2YFUA

Cbm62 from clostridium thermocellum xyl5a
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
140
structure length
140
Chain Sequence
SYPKLTGTVIGTQGSWNNIGNTIHKAFDGDLNTFFDGPTANGCWLGLDFGEGVRNVITQIKFCPRSGYEQRMIGGIFQGANKEDFSDAVTLFTITSLPGSGTLTSVDVDNPTGFRYVRYLSPDGSNGNIAELQFFGTPAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Novel, Noncatalytic Carbohydrate-Binding Module Displays Specificity for Galactose-Containing Polysaccharides Through Calcium-Mediated Oligomerization.
pubmed doi rcsb
molecule tags Sugar binding protein
molecule keywords CARBOHYDRATE BINDING FAMILY 6
total genus 32
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2011-04-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2yfuA00
4XUTA 1F4HA 2DCKA 5I0DA 1J84A 4LPLA 1UYYA 2X05A 2LS6A 1JZ6A 2VCCA 2WAAA 2QQLA 1JI6A 1O59A 5IHRA 4A42A 3I2IA 2ID4A 1NX9A 1CZVA 2W1SA 2EIBA 4DUWA 5LA1A 1RYYA 1JZ2A 1JZ7A 4OMCA 2VJXA 4E8CA 1GMMA 3I2HA 2VMFA 1JZ3A 2ZEWA 5LA0A 1GNYA 2E32A 5EJZB 1F4AA 4A6OA 1K45A 3F2ZA 3THDA 1JYVA 3OEBA 1DYOA 3A23A 2VTFA 3FHAA 4PF1A 3IIIA 2C9KA 3VDAA 1UYXA 3DYMA 3SKVA 5IYYA 4P5YA 2YG0A 3WNMA 1D7PM 2VQUA 2CDPA 3T08A 2VZUA 4A44A 3I2GA 4Z2AA 5DMYA 2ZXQA 5C7GA 1HN1A 3LEGA 1UY0A 4JKMA 4AG4A 2W5FA 2VZTA 3CQOA 2C26A 3BGAA 2Y6GA 3C7GA 2VMDA 4IUGA 3NJXA 2WBKA 2VZOA 3T0BA 4TTGA 2Y6KA 5HPOA 3MUZ1 2QQOA 2Y64A 2OKXA 3THCA 3VD4A 4CU8A 3LQCA 4ET7A 1UZ0A 1JYWA 2J7MA 2VZPA 3CZJA 1PX4A 2E26A 4E8DA 2YFUA 1OF3A 2VL4A 4P00B 2VZ3A 4CUAA 3I2FA 2W95A 2YFZA 4UOJA 4CUCA 1CZSA 3K77A 1XNAA 4P02B 5IFTA 3D3AA 2W47A 2KD7A 1PX3A 3P6BA 3IAPA 3GXUA 1EUUA 3A22A 3VD9A 2WZEA 5JXIA 4GWIA 4QX1A 2W92A 2WN2A 2BGPA 3LE0A 4JX0A 3NJVA 2VZQA 3K46A 4ZXEA 2WAOA 5DQ0A 3W5MA 5A1AA 2W9XA 2JDAA 3HEIA 1JHJA 1KGYA 2E33A 4BK4A 3HJRA 3A21A 4BJ0A 3W5NA 3UESA 3ABZA 3WF2A 1GOGA 3LPFA 5CYYA 4PQQA 1I5PA 4A41A 2DCJA 4XUPA 2E31A 2WO3A 5EJ1B 3T2OA 2JE8A 2WUHA 3C8XA 4ZZ8A 1JZ8A 1US3A 1UY4A 2VZ1A 3WNNA 2WO2A 3OGSA 1UXXX 1UX7A 3DECA 3VD7A 3MO4A 3WF1A 2VCAA 3ETPA 4XUQA 1GOHA 1W9TA 3VD3A 3VDCA 3OB8A 3MV01 3JXSA 1TG7A 1DLCA 4CUBA 4HG6B 2VZSA 4CU7A 3HNYM 3OG2A 1MPXA 4LKSA 1TVGA 3MBWA 2XQXA 4ZY9A 2Y6JA 3J7HA 3WSOA 4GWJA 3ZM8A 2QQNA 4QPWA 2QQKA 2VMEA 3NRUA 1PMJX 2B9VA 1GQPA 5JXJA 3ECQA 4QX0A 4XURA 5CZKA 1K42A 2W87A 4QDQA 3NNGA 1JU3A 2QQIA 1BHGA 3PUHA 2J1UA 3CDZB 1IQDC 1GUIA 2HLEA 3ACGA 3CIHA 2V5DA 3I97A 4XUOA 2J1EA 2YC4A 4A3ZA 3I3DA 1UMIA 3WNPA 3WF4A 3FHQA 5JUVA 4LHSA 1DP0A 3T09A 5C71A 1UMHA 1L7QA 3K75B 1NAEA 4OUEA 2W3JA 3DYPA 2VC9A 4TXWA 3WF0A 2W1WA 5IJRA 3PUIA 3I3EA 2JKXA 3OGRA 3WQBA 2Z4FA 2B4KA 3HNMA 5JXGA 3WNLA 1CZTA 4QAWA 1YQ2A 3ACHA 2VR4A 4BK5A 1WCQA 3OBAA 4KI5M 1W99A 2WDBA 2WABA 4JHZA 1R64A 3I2JA 3CKHA 4QB2A 2WZ8A 4ZZ5A 3T2PA 1ULPA 2QQMA 1WKYA 2VCBA 1XC6A 1O8SA 2Y8KA 4JKLA 4A4AA 4DXTA 1NUKA 2VM9A 1JZ5A 3SEPA 3K4DA 2EIDA 2CDOA 5F7UA 4PT6A 1W9WA 4UAPA 2X09A 4MGSA 1W8NA 4DXRA 4ARXA 4QDSA 2W1UA 5FUIA 1JYNA 2J1TA 3WEZA 2RV9A 1XPWA 3WNOA 1JU4A 3UNPA 2YB7A 4JKKA 3GM8A 3WNKA 4W8JA 3AC0A 3K4AA 1KEXA 2XOMA 4XVHA 3HOBA 4W50A 1OT5A 1SG3A 5JXHA 3UETA 2V4VA 1W9SA 4OMDA 4DEVA 2R7EB 1UWWA 1OD3A 4XZUG 5LA2A 4BXSV 4KWUA 4MO3M 3K4ZA 2LW8A 4OZOA 4A45A 4CU9A 3C7HA 5HXMA 1JZ4A 1J83A 2BERA 4M4RA 4AAXA 3FL7A 4RYDA 3SKJE 2JD9A 1GOFA 4MOAA 1ULOA 5B4XA 1CIYA 4QX2A 3FN9A 2VOTA 3T0AA 1UXZA 3HNBM 4KMQA 5B4NA 3MV11 3E1F1 3I2KA 2ORXA 1P8JA 3C7EA 4YPJA 3GGLA 4D0QA 1UY1A 3ACFA 2HYXA 2Y6LA 2XHNA 3EYPA 3OGVA 5IFPA 5DN2A 4GZ9A 3LEIA 2RVAA 4QDRA 4UI9L 2VZVA 2RJ2A 1UY2A 3LEKA 4DUVA 1SDDB 2V72A 1LNSA 4M4PA 3VDBA 3CMGA 2EIEA 3WF3A 4DXSA 2WQ8A 4LQRA 2C4XA 5G05L 4MGQA 1EUTA 3OEAA 2QBXA 4OYUA 2W46A 4FI9A 1T2XA 1K3IA 2BGOA 3EB7A 1SHWB 2W91A 5J1XA 1NKGA 4QB1A 1W8OA 1JYXA 3HPNA 3IB3A 2J1SA 1L7RA 1H6YA 4D8MA 2Y6HA 5C70A 2BBAA 1XNTA 4CVUA 2J1VA 4BDVB 4DUXA 4CU6A 1UYZA 3HN3A 2VMCA 4QX3A 3P1IA 1GU3A 4XUNA 2W94A 3LPGA 2VQTA 1W0NA 4W4ZA 1US2A 2ZEXA 3IAQA 3NQHA 1OF4A 4ARYA 2ZEYA 1UY3A 3DYOA 3CZUA 5EIYB 3ACIA 2DDUA 1H6XA 2PQSA 2ORZA 3C7OA 5DPNA 2WO1A 2ZEZA 2J1RA 4QB6A 2WN3A 4RN5A 2EICA 1O8PA 3T2QA 3U37A 4MADA 2WYSA 2X10A 2L9LA 2QQJA 2YC2A 4L0PA 1K12A 3A7QA 2XONA 5G04L 1OH4A 5JR2A 1CX1A 1PMHX 2VZRA 5LCWL 2J1AA 3C7FA 3T0DA 3MUY1 4P08A 3IDAA 3SEEA 3I3BA 2W1QA 2VO5A 3GDBA 2J22A 3BN6A 2BZDA 4DEQA 3VD5A 5JMOA
chains in the Genus database with same CATH superfamily
4L99A 1F4HA 4MHRA 2X05A 3LD8A 1LOFC 2EIGA 5CFDC 1OUSA 1SFYA 1VRBA 2ZMLA 1AX1A 1EAH2 1S55A 3GZEA 3I2IA 3PUSA 4GD4A 4G4FA 4XXPA 2AYHA 4IGPA 1CZVA 4EE2A 4K3UA 4DUWA 2EIBA 2XJTA 1NA1C 5EYYA 1FMD1 4WM8C 1RYYA 2QQUA 2Z69A 3O14A 4S2FA 4AI9A 4QXKA 3S7IA 1S4CA 4M3CE 2VUCA 2BRTA 3NNJA 4Q4Y3 5FYZA 2PXJA 4NIIA 5FCCA 1W8TA 3WINE 1SFNA 4CDXC 2VMFA 4QHOA 4LMFA 4FT8A 4X6QB 2Q8DA 1Y9QA 5C3RA 2ZAHA 4RQPA 2VXRA 4XJZA 2G9ZA 1EY2A 1GFF2 2OUJA 2Y6FA 4HFSA 1YNAA 1F4AA 4LA3A 3RZLA 3N9LA 3J26N 1WCSA 1EPZA 4DRRA 2Q5TA 3JBG2 4AHXA 4BM8A 4GIQA 4YSFA 2P1BA 3AP5A 2K0GA 1V00A 2UWBA 2IXHA 4HXCA 3DKWA 4HPKB 4A7KA 4NIDA 1D4M3 3KVAA 3ZR6A 5A80A 5F3IA 4PF1A 2HWC1 5C4WC 1HRI2 4DMIA 5BNQA 1R092 1UD1A 2RM22 2YG0A 1IG3A 3VHRA 1LEDA 2VQUA 3ZSMA 2DCYA 4OUSA 1LHVA 2VNGA 5C6CA 1BZWA 2AUYA 5FY4A 1PO23 3JB4C 2P6CA 2GC0A 4IEPA 3I2GA 4LE4A 4Z2AA 1KFXL 2HWF1 2ZACA 2ZXQA 4QPIB 4META 4DPNA 5DMYA 3H7JA 1UY0A 1SMVA 4GKXA 4RA0A 3VBSA 5F5IA 4P9JA 1MVEA 1R1A1 2VZTA 1AXKA 2WFPA 2P3IA 1JBCA 1N3QA 2ZX4A 2GH2A 3E5XA 3AKRA 4XJAA 1HRV1 4P5HA 3C7GA 2XJQA 2QFEA 1VBD1 1RUH3 1UU4A 2DCTA 4WM8A 2QTWB 4B3NA 4IUGA 1JUIA 4HK8A 1IZ3A 2X5IC 4I09A 3UKVA 3KWVA 4IV1B 4XDQA 5T5LA 5HPOA 3AP7A 5GZCA 4EZ4A 3GCWA 5I0RA 2Y64A 1NZIA 2K9ZA 1WCUA 2OKXA 4DFSA 5LY2A 2R041 3LKJA 4HT1T 3CLPA 3TBDA 3OUJA 2HWB1 1LGNA 4ET7A 1ENSA 5A6YA 1OSGA 2D97A 4FTEA 5DG2A 1HLCA 3JU9A 1PX4A 1ODMA 5FPZA 1OQ1A 1QJU2 3MDPA 4UXAA 2VOWA 1LTEA 2JX9A 2YFUA 3LWCA 3RNSA 2FD8A 2X53S 5FYHA 3LFMA 1GR3A 3N9OA 4IXLA 1MQTB 4KG8A 5DAWA 5GZFA 2WWJA 3I2FA 4OUMA 2RDQA 5LW9A 1O4TA 2ZHLA 1OQDA 1SZBA 2GNBA 2ZGUA 4G3YC 4GJZA 4PDWA 2D3SA 3WP3A 3OCPA 3OYWB 5BNPC 3AMQA 2WQ4A 1C8M1 1EUUA 3VD9A 4ASKA 4CCDA 4GWIA 3AKQA 3Q8FA 3ZVXA 4LK6A 2GH8A 4HN1A 5LASA 2FCVA 4NHLA 3TEZA 2ZS6B 1QF3A 2GALA 4NE9A 2C6SA 1DIWA 3OGGA 5F2WA 3O1UA 4JX0A 4DY5A 4JRLA 3LOIA 4HN0A 3PU3A 1ALYA 5IATA 3W5MA 3PVBB 2PHXA 5LBEA 3PUAA 5JSPA 5J7MA 1YIFA 5FOBB 4HMZA 1KGYA 1BQPA 2RS32 1ZYBA 4NWWA 4YM0A 4EJRA 2PELA 4BJ0A 3W5NA 1WCDJ 1PZ7A 3UESA 5IVBA 3GZTB 4R9DA 3RI8A 3KB5A 1GNHA 1ZX5A 5CYYA 4AGVA 1OVPA 5SV8A 4XUPA 3ASIA 1H8TC 4KGGA 1JZ8A 2XUMA 3C8XA 4ZZ8A 3ZLIA 1YXWA 3LGRA 1X82A 3TYJA 2BTVC 2PHRA 2JG9B 4CP2A 3H8OA 3PIJA 1GQHA 1V0AA 4MUVA 4HSLA 1E57A 1FXZA 1JOPA 2VCAA 4QKDA 1NOVA 1HXS1 3ZFFA 5JPMB 4ES9A 2WNVA 1GOHA 1ZA7A 4MGTA 4AEDC 2C5DA 4DOUA 1QGLA 4UBGA 5APAA 2Y0OA 3DPRC 4D6QA 1TG7A 2I07B 5KWRA 3WDUA 4GH4C 3AZYA 4MXVA 4J1XA 2WFF1 1EAH1 3J7NA 3OG2A 3VGIA 5FZDA 1QWRA 1TME1 2GP5A 4FFGA 4N9HA 4XAAA 3AJZA 3NW4A 3BU7A 2JICA 2CGNA 3DV8A 3KV6A 4XE9A 2VU9A 5A6XA 2Y6JA 2VQAA 3J7HA 1VLNA 3H3UA 3JQXA 2OW4A 3ZM8A 5BNNB 4EWAA 4OHXA 4UFMA 1XU2A 2IWGB 4AVCA 3IM0A 1FV3A 2VMEA 1NA1B 4CDXA 1HW5A 4CDUB 5FY9A 3WHTA 1D2QA 5JXJA 4XW3A 1MS1A 4QX0A 1QJY3 1QY4A 4FFFA 5CZKA 5FZOB 3VBHC 1HB3A 1HQWA 1UOJA 1PK6B 4CEWC 3NNLA 2QQIA 4M3CA 1YIPA 4L2NA 5C8CA 2LROA 3A4UA 4I0AA 3WW3A 3I2OA 2NMNA 2ZHKA 4LT5A 5D8AC 4MLOA 1IQDC 5KC6A 5BUVA 2BEOA 1QJX1 2D6LX 2J1EA 2QVSB 2YC4A 3I59A 3ZFFC 4PCRA 4Q26A 1QQP1 3WF4A 5CKQA 5FFOC 1JN2P 1SPPA 1W6OA 3H42B 4YGEA 3O1VA 2A3WA 3CNAA 1H2NA 5C71A 4GMP0 3L2YA 4XJWA 1NAEA 1PIV2 1XSRA 4S2GA 3DYPA 3APBA 3POIA 4XHXA 5K0UB 3QH6A 3FZ3A 2FDHA 1PK6C 1W2UA 1RC6A 4RGAA 1VMJA 3KGZA 5JXGA 2A7AA 1DG6A 2VVDA 3HVDA 4XFFA 4XILA 1ZZ9A 4QAWA 2P2KA 2VR4A 3K2OA 3M70A 1WLWA 4YM2A 4OI4A 1SDWA 5GM0A 1QHDA 2YY1A 4M3CB 4PIZA 4LO8A 2AZ5A 2WABA 3AZVA 4H55A 4KH9A 5FXWA 2ZGLA 1S0EA 2WZ8A 4IEQA 1V6NA 2XH6A 5EV7A 5FYSA 4CP9A 1QDOA 2QKDA 2DV9A 2A6VA 5D21A 3WW4A 3ZYBA 1EPWA 3ON7A 4QU1A 2VM9A 1JZ5A 4WV8A 3SEPA 2JG8A 4N53C 1LULA 3RI9A 4KWKA 3R05A 1X9TA 4AFBA 5C9AC 2AR6A 4OQ8A 5F7UA 3TN93 2IXIA 4HL0A 3WW1A 3ZXLA 2HWD3 3NKTA 4M0HA 3AL5A 2JDZA 4Q8LA 2VOVA 2GDFA 4XTMA 4EN6B 2JB8A 4Q29A 5BNOA 2ERFA 2XXZA 4QDSA 1IS4A 4CCLA 1JYNA 4N53A 4RS5C 4YZ4A 3O1MA 2JB4A 2RV9A 1NY71 5LEKA 5FYCA 2ZKNA 1VBE3 1AVBA 1QIQA 1LODA 1RJ8A 2JDHA 4NRMA 3UGHA 2YB7A 4FOQA 4C0HA 2D7FA 4W8JA 4RQPB 3NV1A 1SLLA 2BNOA 2EALA 5A1FA 4XVHA 1RUG1 1YO8A 2B45X 1WD3A 5FDBA 2NM1A 3SCFA 4I02A 3VDDC 1CAXB 3ZKUA 5A32B 4QX5A 4W50A 1OT5A 1VBB1 4IW3A 4LBQB 1SG3A 5A33A 3FLPA 4C1WA 3UT0A 4OMDA 2RM23 4JCKA 4DEVA 2JDMA 2YBKA 3AYEA 3WQ7A 4BXSV 4KWUA 3SH3A 4URAA 2XJSA 2HWF3 4Y1YA 3D0JA 3N36A 4AHZA 4EROA 3C7HA 5HXMA 1J83A 4XBQA 5FXZA 4RGGA 3TAYA 1S2KA 1ACCA 1V6JA 4ZONA 3U11A 4LA2A 2ET1A 1VE0A 4F7ZA 2VPVA 5HBAA 3AB0A 1UZYA 1W8WA 3SKJE 4IEWA 1WLCA 1IGOA 1K5MA 1PGW1 2JG8C 3FN9A 2VOTA 4E4DX 3T0AA 2JWPA 2MNGA 1FPN1 1ND2A 2W39A 3KQRA 3MV11 4H7LA 3ZXGA 1EV13 3J8F3 4O9EA 2ORXA 1P8JA 4J6GA 1ULEA 5HCHA 4PLNA 4Z1VA 1XYOA 1JODA 4D0QA 5FR3A 1AX2A 2Z5WA 2OZ6A 3VKLA 1QOOA 2GZWA 4NOTA 2Y6LA 3FBMA 4BIFA 3JUUA 1RUI1 5A7PA 1O7FA 3AXDA 5SV5A 2VH9A 1JW6A 3BIEA 3I2DA 3PL0A 1WW5A 4V2VA 5H9SA 3EYPA 4AQ6A 3OGVA 5FLJA 3H3LA 1ND3B 4W65A 4AVSA 2B7YA 3ZYPA 1UOGA 4RFT0 1CJDA 3GJBA 1OFSA 2P37A 3IN9A 1MZFA 2JDNA 1QXPA 4P9GA 1DBNA 5FY8A 2R071 3KZ4C 1Z78A 5BNNA 3LDBA 1WW7A 4OQ9A 5DUXA 2RJ2A 1QXRA 2VUDA 3BYWA 3UJOA 2YPJA 5B2GB 3MW3A 3VV1A 2VW2A 1VBC1 2E7QA 2R49A 4OHZA 4XYXA 4WVVA 4COUA 1VBC3 3AYDA 4DUVA 1SDDB 3MW2A 1PO11 3GF6A 2IXJA 4UFLA 1Y4WA 4YFZA 4YZ1A 3PNAA 2CNAA 1EV12 2PFWA 3D6EA 3J8F2 1Q56A 5JWPA 4Q1PA 2FDIA 4YVWC 3RWKX 5G05L 2C4XA 2LALA 4XABA 3HR9A 3OEAA 4OYUA 4CEYA 4CP1A 5F9TA 4AE2A 4MGKE 4FI9A 2WT2A 5FO9B 5EYXA 1QQP3 4UW5A 3EB7A 4LO4B 1Z7S3 5LWBA 5J1XA 3FLRA 4XF1A 1IHMA 2PAKA 3WT3A 2WLQA 4OULA 3WDVA 3KSCA 3HPNA 1JYXA 1PMIA 2J1SA 1HKDA 1H6YA 3AYAA 4D8MA 1DQ0A 1XBFA 1KS5A 1O6UA 4CVUA 5GZGA 1PO12 4AEDA 4COWA 5IVEA 2JD4A 1CD3G 1UIJA 1VPHA 2H6BA 4CDUC 1DZRA 2ATFA 3HN3A 2VMCA 1W9YA 3N7JA 1BBT2 3CJIA 3RS6A 1GP6A 1RHI1 4JRAA 1GU3A 4XUNA 3JD72 4Y33A 1VBA2 2ZZQA 4WBBA 3ZR5A 4CUGA 4A7YA 2HKXA 4W4ZA 2UY9A 4CTEA 5IVVA 5JOWA 5FZ7A 1G86A 3H9AA 2R063 1DHKB 2Q30A 5FRAA 5FY7A 4MXWA 4R9BA 3RQ0A 1POV1 4ZPIA 3IMNA 4AEKA 3D8CA 2AREA 3ACIA 3BPSA 4QKBA 4Q4W2 1IPKA 4KQ7A 2XG3A 4PF5A 1TME3 3F95A 3IBMA 4H3WA 1ASJ1 5AC93 1PGL2 2VOKA 2J1RA 5T5JA 5HV4A 3IDEA 2ADDA 4FOWA 2EICA 1O8PA 4HVRA 1UZVA 3T2QA 3B93A 4BWOA 2PLV1 3N7MA 4IESA 2OUHA 1FT9A 4JAAA 2CV6A 5FWJA 2QQJA 4LUKA 3TEWA 2VUAA 1K12A 4Y20A 2BUKA 1GZWA 1RUE2 2PTMA 5FP7A 1OH4A 3AMPA 2BQPA 4OVEA 2XWBB 1LEMA 2A75A 