2YFUA

Cbm62 from clostridium thermocellum xyl5a
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
140
structure length
140
Chain Sequence
SYPKLTGTVIGTQGSWNNIGNTIHKAFDGDLNTFFDGPTANGCWLGLDFGEGVRNVITQIKFCPRSGYEQRMIGGIFQGANKEDFSDAVTLFTITSLPGSGTLTSVDVDNPTGFRYVRYLSPDGSNGNIAELQFFGTPAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Novel, Noncatalytic Carbohydrate-Binding Module Displays Specificity for Galactose-Containing Polysaccharides Through Calcium-Mediated Oligomerization.
pubmed doi rcsb
molecule tags Sugar binding protein
molecule keywords CARBOHYDRATE BINDING FAMILY 6
total genus 32
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2011-04-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2yfuA00
3HNMA 4M4RA 1UWWA 4JKLA 2Y6HA 2L9LA 4CUAA 4DXTA 2XONA 1IQDC 3WEZA 1F4AA 3MUZ1 2VZRA 3WF3A 3VD4A 2E32A 1XNAA 2VO5A 2WUHA 3K4AA 1JU4A 3GGLA 5C70A 1UY1A 1OH4A 2EIBA 4UAPA 4JKKA 4A6OA 1YQ2A 2VCAA 3VDAA 3T2OA 1D7PM 2VC9A 4QPWA 4P08A 5IHRA 2W87A 4ET7A 3C7HA 2B9VA 4JX0A 4W8JA 2VZ1A 2LS6A 2R7EB 4W4ZA 4DXRA 2WAAA 4BK5A 1UY2A 3ACGA 4DEQA 1GUIA 3NRUA 4P02B 3AC0A 2JDAA 2XHNA 3PUIA 1XC6A 2QQNA 1GNYA 3A7QA 5JUVA 5JXIA 5FUIA 1BHGA 2B4KA 3IDAA 3I2JA 2PQSA 3GM8A 4BK4A 4QB6A 3CKHA 4A41A 2W95A 1EUUA 3FHAA 4M4PA 1RYYA 1K45A 2VCCA 3T08A 3CIHA 1JZ4A 3SKJE 1PX3A 5B4XA 4QX3A 3HNBM 4MADA 1OD3A 4DUVA 2HYXA 1K3IA 4XZUG 1NX9A 4CU7A 2VOTA 3DYPA 3VDCA 4QB2A 1W8OA 2RJ2A 1CX1A 4MOAA 4OMDA 2VZPA 4E8DA 2E31A 2YC4A 3LEIA 1W9TA 3ZM8A 3ABZA 1O8SA 3GXUA 1W99A 5LCWL 2QQIA 1JI6A 5IFPA 1H6YA 2VZOA 1J83A 2Y6KA 2WABA 3OGRA 3A21A 5HPOA 2WO2A 2BGOA 2XQXA 3WF4A 4A42A 3VD7A 4P5YA 4XVHA 3LPGA 2WYSA 2YFUA 3MV01 2Y6GA 1UYYA 4QX0A 3NJXA 1ULOA 3I2FA 1CZSA 3THCA 5IFTA 3SKVA 4AG4A 3K75B 1W8NA 2V72A 4RYDA 4ARXA 3BN6A 3P6BA 2WQ8A 2XOMA 5J1XA 3IAQA 1UY3A 2VZVA 3W5NA 2VZTA 4UOJA 3LEGA 4XURA 4GZ9A 1JZ7A 1DYOA 2ZEYA 3T09A 2VZQA 3HJRA 4BDVB 5JMOA 3CZJA 3ACIA 3I3BA 5DQ0A 2BGPA 3I2HA 1GMMA 5A1AA 3WNKA 3LEKA 5B4NA 2JD9A 3WNPA 2YFZA 4ZZ5A 3NQHA 1TG7A 1XNTA 5G05L 4ZZ8A 2VMEA 2VMDA 2X05A 3LPFA 5EIYB 2X09A 1NKGA 3I97A 3T0AA 4E8CA 2VCBA 1W0NA 4ZY9A 2VL4A 4BXSV 1KEXA 3NJVA 2BBAA 1CZVA 2ORXA 4OMCA 1H6XA 1UZ0A 1UMHA 1JU3A 2VMFA 1JYWA 2ZEWA 3OEBA 1W9SA 3FHQA 4JHZA 4LHSA 4TTGA 1ULPA 2WDBA 3E1F1 3WQBA 3WNMA 2J1TA 2W3JA 2VR4A 4CUBA 3OGSA 1GOFA 2W1UA 1KGYA 2ZEXA 5JXJA 3OGVA 5DPNA 1UXZA 1UY0A 4TXWA 4XUOA 2C9KA 1JZ2A 2W9XA 2OKXA 3U37A 4A3ZA 3CMGA 3FL7A 1OF3A 5G04L 4OYUA 4A44A 2Y64A 2CDOA 4D0QA 2WN3A 2WZEA 1F4HA 3WNNA 1GQPA 3P1IA 1O8PA 4PT6A 3VD5A 3ETPA 2VZSA 1GOHA 3VD3A 4MO3M 2ID4A 4KI5M 3IAPA 3WNLA 3I2KA 2CDPA 3HN3A 1US3A 3NNGA 3OB8A 4W50A 3HPNA 1UX7A 2J1RA 4DEVA 4YPJA 2Y8KA 1GU3A 4P00B 1UYZA 5DMYA 3WF1A 3I3DA 3F2ZA 3ACHA 3GDBA 2W94A 2LW8A 1WCQA 3ACFA 4QB1A 2BERA 4DUWA 3C7FA 3DYMA 3EYPA 1CZTA 1UXXX 2J1SA 2VQTA 3OBAA 2RV9A 2WO3A 4D8MA 1K12A 2JE8A 4XUPA 3HNYM 5F7UA 3OEAA 4CU9A 4JKMA 5EJ1B 5C7GA 3K4ZA 3MBWA 1JZ6A 2VMCA 3VD9A 2W1QA 2QBXA 4OZOA 2WO1A 3WF2A 1US2A 3J7HA 2QQMA 2DCJA 4QDRA 1W9WA 4A4AA 3LE0A 3MV11 4FI9A 1T2XA 3K77A 1TVGA 2ZEZA 1R64A 3A22A 4DUXA 3EB7A 2J1VA 1OT5A 4MGSA 3DECA 3C7OA 3I3EA 2J22A 3T0BA 1LNSA 2V5DA 3I2IA 5C71A 2HLEA 2W5FA 2C26A 4XUQA 1GOGA 3LQCA 1JZ8A 2E26A 2C4XA 3HEIA 4QAWA 2WBKA 4KMQA 4XUTA 4AAXA 3C8XA 3I2GA 5LA0A 3OG2A 2W92A 2J1UA 2KD7A 4IUGA 5LA1A 2J1EA 5HXMA 3T0DA 1PX4A 4PQQA 3T2PA 5IJRA 2QQJA 3THDA 1L7RA 2VZ3A 3JXSA 1MPXA 3D3AA 5IYYA 3CZUA 5JR2A 2E33A 1JZ3A 2W46A 1UYXA 3UESA 1SG3A 5I0DA 3WF0A 1JYNA 5CYYA 1XPWA 3MUY1 3UETA 5JXHA 4PF1A 2DCKA 4XUNA 3T2QA 1HN1A 5EJZB 2DDUA 4KWUA 2ZXQA 3ECQA 2J7MA 2W1WA 1SDDB 4BJ0A 1JYVA 1JYXA 3FN9A 1NAEA 4HG6B 3C7GA 4OUEA 3VDBA 2W1SA 4LKSA 4CU6A 1WKYA 1CIYA 4GWIA 2YC2A 1O59A 1PMJX 3SEEA 4RN5A 1SHWB 4GWJA 1OF4A 4QX1A 5LA2A 3K46A 3PUHA 4A45A 2QQKA 4CUCA 2VZUA 2Y6LA 3CQOA 2VQUA 2VM9A 5CZKA 4LQRA 3BGAA 2W47A 2YB7A 2X10A 4DXSA 2ORZA 2VJXA 2J1AA 5JXGA 2QQLA 4QDSA 3W5MA 2WN2A 4LPLA 1UMIA 2EIDA 4CU8A 1J84A 3K4DA 2WAOA 3IB3A 3UNPA 5DN2A 3SEPA 4L0PA 2VTFA 2JKXA 2Z4FA 2BZDA 4UI9L 2RVAA 2EIEA 3HOBA 2Y6JA 1DLCA 4CVUA 4ZXEA 2V4VA 1EUTA 1UY4A 4ARYA 1L7QA 4QDQA 1NUKA 1K42A 1DP0A 2QQOA 3CDZB 3WNOA 2WZ8A 2W91A 1I5PA 1JHJA 4QX2A 1PMHX 3C7EA 4Z2AA 2EICA 2YG0A 3MO4A 3DYOA 3WSOA 3A23A 4MGQA 1P8JA 3IIIA 1JZ5A
chains in the Genus database with same CATH superfamily
1YJKA 1UL9A 4NJ4A 2E7QA 3ETQA 4WM7C 4FAGA 1OVPA 2BOIA 2CV6A 3DXUA 3L2HA 3Q8BA 4NMIA 3WUDA 1ZRCA 4AVTA 1ALYA 5FZ3A 4AEDB 2VVEA 2JWPA 3I3MA 1QXJA 1MEC1 1HB3A 2BNMA 4CDWB 1I9RA 1KJRA 4LJHA 3PMEA 4Y26A 3WF3A 5EPAA 3VD4A 5IATA 2CWSA 1R091 3L9JT 1FYUA 1LGCA 4KBBA 4N9HA 4QHBA 4AF9A 1W28A 3QLQA 1C4RA 1TE1B 5GZFA 2OZJA 1YI7A 2K2SA 1GZCA 4A6OA 5CFCA 2Q5TA 4RQPC 2VCAA 1RUNA 4YFWA 2VC9A 1D4VB 3VZLA 2IXHA 2NPIA 4MX3A 4R52A 3ASIA 5GZCA 3NV3A 5IHRA 2WNUC 4JX0A 1DQ1A 5A33A 4B7KA 2VZ1A 4QX8A 1VB4A 2LS6A 5IK5A 4Q4X1 4W4ZA 2UWBA 4NPLA 1FX5A 3G6JB 4P02B 1FOD2 2Z69A 2JDAA 3AC0A 1M06G 3MW3A 5T55A 1GZWA 2QQNA 5FZ1A 1CD3G 1GNYA 5JUVA 3SH4A 1FNZA 1W6PA 1IS6A 1REFA 1G9BA 1BHGA 1VBE1 3IDAA 4P9GA 1IPJA 4AWDA 4AGVA 3GM8A 3PVOA 5L7OB 2YY1A 5FMOL 3MW4A 1BEV3 2DVDA 4A41A 1EUUA 1IPSA 3FHAA 4YG3A 1UQXA 2D6KA 5A3UA 1N3OA 1PIV1 1W3VA 1GR3A 2DFCA 3T08A 2WT0A 3TAYA 3ES1A 4NN0A 1DF0A 1YXWA 1W39A 1BBT1 4XW3A 1O4TA 2GN3A 3KHCA 3CU7A 1WW6A 2RR11 4FFHA 4Y20A 4YW4A 3ST7A 3POEA 1CAXA 3BOPA 1AR92 2HYXA 4PLNA 4FSJA 1Y9MA 2VOTA 1QJU3 2ZGTA 1YC61 2VG9A 1ULDA 4Y1XA 1ZZBA 5BNNA 4XFHA 1W8OA 3JCIA 3ZFFB 2WA3A 2OXBA 1OKQA 5EHDA 4AR2A 2DWRA 1FAYA 4CXXA 4B1MA 5KC6A 2QDRA 3URFA 5J7MA 2E31A 2PHTA 3LEIA 2D3RA 1YFUA 5A7PA 1E5RA 1WMXA 1AYN1 4Q8LA 1TMF1 2QNKA 5FZBA 1HRV1 3MDPA 1ST8A 1W99A 2XWJB 5DXDA 5LCWL 1JI6A 4Z82A 1Y3TA 3L2YA 1R082 4QXCA 5IFPA 1H6YA 2B5HA 2WL1A 1D2SA 5JSPA 5CFDA 1QU0A 3NNLA 3V0AA 1MACA 3LAGA 4DMIA 1JYCA 1BBT2 3KV6A 5FWJA 4FPOB 5CKQA 4JGZB 4C91A 4IE6A 4PI2A 4BISA 3A21A 2GNDA 4N90A 4MGYE 5HPOA 2QZ2A 2WO2A 2BNNA 3WF4A 2JXAA 1JS9A 3LFMA 1O5UA 1LOGA 4PCRA 5L19A 4GQ7A 1OVSA 1PNFA 3HQRA 4RHV2 4Y4YA 3ZSJA 1BK0A 5KXCA 1AXKA 2Y6GA 5IVVA 4AHZA 3GF6A 1VBD2 1SDWA 2JG9A 2BFUL 2VMHA 2BWCA 1N1TA 1FOD1 3NV1A 2A6XA 3THCA 3IDEA 1QEXA 5KBFA 4AG4A 4NIHA 1PGW2 1V9U3 4AVAA 3H3ZA 3KB5A 1O5LA 1RUI3 1ZA4A 4FFGA 1LR5A 1UMZA 2HWF3 1OC1A 3KMHA 3P6BA 4ATFA 4DXZA 5A3TA 2FDKA 5BXXA 2A71A 1WW7A 1Q43A 3CJIB 5K4LA 4OUMA 3U75A 4OI0A 3RYRA 2VZTA 3LEGA 4G9SB 2ZBJA 1UIKA 1J3RA 3BTAA 4GZ9A 1U5ZA 4P9LA 2WT2A 4G4FA 2ZEYA 2GMPA 4MVTA 1AR72 1FT9A 1F15A 2PLV3 1H8VA 1QXPA 2ZGRA 5DQ0A 3I3BA 1ZREA 4CPBD 4A6SA 4GJZA 2D6LX 2ARXA 4QHZA 4YM2A 1WLTA 3U14A 2GDFA 4OHWA 4D7TA 4XAAA 5FJHA 2WT1A 4E4SA 1V00A 3AZWA 1JODA 3KT4A 3WX5A 3D8CA 2E7TA 2VXJA 2XH6A 3LEKA 4YZ4A 4C0HA 3AZXA 3TOJA 4CCEA 5FQ0A 4LOTA 3AP7A 2CTVA 4LO6B 4OQ9A 2VXRA 3B93A 4LTAA 3GZEA 1MEC3 1RUC2 5FZKA 4BCUA 4KGQA 1AYN2 5D8AA 1UZWA 2RM22 1OBNA 1TG7A 1XNTA 2AREA 2CHHA 4CEWB 3KV4A 1KS5A 4E27A 3V65A 2ET7A 3M3OA 4DIQA 3V0BB 2VPVA 3TB0A 1X50A 4MGKE 3ZYPA 2X09A 1IS4A 2XJTA 5FY5A 2YZ4A 1W0NA 3NSTA 4GMP3 4HBNA 4Y1UA 4FQ4A 4BXSV 2Q1ZB 3M4FA 4IGOA 1KEXA 2VNGA 3NJVA 4CDXB 2WR9A 5GJ6A 5IAXA 2X5IB 2GH8A 3AMMA 2ORXA 1TMF3 4IV3C 1H6XA 4OMCA 5LWBA 2PN5A 