA 5DAPA 4YVWA 5IATA 3BUCA 2D6NA 4W6YA 4EN0A 4ZS3A 3MV11 1ASJ2 1ULEA 2ZMLA 3A21A 1MS8A 1KS5A 3TNQA 4N9HA 2KA3A 3WT3A 3ZIXA 3UV9A 4L2NA 3ZOIA 2NP0A 2WDBA 1U12A 4K7JA 2G9ZA 1HKDA 5FZBA 5HXVA 1RTVA 2WFF1 2W46A 2VC9A 2XJTA 4OULA 3MO4A 5FUIA 5JZGA 4CPBD 2Y6KA 3E5UA 2PTMA 1PIV3 1LHWA 1GOFA 4QPGA 5KHKA 1FX5A 1ZZ8A 5FP8A 2GC3A 3C7GA 1CAUB 5CADA 1U0AA 1SLTA 4XXAA 1WD4A 2ZKLA 2YHJA 2WZ8A 2XL9A 1AR92 1FT9A 2YDEA 3O0VA 5ANNA 4AI2A 1LOEA 1BK1A 4LXLA 2R0HA 1MPXA 3ZXDA 1QOSA 4DXZA 3NJXA 5IHRA 3MIHA 4IV3B 5EQUA 1JYIA 3AXDA 2RR12 3DYMA 4JRLA 4XBNA 5CFCB 3OJBA 4KL1A 3H7YA 1ASJ3 1POV0 4HVQA 4I0WB 5A3PA 1EPZA 5F2WA 4YZ5A 1T6BX 4LT5A 1R091 3ZSLA 1RXGA 5FCCA 4BXFA 5C8CC 4ZY9A 5SV8A 3HQUA 4Z07A 2GP3A 3OY8A 2FDHA 5LCWL 2W1WA 5BXXA 2FCVA 4FCAA 1VMFA 2QVSB 1K5MC 1P8JA 1YNAA 4Q4Y2 4D6RA 4KGQA 2D7FA 4XIOA 3LDKA 2J1VA 1UW8A 4QB2A 5FK7A 4IDZA 5FXWA 1HB2A 1AR93 1W6QB 2VE1A 4N8MA 1AUYA 1NCRC 2TNFA 5ISLA 2XL7A 3NNFA 4IEZA 3TEYA 2VR4A 4HMZA 3ACLA 1RUJ2 3HJRA 1ZYBA 3MF9A 2OX0A 4YGEA 4UT5A 2RR13 2DCJA 1MZ6A 3I2OA 4Q4X2 1J83A 5T50A 4AL9A 1CAVA 1WCKA 2TEPA 4GALA 1W8ZA 5GM0A 5J96B 4BE3A 2VQUA 5FMBA 5KHIA 2ZOEB 3RGBA 4N43C 5GKAC 2RDQA 3ZSMA 1CGPA 5L19A 3VBOA 2ES3A 2P3JA 3ZDVA 3KS7A 1RUNA 5CKMA 5T3NA 3U10A 1POV3 3A23A 4GB31 4LQRA 4EV0A 2B45X 5A6XA 5C8CB 3C7EA 5EWSA 3WF3A 3WCRA 2BOJA 1XYPA 1LOFC 2CY6A 1TZOA 4Q4Y3 2Q4SA 2QZ3A 1E5HA 4UFJA 4PDWC 4Q0PA 1Q43A 3ZYPA 1K5MB 1DF0A 5FZOA 1CAXA 1VIWB 1D2QA 1NE4A 3HT2A 5GZDA 4DOUA 3OBZA 1UX7A 2JG9C 3HN3A 4XIKA 3UJQA 4J1XA 1RUJ3 1O3SA 2OT7A 3FC0A 4JGYC 4H3WA 4MXWA 4OYUA 4HN1A 4Q4X3 5IW0A 3QCWA 1YFWA 4COZA 1TNFA 3FJSA 1OA2A 4PQ9A 5F5CA 1CPNA 3V0AB 1ZBA2 4XFIA 3NQHA 1XYNA 1C3HA 2YB7A 1DQ2A 3OYWA 4GQ7A 4N43B 3MYXA 4HONA 4PLOA 3OBAA 5F3CA 1NE6A 3H3UA 3Q8AA 5FZCA 2DU1A 3MUY1 3GGLA 2FDJA 1AL0G 4BQXA 1PNGA 3E5XA 2YBSA 2CNAA 1YQ8A 1OURA 1GLHA 4WVZA 1KGYA 2RJ2A 1FPN2 2JD4A 1UY3A 1Z7S2 2JDAA 1QH7A 2K2SA 3GBGA 4P9XA 1H9WA 1V6IA 2ERFA 3KHCA 3R4DB 1E5RA 5H9RA 3WNOA 1YFUA 1QGLA 4INDA 1BBT2 3K4AA 2GNTA 2E32A 2JG9B 1AX0A 4CVUA 1FNZA 5SV5A 1MS9A 3R4SA 5A3TA 1TE1B 1VBB2 2QQPA 1X50A 2RMU3 2ZGLA 3J7MA 4JGYB 1XNKA 3T2OA 1GOHA 2VOKA 3B93A 1NLQA 1VBC2 2UU8A 1ZBA3 2WT0A 3H1YA 4XFFA 5DXDA 1VAMA 5JPNB 3SH4A 2FZ2A 3M7AA 2QFEA 1SDWA 2O0OA 5FPAA 4OQ8A 2G9FA 2PHLA 1EAH1 4O7XA 5L7OA 3VHRA 1EV11 1PK6C 2V4VA 3MPPG 2W9XA 2JX9A 2P1BA 4DFSA 3WF4A 4ISRA 5ABJC 4V2VA 4PJYA 3J8F2 5FPZA 4B1MA 4CTEA 5G04L 1N47A 3WQBA 4R9BA 2FCUA 3R05A 1JU4A 4LBNA 3W9AA 2BQPA 4A7ZA 2W3JA 3JUUA 3RZKA 3WP5A 4BMBA 4Y24A 2JECA 1PO11 2OUHA 4FXGB 1LU2A 4XMIA 3AC0A 1BBT3 4A42A 2VMGA 4HBNA 5A33B 3SXWA 4YW4A 3VBHA 1I5PA 5IYYA 4Y5SA 4MHRA 1REDA 4P5HA 2ZGSA 4YZ2A 2RDNA 1VBC3 1NX9A 2W95A 3H1MA 2PHDA 1XQNA 1VMHA 2XJSA 1SLAA 4MXWB 1DGRN 4K1ZA 2G1MA 3GBWA 3D5OA 1PZ9A 1WW7A 1A3KA 3KGLA 2A6ZA 3NJYA 3KV6A 5T52A 4M3CB 3J4UH 4B29A 5KC6A 3LOBA 1PK6B 2EAKA 3TWIA 2X29A 3LA7A 2Y0OA 2XUMA 3G7DA 1Y9GA 4AI9A 3J8F3 5GLUA 3VL8A 3EB7A 5ABJB 4FI9A 1D0GA 2UY8A 1QJEA 1XC6A 1QXRA 1K3IA 3M3QA 1IS4A 1HB1A 1UZYA 1VP6A 1DGWA 1H2LA 1VRBA 2ZGMA 4DXRA 3OGRA 2ARXA 3WNNA 3LCPA 4QX3A 1NQDA 1GYKA 1R083 2WO2A 2ZTNA 4Y1VA 1XNAA 2FCTA 3OGSA 2FBEA 3U78A 2P4EA 4Y4YA 3KQ4B 5FBJA 2YFZA 4B7EA 4AGVA 4FPHA 4KU8A 4BWOA 2ZHNA 2QNKA 4RR3C 5IFTA 4R8HA 4ZU5A 2ZX0A 4AFAA 5LW9A 3T4VA 4XCAA 1S0DA 4NIDA 2VXRA 4W65A 4JC1A 1QJFA 5CFDA 2ZACA 3SKJE 3HR9A 2JKXA 2RS31 3WCSA 4PIZA 3WXPA 1HXS2 3TB0A 1V9U2 3F95A 4MLOA 1JHJA 1RUF2 3AL6A 3CJIC 2YG0A 3ORJA 3R4UA 4HT1T 4F7ZA 2HWC2 5L7OB 5LK7B 5F3GA 2A3YA 1RVF1 2D98A 1YEWA 2WJSA 4HANA 3S6PA 4BQYA 3U37A 3X29B 4QQPA 2W0XA 4JVAA 1UD1A 5J36A 1WCUA 4J25A 2BERA 5AFEA 3I97A 4RHV2 4LK6A 5LBEA 1FYUA 3TEWA 5IVVA 1UN1A 1KDKA 4FPLA 3RYPA 2VQAA 4CPBA 4LKDA 2DCYA 2VMEA 2ZAAA 1ZBE1 3BODA 1AYN1 2DVGA 4HN0A 3N9LA 3TAYA 2DUPA 3UESA 4CU9A 1Q8VA 3WINE 4QPWA 4BZ4A 2LM3A 1XNTA 3VDAA 1JI6A 2UY9A 3ZYIB 4Y1YA 1MEC3 4RR3B 2X5IA 3VKLA 4BM8A 3HPNA 3AP7A 3OF1A 4YFZA 5FQ0B 2Q8CA 4I3GA 1HXS3 2A3WA 1V9U3 2VCCA 1D4VB 5L36A 2OXBA 1RUF3 4AHXA 2YU1A 2DVFA 2HWC3 2QQOA 1HJGA 4E9KA 1DQ0A 1W2OA 3AB0A 1ODMA 4X8PA 1B35A 3CJIB 4QB6A 4JX0A 3TBDA 1NA1A 2W87A 4RGKA 3VBFA 4LBLA 2GH2A 3KZ4C 3ZN6A 1RUH2 5EJ1B 4AFMA 3T2TA 1AR81 1OA3A 4B4QA 4CCJA 2WZR2 4RHV3 5EYYA 2WN3A 3UETA 3VL9A 1QWRA 2XBO2 1CWPA 3ZFGC 5IUQA 3RZZA 3KF3A 1QQP3 4MSVA 4OLLA 2IC1A 5JR7B 1ND2A 3RRDA 3VBRC 3LOIA 4IESA 3PUQA 4NIIA 3GZEA 1BYHA 3NV1A 2NN8A 3K3OA 3NNMA 4ISQA 1V0AA 5EV7A 2JG8C 4N53B 3SHRA 4FTBA 4D7YA 1IQAA 1VB4A 1ZZBA 2HWD2 2G9GA 3CKHA 4GD4A 1W6OB 3LWCA 1LECA 3USUA 2BW8A 1NY71 4QXHA 5T5PA 5B4NA 4XJ8A 1UY4A 1PM7A 4E2SA 1PIV1 2BGPA 1GWLA 3GZTB 3ZVXA 3SLIA 2FMYA 4Q27A 1SBEA 5J37A 2OVUA 4LPLA 1J58A 3JCIA 5TSWA 4I2OA 3LEMA 1C4RA 4W6WA 3GNEA 4IE0A 2G4IA 4CEYA 1OF4A 4QB1A 2WZR3 3OEAA 3POYA 3IPVA 1N1VA 2I07B 2XBO3 3ZYRA 3GJBA 5GLZA 4DEVA 4WVMB 4F83A 1Z0HA 4Q0SA 3S7IA 3AYAA 3ZFGB 3ECQA 1HV1A 4IEWA 3VBUC 1BVP1 4AQ6A 4XQWA 2XVLA 3PU8A 1OH4A 3U14A 5J09A 3VD4A 2HWD3 4UYBA 2JG8B 4A4AA 1S0FA 4YLZA 3C7HA 5CBLA 1JYTA 2PHFA 4QX0A 2RS52 3POEA 1FI2A 2VZ3A 5FZHA 4XILA 3DPRC 5H9QA 3NJZA 5IFPA 1PZ7A 4H2AA 4CDWA 2RVAA 3CBNA 4RA0A 2VZUA 5KHHA 1AR91 4QX1A 1CVNA 2A1XA 4RQPB 4YW3A 1QJX2 4QKFA 1W9SA 1GQGA 2ATFA 2YU2A 2V5DA 1KQRA 5DZEA 2JE9A 3WV6A 1IG3A 4AQSA 3VBUA 1B35B 2RR11 4IGPA 2WT2A 3D0SA 1CQ9A 5L9VA 4K40A 3SEEA 1JXNA 1UOJA 1OF3A 3SC7X 4XBLA 3SCGA 4IETA 1COV2 3I59B 4MHUA 3LQCA 3VZKA 4AI0A 4CXYA 2ZPXA 3I3DA 3LGRA 1VRH2 4BIOA 3FLRA 4HPKB 3VHOA 4Q4V2 2ZBJA 3EBRA 3WSOA 1ZX5A 2R042 1POV1 2WQ4A 1G9BA 2GU9A 1UZVA 5F37A 1REEA 2PHRA 4LITA 4CP1A 3SKVA 3J7HA 4HOOA 4Q4Y1 1XNCA 3LDBA 3N9OA 1PO23 4XABA 3VDBA 4P9GA 3KGZA 2SBAA 3DPRB 1B09A 3LIHA 3ZXLA 4CEWC 1VBE2 1DLLA 1GNYA 5IK5A 1FXZA 2CTVA 3KCYA 1QJX3 4R9DA 2DCZA 4AEDC 1QY4A 1G7YA 4JV4A 2BGCA 2OW4A 4WBBA 1LULA 2VZVA 1LGNA 1U5XA 3MICA 4FPKA 1RUJ1 1MQTC 3T1MA 4EYUA 4CDUA 5C3RA 1AZDA 1MVEA 1UU6A 1CN1A 1LESA 4XFBA 2W2IA 4NN0A 5D2AA 1TEIA 4QQ2A 2XDVA 1AL23 1COV3 2WWSA 4Q1RA 4E4DX 1VRH3 3J9SA 3V0BA 1IPJA 2OUJA 5A1FA 1CZTA 3IKWA 1LOBA 4ZHNA 2R043 1VBA2 4A3XA 4MADA 3GM8A 3QACA 4FP3A 3SH5A 1IGOA 1AR63 1GNZA 3AP4A 4CDXB 4G3YC 2R30A 1IPKA 4J1WA 4KU7A 1D4M2 3T0BA 2BZDA 2GALA 2B42B 3EO6A 3HBZA 1HX6A 4EWDA 4Q1PA 4CEWB 1W90A 3VDDA 3M4FA 3ILNA 2HEVF 1RUOA 1VR3A 4AFDA 2WR9A 2ZKNA 4ZXEA 4AEDB 1ND3C 2OQ7A 4FFFA 4FOWA 4LR4A 4QQOA 4RFRB 3ZX7A 5C8WA 2J1SA 3HQXA 1H8TC 1MQTB 2RMU1 3Q8FA 5I0DA 2XB6C 2OZ6A 3DL3A 3HN1A 4LKFA 4JGZA 3MLKA 1ZBA1 3S30A 3BTYA 2OZJA 2RG4A 3Q8EA 5C3QA 3E6BA 4QXKA 2JEMA 3RFRA 2PYTA 1VBA3 4XFGA 4YW7A 3RWKX 4KH9A 3VD7A 4Q4W2 1K45A 1AX2A 2YUEA 3C2UA 4YM1A 1IG0A 3KV4A 2LW8A 1C1LA 1VLNA 2JDUA 2WS92 3W20A 2P3YA 2WNUC 3BGAA 3AMPA 1D4M3 1NCQA 3PJYA 4NIAA 2SLIA 5A6ZA 5A3NA 1S0IA 1ENQA 1KXGA 2CWSA 2V5YA 3HWJA 3POFA 2FDGA 3RDIA 1JMUB 1BBT1 5A1LA 1X9PA 1F2NA 2J1EA 5DUWA 3ZYFA 3ZXJA 1PX3A 1FV3A 1CONA 1X9TA 4FQZA 1ND3B 2QE3A 1OUSA 4BXSV 1GUIA 4E4SA 2WAOA 4H7MA 4IV1B 1H8TB 2AR6A 1PVC1 1YUDA 2ZX2A 4AYUA 3EXUA 1CR7A 2ZABA 4JQTA 4QPIC 2ZGOA 1CX4A 1G9AA 4E4HA 2CDOA 1HV0A 1RUG3 4LLFA 4QU2A 5C6CA 2XHNA 5J48A 4JHZA 5K7PA 3HNYM 5FLHA 5FZ9A 1GNHA 2H0VA 2YC0A 3O7OA 1OHFA 3TEZA 2CAVA 4RYDA 2Y0IA 4UFKA 3I7DA 2CU5A 3J8F1 5A6YA 1HQNA 3WG1A 4BISA 3AL5A 1LKNA 1UY0A 2A75A 4QGMA 1AJKA 4YGBA 3WR0A 4AVTA 2WNUB 5DDJ2 5FZ6A 3MLLA 4CDQC 2VW2A 1F5JA 2A6XA 1NLRA 3QOPA 3OGJA 1TME2 2ZX4A 4AVSA 4FXKB 3K51A 1R081 3UNPA 4M3CF 2BEOA 1GQPA 2JDKA 4UF0B 1K12A 3NMBA 1E5SA 4QM9A 4DMIA 2W92A 1HRV2 2Z4FA 5FY0A 3PIJA 1RUI2 5DAVA 5FZIA 3ZFEC 2BBVA 3AK0A 1O91A 1NOVA 2FQPA 4DRRA 1LNSA 1PHMA 1S0BA 1M06G 2GC0A 2VZQA 4R9AA 1UIKA 4NRPA 1DYKA 3WD5A 1F9KA 4LK7A 4CP0A 5BNNA 1UY2A 2J1RA 4QPIB 2FDFA 5DAWA 1QXPA 5A7WB 1X36A 4E2QA 4FAHA 1BLZA 1HRI2 4PIXA 2DDUA 3BVCA 1KS4A 2WZEA 2QZ2A 5DDJ3 4LBQD 2QDNA 4ONUA 2BV4A 3ASIA 4AI3A 3NJVA 1OT5A 1O6UA 5K9YA 4K21A 1TME3 1BCXA 4NHXA 3W59A 2MEV2 4NPLA 4OHVA 2GC1A 4CDQB 2WWUA 3RZHA 4CUAA 4OMCA 4LO4B 4MG2A 1OLRA 3WW3A 4N7UA 4URAA 1HRV3 1DQ4A 2K9ZA 1RUI3 2D6KA 2ZGUA 3PURA 5I0UA 2WKKA 3M8LA 4HG6B 1L7LA 3U4SA 2XMLA 4AXOA 1Q8SA 1RITA 3DYOA 3UGFA 3ZFEB 2JIGA 1ZZCA 3INAA 4XURA 3WX5A 1MEC1 2BNOA 4WVWA 2GP5A 4GULA 2HEYF 1HRI3 1W6PA 1V9U1 2W1SA 1YI7A 2R0FA 3B3QE 5KXBA 1PGL2 1RGSA 3N7MA 4IQPA 4K6BA 5FMOL 4WM7A 4UFLA 4LMFA 2HWC1 2Z42A 3N35A 4JKKA 5FLIA 1DHKB 2Y6JA 1IS5A 4NHMA 1QNYA 1UZWA 3POBA 3O0WA 2CGOA 2MEV3 5G05L 5A7PA 4K20A 4XFHA 1PZ8A 