4YARA 2MEV2 1LOEA 1SACA 1WCKA 1PMHX 1W05A 1NQJA 2VZRA 1N1TA 2J1AA 1RUI3 1UOBA 2QZ2A 3WHUA 3S5QA 1LHWA 2XJRA 3AMMA 5GALA 3VKOA 5L9RA 4P08A 1REFA 2VVEA 2A73B 4S2HA 3WNXA 3AJYA 2DTWA 1PVC1 2ADEA 3SEEA 3TEYA 2W1QA 2VO5A 2VMIA 4FOYA 5BNPA 4XF3A 3BN6A 3KCYA 5GLTA 5A33B 1RMU3 3IPVB 5F5QA 5JMOA 2CWMA 3FJSA 3Q8CA 1XE7A 2PAEA 1ZZBA 1J84A 4LPLA 4CCOA 3UKTA 3HBZA 1JZ6A 1PGL1 2WAAA 3AK0A 3ES1A 1O59A 3RZMA 5IHRA 5FZHA 4EN9B 4A42A 2BVBA 3J7MA 1VAMA 1J1LA 2Q1ZB 4GH4B 4W6YA 2IXCA 3PVNA 4E4HA 1WWYA 1PO21 2BFUL 5JZGC 5FZCA 1V70A 5A1LA 4AEDB 4HK9A 2DBIA 5FYTA 1JZ2A 3KF5A 3N9MA 3Q9OA 3ZYJB 1LJ7A 2AACA 4E4ZA 1CR7A 1S0CA 1JTZX 1NY72 4AXOA 1GMMA 4TYSA 2H0BA 2VUJA 3NKGA 4IDZA 5FTTC 4Z82A 4DRVA 3THDA 4QWNA 1YFUA 1JZ3A 4B1MA 1W6NB 3WOGA 3CHXA 5A3NA 1GNYA 4HVQA 1UU6A 5F3CA 3POBA 2GC2A 5FZKA 4DB5A 1DQ1A 1OFNA 3VBHA 1H30A 5A32A 1IKQA 3N7KA 1PVC3 1T6GC 1SBDA 3M3CA 2A1XA 4R52A 4XQDA 5DAQA 3OEBA 4ZU5A 1OC1A 5FP8A 5HCBA 4FCAA 2VNRA 4HONA 5IW0A 4AAPA 4HETA 4D69A 1G6NA 2BGCA 1W2AX 3RJ2X 2BYVE 5T54A 3UYJA 2YXSA 1HQNA 2ZTNA 5IWFA 2Z2SB 5KHIA 4GALA 1UPIA 2WNOA 4TLGA 2HEYF 3DYMA 3SKVA 4Y1VA 5IYYA 3WNMA 2OX0A 1D7PM 4M0NA 5FOJB 4FXGB 5FPAA 1JS9A 5C5TA 1ZREA 4A44A 5FZBA 4YW7A 2CAVA 3TWIA 3M7AA 4JTOA 3T1MA 1G9DA 2ZBJA 2WKKA 2ZMKA 3BTAA 4U36A 1HN1A 1K5MB 2JDYA 5FZOA 3ZSEA 3B01A 1IOAA 2FQPA 3RFRA 1BEV1 4IE0A 1AXZA 2GC1A 2W5FA 3J9SA 1VJ2A 4ORFA 5F3EA 5JI7A 1CX4A 3V56A 4EWDA 2JG9A 3BVCA 2C26A 3RPQA 3BGAA 2LUWA 1W03A 4NJ4A 3S6PA 4XQ4A 3KHBA 1BKZA 1UO9A 5FP9A 1OLMA 1XU1A 4KBZA 3AMHA 5ANNA 4JGYA 3T4HB 4IE5A 2YU2A 1R082 4EN8B 5CFCA 2Y6KA 1J1TA 1XRUA 4FFIA 2RDRA 4TTGA 3O1SA 2QQOA 3JQWA 2Y60A 3CF6E 1KD7A 2P4EA 4IQPA 3VD4A 3JB8A 1O91A 5FY0A 3HBKA 2XKOA 5FY5A 3WUCA 3LQCA 1RVF3 2ZGSA 4BLIA 1LCLA 5I0SA 1HRI3 4FSJA 1RVF1 2J7MA 3GBFA 1DZQA 4QQ2A 4CRQA 3WDXA 1MACA 3M3EA 1AL21 1Q8QA 4LE3A 2WZR2 2B39A 5C9AB 3ZN6B 2ZGRA 4TLFA 2P34A 4LBQD 3MZHA 1UZZA 5C4WA 2VZ3A 2AENA 4HBNA 5A3TA 4NN0A 3WQ1A 2UURA 1VRH2 4UWDA 3ST7A 3H8UA 3OYWA 1F35A 3EMRA 1CZSA 3FLTA 1XNAA 2A71A 2UWAA 2O0OA 3D3AA 2W47A 3DUIA 5DDJ2 4F83A 4Y4YA 1PX3A 4Q4W1 3P6BA 1RUC2 5FPVA 1RXGA 1Y9MA 3HQXA 1QJX2 4J25A 2XJUA 4Q1RA 5EHDA 2Q4SA 2D6OX 1CPNA 5JLVA 2DUPA 4MXWB 2BGPA 3VN4A 2ZGTA 4ZKTB 4YWAA 5A7OA 4CSWA 4P9IA 3J7LA 2CHHA 4LOTA 5IVJA 4JGYB 1CGPA 3WW2A 4MG2A 2RS33 1LHNA 1SCRA 2VZQA 3K46A 3POEA 3VHNA 2V5YA 5LRRA 3PUQA 4B8EA 3M3OA 4RR3A 4XCBA 2DUQA 5IK7A 2JDAA 3HEIA 4GB32 1O3RA 1JHJA 1U5IA 1VAVA 2E33A 2RM21 2GU9A 3G6JB 3OUIA 2XBO2 3I3QA 1FYUA 4XJUA 4DXZA 1J3QA 1Q3EA 3WF2A 3POYA 4AVAA 4Q0QA 1YHFA 1RHI2 3I4IA 4N8MA 4A41A 2B42B 5A3LA 5JMCA 3LF7A 2CYFA 2VY0A 2VW1A 5LY1A 5EJ1B 3T2OA 3NAPA 1KRIA 2JE8A 2ZGPA 4JZRA 3VBFC 3QLQA 2UU8A 1VRH3 2XWJB 1DGWA 1PNGA 1LR5A 2VZ1A 2BBVA 2UY8A 3DPRB 1VBB2 3OGSA 1Z7S1 1REEA 3DECA 2WC2A 3MO4A 3VD7A 2UYAA 1O5UA 3DKQA 3NV4A 4XUQA 4ZU7A 3MICA 1W9TA 4XEZA 3VD3A 5FMOS 4R4XA 1WMXA 4CEYB 3MV01 2V73A 2ZA9A 5AFBA 3INAA 4QX8A 1EYBA 4YZ5A 3CBNA 1OA3A 3M3IA 3EQEA 4CUBA 1EV11 3J8F1 4HG6B 4CDWA 4CU7A 1Y9GA 2A5ZA 3PVOA 3IZOA 3MPBA 2YROA 5F5CA 3CL1A 4YG0A 1TVGA 1UQXA 3MBWA 5CFDB 4OHYA 4COVA 1AYM1 3PMEA 4ZY9A 4CEWA 4XHBA 3VBUB 1MQTC 1AR91 1AR73 5FP3A 2Z42A 2FCUA 1AR61 1WW6A 2D5HA 2ET7A 4LK7A 5DUVA 2UWCA 1YI7A 2XBO3 4QPWA 5FYBA 2QDNA 2PQQA 3TEXA 3ZXAC 4AFMA 1C8M3 2EXIA 3ECQA 3P5BA 4XURA 3MIBA 3MHZA 4DO0A 3JCIA 2TUNA 2ZMNA 3VKNA 2QJVA 5FYVA 4QQOA 4X8PA 1FOD2 1YLLA 1EAH3 1F31A 3E5UA 5E88A 5T55A 4P14A 1IPJA 2C0ZA 3PUHA 2PYTA 2J1UA 3N9NA 5IAXA 2XHKA 1H8TB 1RUI2 2ARAA 4XMIA 1B09A 1RITA 2ZGQA 1YYNA 1SLCA 4NPMA 4XF9A 5E6HA 3WG2A 4AOCA 2CL2A 4UW3A 4CP0A 2HBUA 4EQVA 4N7IA 3MFCA 5FZ0A 2RG4A 4A3ZA 3I3DA 4N43A 3AZXA 3WNPA 3ZDSA 4Q0SA 4BMBA 2F4PA 4SLIA 4LNVA 1ZRIA 2ZGMA 4XFHA 3O0VA 1RMU2 4XFGA 5L7OC 1UMHA 1MZEA 4OLLA 4A3XA 1WGPA 1GZ9A 3K75B 2RS12 4YVSA 5BPXA 3NO8A 3E6CC 2W3JA 2VC9A 2RDNA 2WS93 3K3NA 2YPDA 1FATA 3WZ1A 2C1FA 4FPYA 2WZR1 2HH9A 3PUIA 5A6QA 1GZWB 1OA2A 2SLIA 1SEFA 3I3EA 4XPVA 3WQBA 2VQ0A 3AKTA 3ZFEC 4CDWC 2WYFA 1PGW2 1C1LA 1DGLA 1KJRA 4LUMA 5FZEA 2EXHA 3ACHA 1W6MB 4B4RA 3BTYA 2WT1A 3SHRA 1FOD1 5FY1A 4BU2A 1RUOA 1NE6A 4FQ4A 4KI5M 3ILFA 4CDQC 1URXA 1RUH2 4XFIA 3WCSA 1W8ZA 4LBLA 1Q8PA 3I2JA 2HWC2 1W04A 4OI1A 1GQGA 5AVPA 2B46X 4PLOA 4CA9A 1OLME 2VCBA 1W8UA 1AR62 1IS6A 2ILMA 4JKLA 4LHLA 1SBEA 4WZFA 1N1SA 3JBG1 4I2OA 1MR5A 4Q4X2 2EIDA 4EYUA 2XVLA 4QKFA 2CDOA 4YVSB 5C3QA 2YMZA 2X09A 4RFRB 4DXRA 5JZGB 5H9PA 1POQA 2RS13 5LATA 1DCSA 1BVP1 1I9RA 2XUEA 5L7OA 1GANA 1G9BA 2W1UA 5FUIA 4XDPA 1AX0A 3LDRA 1LECA 1XPWA 5FZFA 3WNOA 3UNPA 1SLTA 1VBE1 1W6MA 1ZBA1 4MSVA 4GMP3 1HRI1 5K0UC 5FK7A 5FV3A 4GWNA 1UOFA 2LTNA 1LGBA 3IIAA 5A7WB 5KHGA 4LBQA 3CJIC 2RDSA 4C91A 1NCQA 3SISA 2O8OA 4C90A 2VMGA 3G7DA 3KCCA 3UETA 2VTXA 4YVWB 5KXBA 1NCRC 2YC0A 1W9SA 3ZFGC 3JZVA 4RD7A 1YRZA 2RR11 2C24A 3ZN5A 2TBVA 1QH7A 5E89A 5A3WA 1APNA 2RS31 1COV1 3AMNA 4MVTA 3OUHA 1H2MA 3IDBB 1R083 3PIGA 2JDUA 4A45A 3VZNA 1LENA 5FIXA 1OXCA 2O1QA 2JDPA 3FL7A 4RYDA 1C5HA 1CAWA 2BVVA 2OZJA 4FAHA 2DU1A 1D4VB 5FP4A 3SC7X 1F5JA 5C4WB 3OBRA 1NXD1 2BPA2 4A6SA 2E53A 1CQ9A 1ULOA 5C9AA 2FZ1A 4RHV1 4E9KA 3O1TA 4KU7A 2Q1MA 3U10A 4O65A 1WMEA 3EBRA 1HV0A 4E2SA 2R6QA 3PDQA 4HKWA 4QPGB 1MS9A 1IS3A 5CU1A 5DDJ1 2D6PA 5LBFA 4LHNA 3ACFA 4OCTA 2HYXA 1NG0A 5FUPA 5CFCB 4B1LA 2O14A 5C3PA 4WM8B 1HDKA 1QEXA 4FPKA 2OYZA 2OIIA 1AZDA 1RUF3 2E9QA 2PLV3 1Q43A 4HSJA 1BLZA 2JECA 3AKPA 3FUOA 1W0PA 4YW2A 2ZGOA 1UPSA 3ZXJA 5DN2A 1NE4A 3B5LB 4GZ9A 1HB1A 3ZFEB 1WLTA 3PTRB 3AVRA 1OKOA 1W0OA 3B94A 3LEIA 1VB4A 1LESA 1QKQA 2J42A 1ZRFA 3ZSJA 1O5LA 2RVAA 4W6XA 2BNMA 3ZIWA 3SCGA 1NA1A 1SCSA 2VZVA 3NJYA 4QT6A 1FNZA 3RVHA 3CJIB 2A6XA 3I49A 5FPLA 2FDGA 2XVGA 5ANQA 5AC92 3HWJA 2G9FA 1DLLA 3N35A 5DUUA 5LBBA 1ENQA 4FP2A 5FZGA 2V72A 3GYDA 3H3ZA 1ND2C 4KWJA 2WFF2 3S0MA 2EF6A 3MIEA 3CMGA 2EIEA 2PHUA 1OOPB 1F15A 3WP4A 3AFKA 3D5OA 2OVUA 4IEOA 1EUTA 1V9U3 4QMAA 5J98B 3VBOC 5C5UA 4NHXA 4K8FA 3FHIB 1ZBE2 3PJYA 4QPIC 4RR3B 1X9PA 1RUF1 4LBOA 2BGOA 2PN5A 3A0NA 4IEXA 2CAUA 2HYKA 2W91A 5C3OA 4Q4X1 2XMLA 1NKGA 1V6IA 3ZOIA 4QB1A 3EHKA 1K5JA 4H2AA 5J36A 1ZBA3 1Y3TA 3FMGA 3IB3A 4XFCA 5CKMA 5T50A 1CAWB 3ZPOA 2Y6HA 2BBAA 2Q1FA 5DXDA 1XNTA 1YFYA 1AJOA 2GN3A 1ZNPA 2J1VA 3QH7A 4YFWA 3UGGA 2JE7A 5AVAA 4FBFA 3NAPB 1M4WA 4GKYA 3LFIA 1RUH1 2HWB3 1Z0HA 2DYCA 4CCCA 3VBFB 5LA9A 5FZIA 3MI8A 4QX3A 5T52A 3VKMA 4LR4A 4AI0A 4Y5Z0 4E27A 4COZA 1IPSA 1W0NA 1WLDA 2R072 3GNEA 5A7NA 1AF9A 2XBO1 3T30A 4FTBA 4L9BA 4NUBA 1F5FA 3H50A 4XBLA 4COYA 5KXDA 4CU8A 3IAQA 3NQHA 1AR71 5FUNA 2JG9C 4YVWA 4YM3A 5KBFA 1POV3 3IDCB 1IG0A 5BNPB 1TMF3 2RJKA 4GWMA 3ZPYA 1SPPB 1W6OB 3OBTA 1GV9A 2Y34A 5FWEA 3WUDA 4JTNA 3MEPA 3D0SA 1FMD2 3OY8A 3VBUC 1YEWA 1LOBA 2HBTA 1DU3D 2WN3A 3FBYA 4ATEA 1ENRA 3RDIA 4JDOA 2W0XA 3ZKYA 3C2UA 4GQ7A 1JYIA 2X10A 2RMU1 2ZHNA 5K0UA 3OOXA 2HWE1 1Q8SA 2YC2A 4QHZA 2E63A 2EAAA 3A7QA 5T5PA 5G04L 5JR2A 1DZTA 1AYN1 3WDTA 4AQSA 5L36A 1O3QA 5JR7B 5LCWL 1ZA4A 3VBOB 4QGNA 4YGCA 1AL22 5H9RA 3A0KA 1RJ7A 1CIWA 1E5RA 3QCWA 5FJHA 4PIYA 1U0AA 3IDAA 4AW7A 5H9QA 2R16A 5F6LB 1RUD2 3U0ZA 2C9AA 3FX3A 3IPVA 3GDBA 2LRPA 3CJXA 2BP6A 3VD5A 1XJAA 3HQRA 3KV9A 3AYCA 4L11A 4XOGA 2DCKA 2YYOA 4BZ4A 5I0DA 1TNFA 2WR9A 4XDOA 2IFWA 1R081 1AYM2 3GHNA 1UYPA 1QDCA 2LS6A 4NAOA 4CEWB 2EVXA 2QQLA 1JI6A 2RMU2 2IZWA 4AI3A 4CE8A 2ID4A 3AZWA 3ACLA 2D6KA 4NRPA 3GHMA 1WMFA 1AR63 3FE5A 3W21A 2W1SA 4CDXB 3GJAA 1G9CA 3TN92 3UL2A 2B5HA 2DUOA 2VAUA 5A3PA 2ES3A 1D2SA 4JGZC 4BMEA 5BV6A 4AQTA 3T2TA 2R061 5I0TA 1CAVB 3SXWA 3VKFC 2HWF2 4E8CA 4NHMA 3I2HA 1QJY2 4RGKA 4BQ5A 1C57A 2XLAA 2WNUA 1W6QA 5EZWA 3LA2A 2ZHMA 4BQ4A 1HXS2 1W6QB 4AI1A 3SITA 2E32A 4B4QA 2OXBA 5EJZB 3H1YA 4A6OA 2ARBA 2RR12 4Q4X3 4UFIA 2FDFA 3ES4A 3WV6A 4A7ZA 4B7EA 5I93A 4YGDA 1DYOA 4R4ZA 3U78A 4GMP1 4CDWB 3A23A 1A8DA 3KT4A 1WD4A 4YM1A 1NLQA 1X8MA 5D8AB 3CEWA 2VTFA 2GP3A 1RUG2 5IK5A 1MEC3 3IIIA 4LBMA 5JOXA 3AXEA 1QOTA 2R043 3WR0A 1UYXA 5KR7A 1NCRA 5FYIA 4XF0A 2VOXA 3MGUA 4PDWC 4P5YA 5DZGA 2VMHA 2IVJA 2W2IA 1DFQA 2CDPA 4IE6A 3T1LA 4DNYA 1S0BA 4O9GA 3T08A 4IE7A 3USUA 1MQTA 1HX6A 3USUB 3EXUA 3LEGA 1RL3A 4Q4Y1 4Q4V3 2WNUB 1BXHA 3ZSLA 1CAUB 1ND3C 1PK6A 1BEV3 4FAGA 4O61A 2JENA 3U07A 3DXTA 3CQOA 4B29A 1PO22 5JOYA 2PA7A 1N1YA 3DL3A 4BH9A 4XFBA 3LCPA 4QM8A 1QJU1 3MF9A 2WBKA 4UF0A 3W9AA 5LZ6A 5FZ9A 3T0BA 1QQP2 1RINA 1G7YA 4MGZE 1BMV1 1QH6A 3W58A 3MUZ1 1DGRA 1RVF2 4YRDA 5J09A 1DF0A 1YUDA 1J59A 4LORA 1KDKA 3KF3A 1VMFA 1VMHA 4JGZB 3THCA 2VBPA 4UT5A 3MIDA 1MEC1 3MLLA 1PVXA 2WIIB 5I0UA 1YWKA 4XACA 4D94A 4TN7A 4K6BA 3BOWA 2A3XA 2ETEA 4E8DA 5JDBA 2V09A 4GXLA 2VW0A 5CG9A 2OT7A 1OF3A 1OQEA 1LOGA 3NAPC 4NAMA 3O5SA 4NO4A 1GYKA 4R8HA 3VBSB 4LULA 1KJLA 2YFZA 5FZ6A 5A3MA 4Q0PA 2FZ2A 5IFTA 1FPN3 3RZGA 2PLV2 5TSWA 5CB7A 2KD7A 3DPRA 1GSLA 1CONA 4U2AA 3GXUA 4OI2A 3A22A 3VL9A 1UW8A 2OA2A 2WZEA 1QJZA 3VUOA 2W92A 2WN2A 3DCQA 1OOPC 1XNKA 3FFQA 3MLKA 1ASJ2 4ITCA 4XETA 1KQRA 3TNPB 4FPLA 4BYYA 3ETQA 4ASLA 3NJVA 4XJ9A 5FO8B 4ZXEA 1I6XA 4I0BA 4HANA 1VAKA 5DQ0A 1X50A 5A1AA 3QD6A 2Q0AA 3N9QA 1C3HA 4QXHA 3T3YA 1PHMA 2X29A 4BK4A 2JJ6A 3HJRA 1Z7S2 3A21A 3GCXA 5IVYA 1VBA1 3I8TA 1GOGA 1V6KA 1QJFA 2DVAA 2WINB 4PQQA 1I5PA 2DCJA 3R0RA 3THTA 1VBB3 3Q8EA 2WO3A 5F8PA 1AUYA 2WUHA 3R4SA 1CAUA 3KVBA 5JPNB 4HKOA 4RQPC 1UY4A 1X7NA 4IE4A 3ROUA 3WNNA 1UXXX 1UX7A 1ZBE3 1ZBE1 2ZGKA 4HZFA 2Q8EA 3RMXA 3ETPA 1IKPA 5K7PA 2VG9A 3VDCA 4BQ1A 3OB8A 4XF4A 3TN91 3O1RA 3JXSA 1QJX3 3SH4A 2BOIA 2Y26A 3U4SA 4QPGC 3VZKA 4AVBA 5CISA 1OA4A 3HNYM 3ZXDA 5DZFA 4EZHA 5T3NA 1S0FA 4LKSA 4XC9A 1VBD3 1MVQA 4UFHA 5FMOL 3T4VA 2XB6C 3NSTA 1AHSA 1V6OA 2QDRA 3O7OA 4NR1A 4YLZA 1ZZ6A 2ZX0A 1C8M2 3DXUA 3J4UH 1AR83 5LBCA 4GWJA 3ZYHA 1GP4A 5FBZA 2NQYA 1FMD3 5KXCA 5F6KA 3E6BA 4WVMA 1I5ZA 3LZZA 5BNOB 3NRUA 3KHCA 2R073 1PMJX 4IV3C 3PTYA 5K8SA 1ENXA 3IKWA 2ZX3A 3KM5A 1GQPA 3NMBA 1XYNA 4MHUA 3S7EA 1F8VA 2GSYA 5FLIA 2P6HA 4YW1A 2JDKA 2R0HA 1VB2A 3UK9A 1WA6X 3B02A 3E97A 1BHGA 1W2OA 4KNCA 3POGA 1DGRN 4O7XA 3ZFFB 3D4KA 5CVRA 3RWNA 3BKZA 4IEZA 4Z8BA 5EP9A 1BK0A 1YI9A 3ACGA 3CIHA 4XUOA 1RUNA 2P3YA 3QACA 2XJVA 5DABA 3V0BA 1DYPA 3L2HA 1V6LA 4BISA 4P9YA 1FX5A 1RUE1 2WSVA 5C33A 1LHUA 3IWZA 4BXFA 1LHOA 2X5IA 3R4DB 4WM7B 3AKSA 1H1MA 1ZVFA 2ENRA 3LDKA 3NVCA 3HT1A 4XQWA 5CNAA 2RS11 4UBHA 4AFDA 4MX3A 4TXWA 1D0GA 2RMU3 3BALA 3WF0A 2CSGA 2W1WA 4K1ZA 4QM9A 4E4SA 4F8AA 3RRDA 3VDDB 5FQ0A 1I1EA 1N1VA 3WNLA 1YQ2A 3ZFGA 5A7WA 4KWLA 1WBLA 1YQ8A 4FFHA 4IGQA 3WD5A 1FOD3 5JIAA 4BK5A 2HJIA 3OBAA 2R30A 1NCQC 3BODA 5CG8A 1W99A 5KXEA 1IS5A 2WDBA 2D43A 2XLGA 1AYM3 2Y38A 2OPWA 1OOPA 4JHZA 4QB2A 5GZEA 3LOBA 4ZXKA 2YHJA 3I59B 4Q4V1 3AP6A 