3RWKX 2WIIB 1ZZ7A 2XJSA 3HQUA 3LDRA 4HMZA 3TNQA 4CDQA 4WM7B 4FPGA 4I3PA 4AI9A 4ZU4A 1QJFA 1UOGA 1W9SA 1Q8SA 2ZEWA 3OEBA 4QPGC 4XF3A 4TTGA 3E1F1 3QH7A 5FY7A 5FYBA 2FCUA 2J1TA 4X8PA 4Y5SA 2VR4A 4CUBA 1W6OA 3OGSA 4R4XA 5EV7A 1GOFA 5SV8A 2W1UA 3H1YA 4CEYB 3O0VA 5L36A 4N9IA 2WZR2 4YGEA 3BVCA 2B7YA 2DYCA 3BODA 3ZFGB 5KWRA 1MR5A 4YLZA 5DPNA 5C5UA 5CIRA 4XUOA 4LBNA 2W9XA 2OKXA 3U37A 3IPVB 1H2MA 2C24A 4MGTA 1PGSA 4OYUA 3JQWA 3UGFA 3B9CA 1MS8A 2YGMA 4JGYB 2Y64A 2XJUA 4D0QA 2WN3A 4MSVA 4XIOA 2FDGA 3ZFGC 2XKOA 2RS53 1COV1 4F3JA 1RC6A 4R9DA 1PVXA 5GLUA 5JAXA 1VBB1 3WNNA 3P1IA 2ARAA 4GB32 4MG2A 3AVSA 5LK7B 3UT0A 2VZSA 5DAQA 1GOHA 2D98A 3VD3A 4C1WA 4MO3M 1FMD3 1APNA 1QJY3 4RR3B 1ZBE2 4XETA 2OA2A 5FPBA 2WFF2 1US3A 3NNGA 1VBA2 3I4IA 4LKFA 1ENXA 4W50A 3USUB 1V70A 3AK0A 1UX7A 1WA6X 1TQ5A 3PU8A 2P2KA 5EZWA 3RZJA 1GU3A 4HL0A 1IS3A 3B94A 4CDWA 4LBQB 1CR7A 1UU5A 5FZIA 3WF1A 2ZTNA 1SBDA 2Y0OA 3CBNA 1WBFA 5DAWA 3F2ZA 3GDBA 5FUNA 2W94A 4BLJA 1QJU2 5K0UB 3H8RA 3U4XA 2RS12 3OCPA 1WCQA 4OZXA 3SCFA 4DUWA 3OGGA 3C7FA 1ASJ1 2JDYA 5BNNC 1CZTA 2AACA 4J1WA 4CTEA 1ENSA 1XU2A 4NIIA 1FV3A 3M3IA 2PHLA 1JN2P 4IEQA 4XUPA 2NMOA 1PIV2 2BU9A 1W9YA 1H2LA 5KXDA 2OZ6A 3BU0A 1C8M3 5C7GA 4Y4RA 5F9TA 5C8CB 2JE7A 2VE1A 3N9QA 4UT5A 2GU9A 3KWVA 4XHBA 2WO1A 3R4SA 1US2A 3WF2A 4Q27A 5ACA1 3AMHA 2CAVA 3S7EA 1O3RA 2RE9A 4GMP0 1NYWA 3B9IA 1OHFA 1H1AA 5DAXA 4AEJA 1RUH3 1GNZA 5A1FA 4AGGA 3MV11 1AR83 4OI1A 3HN1A 1OUSA 4UBHA 3VN4A 1R64A 2F4PA 4K40A 2R1DA 4K20A 4CP0A 1UZZA 2R49A 4AQTA 4YWAA 1NG0A 3TNPB 4RHV3 3PVNA 3O12A 4MGSA 3C7OA 4O7XA 3I3EA 5JOXA 1SBFA 1S0FA 4Y20B 4RFT0 1URXA 2XBO2 4YVSC 2DTWA 4L9BA 1LNSA 1RGSA 2PHFA 2GSYA 2XMLA 1ZZ8A 3I2IA 4ORFA 4XILA 3W9AA 2WNUA 3O1RA 3ZDSA 3OUIA 2QQWA 3OGJA 1W6NA 5CVRA 3DKQA 2JD4A 1BVVA 1AF9A 1OA3A 4E4HA 4C1XA 2ZGNA 4Q1PA 4GAZA 2PHRA 3DUIA 1C5HA 4FVVA 2QJVA 1RUJ3 1FOD3 1W0OA 3WOGA 3H1WA 2MNGA 2XVKA 5LA0A 3OG2A 3QBQA 4DZGA 1CESA 2W92A 3H7JA 2VY0A 5LW9A 1CIWA 5KXBA 5LA1A 2J1EA 2HBUA 2ZS6B 3VBUA 2ZAAA 3J8F1 4YZ2A 5ABJC 4UFJA 4AAPA 5BNOA 1NY72 4FTSA 5I0SA 2JDMA 1OH3A 3IMNA 3VBOB 1VBE3 1AR73 3BYWA 5IJRA 4AQ6A 1VBB3 2VOKA 4I01A 4YG0A 1BQPA 3ZYJB 1X8MA 1SLIA 4KWLA 2JEMA 1MQTA 5FPUA 1NQJA 5IYYA 3MFCA 1DQ0A 3ZFFA 3KT7A 4LIUA 4LO7A 4FT8A 1ENQA 3OPZA 3R4UA 4M0HA 3WV6A 4CXWA 3OUHA 5E16A 5FPZA 3VB9A 2JIGA 1SG3A 5FZ9A 2NYYA 5FMBA 3WF0A 4EN9B 4ASLA 1JYNA 1PO23 2Z5WA 4IXLA 3E5XA 4UYBA 3BKZA 4CCCA 5A7NA 1XPWA 1H2NA 2HWC3 3MUY1 4HKOA 4QXHA 3HT1A 3UETA 5IVEA 5A6XA 3IWZA 2SLIA 3KHBA 1OUXA 4BQ2A 2DCKA 1KRIA 4R9AA 3V0AB 1YQCA 2UYAA 2AUYA 2W39A 3OSDA 4WVZA 3C2UA 3S7IA 2DDUA 4KWUA 2ZXQA 2Y33A 3ECQA 3N7MA 1G7YA 3K51A 4QPIA 5AFBA 4BJ0A 1R083 1YWKA 3FN9A 3PURA 5DUWA 3SMHA 3WY6A 3VKLA 3CJIA 4B4RA 4KWJA 1I3HA 1W04A 4LO5B 2YC2A 3DL3A 4AFBA 2YUEA 1YO8A 3FMGA 4EROA 4WM8C 1FXZA 1O59A 4NVPA 3PTYA 1PMJX 4N53A 5CADA 3KM5A 3EO6A 3RZGA 1OF4A 2ZA9A 3NVCA 5L9BA 3JBG2 1HQLA 4IGPA 3K46A 4CCNA 3PUHA 4Z8BA 4XXAA 2GH2A 4JZRA 2AYHA 3QACA 4K1ZA 3UYJA 2BEOA 4A45A 2I07B 1A6CA 2PAKA 4CUCA 2VW0A 2WO7A 3Q8CA 3BIEA 2EXJA 4FXGB 2P3KA 2CU5A 3R05A 2ZKLA 2WZR3 5CZKA 3AM2A 5C4WB 5HCBA 1GKBA 5AC91 1BCXA 1MS5A 2YB7A 2HWF2 2ORZA 5A7QA 3W5MA 1UZYA 2YC0A 2WN2A 1NE4A 4OVEA 4E2GA 4CDUA 4K3UA 1C3HA 3K4DA 4MGZE 3VBFC 1W8TA 1JXNA 2GALA 3SEPA 4Y3OA 5F5IA 2GZWA 3RI9A 1RHI1 1H1MA 4LE3A 2PLV2 5GKAC 1V6KA 1OFSA 4ITCA 4L0PA 1NA1C 2JB4A 2UY8A 2Y34A 1OQDA 2JKXA 1NCQA 2PHDA 2VTFA 4N8MA 4CP2A 2HWD1 1FV2A 5CNAA 4OHZA 3H8UA 2JG9B 2RVAA 2GMEA 2RS51 2PLV1 3FHIB 4IERA 4QM9A 2LRPA 1GSLA 4AFAA 4AZZA 2EAKA 1NY71 2B45X 1WGPA 2G9FA 2W08A 4TYSA 2E53A 5DAVA 1OA2A 3CJIC 1IZ3A 2R061 3LDBA 2B8MA 2WINB 2J42A 4I0AA 3D82A 1MEC2 1DP0A 2DV9A 2QQOA 2DF7A 1RIRA 4CCDA 4INDA 5J98B 2CYFA 3LDKA 2CSGA 1JW6A 2HEYF 4XE9A 1WLCA 2X5IA 2XKPA 4JDNA 3ZYFA 3RJ2X 5T5LA 2W91A 1BMV1 1UIJA 4Q26A 1J58A 2DU1A 2EICA 3AMPA 5DZGA 1TEIA 2VQ0A 3DYOA 4KNCA 1OFNA 5AVPA 4FTBA 2D6NA 1W2NA 3VZOA 1DGWA 1SFYA 2YBPA 2PA7A 3H50A 1CN1A 3GYDA 1VAVA 5EYYA 4ZU7A 1N1SA 2ZKNA 5HBAA 4XIKA 2H6CA 1WZXA 1JOJA 3I7DA 2JG8C 2UWAA 1REDA 4DXTA 2XONA 2VUDA 2G19A 3ROUA 1IQDC 2HWB2 5D1IA 1Q56A 2AEYA 3USSA 5FP4A 3J8F3 1F4AA 1MS1A 4FQZA 5FP9A 2JDUA 3W21A 5J3UA 1T6BX 4Q4W2 1HLCA 2FQPA 3CO2A 3VBUC 1X36A 3FE5A 5AVAA 4AI1A 2E32A 1XNAA 4JGYA 5LBFA 3SC7X 1JU4A 3GGLA 3ZN6A 3JBG1 4S2FA 2EIBA 4UAPA 5HXVA 4LHKA 1OOPB 1JTZX 1ZVFA 2BGCA 3HQXA 4XDQA 3H7YA 1D7PM 5CB7A 4HK8A 2I2SA 1B09A 1PVC1 2BJSA 2P5BA 4H7LA 4UF0A 3VHRA 2R041 2CWMA 2ZZJA 3C7HA 4QQ2A 1AR62 4B4PA 4K8RB 1HKDA 4W8JA 2WLPA 1HV0A 1J59A 1GZWB 2A6VA 2XUEA 3W59A 4BK5A 3BIWE 4DEQA 2RS52 3NRUA 1RUJ2 2D7FA 2OPKA 1VJ2A 3PUIA 1XC6A 3OY8A 2ARBA 2AZ5A 3K48A 3VBHA 1RUI1 5LY1A 2R062 3I2JA 2XQRA 3AZZA 4IV1B 2PQSA 3LA2A 2QQPA 1SMVA 4QB6A 2ZX4A 3CKHA 4XBLA 5F8PA 2W95A 5CG9A 4KU7A 1ULGA 1VBB2 3LA7A 5JWPA 2VCCA 4XYXA 1O3QA 5FYIA 1HRV3 3DXTA 5I8YA 2QKDA 3LIHA 4UW6A 4XMIA 1GWLA 5JLVA 2VNRA 3HNBM 2OYZA 4COVA 4K1YA 4DUVA 1YNAA 3HVDA 1V9U1 5KHKA 1FNYA 2VBDA 2D5HA 4Y22B 2WC2A 5C6CA 4UFLA 2HWE2 5A80A 1NX9A 4IE4A 3U11A 4FTEA 5A32B 2C9AA 2ZMLA 4QPGA 1OURA 2V5YA 5BYNA 5JVVA 4QB2A 3TBDA 3ZYHA 4GD4A 4CDQC 1ZRFA 4AGRA 4ES8A 1W8ZA 3M3QA 4RR3C 5CAZA 3WP5A 5JZGC 4PDWC 1Q8VA 4FO9A 5J48A 2PHUA 3LD8A 4E8DA 4TLGA 4YM3A 3WDXA 5DUXA 1O8SA 5HCAA 4CDWC 3UJQA 3I49A 1JMUB 3NAPA 4AE2A 5FFOC 4GKYA 2CL2A 1GP6A 3MHZA 1PK6C 3VKFC 4UFKA 1BLZA 2GAUA 2LM3A 2C1FA 2UU8A 1C8M1 2Y6KA 4PDWB 4TLFA 2VW2A 2JDHA 3H0OA 1HN0A 1AR82 1CPNA 1AVBA 4IGQA 4A42A 2WNUB 2BP6A 5K9YA 3BOWA 3JBG3 1VRBA 3VHPA 1IGOA 1XJAA 2WRAA 1AR81 4AW7A 5I0TA 4NROA 1W6QA 5IVBA 2K46A 1QY4A 1OXCA 3M3EA 3VHNA 2A3XA 3I2FA 4QMAA 5CKNA 1CZSA 5IFTA 3KD4A 5H9PA 3THTA 4ZXKA 3SKVA 4I0BA 4N43B 3BTYA 1RVF1 2P34A 4D3WA 5M0TA 2V72A 4PF5A 4AVCA 2JKBA 4HPKB 4DS0A 3BN6A 2TEPA 3ZKYA 1B35A 4DINB 1LHWA 3T1LA 2XBO1 4XF4A 2XLAA 2HWD2 2W2IA 2GC3A 2WYFA 1UY3A 3FWEA 4JTNA 2VZVA 1KQRA 1UOBA 2F4LA 3W5NA 1VBA1 3Q8AA 1X9PA 3I59B 5H9RA 3ZN4A 1JZ7A 5GALA 1MZ6A 3T09A 4EE2A 1S0GA 3POIA 4XOGA 2Q1FA 2PAMA 3ME2A 4FPLA 5E8AA 3AXEA 3ACIA 3CZJA 2C0ZA 4GWNA 1DU3D 4EWAA 2BGPA 1G9CA 3JUUA 5EFUA 1H30A 1V6MA 1AR71 1COV3 4OHVA 1ZM1A 2EA7A 4IE5A 2VUJA 2NLRA 4Y5Z0 5IUQA 1RHI3 5DZEA 1Z7S1 1C5IA 2AENA 2JG9C 4QWNA 3ZX7A 2Q30A 3FUQA 4LEJA 2D93A 1NLRA 1CX4A 3KV5A 1MS3A 3DEMA 2OPWA 5A3MA 1YIFA 1IOAA 4QD2A 1PO22 4COYA 4C8DA 2JD9A 3D6EA 5A3PA 5JI9A 4AK3A 4I02A 2OUJA 1HXS3 1QMJA 4U2AA 3B3QE 4BQ4A 3WQ7A 1R1A2 4XPVA 2VQAA 4WBBA 1BZWA 3VBOC 2RMU1 3KCXA 3WINE 3USUA 1LOCA 3SHRA 4N7UA 1W6MA 4LNVA 4RD7A 2X05A 1SACA 3K3NA 3VBOA 5EIYB 3T0AA 2A1XA 4PBOA 3POSA 4E8CA 5A1LA 4BIOA 3VKMA 2XVGA 4LBQA 5ACA2 1AYM3 1N1YA 5EQUA 2VL4A 4ZY9A 1SLTA 4YM0A 4UW5A 5BNQA 3KF3A 1FMD1 4F8AA 2RG4A 2R0HA 1GNHA 2BBAA 2ZX2A 1H8TB 2HWB1 5APAA 5K0UA 2A3WA 1R093 5A32A 2WLQA 4YW1A 3WDVA 2JX9A 4PDWA 1OLME 1UD1A 1UZ0A 3EMRA 1S1AA 4XMAA 5CBLA 1JU3A 2ZX3A 2UURA 3RMXA 1QH6A 3ZSKA 1GWKA 5FYUA 3WT3A 1DQ5A 4LHSA 3TN91 1EV13 1LOEA 5FPVA 1LU1A 4RGKA 4GXLA 1LHNA 4HN1A 3WDWA 1Q3EA 2RDNA 4XJAA 4URAA 2VGDA 2OUHA 4EZ4A 4OFGA 4S2HA 5BUVA 1NOVA 3SH3A 4YGBA 4WVMA 1RUD3 4HONA 1S0BA 3OGVA 2TBVA 3FJSA 1UY0A 3AZVA 2C5DA 3M3CA 2C9KA 1UPIA 3O1OA 4WM8B 3WUCA 