2C24A 3MGUA 2NQYA 2B7YA 5I91A 2VY0A 1W39A 1XB9A 3ZDSA 1Y3TA 2DTYA 4GKYA 4BH9A 5F8PA 4BDVB 4B3NA 1QQP1 3M70A 1HQWA 1W2NA 3D0JA 4NMIA 4AI8A 1GMMA 3AFGA 3FUOA 4GH4C 4BB3A 4AGRA 3IAPA 4YARA 1H4HA 3GHNA 4MGQA 3POGA 1WBFA 2NMOA 3MIDA 1RHI2 1AYM2 2ZMNA 4QKBA 2JDYA 2XJVA 5FZAA 4O9GA 5C33A 5F7UA 3O1VA 3LEIA 1MS4A 2ZX3A 1CZSA 4LULA 5CFCC 5HI0A 1L3JA 2F4LA 4TWTA 5IVJA 2LTNA 1UOBA 2OS2A 3FLPA 5BNPA 4PI2A 1H1MA 4IUGA 2I45A 2WZR1 5FKBA 1ZZ9A 5B2GB 3T2QA 5A80A 5FYYA 2O8QA 2VNRA 2XBO1 2VOVA 2A7AA 2ET7A 1RUD2 1LAJA 1WBLA 3KT1A 3ZFFA 4DEQA 2ZGNA 2VGDA 2HBTA 4I01A 4R52A 3D82A 1RHI3 3CDZB 1AYM3 1N1SA 1O4YA 2HWD1 2VMIA 4GH4B 3RMYA 4BQ5A 2XLFA 2QQVA 4AEKA 2DURA 5E6HA 1JN2P 5FYMA 4TN7A 3AMHA 3RYRA 2WNVA 2GDFA 5DABA 3KV9A 1BHGA 2BUKA 5CZKA 2R072 1X7NA 3PMSA 3OG2A 2HBUA 3O12A 1ZVFA 4YVWC 1RINA 3B00A 3LPFA 1NCRA 3T2PA 3TNPB 1RXFA 5KHGA 2VUDA 3HVDA 3N9MA 4LOTA 2F17A 3KSCA 1LOAA 2GMEA 1W2UA 1QOOA 2WQ8A 2Y38A 5IT6A 2PELA 4AWDA 3I54A 1F35A 2QTWB 3ON7A 1GFF2 4YG6A 1H30A 2ZEWA 5C5TA 5JZGC 3CMGA 2P3KA 5BUVA 2WO1A 1PX4A 3UT0A 1IKPA 4WVVA 3RI9A 1PMIA 2VQ0A 4AAPA 3WLUA 2W39A 2QQNA 4YWAA 3VHPA 4MGTA 4QPGC 2D5FA 5HCFA 2H6BA 2IXHA 1DGWX 2VMDA 1UL9A 2OPWA 2BWCA 5DN2A 4EN6B 3B02A 5ACA2 2NMNA 4RD7A 2VCAA 4AW7A 2ORXA 1PO21 3NKGA 4O9EA 2R073 3K2OA 2XQRA 1ZZ6A 4QGLA 4OHZA 1TMF2 2O1QA 3V65A 3KM5A 5J98B 1QJY2 2B46X 2E26A 4AOCA 3KQRA 3OBRA 1QJX1 4XBQA 1JUHA 5LEJA 4FOQA 1S1AA 2ZEYA 4YVWB 4COUA 5FOBB 1OC1A 4DQAA 1PMHX 2CDPA 4GKXA 2QDRA 4QX8A 5IK7A 1F4HA 2E31A 1G8WA 1ONAA 2DVAA 3PVEA 2WZPP 3DN7A 1AVBA 4LHSA 5FP4A 1AL21 1COV1 5JZGB 3JD72 4UFMA 1YC61 1VRH1 4ET7A 4YGDA 3AP9A 4ZPIA 3FE5A 3DCQA 5FYBA 4ZKTB 5C9AA 5LA1A 3H42B 2FHRA 3R6SA 2R041 1KDMA 5LK5A 3VZOA 4QPGB 4XUOA 4COWA 4UWDA 5ACA3 3MFCA 1AR61 2VMCA 4XVHA 4CCEA 3IDEA 4QXCA 3AFKA 3ZPYA 2BJSA 4I02A 4YVSA 2A73B 1EP0A 2VZRA 4UAPA 5CYYA 1H1AA 2DTWA 2ID4A 3HMYA 5L9RA 4CU8A 1L7QA 5CKNA 3AMNA 5LZ6A 1U5YA 2PFWA 1QJU1 1DQ6A 1RMU2 3P3NA 4KWJA 4DB5A 1UZ0A 4DZGA 5A1AA 1R64A 4NRMA 3O1MA 1SLLA 3BTZA 5AVAA 4A2UA 3KT7A 5GZFA 4OMDA 4D3WA 3O1SA 1IHMA 1WMFA 3OUJA 5C4WA 4IERA 3WNLA 2PQSA 3LPGA 3BALA 4UFHA 2I2SA 3VBOC 1DYOA 2HWF2 3RZMA 3MIFA 4DINB 4YZ1A 1C5HA 4RS5A 3PVBB 5F6KA 3MW2A 2HJIA 3S5QA 3JD73 3S5AA 4NIHA 3P1IA 2BBAA 3I8TA 5FUPA 3B9IA 2XLGA 3OY8B 1BEV2 1J1TA 1QF3A 2KR2A 1H6YA 3LF7A 2R7EB 1XBFA 4FVVA 1VBA1 1UQXA 2WWJA 3VZMA 2BFUL 3ZSJA 4FT8A 1L7RA 1LHOA 1U5IA 4ARXA 4F8AA 4KGGA 1IQDC 3U11A 2LRPA 2W5FA 3ZN4A 5FIXA 5FYVA 1D4M1 1TG7A 4BPZA 3VD5A 1SFPA 1AXYA 2YGLA 1H1IA 1XXNA 4LLOA 5I93A 3M3IA 3WG3A 1UU4A 2NZ9A 2ZA9A 3OBTA 1XSRA 4OI2A 5H9PA 2ILMA 4CCOA 4Z8BA 4M4PA 5CNAA 5DUVA 3FHIB 5A70A 2EIDA 1CAVB 5BV6A 3RVHA 1VBD2 4A45A 1KITA 1NXD1 1ZNPA 4BMEA 3AM2A 2X10A 1US3A 3WF2A 4D94A 4UI9L 3W58A 4Z2AA 3RZLA 3POIA 4QDSA 5JSRA 1FPN3 2CHHA 1OQ1A 1Z7S3 4LKEA 1J59A 3IT8A 5HBAA 3VBOB 4ZZ8A 1YFXA 1JW6A 2E6VA 4JDMA 2D3RA 3AKPA 4XACA 4M0NA 1O5LA 4XQ4A 5FY9A 3E5QA 4LBJA 5JSPA 1BEV3 3NKTA 5FZ3A 2ZX1A 4EROA 1RUG1 4LBQA 1BMV2 3ACGA 1GSLA 1WMDA 1JS9A 1WWYA 2RJLA 2VBBA 2WSVA 4C8DA 2Q5TA 5A3WA 2XLAA 5FO8B 2P34A 5FZOB 1VBB3 1CAXB 4XUQA 1WW6A 3M3EA 1RUC2 3MW4A 3N7JA 2ZEXA 1MZEA 4HXCA 1NUKA 3SH3A 2VUCA 1UOFA 4I09A 4HKLA 3P5BA 2YPDA 3THCA 4A7YA 1YXWA 3OD0A 3QD6A 5FZFA 1VBD3 1FOD2 2A6VA 4A44A 4KWLA 4LORA 4PLMA 4FTEA 3J7NA 4CCMA 4IE6A 1BZWA 4YZ3A 3OYWB 5DQ0A 3FHAA 4NHYA 5L7OC 5LWBA 4JDNA 3WUCA 3H8UA 4P9JA 1LGBA 2W1QA 4CP9A 2VZPA 5KXDA 1XSQA 3FBYA 2WABA 3L9JT 1C8M1 5FZ8A 4AFCA 5BY5A 4FOVA 1ALYA 2NLRA 3BU7A 5EPAA 3CZUA 3NNLA 3Q9OA 4ASKA 2WC2A 3OTFA 1JBCA 4B4PA 1RUC3 2EA7A 2JICA 1C57A 1X82A 5IWFA 3AKTA 2OYZA 2W94A 2Y33A 2UURA 5DDJ1 3BIWE 5JXIA 4Y33A 1S0JA 5K4LA 3VBHC 4IL7A 3WDUA 1YQ6A 3Q8BA 3PHMA 4K1YA 5I0TA 5LY1A 5T54A 2MPFA 1BKZA 1W8NA 2JB4A 5FMOS 2ZS6B 2Q1FA 1W9FA 5LBBA 1UIJA 1FOD3 4MO3M 3WNKA 4R4XA 5FP3A 1PGW1 3GBFA 1VALA 4I3PA 1W8HA 2BTVC 2IZWA 3SCHA 1HRV1 1I9RA 1WCDJ 3LDRA 1W6MA 4COYA 4FBFA 4IEVA 3JBG2 4YPJA 3AVRA 3IIIA 5E8AA 4C0BA 2JENA 4OHXA 4QHOA 4UW5A 1H2KA 1S2EA 4ES8A 3I2HA 5CG8A 3THTA 2XJRA 2QQLA 4S2DA 4FAGA 1S0GA 2PAMA 5DG1A 4TZDA 3MEPA 5D8AA 3WDYA 1HRI1 4Z2WA 1H2MA 1WW4A 3VBSA 2DBIA 4N53C 2V73A 2C26A 3MBWA 2RDSA 2XR4A 5FMDA 2VZ1A 3LSDA 5FJHA 3THDA 2Z2SB 3VBHB 2MEV1 4DIQA 4YZ4A 4AE2A 3RZGA 2FDKA 5FAXA 2UYAA 3M1HA 5JOZA 4XJAA 2IXLA 4URTA 3WW1A 2R16A 2ZGKA 3GCWA 1UO9A 4S2GA 4KMQA 5JMCA 3VBRA 1O3TA 2WA3A 1H0BA 3B69A 1N3PA 1ULDA 3N9NA 3FBMA 3LE0A 3JBG3 4KWKA 4CP2A 1GBGA 1D2SA 3TN92 4DS0A 4LIVA 4OUMA 5EZWA 2DYCA 4PT6A 3O1UA 1ENXA 1VAKA 4IEPA 1VJ2A 3WQ1A 1LRHA 5EFUA 4AHYA 1G6NA 1UYZA 5I0SA 2CYFA 3ITQA 1PGL1 1QHDA 2HLEA 4DO0A 2GMPA 3D8CA 3LIGA 4OZOA 5IJRA 5T55A 1LODA 4QT6A 4BCUA 1AJOA 2E7AA 2A70A 3CQOA 1G9CA 2PAEA 2EVXA 1H9PA 4S2FA 5KXCA 5FLJA 5A32A 3A4UA 3WHTA 3VDCA 4ZXKA 2X8KA 1IZ3A 3MUZ1 3ZXAC 1KRIA 3LEKA 1OA4A 2EXIA 2D93A 2RM22 4LE4A 1GZWA 2GNDA 2JDMA 5JMOA 3WZ1A 1EY2A 2WFF2 3CL1A 1WCSA 4PI0A 4Y4RA 3E6CC 5FZKA 2X5IC 5JI9A 1FMD2 4OFGA 2P37A 3TN93 4RQPC 1RHI1 5LRRA 3LD8A 3WDXA 5CFDB 4XCBA 1XPWA 3GALA 4IGQA 3D4KA 4DUWA 1RUH3 4AVVA 4FPGA 1OI6A 1KJRA 5F3EA 5EXOA 2J42A 1B35C 3VBFC 4XEZA 1NA1C 5FYHA 2CWMA 4H14A 1W04A 1ST8A 3NAPA 5JAXA 3G6JB 3QLQA 4LOSA 3Q8CA 3T09A 4AQ2A 5LRSA 1ASJ1 1GANA 4AHZA 4XAAA 5FYIA 4W8JA 4KBBA 5F5IA 4GWIA 4LTAA 1KD7A 1ND2C 1OOPA 5AC92 3T3YA 2XHKA 4XUPA 5HCAA 2FDIA 1QJZA 1OD5A 1W05A 4XJ9A 1UWWA 3ZYGA 1Q8PA 1TVGA 4AG4A 1NQJA 1R092 2RM23 4FOYA 2AYHA 3VLBB 4QHBA 4IGOA 2H0BA 1PVXA 1WMEA 1IPSA 1FMD3 3K3NA 1CZVA 3LKJA 4GAZA 4O65A 5K0UA 1HN0A 2DVDA 3ATGA 1D0HA 2X5IB 4P00B 5KC5A 4QPYA 2YFUA 4CCDA 3SEPA 4PF5A 4P5YA 2VCBA 3MIEA 2DV9A 5GJ6A 2C9AA 2B9UA 1KFUL 5FZLA 4ZS2A 3VBFB 3I2KA 1NA1B 2R071 4CEYC 3R0RA 2HEWF 4MGZE 1J1LA 1O8PA 1YFYA 2AACA 1DZRA 2AUYA 1DQ1A 3ZN6B 3OSDA 3IM0A 1GICA 3DKQA 1EUUA 5JOWA 5LBCA 2Y8KA 5AC93 4NWVA 4HKOA 4B8EA 2EXKA 1ND2B 2EALA 4Q0VA 1SBDA 2RS53 3SMHA 3KB5A 1ZA4A 4I0AA 5JVVA 2ARAA 4CDXC 2VAUA 5A3UA 5IVYA 2GH8A 4TSVA 4CE8A 2VOWA 3OEBA 3P3PA 2OA2A 1YRZA 3I2IA 2UWBA 3FWEA 3IIAA 4LA3A 4Q2FA 3UGGA 1HLCA 4A3ZA 5CA6A 1GP4A 3USUB 2VUJA 2Y34A 4CDWC 5BNOA 4FFIA 1H6XA 2PHTA 5ACA1 4JKLA 4UOJA 3ZKUA 2W1UA 4KG0A 4Y1UA 3FZ3A 5F32A 5FOJB 2DU0A 2HH9A 4Q4X1 5F5AA 5LA9A 2XQXA 1O3RA 4NIGA 2J7MA 4GWJA 1AXZA 2RHPA 4CEYB 2BPA2 4TLGA 3I4IA 4L0PA 1O4TA 2BFUS 3IPVB 5FP9A 2Y6HA 1BK0A 1HJFA 3ETPA 1SPPA 2O14A 2D97A 4Y22A 5J7MA 2VTFA 3PUIA 5FPXA 4Q4V3 4XZPA 3GZAA 1O8SA 1RL3A 2WUHA 5AVPA 4J6GA 1GP5A 3BYWA 3O1OA 3FX3A 2EIGA 2VVDA 5APAA 5FY1A 1OLMA 2VCMA 3AX4A 4ES9A 3UKNA 1NYWA 1HN1A 2Q8OA 4G9SB 3K75B 1NZCA 4NPRA 2VH9A 3WDTA 3GCXA 3U0ZA 3ILRA 1VBE3 5DG2A 5JPMB 5JLVA 3KVAA 2ARBA 1ENRA 3A7QA 4QKDA 5FYCA 2EIBA 1MZFA 3ES1A 4OVEA 4MVTA 3URFA 1W28A 4LE3A 4C0HA 4CDWB 4UW3A 3GYDA 4M0HA 2UYBA 3ZXGA 3LA2A 3RSJA 4IV1C 4OUEA 4NAMA 2WIIB 4OHYA 2XH6A 1HDKA 3OPWA 1AR72 3N9PA 4FQ4A 4CDUC 3WP3A 4BK4A 3ALQA 1JU3A 2OIIA 3VBUB 4KWUA 4XE9A 1XU2A 5FPBA 4E8DA 4FPJA 4AFBA 3TYJA 3WDWA 2I74A 3CHXA 4R9CA 3GXUA 2D40A 1FPN1 1Z7S1 1EAH2 1CAWA 3KWVA 4LO6B 1EV12 3DYPA 3RMXA 2OQ6A 3FLTA 5B4XA 1I5ZA 2WYFA 5A3OA 1QIQA 2JWPA 2VOTA 3JQXA 3WW2A 3W5MA 2R32A 5FREA 2VNOA 2CGNA 4LBMA 1HW5A 3K4DA 4D7TA 5JXGA 4HSJA 1SFNA 1PO12 1EUTA 1VBB1 2EXJA 3C3VA 4WM8A 3VZNA 2YROA 4BQ4A 1W8WA 3ELNA 4ATEA 1VBC1 1OLQA 2IWGB 1AR73 3MDPA 4LUMA 2V4AA 5CIRA 4A6SA 2R062 1HIXA 3AZZA 4I30A 4WZCA 2D6PA 4EN7B 2W47A 4CDUB 4PQQA 5KWRA 2Z79A 2A6WA 4XDQA 3ME2A 4JGZC 2ZGPA 1YI9A 4IE7A 3UKVA 3AXEA 4Q4W3 1WZXA 4UW6A 1REFA 2Y6GA 3OB8A 4FPEA 2XWBB 4XYXA 4FTSA 3SITA 2WS93 1APNA 3N36A 3RWNA 1EAH3 3MLJA 3V0BB 1EV13 4JTOA 4DXTA 3DF0A 1LTEA 1WKYA 3BOWA 5FFOC 1QH6A 1ZM1A 4Y5TA 1YQ5A 3KD4A 1NCQC 2BWAA 2QBXA 2YMZA 2ZHKA 3C7OA 4X8NA 3RG0A 1R1ZA 4NOTA 5JXJA 3FL7A 4L11A 1DQ5A 1RUC1 2ZJCA 3ZO0B 1W8FA 4B4RA 4ZU7A 3VDDB 2HWE2 4LHLA 4XQDA 5IVCA 2PLV2 2R063 1JZ3A 4FPFA 4FFHA 2XJPA 2XGXA 2AZ5A 3DXUA 5CVRA 2WNOA 5K8SA 3HEIA 3JB8A 2EIEA 2PHWA 1FOD1 2BVBA 2VMHA 3VD9A 3PVNA 2C0ZA 3LZZA 4JGZB 4KBZA 2D6OX 4HVOA 3L2HA 4EN9B 3AMQA 1W6NA 1DCSA 3MFAA 4M3CE 4W4ZA 4RN5A 3LEGA 4Y20A 2RS32 3MF6A 3AKQA 1YJKA 1C1FA 2A5ZA 2ZHMA 4HFSA 2X05A 3USSA 3ZR6A 1NKGA 3ABZA 4P9WA 3KV5A 3H1WA 1X8MA 5LA2A 1JTZX 2VD7A 4M01A 1TQ5A 1UU5A 1RVF2 1NCQB 4LHKA 2YC2A 5D1IA 1I1EA 3DEMA 2HWE3 2PLV3 2GN3A 3HBKA 1WLTA 2UWCA 2VZOA 2F6BA 3BB6A 2LUWA 3HNBM 2VL4A 3I2DA 4QXBA 2Q0AA 3CEWA 1OKOA 4FPYA 3WNMA 1HXS1 4Q5OA 4DY3A 3VUOA 4N9IA 