1JUHA 3EJKA 3U14A 1HJFA 3M8LA 1GWLA 2FBEA 1XC6A 2Y8KA 1A8MA 2QQWA 1LKNA 2ZAAA 4A4AA 1COV3 1NUKA 4IEUA 2K46A 4QHBA 4YG6A 4DXTA 1KS4A 2KR2A 4N43C 2R1DA 3W20A 4QXBA 3POJA 4JDNA 2F17A 2BU9A 3OPTA 2VTXJ 1VALA 2HWC3 4MH0E 4PT6A 4QQHA 3MIHA 1ZRCA 1W9WA 2PHTA 4UAPA 4Z2WA 1G9AA 5CKNA 2PHLA 1DQ6A 4ARXA 5LEJA 1GZTA 2NN8A 4YW6A 4JHTA 1RUF2 3VDDA 3WEZA 5IVCA 4LKDA 1RTVA 3UJQA 4GULA 1JU4A 2BJSA 2E51A 4JKKA 5FREA 3AC0A 5CEHA 2XOMA 3B9IA 3H1WA 1RB8G 3LEMA 3VLBB 2VGDA 3JBG3 2GMMA 5IT6A 1IQAA 4CCKA 3AM2A 2Y0IA 1I3HA 3PURA 2ZOEB 1JXNA 5JXHA 1J3PA 4LHKA 2JEMA 3VBRA 1HV1A 1WA4A 2V4VA 4INDA 2I74A 5ACA2 3W59A 2QNKA 3MPPG 1OD3A 1W2NA 4XZUG 2WNVC 3U4XA 4MO3M 3K4ZA 3WVJA 3S5AA 4QXCA 3ALQA 2LW8A 4P9XA 4OZOA 4CU9A 5FPBA 1ND3A 4F3JA 2FMDA 3TOJA 3SNMA 5KC5A 1BJQA 3LIGA 4AAXA 1JYTA 4LBJA 3ZSKA 3RYPA 3BOPA 3NL1A 1V9U2 5IAVA 5J3UA 4LIUA 5CFCC 3BCWA 4BQWA 2PHWA 3H8XA 2JD9A 1QOSA 1T6BX 3BTZA 4MOAA 3NNMA 5B4XA 3N3HA 5IUQA 3WXPA 5L7OB 4NRQA 1NYWA 1OVSA 5FZ8A 4AZZA 5LK5A 2Q8OA 3WY6A 4RS5B 1UXZA 4BQYA 5DG1A 1RMU1 2I2SA 4Y5TA 1XNCA 3EO6A 3R4UA 1CAXA 3I2KA 1GBGA 2P17A 2WQZC 3C7EA 4YPJA 1JMUB 3GGLA 4TSVA 5F5AA 2NYYA 1UY1A 2BWAA 5DDJ3 4AF9A 1AYN3 4AYUA 4Y22A 3ILNA 5FBJA 1RUJ1 1PVC2 2PHFA 3AFGA 1VRH1 3E5QA 1H9WA 3LSEA 4K40A 2JXAA 1D0HA 4CXYA 2PHDA 2XHNA 2RS52 2VXJA 3VBRC 1ASJ3 1MS3A 2X5IB 1B35A 1LU1A 4H7MA 4WM7A 1RGSA 5A70A 1B35B 2HWD1 2Y33A 5A7QA 3QBQA 4FOVA 4BQ3A 5F1RA 2VD7A 2E7AA 5FZAA 1W06A 1TZOA 1WZXA 2HWE2 1UU5A 2ZJCA 3JD71 3PHMA 3PLQA 4QDRA 4AHYA 3ZYGA 4Y20B 2JE9A 5FAXA 1SQ4A 3HIFA 5FQ0B 1OH3A 3LEKA 4M01A 4CDQA 5ACA3 5ACA1 1N47A 1TE1B 1UNBA 4CCJA 1AR93 1RHI3 1XSQA 4NPRA 3ZFGB 2D6MA 3C3VA 2KA3A 3BIWE 4LLOA 1SLBA 1JYCA 4M4PA 2YUEA 4CCEA 3P3PA 2VNVA 4PDWB 3WF3A 2IXKA 4DXSA 2WLPA 1GP5A 2ZPXA 1PZ8A 4IV1A 3TB0A 2QBXA 2W46A 5IK8A 2WWUA 3ELNA 3LSDA 3OD4A 4UFKA 3CO2A 4LKEA 1ZRDA 2DVFA 1T2XA 4CXWA 1W2TA 2RS53 2G4IA 4KL1A 3HD8B 4ONUA 5FLHA 4R9AA 1NXMA 2CTVA 1BBT1 2EXJA 3GZAA 3ZXFA 1Q5OA 1GWMA 4L92A 3RGBA 4D3WA 4D6RA 1VBA3 4A2UA 4LBNA 5FO7B 3OD0A 4I30A 3S30A 2HWE3 4BDVB 4IV3B 2AGSA 4NROA 5CIRA 1YC61 3H0OA 4ASMB 1RXFA 1UYZA 4Y1XA 1OI6A 4WVZA 2OQ6A 5FYYA 1C1FA 1PO13 3P1IA 3AP4A 1ZZ7A 4AWDA 4BLJA 5ISLA 4H14A 5KHKA 2TEPA 2W94A 3LPGA 4FQZA 4EN0A 5BNNC 1US2A 2GNTA 4BOWA 2FMYA 1V6MA 2G1MA 3U1XA 4CPBD 3ZO0B 4ARYA 4Z92B 4ATFA 2XKPA 1A34A 4XZPA 1UY3A 3OTFA 4V1PA 3PU8A 4V2WA 5EIYB 2PMWB 3BUCA 1SLIA 1H6XA 4NWVA 2ORZA 3C7OA 3O0XA 2MPFA 2UYBA 1GLHA 1A6CA 3SMHA 3NV2A 1BVVA 2QQVA 4LBKA 3L9JT 3RG0A 2WL1A 4RN5A 1OBNA 1ZM1A 2CU5A 1YCIA 4FO9A 4L8QA 1TMF2 4IERA 2F4LA 1RIRA 2VE1A 1ST8A 4LOSA 3B00A 2L9LA 2RHPA 2DBNA 3ORJA 4L0PA 3HT2A 1UCXA 2W52A 2ZKLA 2BOJA 5GKAC 4FP3A 5JIUA 5AFEA 2LM3A 1L3JA 1H4HA 3WLUA 1MEC2 1GZCA 1E5IA 5FMCA 4DZGA 2GC3A 3THPA 1RUJ3 3T0DA 3B3QE 2H6CA 4QQLA 3RZZA 4FPCA 1BK1A 3MUY1 4YVSC 1C4RA 4R9CA 3VBHB 3BTXA 1HB2A 2TNFA 4Y26A 4JQRA 4Z07A 1VP6A 5ABJA 1LRHA 2DTYA 1CJPA 3O0WA 2J22A 2W68A 3H7YA 3OPZA 1MS8A 3BB6A 3K51A 2YGLA 4XUTA 4AHWA 4YZ2A 1QNYA 2A6WA 2MHFA 1UYYA 4P9WA 4N43B 2VCCA 5E1RA 4OFGA 2OPKA 3FC0A 3WG4A 3DGTA 1NX9A 3WCRA 1E5SA 4RHV2 2JKBA 4GH4A 2YDEA 2VECA 2WA4A 3AP9A 5HV0A 3V0AA 4KBBA 1TEIA 4NVPA 5D1IA 5LA1A 2O8QA 5DAXA 1CAVA 1JZ7A 2IVIB 3MLJA 3ZN6A 1H4GA 1STMA 5F32A 5FMBA 4OMCA 1OD5A 2B9UA 2VJXA 4FPFA 3VHPA 4Y3OA 3B69A 1O4YA 2ZEWA 5LA0A 1NCQB 4NIGA 3OPWA 1COV2 2WSUA 1CN1A 1HN0A 4AEMA 1K45A 1Y43B 1PIV3 3F2ZA 2GNMA 4DY3A 4CEYC 1NQDA 1JYVA 4M00A 3DEMA 5DZEA 3KD4A 2JG8B 4HOOA 1KFUL 2D6NA 4NHKA 4RL7A 3GALA 2GN7A 4UFJA 5BY5A 3DF0A 3FHAA 1QJEA 4X6RB 2C9KA 3VDAA 4Q0VA 1DYKA 2D3RA 4LO7A 2FDJA 5D8AA 3K48A 2JIGA 4AVVA 3OSDA 3UV9A 1FI2A 2ZZJA 1QXJA 5A3UA 5CAZA 3SLIA 1XNDA 4CDUA 2VZUA 1PGSA 2JIJA 3ZMNA 1SBFA 4AFCA 4K20A 1ZZCA 5I8YA 3HN1A 4ISQA 5C7GA 3ZYFA 3SCHA 3SH5A 1MS0A 3NWKA 4ES8A 5J48A 1AR81 1YFXA 3M4FA 3Q8AA 4JKMA 5GJ6A 1GNZA 4AG4A 4PI0A 5L73A 2A3YA 5GLWA 2RJLA 1LB2A 2ARXA 4D7SA 5K4LA 3H8RA 1UX6A 2Y6GA 1VR3A 1MS5A 1REDA 2B8MA 4JVAA 4PHZA 1Q8VA 2CY6A 4D7YA 4Q2FA 3KS7A 1S2BA 2VMDA 2DCZA 4Q4V2 3FFZA 3NJXA 3OGJA 3MIGA 2VZOA 1NLSA 2AH2A 2AEZA 1E5HA 1HB4A 2DFBA 1XYPA 5JSOA 1VBC2 2BV4A 4I0WB 2D40A 3KT1A 2WZR3 4LO6B 1XE0A 3PMSA 5DUWA 2DVDA 3RJRA 3AL6A 4GA9A 2BNNA 1UZ0A 3NJZA 4XJ8A 1JYWA 3ZFEA 2VZPA 3CZJA 3TRSB 5DAVA 2HWD2 4I3GA 2XR4A 2E26A 1U5YA 1GWKA 1AJKA 1L7LA 4N9IA 4PIXA 5BNOC 1W6PB 2QZ3A 3HAGA 4ISRA 2MEV1 2NMOA 2VL4A 4P00B 1PIV1 1HRV2 1W6PA 2Q8CA 4CUAA 1KDMA 5IK4A 1J3RA 4IGOA 4LLFA 4AR2A 2W95A 4UOJA 4CUCA 3K77A 4QPGA 1AR82 1W3VA 4P02B 4WVWA 1H9PA 3MIFA 4Y4RA 5L9BA 1AL0G 1ULGA 3IAPA 1AR92 3IMMA 1KITA 4MGYE 2F6BA 3VZMA 4E2QA 5JXIA 4AK3A 1S0GA 4QGLA 4QX1A 1QNWA 4OHVA 5HCAA 1LOCA 2XDVA 4XMAA 4Y1UA 5M0TA 2QE3A 3I54A 3LE0A 1RUC3 1GKBA 1H1IA 4GB33 4PI2A 2D3PA 2WT0A 2NZ9A 4J1WA 4CXXA 1R091 5F2SA 1MZ6A 2VNOA 3VBUA 1LAJA 4XCAA 2BFUS 2WAOA 4DQAA 5K9YA 2DVBA 2W9XA 2DF7A 1YJLA 4IETA 1LOFA 1YJKA 5CFDA 3V64A 1MZ5A 1XQNA 4K8RB 4JGZA 2A6YA 2YBPA 3D82A 2V4AA 1FNYA 1C5IA 1X33A 5JZGA 3ABZA 5E8AA 2G19A 4IV3A 2WA3A 3ME2A 3LPFA 2WJSA 4GAZA 4L97A 5C8CC 4SBVA 4KU8A 1QMJA 2E31A 4IEYA 2XQRA 4QPIA 3VL8A 4EWEA 2MEV3 5C3SA 1U5ZA 2IC1A 2GMEA 3MFAA 2VBDA 5FMDA 4EV0A 2WWSA 2KM2A 1H1AA 1UF2C 4ZS2A 1US3A 4YW4A 5HXVA 2GNDA 4C1XA 4D6SA 3LA7A 2WO2A 3VHOA 4BA6A 5A3OA 3WF1A 3VZLA 1TNRA 1OURA 2A70A 3I3MA 5JVVA 1M06G 4ZS3A 4BIOA 4C8DA 1N3OA 4GJYA 4W6WA 4BPZA 3VB9A 1BYHA 4CCMA 1W3XA 1QJU3 1LU2A 3DN7A 4QX7A 1RUE3 4AGRA 3WDWA 5I8TA 1DLCA 3SQOA 5KHJA 2VZSA 2DURA 2WNEA 4AI2A 1HRV3 4Q27A 1OPMA 1MPXA 1SFPA 5DAPA 4HLTA 1WUVA 5L19A 2XQXA 1NT0A 3AX4A 2QUOA 4JDMA 1PM7A 3WSOA 3ZXEA 5FXVA 4XTPA 4FPGA 1XE8A 1AXYA 2QQNA 3HMYA 4XFAA 5F37A 4XIOA 3NV3A 2QQKA 1WBFA 3V0AB 5GLUA 3BI3A 2B9VA 3UKNA 3KV5A 2YGMA 4Q8KA 1YFWA 3JD73 1B35C 3WP6A 1OHFA 5EWSA 3R6SA 4AVTA 4LTAA 1K42A 4RR3C 2W87A 4QDQA 3NNGA 1NLRA 3VZOA 4FPOB 1JU3A 1XB9A 3O12A 3POSA 1H0BA 1OKQA 3BPZA 4YW3A 5I91A 2VVFA 2YZ4A 5FYMA 1ZZ8A 4BE3A 4LITA 2NPIA 2DU0A 4QD2A 3CDZB 4MV2A 1RUJ2 1Y7BA 3V0BB 1GUIA 2HLEA 4Y22B 2V5DA 2QCSB 2XGXA 3I97A 5JOZA 3RYKA 5ERLA 4XIKA 1NZCA 3O1PA 1RUG3 4QQPA 1UMIA 3FHQA 1J58A 3U75A 5JUVA 4LHSA 2H0VA 1DP0A 4MZUA 3ATGA 2OS2A 1VBD2 2YBSA 3T09A 4Y5SA 3CU7A 3IT8A 4BCUA 4S2DA 1L7QA 2ZGNA 5KHHA 4N53B 4OUEA 1HQLA 5A7SA 1W8FA 4E2GA 3KCXA 2FDKA 1JH5A 1R1ZA 3RMYA 5IJRA 5FKCA 4K1YA 5FZMA 2CGOA 2JKXA 3OGRA 4M3CF 2Z4FA 2BWCA 3POWA 4RHV3 4WVMB 2IFRA 3FWEA 3TNQA 2B4KA 3HNMA 3VBSC 4CYDA 4DIQA 3ZMOA 2HWB2 2GMPA 2NLRA 1CZTA 4AL9A 1O3TA 1QU0A 2R042 4ZHNA 2IUWA 2WS92 4K9SA 2R0FA 5GZDA 1TQ5A 2RE9A 1WCQA 3VBOA 5FKBA 5FYUA 5FPUA 3S57A 1W9FA 2HEVF 4CP9B 1R64A 3CKHA 4UW4A 3T2PA 4ZZ5A 1ULPA 5FZ3A 1UKGA 4TWTA 5JAXA 3MYXA 2OQ7A 2QQMA 1WKYA 1JOJA 2RR13 4AEJA 1O8SA 4LEJA 2WNUC 3ZXKA 2D5FA 4Q4W3 4HPKA 1DGWX 3H1MA 1CVNA 1D4M1 1OUXA 2P5BA 3K4DA 4N90A 4PBOA 4HVOA 4PBPA 1TME2 2P3KA 1JHNA 5A6ZA 1VBE2 5BYNA 1O4ZA 4CPBA 4Q4Y2 1AL23 1LOAA 1OMIA 2EA7A 1CESA 4MGSA 1W8NA 5JI9A 1ULDA 2AC1A 4N7UA 2HEWF 4IL7A 1H8VA 2KXLA 1VIWB 5EPAA 5EQUA 3K3OA 3KT7A 1RUD3 4FPJA 3KMHA 5I8SA 2D44A 2J1TA 3WG3A 3ZYRA 4I3PA 4WZCA 4Q5OA 2Z79A 3WP5A 4BQXA 2XL7A 4G9SB 3GM8A 4BQ2A 3WNKA 1S1AA 3K4AA 1KEXA 4NPLA 5FZ4A 2R32A 1DQ5A 1FAYA 5LB6A 1G9FA 2QQPA 2GAUA 3NNFA 1W6NA 2SBAA 1OLQA 3N9PA 3HOBA 4WM7C 4EN7B 2W08A 1ONAA 5ABJC 2XLFA 4BHPA 2EXKA 1D4M2 4X8NA 1N3PA 2R7EB 1UWWA 2BDRA 4XAEA 4URTA 5LA2A 5FPXA 5IVFA 1R093 2CWSA 3URFA 1G8WA 5EJ3A 1NCRB 1XXNA 1QJY1 3OF1A 1JZ4A 5LK7B 2BERA 4LJHA 4M4RA 2CGPA 3B7MA 2VULA 5FZLA 4XBNA 4GB31 2WS91 1POV0 3WDYA 2AEYA 4OZXA 3ZX7A 1GOFA 1U12A 5L9VA 1CIYA 4MGIE 2FHRA 4NMIA 4C0BA 4RS5A 3POFA 4QX2A 2ZX1A 3P3NA 1ODNA 3WX5A 2XPJA 1F9KA 5CA6A 1W28A 3HNBM 4KMQA 4QKNA 1EP0A 5B4NA 3AZZA 4LO5B 2YU1A 4YG3A 3LIHA 1ZRRA 2YV8A 2VBBA 3E1F1 1SLAA 4FPEA 1HJGA 4JC1A 1HXS3 2P3JA 4TZDA 5FJKA 4DS0A 3ITQA 2D93A 2A6ZA 1FPN2 1PM4A 3HQUA 1JOBA 3N7LA 4FPHA 4UF0B 1V9U1 3RZKA 4K21A 4JQTA 2VCMA 1U5XA 2E7TA 5E16A 4P9LA 4D7TA 3M3QA 4YNIA 2I45A 2ZCWA 5FZ1A 4LKFA 5IFPA 1XNBA 5J37A 5C8WA 1H2LA 2D98A 1AR72 5F3GA 5BXXA 3LB9A 1AYN2 3ZIXA 1X8EA 3X29B 5EFUA 4PLMA 4Q0UA 4B7KA 1C8NA 1W8HA 2XJPA 2ZX2A 3ILRA 4I01A 2WRAA 5HCFA 3KQ4B 5GLVA 3USSA 2BW8A 4UI9L 1YQCA 1A3KA 1DQ2A 1UY2A 1S0JA 5F39A 1K5MC 2NP0A 4KG0A 1YQ5A 4YZ3A 1DDLA 4AFAA 1BMV2 3KGLA 4BB3A 1XOYA 2DVGA 2XL9A 3WG1A 4FTSA 3GZUC 2DFCA 2N7GA 1BEV2 4AGGA 1LNSA 2WNVB 2ARCA 5D2AA 3VDBA 1FV2A 3B9CA 2WQ8A 3VBRB 4LQRA 3OBZA 4MGQA 1R1A2 3MW4A 1ZBA2 1UIKA 2WFF3 4LXLA 3RZJA 1K3IA 1LGCA 1PNFA 1SHWB 1C28A 2FCTA 1ULCA 3LAGA 1W8OA 3OY8B 4QGMA 4JGYC 3ZDVA 1HIXA 5EXOA 1BBT3 5GLZA 1L7RA 4FVVA 5C70A 4UYBA 2WZPP 4NIHA 3FUQA 3GBWA 1OPOA 1UL9A 4QPYA 3ZN4A 4IEVA 4DUXA 4CU6A 4UW6A 4Y1ZA 1YQ6A 1UZWA 5AC91 3PVEA 4CDQB 4JV4A 2K2SA 4RSUA 5JCTA 5JSRA 3M1HA 1Q8OA 1S0IA 1S2EA 1UN1A 4CZSA 4KGQA 2VQTA 1DQ4A 4AI8A 5FXXA 3KLSA 4AQ2A 5CBLA 3ENRA 1MS4A 3V65A 3N4MA 4FXKB 3KV4A 1UAIA 3VZJA 2ZEXA 3BU0A 4OI0A 1OF4A 3RYRA 3OJBA 1WW4A 2ZEYA 3DYOA 1S0DA 1F2NA 1R1A3 3CZUA 2PAMA 5CADA 1RUC1 2DDUA 4NHYA 3O1OA 2PQSA 2R062 4ZU4A 1OLRA 3LA3A 5DPNA 5FK8A 1W90A 2E6VA 2WO1A 2ZEZA 3RSJA 1WMDA 4NIAA 1CPMA 4OHWA 4CCNA 4QB6A 3AVSA 3Q8BA 4Y24A 4IV1C 5T5OA 1ULFA 4MYEA 3U37A 4MADA 1KXGA 1W39A 2WYSA 1A78A 1PZ9A 3QOPA 4PJYA 3ZYIB 3RZHA 2XVKA 4YYOA 1RUD1 5LRSA 2XONA 4PQ9A 2G9GA 5HI0A 1CX1A 2DWRA 1UMZA 4XXAA 3GBGA 2WO7A 3C7FA 1BCXA 2R1BA 2ZABA 1ND2B 3E6DA 4K7JA 3VBFA 3WQ0A 5C8CB 4YGBA 4HKLA 4B4PA 1H2KA 1H8TA 2RS51 3M2MA 3I7DA 3MF6A 4QU2A 1O3SA 2X8KA 4YW5A 3I3BA 5J96B 3PJQA 1UKRA 3UGFA 1GICA 2IXLA 4DINB 5ABJB 1CWPA 4LIVA 2BZDA 4DEQA 1TMF1 1X36A 2EAKA
chains in the Genus database with same CATH topology