5FZFA 3ZOIA 4JQRA 4URTA 3H3LA 3RG0A 2GP5A 3FL7A 5F32A 1OF3A 3UL2A 1YFWA 2WQZC 1H4HA 1QDCA 5FMOS 1OPMA 2WZEA 2E63A 1A8MA 1XNCA 1GZ9A 5IK8A 2RR13 4AYUA 4X8NA 5FY4A 4P9WA 5IVJA 2QDNA 2O0OA 1Y9QA 1RUH1 3WW1A 5I0RA 5EJ3A 3OYWB 4KG0A 2AGSA 1ENRA 4P9JA 4HK9A 1W2UA 3IAPA 5HI0A 1W90A 3J7MA 3I2KA 4YW7A 1DYPA 2H6BA 5FV3A 4PI0A 4RQPA 3LOIA 4QXBA 1YFXA 1AL22 2J1RA 4JRAA 4DEVA 4ASKA 1DQ2A 1CQ9A 2Y8KA 4AEMA 3AKQA 3MIFA 4COUA 4Q4X2 1W06A 2XJVA 4RL7A 2A6ZA 3TEZA 4OI2A 4N7IA 4CDXC 5FDBA 4R4ZA 4IEWA 4LR4A 3GBFA 2VVDA 2DCYA 3K3OA 2ILMA 4Q4Y1 1FPN3 1ZNPA 3ZXFA 4XXPA 1UXXX 1D4M1 1UO9A 2J1SA 1LOAA 3OBAA 2RV9A 1F31A 3DN7A 1DZRA 1K12A 4MHUA 3VDDB 4D8MA 1H4GA 2HEWF 2RJLA 3OBZA 3HIFA 3RZKA 1E57A 2WSUA 3WW3A 4DFSA 1VALA 1BK1A 5LB6A 4NE9A 1IPKA 2BVVA 3IKWA 1SCSA 1CAVA 4CU9A 5IVCA 5KHGA 4JDMA 1LHVA 3MBWA 2KR2A 3U07A 1UZVA 4CEYC 4FPHA 3SQOA 3POWA 3ZFEA 2HWB3 2WWUA 2E9QA 2QBXA 4MZUA 4NRMA 1QH7A 2VBBA 1G9AA 3IBMA 1W8UA 4JGZC 4B29A 4NHKA 3FC0A 4FBFA 5FBJA 1A34A 4Q4W3 3GNEA 4R9CA 1W2TA 4A4AA 5T5OA 1HJFA 3LE0A 2WKKA 2BPA2 1T2XA 1BVP1 3A4UA 1S55A 4YNIA 2X53S 2ZEZA 4XACA 4XFIA 5JIUA 1BXHA 1UU4A 5KHIA 3N3HA 3DECA 5BY5A 1PZ8A 5GLWA 2XG3A 3UKNA 3O1UA 2H0VA 2JG8B 2Y60A 4AEKA 2D6PA 2HLEA 2XWBB 3B69A 3WDUA 3NO8A 4J25A 4PIYA 4XUQA 3ZYGA 1GOGA 4D6SA 1ZRDA 2WNVA 5FY8A 1J1TA 1XBFA 1QWRA 2YU2A 4QAWA 3MI8A 1HXS1 3MYXA 4KMQA 4PIXA 4AAXA 3DGTA 1QQP1 5T5PA 5JMCA 5FXXA 2DFBA 3I2GA 5FZ8A 1ZBE1 1XYNA 1BEV1 2DCZA 2YXSA 3MLJA 1V6LA 2KD7A 4IUGA 4R8HA 3T0DA 1PX4A 2I45A 3E6DA 4PQQA 1RUF1 2OW4A 1XU1A 2BWAA 2XDVA 1QOTA 2CGPA 3THDA 4JHTA 1K5MA 2VZ3A 2YMZA 5LBEA 1KFUL 1PHMA 2AEZA 1MVQA 5F6KA 5ABJB 4ZONA 1VLNA 1AR93 4ASMB 1UKGA 1VIWB 4M3CF 4AI2A 2E33A 5EYXA 5JR2A 1JZ3A 4P9YA 2A6YA 4Y1ZA 3ZR5A 2HWE3 3VV1A 1MVEA 4B3NA 1VMHA 3KQRA 3RPQA 1DBNA 3UKVA 3ZYIB 4JVAA 5CYYA 1F5JA 4QX5A 5LRRA 2VCMA 3N7JA 3AP9A 3JD71 1EPZA 1HXS2 4AI8A 1IG3A 4CEWC 1QGLA 2IZWA 4N53C 2VMIA 4GH4A 4GULA 1E5IA 3PJQA 4PF1A 2CNAA 4XJUA 3WW4A 5JXHA 4Y1VA 4BQYA 5DZFA 1DDLA 1LOFA 1NXMA 1X9TA 1VE0A 4UXAA 4ZU5A 2J7MA 2B9UA 3HBZA 2W1WA 1YUDA 1F9KA 4V1PA 1HQWA 4OUEA 3ALQA 2JICA 4HSJA 2A6WA 3TN92 4CU6A 4IESA 3LOBA 2ARCA 3M1HA 4SLIA 3JQXA 3OY8B 1CIYA 3GHNA 4Q2FA 1H8TC 1FI2A 1TMF2 1XB9A 2GP3A 5DDJ1 4YW6A 3ZFEB 4Q4W1 4RGAA 4HXCA 5FK7A 4RN5A 4QKNA 4QPGB 1OA4A 4M01A 4YSFA 1JHNA 1NA1A 3BPZA 5LA2A 1QJX1 4OQ8A 1WW5A 1HIXA 1S0DA 1YHFA 3VGIA 2AC1A 5LEKA 5A3NA 2D44A 2VZUA 5GZDA 2F6BA 2Q1MA 2VQUA 1ZRRA 2VM9A 3DPRB 1GV9A 3M70A 2ERFA 4FOWA 1WD4A 4K7JA 1IG0A 4KGGA 4Q0QA 4Z1VA 1JBCA 4EZHA 2ZX0A 2FDIA 1GANA 3ATGA 3VKNA 2X10A 1VBC1 2IXKA 4HN0A 5JXGA 4QDSA 3NKTA 4KL1A 1W8WA 3LFIA 3RZHA 2WNEA 1H9PA 2PHXA 4Q0PA 3ZLIA 4LBLA 1WD3A 4XBNA 4XZPA 2E6VA 5DDJ2 5CG8A 4CCLA 2WAOA 4M3CA 3POBA 4LBMA 2RR12 4FPJA 5FO7B 4YVWA 2PQQA 3MIHA 4QGLA 1UPSA 3SISA 3PIJA 4CDUB 2PFWA 1W9FA 2TUNA 1CAWA 4AFMA 1SQ4A 2AR6A 3HOBA 2Y6JA 1A3KA 1FMD2 1DLCA 2MEV1 2V4VA 1EUTA 3AB0A 3E97A 1UY4A 1ASJ3 5LBBA 4ARYA 1EAH2 5BV6A 2CY6A 3T2TA 4MGIE 4XCBA 2EXHA 2X29A 5FMCA 1Y4WA 3AKPA 3VLBB 4AHXA 4LBQD 1K42A 3ZXKA 1AYN3 1Z7S2 2Q0AA 1R1A3 5F3EA 3WNOA 1ODNA 1PNGA 3NNJA 3VBSB 1W05A 4JGZA 4XFCA 2WZ8A 1RXFA 1I5PA 1UCXA 5LBCA 3TEWA 2QZ3A 1LCLA 4Z2AA 3R0RA 3VDDA 1PO21 2FBEA 1AYM2 1OQ1A 3OD4A 3LCPA 5FLIA 2GNTA 2YV8A 5FYTA 5E88A 2IC1A 4ZHNA 4UFIA 1W6PB 4M3CE 1NZIA 3M2MA 3IIIA 1PK6B 4Q4V1 1HX6A 2VUCA 4RGGA 5HCHA 1JZ5A 4BB3A 1RMU3 4D6RA 2BFUS 3CLPA 2D6MA 4UBGA 1LJ7A 1O91A 1GICA 2D3SA 5IAVA 3WP4A 1MQTC 4LKEA 2O1QA 5L9VA 3LWCA 4IL7A 1WCKA 4YM1A 4BQXA 2WS91 4IE7A 2YROA 1PVC3 3FLPA 2FD8A 2VZRA 3J7NA 1GBGA 5GLTA 4TN7A 5FP8A 2FDHA 1VBC2 4QQHA 2HWF1 4AI3A 4XJWA 4QT6A 3RYPA 2WUHA 3J26N 1VRH3 5ANNA 2HKXA 3N7KA 1RVF2 2WZPP 2YDEA 3TWIA 1WW4A 2ZABA 3MIBA 5FWEA 1RL3A 4P08A 4ZKTB 1KXGA 2W87A 4ET7A 1GP5A 1PO13 3MIEA 2B9VA 3EQEA 3PUQA 2HWE1 4BOWA 4FAHA 1UX6A 3ES4A 1O7FA 2R7EB 1LEMA 2WAAA 1TNFA 4COWA 1T6GC 1PGL1 1UY2A 1OOPA 4YZ1A 2RS32 1DQ4A 1F5FA 3LZZA 4M3CB 2XHNA 3FX3A 3DPRA 2EALA 5JXIA 1KDMA 1XOYA 2B4KA 4E2SA 1N3QA 2WS92 4QQOA 4O9EA 4BK4A 2MEV3 1QJY2 4B1LA 1O3SA 2Z42A 3D3AA 1ZBE3 1VP6A 4R9BA 4M4PA 5CFCB 2DVAA 3AP4A 4LUKA 1RB8G 2QCSB 1Y9GA 2D43A 2DUOA 5A7WA 3CIHA 5EWSA 3SKJE 1AJKA 2UY9A 5I91A 3DCQA 3PUSA 1X7NA 4MADA 3UJOA 4C0BA 1HB2A 2GMMA 1D0GA 3OD0A 3ZPOA 1K3IA 2C6SA 4FP2A 4GMP1 4L11A 5FOBB 5K7PA 4AVVA 2G9ZA 3EBRA 4YW2A 3S5AA 2RS13 3DYPA 4A2UA 1G9FA 4MH0E 3VDCA 2GNBA 4GIQA 5CU1A 2VOWA 5J37A 2MPFA 3VUOA 1H1IA 1BJQA 1SPPB 2WWJA 4MOAA 2VBPA 3SH5A 3U1XA 4A3XA 4NWVA 2VZPA 4NR1A 4OMDA 5FLJA 1U0AA 4PJYA 4CDXA 2VULA 1W9TA 1NLQA 3ABZA 3GXUA 1QKQA 2PMWB 3VZJA 2WSVA 4HSLA 3ZIXA 5BNPB 5F39A 3NJZA 3TRSB 2KM2A 2W0XA 2XLGA 3SNMA 4HANA 4BQWA 2VZOA 4QU1A 5CEHA 3BUCA 1J83A 4NWWA 2VMGA 2MHFA 3MIDA 5FXZA 1K5JA 2DUPA 3A0KA 1SFNA 1DGRA 3VL8A 2IUWA 3AYDA 3NAPB 3OUJA 1ZBA3 4RHV1 2BGOA 4BHPA 5J96B 4HKLA 3RNSA 1XE8A 2OS2A 2ZGPA 4V2VA 2RDRA 4XJ9A 2GC2A 4Q5OA 3ZMOA 1ZRIA 2WYSA 3LPGA 3ZFGA 3MV01 2A7AA 1UYYA 1PZ7A 3NJXA 1ULOA 3N36A 2KA3A 3POJA 3WVJA 3NNMA 4AHYA 4Z92B 2VUAA 1I5ZA 4OCTA 3K75B 5JDBA 4QQLA 1AUYA 1KFXL 1W8NA 4XAEA 4RYDA 5FZOB 3B5LB 4ARXA 1E5HA 1R1A1 1GYKA 2WQ8A 2CGOA 2XOMA 3I59A 4L92A 1XYOA 4IETA 4Q29A 4QGNA 4RSUA 2IXJA 5DG2A 5J1XA 4TZDA 1DGWX 3PUAA 3CEWA 5FY1A 4UOJA 4XURA 1HQNA 1QJX2 3ZXGA 1DYOA 4CUGA 1EV11 1OKOA 1ND2A 4LBKA 1X33A 4BH9A 3U0ZA 3HJRA 5F3GA 4BDVB 3J7LA 1TME3 3PVBB 5JMOA 3H8OA 2HJIA 4JQTA 3WP6A 5A70A 1RUG2 1X8EA 1GMMA 1SZBA 2BOJA 3NMBA 4MXVA 5FO9B 1QNWA 2VECA 3FBMA 5E6HA 3AX4A 4XFBA 1KJLA 5FMDA 3WNKA 2YGLA 3WG2A 5C5TA 1Q8PA 2P1BA 2P6CA 4CZSA 5K0UC 1EAH3 3KCCA 3VZKA 3KVBA 4J6GA 1LODA 2A5ZA 4NAOA 3UGGA 5T5JA 5B4NA 1WCSA 2IVIB 3VBRB 4FPKA 3N9NA 2YFZA 3WNPA 4ZZ5A 4BZ4A 2FCVA 2HWC2 4EN8B 3U78A 1R1ZA 4Q4V2 3WP3A 2DVFA 5G05L 1QJZA 4ZZ8A 4LITA 1KDKA 1SPPA 1NKGA 1G6NA 5CFDC 1PK6A 2RHPA 5D8AC 5F2SA 1RJ8A 2VCBA 3KS7A 3NJYA 1CONA 3TN93 1XNBA 2JB8A 5F5QA 5C8WA 2HYKA 1CJDA 4COZA 3GZAA 2VNVA 5AFEA 5CISA 1NLSA 4NUBA 3SITA 1YLLA 4FPYA 4EWDA 4FOVA 5FYMA 2BNOA 3AZYA 4RR3A 3POGA 5JZGA 2PAEA 2YBSA 3RZZA 3VZMA 1JYWA 5I93A 1LGBA 1H2KA 4XJZA 5D8AB 4Y5TA 1KS4A 2DVBA 3FHQA 4JHZA 4DRRA 1DIWA 4Y24A 1IKQA 1ULPA 2WDBA 2H0BA 2VOVA 2D97A 4N43C 5F6LB 1JOBA 2A73B 3WNMA 4AQ2A 1PVC2 5FZEA 4CP9B 3O1SA 1LU2A 4HT1T 2W3JA 5D21A 5DUVA 3M7AA 4EN7B 4BYYA 1M4WA 1WMDA 5AC93 2RMU2 3Q8FA 5H9SA 5TSWA 3AVRA 4MYEA 1JYIA 4ONUA 5KR7A 2YPJA 1POV0 4HKWA 3AYCA 3UGHA 4PHZA 1JZ2A 2ADEA 3ZVXA 4AOCA 3TEYA 4NRQA 5A3LA 3GBWA 3CMGA 4A3ZA 4G3YC 4S2DA 4BQ5A 3MGUA 1NCRB 4A44A 4K21A 5L73A 4WVMB 3VBHC 4AL9A 3H1MA 1W2AX 3RI8A 1NZCA 1RUE3 2G1MA 1AXZA 1QJY1 1RUG1 4PIZA 3P5BA 5F3CA 3CNAA 3O1MA 5A7SA 1TME1 2P4EA 3NKGA 2ATFA 5DABA 1GQPA 1L7LA 3W58A 1NQDA 1O8PA 1QF3A 4PT6A 4BPZA 1WWYA 1XNKA 2WNVB 1QOSA 1C57A 3LEMA 3PIGA 2R0FA 3NV4A 3RVHA 4JDOA 3ZN6B 1U5XA 2GC1A 3KZ4C 4I30A 3EJKA 2CDPA 4LE4A 1N1VA 5I0UA 4F7ZA 4OHYA 1GZTA 4QXKA 5CFCC 4RS5A 3EHKA 4Q4Y3 2IFWA 4YPJA 1YJLA 3OPTA 4WZCA 4O65A 4P00B 1UYZA 1F35A 2PYTA 3KVAA 4U36A 2OT7A 4P9XA 3WZ1A 3I3DA 2I74A 2ZGUA 3FFQA 2CGNA 2Q8DA 4LBOA 3WR0A 2E7AA 3APBA 4EN6B 3WDTA 5KXEA 2FDFA 4HVOA 3EYPA 3R4DB 4YGCA 4W6YA 3V0BA 2A70A 5CA6A 2FHRA 2NMNA 3FLTA 1EPWA 4HOOA 4YW3A 