1CAUA 3VZJA 4NJ4A 5BNNC 1JZ4A 4QDQA 1RUF1 4RFT0 3JBG1 2HWB2 1H8VA 2RJKA 1XE0A 4IEQA 3F2ZA 4XDPA 1DU3D 4QDRA 2R1DA 1YO8A 4LA2A 5CB7A 2E53A 1O3QA 2DFBA 3NNGA 4IV3A 5FZMA 5LATA 2PAKA 4SBVA 3ZIWA 4RHV1 2VVEA 5F3IA 1UZZA 2E51A 5CFCA 2WNEA 4QKNA 1J84A 3RZJA 1AR82 1Y43B 5FZDA 1VMJA 5JXHA 5KXEA 5FO7B 1MS1A 2VJXA 4MXVA 2Z5WA 3T08A 3GJAA 1WUVA 3AYEA 3KHBA 5CAZA 1IOAA 4LUKA 3PVOA 4I0BA 2WFPA 3V56A 3D3AA 2E63A 1W03A 2B4KA 4CCLA 2QJVA 2YV8A 4META 1A6CA 1D7PM 1W2AX 3H50A 2Y64A 4LNVA 3WF0A 4CSWA 2HWB3 1NY72 1W6QA 5BNNB 1SCSA 1V6OA 1FV2A 3OD4A 5H9SA 4Y26A 3TN91 1Y7BA 5M0TA 1VE0A 3CF6E 2RS12 3DGTA 4JDOA 4WM7C 3AKRA 1RUH1 3KCXA 2A6YA 5BPXA 1QEXA 2E7QA 2ZGQA 4CU6A 5FRAA 4XPVA 1J3RA 1F4AA 3C7FA 3ZSEA 4RGGA 1JOPA 5C5UA 3H9AA 4AVCA 4Y1ZA 4GA9A 5FYZA 3RJ2X 4QU1A 4B1LA 1A34A 4LBKA 3SNMA 4PHZA 4UBGA 1GP6A 1SEFA 5FMCA 3BN6A 2Y6FA 5FXXA 4IEYA 5C8CA 4BQWA 3APBA 3UL2A 1ULFA 1XJAA 3ST7A 3PU3A 2RM21 2JDNA 5EJZB 1XE8A 1A78A 1K5MA 4L92A 2QUOA 5LEKA 3ACHA 1T6GC 5IK4A 1MVQA 1S0EA 3KMHA 1W9TA 1FMD1 1SMVA 3SISA 4P9LA 1QNWA 2BP6A 1JUIA 4YNIA 1GWKA 3C8XA 1YIFA 3IWZA 1N1YA 2RS13 1JYXA 1W6PB 3PTYA 4QMAA 1J3PA 3ZYHA 4B7KA 4EE2A 2FZ1A 3WG2A 1ENSA 2Z69A 4WM7B 4IEUA 2QQJA 1CX1A 1FAYA 4AEMA 3AJYA 4UFIA 4E2GA 5BNPC 4BIFA 4COVA 2E33A 2ZCWA 4AGGA 1RUD3 2IXKA 3V0AA 1MACA 2Q1ZB 2ENRA 3KF5A 3RI8A 4YYOA 2IFWA 4N43A 1T2XA 4GMP0 1MS5A 1XOYA 1BXHA 4P9IA 4DNYA 1W0NA 2HKXA 5AC91 3TOJA 2DUQA 3ZFFC 1CESA 4BQ1A 2J1AA 3IN9A 5A7QA 5FPVA 1DP0A 2RS51 1CIWA 2XKOA 1G9FA 2PN5A 3CJXA 3I2FA 3OCPA 4L9BA 1LOFA 3VZLA 2D44A 1ODNA 2VU9A 3BCWA 3ROUA 5F1RA 3U4XA 4PDWA 3I3MA 4PBPA 2PQQA 5FY5A 1UF2C 4X6QB 4PBOA 3VGIA 4C91A 2WNVC 3WG4A 4MZUA 4NROA 1SZBA 4YM3A 5DZGA 4HETA 2HYKA 1V00A 2JG9A 5J3UA 3ILFA 2XVGA 4LKSA 1DBNA 4D0QA 3T0AA 1NLSA 1JZ7A 2LS6A 4JGYA 3WW4A 2Q1MA 5CU1A 1UYPA 4MUVA 2WLPA 3CZJA 4L97A 4HLTA 4D8MA 3PUHA 5ANQA 4RL7A 4AZZA 2DVBA 5BNPB 1DZQA 2B9VA 2B39A 4QQLA 4BLJA 1NAEA 1UOGA 2CAUA 2YC4A 4IE4A 3FHQA 4JAAA 3S0MA 4Q4V1 1UMHA 1YJLA 2VMFA 5FPLA 3PJQA 2GSYA 3ZFFB 1JYWA 4NAOA 4MGSA 2BGOA 3JZVA 1UPIA 3OOXA 3WQ7A 2WRAA 1Z78A 3NWKA 1YHFA 4GMP3 2Y60A 3M2MA 2P17A 3BOPA 5FXVA 1TMF3 2C1FA 1VBE1 2IVJA 1O4ZA 1QJY3 1S2BA 1WCQA 2VTXA 3EQEA 3H7JA 4GWNA 1GU3A 3UKTA 5FPUA 2MNGA 4F3JA 2WNVB 1SFYA 4BA6A 5A33A 1JYCA 4IE5A 1LJ7A 4CUCA 1QDOA 5DAXA 3WF1A 4YRDA 1UMIA 2AEZA 1JODA 2WT1A 4JRAA 3H0OA 4PF1A 5JIAA 5IVFA 3IDBB 3N7LA 3MZHA 4OCTA 2WA4A 4LEJA 3AYCA 1X33A 4DPNA 1NCRB 4GXLA 3WUDA 1RC6A 5C7GA 5FYTA 3IZOA 4HK8A 1Y9QA 3GZUC 3RS6A 2XG3A 3N3HA 3KT4A 5F6LB 5F5QA 4QX7A 1UY1A 2RMU2 1FATA 4CA9A 2IUWA 2JD9A 3NO8A 2KM2A 4M3CA 3T1LA 4NE9A 2ZHLA 1TNRA 2GAUA 3CIHA 1PK6A 1GOGA 1SHWB 3RJRA 5C9AC 1MS3A 2JXAA 1SLBA 5ABJA 5FR3A 3NL1A 3IBMA 5IAVA 2EICA 3VV1A 2PMWB 2Y26A 3I2JA 3U1XA 2GC2A 4AEJA 1WGPA 4H55A 1LB2A 4GWMA 1RMU3 4IXLA 5FV3A 4K8FA 4YVSC 1WD3A 5IK8A 1LU1A 1OVPA 4P9YA 4PDWB 4CCNA 4DUXA 4V2WA 2ETEA 3LFMA 1NT0A 2ORZA 2P5BA 5DAQA 4YW2A 1EYBA 3BI3A 4NHKA 5IVBA 2BU9A 1YWKA 1LENA 2HWF3 3HT1A 3ZYBA 2QQMA 4XF9A 2CV6A 4CYDA 1AR71 1EPWA 1RUE2 5LASA 2DUOA 3U07A 5C4WC 2AGSA 1BVVA 1ZRCA 1OUXA 4P08A 4RGAA 4XFAA 2C5DA 4QM8A 2IFRA 3WHUA 3WP4A 4AQTA 5C3PA 4RS5C 1S0CA 4HL0A 4Q29A 5FTTC 1C8NA 1PVC2 4Q4W1 4QQHA 2BDRA 4XAEA 4YG3A 3ZYJB 5JCTA 1LOCA 2Y6LA 3IMNA 3LAGA 2WS91 3DV8A 1LEDA 2YPJA 5C9AB 1GZCA 4YM0A 4D7SA 1CPMA 2QKDA 5JR2A 3ZPOA 2GNMA 2V09A 1N3OA 1ZRRA 4YGCA 4Y3OA 2OKXA 1W9WA 3AP5A 3ZKYA 2IXJA 1WA6X 3NSTA 5A7SA 3PUSA 4YVSB 4P02B 1JOJA 4XXPA 3J7LA 2GZWA 2JIJA 5FZ1A 5BYNA 5I8YA 1R082 1RUE3 2R061 2X53S 3FN9A 4AF9A 1E5IA 2ZZJA 5A3LA 5HPOA 3M3CA 1OLME 4BK5A 4XUNA 5C4WB 4RR3A 4CRQA 3VB9A 1W2TA 2A3XA 5FQ0A 4BYYA 1PVC3 1WLWA 4L8QA 4PCRA 2KD7A 1OQEA 1CJDA 3DKWA 4RS5B 3U75A 5EP9A 1KEXA 1O5UA 1SDDB 2VPVA 2VQTA 3H3ZA 3NNJA 3QH6A 2JE8A 2P6HA 4TTGA 3UJOA 4FO9A 4QGNA 4C1XA 1C28A 3CJIA 3TEXA 1STMA 5FZGA 3W5NA 2D3PA 3B7MA 2L9LA 4N90A 4A7KA 2D6MA 2DFCA 2YXSA 4JKMA 4TYSA 3ZN5A 3PDQA 3WNPA 1TME1 1CIYA 3AZVA 3LA3A 5FY4A 3PUAA 3NV4A 1LR5A 4CU7A 2JDPA 3I3QA 1ULGA 4ITCA 3O1RA 2Q8DA 2WO3A 3CLPA 2PHXA 1ULCA 3P6BA 1JZ5A 4N53A 1NG0A 2HWE1 1RUI1 2PXJA 4MYEA 2PLV1 4D6SA 5JSOA 2QQKA 3I49A 1QDCA 4Q26A 1HB4A 4LBOA 1W6OA 4Q0UA 2QQIA 1UCXA 1W8UA 3O1TA 1N3QA 1JZ2A 3PMEA 1H2NA 1OD3A 1R1A2 1DLCA 1V6LA 3ZSKA 1E57A 2AC1A 1F15A 1Q5OA 1XYOA 3AVSA 3IDAA 4XMAA 5C71A 5T5LA 4FP2A 5DPNA 3VKFC 1MEC2 5DUUA 3WP6A 3D6EA 1UX6A 5C70A 3FMGA 3UK9A 1POQA 4LBQB 4W6XA 2XOMA 1KFXL 2WBKA 5FWEA 3UGHA 2VVFA 5IAXA 1GR3A 4XHBA 3AZXA 3E1F1 4JZRA 4AVAA 4NR1A 3S7EA 5HCBA 4ORFA 4JTNA 2QCSB 3ZXEA 4WVMA 4NWWA 2IVIB 5FY8A 2CSGA 3ZFGA 1SCRA 4D69A 5CKQA 1GZ9A 1Q56A 2VTXJ 4YG0A 5EYXA 3WNXA 4K3UA 1V6JA 2JG8A 5AFBA 5DMYA 5CFDC 5CG9A 1QQP2 1F8VA 4E8CA 3KLSA 3B01A 1R1A3 4CXXA 3LB9A 2D43A 3RNSA 3H8XA 1W99A 4XF1A 2AENA 4XUTA 2QQWA 3GF6A 4M4RA 1PGSA 2ZGRA 4CP9B 4G4FA 4JCKA 1Y9MA 2HWB1 3DUIA 4M00A 1JHNA 4CUGA 3CO2A 3KCCA 5D8AC 4RQPA 1O7FA 2WAAA 5LBFA 3JQWA 3I3BA 4JHTA 3VBSC 4WZFA 1Q8OA 1RJ8A 2UWAA 1NZIA 4S2HA 5JUVA 5FY7A 1YQ2A 2DWRA 3H8OA 3H3LA 2D3SA 2YBPA 2YYOA 4N7IA 1N1TA 3CU7A 3OUIA 3FUQA 3M3OA 2J1UA 1LHUA 2XJUA 2YY1A 3I59A 1OMIA 4ZU4A 3K46A 1JYNA 2VZSA 3ZM8A 3VKNA 1AX1A 4HPKA 4ATFA 2DF7A 3BKZA 2E9QA 2VO5A 3WVJA 1AYM1 1BQPA 2ADDA 3OGGA 2CGPA 5F9TA 5JI7A 1RB8G 3POJA 4HKWA 4K9SA 1W6MB 2BYVE 5I0RA 2WLQA 2XPJA 3DPRA 1U5ZA 1ZZ7A 4MOAA 5FYUA 5LA0A 2PHUA 1LEMA 2J22A 3HNMA 1RYYA 2VG9A 3NVCA 3VD3A 4YFWA 1OFNA 2AEYA 2RS11 5D8AB 4LIUA 3ACFA 3AKSA 4UBHA 5JWPA 3VBSB 3TRSB 4Q0QA 4AVBA 3E6DA 1VB2A 4XFCA 5CEHA 1DZTA 3HIFA 3MIBA 3W21A 1AHSA 1DGLA 1RUD1 5KR7A 2WFF3 4OI1A 1V6KA 2WINB 5BNQA 2R6QA 3N7KA 5I8SA 5JDBA 3O5SA 2TUNA 2FMDA 2BOIA 3BIEA 5JOXA 3NV3A 1VAVA 3VBRB 4BU2A 1K5JA 3IB3A 4CCKA 4XF3A 1LGCA 1LHVA 3I3EA 4CDXA 2BVVA 4HK9A 4Z82A 4MGKE 1W8OA 1UYYA 1I3HA 2ZZQA 3O14A 5DZFA 4YW1A 2XWJB 3EMRA 4QX5A 2RDRA 4CEWA 1VPHA 3MI8A 1ULPA 4JQRA 4XJUA 3B94A 2CL2A 1WW5A 3NAPC 1PO22 5EJ3A 2GNBA 4LO5B 4AEDA 5FDBA 5E1RA 3L2YA 1LCLA 1MS0A 5HCHA 1UAIA 2VNVA 1MQTA 3BTAA 4XOGA 1DG6A 1R093 1OOPC 3JB4C 4QX2A 1WLCA 1OPMA 2O8OA 1LHNA 2ARCA 5HV0A 4OI4A 4GB32 4XF4A 5A32B 5F39A 3ACIA 3JXSA 1OXCA 3FFQA 3MW3A 4PLNA 2A71A 3T4HB 3ZXFA 1PNFA 1GZWB 1F31A 2VNGA 3ETQA 1W06A 4C90A 5K0UC 1AL22 2VZTA 1XNBA 1UXXX 4OHWA 3O1PA 1LOGA 4GMP1 2ZEZA 4K8RB 4A41A 3CNAA 4AR2A 5A6QA 1J3QA 3RYKA 1CD3G 1TMF1 3I2GA 1JH5A 1QJY1 1S55A 1UKRA 1AR62 2HYXA 2P3IA 1UNBA 1MZ5A 1UXZA 2VOXA 4FFGA 1W3XA 1DDLA 1UPSA 4GJZA 5CISA 3NAPB 4AK3A 2NYYA 1QKQA 4LO7A 5FJKA 1ND3A 2W68A 5FYSA 1QJU2 3J26N 2X09A 4IV1A 1H8TA 1OQDA 1ZRFA 4YW6A 3BPZA 2ZMKA 1V70A 3ENRA 5GLTA 1OOPB 4GB33 1W8TA 2ZAHA 5FWJA 3JD71 3VKMA 2RE9A 3NV2A 4XETA 2F4PA 4MGIE 3BPSA 2WO7A 4CXWA 1FNYA 2YBKA 2QQUA 4NHLA 4CZSA 3LSEA 3K77A 5GLWA 3K48A 5FP7A 1W9YA 2OPKA 3HQRA 3HAGA 2J1TA 3MIGA 5K0UB 3RPQA 3ZMOA 4R4ZA 2WNUA 4BOWA 5BNOC 2R49A 5FKCA 5C3OA 2EAAA 5I8TA 1IS6A 1WA4A 4ZZ5A 5J1XA 4BJ0A 4IEXA 4ASLA 1DYPA 2XKPA 3EYPA 3EJKA 2ZGTA 1RMU1 2B8MA 3OGVA 3WOGA 3T0DA 5GALA 1OH3A 2RV9A 4RSUA 4UF0A 4BQ3A 1NXMA 2C6SA 3PNAA 3QBQA 4EQVA 1QJU3 1DGRA 1XRUA 3ES4A 2HWF1 2VXJA 3PTRB 4ASMB 3DECA 2Q30A 4E27A 1OFSA 3ZR5A 3T30A 4E4ZA 3E97A 4TLFA 2JKBA 2XONA 5FUNA 4AAXA 2W52A 1W0OA 1ACCA 4DY5A 3VKOA 3POSA 4QPIA 1A8MA 2JE7A 5L73A 1BEV1 5A7WA 4O61A 2WSUA 3UYJA 4DXSA 3HD8B 2AREA 2DCTA 1KJLA 4HSLA 1HB3A 4V1PA 4XC9A 3OPZA 4GJYA 3KVBA 1RUG2 4GZ9A 2N7GA 2ET1A 3VDDC 4YW5A 5EIYB 5FZ7A 2P6CA 5GZCA 3PL0A 1I6XA 3LFIA 5LY2A 1OPOA 1SQ4A 5BNOB 4CDQA 4P14A 4KQ7A 1PMJX 2BNNA 4NPMA 3BTXA 2NPIA 5GZEA 1JOBA 4IW3A 2NM1A 2YZ4A 4BLIA 3GDBA 1VBD1 5A7OA 4D6QA 1HQLA 1JZ6A 1BJQA 3HOBA 4Q8KA 1W3VA 5A3MA 5KHJA 4FPOB 3OPTA 5T5OA 5FXZA 2VBPA 1YYNA 4Y22B 1SPPB 2VW0A 1RUE1 3ZFEA 1JZ8A 1ZRDA 1H4GA 1V6MA 3IDCB 4LJHA 3VN4A 2K46A 1OKQA 3GHMA 4KI5M 1Q3EA 1O59A 1X8EA 2G19A 3MHZA 4FSJA 3A0KA 1BMV1 1K42A 2ZXQA 4Y5Z0 1GZTA 1SLIA 3AP6A 3THPA 3RQ0A 2VUAA 1G9DA 4OI0A 1WMXA 4XHXA 1PO13 2XUEA 1YLLA 2IXCA 5LB6A 1DIWA 3QH7A 2P2KA 1C8M2 2VBDA 3SCFA 4QD2A 1SLCA 4NRQA 4CUBA 5DUXA 4DRVA 3N4MA 1G86A 2Q8EA 4WM8C 1S4CA 3B5LB 2DCKA 4WV8A 4HVRA 4XDOA 4XF0A 3FFZA 1YCIA 3V64A 4AHWA 4KNCA 3S57A 5FZ4A 4H7LA 4EWEA 4YM2A 4TXWA 5JIUA 3WEZA 2KXLA 4OQ9A 2BNMA 2V72A 1M4WA 3PLQA 4XJWA 1GWMA 1RJ7A 1V6NA 4XTPA 4AI1A 4EWAA 1PGW2 4MV2A 2GMMA 3IAQA 3MPBA 5EHDA 1XE7A 4DUVA 5HXMA 4FPCA 4PIYA 5FZEA 4U36A 3ZXKA 2XJQA 2C4XA 2FD8A 3JU9A 5IVEA 1DFQA 2WL1A 2WN2A 4QAWA 1CAWB 2LROA 4XTMA 3O0XA 2GN7A 1OVSA 2IXIA 2K0GA 2VM9A 1MR5A 1W0PA 2VULA 4W50A 1IKQA 3AZWA 1C8M3 1UKGA 4NUBA 1UYXA 1AXKA 1ZA7A 1YIPA 2JDZA 4SLIA 4EJRA 4EN8B 4Z1VA 5HV4A 2JDHA 3DXTA 1IS3A 4U2AA 2B5HA 5FO9B 4BHPA 1SG3A 4XZUG 4OZXA 4WM8B 1ZREA 2DBNA 1ZBE2 2TBVA 1AYN2 3POWA 1OBNA 2C9KA 4NO4A 5FK8A 2R1BA 3AZYA 2WYSA 3N9QA 4HZFA 4UW4A 4L99A 2BRTA 2XVKA 3EHKA 4MH0E 1XU1A 5GLVA 4A6OA 1A8DA 4GH4A 4X6RB 3BU0A 3ZMNA 2RS33 3OUHA 2JB8A 1SACA 5GZGA 4UXAA 4XW3A 3PIGA 5F2SA 1R1A1 1AF9A 5KBFA 2XXZA 5C3SA 2AH2A 2PA7A 4QWNA 1RVF3 5FZ0A 1QOTA 3B9CA 1S2KA 3WY6A 4CCCA 4IEOA 1JYVA 1WLDA 1F5FA 1SBFA 4Q8LA 2EF6A 2EXHA 3VHNA 3AYDA 1PM4A 4XJZA 1XNDA 5ERLA 4C1WA 1ZRIA 3AMMA 1US2A 3ZLIA 2YGMA 1YQCA 1UMZA 2VECA 1ZBE3 5JOYA 1AYN3 4YSFA 3WQ0A 2ADEA