4XUTA 1F4HA 2DCKA 5I0DA 1J84A 4LPLA 1UYYA 2X05A 2LS6A 1JZ6A 2VCCA 2WAAA 2QQLA 1JI6A 1O59A 5IHRA 4A42A 3I2IA 2ID4A 1NX9A 1CZVA 2W1SA 2EIBA 4DUWA 5LA1A 1RYYA 1JZ2A 1JZ7A 4OMCA 2VJXA 4E8CA 1GMMA 3I2HA 2VMFA 1JZ3A 2ZEWA 5LA0A 1GNYA 2E32A 5EJZB 1F4AA 4A6OA 1K45A 3F2ZA 3THDA 1JYVA 3OEBA 1DYOA 3A23A 2VTFA 3FHAA 4PF1A 3IIIA 2C9KA 3VDAA 1UYXA 3DYMA 3SKVA 5IYYA 4P5YA 2YG0A 3WNMA 1D7PM 2VQUA 2CDPA 3T08A 2VZUA 4A44A 3I2GA 4Z2AA 5DMYA 2ZXQA 5C7GA 1HN1A 3LEGA 1UY0A 4JKMA 4AG4A 2W5FA 2VZTA 3CQOA 2C26A 3BGAA 2Y6GA 3C7GA 2VMDA 4IUGA 3NJXA 2WBKA 2VZOA 3T0BA 4TTGA 2Y6KA 5HPOA 3MUZ1 2QQOA 2Y64A 2OKXA 3THCA 3VD4A 4CU8A 3LQCA 4ET7A 1UZ0A 1JYWA 2J7MA 2VZPA 3CZJA 1PX4A 2E26A 4E8DA 2YFUA 1OF3A 2VL4A 4P00B 2VZ3A 4CUAA 3I2FA 2W95A 2YFZA 4UOJA 4CUCA 1CZSA 3K77A 1XNAA 4P02B 5IFTA 3D3AA 2W47A 2KD7A 1PX3A 3P6BA 3IAPA 3GXUA 1EUUA 3A22A 3VD9A 2WZEA 5JXIA 4GWIA 4QX1A 2W92A 2WN2A 2BGPA 3LE0A 4JX0A 3NJVA 2VZQA 3K46A 4ZXEA 2WAOA 5DQ0A 3W5MA 5A1AA 2W9XA 2JDAA 3HEIA 1JHJA 1KGYA 2E33A 4BK4A 3HJRA 3A21A 4BJ0A 3W5NA 3UESA 3ABZA 3WF2A 1GOGA 3LPFA 5CYYA 4PQQA 1I5PA 4A41A 2DCJA 4XUPA 2E31A 2WO3A 5EJ1B 3T2OA 2JE8A 2WUHA 3C8XA 4ZZ8A 1JZ8A 1US3A 1UY4A 2VZ1A 3WNNA 2WO2A 3OGSA 1UXXX 1UX7A 3DECA 3VD7A 3MO4A 3WF1A 2VCAA 3ETPA 4XUQA 1GOHA 1W9TA 3VD3A 3VDCA 3OB8A 3MV01 3JXSA 1TG7A 1DLCA 4CUBA 4HG6B 2VZSA 4CU7A 3HNYM 3OG2A 1MPXA 4LKSA 1TVGA 3MBWA 2XQXA 4ZY9A 2Y6JA 3J7HA 3WSOA 4GWJA 3ZM8A 2QQNA 4QPWA 2QQKA 2VMEA 3NRUA 1PMJX 2B9VA 1GQPA 5JXJA 3ECQA 4QX0A 4XURA 5CZKA 1K42A 2W87A 4QDQA 3NNGA 1JU3A 2QQIA 1BHGA 3PUHA 2J1UA 3CDZB 1IQDC 1GUIA 2HLEA 3ACGA 3CIHA 2V5DA 3I97A 4XUOA 2J1EA 2YC4A 4A3ZA 3I3DA 1UMIA 3WNPA 3WF4A 3FHQA 5JUVA 4LHSA 1DP0A 3T09A 5C71A 1UMHA 1L7QA 3K75B 1NAEA 4OUEA 2W3JA 3DYPA 2VC9A 4TXWA 3WF0A 2W1WA 5IJRA 3PUIA 3I3EA 2JKXA 3OGRA 3WQBA 2Z4FA 2B4KA 3HNMA 5JXGA 3WNLA 1CZTA 4QAWA 1YQ2A 3ACHA 2VR4A 4BK5A 1WCQA 3OBAA 4KI5M 1W99A 2WDBA 2WABA 4JHZA 1R64A 3I2JA 3CKHA 4QB2A 2WZ8A 4ZZ5A 3T2PA 1ULPA 2QQMA 1WKYA 2VCBA 1XC6A 1O8SA 2Y8KA 4JKLA 4A4AA 4DXTA 1NUKA 2VM9A 1JZ5A 3SEPA 3K4DA 2EIDA 2CDOA 5F7UA 4PT6A 1W9WA 4UAPA 2X09A 4MGSA 1W8NA 4DXRA 4ARXA 4QDSA 2W1UA 5FUIA 1JYNA 2J1TA 3WEZA 2RV9A 1XPWA 3WNOA 1JU4A 3UNPA 2YB7A 4JKKA 3GM8A 3WNKA 4W8JA 3AC0A 3K4AA 1KEXA 2XOMA 4XVHA 3HOBA 4W50A 1OT5A 1SG3A 5JXHA 3UETA 2V4VA 1W9SA 4OMDA 4DEVA 2R7EB 1UWWA 1OD3A 4XZUG 5LA2A 4BXSV 4KWUA 4MO3M 3K4ZA 2LW8A 4OZOA 4A45A 4CU9A 3C7HA 5HXMA 1JZ4A 1J83A 2BERA 4M4RA 4AAXA 3FL7A 4RYDA 3SKJE 2JD9A 1GOFA 4MOAA 1ULOA 5B4XA 1CIYA 4QX2A 3FN9A 2VOTA 3T0AA 1UXZA 3HNBM 4KMQA 5B4NA 3MV11 3E1F1 3I2KA 2ORXA 1P8JA 3C7EA 4YPJA 3GGLA 4D0QA 1UY1A 3ACFA 2HYXA 2Y6LA 2XHNA 3EYPA 3OGVA 5IFPA 5DN2A 4GZ9A 3LEIA 2RVAA 4QDRA 4UI9L 2VZVA 2RJ2A 1UY2A 3LEKA 4DUVA 1SDDB 2V72A 1LNSA 4M4PA 3VDBA 3CMGA 2EIEA 3WF3A 4DXSA 2WQ8A 4LQRA 2C4XA 5G05L 4MGQA 1EUTA 3OEAA 2QBXA 4OYUA 2W46A 4FI9A 1T2XA 1K3IA 2BGOA 3EB7A 1SHWB 2W91A 5J1XA 1NKGA 4QB1A 1W8OA 1JYXA 3HPNA 3IB3A 2J1SA 1L7RA 1H6YA 4D8MA 2Y6HA 5C70A 2BBAA 1XNTA 4CVUA 2J1VA 4BDVB 4DUXA 4CU6A 1UYZA 3HN3A 2VMCA 4QX3A 3P1IA 1GU3A 4XUNA 2W94A 3LPGA 2VQTA 1W0NA 4W4ZA 1US2A 2ZEXA 3IAQA 3NQHA 1OF4A 4ARYA 2ZEYA 1UY3A 3DYOA 3CZUA 5EIYB 3ACIA 2DDUA 1H6XA 2PQSA 2ORZA 3C7OA 5DPNA 2WO1A 2ZEZA 2J1RA 4QB6A 2WN3A 4RN5A 2EICA 1O8PA 3T2QA 3U37A 4MADA 2WYSA 2X10A 2L9LA 2QQJA 2YC2A 4L0PA 1K12A 3A7QA 2XONA 5G04L 1OH4A 5JR2A 1CX1A 1PMHX 2VZRA 5LCWL 2J1AA 3C7FA 3T0DA 3MUY1 4P08A 3IDAA 3SEEA 3I3BA 2W1QA 2VO5A 3GDBA 2J22A 3BN6A 2BZDA 4DEQA 3VD5A 5JMOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XUT A;  1F4H A;  2DCK A;  5I0D A;  1J84 A;  4LPL A;  1UYY A;  2X05 A;  2LS6 A;  1JZ6 A;  2VCC A;  2WAA A;  2QQL A;  1JI6 A;  1O59 A;  5IHR A;  4A42 A;  3I2I A;  2ID4 A;  1NX9 A;  1CZV A;  2W1S A;  2EIB A;  4DUW A;  5LA1 A;  1RYY A;  1JZ2 A;  1JZ7 A;  4OMC A;  2VJX A;  4E8C A;  1GMM A;  3I2H A;  2VMF A;  1JZ3 A;  2ZEW A;  5LA0 A;  1GNY A;  2E32 A;  5EJZ B;  1F4A A;  4A6O A;  1K45 A;  3F2Z A;  3THD A;  1JYV A;  3OEB A;  1DYO A;  3A23 A;  2VTF A;  3FHA A;  4PF1 A;  3III A;  2C9K A;  3VDA A;  1UYX A;  3DYM A;  3SKV A;  5IYY A;  4P5Y A;  2YG0 A;  3WNM A;  1D7P M;  2VQU A;  2CDP A;  3T08 A;  2VZU A;  4A44 A;  3I2G A;  4Z2A A;  5DMY A;  2ZXQ A;  5C7G A;  1HN1 A;  3LEG A;  1UY0 A;  4JKM A;  4AG4 A;  2W5F A;  2VZT A;  3CQO A;  2C26 A;  3BGA A;  2Y6G A;  3C7G A;  2VMD A;  4IUG A;  3NJX A;  2WBK A;  2VZO A;  3T0B A;  4TTG A;  2Y6K A;  5HPO A;  3MUZ 1;  2QQO A;  2Y64 A;  2OKX A;  3THC A;  3VD4 A;  4CU8 A;  3LQC A;  4ET7 A;  1UZ0 A;  1JYW A;  2J7M A;  2VZP A;  3CZJ A;  1PX4 A;  2E26 A;  4E8D A;  2YFU A;  1OF3 A;  2VL4 A;  4P00 B;  2VZ3 A;  4CUA A;  3I2F A;  2W95 A;  2YFZ A;  4UOJ A;  4CUC A;  1CZS A;  3K77 A;  1XNA A;  4P02 B;  5IFT A;  3D3A A;  2W47 A;  2KD7 A;  1PX3 A;  3P6B A;  3IAP A;  3GXU A;  1EUU A;  3A22 A;  3VD9 A;  2WZE A;  5JXI A;  4GWI A;  4QX1 A;  2W92 A;  2WN2 A;  2BGP A;  3LE0 A;  4JX0 A;  3NJV A;  2VZQ A;  3K46 A;  4ZXE A;  2WAO A;  5DQ0 A;  3W5M A;  5A1A A;  2W9X A;  2JDA A;  3HEI A;  1JHJ A;  1KGY A;  2E33 A;  4BK4 A;  3HJR A;  3A21 A;  4BJ0 A;  3W5N A;  3UES A;  3ABZ A;  3WF2 A;  1GOG A;  3LPF A;  5CYY A;  4PQQ A;  1I5P A;  4A41 A;  2DCJ A;  4XUP A;  2E31 A;  2WO3 A;  5EJ1 B;  3T2O A;  2JE8 A;  2WUH A;  3C8X A;  4ZZ8 A;  1JZ8 A;  1US3 A;  1UY4 A;  2VZ1 A;  3WNN A;  2WO2 A;  3OGS A;  1UXX X;  1UX7 A;  3DEC A;  3VD7 A;  3MO4 A;  3WF1 A;  2VCA A;  3ETP A;  4XUQ A;  1GOH A;  1W9T A;  3VD3 A;  3VDC A;  3OB8 A;  3MV0 1;  3JXS A;  1TG7 A;  1DLC A;  4CUB A;  4HG6 B;  2VZS A;  4CU7 A;  3HNY M;  3OG2 A;  1MPX A;  4LKS A;  1TVG A;  3MBW A;  2XQX A;  4ZY9 A;  2Y6J A;  3J7H A;  3WSO A;  4GWJ A;  3ZM8 A;  2QQN A;  4QPW A;  2QQK A;  2VME A;  3NRU A;  1PMJ X;  2B9V A;  1GQP A;  5JXJ A;  3ECQ A;  4QX0 A;  4XUR A;  5CZK A;  1K42 A;  2W87 A;  4QDQ A;  3NNG A;  1JU3 A;  2QQI A;  1BHG A;  3PUH A;  2J1U A;  3CDZ B;  1IQD C;  1GUI A;  2HLE A;  3ACG A;  3CIH A;  2V5D A;  3I97 A;  4XUO A;  2J1E A;  2YC4 A;  4A3Z A;  3I3D A;  1UMI A;  3WNP A;  3WF4 A;  3FHQ A;  5JUV A;  4LHS A;  1DP0 A;  3T09 A;  5C71 A;  1UMH A;  1L7Q A;  3K75 B;  1NAE A;  4OUE A;  2W3J A;  3DYP A;  2VC9 A;  4TXW A;  3WF0 A;  2W1W A;  5IJR A;  3PUI A;  3I3E A;  2JKX A;  3OGR A;  3WQB A;  2Z4F A;  2B4K A;  3HNM A;  5JXG A;  3WNL A;  1CZT A;  4QAW A;  1YQ2 A;  3ACH A;  2VR4 A;  4BK5 A;  1WCQ A;  3OBA A;  4KI5 M;  1W99 A;  2WDB A;  2WAB A;  4JHZ A;  1R64 A;  3I2J A;  3CKH A;  4QB2 A;  2WZ8 A;  4ZZ5 A;  3T2P A;  1ULP A;  2QQM A;  1WKY A;  2VCB A;  1XC6 A;  1O8S A;  2Y8K A;  4JKL A;  4A4A A;  4DXT A;  1NUK A;  2VM9 A;  1JZ5 A;  3SEP A;  3K4D A;  2EID A;  2CDO A;  5F7U A;  4PT6 A;  1W9W A;  4UAP A;  2X09 A;  4MGS A;  1W8N A;  4DXR A;  4ARX A;  4QDS A;  2W1U A;  5FUI A;  1JYN A;  2J1T A;  3WEZ A;  2RV9 A;  1XPW A;  3WNO A;  1JU4 A;  3UNP A;  2YB7 A;  4JKK A;  3GM8 A;  3WNK A;  4W8J A;  3AC0 A;  3K4A A;  1KEX A;  2XOM A;  4XVH A;  3HOB A;  4W50 A;  1OT5 A;  1SG3 A;  5JXH A;  3UET A;  2V4V A;  1W9S A;  4OMD A;  4DEV A;  2R7E B;  1UWW A;  1OD3 A;  4XZU G;  5LA2 A;  4BXS V;  4KWU A;  4MO3 M;  3K4Z A;  2LW8 A;  4OZO A;  4A45 A;  4CU9 A;  3C7H A;  5HXM A;  1JZ4 A;  1J83 A;  2BER A;  4M4R A;  4AAX A;  3FL7 A;  4RYD A;  3SKJ E;  2JD9 A;  1GOF A;  4MOA A;  1ULO A;  5B4X A;  1CIY A;  4QX2 A;  3FN9 A;  2VOT A;  3T0A A;  1UXZ A;  3HNB M;  4KMQ A;  5B4N A;  3MV1 1;  3E1F 1;  3I2K A;  2ORX A;  1P8J A;  3C7E A;  4YPJ A;  3GGL A;  4D0Q A;  1UY1 A;  3ACF A;  2HYX A;  2Y6L A;  2XHN A;  3EYP A;  3OGV A;  5IFP A;  5DN2 A;  4GZ9 A;  3LEI A;  2RVA A;  4QDR A;  4UI9 L;  2VZV A;  2RJ2 A;  1UY2 A;  3LEK A;  4DUV A;  1SDD B;  2V72 A;  1LNS A;  4M4P A;  3VDB A;  3CMG A;  2EIE A;  3WF3 A;  4DXS A;  2WQ8 A;  4LQR A;  2C4X A;  5G05 L;  4MGQ A;  1EUT A;  3OEA A;  2QBX A;  4OYU A;  2W46 A;  4FI9 A;  1T2X A;  1K3I A;  2BGO A;  3EB7 A;  1SHW B;  2W91 A;  5J1X A;  1NKG A;  4QB1 A;  1W8O A;  1JYX A;  3HPN A;  3IB3 A;  2J1S A;  1L7R A;  1H6Y A;  4D8M A;  2Y6H A;  5C70 A;  2BBA A;  1XNT A;  4CVU A;  2J1V A;  4BDV B;  4DUX A;  4CU6 A;  1UYZ A;  3HN3 A;  2VMC A;  4QX3 A;  3P1I A;  1GU3 A;  4XUN A;  2W94 A;  3LPG A;  2VQT A;  1W0N A;  4W4Z A;  1US2 A;  2ZEX A;  3IAQ A;  3NQH A;  1OF4 A;  4ARY A;  2ZEY A;  1UY3 A;  3DYO A;  3CZU A;  5EIY B;  3ACI A;  2DDU A;  1H6X A;  2PQS A;  2ORZ A;  3C7O A;  5DPN A;  2WO1 A;  2ZEZ A;  2J1R A;  4QB6 A;  2WN3 A;  4RN5 A;  2EIC A;  1O8P A;  3T2Q A;  3U37 A;  4MAD A;  2WYS A;  2X10 A;  2L9L A;  2QQJ A;  2YC2 A;  4L0P A;  1K12 A;  3A7Q A;  2XON A;  5G04 L;  1OH4 A;  5JR2 A;  1CX1 A;  1PMH X;  2VZR A;  5LCW L;  2J1A A;  3C7F A;  3T0D A;  3MUY 1;  4P08 A;  3IDA A;  3SEE A;  3I3B A;  2W1Q A;  2VO5 A;  3GDB A;  2J22 A;  3BN6 A;  2BZD A;  4DEQ A;  3VD5 A;  5JMO A; 
#chains in the Genus database with same CATH topology
 4L99 A;  1F4H A;  4MHR A;  2X05 A;  3LD8 A;  1LOF C;  2EIG A;  5CFD C;  1OUS A;  1SFY A;  1VRB A;  2ZML A;  1AX1 A;  1EAH 2;  1S55 A;  3GZE A;  3I2I A;  3PUS A;  4GD4 A;  4G4F A;  4XXP A;  2AYH A;  4IGP A;  1CZV A;  4EE2 A;  4K3U A;  4DUW A;  2EIB A;  2XJT A;  1NA1 C;  5EYY A;  1FMD 1;  4WM8 C;  1RYY A;  2QQU A;  2Z69 A;  3O14 A;  4S2F A;  4AI9 A;  4QXK A;  3S7I A;  1S4C A;  4M3C E;  2VUC A;  2BRT A;  3NNJ A;  4Q4Y 3;  5FYZ A;  2PXJ A;  4NII A;  5FCC A;  1W8T A;  3WIN E;  1SFN A;  4CDX C;  2VMF A;  4QHO A;  4LMF A;  4FT8 A;  4X6Q B;  2Q8D A;  1Y9Q A;  5C3R A;  2ZAH A;  4RQP A;  2VXR A;  4XJZ A;  2G9Z A;  1EY2 A;  1GFF 2;  2OUJ A;  2Y6F A;  4HFS A;  1YNA A;  1F4A A;  4LA3 A;  3RZL A;  3N9L A;  3J26 N;  1WCS A;  1EPZ A;  4DRR A;  2Q5T A;  3JBG 2;  4AHX A;  4BM8 A;  4GIQ A;  4YSF A;  2P1B A;  3AP5 A;  2K0G A;  1V00 A;  2UWB A;  2IXH A;  4HXC A;  3DKW A;  4HPK B;  4A7K A;  4NID A;  1D4M 3;  3KVA A;  3ZR6 A;  5A80 A;  5F3I A;  4PF1 A;  2HWC 1;  5C4W C;  1HRI 2;  4DMI A;  5BNQ A;  1R09 2;  1UD1 A;  2RM2 2;  2YG0 A;  1IG3 A;  3VHR A;  1LED A;  2VQU A;  3ZSM A;  2DCY A;  4OUS A;  1LHV A;  2VNG A;  5C6C A;  1BZW A;  2AUY A;  5FY4 A;  1PO2 3;  3JB4 C;  2P6C A;  2GC0 A;  4IEP A;  3I2G A;  4LE4 A;  4Z2A A;  1KFX L;  2HWF 1;  2ZAC A;  2ZXQ A;  4QPI B;  4MET A;  4DPN A;  5DMY A;  3H7J A;  1UY0 A;  1SMV A;  4GKX A;  4RA0 A;  3VBS A;  5F5I A;  4P9J A;  1MVE A;  1R1A 1;  2VZT A;  1AXK A;  2WFP A;  2P3I A;  1JBC A;  1N3Q A;  2ZX4 A;  2GH2 A;  3E5X A;  3AKR A;  4XJA A;  1HRV 1;  4P5H A;  3C7G A;  2XJQ A;  2QFE A;  1VBD 1;  1RUH 3;  1UU4 A;  2DCT A;  4WM8 A;  2QTW B;  4B3N A;  4IUG A;  1JUI A;  4HK8 A;  1IZ3 A;  2X5I C;  4I09 A;  3UKV A;  3KWV A;  4IV1 B;  4XDQ A;  5T5L A;  5HPO A;  3AP7 A;  5GZC A;  4EZ4 A;  3GCW A;  5I0R A;  2Y64 A;  1NZI A;  2K9Z A;  1WCU A;  2OKX A;  4DFS A;  5LY2 A;  2R04 1;  3LKJ A;  4HT1 T;  3CLP A;  3TBD A;  3OUJ A;  2HWB 1;  1LGN A;  4ET7 A;  1ENS A;  5A6Y A;  1OSG A;  2D97 A;  4FTE A;  5DG2 A;  1HLC A;  3JU9 A;  1PX4 A;  1ODM A;  5FPZ A;  1OQ1 A;  1QJU 2;  3MDP A;  4UXA A;  2VOW A;  1LTE A;  2JX9 A;  2YFU A;  3LWC A;  3RNS A;  2FD8 A;  2X53 S;  5FYH A;  3LFM A;  1GR3 A;  3N9O A;  4IXL A;  1MQT B;  4KG8 A;  5DAW A;  5GZF A;  2WWJ A;  3I2F A;  4OUM A;  2RDQ A;  5LW9 A;  1O4T A;  2ZHL A;  1OQD A;  1SZB A;  2GNB A;  2ZGU A;  4G3Y C;  4GJZ A;  4PDW A;  2D3S A;  3WP3 A;  3OCP A;  3OYW B;  5BNP C;  3AMQ A;  2WQ4 A;  1C8M 1;  1EUU A;  3VD9 A;  4ASK A;  4CCD A;  4GWI A;  3AKQ A;  3Q8F A;  3ZVX A;  4LK6 A;  2GH8 A;  4HN1 