1DQ6A 1ZA7A 4PBPA 3OEAA 2W68A 2XUMA 5EJ1B 2AH2A 4YGDA 3RGBA 3K2OA 2YHJA 2VVFA 3BB6A 5F37A 1RMU1 1TZOA 3VDDC 4XDPA 2W1QA 1GQHA 4I09A 5KHJA 1D0HA 5FP7A 2D6OX 1X82A 1QXRA 2NM1A 1EP0A 2YU1A 3J8F2 4L2NA 2X5IC 2DCJA 5F1RA 4QDRA 3FBYA 4MXWB 1F2NA 3CJXA 3B01A 3MW2A 1LKNA 1SLLA 1TVGA 3A22A 3DPRC 3WLUA 3O1VA 4K9SA 4DUXA 4Y1YA 1OSGA 4BIFA 1XRUA 2J1VA 3H3UA 2Q8CA 4QGMA 3RFRA 3Q8EA 3FLRA 3ZXDA 2J22A 1VBD3 5FZOA 1MQTB 4LHLA 3KCYA 3ZIWA 2C26A 4HFSA 5LY2A 2E26A 1JZ8A 2EAAA 3GJBA 1V6IA 2RS33 2DUQA 4B4QA 4XUTA 3JB4C 3P3NA 3FZ3A 3KLSA 4QM8A 5LRSA 1QJEA 3H8XA 3I8TA 1OPOA 1DCSA 2ZCWA 5FIXA 2WFF1 2J1UA 4LXLA 1DLLA 1WA4A 2R063 2XL7A 1Y7BA 4HLTA 5HCFA 4CDUC 3PNAA 3VHOA 1QJX3 1MZFA 4OULA 1BEV2 3I3QA 2XXZA 3KSCA 4NRPA 3T2PA 5FYCA 5L7OC 1W6QB 3ITQA 3AMNA 4BA6A 1HJGA 1L7RA 1V6JA 4DOUA 1HRV2 2UYBA 1U5IA 3JXSA 1VPHA 2YPDA 3BU7A 1ND3C 1S2EA 1COV2 1ZZCA 1POQA 1GQGA 1WLWA 1ZZ6A 3D4KA 3GALA 3POFA 1RHI2 4META 1UF2C 3RJRA 2ETEA 4Q0SA 5FZHA 2OQ7A 2W46A 5C3RA 2XJPA 3E5QA 4KH9A 4IEVA 4D6QA 3GZTB 1PM7A 1DZQA 2JENA 2ET1A 2E51A 1XSRA 4XDOA 3B02A 1YQ8A 5E1RA 1O4YA 5KC5A 3WG3A 3VBRC 1LECA 1ND3B 3S30A 2PELA 3AL5A 2VTXA 2R6QA 4WM8A 4YZ3A 1AJOA 2FMYA 5LA9A 5K8SA 4XUNA 3T2QA 1JYTA 3TYJA 3D0JA 2DCTA 1IS5A 3AFKA 1SDDB 4QPIC 1JYVA 5FXWA 2IXCA 1NAEA 3H9AA 4WVVA 4HG6B 3C7GA 2ES3A 5FYHA 2W1SA 1NCQB 4LKSA 1WKYA 5JCTA 1R092 2ZGOA 5SV5A 3PHMA 3VKOA 4GWIA 3ILNA 2DTYA 3VBUB 1HW5A 2NZ9A 4IDZA 3ZPYA 4E9KA 1ZZ9A 4I3GA 5DG1A 3SEEA 1RJ7A 4FXKB 4FPFA 1AXYA 4GWJA 1ZBA2 1G8WA 3ORJA 3ZSLA 4YARA 4NPMA 3LF7A 2WZR1 4QX1A 1DG6A 5A3OA 1EV12 4QKFA 5J09A 4KQ7A 2O8OA 1ODMA 1HRI3 4XEZA 2QQKA 1UW8A 3JD72 3LGRA 1VMFA 1OLMA 2Y6LA 3NV2A 2P3IA 2RMU3 4IV1A 5FAXA 1CAUB 4X6RB 3AP5A 1LULA 1HB4A 3CF6E 4LQRA 1BYHA 3BGAA 5KHHA 1D2QA 1ND2B 3I2DA 3UV9A 2W47A 4LULA 4ZPIA 5C3QA 4CCMA 2J1AA 2P37A 2QQLA 1OQEA 5BNOC 2HBTA 1GLHA 4FPCA 3PU3A 5C9AA 1UOFA 1KITA 4IV1C 1MZEA 2PTMA 5JSOA 1J84A 1RUE2 1XSQA 2VOXA 1SLCA 3IB3A 5FTTC 3VBHB 2ZMKA 5DN2A 1UKRA 3ZYRA 1Q5OA 3MICA 1S0CA 4DY3A 1WCUA 4L8QA 3PVEA 1ULCA 2R32A 2Z4FA 4CCOA 1MS9A 3O0XA 2BQPA 3B7MA 3GZUC 4UI9L 1RUG3 5DAPA 5LATA 4HVQA 1C1LA 2EVXA 1RUJ1 3T30A 4UWDA 4N53B 4XTPA 4FOQA 1QJU1 3H42B 3QD6A 3TEXA 3E5UA 2NQYA 4QDQA 4PLMA 5FYVA 4AVSA 1GWMA 1PO11 4CDQB 2O14A 1NUKA 5FZ4A 5HV4A 3CDZB 3LB9A 2RM23 4W6XA 1C1FA 4Q4V3 5FPXA 4LHNA 4AHWA 4EN0A 1JH5A 2BTVC 1JHJA 4LLOA 1PMHX 3C7EA 3ZFEC 4CRQA 2R071 4CEYA 1FPN2 2ZACA 2BUKA 1ULEA 1W03A 2P3JA 3IZOA 4Z2WA 4KG8A 3VBSC 3WQ1A 3WSOA 2P17A 3HNMA 5FZAA 3BALA 3FFZA 3QOPA 5T54A 5FYSA 4AI0A 4M4RA 1UWWA 2RS31 4JKLA 3ZFFC 2BW8A 1ND3A 2Q4SA 2W52A 3R6SA 2Y6HA 2L9LA 3OBTA 4CUAA 1DFQA 3HT2A 1ZX5A 1AX2A 3T4HB 3WEZA 3OF1A 3SCGA 4JRLA 5LK5A 2ZGLA 1OMIA 2NN8A 2XL9A 3MUZ1 3QH6A 1AL0G 3N9MA 5ABJA 2B42B 1J1LA 4MV2A 5IVFA 4Y22A 1RUH2 2VO5A 1QQP3 2EXIA 3K4AA 4J1XA 3FUOA 1RUD2 3RYKA 5C70A 1UY1A 1PGW1 1OH4A 5JPNB 4RS5C 4JKKA 4IE0A 3WQ0A 4Y33A 5A3WA 1YQ2A 4JV4A 1ZBA1 3UK9A 1G9DA 5E89A 3T2OA 2VH9A 3VDAA 1N3PA 4QPWA 2F17A 3OTFA 1S0EA 4LK7A 1AL21 2BVBA 3WG4A 3INAA 4XF0A 4LMFA 1N47A 1LHUA 3GJAA 4OLLA 4DXRA 1OI6A 3ACGA 4IEYA 1GUIA 1Q8QA 4LA2A 4DB5A 2NP0A 3BTXA 1A8DA 4WZFA 4JAAA 2LALA 3U10A 5FZ6A 3WHUA 4BXFA 3A7QA 3WCRA 1VB2A 4D7YA 3VZNA 4P14A 4LO4B 5FUIA 1DZTA 4CE8A 5C3OA 4RFRB 2G9GA 2IFRA 3CL1A 5FXVA 4XF9A 4E4DX 5BPXA 2ZX1A 4NIAA 4DPNA 1VBE2 1RYYA 3EXUA 4O61A 2WFF3 5C4WA 2RDSA 1K45A 1AHSA 2O8QA 3GBGA 2X8KA 1JZ4A 1PX3A 5B4XA 1NA1B 4QX3A 4ATEA 4XQ4A 2VD7A 1OD3A 3S6PA 4QKBA 3OOXA 1AZDA 1CVNA 1S0IA 2RM21 3IDBB 3ENRA 2KXLA 3KQ4B 1EY2A 4Q4X3 4CP9A 1YQ5A 3AYEA 4MXWA 2RJKA 4OI4A 4GALA 4W6WA 3E6BA 4XZUG 3MFAA 3AFGA 3RQ0A 4CU7A 1D4M3 1LOBA 2JE9A 1WMFA 4N43A 4QU2A 4M0NA 3IMMA 4I2OA 4CA9A 1QDOA 2QQUA 3LA3A 2BDRA 2RJ2A 2LTNA 2XLFA 4D69A 1CX1A 4NPRA 4JTOA 1LHOA 2YC4A 2JECA 4IV3A 4QPYA 2YYOA 1IKPA 5F5AA 1SLAA 3ACLA 1PIV3 3AJYA 3ZM8A 1C8M2 4B7EA 3BPSA 2QQIA 3X29B 2B39A 3LKJA 2DU0A 2N7GA 4I0WB 5J36A 2ZGQA 2QVSB 2SBAA 3IM0A 4L99A 3WW2A 2HEVF 2IXLA 3PTRB 1IHMA 1W8FA 3JU9A 3POYA 4NHYA 4UW4A 2WABA 3OGRA 3WXPA 5IK7A 5JOWA 1CAWB 4IEUA 1SEFA 3C3VA 2ZPXA 3O1TA 2D5FA 3U4SA 2XQXA 1WLDA 2XR4A 3ZSEA 1NXD1 4AEDC 5FP3A 3VD7A 4Q8KA 5FR3A 2Y6FA 5FY0A 2UWCA 4P5YA 3CHXA 3HBKA 4XVHA 4IEPA 4XABA 5GLZA 2RDQA 2YFUA 4GA9A 1RTVA 4QX0A 3JD73 5FYZA 3AKSA 1WBLA 5FBZA 2XBO3 1TNRA 2FDJA 4LK6A 4YVSB 1UNBA 1PM4A 3S57A 4XC9A 5L9RA 3MZHA 4F83A 4NHMA 3BI3A 1NCRC 1U12A 4MLOA 4H2AA 4NAMA 4RQPB 4AFDA 2HWC1 4AQSA 4B8EA 1J3QA 3MF6A 1POV1 1LTEA 1ND2C 2JJ6A 4JCKA 4WV8A 3HD8B 3T1MA 3AJZA 3IAQA 1BKZA 2R16A 3AKTA 4XCAA 5FPAA 5FZDA 3WD5A 4AXOA 4CCKA 4CYDA 4NO4A 4RA0A 4X6QB 5DDJ3 5JOYA 5LZ6A 3ZR6A 4GKXA 1OLRA 5F3IA 3AL6A 1C8NA 5C3SA 1B35C 2XHKA 3WCSA 1F8VA 2VZQA 4NHLA 4ISRA 5BNOB 4YG6A 1GFF2 5A6YA 4YYOA 5I8TA 3O14A 1NCRA 4FP3A 4IW3A 3MLLA 4NOTA 4CXYA 3I2HA 4UF0B 3SCHA 2WFPA 5A1AA 1RUF2 5F2WA 1OD5A 3D0SA 3N35A 5JSRA 2FZ2A 4HPKA 1QIQA 1ASJ2 1RUC1 2PHWA 4XHXA 4ISQA 2VNOA 1B35B 2R072 1Y43B 2K0GA 2D40A 4LORA 4XJ8A 3WHTA 3NQHA 1Z7S3 3J4UH 3JZVA 2FMDA 2IXIA 2OQ6A 4XBQA 2VTXJ 1WMEA 5JOZA 4HETA 3UKTA 2VMEA 1LAJA 3SXWA 2VMDA 3AYAA 5IT6A 3LPFA 4M00A 1UU6A 3I97A 2XJRA 2QE3A 2Y26A 4IV3B 3DKWA 2TNFA 4BQ3A 1RXGA 3BCWA 5A6QA 3ILFA 4P5HA 2Q8EA 5FOJB 1CAVB 3NAPC 3MIGA 2WQ4A 5B2GB 5JZGB 1CZVA 2JDKA 3KF5A 4Q0VA 2ZHKA 3A0NA 4EV0A 4XQDA 1V0AA 4XFAA 1I1EA 4CPBA 1XQNA 1UMHA 3LSDA 3RZLA 2VMFA 5FLHA 3RDIA 4A7ZA 4MUVA 3N9OA 4QX7A 1VR3A 3THPA 3MF9A 2WWSA 2VW1A 1IQAA 1RUE1 1RUD1 4FOYA 3T3YA 5CKMA 2OX0A 3WQBA 2DURA 5GLVA 1HRI2 1R081 1W6MB 2VAUA 3ZXJA 1LB2A 5FZ7A 3NW4A 1FATA 4WVWA 4Z07A 2R043 2JDPA 5C9AB 5FO8B 1KD7A 4DQAA 3OYWA 3S5QA 1DGRN 1QQP2 1YFYA 1KGYA 1VRH2 3QCWA 4BWOA 4D7SA 2ZGKA 4MHRA 2ZEXA 3ELNA 5JXJA 1W6OB 4IEXA 1WUVA 1UXZA 3KGLA 4TXWA 3RSJA 1CJPA 5C4WC 2YBKA 1O6UA 1XXNA 1UAIA 2CAUA 3N9LA 5ANQA 2Q8OA 5G04L 1PO12 1AR63 1H0BA 1CAXB 5LASA 4W65A 2CDOA 2V4AA 3MLKA 2WA4A 3T4VA 3IPVA 1F4HA 1WCDJ 3VBFB 4H14A 3GHMA 1YYNA 2ENRA 1W0PA 3BTZA 2FZ1A 4AEDA 2R30A 1UOJA 3RRDA 2GNMA 3VD5A 3ETPA 4SBVA 5GZEA 2WS93 4CCJA 4YZ5A 4JC1A 2ID4A 1CAUA 4KI5M 1YEWA 1QNYA 3WNLA 3KT1A 3HMYA 4DY5A 5JI7A 3I2OA 3HN3A 3OB8A 4PLOA 5FZMA 4BMEA 5C3PA 3KV9A 3HPNA 2JDZA 1EYBA 3ZKUA 1CPMA 4EWEA 5CFDB 4LO8A 4XQWA 4A7KA 5DMYA 1MZ5A 1PGL2 3PDQA 1YCIA 5GZGA 1Z0HA 4GH4B 3KGZA 4TSVA 3ACHA 3N9PA 1D4M2 4YFZA 2LW8A 5FUPA 1H9WA 3ACFA 4QB1A 2BERA 3O5SA 4ZS3A 3DYMA 1DYKA 2Z2SB 2ZHNA 1NE6A 4BU2A 2VQTA 4WM7A 1QHDA 4XFFA 2WO3A 1OLQA 4FFIA 4YW5A 2EIGA 2JE8A 1RMU2 3HNYM 5C33A 5F7UA 2HH9A 2ZJCA 2BV4A 5BNPC 4JKMA 4E4ZA 4TWTA 1POV3 4LA3A 1LEDA 3K4ZA 1JZ6A 1HV1A 2VMCA 5T50A 2ZGMA 2P3YA 4LKDA 3VD9A 3NWKA 4LUMA 1O3TA 1RUOA 3OBRA 2BYVE 4OZOA 2IVJA 3ZXAC 1Q8OA 3J7HA 2QQMA 5FJKA 2EXKA 3M8LA 3OPWA 2ZHLA 5FZGA 1V6NA 5FYYA 1W3XA 1W9WA 3ZDVA 4NHXA 4C90A 2DBIA 1VBC3 3DV8A 2DBNA 1STMA 4FI9A 4FPEA 3K77A 3O0WA 4HVRA 3RZMA 5FK8A 3ZN5A 1RVF3 3EB7A 3LIGA 4BQ1A 1OT5A 1SCRA 3ZO0B 3RS6A 1W8HA 4FFFA 2LROA 3AP6A 1C28A 4L97A 4BM8A 4DRVA 1OOPC 1O4ZA 2QUOA 1SFPA 3NNFA 1YIPA 3T0BA 1LRHA 2V5DA 4Q0UA 5C71A 2W5FA 1S4CA 4H55A 1HRI1 1VRH1 3LQCA 3AKRA 3ZSMA 4DO0A 3E6CC 1V9U2 2QTWB 2C4XA 3HEIA 1JUHA 5FKBA 5FREA 2WBKA 2JIJA 3IN9A 1AX1A 3B00A 3SLIA 