chains in the Genus database with same CATH topology
1W90A 2VXJA 2LROA 3UT0A 1WZXA 2LRPA 4BQ2A 2Q1FA 1W9FA 2C24A 4LK7A 2WYFA 4YWAA 2JWPA 4CP9B 1L7LA 4CP9A 3F95A 2O14A 1HN0A 1V0AA 4LKFA 3ORJA 5D21A 4CPBD 4LJHA 3ZYFA 2K46A 4BQ4A 4AL9A 1GWKA 1W8WA 1OKOA 1W8ZA 1GWMA 3ZYHA 1WCUA 1W8UA 1OH3A 4YW7A 4YW6A 4LK6A 1GWLA 1WMXA 4A6SA 4BQ3A 2KR2A 1UOJA 1W8TA 4LKEA 3ZYBA 4BQ5A 4CPBA 4LKDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W90 A;  2VXJ A;  2LRO A;  3UT0 A;  1WZX A;  2LRP A;  4BQ2 A;  2Q1F A;  1W9F A;  2C24 A;  4LK7 A;  2WYF A;  4YWA A;  2JWP A;  4CP9 B;  1L7L A;  4CP9 A;  3F95 A;  2O14 A;  1HN0 A;  1V0A A;  4LKF A;  3ORJ A;  5D21 A;  4CPB D;  4LJH A;  3ZYF A;  2K46 A;  4BQ4 A;  4AL9 A;  1GWK A;  1W8W A;  1OKO A;  1W8Z A;  1GWM A;  3ZYH A;  1WCU A;  1W8U A;  1OH3 A;  4YW7 A;  4YW6 A;  4LK6 A;  1GWL A;  1WMX A;  4A6S A;  4BQ3 A;  2KR2 A;  1UOJ A;  1W8T A;  4LKE A;  3ZYB A;  4BQ5 A;  4CPB A;  4LKD A; 
#chains in the Genus database with same CATH topology
 1URX A;  2LAL A;  4LO8 A;  4ARY A;  3A0N A;  4BQ2 A;  4MX3 A;  2D6L X;  2D5H A;  1CJP A;  1QU0 A;  2E7T A;  3WDV A;  1RIR A;  4QHZ A;  4LHN A;  2W08 A;  3A22 A;  1ULO A;  4GIQ A;  1GQH A;  1QXJ A;  5FBZ A;  1PIV 2;  3H8R A;  3IMM A;  4MGY E;  5T5J A;  5D21 A;  5E89 A;  4ZON A;  1GKB A;  2W91 A;  5A7N A;  2MHF A;  1W6N B;  1Y4W A;  4Y1X A;  1GV9 A;  1Q8Q A;  2WQZ C;  5E88 A;  4Y20 B;  3K4Z A;  2H6C A;  3AJZ A;  4OUS A;  4EZ4 A;  3NRU A;  4IV3 C;  4EZH A;  4Z92 B;  1AR8 3;  3MV0 1;  1QMJ A;  1OSG A;  3NW4 A;  5E16 A;  2JJ6 A;  2VW1 A;  3SQO A;  1C5I A;  5L9B A;  4KG8 A;  4NVP A;  5DAP A;  4YVW A;  5IAT A;  3BUC A;  2D6N A;  4W6Y A;  4EN0 A;  4ZS3 A;  3MV1 1;  1ASJ 2;  1ULE A;  2ZML A;  3A21 A;  1MS8 A;  1KS5 A;  3TNQ A;  4N9H A;  2KA3 A;  3WT3 A;  3ZIX A;  3UV9 A;  4L2N A;  3ZOI A;  2NP0 A;  2WDB A;  1U12 A;  4K7J A;  2G9Z A;  1HKD A;  5FZB A;  5HXV A;  1RTV A;  2WFF 1;  2W46 A;  2VC9 A;  2XJT A;  4OUL A;  3MO4 A;  5FUI A;  5JZG A;  4CPB D;  2Y6K A;  3E5U A;  2PTM A;  1PIV 3;  1LHW A;  1GOF A;  4QPG A;  5KHK A;  1FX5 A;  1ZZ8 A;  5FP8 A;  2GC3 A;  3C7G A;  1CAU B;  5CAD A;  1U0A A;  1SLT A;  4XXA A;  1WD4 A;  2ZKL A;  2YHJ A;  2WZ8 A;  2XL9 A;  1AR9 2;  1FT9 A;  2YDE A;  3O0V A;  5ANN A;  4AI2 A;  1LOE A;  1BK1 A;  4LXL A;  2R0H A;  1MPX A;  3ZXD A;  1QOS A;  4DXZ A;  3NJX A;  5IHR A;  3MIH A;  4IV3 B;  5EQU A;  1JYI A;  3AXD A;  2RR1 2;  3DYM A;  4JRL A;  4XBN A;  5CFC B;  3OJB A;  4KL1 A;  3H7Y A;  1ASJ 3;  1POV 0;  4HVQ A;  4I0W B;  5A3P A;  1EPZ A;  5F2W A;  4YZ5 A;  1T6B X;  4LT5 A;  1R09 1;  3ZSL A;  1RXG A;  5FCC A;  4BXF A;  5C8C C;  4ZY9 A;  5SV8 A;  3HQU A;  4Z07 A;  2GP3 A;  3OY8 A;  2FDH A;  5LCW L;  2W1W A;  5BXX A;  2FCV A;  4FCA A;  1VMF A;  2QVS B;  1K5M C;  1P8J A;  1YNA A;  4Q4Y 2;  4D6R A;  4KGQ A;  2D7F A;  4XIO A;  3LDK A;  2J1V A;  1UW8 A;  4QB2 A;  5FK7 A;  4IDZ A;  5FXW A;  1HB2 A;  1AR9 3;  1W6Q B;  2VE1 A;  4N8M A;  1AUY A;  1NCR C;  2TNF A;  5ISL A;  2XL7 A;  3NNF A;  4IEZ A;  3TEY A;  2VR4 A;  4HMZ A;  3ACL A;  1RUJ 2;  3HJR A;  1ZYB A;  3MF9 A;  2OX0 A;  4YGE A;  4UT5 A;  2RR1 3;  2DCJ A;  1MZ6 A;  3I2O A;  4Q4X 2;  1J83 A;  5T50 A;  4AL9 A;  1CAV A;  1WCK A;  2TEP A;  4GAL A;  1W8Z A;  5GM0 A;  5J96 B;  4BE3 A;  2VQU A;  5FMB A;  5KHI A;  2ZOE B;  3RGB A;  4N43 C;  5GKA C;  2RDQ A;  3ZSM A;  1CGP A;  5L19 A;  3VBO A;  2ES3 A;  2P3J A;  3ZDV A;  3KS7 A;  1RUN A;  5CKM A;  5T3N A;  3U10 A;  1POV 3;  3A23 A;  4GB3 1;  4LQR A;  4EV0 A;  2B45 X;  5A6X A;  5C8C B;  3C7E A;  5EWS A;  3WF3 A;  3WCR A;  2BOJ A;  1XYP A;  1LOF C;  2CY6 A;  1TZO A;  4Q4Y 3;  2Q4S A;  2QZ3 A;  1E5H A;  4UFJ A;  4PDW C;  4Q0P A;  1Q43 A;  3ZYP A;  1K5M B;  1DF0 A;  5FZO A;  1CAX A;  1VIW B;  1D2Q A;  1NE4 A;  3HT2 A;  5GZD A;  4DOU A;  3OBZ A;  1UX7 A;  2JG9 C;  3HN3 A;  4XIK A;  3UJQ A;  4J1X A;  1RUJ 3;  1O3S A;  2OT7 A;  3FC0 A;  4JGY C;  4H3W A;  4MXW A;  4OYU A;  4HN1 A;  4Q4X 3;  5IW0 A;  3QCW A;  1YFW A;  4COZ A;  1TNF A;  3FJS A;  1OA2 A;  4PQ9 A;  5F5C A;  1CPN A;  3V0A B;  1ZBA 2;  4XFI A;  3NQH A;  1XYN A;  1C3H A;  2YB7 A;  1DQ2 A;  3OYW A;  4GQ7 A;  4N43 B;  3MYX A;  4HON A;  4PLO A;  3OBA A;  5F3C A;  1NE6 A;  3H3U A;  3Q8A A;  5FZC A;  2DU1 A;  3MUY 1;  3GGL A;  2FDJ A;  1AL0 G;  4BQX A;  1PNG A;  3E5X A;  2YBS A;  2CNA A;  1YQ8 A;  1OUR A;  1GLH A;  4WVZ A;  1KGY A;  2RJ2 A;  1FPN 2;  2JD4 A;  1UY3 A;  1Z7S 2;  2JDA A;  1QH7 A;  2K2S A;  3GBG A;  4P9X A;  1H9W A;  1V6I A;  2ERF A;  3KHC A;  3R4D B;  1E5R A;  5H9R A;  3WNO A;  1YFU A;  1QGL A;  4IND A;  1BBT 2;  3K4A A;  2GNT A;  2E32 A;  2JG9 B;  1AX0 A;  4CVU A;  1FNZ A;  5SV5 A;  1MS9 A;  3R4S A;  5A3T A;  1TE1 B;  1VBB 2;  2QQP A;  1X50 A;  2RMU 3;  2ZGL A;  3J7M A;  4JGY B;  1XNK A;  3T2O A;  1GOH A;  2VOK A;  3B93 A;  1NLQ A;  1VBC 2;  2UU8 A;  1ZBA 3;  2WT0 A;  3H1Y A;  4XFF A;  5DXD A;  1VAM A;  5JPN B;  3SH4 A;  2FZ2 A;  3M7A A;  2QFE A;  1SDW A;  2O0O A;  5FPA A;  4OQ8 A;  2G9F A;  2PHL A;  1EAH 1;  4O7X A;  5L7O A;  3VHR A;  1EV1 1;  1PK6 C;  2V4V A;  3MPP G;  2W9X A;  2JX9 A;  2P1B A;  4DFS A;  3WF4 A;  4ISR A;  5ABJ C;  4V2V A;  4PJY A;  3J8F 2;  5FPZ A;  4B1M A;  4CTE A;  5G04 L;  1N47 A;  3WQB A;  4R9B A;  2FCU A;  3R05 A;  1JU4 A;  4LBN A;  3W9A A;  2BQP A;  4A7Z A;  2W3J A;  3JUU A;  3RZK A;  3WP5 A;  4BMB A;  4Y24 A;  2JEC A;  1PO1 1;  2OUH A;  4FXG B;  1LU2 A;  4XMI A;  3AC0 A;  1BBT 3;  4A42 A;  2VMG A;  4HBN A;  5A33 B;  3SXW A;  4YW4 A;  3VBH A;  1I5P A;  5IYY A;  4Y5S A;  4MHR A;  1RED A;  4P5H A;  2ZGS A;  4YZ2 A;  2RDN A;  1VBC 3;  1NX9 A;  2W95 A;  3H1M A;  2PHD A;  1XQN A;  1VMH A;  2XJS A;  1SLA A;  4MXW B;  1DGR N;  4K1Z A;  2G1M A;  3GBW A;  3D5O A;  1PZ9 A;  1WW7 A;  1A3K A;  3KGL A;  2A6Z A;  3NJY A;  3KV6 A;  5T52 A;  4M3C B;  3J4U H;  4B29 A;  5KC6 A;  3LOB A;  1PK6 B;  2EAK A;  3TWI A;  2X29 A;  3LA7 A;  2Y0O A;  2XUM A;  3G7D A;  1Y9G A;  4AI9 A;  3J8F 3;  5GLU A;  3VL8 A;  3EB7 A;  5ABJ B;  4FI9 A;  1D0G A;  2UY8 A;  1QJE A;  1XC6 A;  1QXR A;  1K3I A;  3M3Q A;  1IS4 A;  1HB1 A;  1UZY A;  1VP6 A;  1DGW A;  1H2L A;  1VRB A;  2ZGM A;  4DXR A;  3OGR A;  2ARX A;  3WNN A;  3LCP A;  4QX3 A;  1NQD A;  1GYK A;  1R08 3;  2WO2 A;  2ZTN A;  4Y1V A;  1XNA A;  2FCT A;  3OGS A;  2FBE A;  3U78 A;  2P4E A;  4Y4Y A;  3KQ4 B;  5FBJ A;  2YFZ A;  4B7E A;  4AGV A;  4FPH A;  4KU8 A;  4BWO A;  2ZHN A;  2QNK A;  4RR3 C;  5IFT A;  4R8H A;  4ZU5 A;  2ZX0 A;  4AFA A;  5LW9 A;  3T4V A;  4XCA A;  1S0D A;  4NID A;  2VXR A;  4W65 A;  4JC1 A;  1QJF A;  5CFD A;  2ZAC A;  3SKJ E;  3HR9 A;  2JKX A;  2RS3 1;  3WCS A;  4PIZ A;  3WXP A;  1HXS 2;  3TB0 A;  1V9U 2;  3F95 A;  4MLO A;  1JHJ A;  1RUF 2;  3AL6 A;  3CJI C;  2YG0 A;  3ORJ A;  3R4U A;  4HT1 T;  4F7Z A;  2HWC 2;  5L7O B;  5LK7 B;  5F3G A;  2A3Y A;  1RVF 1;  2D98 A;  1YEW A;  2WJS A;  4HAN A;  3S6P A;  4BQY A;  3U37 A;  3X29 B;  4QQP A;  2W0X A;  4JVA A;  1UD1 A;  5J36 A;  1WCU A;  4J25 A;  2BER A;  5AFE A;  3I97 A;  4RHV 2;  4LK6 A;  5LBE A;  1FYU A;  3TEW A;  5IVV A;  1UN1 A;  1KDK A;  4FPL A;  3RYP A;  2VQA A;  4CPB A;  4LKD A;  2DCY A;  2VME A;  2ZAA A;  1ZBE 1;  3BOD A;  1AYN 1;  2DVG A;  4HN0 A;  3N9L A;  3TAY A;  2DUP A;  3UES A;  4CU9 A;  1Q8V A;  3WIN E;  4QPW A;  4BZ4 A;  2LM3 A;  1XNT A;  3VDA A;  1JI6 A;  2UY9 A;  3ZYI B;  4Y1Y A;  1MEC 3;  4RR3 B;  2X5I A;  3VKL A;  4BM8 A;  3HPN A;  3AP7 A;  3OF1 A;  4YFZ A;  5FQ0 B;  2Q8C A;  4I3G A;  1HXS 3;  2A3W A;  1V9U 3;  