A;  5LAS A;  2FCV A;  4NHL A;  3TEZ A;  2ZS6 B;  1QF3 A;  2GAL A;  4NE9 A;  2C6S A;  1DIW A;  3OGG A;  5F2W A;  3O1U A;  4JX0 A;  4DY5 A;  4JRL A;  3LOI A;  4HN0 A;  3PU3 A;  1ALY A;  5IAT A;  3W5M A;  3PVB B;  2PHX A;  5LBE A;  3PUA A;  5JSP A;  5J7M A;  1YIF A;  5FOB B;  4HMZ A;  1KGY A;  1BQP A;  2RS3 2;  1ZYB A;  4NWW A;  4YM0 A;  4EJR A;  2PEL A;  4BJ0 A;  3W5N A;  1WCD J;  1PZ7 A;  3UES A;  5IVB A;  3GZT B;  4R9D A;  3RI8 A;  3KB5 A;  1GNH A;  1ZX5 A;  5CYY A;  4AGV A;  1OVP A;  5SV8 A;  4XUP A;  3ASI A;  1H8T C;  4KGG A;  1JZ8 A;  2XUM A;  3C8X A;  4ZZ8 A;  3ZLI A;  1YXW A;  3LGR A;  1X82 A;  3TYJ A;  2BTV C;  2PHR A;  2JG9 B;  4CP2 A;  3H8O A;  3PIJ A;  1GQH A;  1V0A A;  4MUV A;  4HSL A;  1E57 A;  1FXZ A;  1JOP A;  2VCA A;  4QKD A;  1NOV A;  1HXS 1;  3ZFF A;  5JPM B;  4ES9 A;  2WNV A;  1GOH A;  1ZA7 A;  4MGT A;  4AED C;  2C5D A;  4DOU A;  1QGL A;  4UBG A;  5APA A;  2Y0O A;  3DPR C;  4D6Q A;  1TG7 A;  2I07 B;  5KWR A;  3WDU A;  4GH4 C;  3AZY A;  4MXV A;  4J1X A;  2WFF 1;  1EAH 1;  3J7N A;  3OG2 A;  3VGI A;  5FZD A;  1QWR A;  1TME 1;  2GP5 A;  4FFG A;  4N9H A;  4XAA A;  3AJZ A;  3NW4 A;  3BU7 A;  2JIC A;  2CGN A;  3DV8 A;  3KV6 A;  4XE9 A;  2VU9 A;  5A6X A;  2Y6J A;  2VQA A;  3J7H A;  1VLN A;  3H3U A;  3JQX A;  2OW4 A;  3ZM8 A;  5BNN B;  4EWA A;  4OHX A;  4UFM A;  1XU2 A;  2IWG B;  4AVC A;  3IM0 A;  1FV3 A;  2VME A;  1NA1 B;  4CDX A;  1HW5 A;  4CDU B;  5FY9 A;  3WHT A;  1D2Q A;  5JXJ A;  4XW3 A;  1MS1 A;  4QX0 A;  1QJY 3;  1QY4 A;  4FFF A;  5CZK A;  5FZO B;  3VBH C;  1HB3 A;  1HQW A;  1UOJ A;  1PK6 B;  4CEW C;  3NNL A;  2QQI A;  4M3C A;  1YIP A;  4L2N A;  5C8C A;  2LRO A;  3A4U A;  4I0A A;  3WW3 A;  3I2O A;  2NMN A;  2ZHK A;  4LT5 A;  5D8A C;  4MLO A;  1IQD C;  5KC6 A;  5BUV A;  2BEO A;  1QJX 1;  2D6L X;  2J1E A;  2QVS B;  2YC4 A;  3I59 A;  3ZFF C;  4PCR A;  4Q26 A;  1QQP 1;  3WF4 A;  5CKQ A;  5FFO C;  1JN2 P;  1SPP A;  1W6O A;  3H42 B;  4YGE A;  3O1V A;  2A3W A;  3CNA A;  1H2N A;  5C71 A;  4GMP 0;  3L2Y A;  4XJW A;  1NAE A;  1PIV 2;  1XSR A;  4S2G A;  3DYP A;  3APB A;  3POI A;  4XHX A;  5K0U B;  3QH6 A;  3FZ3 A;  2FDH A;  1PK6 C;  1W2U A;  1RC6 A;  4RGA A;  1VMJ A;  3KGZ A;  5JXG A;  2A7A A;  1DG6 A;  2VVD A;  3HVD A;  4XFF A;  4XIL A;  1ZZ9 A;  4QAW A;  2P2K A;  2VR4 A;  3K2O A;  3M70 A;  1WLW A;  4YM2 A;  4OI4 A;  1SDW A;  5GM0 A;  1QHD A;  2YY1 A;  4M3C B;  4PIZ A;  4LO8 A;  2AZ5 A;  2WAB A;  3AZV A;  4H55 A;  4KH9 A;  5FXW A;  2ZGL A;  1S0E A;  2WZ8 A;  4IEQ A;  1V6N A;  2XH6 A;  5EV7 A;  5FYS A;  4CP9 A;  1QDO A;  2QKD A;  2DV9 A;  2A6V A;  5D21 A;  3WW4 A;  3ZYB A;  1EPW A;  3ON7 A;  4QU1 A;  2VM9 A;  1JZ5 A;  4WV8 A;  3SEP A;  2JG8 A;  4N53 C;  1LUL A;  3RI9 A;  4KWK A;  3R05 A;  1X9T A;  4AFB A;  5C9A C;  2AR6 A;  4OQ8 A;  5F7U A;  3TN9 3;  2IXI A;  4HL0 A;  3WW1 A;  3ZXL A;  2HWD 3;  3NKT A;  4M0H A;  3AL5 A;  2JDZ A;  4Q8L A;  2VOV A;  2GDF A;  4XTM A;  4EN6 B;  2JB8 A;  4Q29 A;  5BNO A;  2ERF A;  2XXZ A;  4QDS A;  1IS4 A;  4CCL A;  1JYN A;  4N53 A;  4RS5 C;  4YZ4 A;  3O1M A;  2JB4 A;  2RV9 A;  1NY7 1;  5LEK A;  5FYC A;  2ZKN A;  1VBE 3;  1AVB A;  1QIQ A;  1LOD A;  1RJ8 A;  2JDH A;  4NRM A;  3UGH A;  2YB7 A;  4FOQ A;  4C0H A;  2D7F A;  4W8J A;  4RQP B;  3NV1 A;  1SLL A;  2BNO A;  2EAL A;  5A1F A;  4XVH A;  1RUG 1;  1YO8 A;  2B45 X;  1WD3 A;  5FDB A;  2NM1 A;  3SCF A;  4I02 A;  3VDD C;  1CAX B;  3ZKU A;  5A32 B;  4QX5 A;  4W50 A;  1OT5 A;  1VBB 1;  4IW3 A;  4LBQ B;  1SG3 A;  5A33 A;  3FLP A;  4C1W A;  3UT0 A;  4OMD A;  2RM2 3;  4JCK A;  4DEV A;  2JDM A;  2YBK A;  3AYE A;  3WQ7 A;  4BXS V;  4KWU A;  3SH3 A;  4URA A;  2XJS A;  2HWF 3;  4Y1Y A;  3D0J A;  3N36 A;  4AHZ A;  4ERO A;  3C7H A;  5HXM A;  1J83 A;  4XBQ A;  5FXZ A;  4RGG A;  3TAY A;  1S2K A;  1ACC A;  1V6J A;  4ZON A;  3U11 A;  4LA2 A;  2ET1 A;  1VE0 A;  4F7Z A;  2VPV A;  5HBA A;  3AB0 A;  1UZY A;  1W8W A;  3SKJ E;  4IEW A;  1WLC A;  1IGO A;  1K5M A;  1PGW 1;  2JG8 C;  3FN9 A;  2VOT A;  4E4D X;  3T0A A;  2JWP A;  2MNG A;  1FPN 1;  1ND2 A;  2W39 A;  3KQR A;  3MV1 1;  4H7L A;  3ZXG A;  1EV1 3;  3J8F 3;  4O9E A;  2ORX A;  1P8J A;  4J6G A;  1ULE A;  5HCH A;  4PLN A;  4Z1V A;  1XYO A;  1JOD A;  4D0Q A;  5FR3 A;  1AX2 A;  2Z5W A;  2OZ6 A;  3VKL A;  1QOO A;  2GZW A;  4NOT A;  2Y6L A;  3FBM A;  4BIF A;  3JUU A;  1RUI 1;  5A7P A;  1O7F A;  3AXD A;  5SV5 A;  2VH9 A;  1JW6 A;  3BIE A;  3I2D A;  3PL0 A;  1WW5 A;  4V2V A;  5H9S A;  3EYP A;  4AQ6 A;  3OGV A;  5FLJ A;  3H3L A;  1ND3 B;  4W65 A;  4AVS A;  2B7Y A;  3ZYP A;  1UOG A;  4RFT 0;  1CJD A;  3GJB A;  1OFS A;  2P37 A;  3IN9 A;  1MZF A;  2JDN A;  1QXP A;  4P9G A;  1DBN A;  5FY8 A;  2R07 1;  3KZ4 C;  1Z78 A;  5BNN A;  3LDB A;  1WW7 A;  4OQ9 A;  5DUX A;  2RJ2 A;  1QXR A;  2VUD A;  3BYW A;  3UJO A;  2YPJ A;  5B2G B;  3MW3 A;  3VV1 A;  2VW2 A;  1VBC 1;  2E7Q A;  2R49 A;  4OHZ A;  4XYX A;  4WVV A;  4COU A;  1VBC 3;  3AYD A;  4DUV A;  1SDD B;  3MW2 A;  1PO1 1;  3GF6 A;  2IXJ A;  4UFL A;  1Y4W A;  4YFZ A;  4YZ1 A;  3PNA A;  2CNA A;  1EV1 2;  2PFW A;  3D6E A;  3J8F 2;  1Q56 A;  5JWP A;  4Q1P A;  2FDI A;  4YVW C;  3RWK X;  5G05 L;  2C4X A;  2LAL A;  4XAB A;  3HR9 A;  3OEA A;  4OYU A;  4CEY A;  4CP1 A;  5F9T A;  4AE2 A;  4MGK E;  4FI9 A;  2WT2 A;  5FO9 B;  5EYX A;  1QQP 3;  4UW5 A;  3EB7 A;  4LO4 B;  1Z7S 3;  5LWB A;  5J1X A;  3FLR A;  4XF1 A;  1IHM A;  2PAK A;  3WT3 A;  2WLQ A;  4OUL A;  3WDV A;  3KSC A;  3HPN A;  1JYX A;  1PMI A;  2J1S A;  1HKD A;  1H6Y A;  3AYA A;  4D8M A;  1DQ0 A;  1XBF A;  1KS5 A;  1O6U A;  4CVU A;  5GZG A;  1PO1 2;  4AED A;  4COW A;  5IVE A;  2JD4 A;  1CD3 G;  1UIJ A;  1VPH A;  2H6B A;  4CDU C;  1DZR A;  2ATF A;  3HN3 A;  2VMC A;  1W9Y A;  3N7J A;  1BBT 2;  3CJI A;  3RS6 A;  1GP6 A;  1RHI 1;  4JRA A;  1GU3 A;  4XUN A;  3JD7 2;  4Y33 A;  1VBA 2;  2ZZQ A;  4WBB A;  3ZR5 A;  4CUG A;  4A7Y A;  2HKX A;  4W4Z A;  2UY9 A;  4CTE A;  5IVV A;  5JOW A;  5FZ7 A;  1G86 A;  3H9A A;  2R06 3;  1DHK B;  2Q30 A;  5FRA A;  5FY7 A;  4MXW A;  4R9B A;  3RQ0 A;  1POV 1;  4ZPI A;  3IMN A;  4AEK A;  3D8C A;  2ARE A;  3ACI A;  3BPS A;  4QKB A;  4Q4W 2;  1IPK A;  4KQ7 A;  2XG3 A;  4PF5 A;  1TME 3;  3F95 A;  3IBM A;  4H3W A;  1ASJ 1;  5AC9 3;  1PGL 2;  2VOK A;  2J1R A;  5T5J A;  5HV4 A;  3IDE A;  2ADD A;  4FOW A;  2EIC A;  1O8P A;  4HVR A;  1UZV A;  3T2Q A;  3B93 A;  4BWO A;  2PLV 1;  3N7M A;  4IES A;  2OUH A;  1FT9 A;  4JAA A;  2CV6 A;  5FWJ A;  2QQJ A;  4LUK A;  3TEW A;  2VUA A;  1K12 A;  4Y20 A;  2BUK A;  1GZW A;  1RUE 2;  2PTM A;  5FP7 A;  1OH4 A;  3AMP A;  2BQP A;  4OVE A;  2XWB B;  1LEM A;  2A75 A;  4YAR A;  2MEV 2;  1LOE A;  1SAC A;  1WCK A;  1PMH X;  1W05 A;  1NQJ A;  2VZR A;  1N1T A;  2J1A A;  1RUI 3;  1UOB A;  2QZ2 A;  3WHU A;  3S5Q A;  1LHW A;  2XJR A;  3AMM A;  5GAL A;  3VKO A;  5L9R A;  4P08 A;  1REF A;  2VVE A;  2A73 B;  4S2H A;  3WNX A;  3AJY A;  2DTW A;  1PVC 1;  2ADE A;  3SEE A;  3TEY A;  2W1Q A;  2VO5 A;  2VMI A;  4FOY A;  5BNP A;  4XF3 A;  3BN6 A;  3KCY A;  5GLT A;  5A33 B;  1RMU 3;  3IPV B;  5F5Q A;  5JMO A;  2CWM A;  3FJS A;  3Q8C A;  1XE7 A;  2PAE A;  1ZZB A;  1J84 A;  4LPL A;  4CCO A;  3UKT A;  3HBZ A;  1JZ6 A;  1PGL 1;  2WAA A;  3AK0 A;  3ES1 A;  1O59 A;  3RZM A;  5IHR A;  5FZH A;  4EN9 B;  4A42 A;  2BVB A;  3J7M A;  1VAM A;  1J1L A;  2Q1Z B;  4GH4 B;  4W6Y A;  2IXC A;  3PVN A;  4E4H A;  1WWY A;  1PO2 1;  2BFU L;  5JZG C;  5FZC A;  1V70 A;  5A1L A;  4AED B;  4HK9 A;  2DBI A;  5FYT A;  1JZ2 A;  3KF5 A;  3N9M A;  3Q9O A;  3ZYJ B;  1LJ7 A;  2AAC A;  4E4Z A;  1CR7 A;  1S0C A;  1JTZ X;  1NY7 2;  4AXO A;  1GMM A;  4TYS A;  2H0B A;  2VUJ A;  3NKG A;  4IDZ A;  5FTT C;  4Z82 A;  4DRV A;  3THD A;  4QWN A;  1YFU A;  1JZ3 A;  4B1M A;  1W6N B;  3WOG A;  3CHX A;  5A3N A;  1GNY A;  4HVQ A;  1UU6 A;  5F3C A;  3POB A;  2GC2 A;  5FZK A;  4DB5 A;  1DQ1 A;  1OFN A;  3VBH A;  1H30 A;  5A32 A;  1IKQ A;  3N7K A;  1PVC 3;  1T6G C;  1SBD A;  3M3C A;  2A1X A;  4R52 A;  4XQD A;  5DAQ A;  3OEB A;  4ZU5 A;  1OC1 A;  5FP8 A;  5HCB A;  4FCA A;  2VNR A;  4HON A;  5IW0 A;  4AAP A;  4HET A;  4D69 A;  1G6N A;  2BGC A;  1W2A X;  3RJ2 X;  2BYV E;  5T54 A;  3UYJ A;  2YXS A;  1HQN A;  2ZTN A;  5IWF A;  2Z2S B;  5KHI A;  4GAL A;  1UPI A;  2WNO A;  4TLG A;  2HEY F;  3DYM A;  3SKV A;  4Y1V A;  5IYY A;  3WNM A;  2OX0 A;  1D7P M;  4M0N A;  5FOJ B;  4FXG B;  5FPA A;  1JS9 A;  5C5T A;  1ZRE A;  4A44 A;  5FZB A;  4YW7 A;  2CAV A;  3TWI A;  3M7A A;  4JTO A;  3T1M A;  1G9D A;  2ZBJ A;  2WKK A;  2ZMK A;  3BTA A;  4U36 A;  1HN1 A;  1K5M B;  2JDY A;  5FZO A;  3ZSE A;  3B01 A;  1IOA A;  2FQP A;  3RFR A;  1BEV 1;  4IE0 A;  1AXZ A;  2GC1 A;  2W5F A;  3J9S A;  1VJ2 A;  4ORF A;  5F3E A;  5JI7 A;  1CX4 A;  3V56 A;  4EWD A;  2JG9 A;  3BVC A;  2C26 A;  3RPQ A;  3BGA A;  2LUW A;  1W03 A;  4NJ4 A;  3S6P A;  4XQ4 A;  3KHB A;  1BKZ A;  1UO9 A;  5FP9 A;  1OLM A;  1XU1 A;  4KBZ A;  3AMH A;  5ANN A;  4JGY A;  3T4H B;  4IE5 A;  2YU2 A;  1R08 2;  4EN8 B;  5CFC A;  2Y6K A;  1J1T A;  1XRU A;  4FFI A;  2RDR A;  4TTG A;  3O1S A;  2QQO A;  3JQW A;  2Y60 A;  3CF6 E;  1KD7 A;  2P4E A;  4IQP A;  3VD4 A;  3JB8 A;  1O91 A;  5FY0 A;  3HBK A;  2XKO A;  5FY5 A;  3WUC A;  3LQC A;  1RVF 3;  2ZGS A;  4BLI A;  1LCL A;  5I0S A;  1HRI 3;  4FSJ A;  1RVF 1;  2J7M A;  3GBF A;  1DZQ A;  4QQ2 A;  4CRQ A;  3WDX A;  1MAC A;  3M3E A;  1AL2 1;  1Q8Q A;  4LE3 A;  2WZR 2;  2B39 A;  5C9A B;  3ZN6 B;  2ZGR A;  4TLF A;  2P34 A;  4LBQ D;  3MZH A;  1UZZ A;  5C4W A;  2VZ3 A;  2AEN A;  4HBN A;  5A3T A;  4NN0 A;  3WQ1 A;  2UUR A;  1VRH 2;  4UWD A;  3ST7 A;  3H8U A;  3OYW A;  1F35 A;  3EMR A;  1CZS A;  3FLT A;  1XNA A;  2A71 A;  2UWA A;  2O0O A;  3D3A A;  2W47 A;  3DUI A;  5DDJ 2;  4F83 A;  4Y4Y A;  1PX3 A;  4Q4W 1;  3P6B A;  1RUC 2;  5FPV A;  1RXG A;  1Y9M A;  3HQX A;  1QJX 2;  4J25 A;  2XJU A;  4Q1R A;  5EHD A;  2Q4S A;  2D6O X;  1CPN A;  5JLV A;  2DUP A;  4MXW B;  2BGP A;  3VN4 A;  2ZGT A;  4ZKT B;  4YWA A;  5A7O A;  4CSW A;  4P9I A;  3J7L A;  2CHH A;  4LOT A;  5IVJ A;  4JGY B;  1CGP A;  3WW2 A;  4MG2 A;  2RS3 3;  1LHN A;  1SCR A;  2VZQ A;  3K46 A;  3POE A;  3VHN A;  2V5Y A;  5LRR A;  3PUQ A;  4B8E A;  3M3O A;  4RR3 A;  4XCB A;  2DUQ A;  5IK7 A;  2JDA A;  3HEI A;  4GB3 2;  1O3R A;  1JHJ A;  1U5I A;  1VAV A;  2E33 A;  2RM2 1;  2GU9 A;  3G6J B;  3OUI A;  2XBO 2;  3I3Q A;  1FYU A;  4XJU A;  4DXZ A;  1J3Q A;  1Q3E A;  3WF2 A;  3POY A;  4AVA A;  4Q0Q A;  1YHF