5GM0A 3C8XA 3GCXA 1W6NB 3VBFA 2HWD3 4JGYC 3AMQA 3NL1A 4BMBA 4EQVA 1EAH1 3WG1A 1LENA 2WNOA 3J9SA 3MEPA 5HXMA 2BBVA 3ZMNA 2MEV2 1LESA 2V73A 4CSWA 4KWKA 1JOPA 1XE0A 2XB6C 4O9GA 2QQJA 2ZAHA 1TME2 1SBEA 2XJQA 2XVLA 3O7OA 4GB31 4IEZA 2JG8A 1S0JA 1MPXA 4BLIA 2G4IA 5IWFA 5IVYA 3RMYA 3ZXLA 4CP1A 1LGNA 1YRZA 5JR7B 3PMSA 3CZUA 1HDKA 1RUF3 1Z78A 3P3PA 5FPLA 1NT0A 3HWJA 5FRAA 2A3YA 1UYXA 4HZFA 2OIIA 1QOOA 4LLFA 4YRDA 3UESA 5I0DA 4QKDA 3VBSA 5LEJA 4OHXA 4OUSA 4UFHA 3PLQA 2A75A 2JDNA 3DF0A 1AR91 2BRTA 5C8CA 1DHKB 4IEOA 5FZ0A 1YI9A 3OJBA 3WDYA 1HN1A 5EJZB 2RS11 1ULFA 2ZZQA 1G86A 2EF6A 1UYPA 2LUWA 1I6XA 4XTMA 5F5CA 4V2WA 5ACA3 4UFMA 5ERLA 4NIDA 1JYXA 4YVWB 1VAMA 3VDBA 1ONAA 4ZS2A 4P9IA 4BE3A 2ZHMA 1FPN1 1XYPA 1BBT3 4ES9A 5ISLA 4DNYA 1VAKA 2P6HA 3N7LA 3IDCB 3RWNA 3ZYBA 1AX0A 3O1PA 1RITA 1PMIA 5FZCA 1REEA 5C8CC 2K9ZA 1SHWB 3G7DA 3VBRA 2Z79A 3VL9A 2ZGSA 5IW0A 1U5YA 1NCQC 3Q9OA 5FQ0B 5A33B 1K5MB 4PQ9A 5T52A 4YVWC 3W20A 4UW3A 5DUUA 1V6OA 4RS5B 5D2AA 3S0MA 5HV0A 3PJYA 3V64A 4H7MA 2OVUA 4FCAA 3ZXEA 2R042 3CQOA 5AC92 1ACCA 4XFGA 5FY9A 5C9AC 2GN7A 1S2KA 1XE7A 4AVBA 4QHOA 3AXDA 2Y38A 4AFCA 1K5MC 1RUI2 4EYUA 5A7WB 4DXSA 5L7OA 2VJXA 5EP9A 4NIGA 4LPLA 4A7YA 1VBD1 5FCCA 1UMIA 3LSEA 2WJSA 1DGLA 1W2OA 2EIDA 4CU8A 1YQ6A 5A7OA 5A6ZA 1ZYBA 2R1BA 3UNPA 1E5SA 4E2QA 1AYM1 3IIAA 4KU8A 4Q1RA 5FZLA 1AR61 2FCTA 5FKCA 3N4MA 2GC0A 2WNVC 2Y0IA 4GB33 2IWGB 4IQPA 2XPJA 2BZDA 1RINA 2PXJA 1SLBA 4XF1A 2B46X 2EIEA 5BNNB 4YVSA 1CWPA 3MPBA 4CVUA 4ZXEA 4K6BA 1H8TA 2QQVA 4LT5A 5I8SA 1L7QA 1JUIA 5T3NA 1VBA3 1L3JA 2R073 2QFEA 3MPPG 1PZ9A 1VMJA 2V09A 4Q4Y2 4EJRA 2VU9A 1AL23 3HAGA 1UN1A 3JB8A 5IK4A 3GCWA 3WNXA 1RUC3 5JIAA 4QQPA 4D94A 3ON7A 1XNDA 1BMV2 4QPIB 3PL0A 1LOFC 4H3WA 1MS4A 3D5OA 3HR9A 3I54A 4LOSA 4GJYA 5JPMB 1GP4A 2D3PA 5H9QA 1A78A 1S2BA 3ILRA 4GH4C 4QX2A 2XGXA 5EXOA 4S2GA 4CEWA 1HB1A 3V56A 1J3PA 1MS0A 2ADDA 4KBZA 2YG0A 4LBJA 3MO4A 4K8FA 3IT8A 1CGPA 3F95A 2ZMNA 5BNPA 3A23A 4GWMA 4MGQA 1P8JA 4LIVA 2DVGA 2ZOEB
chains in the Genus database with same CATH topology
3HNMA 4M4RA 1UWWA 4JKLA 2Y6HA 2L9LA 4CUAA 4DXTA 2XONA 1IQDC 3WEZA 1F4AA 3MUZ1 2VZRA 3WF3A 3VD4A 2E32A 1XNAA 2VO5A 2WUHA 3K4AA 1JU4A 3GGLA 5C70A 1UY1A 1OH4A 2EIBA 4UAPA 4JKKA 4A6OA 1YQ2A 2VCAA 3VDAA 3T2OA 1D7PM 2VC9A 4QPWA 4P08A 5IHRA 2W87A 4ET7A 3C7HA 2B9VA 4JX0A 4W8JA 2VZ1A 2LS6A 2R7EB 4W4ZA 4DXRA 2WAAA 4BK5A 1UY2A 3ACGA 4DEQA 1GUIA 3NRUA 4P02B 3AC0A 2JDAA 2XHNA 3PUIA 1XC6A 2QQNA 1GNYA 3A7QA 5JUVA 5JXIA 5FUIA 1BHGA 2B4KA 3IDAA 3I2JA 2PQSA 3GM8A 4BK4A 4QB6A 3CKHA 4A41A 2W95A 1EUUA 3FHAA 4M4PA 1RYYA 1K45A 2VCCA 3T08A 3CIHA 1JZ4A 3SKJE 1PX3A 5B4XA 4QX3A 3HNBM 4MADA 1OD3A 4DUVA 2HYXA 1K3IA 4XZUG 1NX9A 4CU7A 2VOTA 3DYPA 3VDCA 4QB2A 1W8OA 2RJ2A 1CX1A 4MOAA 4OMDA 2VZPA 4E8DA 2E31A 2YC4A 3LEIA 1W9TA 3ZM8A 3ABZA 1O8SA 3GXUA 1W99A 5LCWL 2QQIA 1JI6A 5IFPA 1H6YA 2VZOA 1J83A 2Y6KA 2WABA 3OGRA 3A21A 5HPOA 2WO2A 2BGOA 2XQXA 3WF4A 4A42A 3VD7A 4P5YA 4XVHA 3LPGA 2WYSA 2YFUA 3MV01 2Y6GA 1UYYA 4QX0A 3NJXA 1ULOA 3I2FA 1CZSA 3THCA 5IFTA 3SKVA 4AG4A 3K75B 1W8NA 2V72A 4RYDA 4ARXA 3BN6A 3P6BA 2WQ8A 2XOMA 5J1XA 3IAQA 1UY3A 2VZVA 3W5NA 2VZTA 4UOJA 3LEGA 4XURA 4GZ9A 1JZ7A 1DYOA 2ZEYA 3T09A 2VZQA 3HJRA 4BDVB 5JMOA 3CZJA 3ACIA 3I3BA 5DQ0A 2BGPA 3I2HA 1GMMA 5A1AA 3WNKA 3LEKA 5B4NA 2JD9A 3WNPA 2YFZA 4ZZ5A 3NQHA 1TG7A 1XNTA 5G05L 4ZZ8A 2VMEA 2VMDA 2X05A 3LPFA 5EIYB 2X09A 1NKGA 3I97A 3T0AA 4E8CA 2VCBA 1W0NA 4ZY9A 2VL4A 4BXSV 1KEXA 3NJVA 2BBAA 1CZVA 2ORXA 4OMCA 1H6XA 1UZ0A 1UMHA 1JU3A 2VMFA 1JYWA 2ZEWA 3OEBA 1W9SA 3FHQA 4JHZA 4LHSA 4TTGA 1ULPA 2WDBA 3E1F1 3WQBA 3WNMA 2J1TA 2W3JA 2VR4A 4CUBA 3OGSA 1GOFA 2W1UA 1KGYA 2ZEXA 5JXJA 3OGVA 5DPNA 1UXZA 1UY0A 4TXWA 4XUOA 2C9KA 1JZ2A 2W9XA 2OKXA 3U37A 4A3ZA 3CMGA 3FL7A 1OF3A 5G04L 4OYUA 4A44A 2Y64A 2CDOA 4D0QA 2WN3A 2WZEA 1F4HA 3WNNA 1GQPA 3P1IA 1O8PA 4PT6A 3VD5A 3ETPA 2VZSA 1GOHA 3VD3A 4MO3M 2ID4A 4KI5M 3IAPA 3WNLA 3I2KA 2CDPA 3HN3A 1US3A 3NNGA 3OB8A 4W50A 3HPNA 1UX7A 2J1RA 4DEVA 4YPJA 2Y8KA 1GU3A 4P00B 1UYZA 5DMYA 3WF1A 3I3DA 3F2ZA 3ACHA 3GDBA 2W94A 2LW8A 1WCQA 3ACFA 4QB1A 2BERA 4DUWA 3C7FA 3DYMA 3EYPA 1CZTA 1UXXX 2J1SA 2VQTA 3OBAA 2RV9A 2WO3A 4D8MA 1K12A 2JE8A 4XUPA 3HNYM 5F7UA 3OEAA 4CU9A 4JKMA 5EJ1B 5C7GA 3K4ZA 3MBWA 1JZ6A 2VMCA 3VD9A 2W1QA 2QBXA 4OZOA 2WO1A 3WF2A 1US2A 3J7HA 2QQMA 2DCJA 4QDRA 1W9WA 4A4AA 3LE0A 3MV11 4FI9A 1T2XA 3K77A 1TVGA 2ZEZA 1R64A 3A22A 4DUXA 3EB7A 2J1VA 1OT5A 4MGSA 3DECA 3C7OA 3I3EA 2J22A 3T0BA 1LNSA 2V5DA 3I2IA 5C71A 2HLEA 2W5FA 2C26A 4XUQA 1GOGA 3LQCA 1JZ8A 2E26A 2C4XA 3HEIA 4QAWA 2WBKA 4KMQA 4XUTA 4AAXA 3C8XA 3I2GA 5LA0A 3OG2A 2W92A 2J1UA 2KD7A 4IUGA 5LA1A 2J1EA 5HXMA 3T0DA 1PX4A 4PQQA 3T2PA 5IJRA 2QQJA 3THDA 1L7RA 2VZ3A 3JXSA 1MPXA 3D3AA 5IYYA 3CZUA 5JR2A 2E33A 1JZ3A 2W46A 1UYXA 3UESA 1SG3A 5I0DA 3WF0A 1JYNA 5CYYA 1XPWA 3MUY1 3UETA 5JXHA 4PF1A 2DCKA 4XUNA 3T2QA 1HN1A 5EJZB 2DDUA 4KWUA 2ZXQA 3ECQA 2J7MA 2W1WA 1SDDB 4BJ0A 1JYVA 1JYXA 3FN9A 1NAEA 4HG6B 3C7GA 4OUEA 3VDBA 2W1SA 4LKSA 4CU6A 1WKYA 1CIYA 4GWIA 2YC2A 1O59A 1PMJX 3SEEA 4RN5A 1SHWB 4GWJA 1OF4A 4QX1A 5LA2A 3K46A 3PUHA 4A45A 2QQKA 4CUCA 2VZUA 2Y6LA 3CQOA 2VQUA 2VM9A 5CZKA 4LQRA 3BGAA 2W47A 2YB7A 2X10A 4DXSA 2ORZA 2VJXA 2J1AA 5JXGA 2QQLA 4QDSA 3W5MA 2WN2A 4LPLA 1UMIA 2EIDA 4CU8A 1J84A 3K4DA 2WAOA 3IB3A 3UNPA 5DN2A 3SEPA 4L0PA 2VTFA 2JKXA 2Z4FA 2BZDA 4UI9L 2RVAA 2EIEA 3HOBA 2Y6JA 1DLCA 4CVUA 4ZXEA 2V4VA 1EUTA 1UY4A 4ARYA 1L7QA 4QDQA 1NUKA 1K42A 1DP0A 2QQOA 3CDZB 3WNOA 2WZ8A 2W91A 1I5PA 1JHJA 4QX2A 1PMHX 3C7EA 4Z2AA 2EICA 2YG0A 3MO4A 3DYOA 3WSOA 3A23A 4MGQA 1P8JA 3IIIA 1JZ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HNM A;  4M4R A;  1UWW A;  4JKL A;  2Y6H A;  2L9L A;  4CUA A;  4DXT A;  2XON A;  1IQD C;  3WEZ A;  1F4A A;  3MUZ 1;  2VZR A;  3WF3 A;  3VD4 A;  2E32 A;  1XNA A;  2VO5 A;  2WUH A;  3K4A A;  1JU4 A;  3GGL A;  5C70 A;  1UY1 A;  1OH4 A;  2EIB A;  4UAP A;  4JKK A;  4A6O A;  1YQ2 A;  2VCA A;  3VDA A;  3T2O A;  1D7P M;  2VC9 A;  4QPW A;  4P08 A;  5IHR A;  2W87 A;  4ET7 A;  3C7H A;  2B9V A;  4JX0 A;  4W8J A;  2VZ1 A;  2LS6 A;  2R7E B;  4W4Z A;  4DXR A;  2WAA A;  4BK5 A;  1UY2 A;  3ACG A;  4DEQ A;  1GUI A;  3NRU A;  4P02 B;  3AC0 A;  2JDA A;  2XHN A;  3PUI A;  1XC6 A;  2QQN A;  1GNY A;  3A7Q A;  5JUV A;  5JXI A;  5FUI A;  1BHG A;  2B4K A;  3IDA A;  3I2J A;  2PQS A;  3GM8 A;  4BK4 A;  4QB6 A;  3CKH A;  4A41 A;  2W95 A;  1EUU A;  3FHA A;  4M4P A;  1RYY A;  1K45 A;  2VCC A;  3T08 A;  3CIH A;  1JZ4 A;  3SKJ E;  1PX3 A;  5B4X A;  4QX3 A;  3HNB M;  4MAD A;  1OD3 A;  4DUV A;  2HYX A;  1K3I A;  4XZU G;  1NX9 A;  4CU7 A;  2VOT A;  3DYP A;  3VDC A;  4QB2 A;  1W8O A;  2RJ2 A;  1CX1 A;  4MOA A;  4OMD A;  2VZP A;  4E8D A;  2E31 A;  2YC4 A;  3LEI A;  1W9T A;  3ZM8 A;  3ABZ A;  1O8S A;  3GXU A;  1W99 A;  5LCW L;  2QQI A;  1JI6 A;  5IFP A;  1H6Y A;  2VZO A;  1J83 A;  2Y6K A;  2WAB A;  3OGR A;  3A21 A;  5HPO A;  2WO2 A;  2BGO A;  2XQX A;  3WF4 A;  4A42 A;  3VD7 A;  4P5Y A;  4XVH A;  3LPG A;  2WYS A;  2YFU A;  3MV0 1;  2Y6G A;  1UYY A;  4QX0 A;  3NJX A;  1ULO A;  3I2F A;  1CZS A;  3THC A;  5IFT A;  3SKV A;  4AG4 A;  3K75 B;  1W8N A;  2V72 A;  