2VCC A;  1D4V B;  5L36 A;  2OXB A;  1RUF 3;  4AHX A;  2YU1 A;  2DVF A;  2HWC 3;  2QQO A;  1HJG A;  4E9K A;  1DQ0 A;  1W2O A;  3AB0 A;  1ODM A;  4X8P A;  1B35 A;  3CJI B;  4QB6 A;  4JX0 A;  3TBD A;  1NA1 A;  2W87 A;  4RGK A;  3VBF A;  4LBL A;  2GH2 A;  3KZ4 C;  3ZN6 A;  1RUH 2;  5EJ1 B;  4AFM A;  3T2T A;  1AR8 1;  1OA3 A;  4B4Q A;  4CCJ A;  2WZR 2;  4RHV 3;  5EYY A;  2WN3 A;  3UET A;  3VL9 A;  1QWR A;  2XBO 2;  1CWP A;  3ZFG C;  5IUQ A;  3RZZ A;  3KF3 A;  1QQP 3;  4MSV A;  4OLL A;  2IC1 A;  5JR7 B;  1ND2 A;  3RRD A;  3VBR C;  3LOI A;  4IES A;  3PUQ A;  4NII A;  3GZE A;  1BYH A;  3NV1 A;  2NN8 A;  3K3O A;  3NNM A;  4ISQ A;  1V0A A;  5EV7 A;  2JG8 C;  4N53 B;  3SHR A;  4FTB A;  4D7Y A;  1IQA A;  1VB4 A;  1ZZB A;  2HWD 2;  2G9G A;  3CKH A;  4GD4 A;  1W6O B;  3LWC A;  1LEC A;  3USU A;  2BW8 A;  1NY7 1;  4QXH A;  5T5P A;  5B4N A;  4XJ8 A;  1UY4 A;  1PM7 A;  4E2S A;  1PIV 1;  2BGP A;  1GWL A;  3GZT B;  3ZVX A;  3SLI A;  2FMY A;  4Q27 A;  1SBE A;  5J37 A;  2OVU A;  4LPL A;  1J58 A;  3JCI A;  5TSW A;  4I2O A;  3LEM A;  1C4R A;  4W6W A;  3GNE A;  4IE0 A;  2G4I A;  4CEY A;  1OF4 A;  4QB1 A;  2WZR 3;  3OEA A;  3POY A;  3IPV A;  1N1V A;  2I07 B;  2XBO 3;  3ZYR A;  3GJB A;  5GLZ A;  4DEV A;  4WVM B;  4F83 A;  1Z0H A;  4Q0S A;  3S7I A;  3AYA A;  3ZFG B;  3ECQ A;  1HV1 A;  4IEW A;  3VBU C;  1BVP 1;  4AQ6 A;  4XQW A;  2XVL A;  3PU8 A;  1OH4 A;  3U14 A;  5J09 A;  3VD4 A;  2HWD 3;  4UYB A;  2JG8 B;  4A4A A;  1S0F A;  4YLZ A;  3C7H A;  5CBL A;  1JYT A;  2PHF A;  4QX0 A;  2RS5 2;  3POE A;  1FI2 A;  2VZ3 A;  5FZH A;  4XIL A;  3DPR C;  5H9Q A;  3NJZ A;  5IFP A;  1PZ7 A;  4H2A A;  4CDW A;  2RVA A;  3CBN A;  4RA0 A;  2VZU A;  5KHH A;  1AR9 1;  4QX1 A;  1CVN A;  2A1X A;  4RQP B;  4YW3 A;  1QJX 2;  4QKF A;  1W9S A;  1GQG A;  2ATF A;  2YU2 A;  2V5D A;  1KQR A;  5DZE A;  2JE9 A;  3WV6 A;  1IG3 A;  4AQS A;  3VBU A;  1B35 B;  2RR1 1;  4IGP A;  2WT2 A;  3D0S A;  1CQ9 A;  5L9V A;  4K40 A;  3SEE A;  1JXN A;  1UOJ A;  1OF3 A;  3SC7 X;  4XBL A;  3SCG A;  4IET A;  1COV 2;  3I59 B;  4MHU A;  3LQC A;  3VZK A;  4AI0 A;  4CXY A;  2ZPX A;  3I3D A;  3LGR A;  1VRH 2;  4BIO A;  3FLR A;  4HPK B;  3VHO A;  4Q4V 2;  2ZBJ A;  3EBR A;  3WSO A;  1ZX5 A;  2R04 2;  1POV 1;  2WQ4 A;  1G9B A;  2GU9 A;  1UZV A;  5F37 A;  1REE A;  2PHR A;  4LIT A;  4CP1 A;  3SKV A;  3J7H A;  4HOO A;  4Q4Y 1;  1XNC A;  3LDB A;  3N9O A;  1PO2 3;  4XAB A;  3VDB A;  4P9G A;  3KGZ A;  2SBA A;  3DPR B;  1B09 A;  3LIH A;  3ZXL A;  4CEW C;  1VBE 2;  1DLL A;  1GNY A;  5IK5 A;  1FXZ A;  2CTV A;  3KCY A;  1QJX 3;  4R9D A;  2DCZ A;  4AED C;  1QY4 A;  1G7Y A;  4JV4 A;  2BGC A;  2OW4 A;  4WBB A;  1LUL A;  2VZV A;  1LGN A;  1U5X A;  3MIC A;  4FPK A;  1RUJ 1;  1MQT C;  3T1M A;  4EYU A;  4CDU A;  5C3R A;  1AZD A;  1MVE A;  1UU6 A;  1CN1 A;  1LES A;  4XFB A;  2W2I A;  4NN0 A;  5D2A A;  1TEI A;  4QQ2 A;  2XDV A;  1AL2 3;  1COV 3;  2WWS A;  4Q1R A;  4E4D X;  1VRH 3;  3J9S A;  3V0B A;  1IPJ A;  2OUJ A;  5A1F A;  1CZT A;  3IKW A;  1LOB A;  4ZHN A;  2R04 3;  1VBA 2;  4A3X A;  4MAD A;  3GM8 A;  3QAC A;  4FP3 A;  3SH5 A;  1IGO A;  1AR6 3;  1GNZ A;  3AP4 A;  4CDX B;  4G3Y C;  2R30 A;  1IPK A;  4J1W A;  4KU7 A;  1D4M 2;  3T0B A;  2BZD A;  2GAL A;  2B42 B;  3EO6 A;  3HBZ A;  1HX6 A;  4EWD A;  4Q1P A;  4CEW B;  1W90 A;  3VDD A;  3M4F A;  3ILN A;  2HEV F;  1RUO A;  1VR3 A;  4AFD A;  2WR9 A;  2ZKN A;  4ZXE A;  4AED B;  1ND3 C;  2OQ7 A;  4FFF A;  4FOW A;  4LR4 A;  4QQO A;  4RFR B;  3ZX7 A;  5C8W A;  2J1S A;  3HQX A;  1H8T C;  1MQT B;  2RMU 1;  3Q8F A;  5I0D A;  2XB6 C;  2OZ6 A;  3DL3 A;  3HN1 A;  4LKF A;  4JGZ A;  3MLK A;  1ZBA 1;  3S30 A;  3BTY A;  2OZJ A;  2RG4 A;  3Q8E A;  5C3Q A;  3E6B A;  4QXK A;  2JEM A;  3RFR A;  2PYT A;  1VBA 3;  4XFG A;  4YW7 A;  3RWK X;  4KH9 A;  3VD7 A;  4Q4W 2;  1K45 A;  1AX2 A;  2YUE A;  3C2U A;  4YM1 A;  1IG0 A;  3KV4 A;  2LW8 A;  1C1L A;  1VLN A;  2JDU A;  2WS9 2;  3W20 A;  2P3Y A;  2WNU C;  3BGA A;  3AMP A;  1D4M 3;  1NCQ A;  3PJY A;  4NIA A;  2SLI A;  5A6Z A;  5A3N A;  1S0I A;  1ENQ A;  1KXG A;  2CWS A;  2V5Y A;  3HWJ A;  3POF A;  2FDG A;  3RDI A;  1JMU B;  1BBT 1;  5A1L A;  1X9P A;  1F2N A;  2J1E A;  5DUW A;  3ZYF A;  3ZXJ A;  1PX3 A;  1FV3 A;  1CON A;  1X9T A;  4FQZ A;  1ND3 B;  2QE3 A;  1OUS A;  4BXS V;  1GUI A;  4E4S A;  2WAO A;  4H7M A;  4IV1 B;  1H8T B;  2AR6 A;  1PVC 1;  1YUD A;  2ZX2 A;  4AYU A;  3EXU A;  1CR7 A;  2ZAB A;  4JQT A;  4QPI C;  2ZGO A;  1CX4 A;  1G9A A;  4E4H A;  2CDO A;  1HV0 A;  1RUG 3;  4LLF A;  4QU2 A;  5C6C A;  2XHN A;  5J48 A;  4JHZ A;  5K7P A;  3HNY M;  5FLH A;  5FZ9 A;  1GNH A;  2H0V A;  2YC0 A;  3O7O A;  1OHF A;  3TEZ A;  2CAV A;  4RYD A;  2Y0I A;  4UFK A;  3I7D A;  2CU5 A;  3J8F 1;  5A6Y A;  1HQN A;  3WG1 A;  4BIS A;  3AL5 A;  1LKN A;  1UY0 A;  2A75 A;  4QGM A;  1AJK A;  4YGB A;  3WR0 A;  4AVT A;  2WNU B;  5DDJ 2;  5FZ6 A;  3MLL A;  4CDQ C;  2VW2 A;  1F5J A;  2A6X A;  1NLR A;  3QOP A;  3OGJ A;  1TME 2;  2ZX4 A;  4AVS A;  4FXK B;  3K51 A;  1R08 1;  3UNP A;  4M3C F;  2BEO A;  1GQP A;  2JDK A;  4UF0 B;  1K12 A;  3NMB A;  1E5S A;  4QM9 A;  4DMI A;  2W92 A;  1HRV 2;  2Z4F A;  5FY0 A;  3PIJ A;  1RUI 2;  5DAV A;  5FZI A;  3ZFE C;  2BBV A;  3AK0 A;  1O91 A;  1NOV A;  2FQP A;  4DRR A;  1LNS A;  1PHM A;  1S0B A;  1M06 G;  2GC0 A;  2VZQ A;  4R9A A;  1UIK A;  4NRP A;  1DYK A;  3WD5 A;  1F9K A;  4LK7 A;  4CP0 A;  5BNN A;  1UY2 A;  2J1R A;  4QPI B;  2FDF A;  5DAW A;  1QXP A;  5A7W B;  1X36 A;  4E2Q A;  4FAH A;  1BLZ A;  1HRI 2;  4PIX A;  2DDU A;  3BVC A;  1KS4 A;  2WZE A;  2QZ2 A;  5DDJ 3;  4LBQ D;  2QDN A;  4ONU A;  2BV4 A;  3ASI A;  4AI3 A;  3NJV A;  1OT5 A;  1O6U A;  5K9Y A;  4K21 A;  1TME 3;  1BCX A;  4NHX A;  3W59 A;  2MEV 2;  4NPL A;  4OHV A;  2GC1 A;  4CDQ B;  2WWU A;  3RZH A;  4CUA A;  4OMC A;  4LO4 B;  4MG2 A;  1OLR A;  3WW3 A;  4N7U A;  4URA A;  1HRV 3;  1DQ4 A;  2K9Z A;  1RUI 3;  2D6K A;  2ZGU A;  3PUR A;  5I0U A;  2WKK A;  3M8L A;  4HG6 B;  1L7L A;  3U4S A;  2XML A;  4AXO A;  1Q8S A;  1RIT A;  3DYO A;  3UGF A;  3ZFE B;  2JIG A;  1ZZC A;  3INA A;  4XUR A;  3WX5 A;  1MEC 1;  2BNO A;  4WVW A;  2GP5 A;  4GUL A;  2HEY F;  1HRI 3;  1W6P A;  1V9U 1;  2W1S A;  1YI7 A;  2R0F A;  3B3Q E;  5KXB A;  1PGL 2;  1RGS A;  3N7M A;  4IQP A;  4K6B A;  5FMO L;  4WM7 A;  4UFL A;  4LMF A;  2HWC 1;  2Z42 A;  3N35 A;  4JKK A;  5FLI A;  1DHK B;  2Y6J A;  1IS5 A;  4NHM A;  1QNY A;  1UZW A;  3POB A;  3O0W A;  2CGO A;  2MEV 3;  5G05 L;  5A7P A;  4K20 A;  4XFH A;  1PZ8 A;  2C24 A;  3MGU A;  2NQY A;  2B7Y A;  5I91 A;  2VY0 A;  1W39 A;  1XB9 A;  3ZDS A;  1Y3T A;  2DTY A;  4GKY A;  4BH9 A;  5F8P A;  4BDV B;  4B3N A;  1QQP 1;  3M70 A;  1HQW A;  1W2N A;  3D0J A;  4NMI A;  4AI8 A;  1GMM A;  3AFG A;  3FUO A;  4GH4 C;  4BB3 A;  4AGR A;  3IAP A;  4YAR A;  1H4H A;  3GHN A;  4MGQ A;  3POG A;  1WBF A;  2NMO A;  3MID A;  1RHI 2;  1AYM 2;  2ZMN A;  4QKB A;  2JDY A;  2XJV A;  5FZA A;  4O9G A;  5C33 A;  5F7U A;  3O1V A;  3LEI A;  1MS4 A;  2ZX3 A;  1CZS A;  4LUL A;  5CFC C;  5HI0 A;  1L3J A;  2F4L A;  4TWT A;  5IVJ A;  2LTN A;  1UOB A;  2OS2 A;  3FLP A;  5BNP A;  4PI2 A;  1H1M A;  4IUG A;  2I45 A;  2WZR 1;  5FKB A;  1ZZ9 A;  5B2G B;  3T2Q A;  5A80 A;  5FYY A;  2O8Q A;  2VNR A;  2XBO 1;  2VOV A;  2A7A A;  2ET7 A;  1RUD 2;  1LAJ A;  1WBL A;  3KT1 A;  3ZFF A;  4DEQ A;  2ZGN A;  2VGD A;  2HBT A;  4I01 A;  4R52 A;  3D82 A;  1RHI 3;  3CDZ B;  1AYM 3;  1N1S A;  1O4Y A;  2HWD 1;  2VMI A;  4GH4 B;  3RMY A;  4BQ5 A;  2XLF A;  2QQV A;  4AEK A;  2DUR A;  5E6H A;  1JN2 P;  5FYM A;  4TN7 A;  3AMH A;  3RYR A;  2WNV A;  2GDF A;  5DAB A;  3KV9 A;  1BHG A;  2BUK A;  5CZK A;  2R07 2;  1X7N A;  3PMS A;  3OG2 A;  2HBU A;  3O12 A;  1ZVF A;  4YVW C;  1RIN A;  3B00 A;  3LPF A;  1NCR A;  3T2P A;  3TNP B;  1RXF A;  5KHG A;  2VUD A;  3HVD A;  3N9M A;  4LOT A;  2F17 A;  3KSC A;  1LOA A;  2GME A;  1W2U A;  1QOO A;  2WQ8 A;  2Y38 A;  5IT6 A;  2PEL A;  4AWD A;  3I54 A;  1F35 A;  2QTW B;  3ON7 A;  1GFF 2;  4YG6 A;  1H30 A;  2ZEW A;  5C5T A;  5JZG C;  3CMG A;  2P3K A;  5BUV A;  2WO1 A;  1PX4 A;  3UT0 A;  1IKP A;  4WVV A;  3RI9 A;  1PMI A;  2VQ0 A;  4AAP A;  3WLU A;  2W39 A;  2QQN A;  4YWA A;  3VHP A;  4MGT A;  4QPG C;  2D5F A;  5HCF A;  2H6B A;  2IXH A;  1DGW X;  2VMD