A;  1RHI 2;  3I4I A;  4N8M A;  4A41 A;  2B42 B;  5A3L A;  5JMC A;  3LF7 A;  2CYF A;  2VY0 A;  2VW1 A;  5LY1 A;  5EJ1 B;  3T2O A;  3NAP A;  1KRI A;  2JE8 A;  2ZGP A;  4JZR A;  3VBF C;  3QLQ A;  2UU8 A;  1VRH 3;  2XWJ B;  1DGW A;  1PNG A;  1LR5 A;  2VZ1 A;  2BBV A;  2UY8 A;  3DPR B;  1VBB 2;  3OGS A;  1Z7S 1;  1REE A;  3DEC A;  2WC2 A;  3MO4 A;  3VD7 A;  2UYA A;  1O5U A;  3DKQ A;  3NV4 A;  4XUQ A;  4ZU7 A;  3MIC A;  1W9T A;  4XEZ A;  3VD3 A;  5FMO S;  4R4X A;  1WMX A;  4CEY B;  3MV0 1;  2V73 A;  2ZA9 A;  5AFB A;  3INA A;  4QX8 A;  1EYB A;  4YZ5 A;  3CBN A;  1OA3 A;  3M3I A;  3EQE A;  4CUB A;  1EV1 1;  3J8F 1;  4HG6 B;  4CDW A;  4CU7 A;  1Y9G A;  2A5Z A;  3PVO A;  3IZO A;  3MPB A;  2YRO A;  5F5C A;  3CL1 A;  4YG0 A;  1TVG A;  1UQX A;  3MBW A;  5CFD B;  4OHY A;  4COV A;  1AYM 1;  3PME A;  4ZY9 A;  4CEW A;  4XHB A;  3VBU B;  1MQT C;  1AR9 1;  1AR7 3;  5FP3 A;  2Z42 A;  2FCU A;  1AR6 1;  1WW6 A;  2D5H A;  2ET7 A;  4LK7 A;  5DUV A;  2UWC A;  1YI7 A;  2XBO 3;  4QPW A;  5FYB A;  2QDN A;  2PQQ A;  3TEX A;  3ZXA C;  4AFM A;  1C8M 3;  2EXI A;  3ECQ A;  3P5B A;  4XUR A;  3MIB A;  3MHZ A;  4DO0 A;  3JCI A;  2TUN A;  2ZMN A;  3VKN A;  2QJV A;  5FYV A;  4QQO A;  4X8P A;  1FOD 2;  1YLL A;  1EAH 3;  1F31 A;  3E5U A;  5E88 A;  5T55 A;  4P14 A;  1IPJ A;  2C0Z A;  3PUH A;  2PYT A;  2J1U A;  3N9N A;  5IAX A;  2XHK A;  1H8T B;  1RUI 2;  2ARA A;  4XMI A;  1B09 A;  1RIT A;  2ZGQ A;  1YYN A;  1SLC A;  4NPM A;  4XF9 A;  5E6H A;  3WG2 A;  4AOC A;  2CL2 A;  4UW3 A;  4CP0 A;  2HBU A;  4EQV A;  4N7I A;  3MFC A;  5FZ0 A;  2RG4 A;  4A3Z A;  3I3D A;  4N43 A;  3AZX A;  3WNP A;  3ZDS A;  4Q0S A;  4BMB A;  2F4P A;  4SLI A;  4LNV A;  1ZRI A;  2ZGM A;  4XFH A;  3O0V A;  1RMU 2;  4XFG A;  5L7O C;  1UMH A;  1MZE A;  4OLL A;  4A3X A;  1WGP A;  1GZ9 A;  3K75 B;  2RS1 2;  4YVS A;  5BPX A;  3NO8 A;  3E6C C;  2W3J A;  2VC9 A;  2RDN A;  2WS9 3;  3K3N A;  2YPD A;  1FAT A;  3WZ1 A;  2C1F A;  4FPY A;  2WZR 1;  2HH9 A;  3PUI A;  5A6Q A;  1GZW B;  1OA2 A;  2SLI A;  1SEF A;  3I3E A;  4XPV A;  3WQB A;  2VQ0 A;  3AKT A;  3ZFE C;  4CDW C;  2WYF A;  1PGW 2;  1C1L A;  1DGL A;  1KJR A;  4LUM A;  5FZE A;  2EXH A;  3ACH A;  1W6M B;  4B4R A;  3BTY A;  2WT1 A;  3SHR A;  1FOD 1;  5FY1 A;  4BU2 A;  1RUO A;  1NE6 A;  4FQ4 A;  4KI5 M;  3ILF A;  4CDQ C;  1URX A;  1RUH 2;  4XFI A;  3WCS A;  1W8Z A;  4LBL A;  1Q8P A;  3I2J A;  2HWC 2;  1W04 A;  4OI1 A;  1GQG A;  5AVP A;  2B46 X;  4PLO A;  4CA9 A;  1OLM E;  2VCB A;  1W8U A;  1AR6 2;  1IS6 A;  2ILM A;  4JKL A;  4LHL A;  1SBE A;  4WZF A;  1N1S A;  3JBG 1;  4I2O A;  1MR5 A;  4Q4X 2;  2EID A;  4EYU A;  2XVL A;  4QKF A;  2CDO A;  4YVS B;  5C3Q A;  2YMZ A;  2X09 A;  4RFR B;  4DXR A;  5JZG B;  5H9P A;  1POQ A;  2RS1 3;  5LAT A;  1DCS A;  1BVP 1;  1I9R A;  2XUE A;  5L7O A;  1GAN A;  1G9B A;  2W1U A;  5FUI A;  4XDP A;  1AX0 A;  3LDR A;  1LEC A;  1XPW A;  5FZF A;  3WNO A;  3UNP A;  1SLT A;  1VBE 1;  1W6M A;  1ZBA 1;  4MSV A;  4GMP 3;  1HRI 1;  5K0U C;  5FK7 A;  5FV3 A;  4GWN A;  1UOF A;  2LTN A;  1LGB A;  3IIA A;  5A7W B;  5KHG A;  4LBQ A;  3CJI C;  2RDS A;  4C91 A;  1NCQ A;  3SIS A;  2O8O A;  4C90 A;  2VMG A;  3G7D A;  3KCC A;  3UET A;  2VTX A;  4YVW B;  5KXB A;  1NCR C;  2YC0 A;  1W9S A;  3ZFG C;  3JZV A;  4RD7 A;  1YRZ A;  2RR1 1;  2C24 A;  3ZN5 A;  2TBV A;  1QH7 A;  5E89 A;  5A3W A;  1APN A;  2RS3 1;  1COV 1;  3AMN A;  4MVT A;  3OUH A;  1H2M A;  3IDB B;  1R08 3;  3PIG A;  2JDU A;  4A45 A;  3VZN A;  1LEN A;  5FIX A;  1OXC A;  2O1Q A;  2JDP A;  3FL7 A;  4RYD A;  1C5H A;  1CAW A;  2BVV A;  2OZJ A;  4FAH A;  2DU1 A;  1D4V B;  5FP4 A;  3SC7 X;  1F5J A;  5C4W B;  3OBR A;  1NXD 1;  2BPA 2;  4A6S A;  2E53 A;  1CQ9 A;  1ULO A;  5C9A A;  2FZ1 A;  4RHV 1;  4E9K A;  3O1T A;  4KU7 A;  2Q1M A;  3U10 A;  4O65 A;  1WME A;  3EBR A;  1HV0 A;  4E2S A;  2R6Q A;  3PDQ A;  4HKW A;  4QPG B;  1MS9 A;  1IS3 A;  5CU1 A;  5DDJ 1;  2D6P A;  5LBF A;  4LHN A;  3ACF A;  4OCT A;  2HYX A;  1NG0 A;  5FUP A;  5CFC B;  4B1L A;  2O14 A;  5C3P A;  4WM8 B;  1HDK A;  1QEX A;  4FPK A;  2OYZ A;  2OII A;  1AZD A;  1RUF 3;  2E9Q A;  2PLV 3;  1Q43 A;  4HSJ A;  1BLZ A;  2JEC A;  3AKP A;  3FUO A;  1W0P A;  4YW2 A;  2ZGO A;  1UPS A;  3ZXJ A;  5DN2 A;  1NE4 A;  3B5L B;  4GZ9 A;  1HB1 A;  3ZFE B;  1WLT A;  3PTR B;  3AVR A;  1OKO A;  1W0O A;  3B94 A;  3LEI A;  1VB4 A;  1LES A;  1QKQ A;  2J42 A;  1ZRF A;  3ZSJ A;  1O5L A;  2RVA A;  4W6X A;  2BNM A;  3ZIW A;  3SCG A;  1NA1 A;  1SCS A;  2VZV A;  3NJY A;  4QT6 A;  1FNZ A;  3RVH A;  3CJI B;  2A6X A;  3I49 A;  5FPL A;  2FDG A;  2XVG A;  5ANQ A;  5AC9 2;  3HWJ A;  2G9F A;  1DLL A;  3N35 A;  5DUU A;  5LBB A;  1ENQ A;  4FP2 A;  5FZG A;  2V72 A;  3GYD A;  3H3Z A;  1ND2 C;  4KWJ A;  2WFF 2;  3S0M A;  2EF6 A;  3MIE A;  3CMG A;  2EIE A;  2PHU A;  1OOP B;  1F15 A;  3WP4 A;  3AFK A;  3D5O A;  2OVU A;  4IEO A;  1EUT A;  1V9U 3;  4QMA A;  5J98 B;  3VBO C;  5C5U A;  4NHX A;  4K8F A;  3FHI B;  1ZBE 2;  3PJY A;  4QPI C;  4RR3 B;  1X9P A;  1RUF 1;  4LBO A;  2BGO A;  2PN5 A;  3A0N A;  4IEX A;  2CAU A;  2HYK A;  2W91 A;  5C3O A;  4Q4X 1;  2XML A;  1NKG A;  1V6I A;  3ZOI A;  4QB1 A;  3EHK A;  1K5J A;  4H2A A;  5J36 A;  1ZBA 3;  1Y3T A;  3FMG A;  3IB3 A;  4XFC A;  5CKM A;  5T50 A;  1CAW B;  3ZPO A;  2Y6H A;  2BBA A;  2Q1F A;  5DXD A;  1XNT A;  1YFY A;  1AJO A;  2GN3 A;  1ZNP A;  2J1V A;  3QH7 A;  4YFW A;  3UGG A;  2JE7 A;  5AVA A;  4FBF A;  3NAP B;  1M4W A;  4GKY A;  3LFI A;  1RUH 1;  2HWB 3;  1Z0H A;  2DYC A;  4CCC A;  3VBF B;  5LA9 A;  5FZI A;  3MI8 A;  4QX3 A;  5T52 A;  3VKM A;  4LR4 A;  4AI0 A;  4Y5Z 0;  4E27 A;  4COZ A;  1IPS A;  1W0N A;  1WLD A;  2R07 2;  3GNE A;  5A7N A;  1AF9 A;  2XBO 1;  3T30 A;  4FTB A;  4L9B A;  4NUB A;  1F5F A;  3H50 A;  4XBL A;  4COY A;  5KXD A;  4CU8 A;  3IAQ A;  3NQH A;  1AR7 1;  5FUN A;  2JG9 C;  4YVW A;  4YM3 A;  5KBF A;  1POV 3;  3IDC B;  1IG0 A;  5BNP B;  1TMF 3;  2RJK A;  4GWM A;  3ZPY A;  1SPP B;  1W6O B;  3OBT A;  1GV9 A;  2Y34 A;  5FWE A;  3WUD A;  4JTN A;  3MEP A;  3D0S A;  1FMD 2;  3OY8 A;  3VBU C;  1YEW A;  1LOB A;  2HBT A;  1DU3 D;  2WN3 A;  3FBY A;  4ATE A;  1ENR A;  3RDI A;  4JDO A;  2W0X A;  3ZKY A;  3C2U A;  4GQ7 A;  1JYI A;  2X10 A;  2RMU 1;  2ZHN A;  5K0U A;  3OOX A;  2HWE 1;  1Q8S A;  2YC2 A;  4QHZ A;  2E63 A;  2EAA A;  3A7Q A;  5T5P A;  5G04 L;  5JR2 A;  1DZT A;  1AYN 1;  3WDT A;  4AQS A;  5L36 A;  1O3Q A;  5JR7 B;  5LCW L;  1ZA4 A;  3VBO B;  4QGN A;  4YGC A;  1AL2 2;  5H9R A;  3A0K A;  1RJ7 A;  1CIW A;  1E5R A;  3QCW A;  5FJH A;  4PIY A;  1U0A A;  3IDA A;  4AW7 A;  5H9Q A;  2R16 A;  5F6L B;  1RUD 2;  3U0Z A;  2C9A A;  3FX3 A;  3IPV A;  3GDB A;  2LRP A;  3CJX A;  2BP6 A;  3VD5 A;  1XJA A;  3HQR A;  3KV9 A;  3AYC A;  4L11 A;  4XOG A;  2DCK A;  2YYO A;  4BZ4 A;  5I0D A;  1TNF A;  2WR9 A;  4XDO A;  2IFW A;  1R08 1;  1AYM 2;  3GHN A;  1UYP A;  1QDC A;  2LS6 A;  4NAO A;  4CEW B;  2EVX A;  2QQL A;  1JI6 A;  2RMU 2;  2IZW A;  4AI3 A;  4CE8 A;  2ID4 A;  3AZW A;  3ACL A;  2D6K A;  4NRP A;  3GHM A;  1WMF A;  1AR6 3;  3FE5 A;  3W21 A;  2W1S A;  4CDX B;  3GJA A;  1G9C A;  3TN9 2;  3UL2 A;  2B5H A;  2DUO A;  2VAU A;  5A3P A;  2ES3 A;  1D2S A;  4JGZ C;  4BME A;  5BV6 A;  4AQT A;  3T2T A;  2R06 1;  5I0T A;  1CAV B;  3SXW A;  3VKF C;  2HWF 2;  4E8C A;  4NHM A;  3I2H A;  1QJY 2;  4RGK A;  4BQ5 A;  1C57 A;  2XLA A;  2WNU A;  1W6Q A;  5EZW A;  3LA2 A;  2ZHM A;  4BQ4 A;  1HXS 2;  1W6Q B;  4AI1 A;  3SIT A;  2E32 A;  4B4Q A;  2OXB A;  5EJZ B;  3H1Y A;  4A6O A;  2ARB A;  2RR1 2;  4Q4X 3;  4UFI A;  2FDF A;  3ES4 A;  3WV6 A;  4A7Z A;  4B7E A;  5I93 A;  4YGD A;  1DYO A;  4R4Z A;  3U78 A;  4GMP 1;  4CDW B;  3A23 A;  1A8D A;  3KT4 A;  1WD4 A;  4YM1 A;  1NLQ A;  1X8M A;  5D8A B;  3CEW A;  2VTF A;  2GP3 A;  1RUG 2;  5IK5 A;  1MEC 3;  3III A;  4LBM A;  5JOX A;  3AXE A;  1QOT A;  2R04 3;  3WR0 A;  1UYX A;  5KR7 A;  1NCR A;  5FYI A;  4XF0 A;  2VOX A;  3MGU A;  4PDW C;  4P5Y A;  5DZG A;  2VMH A;  2IVJ A;  2W2I A;  1DFQ A;  2CDP A;  4IE6 A;  3T1L A;  4DNY A;  1S0B A;  4O9G A;  3T08 A;  4IE7 A;  3USU A;  1MQT A;  1HX6 A;  3USU B;  3EXU A;  3LEG A;  1RL3 A;  4Q4Y 1;  4Q4V 3;  2WNU B;  1BXH A;  3ZSL A;  1CAU B;  1ND3 C;  1PK6 A;  1BEV 3;  4FAG A;  4O61 A;  2JEN A;  3U07 A;  3DXT A;  3CQO A;  4B29 A;  1PO2 2;  5JOY A;  2PA7 A;  1N1Y A;  3DL3 A;  4BH9 A;  4XFB A;  3LCP A;  4QM8 A;  1QJU 1;  3MF9 A;  2WBK A;  4UF0 A;  3W9A A;  5LZ6 A;  5FZ9 A;  3T0B A;  1QQP 2;  1RIN A;  1G7Y A;  4MGZ E;  1BMV 1;  1QH6 A;  3W58 A;  3MUZ 1;  1DGR A;  1RVF 2;  4YRD A;  5J09 A;  1DF0 A;  1YUD A;  1J59 A;  4LOR A;  1KDK A;  3KF3 A;  1VMF A;  1VMH A;  4JGZ B;  3THC A;  2VBP A;  4UT5 A;  3MID A;  1MEC 1;  3MLL A;  1PVX A;  2WII B;  5I0U A;  1YWK A;  4XAC A;  4D94 A;  4TN7 A;  4K6B A;  3BOW A;  2A3X A;  2ETE A;  4E8D A;  5JDB A;  2V09 A;  4GXL A;  2VW0 A;  5CG9 A;  2OT7 A;  1OF3 A;  1OQE A;  1LOG A;  3NAP C;  4NAM A;  3O5S A;  4NO4 A;  1GYK A;  4R8H A;  3VBS B;  4LUL A;  1KJL A;  2YFZ A;  5FZ6 A;  5A3M A;  4Q0P A;  2FZ2 A;  5IFT A;  1FPN 3;  3RZG A;  2PLV 2;  5TSW A;  5CB7 A;  2KD7 A;  3DPR A;  1GSL A;  1CON A;  4U2A A;  3GXU A;  4OI2 A;  3A22 A;  3VL9 A;  1UW8 A;  2OA2 A;  2WZE A;  1QJZ A;  3VUO A;  2W92 A;  2WN2 A;  3DCQ A;  1OOP C;  1XNK A;  3FFQ A;  3MLK A;  1ASJ 2;  4ITC A;  4XET A;  1KQR A;  3TNP B;  4FPL A;  4BYY A;  3ETQ A;  4ASL A;  3NJV A;  4XJ9 A;  5FO8 B;  4ZXE A;  1I6X A;  4I0B A;  4HAN A;  1VAK A;  5DQ0 A;  1X50 A;  5A1A A;  3QD6 A;  2Q0A A;  3N9Q A;  1C3H A;  4QXH A;  3T3Y A;  1PHM A;  2X29 A;  4BK4 A;  2JJ6 A;  3HJR A;  1Z7S 2;  3A21 A;  3GCX A;  5IVY A;  1VBA 1;  3I8T A;  1GOG A;  1V6K A;  1QJF A;  2DVA A;  2WIN B;  4PQQ A;  1I5P A;  2DCJ A;  3R0R A;  3THT A;  1VBB 3;  3Q8E A;  2WO3 A;  5F8P A;  1AUY A;  2WUH A;  3R4S A;  1CAU A;  3KVB A;  5JPN B;  4HKO A;  4RQP C;  1UY4 A;  1X7N A;  4IE4 A;  3ROU A;  3WNN A;  1UXX X;  1UX7 A;  1ZBE 3;  1ZBE 1;  2ZGK A;  4HZF A;  2Q8E A;  3RMX A;  3ETP A;  1IKP A;  5K7P A;  2VG9 A;  3VDC A;  4BQ1 A;  3OB8 A;  4XF4 A;  3TN9 1;  3O1R A;  3JXS A;  1QJX 3;  3SH4 A;  2BOI A;  2Y26 A;  3U4S A;  4QPG C;  3VZK A;  4AVB A;  5CIS A;  1OA4 A;  3HNY M;  3ZXD A;  5DZF A;  4EZH A;  5T3N A;  1S0F A;  4LKS A;  4XC9 A;  1VBD 3;  1MVQ A;  4UFH A;  5FMO L;  3T4V A;  2XB6 C;  3NST A;  1AHS A;  1V6O A;  2QDR A;  3O7O A;  4NR1 A;  4YLZ A;  1ZZ6 A;  2ZX0 A;  1C8M 2;  3DXU A;  3J4U H;  1AR8 3;  5LBC A;  