4RYD A;  4ARX A;  3BN6 A;  3P6B A;  2WQ8 A;  2XOM A;  5J1X A;  3IAQ A;  1UY3 A;  2VZV A;  3W5N A;  2VZT A;  4UOJ A;  3LEG A;  4XUR A;  4GZ9 A;  1JZ7 A;  1DYO A;  2ZEY A;  3T09 A;  2VZQ A;  3HJR A;  4BDV B;  5JMO A;  3CZJ A;  3ACI A;  3I3B A;  5DQ0 A;  2BGP A;  3I2H A;  1GMM A;  5A1A A;  3WNK A;  3LEK A;  5B4N A;  2JD9 A;  3WNP A;  2YFZ A;  4ZZ5 A;  3NQH A;  1TG7 A;  1XNT A;  5G05 L;  4ZZ8 A;  2VME A;  2VMD A;  2X05 A;  3LPF A;  5EIY B;  2X09 A;  1NKG A;  3I97 A;  3T0A A;  4E8C A;  2VCB A;  1W0N A;  4ZY9 A;  2VL4 A;  4BXS V;  1KEX A;  3NJV A;  2BBA A;  1CZV A;  2ORX A;  4OMC A;  1H6X A;  1UZ0 A;  1UMH A;  1JU3 A;  2VMF A;  1JYW A;  2ZEW A;  3OEB A;  1W9S A;  3FHQ A;  4JHZ A;  4LHS A;  4TTG A;  1ULP A;  2WDB A;  3E1F 1;  3WQB A;  3WNM A;  2J1T A;  2W3J A;  2VR4 A;  4CUB A;  3OGS A;  1GOF A;  2W1U A;  1KGY A;  2ZEX A;  5JXJ A;  3OGV A;  5DPN A;  1UXZ A;  1UY0 A;  4TXW A;  4XUO A;  2C9K A;  1JZ2 A;  2W9X A;  2OKX A;  3U37 A;  4A3Z A;  3CMG A;  3FL7 A;  1OF3 A;  5G04 L;  4OYU A;  4A44 A;  2Y64 A;  2CDO A;  4D0Q A;  2WN3 A;  2WZE A;  1F4H A;  3WNN A;  1GQP A;  3P1I A;  1O8P A;  4PT6 A;  3VD5 A;  3ETP A;  2VZS A;  1GOH A;  3VD3 A;  4MO3 M;  2ID4 A;  4KI5 M;  3IAP A;  3WNL A;  3I2K A;  2CDP A;  3HN3 A;  1US3 A;  3NNG A;  3OB8 A;  4W50 A;  3HPN A;  1UX7 A;  2J1R A;  4DEV A;  4YPJ A;  2Y8K A;  1GU3 A;  4P00 B;  1UYZ A;  5DMY A;  3WF1 A;  3I3D A;  3F2Z A;  3ACH A;  3GDB A;  2W94 A;  2LW8 A;  1WCQ A;  3ACF A;  4QB1 A;  2BER A;  4DUW A;  3C7F A;  3DYM A;  3EYP A;  1CZT A;  1UXX X;  2J1S A;  2VQT A;  3OBA A;  2RV9 A;  2WO3 A;  4D8M A;  1K12 A;  2JE8 A;  4XUP A;  3HNY M;  5F7U A;  3OEA A;  4CU9 A;  4JKM A;  5EJ1 B;  5C7G A;  3K4Z A;  3MBW A;  1JZ6 A;  2VMC A;  3VD9 A;  2W1Q A;  2QBX A;  4OZO A;  2WO1 A;  3WF2 A;  1US2 A;  3J7H A;  2QQM A;  2DCJ A;  4QDR A;  1W9W A;  4A4A A;  3LE0 A;  3MV1 1;  4FI9 A;  1T2X A;  3K77 A;  1TVG A;  2ZEZ A;  1R64 A;  3A22 A;  4DUX A;  3EB7 A;  2J1V A;  1OT5 A;  4MGS A;  3DEC A;  3C7O A;  3I3E A;  2J22 A;  3T0B A;  1LNS A;  2V5D A;  3I2I A;  5C71 A;  2HLE A;  2W5F A;  2C26 A;  4XUQ A;  1GOG A;  3LQC A;  1JZ8 A;  2E26 A;  2C4X A;  3HEI A;  4QAW A;  2WBK A;  4KMQ A;  4XUT A;  4AAX A;  3C8X A;  3I2G A;  5LA0 A;  3OG2 A;  2W92 A;  2J1U A;  2KD7 A;  4IUG A;  5LA1 A;  2J1E A;  5HXM A;  3T0D A;  1PX4 A;  4PQQ A;  3T2P A;  5IJR A;  2QQJ A;  3THD A;  1L7R A;  2VZ3 A;  3JXS A;  1MPX A;  3D3A A;  5IYY A;  3CZU A;  5JR2 A;  2E33 A;  1JZ3 A;  2W46 A;  1UYX A;  3UES A;  1SG3 A;  5I0D A;  3WF0 A;  1JYN A;  5CYY A;  1XPW A;  3MUY 1;  3UET A;  5JXH A;  4PF1 A;  2DCK A;  4XUN A;  3T2Q A;  1HN1 A;  5EJZ B;  2DDU A;  4KWU A;  2ZXQ A;  3ECQ A;  2J7M A;  2W1W A;  1SDD B;  4BJ0 A;  1JYV A;  1JYX A;  3FN9 A;  1NAE A;  4HG6 B;  3C7G A;  4OUE A;  3VDB A;  2W1S A;  4LKS A;  4CU6 A;  1WKY A;  1CIY A;  4GWI A;  2YC2 A;  1O59 A;  1PMJ X;  3SEE A;  4RN5 A;  1SHW B;  4GWJ A;  1OF4 A;  4QX1 A;  5LA2 A;  3K46 A;  3PUH A;  4A45 A;  2QQK A;  4CUC A;  2VZU A;  2Y6L A;  3CQO A;  2VQU A;  2VM9 A;  5CZK A;  4LQR A;  3BGA A;  2W47 A;  2YB7 A;  2X10 A;  4DXS A;  2ORZ A;  2VJX A;  2J1A A;  5JXG A;  2QQL A;  4QDS A;  3W5M A;  2WN2 A;  4LPL A;  1UMI A;  2EID A;  4CU8 A;  1J84 A;  3K4D A;  2WAO A;  3IB3 A;  3UNP A;  5DN2 A;  3SEP A;  4L0P A;  2VTF A;  2JKX A;  2Z4F A;  2BZD A;  4UI9 L;  2RVA A;  2EIE A;  3HOB A;  2Y6J A;  1DLC A;  4CVU A;  4ZXE A;  2V4V A;  1EUT A;  1UY4 A;  4ARY A;  1L7Q A;  4QDQ A;  1NUK A;  1K42 A;  1DP0 A;  2QQO A;  3CDZ B;  3WNO A;  2WZ8 A;  2W91 A;  1I5P A;  1JHJ A;  4QX2 A;  1PMH X;  3C7E A;  4Z2A A;  2EIC A;  2YG0 A;  3MO4 A;  3DYO A;  3WSO A;  3A23 A;  4MGQ A;  1P8J A;  3III A;  1JZ5 A; 
#chains in the Genus database with same CATH topology
 1YJK A;  1UL9 A;  4NJ4 A;  2E7Q A;  3ETQ A;  4WM7 C;  4FAG A;  1OVP A;  2BOI A;  2CV6 A;  3DXU A;  3L2H A;  3Q8B A;  4NMI A;  3WUD A;  1ZRC A;  4AVT A;  1ALY A;  5FZ3 A;  4AED B;  2VVE A;  2JWP A;  3I3M A;  1QXJ A;  1MEC 1;  1HB3 A;  2BNM A;  4CDW B;  1I9R A;  1KJR A;  4LJH A;  3PME A;  4Y26 A;  3WF3 A;  5EPA A;  3VD4 A;  5IAT A;  2CWS A;  1R09 1;  3L9J T;  1FYU A;  1LGC A;  4KBB A;  4N9H A;  4QHB A;  4AF9 A;  1W28 A;  3QLQ A;  1C4R A;  1TE1 B;  5GZF A;  2OZJ A;  1YI7 A;  2K2S A;  1GZC A;  4A6O A;  5CFC A;  2Q5T A;  4RQP C;  2VCA A;  1RUN A;  4YFW A;  2VC9 A;  1D4V B;  3VZL A;  2IXH A;  2NPI A;  4MX3 A;  4R52 A;  3ASI A;  5GZC A;  3NV3 A;  5IHR A;  2WNU C;  4JX0 A;  1DQ1 A;  5A33 A;  4B7K A;  2VZ1 A;  4QX8 A;  1VB4 A;  2LS6 A;  5IK5 A;  4Q4X 1;  4W4Z A;  2UWB A;  4NPL A;  1FX5 A;  3G6J B;  4P02 B;  1FOD 2;  2Z69 A;  2JDA A;  3AC0 A;  1M06 G;  3MW3 A;  5T55 A;  1GZW A;  2QQN A;  5FZ1 A;  1CD3 G;  1GNY A;  5JUV A;  3SH4 A;  1FNZ A;  1W6P A;  1IS6 A;  1REF A;  1G9B A;  1BHG A;  1VBE 1;  3IDA A;  4P9G A;  1IPJ A;  4AWD A;  4AGV A;  3GM8 A;  3PVO A;  5L7O B;  2YY1 A;  5FMO L;  3MW4 A;  1BEV 3;  2DVD A;  4A41 A;  1EUU A;  1IPS A;  3FHA A;  4YG3 A;  1UQX A;  2D6K A;  5A3U A;  1N3O A;  1PIV 1;  1W3V A;  1GR3 A;  2DFC A;  3T08 A;  2WT0 A;  3TAY A;  3ES1 A;  4NN0 A;  1DF0 A;  1YXW A;  1W39 A;  1BBT 1;  4XW3 A;  1O4T A;  2GN3 A;  3KHC A;  3CU7 A;  1WW6 A;  2RR1 1;  4FFH A;  4Y20 A;  4YW4 A;  3ST7 A;  3POE A;  1CAX A;  3BOP A;  1AR9 2;  2HYX A;  4PLN A;  4FSJ A;  1Y9M A;  2VOT A;  1QJU 3;  2ZGT A;  1YC6 1;  2VG9 A;  1ULD A;  4Y1X A;  1ZZB A;  5BNN A;  4XFH A;  1W8O A;  3JCI A;  3ZFF B;  2WA3 A;  2OXB A;  1OKQ A;  5EHD A;  4AR2 A;  2DWR A;  1FAY A;  4CXX A;  4B1M A;  5KC6 A;  2QDR A;  3URF A;  5J7M A;  2E31 A;  2PHT A;  3LEI A;  2D3R A;  1YFU A;  5A7P A;  1E5R A;  1WMX A;  1AYN 1;  4Q8L A;  1TMF 1;  2QNK A;  5FZB A;  1HRV 1;  3MDP A;  1ST8 A;  1W99 A;  2XWJ B;  5DXD A;  5LCW L;  1JI6 A;  4Z82 A;  1Y3T A;  3L2Y A;  1R08 2;  4QXC A;  5IFP A;  1H6Y A;  2B5H A;  2WL1 A;  1D2S A;  5JSP A;  5CFD A;  1QU0 A;  3NNL A;  3V0A A;  1MAC A;  3LAG A;  4DMI A;  1JYC A;  1BBT 2;  3KV6 A;  5FWJ A;  4FPO B;  5CKQ A;  4JGZ B;  4C91 A;  4IE6 A;  4PI2 A;  4BIS A;  3A21 A;  2GND A;  4N90 A;  4MGY E;  5HPO A;  2QZ2 A;  2WO2 A;  2BNN A;  3WF4 A;  2JXA A;  1JS9 A;  3LFM A;  1O5U A;  1LOG A;  4PCR A;  5L19 A;  4GQ7 A;  1OVS A;  1PNF A;  3HQR A;  4RHV 2;  4Y4Y A;  3ZSJ A;  1BK0 A;  5KXC A;  1AXK A;  2Y6G A;  5IVV A;  4AHZ A;  3GF6 A;  1VBD 2;  1SDW A;  2JG9 A;  2BFU L;  2VMH A;  2BWC A;  1N1T A;  1FOD 1;  3NV1 A;  2A6X A;  3THC A;  3IDE A;  1QEX A;  5KBF A;  4AG4 A;  4NIH A;  1PGW 2;  1V9U 3;  4AVA A;  3H3Z A;  3KB5 A;  1O5L A;  1RUI 3;  1ZA4 A;  4FFG A;  1LR5 A;  1UMZ A;  2HWF 3;  1OC1 A;  3KMH A;  3P6B A;  4ATF A;  4DXZ A;  5A3T A;  2FDK A;  5BXX A;  2A71 A;  1WW7 A;  1Q43 A;  3CJI B;  5K4L A;  4OUM A;  3U75 A;  4OI0 A;  3RYR A;  2VZT A;  3LEG A;  4G9S B;  2ZBJ A;  1UIK A;  1J3R A;  3BTA A;  4GZ9 A;  1U5Z A;  4P9L A;  2WT2 A;  4G4F A;  2ZEY A;  2GMP A;  4MVT A;  1AR7 2;  1FT9 A;  1F15 A;  2PLV 3;  1H8V A;  1QXP A;  2ZGR A;  5DQ0 A;  3I3B A;  1ZRE A;  4CPB D;  4A6S A;  4GJZ A;  2D6L X;  2ARX A;  4QHZ A;  4YM2 A;  1WLT A;  3U14 A;  2GDF A;  