A;  1UL9 A;  2OPW A;  2BWC A;  5DN2 A;  4EN6 B;  3B02 A;  5ACA 2;  2NMN A;  4RD7 A;  2VCA A;  4AW7 A;  2ORX A;  1PO2 1;  3NKG A;  4O9E A;  2R07 3;  3K2O A;  2XQR A;  1ZZ6 A;  4QGL A;  4OHZ A;  1TMF 2;  2O1Q A;  3V65 A;  3KM5 A;  5J98 B;  1QJY 2;  2B46 X;  2E26 A;  4AOC A;  3KQR A;  3OBR A;  1QJX 1;  4XBQ A;  1JUH A;  5LEJ A;  4FOQ A;  1S1A A;  2ZEY A;  4YVW B;  4COU A;  5FOB B;  1OC1 A;  4DQA A;  1PMH X;  2CDP A;  4GKX A;  2QDR A;  4QX8 A;  5IK7 A;  1F4H A;  2E31 A;  1G8W A;  1ONA A;  2DVA A;  3PVE A;  2WZP P;  3DN7 A;  1AVB A;  4LHS A;  5FP4 A;  1AL2 1;  1COV 1;  5JZG B;  3JD7 2;  4UFM A;  1YC6 1;  1VRH 1;  4ET7 A;  4YGD A;  3AP9 A;  4ZPI A;  3FE5 A;  3DCQ A;  5FYB A;  4ZKT B;  5C9A A;  5LA1 A;  3H42 B;  2FHR A;  3R6S A;  2R04 1;  1KDM A;  5LK5 A;  3VZO A;  4QPG B;  4XUO A;  4COW A;  4UWD A;  5ACA 3;  3MFC A;  1AR6 1;  2VMC A;  4XVH A;  4CCE A;  3IDE A;  4QXC A;  3AFK A;  3ZPY A;  2BJS A;  4I02 A;  4YVS A;  2A73 B;  1EP0 A;  2VZR A;  4UAP A;  5CYY A;  1H1A A;  2DTW A;  2ID4 A;  3HMY A;  5L9R A;  4CU8 A;  1L7Q A;  5CKN A;  3AMN A;  5LZ6 A;  1U5Y A;  2PFW A;  1QJU 1;  1DQ6 A;  1RMU 2;  3P3N A;  4KWJ A;  4DB5 A;  1UZ0 A;  4DZG A;  5A1A A;  1R64 A;  4NRM A;  3O1M A;  1SLL A;  3BTZ A;  5AVA A;  4A2U A;  3KT7 A;  5GZF A;  4OMD A;  4D3W A;  3O1S A;  1IHM A;  1WMF A;  3OUJ A;  5C4W A;  4IER A;  3WNL A;  2PQS A;  3LPG A;  3BAL A;  4UFH A;  2I2S A;  3VBO C;  1DYO A;  2HWF 2;  3RZM A;  3MIF A;  4DIN B;  4YZ1 A;  1C5H A;  4RS5 A;  3PVB B;  5F6K A;  3MW2 A;  2HJI A;  3S5Q A;  3JD7 3;  3S5A A;  4NIH A;  3P1I A;  2BBA A;  3I8T A;  5FUP A;  3B9I A;  2XLG A;  3OY8 B;  1BEV 2;  1J1T A;  1QF3 A;  2KR2 A;  1H6Y A;  3LF7 A;  2R7E B;  1XBF A;  4FVV A;  1VBA 1;  1UQX A;  2WWJ A;  3VZM A;  2BFU L;  3ZSJ A;  4FT8 A;  1L7R A;  1LHO A;  1U5I A;  4ARX A;  4F8A A;  4KGG A;  1IQD C;  3U11 A;  2LRP A;  2W5F A;  3ZN4 A;  5FIX A;  5FYV A;  1D4M 1;  1TG7 A;  4BPZ A;  3VD5 A;  1SFP A;  1AXY A;  2YGL A;  1H1I A;  1XXN A;  4LLO A;  5I93 A;  3M3I A;  3WG3 A;  1UU4 A;  2NZ9 A;  2ZA9 A;  3OBT A;  1XSR A;  4OI2 A;  5H9P A;  2ILM A;  4CCO A;  4Z8B A;  4M4P A;  5CNA A;  5DUV A;  3FHI B;  5A70 A;  2EID A;  1CAV B;  5BV6 A;  3RVH A;  1VBD 2;  4A45 A;  1KIT A;  1NXD 1;  1ZNP A;  4BME A;  3AM2 A;  2X10 A;  1US3 A;  3WF2 A;  4D94 A;  4UI9 L;  3W58 A;  4Z2A A;  3RZL A;  3POI A;  4QDS A;  5JSR A;  1FPN 3;  2CHH A;  1OQ1 A;  1Z7S 3;  4LKE A;  1J59 A;  3IT8 A;  5HBA A;  3VBO B;  4ZZ8 A;  1YFX A;  1JW6 A;  2E6V A;  4JDM A;  2D3R A;  3AKP A;  4XAC A;  4M0N A;  1O5L A;  4XQ4 A;  5FY9 A;  3E5Q A;  4LBJ A;  5JSP A;  1BEV 3;  3NKT A;  5FZ3 A;  2ZX1 A;  4ERO A;  1RUG 1;  4LBQ A;  1BMV 2;  3ACG A;  1GSL A;  1WMD A;  1JS9 A;  1WWY A;  2RJL A;  2VBB A;  2WSV A;  4C8D A;  2Q5T A;  5A3W A;  2XLA A;  5FO8 B;  2P34 A;  5FZO B;  1VBB 3;  1CAX B;  4XUQ A;  1WW6 A;  3M3E A;  1RUC 2;  3MW4 A;  3N7J A;  2ZEX A;  1MZE A;  4HXC A;  1NUK A;  3SH3 A;  2VUC A;  1UOF A;  4I09 A;  4HKL A;  3P5B A;  2YPD A;  3THC A;  4A7Y A;  1YXW A;  3OD0 A;  3QD6 A;  5FZF A;  1VBD 3;  1FOD 2;  2A6V A;  4A44 A;  4KWL A;  4LOR A;  4PLM A;  4FTE A;  3J7N A;  4CCM A;  4IE6 A;  1BZW A;  4YZ3 A;  3OYW B;  5DQ0 A;  3FHA A;  4NHY A;  5L7O C;  5LWB A;  4JDN A;  3WUC A;  3H8U A;  4P9J A;  1LGB A;  2W1Q A;  4CP9 A;  2VZP A;  5KXD A;  1XSQ A;  3FBY A;  2WAB A;  3L9J T;  1C8M 1;  5FZ8 A;  4AFC A;  5BY5 A;  4FOV A;  1ALY A;  2NLR A;  3BU7 A;  5EPA A;  3CZU A;  3NNL A;  3Q9O A;  4ASK A;  2WC2 A;  3OTF A;  1JBC A;  4B4P A;  1RUC 3;  2EA7 A;  2JIC A;  1C57 A;  1X82 A;  5IWF A;  3AKT A;  2OYZ A;  2W94 A;  2Y33 A;  2UUR A;  5DDJ 1;  3BIW E;  5JXI A;  4Y33 A;  1S0J A;  5K4L A;  3VBH C;  4IL7 A;  3WDU A;  1YQ6 A;  3Q8B A;  3PHM A;  4K1Y A;  5I0T A;  5LY1 A;  5T54 A;  2MPF A;  1BKZ A;  1W8N A;  2JB4 A;  5FMO S;  2ZS6 B;  2Q1F A;  1W9F A;  5LBB A;  1UIJ A;  1FOD 3;  4MO3 M;  3WNK A;  4R4X A;  5FP3 A;  1PGW 1;  3GBF A;  1VAL A;  4I3P A;  1W8H A;  2BTV C;  2IZW A;  3SCH A;  1HRV 1;  1I9R A;  1WCD J;  3LDR A;  1W6M A;  4COY A;  4FBF A;  4IEV A;  3JBG 2;  4YPJ A;  3AVR A;  3III A;  5E8A A;  4C0B A;  2JEN A;  4OHX A;  4QHO A;  4UW5 A;  1H2K A;  1S2E A;  4ES8 A;  3I2H A;  5CG8 A;  3THT A;  2XJR A;  2QQL A;  4S2D A;  4FAG A;  1S0G A;  2PAM A;  5DG1 A;  4TZD A;  3MEP A;  5D8A A;  3WDY A;  1HRI 1;  4Z2W A;  1H2M A;  1WW4 A;  3VBS A;  2DBI A;  4N53 C;  2V73 A;  2C26 A;  3MBW A;  2RDS A;  2XR4 A;  5FMD A;  2VZ1 A;  3LSD A;  5FJH A;  3THD A;  2Z2S B;  3VBH B;  2MEV 1;  4DIQ A;  4YZ4 A;  4AE2 A;  3RZG A;  2FDK A;  5FAX A;  2UYA A;  3M1H A;  5JOZ A;  4XJA A;  2IXL A;  4URT A;  3WW1 A;  2R16 A;  2ZGK A;  3GCW A;  1UO9 A;  4S2G A;  4KMQ A;  5JMC A;  3VBR A;  1O3T A;  2WA3 A;  1H0B A;  3B69 A;  1N3P A;  1ULD A;  3N9N A;  3FBM A;  3LE0 A;  3JBG 3;  4KWK A;  4CP2 A;  1GBG A;  1D2S A;  3TN9 2;  4DS0 A;  4LIV A;  4OUM A;  5EZW A;  2DYC A;  4PT6 A;  3O1U A;  1ENX A;  1VAK A;  4IEP A;  1VJ2 A;  3WQ1 A;  1LRH A;  5EFU A;  4AHY A;  1G6N A;  1UYZ A;  5I0S A;  2CYF A;  3ITQ A;  1PGL 1;  1QHD A;  2HLE A;  4DO0 A;  2GMP A;  3D8C A;  3LIG A;  4OZO A;  5IJR A;  5T55 A;  1LOD A;  4QT6 A;  4BCU A;  1AJO A;  2E7A A;  2A70 A;  3CQO A;  1G9C A;  2PAE A;  2EVX A;  1H9P A;  4S2F A;  5KXC A;  5FLJ A;  5A32 A;  3A4U A;  3WHT A;  3VDC A;  4ZXK A;  2X8K A;  1IZ3 A;  3MUZ 1;  3ZXA C;  1KRI A;  3LEK A;  1OA4 A;  2EXI A;  2D93 A;  2RM2 2;  4LE4 A;  1GZW A;  2GND A;  2JDM A;  5JMO A;  3WZ1 A;  1EY2 A;  2WFF 2;  3CL1 A;  1WCS A;  4PI0 A;  4Y4R A;  3E6C C;  5FZK A;  2X5I C;  5JI9 A;  1FMD 2;  4OFG A;  2P37 A;  3TN9 3;  4RQP C;  1RHI 1;  5LRR A;  3LD8 A;  3WDX A;  5CFD B;  4XCB A;  1XPW A;  3GAL A;  4IGQ A;  3D4K A;  4DUW A;  1RUH 3;  4AVV A;  4FPG A;  1OI6 A;  1KJR A;  5F3E A;  5EXO A;  2J42 A;  1B35 C;  3VBF C;  4XEZ A;  1NA1 C;  5FYH A;  2CWM A;  4H14 A;  1W04 A;  1ST8 A;  3NAP A;  5JAX A;  3G6J B;  3QLQ A;  4LOS A;  3Q8C A;  3T09 A;  4AQ2 A;  5LRS A;  1ASJ 1;  1GAN A;  4AHZ A;  4XAA A;  5FYI A;  4W8J A;  4KBB A;  5F5I A;  4GWI A;  4LTA A;  1KD7 A;  1ND2 C;  1OOP A;  5AC9 2;  3T3Y A;  2XHK A;  4XUP A;  5HCA A;  2FDI A;  1QJZ A;  1OD5 A;  1W05 A;  4XJ9 A;  1UWW A;  3ZYG A;  1Q8P A;  1TVG A;  4AG4 A;  1NQJ A;  1R09 2;  2RM2 3;  4FOY A;  2AYH A;  3VLB B;  4QHB A;  4IGO A;  2H0B A;  1PVX A;  1WME A;  1IPS A;  1FMD 3;  3K3N A;  1CZV A;  3LKJ A;  4GAZ A;  4O65 A;  5K0U A;  1HN0 A;  2DVD A;  3ATG A;  1D0H A;  2X5I B;  4P00 B;  5KC5 A;  4QPY A;  2YFU A;  4CCD A;  3SEP A;  4PF5 A;  4P5Y A;  2VCB A;  3MIE A;  2DV9 A;  5GJ6 A;  2C9A A;  2B9U A;  1KFU L;  5FZL A;  4ZS2 A;  3VBF B;  3I2K A;  1NA1 B;  2R07 1;  4CEY C;  3R0R A;  2HEW F;  4MGZ E;  1J1L A;  1O8P A;  1YFY A;  2AAC A;  1DZR A;  2AUY A;  1DQ1 A;  3ZN6 B;  3OSD A;  3IM0 A;  1GIC A;  3DKQ A;  1EUU A;  5JOW A;  5LBC A;  2Y8K A;  5AC9 3;  4NWV A;  4HKO A;  4B8E A;  2EXK A;  1ND2 B;  2EAL A;  4Q0V A;  1SBD A;  2RS5 3;  3SMH A;  3KB5 A;  1ZA4 A;  4I0A A;  5JVV A;  2ARA A;  4CDX C;  2VAU A;  5A3U A;  5IVY A;  2GH8 A;  4TSV A;  4CE8 A;  2VOW A;  3OEB A;  3P3P A;  2OA2 A;  1YRZ A;  3I2I A;  2UWB A;  3FWE A;  3IIA A;  4LA3 A;  4Q2F A;  3UGG A;  1HLC A;  4A3Z A;  5CA6 A;  1GP4 A;  3USU B;  2VUJ A;  2Y34 A;  4CDW C;  5BNO A;  4FFI A;  1H6X A;  2PHT A;  5ACA 1;  4JKL A;  4UOJ A;  3ZKU A;  2W1U A;  4KG0 A;  4Y1U A;  3FZ3 A;  5F32 A;  5FOJ B;  2DU0 A;  2HH9 A;  4Q4X 1;  5F5A A;  5LA9 A;  2XQX A;  1O3R A;  4NIG A;  2J7M A;  4GWJ A;  1AXZ A;  2RHP A;  4CEY B;  2BPA 2;  4TLG A;  3I4I A;  4L0P A;  1O4T A;  2BFU S;  3IPV B;  5FP9 A;  2Y6H A;  1BK0 A;  1HJF A;  3ETP A;  1SPP A;  2O14 A;  2D97 A;  4Y22 A;  5J7M A;  2VTF A;  3PUI A;  5FPX A;  4Q4V 3;  4XZP A;  3GZA A;  1O8S A;  1RL3 A;  2WUH A;  5AVP A;  4J6G A;  1GP5 A;  3BYW A;  3O1O A;  3FX3 A;  2EIG A;  2VVD A;  5APA A;  5FY1 A;  1OLM A;  2VCM A;  3AX4 A;  4ES9 A;  3UKN A;  1NYW A;  1HN1 A;  2Q8O A;  4G9S B;  3K75 B;  1NZC A;  4NPR A;  2VH9 A;  3WDT A;  3GCX A;  3U0Z A;  3ILR A;  1VBE 3;  5DG2 A;  5JPM B;  5JLV A;  3KVA A;  2ARB A;  1ENR A;  3A7Q A;  4QKD A;  5FYC A;  2EIB A;  1MZF A;  3ES1 A;  4OVE A;  4MVT A;  3URF A;  1W28 A;  4LE3 A;  4C0H A;  4CDW B;  4UW3 A;  3GYD A;  4M0H A;  2UYB A;  3ZXG A;  3LA2 A;  3RSJ A;  4IV1 C;  4OUE