4GWJ A;  3ZYH A;  1GP4 A;  5FBZ A;  2NQY A;  1FMD 3;  5KXC A;  5F6K A;  3E6B A;  4WVM A;  1I5Z A;  3LZZ A;  5BNO B;  3NRU A;  3KHC A;  2R07 3;  1PMJ X;  4IV3 C;  3PTY A;  5K8S A;  1ENX A;  3IKW A;  2ZX3 A;  3KM5 A;  1GQP A;  3NMB A;  1XYN A;  4MHU A;  3S7E A;  1F8V A;  2GSY A;  5FLI A;  2P6H A;  4YW1 A;  2JDK A;  2R0H A;  1VB2 A;  3UK9 A;  1WA6 X;  3B02 A;  3E97 A;  1BHG A;  1W2O A;  4KNC A;  3POG A;  1DGR N;  4O7X A;  3ZFF B;  3D4K A;  5CVR A;  3RWN A;  3BKZ A;  4IEZ A;  4Z8B A;  5EP9 A;  1BK0 A;  1YI9 A;  3ACG A;  3CIH A;  4XUO A;  1RUN A;  2P3Y A;  3QAC A;  2XJV A;  5DAB A;  3V0B A;  1DYP A;  3L2H A;  1V6L A;  4BIS A;  4P9Y A;  1FX5 A;  1RUE 1;  2WSV A;  5C33 A;  1LHU A;  3IWZ A;  4BXF A;  1LHO A;  2X5I A;  3R4D B;  4WM7 B;  3AKS A;  1H1M A;  1ZVF A;  2ENR A;  3LDK A;  3NVC A;  3HT1 A;  4XQW A;  5CNA A;  2RS1 1;  4UBH A;  4AFD A;  4MX3 A;  4TXW A;  1D0G A;  2RMU 3;  3BAL A;  3WF0 A;  2CSG A;  2W1W A;  4K1Z A;  4QM9 A;  4E4S A;  4F8A A;  3RRD A;  3VDD B;  5FQ0 A;  1I1E A;  1N1V A;  3WNL A;  1YQ2 A;  3ZFG A;  5A7W A;  4KWL A;  1WBL A;  1YQ8 A;  4FFH A;  4IGQ A;  3WD5 A;  1FOD 3;  5JIA A;  4BK5 A;  2HJI A;  3OBA A;  2R30 A;  1NCQ C;  3BOD A;  5CG8 A;  1W99 A;  5KXE A;  1IS5 A;  2WDB A;  2D43 A;  2XLG A;  1AYM 3;  2Y38 A;  2OPW A;  1OOP A;  4JHZ A;  4QB2 A;  5GZE A;  3LOB A;  4ZXK A;  2YHJ A;  3I59 B;  4Q4V 1;  3AP6 A;  1JUH A;  3EJK A;  3U14 A;  1HJF A;  3M8L A;  1GWL A;  2FBE A;  1XC6 A;  2Y8K A;  1A8M A;  2QQW A;  1LKN A;  2ZAA A;  4A4A A;  1COV 3;  1NUK A;  4IEU A;  2K46 A;  4QHB A;  4YG6 A;  4DXT A;  1KS4 A;  2KR2 A;  4N43 C;  2R1D A;  3W20 A;  4QXB A;  3POJ A;  4JDN A;  2F17 A;  2BU9 A;  3OPT A;  2VTX J;  1VAL A;  2HWC 3;  4MH0 E;  4PT6 A;  4QQH A;  3MIH A;  1ZRC A;  1W9W A;  2PHT A;  4UAP A;  4Z2W A;  1G9A A;  5CKN A;  2PHL A;  1DQ6 A;  4ARX A;  5LEJ A;  1GZT A;  2NN8 A;  4YW6 A;  4JHT A;  1RUF 2;  3VDD A;  3WEZ A;  5IVC A;  4LKD A;  1RTV A;  3UJQ A;  4GUL A;  1JU4 A;  2BJS A;  2E51 A;  4JKK A;  5FRE A;  3AC0 A;  5CEH A;  2XOM A;  3B9I A;  3H1W A;  1RB8 G;  3LEM A;  3VLB B;  2VGD A;  3JBG 3;  2GMM A;  5IT6 A;  1IQA A;  4CCK A;  3AM2 A;  2Y0I A;  1I3H A;  3PUR A;  2ZOE B;  1JXN A;  5JXH A;  1J3P A;  4LHK A;  2JEM A;  3VBR A;  1HV1 A;  1WA4 A;  2V4V A;  4IND A;  2I74 A;  5ACA 2;  3W59 A;  2QNK A;  3MPP G;  1OD3 A;  1W2N A;  4XZU G;  2WNV C;  3U4X A;  4MO3 M;  3K4Z A;  3WVJ A;  3S5A A;  4QXC A;  3ALQ A;  2LW8 A;  4P9X A;  4OZO A;  4CU9 A;  5FPB A;  1ND3 A;  4F3J A;  2FMD A;  3TOJ A;  3SNM A;  5KC5 A;  1BJQ A;  3LIG A;  4AAX A;  1JYT A;  4LBJ A;  3ZSK A;  3RYP A;  3BOP A;  3NL1 A;  1V9U 2;  5IAV A;  5J3U A;  4LIU A;  5CFC C;  3BCW A;  4BQW A;  2PHW A;  3H8X A;  2JD9 A;  1QOS A;  1T6B X;  3BTZ A;  4MOA A;  3NNM A;  5B4X A;  3N3H A;  5IUQ A;  3WXP A;  5L7O B;  4NRQ A;  1NYW A;  1OVS A;  5FZ8 A;  4AZZ A;  5LK5 A;  2Q8O A;  3WY6 A;  4RS5 B;  1UXZ A;  4BQY A;  5DG1 A;  1RMU 1;  2I2S A;  4Y5T A;  1XNC A;  3EO6 A;  3R4U A;  1CAX A;  3I2K A;  1GBG A;  2P17 A;  2WQZ C;  3C7E A;  4YPJ A;  1JMU B;  3GGL A;  4TSV A;  5F5A A;  2NYY A;  1UY1 A;  2BWA A;  5DDJ 3;  4AF9 A;  1AYN 3;  4AYU A;  4Y22 A;  3ILN A;  5FBJ A;  1RUJ 1;  1PVC 2;  2PHF A;  3AFG A;  1VRH 1;  3E5Q A;  1H9W A;  3LSE A;  4K40 A;  2JXA A;  1D0H A;  4CXY A;  2PHD A;  2XHN A;  2RS5 2;  2VXJ A;  3VBR C;  1ASJ 3;  1MS3 A;  2X5I B;  1B35 A;  1LU1 A;  4H7M A;  4WM7 A;  1RGS A;  5A70 A;  1B35 B;  2HWD 1;  2Y33 A;  5A7Q A;  3QBQ A;  4FOV A;  4BQ3 A;  5F1R A;  2VD7 A;  2E7A A;  5FZA A;  1W06 A;  1TZO A;  1WZX A;  2HWE 2;  1UU5 A;  2ZJC A;  3JD7 1;  3PHM A;  3PLQ A;  4QDR A;  4AHY A;  3ZYG A;  4Y20 B;  2JE9 A;  5FAX A;  1SQ4 A;  3HIF A;  5FQ0 B;  1OH3 A;  3LEK A;  4M01 A;  4CDQ A;  5ACA 3;  5ACA 1;  1N47 A;  1TE1 B;  1UNB A;  4CCJ A;  1AR9 3;  1RHI 3;  1XSQ A;  4NPR A;  3ZFG B;  2D6M A;  3C3V A;  2KA3 A;  3BIW E;  4LLO A;  1SLB A;  1JYC A;  4M4P A;  2YUE A;  4CCE A;  3P3P A;  2VNV A;  4PDW B;  3WF3 A;  2IXK A;  4DXS A;  2WLP A;  1GP5 A;  2ZPX A;  1PZ8 A;  4IV1 A;  3TB0 A;  2QBX A;  2W46 A;  5IK8 A;  2WWU A;  3ELN A;  3LSD A;  3OD4 A;  4UFK A;  3CO2 A;  4LKE A;  1ZRD A;  2DVF A;  1T2X A;  4CXW A;  1W2T A;  2RS5 3;  2G4I A;  4KL1 A;  3HD8 B;  4ONU A;  5FLH A;  4R9A A;  1NXM A;  2CTV A;  1BBT 1;  2EXJ A;  3GZA A;  3ZXF A;  1Q5O A;  1GWM A;  4L92 A;  3RGB A;  4D3W A;  4D6R A;  1VBA 3;  4A2U A;  4LBN A;  5FO7 B;  3OD0 A;  4I30 A;  3S30 A;  2HWE 3;  4BDV B;  4IV3 B;  2AGS A;  4NRO A;  5CIR A;  1YC6 1;  3H0O A;  4ASM B;  1RXF A;  1UYZ A;  4Y1X A;  1OI6 A;  4WVZ A;  2OQ6 A;  5FYY A;  1C1F A;  1PO1 3;  3P1I A;  3AP4 A;  1ZZ7 A;  4AWD A;  4BLJ A;  5ISL A;  4H14 A;  5KHK A;  2TEP A;  2W94 A;  3LPG A;  4FQZ A;  4EN0 A;  5BNN C;  1US2 A;  2GNT A;  4BOW A;  2FMY A;  1V6M A;  2G1M A;  3U1X A;  4CPB D;  3ZO0 B;  4ARY A;  4Z92 B;  4ATF A;  2XKP A;  1A34 A;  4XZP A;  1UY3 A;  3OTF A;  4V1P A;  3PU8 A;  4V2W A;  5EIY B;  2PMW B;  3BUC A;  1SLI A;  1H6X A;  4NWV A;  2ORZ A;  3C7O A;  3O0X A;  2MPF A;  2UYB A;  1GLH A;  1A6C A;  3SMH A;  3NV2 A;  1BVV A;  2QQV A;  4LBK A;  3L9J T;  3RG0 A;  2WL1 A;  4RN5 A;  1OBN A;  1ZM1 A;  2CU5 A;  1YCI A;  4FO9 A;  4L8Q A;  1TMF 2;  4IER A;  2F4L A;  1RIR A;  2VE1 A;  1ST8 A;  4LOS A;  3B00 A;  2L9L A;  2RHP A;  2DBN A;  3ORJ A;  4L0P A;  3HT2 A;  1UCX A;  2W52 A;  2ZKL A;  2BOJ A;  5GKA C;  4FP3 A;  5JIU A;  5AFE A;  2LM3 A;  1L3J A;  1H4H A;  3WLU A;  1MEC 2;  1GZC A;  1E5I A;  5FMC A;  4DZG A;  2GC3 A;  3THP A;  1RUJ 3;  3T0D A;  3B3Q E;  2H6C A;  4QQL A;  3RZZ A;  4FPC A;  1BK1 A;  3MUY 1;  4YVS C;  1C4R A;  4R9C A;  3VBH B;  3BTX A;  1HB2 A;  2TNF A;  4Y26 A;  4JQR A;  4Z07 A;  1VP6 A;  5ABJ A;  1LRH A;  2DTY A;  1CJP A;  3O0W A;  2J22 A;  2W68 A;  3H7Y A;  3OPZ A;  1MS8 A;  3BB6 A;  3K51 A;  2YGL A;  4XUT A;  4AHW A;  4YZ2 A;  1QNY A;  2A6W A;  2MHF A;  1UYY A;  4P9W A;  4N43 B;  2VCC A;  5E1R A;  4OFG A;  2OPK A;  3FC0 A;  3WG4 A;  3DGT A;  1NX9 A;  3WCR A;  1E5S A;  4RHV 2;  2JKB A;  4GH4 A;  2YDE A;  2VEC A;  2WA4 A;  3AP9 A;  5HV0 A;  3V0A A;  4KBB A;  1TEI A;  4NVP A;  5D1I A;  5LA1 A;  2O8Q A;  5DAX A;  1CAV A;  1JZ7 A;  2IVI B;  3MLJ A;  3ZN6 A;  1H4G A;  1STM A;  5F32 A;  5FMB A;  4OMC A;  1OD5 A;  2B9U A;  2VJX A;  4FPF A;  3VHP A;  4Y3O A;  3B69 A;  1O4Y A;  2ZEW A;  5LA0 A;  1NCQ B;  4NIG A;  3OPW A;  1COV 2;  2WSU A;  1CN1 A;  1HN0 A;  4AEM A;  1K45 A;  1Y43 B;  1PIV 3;  3F2Z A;  2GNM A;  4DY3 A;  4CEY C;  1NQD A;  1JYV A;  4M00 A;  3DEM A;  5DZE A;  3KD4 A;  2JG8 B;  4HOO A;  1KFU L;  2D6N A;  4NHK A;  4RL7 A;  3GAL A;  2GN7 A;  4UFJ A;  5BY5 A;  3DF0 A;  3FHA A;  1QJE A;  4X6R B;  2C9K A;  3VDA A;  4Q0V A;  1DYK A;  2D3R A;  4LO7 A;  2FDJ A;  5D8A A;  3K48 A;  2JIG A;  4AVV A;  3OSD A;  3UV9 A;  1FI2 A;  2ZZJ A;  1QXJ A;  5A3U A;  5CAZ A;  3SLI A;  1XND A;  4CDU A;  2VZU A;  1PGS A;  2JIJ A;  3ZMN A;  1SBF A;  4AFC A;  4K20 A;  1ZZC A;  5I8Y A;  3HN1 A;  4ISQ A;  5C7G A;  3ZYF A;  3SCH A;  3SH5 A;  1MS0 A;  3NWK A;  4ES8 A;  5J48 A;  1AR8 1;  1YFX A;  3M4F A;  3Q8A A;  4JKM A;  5GJ6 A;  1GNZ A;  4AG4 A;  4PI0 A;  5L73 A;  2A3Y A;  5GLW A;  2RJL A;  1LB2 A;  2ARX A;  4D7S A;  5K4L A;  3H8R A;  1UX6 A;  2Y6G A;  1VR3 A;  1MS5 A;  1RED A;  2B8M A;  4JVA A;  4PHZ A;  1Q8V A;  2CY6 A;  4D7Y A;  4Q2F A;  3KS7 A;  1S2B A;  2VMD A;  2DCZ A;  4Q4V 2;  3FFZ A;  3NJX A;  3OGJ A;  3MIG A;  2VZO A;  1NLS A;  2AH2 A;  2AEZ A;  1E5H A;  1HB4 A;  2DFB A;  1XYP A;  5JSO A;  1VBC 2;  2BV4 A;  4I0W B;  2D40 A;  3KT1 A;  2WZR 3;  4LO6 B;  1XE0 A;  3PMS A;  5DUW A;  2DVD A;  3RJR A;  3AL6 A;  4GA9 A;  2BNN A;  1UZ0 A;  3NJZ A;  4XJ8 A;  1JYW A;  3ZFE A;  2VZP A;  3CZJ A;  3TRS B;  5DAV A;  2HWD 2;  4I3G A;  2XR4 A;  2E26 A;  1U5Y A;  1GWK A;  1AJK A;  1L7L A;  4N9I A;  4PIX A;  5BNO C;  1W6P B;  2QZ3 A;  3HAG A;  4ISR A;  2MEV 1;  2NMO A;  2VL4 A;  4P00 B;  1PIV 1;  1HRV 2;  1W6P A;  2Q8C A;  4CUA A;  1KDM A;  5IK4 A;  1J3R A;  4IGO A;  4LLF A;  4AR2 A;  2W95 A;  4UOJ A;  4CUC A;  3K77 A;  4QPG A;  1AR8 2;  1W3V A;  4P02 B;  4WVW A;  1H9P A;  3MIF A;  4Y4R A;  5L9B A;  1AL0 G;  1ULG A;  3IAP A;  1AR9 2;  3IMM A;  1KIT A;  4MGY E;  2F6B A;  3VZM A;  4E2Q A;  5JXI A;  4AK3 A;  1S0G A;  4QGL A;  4QX1 A;  1QNW A;  4OHV A;  5HCA A;  1LOC A;  2XDV A;  4XMA A;  4Y1U A;  5M0T A;  2QE3 A;  3I54 A;  3LE0 A;  1RUC 3;  1GKB A;  1H1I A;  4GB3 3;  4PI2 A;  2D3P A;  2WT0 A;  2NZ9 A;  4J1W A;  4CXX A;  1R09 1;  5F2S A;  1MZ6 A;  2VNO A;  3VBU A;  1LAJ A;  4XCA A;  2BFU S;  2WAO A;  4DQA A;  5K9Y A;  2DVB A;  2W9X A;  2DF7 A;  1YJL A;  4IET A;  1LOF A;  1YJK A;  5CFD A;  3V64 A;  1MZ5 A;  1XQN A;  4K8R B;  4JGZ A;  2A6Y A;  2YBP A;  3D82 A;  2V4A A;  1FNY A;  1C5I A;  1X33 A;  5JZG A;  3ABZ A;  5E8A A;  2G19 A;  4IV3 A;  2WA3 A;  3ME2 A;  3LPF A;  2WJS A;  4GAZ A;  4L97 A;  5C8C C;  4SBV A;  4KU8 A;  1QMJ A;  2E31 A;  4IEY A;  2XQR A;  4QPI A;  3VL8 A;  4EWE A;  2MEV 3;  5C3S A;  1U5Z A;  2IC1 A;  2GME A;  3MFA A;  2VBD A;  5FMD A;  4EV0 A;  2WWS A;  2KM2 A;  1H1A A;  1UF2 C;  4ZS2 A;  1US3 A;  4YW4 A;  5HXV A;  2GND A;  4C1X A;  4D6S A;  3LA7 A;  2WO2 A;  3VHO A;  4BA6 A;  5A3O A;  3WF1 A;  3VZL A;  1TNR A;  1OUR A;  2A70 A;  3I3M A;  5JVV A;  1M06 G;  4ZS3 A;  4BIO A;  4C8D A;  1N3O A;  4GJY A;  4W6W A;  4BPZ A;  3VB9 A;  1BYH A;  4CCM A;  1W3X A;  1QJU 3;  1LU2 A;  3DN7 A;  4QX7 A;  1RUE 3;  4AGR A;  3WDW A;  5I8T A;  1DLC A;  3SQO A;  5KHJ A;  2VZS A;  2DUR A;  2WNE A;  4AI2 A;  1HRV 3;  4Q27 A;  1OPM A;  1MPX A;  1SFP A;  5DAP A;  4HLT A;  1WUV A;  5L19 A;  2XQX A;  1NT0 A;  3AX4 A;  2QUO A;  4JDM A;  1PM7 A;  3WSO A;  3ZXE A;  5FXV A;  4XTP A;  4FPG A;  1XE8 A;  1AXY A;  2QQN A;  3HMY A;  4XFA A;  5F37 A;  4XIO A;  3NV3 A;  2QQK A;  1WBF A;  3V0A B;  5GLU A;  3BI3 A;  2B9V A;  3UKN A;  3KV5 A;  2YGM A;  4Q8K A;  1YFW A;  3JD7 3;  1B35 C;  3WP6 A;  1OHF A;  5EWS A;  3R6S A;  4AVT A;  4LTA A;  1K42 A;  4RR3 C;  2W87 A;  4QDQ A;  3NNG A;  1NLR A;  3VZO A;  4FPO B;  1JU3 A;  1XB9 A;  3O12 A;  3POS A;  1H0B A;  1OKQ A;  3BPZ A;  4YW3 A;  5I91 A;  2VVF A;  2YZ4 A;  5FYM A;  1ZZ8 A;  4BE3 A;  4LIT A;  2NPI A;  2DU0 A;  4QD2 A;  3CDZ B;  4MV2 A;  1RUJ 2;  1Y7B A;  3V0B B;  1GUI A;  2HLE A;  4Y22 B;  2V5D A;  2QCS B;  2XGX A;  3I97 A;  5JOZ A;  3RYK A;  5ERL A;  4XIK A;  1NZC A;  3O1P A;  1RUG 3;  4QQP A;  1UMI A;  3FHQ A;  1J58 A;  