4OHW A;  4D7T A;  4XAA A;  5FJH A;  2WT1 A;  4E4S A;  1V00 A;  3AZW A;  1JOD A;  3KT4 A;  3WX5 A;  3D8C A;  2E7T A;  2VXJ A;  2XH6 A;  3LEK A;  4YZ4 A;  4C0H A;  3AZX A;  3TOJ A;  4CCE A;  5FQ0 A;  4LOT A;  3AP7 A;  2CTV A;  4LO6 B;  4OQ9 A;  2VXR A;  3B93 A;  4LTA A;  3GZE A;  1MEC 3;  1RUC 2;  5FZK A;  4BCU A;  4KGQ A;  1AYN 2;  5D8A A;  1UZW A;  2RM2 2;  1OBN A;  1TG7 A;  1XNT A;  2ARE A;  2CHH A;  4CEW B;  3KV4 A;  1KS5 A;  4E27 A;  3V65 A;  2ET7 A;  3M3O A;  4DIQ A;  3V0B B;  2VPV A;  3TB0 A;  1X50 A;  4MGK E;  3ZYP A;  2X09 A;  1IS4 A;  2XJT A;  5FY5 A;  2YZ4 A;  1W0N A;  3NST A;  4GMP 3;  4HBN A;  4Y1U A;  4FQ4 A;  4BXS V;  2Q1Z B;  3M4F A;  4IGO A;  1KEX A;  2VNG A;  3NJV A;  4CDX B;  2WR9 A;  5GJ6 A;  5IAX A;  2X5I B;  2GH8 A;  3AMM A;  2ORX A;  1TMF 3;  4IV3 C;  1H6X A;  4OMC A;  5LWB A;  2PN5 A;  3RWK X;  2WII B;  1ZZ7 A;  2XJS A;  3HQU A;  3LDR A;  4HMZ A;  3TNQ A;  4CDQ A;  4WM7 B;  4FPG A;  4I3P A;  4AI9 A;  4ZU4 A;  1QJF A;  1UOG A;  1W9S A;  1Q8S A;  2ZEW A;  3OEB A;  4QPG C;  4XF3 A;  4TTG A;  3E1F 1;  3QH7 A;  5FY7 A;  5FYB A;  2FCU A;  2J1T A;  4X8P A;  4Y5S A;  2VR4 A;  4CUB A;  1W6O A;  3OGS A;  4R4X A;  5EV7 A;  1GOF A;  5SV8 A;  2W1U A;  3H1Y A;  4CEY B;  3O0V A;  5L36 A;  4N9I A;  2WZR 2;  4YGE A;  3BVC A;  2B7Y A;  2DYC A;  3BOD A;  3ZFG B;  5KWR A;  1MR5 A;  4YLZ A;  5DPN A;  5C5U A;  5CIR A;  4XUO A;  4LBN A;  2W9X A;  2OKX A;  3U37 A;  3IPV B;  1H2M A;  2C24 A;  4MGT A;  1PGS A;  4OYU A;  3JQW A;  3UGF A;  3B9C A;  1MS8 A;  2YGM A;  4JGY B;  2Y64 A;  2XJU A;  4D0Q A;  2WN3 A;  4MSV A;  4XIO A;  2FDG A;  3ZFG C;  2XKO A;  2RS5 3;  1COV 1;  4F3J A;  1RC6 A;  4R9D A;  1PVX A;  5GLU A;  5JAX A;  1VBB 1;  3WNN A;  3P1I A;  2ARA A;  4GB3 2;  4MG2 A;  3AVS A;  5LK7 B;  3UT0 A;  2VZS A;  5DAQ A;  1GOH A;  2D98 A;  3VD3 A;  4C1W A;  4MO3 M;  1FMD 3;  1APN A;  1QJY 3;  4RR3 B;  1ZBE 2;  4XET A;  2OA2 A;  5FPB A;  2WFF 2;  1US3 A;  3NNG A;  1VBA 2;  3I4I A;  4LKF A;  1ENX A;  4W50 A;  3USU B;  1V70 A;  3AK0 A;  1UX7 A;  1WA6 X;  1TQ5 A;  3PU8 A;  2P2K A;  5EZW A;  3RZJ A;  1GU3 A;  4HL0 A;  1IS3 A;  3B94 A;  4CDW A;  4LBQ B;  1CR7 A;  1UU5 A;  5FZI A;  3WF1 A;  2ZTN A;  1SBD A;  2Y0O A;  3CBN A;  1WBF A;  5DAW A;  3F2Z A;  3GDB A;  5FUN A;  2W94 A;  4BLJ A;  1QJU 2;  5K0U B;  3H8R A;  3U4X A;  2RS1 2;  3OCP A;  1WCQ A;  4OZX A;  3SCF A;  4DUW A;  3OGG A;  3C7F A;  1ASJ 1;  2JDY A;  5BNN C;  1CZT A;  2AAC A;  4J1W A;  4CTE A;  1ENS A;  1XU2 A;  4NII A;  1FV3 A;  3M3I A;  2PHL A;  1JN2 P;  4IEQ A;  4XUP A;  2NMO A;  1PIV 2;  2BU9 A;  1W9Y A;  1H2L A;  5KXD A;  2OZ6 A;  3BU0 A;  1C8M 3;  5C7G A;  4Y4R A;  5F9T A;  5C8C B;  2JE7 A;  2VE1 A;  3N9Q A;  4UT5 A;  2GU9 A;  3KWV A;  4XHB A;  2WO1 A;  3R4S A;  1US2 A;  3WF2 A;  4Q27 A;  5ACA 1;  3AMH A;  2CAV A;  3S7E A;  1O3R A;  2RE9 A;  4GMP 0;  1NYW A;  3B9I A;  1OHF A;  1H1A A;  5DAX A;  4AEJ A;  1RUH 3;  1GNZ A;  5A1F A;  4AGG A;  3MV1 1;  1AR8 3;  4OI1 A;  3HN1 A;  1OUS A;  4UBH A;  3VN4 A;  1R64 A;  2F4P A;  4K40 A;  2R1D A;  4K20 A;  4CP0 A;  1UZZ A;  2R49 A;  4AQT A;  4YWA A;  1NG0 A;  3TNP B;  4RHV 3;  3PVN A;  3O12 A;  4MGS A;  3C7O A;  4O7X A;  3I3E A;  5JOX A;  1SBF A;  1S0F A;  4Y20 B;  4RFT 0;  1URX A;  2XBO 2;  4YVS C;  2DTW A;  4L9B A;  1LNS A;  1RGS A;  2PHF A;  2GSY A;  2XML A;  1ZZ8 A;  3I2I A;  4ORF A;  4XIL A;  3W9A A;  2WNU A;  3O1R A;  3ZDS A;  3OUI A;  2QQW A;  3OGJ A;  1W6N A;  5CVR A;  3DKQ A;  2JD4 A;  1BVV A;  1AF9 A;  1OA3 A;  4E4H A;  4C1X A;  2ZGN A;  4Q1P A;  4GAZ A;  2PHR A;  3DUI A;  1C5H A;  4FVV A;  2QJV A;  1RUJ 3;  1FOD 3;  1W0O A;  3WOG A;  3H1W A;  2MNG A;  2XVK A;  5LA0 A;  3OG2 A;  3QBQ A;  4DZG A;  1CES A;  2W92 A;  3H7J A;  2VY0 A;  5LW9 A;  1CIW A;  5KXB A;  5LA1 A;  2J1E A;  2HBU A;  2ZS6 B;  3VBU A;  2ZAA A;  3J8F 1;  4YZ2 A;  5ABJ C;  4UFJ A;  4AAP A;  5BNO A;  1NY7 2;  4FTS A;  5I0S A;  2JDM A;  1OH3 A;  3IMN A;  3VBO B;  1VBE 3;  1AR7 3;  3BYW A;  5IJR A;  4AQ6 A;  1VBB 3;  2VOK A;  4I01 A;  4YG0 A;  1BQP A;  3ZYJ B;  1X8M A;  1SLI A;  4KWL A;  2JEM A;  1MQT A;  5FPU A;  1NQJ A;  5IYY A;  3MFC A;  1DQ0 A;  3ZFF A;  3KT7 A;  4LIU A;  4LO7 A;  4FT8 A;  1ENQ A;  3OPZ A;  3R4U A;  4M0H A;  3WV6 A;  4CXW A;  3OUH A;  5E16 A;  5FPZ A;  3VB9 A;  2JIG A;  1SG3 A;  5FZ9 A;  2NYY A;  5FMB A;  3WF0 A;  4EN9 B;  4ASL A;  1JYN A;  1PO2 3;  2Z5W A;  4IXL A;  3E5X A;  4UYB A;  3BKZ A;  4CCC A;  5A7N A;  1XPW A;  1H2N A;  2HWC 3;  3MUY 1;  4HKO A;  4QXH A;  3HT1 A;  3UET A;  5IVE A;  5A6X A;  3IWZ A;  2SLI A;  3KHB A;  1OUX A;  4BQ2 A;  2DCK A;  1KRI A;  4R9A A;  3V0A B;  1YQC A;  2UYA A;  2AUY A;  2W39 A;  3OSD A;  4WVZ A;  3C2U A;  3S7I A;  2DDU A;  4KWU A;  2ZXQ A;  2Y33 A;  3ECQ A;  3N7M A;  1G7Y A;  3K51 A;  4QPI A;  5AFB A;  4BJ0 A;  1R08 3;  1YWK A;  3FN9 A;  3PUR A;  5DUW A;  3SMH A;  3WY6 A;  3VKL A;  3CJI A;  4B4R A;  4KWJ A;  1I3H A;  1W04 A;  4LO5 B;  2YC2 A;  3DL3 A;  4AFB A;  2YUE A;  1YO8 A;  3FMG A;  4ERO A;  4WM8 C;  1FXZ A;  1O59 A;  4NVP A;  3PTY A;  1PMJ X;  4N53 A;  5CAD A;  3KM5 A;  3EO6 A;  3RZG A;  1OF4 A;  2ZA9 A;  3NVC A;  5L9B A;  3JBG 2;  1HQL A;  4IGP A;  3K46 A;  4CCN A;  3PUH A;  4Z8B A;  4XXA A;  2GH2 A;  4JZR A;  2AYH A;  3QAC A;  4K1Z A;  3UYJ A;  2BEO A;  4A45 A;  2I07 B;  1A6C A;  2PAK A;  4CUC A;  2VW0 A;  2WO7 A;  3Q8C A;  3BIE A;  2EXJ A;  4FXG B;  2P3K A;  2CU5 A;  3R05 A;  2ZKL A;  2WZR 3;  5CZK A;  3AM2 A;  5C4W B;  5HCB A;  1GKB A;  5AC9 1;  1BCX A;  1MS5 A;  2YB7 A;  2HWF 2;  2ORZ A;  5A7Q A;  3W5M A;  1UZY A;  2YC0 A;  2WN2 A;  1NE4 A;  4OVE A;  4E2G A;  4CDU A;  4K3U A;  1C3H A;  3K4D A;  4MGZ E;  3VBF C;  1W8T A;  1JXN A;  2GAL A;  3SEP A;  4Y3O A;  5F5I A;  2GZW A;  3RI9 A;  1RHI 1;  1H1M A;  4LE3 A;  2PLV 2;  5GKA C;  1V6K A;  1OFS A;  4ITC A;  4L0P A;  1NA1 C;  2JB4 A;  2UY8 A;  2Y34 A;  1OQD A;  2JKX A;  1NCQ A;  2PHD A;  2VTF A;  4N8M A;  4CP2 A;  2HWD 1;  1FV2 A;  5CNA A;  4OHZ A;  3H8U A;  2JG9 B;  2RVA A;  2GME A;  2RS5 1;  2PLV 1;  3FHI B;  4IER A;  4QM9 A;  2LRP A;  1GSL A;  4AFA A;  4AZZ A;  2EAK A;  1NY7 1;  2B45 X;  1WGP A;  2G9F A;  2W08 A;  4TYS A;  2E53 A;  5DAV A;  1OA2 A;  3CJI C;  1IZ3 A;  2R06 1;  3LDB A;  2B8M A;  2WIN B;  2J42 A;  4I0A A;  3D82 A;  1MEC 2;  1DP0 A;  2DV9 A;  2QQO A;  2DF7 A;  1RIR A;  4CCD A;  4IND A;  5J98 B;  2CYF A;  3LDK A;  2CSG A;  1JW6 A;  2HEY F;  4XE9 A;  1WLC A;  2X5I A;  2XKP A;  4JDN A;  3ZYF A;  3RJ2 X;  5T5L A;  2W91 A;  1BMV 1;  1UIJ A;  4Q26 A;  1J58 A;  2DU1 A;  2EIC A;  3AMP A;  5DZG A;  1TEI A;  2VQ0 A;  3DYO A;  4KNC A;  1OFN A;  5AVP A;  4FTB A;  2D6N A;  1W2N A;  3VZO A;  1DGW A;  1SFY A;  2YBP A;  2PA7 A;  3H50 A;  1CN1 A;  3GYD A;  1VAV A;  5EYY A;  4ZU7 A;  1N1S A;  2ZKN A;  5HBA A;  4XIK A;  2H6C A;  1WZX A;  1JOJ A;  3I7D A;  2JG8 C;  2UWA A;  1RED A;  4DXT A;  2XON A;  2VUD A;  2G19 A;  3ROU A;  1IQD C;  2HWB 2;  5D1I A;  1Q56 A;  2AEY A;  3USS A;  5FP4 A;  3J8F 3;  1F4A A;  1MS1 A;  4FQZ A;  5FP9 A;  2JDU A;  3W21 A;  5J3U