A;  4NAM A;  2WII B;  4OHY A;  2XH6 A;  1HDK A;  3OPW A;  1AR7 2;  3N9P A;  4FQ4 A;  4CDU C;  3WP3 A;  4BK4 A;  3ALQ A;  1JU3 A;  2OII A;  3VBU B;  4KWU A;  4XE9 A;  1XU2 A;  5FPB A;  4E8D A;  4FPJ A;  4AFB A;  3TYJ A;  3WDW A;  2I74 A;  3CHX A;  4R9C A;  3GXU A;  2D40 A;  1FPN 1;  1Z7S 1;  1EAH 2;  1CAW A;  3KWV A;  4LO6 B;  1EV1 2;  3DYP A;  3RMX A;  2OQ6 A;  3FLT A;  5B4X A;  1I5Z A;  2WYF A;  5A3O A;  1QIQ A;  2JWP A;  2VOT A;  3JQX A;  3WW2 A;  3W5M A;  2R32 A;  5FRE A;  2VNO A;  2CGN A;  4LBM A;  1HW5 A;  3K4D A;  4D7T A;  5JXG A;  4HSJ A;  1SFN A;  1PO1 2;  1EUT A;  1VBB 1;  2EXJ A;  3C3V A;  4WM8 A;  3VZN A;  2YRO A;  4BQ4 A;  1W8W A;  3ELN A;  4ATE A;  1VBC 1;  1OLQ A;  2IWG B;  1AR7 3;  3MDP A;  4LUM A;  2V4A A;  5CIR A;  4A6S A;  2R06 2;  1HIX A;  3AZZ A;  4I30 A;  4WZC A;  2D6P A;  4EN7 B;  2W47 A;  4CDU B;  4PQQ A;  5KWR A;  2Z79 A;  2A6W A;  4XDQ A;  3ME2 A;  4JGZ C;  2ZGP A;  1YI9 A;  4IE7 A;  3UKV A;  3AXE A;  4Q4W 3;  1WZX A;  4UW6 A;  1REF A;  2Y6G A;  3OB8 A;  4FPE A;  2XWB B;  4XYX A;  4FTS A;  3SIT A;  2WS9 3;  1APN A;  3N36 A;  3RWN A;  1EAH 3;  3MLJ A;  3V0B B;  1EV1 3;  4JTO A;  4DXT A;  3DF0 A;  1LTE A;  1WKY A;  3BOW A;  5FFO C;  1QH6 A;  1ZM1 A;  4Y5T A;  1YQ5 A;  3KD4 A;  1NCQ C;  2BWA A;  2QBX A;  2YMZ A;  2ZHK A;  3C7O A;  4X8N A;  3RG0 A;  1R1Z A;  4NOT A;  5JXJ A;  3FL7 A;  4L11 A;  1DQ5 A;  1RUC 1;  2ZJC A;  3ZO0 B;  1W8F A;  4B4R A;  4ZU7 A;  3VDD B;  2HWE 2;  4LHL A;  4XQD A;  5IVC A;  2PLV 2;  2R06 3;  1JZ3 A;  4FPF A;  4FFH A;  2XJP A;  2XGX A;  2AZ5 A;  3DXU A;  5CVR A;  2WNO A;  5K8S A;  3HEI A;  3JB8 A;  2EIE A;  2PHW A;  1FOD 1;  2BVB A;  2VMH A;  3VD9 A;  3PVN A;  2C0Z A;  3LZZ A;  4JGZ B;  4KBZ A;  2D6O X;  4HVO A;  3L2H A;  4EN9 B;  3AMQ A;  1W6N A;  1DCS A;  3MFA A;  4M3C E;  4W4Z A;  4RN5 A;  3LEG A;  4Y20 A;  2RS3 2;  3MF6 A;  3AKQ A;  1YJK A;  1C1F A;  2A5Z A;  2ZHM A;  4HFS A;  2X05 A;  3USS A;  3ZR6 A;  1NKG A;  3ABZ A;  4P9W A;  3KV5 A;  3H1W A;  1X8M A;  5LA2 A;  1JTZ X;  2VD7 A;  4M01 A;  1TQ5 A;  1UU5 A;  1RVF 2;  1NCQ B;  4LHK A;  2YC2 A;  5D1I A;  1I1E A;  3DEM A;  2HWE 3;  2PLV 3;  2GN3 A;  3HBK A;  1WLT A;  2UWC A;  2VZO A;  2F6B A;  3BB6 A;  2LUW A;  3HNB M;  2VL4 A;  3I2D A;  4QXB A;  2Q0A A;  3CEW A;  1OKO A;  4FPY A;  3WNM A;  1HXS 1;  4Q5O A;  4DY3 A;  3VUO A;  4N9I A;  1CAU A;  3VZJ A;  4NJ4 A;  5BNN C;  1JZ4 A;  4QDQ A;  1RUF 1;  4RFT 0;  3JBG 1;  2HWB 2;  1H8V A;  2RJK A;  1XE0 A;  4IEQ A;  3F2Z A;  4XDP A;  1DU3 D;  4QDR A;  2R1D A;  1YO8 A;  4LA2 A;  5CB7 A;  2E53 A;  1O3Q A;  2DFB A;  3NNG A;  4IV3 A;  5FZM A;  5LAT A;  2PAK A;  4SBV A;  3ZIW A;  4RHV 1;  2VVE A;  5F3I A;  1UZZ A;  2E51 A;  5CFC A;  2WNE A;  4QKN A;  1J84 A;  3RZJ A;  1AR8 2;  1Y43 B;  5FZD A;  1VMJ A;  5JXH A;  5KXE A;  5FO7 B;  1MS1 A;  2VJX A;  4MXV A;  2Z5W A;  3T08 A;  3GJA A;  1WUV A;  3AYE A;  3KHB A;  5CAZ A;  1IOA A;  4LUK A;  3PVO A;  4I0B A;  2WFP A;  3V56 A;  3D3A A;  2E63 A;  1W03 A;  2B4K A;  4CCL A;  2QJV A;  2YV8 A;  4MET A;  1A6C A;  1D7P M;  1W2A X;  3H50 A;  2Y64 A;  4LNV A;  3WF0 A;  4CSW A;  2HWB 3;  1NY7 2;  1W6Q A;  5BNN B;  1SCS A;  1V6O A;  1FV2 A;  3OD4 A;  5H9S A;  4Y26 A;  3TN9 1;  1Y7B A;  5M0T A;  1VE0 A;  3CF6 E;  2RS1 2;  3DGT A;  4JDO A;  4WM7 C;  3AKR A;  1RUH 1;  3KCX A;  2A6Y A;  5BPX A;  1QEX A;  2E7Q A;  2ZGQ A;  4CU6 A;  5FRA A;  4XPV A;  1J3R A;  1F4A A;  3C7F A;  3ZSE A;  4RGG A;  1JOP A;  5C5U A;  3H9A A;  4AVC A;  4Y1Z A;  4GA9 A;  5FYZ A;  3RJ2 X;  4QU1 A;  4B1L A;  1A34 A;  4LBK A;  3SNM A;  4PHZ A;  4UBG A;  1GP6 A;  1SEF A;  5FMC A;  3BN6 A;  2Y6F A;  5FXX A;  4IEY A;  5C8C A;  4BQW A;  3APB A;  3UL2 A;  1ULF A;  1XJA A;  3ST7 A;  3PU3 A;  2RM2 1;  2JDN A;  5EJZ B;  1XE8 A;  1A78 A;  1K5M A;  4L92 A;  2QUO A;  5LEK A;  3ACH A;  1T6G C;  5IK4 A;  1MVQ A;  1S0E A;  3KMH A;  1W9T A;  1FMD 1;  1SMV A;  3SIS A;  4P9L A;  1QNW A;  2BP6 A;  1JUI A;  4YNI A;  1GWK A;  3C8X A;  1YIF A;  3IWZ A;  1N1Y A;  2RS1 3;  1JYX A;  1W6P B;  3PTY A;  4QMA A;  1J3P A;  3ZYH A;  4B7K A;  4EE2 A;  2FZ1 A;  3WG2 A;  1ENS A;  2Z69 A;  4WM7 B;  4IEU A;  2QQJ A;  1CX1 A;  1FAY A;  4AEM A;  3AJY A;  4UFI A;  4E2G A;  5BNP C;  4BIF A;  4COV A;  2E33 A;  2ZCW A;  4AGG A;  1RUD 3;  2IXK A;  3V0A A;  1MAC A;  2Q1Z B;  2ENR A;  3KF5 A;  3RI8 A;  4YYO A;  2IFW A;  4N43 A;  1T2X A;  4GMP 0;  1MS5 A;  1XOY A;  1BXH A;  4P9I A;  4DNY A;  1W0N A;  2HKX A;  5AC9 1;  3TOJ A;  2DUQ A;  3ZFF C;  1CES A;  4BQ1 A;  2J1A A;  3IN9 A;  5A7Q A;  5FPV A;  1DP0 A;  2RS5 1;  1CIW A;  2XKO A;  1G9F A;  2PN5 A;  3CJX A;  3I2F A;  3OCP A;  4L9B A;  1LOF A;  3VZL A;  2D44 A;  1ODN A;  2VU9 A;  3BCW A;  3ROU A;  5F1R A;  3U4X A;  4PDW A;  3I3M A;  4PBP A;  2PQQ A;  5FY5 A;  1UF2 C;  4X6Q B;  4PBO A;  3VGI A;  4C91 A;  2WNV C;  3WG4 A;  4MZU A;  4NRO A;  1SZB A;  4YM3 A;  5DZG A;  4HET A;  2HYK A;  1V00 A;  2JG9 A;  5J3U A;  3ILF A;  2XVG A;  4LKS A;  1DBN A;  4D0Q A;  3T0A A;  1NLS A;  1JZ7 A;  2LS6 A;  4JGY A;  3WW4 A;  2Q1M A;  5CU1 A;  1UYP A;  4MUV A;  2WLP A;  3CZJ A;  4L97 A;  4HLT A;  4D8M A;  3PUH A;  5ANQ A;  4RL7 A;  4AZZ A;  2DVB A;  5BNP B;  1DZQ A;  2B9V A;  2B39 A;  4QQL A;  4BLJ A;  1NAE A;  1UOG A;  2CAU A;  2YC4 A;  4IE4 A;  3FHQ A;  4JAA A;  3S0M A;  4Q4V 1;  1UMH A;  1YJL A;  2VMF A;  5FPL A;  3PJQ A;  2GSY A;  3ZFF B;  1JYW A;  4NAO A;  4MGS A;  2BGO A;  3JZV A;  1UPI A;  3OOX A;  3WQ7 A;  2WRA A;  1Z78 A;  3NWK A;  1YHF A;  4GMP 3;  2Y60 A;  3M2M A;  2P17 A;  3BOP A;  5FXV A;  1TMF 3;  2C1F A;  1VBE 1;  2IVJ A;  1O4Z A;  1QJY 3;  1S2B A;  1WCQ A;  2VTX A;  3EQE A;  3H7J A;  4GWN A;  1GU3 A;  3UKT A;  5FPU A;  2MNG A;  4F3J A;  2WNV B;  1SFY A;  4BA6 A;  5A33 A;  1JYC A;  4IE5 A;  1LJ7 A;  4CUC A;  1QDO A;  5DAX A;  3WF1 A;  4YRD A;  1UMI A;  2AEZ A;  1JOD A;  2WT1 A;  4JRA A;  3H0O A;  4PF1 A;  5JIA A;  5IVF A;  3IDB B;  3N7L A;  3MZH A;  4OCT A;  2WA4 A;  4LEJ A;  3AYC A;  1X33 A;  4DPN A;  1NCR B;  4GXL A;  3WUD A;  1RC6 A;  5C7G A;  5FYT A;  3IZO A;  4HK8 A;  1Y9Q A;  3GZU C;  3RS6 A;  2XG3 A;  3N3H A;  3KT4 A;  5F6L B;  5F5Q A;  4QX7 A;  1UY1 A;  2RMU 2;  1FAT A;  4CA9 A;  2IUW A;  2JD9 A;  3NO8 A;  2KM2 A;  4M3C A;  3T1L A;  4NE9 A;  2ZHL A;  1TNR A;  2GAU A;  3CIH A;  1PK6 A;  1GOG A;  1SHW B;  3RJR A;  5C9A C;  1MS3 A;  2JXA A;  1SLB A;  5ABJ A;  5FR3 A;  3NL1 A;  3IBM A;  5IAV A;  2EIC A;  3VV1 A;  2PMW B;  2Y26 A;  3I2J A;  3U1X A;  2GC2 A;  4AEJ A;  1WGP A;  4H55 A;  1LB2 A;  4GWM A;  1RMU 3;  4IXL A;  5FV3 A;  4K8F A;  4YVS C;  1WD3 A;  5IK8 A;  1LU1 A;  1OVP A;  4P9Y A;  4PDW B;  4CCN A;  4DUX A;  4V2W A;  2ETE A;  3LFM A;  1NT0 A;  2ORZ A;  2P5B A;  5DAQ A;  4YW2 A;  1EYB A;  3BI3 A;  4NHK A;  5IVB A;  2BU9 A;  1YWK A;  1LEN A;  2HWF 3;  3HT1 A;  3ZYB A;  2QQM A;  4XF9 A;  2CV6 A;  4CYD A;  1AR7 1;  1EPW A;  1RUE 2;  5LAS A;  2DUO A;  3U07 A;  5C4W C;  2AGS A;  1BVV A;  1ZRC A;  1OUX A;  4P08 A;  4RGA A;  4XFA A;  2C5D A;  4QM8 A;  2IFR A;  3WHU A;  3WP4 A;  4AQT A;  5C3P A;  4RS5 C;  1S0C A;  4HL0 A;  4Q29 A;  5FTT C;  1C8N A;  1PVC 2;  4Q4W 1;  4QQH A;  2BDR A;  4XAE A;  4YG3 A;  3ZYJ B;  5JCT A;  1LOC A;  2Y6L A;  3IMN A;  3LAG A;  2WS9 1;  3DV8 A;  1LED A;  2YPJ A;  5C9A B;  1GZC A;  4YM0 A;  4D7S A;  1CPM A;  2QKD A;  5JR2 A;  3ZPO A;  2GNM A;  2V09 A;  1N3O A;  1ZRR A;  4YGC A;  4Y3O A;  2OKX A;  1W9W A;  3AP5 A;  3ZKY A;  2IXJ A;  1WA6 X;  3NST A;  5A7S A;  3PUS A;  4YVS B;  4P02 B;  1JOJ A;  4XXP A;  3J7L A;  2GZW A;  2JIJ A;  5FZ1 A;  5BYN A;  5I8Y A;  1R08 2;  1RUE 3;  2R06 1;  2X53 S;  3FN9 A;  4AF9 A;  1E5I A;  2ZZJ A;  5A3L A;  5HPO A;  3M3C A;  1OLM E;  4BK5 A;  4XUN A;  5C4W B;  4RR3 A;  4CRQ A;  3VB9 A;  1W2T A;  2A3X A;  5FQ0 A;  4BYY A;  1PVC 3;  1WLW A;  4L8Q A;  4PCR A;  2KD7 A;  1OQE A;  1CJD A;  3DKW A;  4RS5 B;  3U75 A;  5EP9 A;  1KEX A;  1O5U A;  1SDD B;  2VPV A;  2VQT A;  3H3Z A;  3NNJ A;  3QH6 A;  2JE8 A;  2P6H A;  4TTG A;  3UJO A;  4FO9 A;  4QGN A;  4C1X A;  1C28 A;  3CJI A;  3TEX A;  1STM A;  5FZG A;  3W5N A;  2D3P A;  3B7M A;  2L9L A;  4N90 A;  4A7K A;  2D6M A;  2DFC A;  2YXS A;  4JKM A;  4TYS A;  3ZN5 A;  3PDQ A;  3WNP A;  1TME 1;  1CIY A;  3AZV A;  3LA3 A;  