3U75 A;  5JUV A;  4LHS A;  2H0V A;  1DP0 A;  4MZU A;  3ATG A;  2OS2 A;  1VBD 2;  2YBS A;  3T09 A;  4Y5S A;  3CU7 A;  3IT8 A;  4BCU A;  4S2D A;  1L7Q A;  2ZGN A;  5KHH A;  4N53 B;  4OUE A;  1HQL A;  5A7S A;  1W8F A;  4E2G A;  3KCX A;  2FDK A;  1JH5 A;  1R1Z A;  3RMY A;  5IJR A;  5FKC A;  4K1Y A;  5FZM A;  2CGO A;  2JKX A;  3OGR A;  4M3C F;  2Z4F A;  2BWC A;  3POW A;  4RHV 3;  4WVM B;  2IFR A;  3FWE A;  3TNQ A;  2B4K A;  3HNM A;  3VBS C;  4CYD A;  4DIQ A;  3ZMO A;  2HWB 2;  2GMP A;  2NLR A;  1CZT A;  4AL9 A;  1O3T A;  1QU0 A;  2R04 2;  4ZHN A;  2IUW A;  2WS9 2;  4K9S A;  2R0F A;  5GZD A;  1TQ5 A;  2RE9 A;  1WCQ A;  3VBO A;  5FKB A;  5FYU A;  5FPU A;  3S57 A;  1W9F A;  2HEV F;  4CP9 B;  1R64 A;  3CKH A;  4UW4 A;  3T2P A;  4ZZ5 A;  1ULP A;  5FZ3 A;  1UKG A;  4TWT A;  5JAX A;  3MYX A;  2OQ7 A;  2QQM A;  1WKY A;  1JOJ A;  2RR1 3;  4AEJ A;  1O8S A;  4LEJ A;  2WNU C;  3ZXK A;  2D5F A;  4Q4W 3;  4HPK A;  1DGW X;  3H1M A;  1CVN A;  1D4M 1;  1OUX A;  2P5B A;  3K4D A;  4N90 A;  4PBO A;  4HVO A;  4PBP A;  1TME 2;  2P3K A;  1JHN A;  5A6Z A;  1VBE 2;  5BYN A;  1O4Z A;  4CPB A;  4Q4Y 2;  1AL2 3;  1LOA A;  1OMI A;  2EA7 A;  1CES A;  4MGS A;  1W8N A;  5JI9 A;  1ULD A;  2AC1 A;  4N7U A;  2HEW F;  4IL7 A;  1H8V A;  2KXL A;  1VIW B;  5EPA A;  5EQU A;  3K3O A;  3KT7 A;  1RUD 3;  4FPJ A;  3KMH A;  5I8S A;  2D44 A;  2J1T A;  3WG3 A;  3ZYR A;  4I3P A;  4WZC A;  4Q5O A;  2Z79 A;  3WP5 A;  4BQX A;  2XL7 A;  4G9S B;  3GM8 A;  4BQ2 A;  3WNK A;  1S1A A;  3K4A A;  1KEX A;  4NPL A;  5FZ4 A;  2R32 A;  1DQ5 A;  1FAY A;  5LB6 A;  1G9F A;  2QQP A;  2GAU A;  3NNF A;  1W6N A;  2SBA A;  1OLQ A;  3N9P A;  3HOB A;  4WM7 C;  4EN7 B;  2W08 A;  1ONA A;  5ABJ C;  2XLF A;  4BHP A;  2EXK A;  1D4M 2;  4X8N A;  1N3P A;  2R7E B;  1UWW A;  2BDR A;  4XAE A;  4URT A;  5LA2 A;  5FPX A;  5IVF A;  1R09 3;  2CWS A;  3URF A;  1G8W A;  5EJ3 A;  1NCR B;  1XXN A;  1QJY 1;  3OF1 A;  1JZ4 A;  5LK7 B;  2BER A;  4LJH A;  4M4R A;  2CGP A;  3B7M A;  2VUL A;  5FZL A;  4XBN A;  4GB3 1;  2WS9 1;  1POV 0;  3WDY A;  2AEY A;  4OZX A;  3ZX7 A;  1GOF A;  1U12 A;  5L9V A;  1CIY A;  4MGI E;  2FHR A;  4NMI A;  4C0B A;  4RS5 A;  3POF A;  4QX2 A;  2ZX1 A;  3P3N A;  1ODN A;  3WX5 A;  2XPJ A;  1F9K A;  5CA6 A;  1W28 A;  3HNB M;  4KMQ A;  4QKN A;  1EP0 A;  5B4N A;  3AZZ A;  4LO5 B;  2YU1 A;  4YG3 A;  3LIH A;  1ZRR A;  2YV8 A;  2VBB A;  3E1F 1;  1SLA A;  4FPE A;  1HJG A;  4JC1 A;  1HXS 3;  2P3J A;  4TZD A;  5FJK A;  4DS0 A;  3ITQ A;  2D93 A;  2A6Z A;  1FPN 2;  1PM4 A;  3HQU A;  1JOB A;  3N7L A;  4FPH A;  4UF0 B;  1V9U 1;  3RZK A;  4K21 A;  4JQT A;  2VCM A;  1U5X A;  2E7T A;  5E16 A;  4P9L A;  4D7T A;  3M3Q A;  4YNI A;  2I45 A;  2ZCW A;  5FZ1 A;  4LKF A;  5IFP A;  1XNB A;  5J37 A;  5C8W A;  1H2L A;  2D98 A;  1AR7 2;  5F3G A;  5BXX A;  3LB9 A;  1AYN 2;  3ZIX A;  1X8E A;  3X29 B;  5EFU A;  4PLM A;  4Q0U A;  4B7K A;  1C8N A;  1W8H A;  2XJP A;  2ZX2 A;  3ILR A;  4I01 A;  2WRA A;  5HCF A;  3KQ4 B;  5GLV A;  3USS A;  2BW8 A;  4UI9 L;  1YQC A;  1A3K A;  1DQ2 A;  1UY2 A;  1S0J A;  5F39 A;  1K5M C;  2NP0 A;  4KG0 A;  1YQ5 A;  4YZ3 A;  1DDL A;  4AFA A;  1BMV 2;  3KGL A;  4BB3 A;  1XOY A;  2DVG A;  2XL9 A;  3WG1 A;  4FTS A;  3GZU C;  2DFC A;  2N7G A;  1BEV 2;  4AGG A;  1LNS A;  2WNV B;  2ARC A;  5D2A A;  3VDB A;  1FV2 A;  3B9C A;  2WQ8 A;  3VBR B;  4LQR A;  3OBZ A;  4MGQ A;  1R1A 2;  3MW4 A;  1ZBA 2;  1UIK A;  2WFF 3;  4LXL A;  3RZJ A;  1K3I A;  1LGC A;  1PNF A;  1SHW B;  1C28 A;  2FCT A;  1ULC A;  3LAG A;  1W8O A;  3OY8 B;  4QGM A;  4JGY C;  3ZDV A;  1HIX A;  5EXO A;  1BBT 3;  5GLZ A;  1L7R A;  4FVV A;  5C70 A;  4UYB A;  2WZP P;  4NIH A;  3FUQ A;  3GBW A;  1OPO A;  1UL9 A;  4QPY A;  3ZN4 A;  4IEV A;  4DUX A;  4CU6 A;  4UW6 A;  4Y1Z A;  1YQ6 A;  1UZW A;  5AC9 1;  3PVE A;  4CDQ B;  4JV4 A;  2K2S A;  4RSU A;  5JCT A;  5JSR A;  3M1H A;  1Q8O A;  1S0I A;  1S2E A;  1UN1 A;  4CZS A;  4KGQ A;  2VQT A;  1DQ4 A;  4AI8 A;  5FXX A;  3KLS A;  4AQ2 A;  5CBL A;  3ENR A;  1MS4 A;  3V65 A;  3N4M A;  4FXK B;  3KV4 A;  1UAI A;  3VZJ A;  2ZEX A;  3BU0 A;  4OI0 A;  1OF4 A;  3RYR A;  3OJB A;  1WW4 A;  2ZEY A;  3DYO A;  1S0D A;  1F2N A;  1R1A 3;  3CZU A;  2PAM A;  5CAD A;  1RUC 1;  2DDU A;  4NHY A;  3O1O A;  2PQS A;  2R06 2;  4ZU4 A;  1OLR A;  3LA3 A;  5DPN A;  5FK8 A;  1W90 A;  2E6V A;  2WO1 A;  2ZEZ A;  3RSJ A;  1WMD A;  4NIA A;  1CPM A;  4OHW A;  4CCN A;  4QB6 A;  3AVS A;  3Q8B A;  4Y24 A;  4IV1 C;  5T5O A;  1ULF A;  4MYE A;  3U37 A;  4MAD A;  1KXG A;  1W39 A;  2WYS A;  1A78 A;  1PZ9 A;  3QOP A;  4PJY A;  3ZYI B;  3RZH A;  2XVK A;  4YYO A;  1RUD 1;  5LRS A;  2XON A;  4PQ9 A;  2G9G A;  5HI0 A;  1CX1 A;  2DWR A;  1UMZ A;  4XXA A;  3GBG A;  2WO7 A;  3C7F A;  1BCX A;  2R1B A;  2ZAB A;  1ND2 B;  3E6D A;  4K7J A;  3VBF A;  3WQ0 A;  5C8C B;  4YGB A;  4HKL A;  4B4P A;  1H2K A;  1H8T A;  2RS5 1;  3M2M A;  3I7D A;  3MF6 A;  4QU2 A;  1O3S A;  2X8K A;  4YW5 A;  3I3B A;  5J96 B;  3PJQ A;  1UKR A;  3UGF A;  1GIC A;  2IXL A;  4DIN B;  5ABJ B;  1CWP A;  4LIV A;  2BZD A;  4DEQ A;  1TMF 1;  1X36 A;  2EAK A; 
#chains in the Genus database with same CATH homology
 4XUT A;  1F4H A;  2DCK A;  5I0D A;  1J84 A;  4LPL A;  1UYY A;  2X05 A;  2LS6 A;  1JZ6 A;  2VCC A;  2WAA A;  2QQL A;  1JI6 A;  1O59 A;  5IHR A;  4A42 A;  3I2I A;  2ID4 A;  1NX9 A;  1CZV A;  2W1S A;  2EIB A;  4DUW A;  5LA1 A;  1RYY A;  1JZ2 A;  1JZ7 A;  4OMC A;  2VJX A;  4E8C A;  1GMM A;  3I2H A;  2VMF A;  1JZ3 A;  2ZEW A;  5LA0 A;  1GNY A;  2E32 A;  5EJZ B;  1F4A A;  4A6O A;  1K45 A;  3F2Z A;  3THD A;  1JYV A;  3OEB A;  1DYO A;  3A23 A;  2VTF A;  3FHA A;  4PF1 A;  3III A;  2C9K A;  3VDA A;  1UYX A;  3DYM A;  3SKV A;  5IYY A;  4P5Y A;  2YG0 A;  3WNM A;  1D7P M;  2VQU A;  2CDP A;  3T08 A;  2VZU A;  4A44 A;  3I2G A;  4Z2A A;  5DMY A;  2ZXQ A;  5C7G A;  1HN1 A;  3LEG A;  1UY0 A;  4JKM A;  4AG4 A;  2W5F A;  2VZT A;  3CQO A;  2C26 A;  3BGA A;  2Y6G A;  3C7G A;  2VMD A;  4IUG A;  3NJX A;  2WBK A;  2VZO A;  3T0B A;  4TTG A;  2Y6K A;  5HPO A;  3MUZ 1;  2QQO A;  2Y64 A;  2OKX A;  3THC A;  3VD4 A;  4CU8 A;  3LQC A;  4ET7 A;  1UZ0 A;  1JYW A;  2J7M A;  2VZP A;  3CZJ A;  1PX4 A;  2E26 A;  4E8D A;  2YFU A;  1OF3 A;  2VL4 A;  4P00 B;  2VZ3 A;  4CUA A;  3I2F A;  2W95 A;  2YFZ A;  4UOJ A;  4CUC A;  1CZS A;  3K77 A;  1XNA A;  4P02 B;  5IFT A;  3D3A A;  2W47 A;  2KD7 A;  1PX3 A;  3P6B A;  3IAP A;  3GXU A;  1EUU A;  3A22 A;  3VD9 A;  2WZE A;  5JXI A;  4GWI A;  4QX1 A;  2W92 A;  2WN2 A;  2BGP A;  3LE0 A;  4JX0 A;  3NJV A;  2VZQ A;  3K46 A;  4ZXE A;  2WAO A;  5DQ0 A;  3W5M A;  5A1A A;  2W9X A;  2JDA A;  3HEI A;  1JHJ A;  1KGY A;  2E33 A;  4BK4 A;  3HJR A;  3A21 A;  4BJ0 A;  3W5N A;  3UES A;  3ABZ A;  3WF2 A;  1GOG A;  3LPF A;  5CYY A;  4PQQ A;  1I5P A;  4A41 A;  2DCJ A;  4XUP A;  2E31 A;  2WO3 A;  5EJ1 B;  3T2O A;  2JE8 A;  2WUH A;  3C8X A;  4ZZ8 A;  1JZ8 A;  1US3 A;  1UY4 A;  2VZ1 A;  3WNN A;  2WO2 A;  3OGS A;  1UXX X;  1UX7 A;  3DEC A;  3VD7 A;  3MO4 A;  3WF1 A;  2VCA A;  3ETP A;  4XUQ A;  1GOH A;  1W9T A;  3VD3 A;  3VDC A;  3OB8 A;  3MV0 1;  3JXS A;  1TG7 A;  1DLC A;  4CUB A;  4HG6 B;  2VZS A;  4CU7 A;  3HNY M;  3OG2 A;  1MPX A;  4LKS A;  1TVG A;  3MBW A;  2XQX A;  4ZY9 A;  2Y6J A;  3J7H A;  3WSO A;  4GWJ A;  3ZM8 A;  2QQN A;  4QPW A;  2QQK A;  2VME A;  3NRU A;  1PMJ X;  2B9V A;  1GQP A;  5JXJ A;  3ECQ A;  4QX0 A;  4XUR A;  5CZK A;  1K42 A;  2W87 A;  4QDQ A;  3NNG A;  1JU3 A;  2QQI A;  1BHG A;  3PUH A;  2J1U A;  3CDZ B;  1IQD C;  1GUI A;  2HLE A;  3ACG A;  3CIH A;  2V5D A;  3I97 A;  4XUO A;  2J1E A;  2YC4 A;  4A3Z A;  3I3D A;  1UMI A;  3WNP A;  3WF4 A;  3FHQ A;  5JUV A;  4LHS A;  1DP0 A;  3T09 A;  5C71 A;  1UMH A;  1L7Q A;  3K75 B;  1NAE A;  4OUE A;  2W3J A;  3DYP A;  2VC9 A;  4TXW A;  3WF0 A;  2W1W A;  5IJR A;  3PUI A;  3I3E A;  2JKX A;  3OGR A;  3WQB A;  2Z4F A;  2B4K A;  3HNM A;  5JXG A;  3WNL A;  1CZT A;  4QAW A;  1YQ2 A;  3ACH A;  2VR4 A;  4BK5 A;  1WCQ A;  3OBA A;  4KI5 M;  1W99 A;  2WDB A;  2WAB A;  4JHZ A;  1R64 A;  3I2J A;  3CKH A;  4QB2 A;  2WZ8 A;  4ZZ5 A;  3T2P A;  1ULP A;  2QQM A;  1WKY A;  2VCB A;  1XC6 A;  1O8S A;  2Y8K A;  4JKL A;  4A4A A;  4DXT A;  1NUK A;  2VM9 A;  1JZ5 A;  3SEP A;  3K4D A;  2EID A;  2CDO A;  5F7U A;  4PT6 A;  1W9W A;  4UAP A;  2X09 A;  4MGS A;  1W8N A;  4DXR A;  4ARX A;  4QDS A;  2W1U A;  5FUI A;  1JYN A;  2J1T A;  3WEZ A;  2RV9 A;  1XPW A;  3WNO A;  1JU4 A;  3UNP A;  2YB7 A;  4JKK A;  3GM8 A;  3WNK A;  4W8J A;  3AC0 A;  3K4A A;  1KEX A;  2XOM A;  4XVH A;  3HOB A;  4W50 A;  1OT5 A;  1SG3 A;  5JXH A;  3UET A;  2V4V A;  1W9S A;  4OMD A;  4DEV A;  2R7E B;  1UWW A;  1OD3 A;  4XZU G;  5LA2 A;  4BXS V;  4KWU A;  4MO3 M;  3K4Z A;  2LW8 A;  4OZO A;  4A45 A;  4CU9 A;  3C7H A;  5HXM A;  1JZ4 A;  1J83 A;  2BER A;  4M4R A;  4AAX A;  3FL7 A;  4RYD A;  3SKJ E;  2JD9 A;  1GOF A;  4MOA A;  1ULO A;  5B4X A;  1CIY A;  4QX2 A;  3FN9 A;  2VOT A;  3T0A A;  1UXZ A;  3HNB M;  4KMQ A;  5B4N A;  3MV1 1;  3E1F 1;  3I2K A;  2ORX A;  1P8J A;  3C7E A;  4YPJ A;  3GGL A;  4D0Q A;  1UY1 A;  3ACF A;  2HYX A;  2Y6L A;  2XHN A;  3EYP A;  3OGV A;  5IFP A;  5DN2 A;  4GZ9 A;  3LEI A;  2RVA A;  4QDR A;  4UI9 L;  2VZV A;  2RJ2 A;  1UY2 A;  3LEK A;  4DUV A;  1SDD B;  2V72 A;  1LNS A;  4M4P A;  3VDB A;  3CMG A;  2EIE A;  3WF3 A;  4DXS A;  2WQ8 A;  4LQR A;  2C4X A;  5G05 L;  4MGQ A;  1EUT A;  3OEA A;  2QBX A;  4OYU A;  2W46 A;  4FI9 A;  1T2X A;  1K3I A;  2BGO A;  3EB7 A;  1SHW B;  2W91 A;  5J1X A;  1NKG A;  4QB1 A;  1W8O A;  1JYX A;  3HPN A;  3IB3 A;  2J1S A;  1L7R A;  1H6Y A;  4D8M A;  2Y6H A;  5C70 A;  2BBA A;  1XNT A;  4CVU A;  2J1V A;  4BDV B;  4DUX A;  4CU6 A;  1UYZ A;  3HN3 A;  2VMC A;  4QX3 A;  3P1I A;  1GU3 A;  4XUN A;  2W94 A;  3LPG A;  2VQT A;  1W0N A;  4W4Z A;  1US2 A;  2ZEX A;  3IAQ A;  3NQH A;  1OF4 A;  4ARY A;  2ZEY A;  1UY3 A;  3DYO A;  3CZU A;  5EIY B;  3ACI A;  2DDU A;  1H6X A;  2PQS A;  2ORZ A;  3C7O A;  5DPN A;  2WO1 A;  2ZEZ A;  2J1R A;  4QB6 A;  2WN3 A;  4RN5 A;  2EIC A;  1O8P A;  3T2Q A;  3U37 A;  4MAD A;  2WYS A;  2X10 A;  2L9L A;  2QQJ A;  2YC2 A;  4L0P A;  1K12 A;  3A7Q A;  2XON A;  5G04 L;  1OH4 A;  5JR2 A;  1CX1 A;  1PMH X;  2VZR A;  5LCW L;  2J1A A;  3C7F A;  3T0D A;  3MUY 1;  4P08 A;  3IDA A;  3SEE A;  3I3B A;  2W1Q A;  2VO5 A;  3GDB A;  2J22 A;  3BN6 A;  2BZD A;  4DEQ A;  3VD5 A;  5JMO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...