5FY4 A;  3PUA A;  3NV4 A;  1LR5 A;  4CU7 A;  2JDP A;  3I3Q A;  1ULG A;  4ITC A;  3O1R A;  2Q8D A;  2WO3 A;  3CLP A;  2PHX A;  1ULC A;  3P6B A;  1JZ5 A;  4N53 A;  1NG0 A;  2HWE 1;  1RUI 1;  2PXJ A;  4MYE A;  2PLV 1;  4D6S A;  5JSO A;  2QQK A;  3I49 A;  1QDC A;  4Q26 A;  1HB4 A;  4LBO A;  1W6O A;  4Q0U A;  2QQI A;  1UCX A;  1W8U A;  3O1T A;  1N3Q A;  1JZ2 A;  3PME A;  1H2N A;  1OD3 A;  1R1A 2;  1DLC A;  1V6L A;  3ZSK A;  1E57 A;  2AC1 A;  1F15 A;  1Q5O A;  1XYO A;  3AVS A;  3IDA A;  4XMA A;  5C71 A;  5T5L A;  4FP2 A;  5DPN A;  3VKF C;  1MEC 2;  5DUU A;  3WP6 A;  3D6E A;  1UX6 A;  5C70 A;  3FMG A;  3UK9 A;  1POQ A;  4LBQ B;  4W6X A;  2XOM A;  1KFX L;  2WBK A;  5FWE A;  3UGH A;  2VVF A;  5IAX A;  1GR3 A;  4XHB A;  3AZX A;  3E1F 1;  4JZR A;  4AVA A;  4NR1 A;  3S7E A;  5HCB A;  4ORF A;  4JTN A;  2QCS B;  3ZXE A;  4WVM A;  4NWW A;  2IVI B;  5FY8 A;  2CSG A;  3ZFG A;  1SCR A;  4D69 A;  5CKQ A;  1GZ9 A;  1Q56 A;  2VTX J;  4YG0 A;  5EYX A;  3WNX A;  4K3U A;  1V6J A;  2JG8 A;  5AFB A;  5DMY A;  5CFD C;  5CG9 A;  1QQP 2;  1F8V A;  4E8C A;  3KLS A;  3B01 A;  1R1A 3;  4CXX A;  3LB9 A;  2D43 A;  3RNS A;  3H8X A;  1W99 A;  4XF1 A;  2AEN A;  4XUT A;  2QQW A;  3GF6 A;  4M4R A;  1PGS A;  2ZGR A;  4CP9 B;  4G4F A;  4JCK A;  1Y9M A;  2HWB 1;  3DUI A;  4M00 A;  1JHN A;  4CUG A;  3CO2 A;  3KCC A;  5D8A C;  4RQP A;  1O7F A;  2WAA A;  5LBF A;  3JQW A;  3I3B A;  4JHT A;  3VBS C;  4WZF A;  1Q8O A;  1RJ8 A;  2UWA A;  1NZI A;  4S2H A;  5JUV A;  5FY7 A;  1YQ2 A;  2DWR A;  3H8O A;  3H3L A;  2D3S A;  2YBP A;  2YYO A;  4N7I A;  1N1T A;  3CU7 A;  3OUI A;  3FUQ A;  3M3O A;  2J1U A;  1LHU A;  2XJU A;  2YY1 A;  3I59 A;  1OMI A;  4ZU4 A;  3K46 A;  1JYN A;  2VZS A;  3ZM8 A;  3VKN A;  1AX1 A;  4HPK A;  4ATF A;  2DF7 A;  3BKZ A;  2E9Q A;  2VO5 A;  3WVJ A;  1AYM 1;  1BQP A;  2ADD A;  3OGG A;  2CGP A;  5F9T A;  5JI7 A;  1RB8 G;  3POJ A;  4HKW A;  4K9S A;  1W6M B;  2BYV E;  5I0R A;  2WLQ A;  2XPJ A;  3DPR A;  1U5Z A;  1ZZ7 A;  4MOA A;  5FYU A;  5LA0 A;  2PHU A;  1LEM A;  2J22 A;  3HNM A;  1RYY A;  2VG9 A;  3NVC A;  3VD3 A;  4YFW A;  1OFN A;  2AEY A;  2RS1 1;  5D8A B;  4LIU A;  3ACF A;  3AKS A;  4UBH A;  5JWP A;  3VBS B;  3TRS B;  4Q0Q A;  4AVB A;  3E6D A;  1VB2 A;  4XFC A;  5CEH A;  1DZT A;  3HIF A;  3MIB A;  3W21 A;  1AHS A;  1DGL A;  1RUD 1;  5KR7 A;  2WFF 3;  4OI1 A;  1V6K A;  2WIN B;  5BNQ A;  2R6Q A;  3N7K A;  5I8S A;  5JDB A;  3O5S A;  2TUN A;  2FMD A;  2BOI A;  3BIE A;  5JOX A;  3NV3 A;  1VAV A;  3VBR B;  4BU2 A;  1K5J A;  3IB3 A;  4CCK A;  4XF3 A;  1LGC A;  1LHV A;  3I3E A;  4CDX A;  2BVV A;  4HK9 A;  4Z82 A;  4MGK E;  1W8O A;  1UYY A;  1I3H A;  2ZZQ A;  3O14 A;  5DZF A;  4YW1 A;  2XWJ B;  3EMR A;  4QX5 A;  2RDR A;  4CEW A;  1VPH A;  3MI8 A;  1ULP A;  4JQR A;  4XJU A;  3B94 A;  2CL2 A;  1WW5 A;  3NAP C;  1PO2 2;  5EJ3 A;  2GNB A;  4LO5 B;  4AED A;  5FDB A;  5E1R A;  3L2Y A;  1LCL A;  1MS0 A;  5HCH A;  1UAI A;  2VNV A;  1MQT A;  3BTA A;  4XOG A;  1DG6 A;  1R09 3;  1OOP C;  3JB4 C;  4QX2 A;  1WLC A;  1OPM A;  2O8O A;  1LHN A;  2ARC A;  5HV0 A;  4OI4 A;  4GB3 2;  4XF4 A;  5A32 B;  5F39 A;  3ACI A;  3JXS A;  1OXC A;  3FFQ A;  3MW3 A;  4PLN A;  2A71 A;  3T4H B;  3ZXF A;  1PNF A;  1GZW B;  1F31 A;  2VNG A;  3ETQ A;  1W06 A;  4C90 A;  5K0U C;  1AL2 2;  2VZT A;  1XNB A;  1UXX X;  4OHW A;  3O1P A;  1LOG A;  4GMP 1;  2ZEZ A;  4K8R B;  4A41 A;  3CNA A;  4AR2 A;  5A6Q A;  1J3Q A;  3RYK A;  1CD3 G;  1TMF 1;  3I2G A;  1JH5 A;  1QJY 1;  1S55 A;  1UKR A;  1AR6 2;  2HYX A;  2P3I A;  1UNB A;  1MZ5 A;  1UXZ A;  2VOX A;  4FFG A;  1W3X A;  1DDL A;  1UPS A;  4GJZ A;  5CIS A;  3NAP B;  4AK3 A;  2NYY A;  1QKQ A;  4LO7 A;  5FJK A;  1ND3 A;  2W68 A;  5FYS A;  1QJU 2;  3J26 N;  2X09 A;  4IV1 A;  1H8T A;  1OQD A;  1ZRF A;  4YW6 A;  3BPZ A;  2ZMK A;  1V70 A;  3ENR A;  5GLT A;  1OOP B;  4GB3 3;  1W8T A;  2ZAH A;  5FWJ A;  3JD7 1;  3VKM A;  2RE9 A;  3NV2 A;  4XET A;  2F4P A;  4MGI E;  3BPS A;  2WO7 A;  4CXW A;  1FNY A;  2YBK A;  2QQU A;  4NHL A;  4CZS A;  3LSE A;  3K77 A;  5GLW A;  3K48 A;  5FP7 A;  1W9Y A;  2OPK A;  3HQR A;  3HAG A;  2J1T A;  3MIG A;  5K0U B;  3RPQ A;  3ZMO A;  4R4Z A;  2WNU A;  4BOW A;  5BNO C;  2R49 A;  5FKC A;  5C3O A;  2EAA A;  5I8T A;  1IS6 A;  1WA4 A;  4ZZ5 A;  5J1X A;  4BJ0 A;  4IEX A;  4ASL A;  1DYP A;  2XKP A;  3EYP A;  3EJK A;  2ZGT A;  1RMU 1;  2B8M A;  3OGV A;  3WOG A;  3T0D A;  5GAL A;  1OH3 A;  2RV9 A;  4RSU A;  4UF0 A;  4BQ3 A;  1NXM A;  2C6S A;  3PNA A;  3QBQ A;  4EQV A;  1QJU 3;  1DGR A;  1XRU A;  3ES4 A;  2HWF 1;  2VXJ A;  3PTR B;  4ASM B;  3DEC A;  2Q30 A;  4E27 A;  1OFS A;  3ZR5 A;  3T30 A;  4E4Z A;  3E97 A;  4TLF A;  2JKB A;  2XON A;  5FUN A;  4AAX A;  2W52 A;  1W0O A;  1ACC A;  4DY5 A;  3VKO A;  3POS A;  4QPI A;  1A8M A;  2JE7 A;  5L73 A;  1BEV 1;  5A7W A;  4O61 A;  2WSU A;  3UYJ A;  4DXS A;  3HD8 B;  2ARE A;  2DCT A;  1KJL A;  4HSL A;  1HB3 A;  4V1P A;  4XC9 A;  3OPZ A;  4GJY A;  3KVB A;  1RUG 2;  4GZ9 A;  2N7G A;  2ET1 A;  3VDD C;  4YW5 A;  5EIY B;  5FZ7 A;  2P6C A;  5GZC A;  3PL0 A;  1I6X A;  3LFI A;  5LY2 A;  1OPO A;  1SQ4 A;  5BNO B;  4CDQ A;  4P14 A;  4KQ7 A;  1PMJ X;  2BNN A;  4NPM A;  3BTX A;  2NPI A;  5GZE A;  1JOB A;  4IW3 A;  2NM1 A;  2YZ4 A;  4BLI A;  3GDB A;  1VBD 1;  5A7O A;  4D6Q A;  1HQL A;  1JZ6 A;  1BJQ A;  3HOB A;  4Q8K A;  1W3V A;  5A3M A;  5KHJ A;  4FPO B;  3OPT A;  5T5O A;  5FXZ A;  2VBP A;  1YYN A;  4Y22 B;  1SPP B;  2VW0 A;  1RUE 1;  3ZFE A;  1JZ8 A;  1ZRD A;  1H4G A;  1V6M A;  3IDC B;  4LJH A;  3VN4 A;  2K46 A;  1OKQ A;  3GHM A;  4KI5 M;  1Q3E A;  1O59 A;  1X8E A;  2G19 A;  3MHZ A;  4FSJ A;  3A0K A;  1BMV 1;  1K42 A;  2ZXQ A;  4Y5Z 0;  1GZT A;  1SLI A;  3AP6 A;  3THP A;  3RQ0 A;  2VUA A;  1G9D A;  4OI0 A;  1WMX A;  4XHX A;  1PO1 3;  2XUE A;  1YLL A;  2IXC A;  5LB6 A;  1DIW A;  3QH7 A;  2P2K A;  1C8M 2;  2VBD A;  3SCF A;  4QD2 A;  1SLC A;  4NRQ A;  4CUB A;  5DUX A;  4DRV A;  3N4M A;  1G86 A;  2Q8E A;  4WM8 C;  1S4C A;  3B5L B;  2DCK A;  4WV8 A;  4HVR A;  4XDO A;  4XF0 A;  3FFZ A;  1YCI A;  3V64 A;  4AHW A;  4KNC A;  3S57 A;  5FZ4 A;  4H7L A;  4EWE A;  4YM2 A;  4TXW A;  5JIU A;  3WEZ A;  2KXL A;  4OQ9 A;  2BNM A;  2V72 A;  1M4W A;  3PLQ A;  4XJW A;  1GWM A;  1RJ7 A;  1V6N A;  4XTP A;  4AI1 A;  4EWA A;  1PGW 2;  4MV2 A;  2GMM A;  3IAQ A;  3MPB A;  5EHD A;  1XE7 A;  4DUV A;  5HXM A;  4FPC A;  4PIY A;  5FZE A;  4U36 A;  3ZXK A;  2XJQ A;  2C4X A;  2FD8 A;  3JU9 A;  5IVE A;  1DFQ A;  2WL1 A;  2WN2 A;  4QAW A;  1CAW B;  2LRO A;  4XTM A;  3O0X A;  2GN7 A;  1OVS A;  2IXI A;  2K0G A;  2VM9 A;  1MR5 A;  1W0P A;  2VUL A;  4W50 A;  1IKQ A;  3AZW A;  1C8M 3;  1UKG A;  4NUB A;  1UYX A;  1AXK A;  1ZA7 A;  1YIP A;  2JDZ A;  4SLI A;  4EJR A;  4EN8 B;  4Z1V A;  5HV4 A;  2JDH A;  3DXT A;  1IS3 A;  4U2A A;  2B5H A;  5FO9 B;  4BHP A;  1SG3 A;  4XZU G;  4OZX A;  4WM8 B;  1ZRE A;  2DBN A;  1ZBE 2;  2TBV A;  1AYN 2;  3POW A;  1OBN A;  2C9K A;  4NO4 A;  5FK8 A;  2R1B A;  3AZY A;  2WYS A;  3N9Q A;  4HZF A;  4UW4 A;  4L99 A;  2BRT A;  2XVK A;  3EHK A;  4MH0 E;  1XU1 A;  5GLV A;  4A6O A;  1A8D A;  4GH4 A;  4X6R B;  3BU0 A;  3ZMN A;  2RS3 3;  3OUH A;  2JB8 A;  1SAC A;  5GZG A;  4UXA A;  4XW3 A;  3PIG A;  5F2S A;  1R1A 1;  1AF9 A;  5KBF A;  2XXZ A;  5C3S A;  2AH2 A;  2PA7 A;  4QWN A;  1RVF 3;  5FZ0 A;  1QOT A;  3B9C A;  1S2K A;  3WY6 A;  4CCC A;  4IEO A;  1JYV A;  1WLD A;  1F5F A;  1SBF A;  4Q8L A;  2EF6 A;  2EXH A;  3VHN A;  3AYD A;  1PM4 A;  4XJZ A;  1XND A;  5ERL A;  4C1W A;  1ZRI A;  3AMM A;  1US2 A;  3ZLI A;  2YGM A;  1YQC A;  1UMZ A;  2VEC A;  1ZBE 3;  5JOY A;  1AYN 3;  4YSF A;  3WQ0 A;  2ADE A; 
#chains in the Genus database with same CATH homology
 1W90 A;  2VXJ A;  2LRO A;  3UT0 A;  1WZX A;  2LRP A;  4BQ2 A;  2Q1F A;  1W9F A;  2C24 A;  4LK7 A;  2WYF A;  4YWA A;  2JWP A;  4CP9 B;  1L7L A;  4CP9 A;  3F95 A;  2O14 A;  1HN0 A;  1V0A A;  4LKF A;  3ORJ A;  5D21 A;  4CPB D;  4LJH A;  3ZYF A;  2K46 A;  4BQ4 A;  4AL9 A;  1GWK A;  1W8W A;  1OKO A;  1W8Z A;  1GWM A;  3ZYH A;  1WCU A;  1W8U A;  1OH3 A;  4YW7 A;  4YW6 A;  4LK6 A;  1GWL A;  1WMX A;  4A6S A;  4BQ3 A;  2KR2 A;  1UOJ A;  1W8T A;  4LKE A;  3ZYB A;  4BQ5 A;  4CPB A;  4LKD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...