A;  1T6B X;  4Q4W 2;  1HLC A;  2FQP A;  3CO2 A;  3VBU C;  1X36 A;  3FE5 A;  5AVA A;  4AI1 A;  2E32 A;  1XNA A;  4JGY A;  5LBF A;  3SC7 X;  1JU4 A;  3GGL A;  3ZN6 A;  3JBG 1;  4S2F A;  2EIB A;  4UAP A;  5HXV A;  4LHK A;  1OOP B;  1JTZ X;  1ZVF A;  2BGC A;  3HQX A;  4XDQ A;  3H7Y A;  1D7P M;  5CB7 A;  4HK8 A;  2I2S A;  1B09 A;  1PVC 1;  2BJS A;  2P5B A;  4H7L A;  4UF0 A;  3VHR A;  2R04 1;  2CWM A;  2ZZJ A;  3C7H A;  4QQ2 A;  1AR6 2;  4B4P A;  4K8R B;  1HKD A;  4W8J A;  2WLP A;  1HV0 A;  1J59 A;  1GZW B;  2A6V A;  2XUE A;  3W59 A;  4BK5 A;  3BIW E;  4DEQ A;  2RS5 2;  3NRU A;  1RUJ 2;  2D7F A;  2OPK A;  1VJ2 A;  3PUI A;  1XC6 A;  3OY8 A;  2ARB A;  2AZ5 A;  3K48 A;  3VBH A;  1RUI 1;  5LY1 A;  2R06 2;  3I2J A;  2XQR A;  3AZZ A;  4IV1 B;  2PQS A;  3LA2 A;  2QQP A;  1SMV A;  4QB6 A;  2ZX4 A;  3CKH A;  4XBL A;  5F8P A;  2W95 A;  5CG9 A;  4KU7 A;  1ULG A;  1VBB 2;  3LA7 A;  5JWP A;  2VCC A;  4XYX A;  1O3Q A;  5FYI A;  1HRV 3;  3DXT A;  5I8Y A;  2QKD A;  3LIH A;  4UW6 A;  4XMI A;  1GWL A;  5JLV A;  2VNR A;  3HNB M;  2OYZ A;  4COV A;  4K1Y A;  4DUV A;  1YNA A;  3HVD A;  1V9U 1;  5KHK A;  1FNY A;  2VBD A;  2D5H A;  4Y22 B;  2WC2 A;  5C6C A;  4UFL A;  2HWE 2;  5A80 A;  1NX9 A;  4IE4 A;  3U11 A;  4FTE A;  5A32 B;  2C9A A;  2ZML A;  4QPG A;  1OUR A;  2V5Y A;  5BYN A;  5JVV A;  4QB2 A;  3TBD A;  3ZYH A;  4GD4 A;  4CDQ C;  1ZRF A;  4AGR A;  4ES8 A;  1W8Z A;  3M3Q A;  4RR3 C;  5CAZ A;  3WP5 A;  5JZG C;  4PDW C;  1Q8V A;  4FO9 A;  5J48 A;  2PHU A;  3LD8 A;  4E8D A;  4TLG A;  4YM3 A;  3WDX A;  5DUX A;  1O8S A;  5HCA A;  4CDW C;  3UJQ A;  3I49 A;  1JMU B;  3NAP A;  4AE2 A;  5FFO C;  4GKY A;  2CL2 A;  1GP6 A;  3MHZ A;  1PK6 C;  3VKF C;  4UFK A;  1BLZ A;  2GAU A;  2LM3 A;  2C1F A;  2UU8 A;  1C8M 1;  2Y6K A;  4PDW B;  4TLF A;  2VW2 A;  2JDH A;  3H0O A;  1HN0 A;  1AR8 2;  1CPN A;  1AVB A;  4IGQ A;  4A42 A;  2WNU B;  2BP6 A;  5K9Y A;  3BOW A;  3JBG 3;  1VRB A;  3VHP A;  1IGO A;  1XJA A;  2WRA A;  1AR8 1;  4AW7 A;  5I0T A;  4NRO A;  1W6Q A;  5IVB A;  2K46 A;  1QY4 A;  1OXC A;  3M3E A;  3VHN A;  2A3X A;  3I2F A;  4QMA A;  5CKN A;  1CZS A;  5IFT A;  3KD4 A;  5H9P A;  3THT A;  4ZXK A;  3SKV A;  4I0B A;  4N43 B;  3BTY A;  1RVF 1;  2P34 A;  4D3W A;  5M0T A;  2V72 A;  4PF5 A;  4AVC A;  2JKB A;  4HPK B;  4DS0 A;  3BN6 A;  2TEP A;  3ZKY A;  1B35 A;  4DIN B;  1LHW A;  3T1L A;  2XBO 1;  4XF4 A;  2XLA A;  2HWD 2;  2W2I A;  2GC3 A;  2WYF A;  1UY3 A;  3FWE A;  4JTN A;  2VZV A;  1KQR A;  1UOB A;  2F4L A;  3W5N A;  1VBA 1;  3Q8A A;  1X9P A;  3I59 B;  5H9R A;  3ZN4 A;  1JZ7 A;  5GAL A;  1MZ6 A;  3T09 A;  4EE2 A;  1S0G A;  3POI A;  4XOG A;  2Q1F A;  2PAM A;  3ME2 A;  4FPL A;  5E8A A;  3AXE A;  3ACI A;  3CZJ A;  2C0Z A;  4GWN A;  1DU3 D;  4EWA A;  2BGP A;  1G9C A;  3JUU A;  5EFU A;  1H30 A;  1V6M A;  1AR7 1;  1COV 3;  4OHV A;  1ZM1 A;  2EA7 A;  4IE5 A;  2VUJ A;  2NLR A;  4Y5Z 0;  5IUQ A;  1RHI 3;  5DZE A;  1Z7S 1;  1C5I A;  2AEN A;  2JG9 C;  4QWN A;  3ZX7 A;  2Q30 A;  3FUQ A;  4LEJ A;  2D93 A;  1NLR A;  1CX4 A;  3KV5 A;  1MS3 A;  3DEM A;  2OPW A;  5A3M A;  1YIF A;  1IOA A;  4QD2 A;  1PO2 2;  4COY A;  4C8D A;  2JD9 A;  3D6E A;  5A3P A;  5JI9 A;  4AK3 A;  4I02 A;  2OUJ A;  1HXS 3;  1QMJ A;  4U2A A;  3B3Q E;  4BQ4 A;  3WQ7 A;  1R1A 2;  4XPV A;  2VQA A;  4WBB A;  1BZW A;  3VBO C;  2RMU 1;  3KCX A;  3WIN E;  3USU A;  1LOC A;  3SHR A;  4N7U A;  1W6M A;  4LNV A;  4RD7 A;  2X05 A;  1SAC A;  3K3N A;  3VBO A;  5EIY B;  3T0A A;  2A1X A;  4PBO A;  3POS A;  4E8C A;  5A1L A;  4BIO A;  3VKM A;  2XVG A;  4LBQ A;  5ACA 2;  1AYM 3;  1N1Y A;  5EQU A;  2VL4 A;  4ZY9 A;  1SLT A;  4YM0 A;  4UW5 A;  5BNQ A;  3KF3 A;  1FMD 1;  4F8A A;  2RG4 A;  2R0H A;  1GNH A;  2BBA A;  2ZX2 A;  1H8T B;  2HWB 1;  5APA A;  5K0U A;  2A3W A;  1R09 3;  5A32 A;  2WLQ A;  4YW1 A;  3WDV A;  2JX9 A;  4PDW A;  1OLM E;  1UD1 A;  1UZ0 A;  3EMR A;  1S1A A;  4XMA A;  5CBL A;  1JU3 A;  2ZX3 A;  2UUR A;  3RMX A;  1QH6 A;  3ZSK A;  1GWK A;  5FYU A;  3WT3 A;  1DQ5 A;  4LHS A;  3TN9 1;  1EV1 3;  1LOE A;  5FPV A;  1LU1 A;  4RGK A;  4GXL A;  1LHN A;  4HN1 A;  3WDW A;  1Q3E A;  2RDN A;  4XJA A;  4URA A;  2VGD A;  2OUH A;  4EZ4 A;  4OFG A;  4S2H A;  5BUV A;  1NOV A;  3SH3 A;  4YGB A;  4WVM A;  1RUD 3;  4HON A;  1S0B A;  3OGV A;  2TBV A;  3FJS A;  1UY0 A;  3AZV A;  2C5D A;  3M3C A;  2C9K A;  1UPI A;  3O1O A;  4WM8 B;  3WUC A;  5FZF A;  3ZOI A;  4JQR A;  4URT A;  3H3L A;  3RG0 A;  2GP5 A;  3FL7 A;  5F32 A;  1OF3 A;  3UL2 A;  1YFW A;  2WQZ C;  1H4H A;  1QDC A;  5FMO S;  1OPM A;  2WZE A;  2E63 A;  1A8M A;  1XNC A;  1GZ9 A;  5IK8 A;  2RR1 3;  4AYU A;  4X8N A;  5FY4 A;  4P9W A;  5IVJ A;  2QDN A;  2O0O A;  1Y9Q A;  1RUH 1;  3WW1 A;  5I0R A;  5EJ3 A;  3OYW B;  4KG0 A;  2AGS A;  1ENR A;  4P9J A;  4HK9 A;  1W2U A;  3IAP A;  5HI0 A;  1W90 A;  3J7M A;  3I2K A;  4YW7 A;  1DYP A;  2H6B A;  5FV3 A;  4PI0 A;  4RQP A;  3LOI A;  4QXB A;  1YFX A;  1AL2 2;  2J1R A;  4JRA A;  4DEV A;  4ASK A;  1DQ2 A;  1CQ9 A;  2Y8K A;  4AEM A;  3AKQ A;  3MIF A;  4COU A;  4Q4X 2;  1W06 A;  2XJV A;  4RL7 A;  2A6Z A;  3TEZ A;  4OI2 A;  4N7I A;  4CDX C;  5FDB A;  4R4Z A;  4IEW A;  4LR4 A;  3GBF A;  2VVD A;  2DCY A;  3K3O A;  2ILM A;  4Q4Y 1;  1FPN 3;  1ZNP A;  3ZXF A;  4XXP A;  1UXX X;  1D4M 1;  1UO9 A;  2J1S A;  1LOA A;  3OBA A;  2RV9 A;  1F31 A;  3DN7 A;  1DZR A;  1K12 A;  4MHU A;  3VDD B;  4D8M A;  1H4G A;  2HEW F;  2RJL A;  3OBZ A;  3HIF A;  3RZK A;  1E57 A;  2WSU A;  3WW3 A;  4DFS A;  1VAL A;  1BK1 A;  5LB6 A;  4NE9 A;  1IPK A;  2BVV A;  3IKW A;  1SCS A;  1CAV A;  4CU9 A;  5IVC A;  5KHG A;  4JDM A;  1LHV A;  3MBW A;  2KR2 A;  3U07 A;  1UZV A;  4CEY C;  4FPH A;  3SQO A;  3POW A;  3ZFE A;  2HWB 3;  2WWU A;  2E9Q A;  2QBX A;  4MZU A;  4NRM A;  1QH7 A;  2VBB A;  1G9A A;  3IBM A;  1W8U A;  4JGZ C;  4B29 A;  4NHK A;  3FC0 A;  4FBF A;  5FBJ A;  1A34 A;  4Q4W 3;  3GNE A;  4R9C A;  1W2T A;  4A4A A;  5T5O A;  1HJF A;  3LE0 A;  2WKK A;  2BPA 2;  1T2X A;  1BVP 1;  3A4U A;  1S55 A;  4YNI A;  2X53 S;  2ZEZ A;  4XAC A;  4XFI A;  5JIU A;  1BXH A;  1UU4 A;  5KHI A;  3N3H A;  3DEC A;  5BY5 A;  1PZ8 A;  5GLW A;  2XG3 A;  3UKN A;  3O1U A;  2H0V A;  2JG8 B;  2Y60 A;  4AEK A;  2D6P A;  2HLE A;  2XWB B;  3B69 A;  3WDU A;  3NO8 A;  4J25 A;  4PIY A;  4XUQ A;  3ZYG A;  1GOG A;  4D6S A;  1ZRD A;  2WNV A;  5FY8 A;  1J1T A;  1XBF A;  1QWR A;  2YU2 A;  4QAW A;  3MI8 A;  1HXS 1;  3MYX A;  4KMQ A;  4PIX A;  4AAX A;  3DGT A;  1QQP 1;  5T5P A;  5JMC A;  5FXX A;  2DFB A;  3I2G A;  5FZ8 A;  1ZBE 1;  1XYN A;  1BEV 1;  2DCZ A;  2YXS A;  3MLJ A;  1V6L A;  2KD7 A;  4IUG A;  4R8H A;  3T0D A;  1PX4 A;  2I45 A;  3E6D A;  4PQQ A;  1RUF 1;  2OW4 A;  1XU1 A;  2BWA A;  2XDV A;  1QOT A;  2CGP A;  3THD A;  4JHT A;  1K5M A;  2VZ3 A;  2YMZ A;  5LBE A;  1KFU L;  1PHM A;  2AEZ A;  1MVQ A;  5F6K A;  5ABJ B;  4ZON A;  1VLN A;  1AR9 3;  4ASM B;  1UKG A;  1VIW B;  4M3C F;  4AI2 A;  2E33 A;  5EYX A;  5JR2 A;  1JZ3 A;  4P9Y A;  2A6Y A;  4Y1Z A;  3ZR5 A;  2HWE 3;  3VV1 A;  1MVE A;  4B3N A;  1VMH A;  3KQR A;  3RPQ A;  1DBN A;  3UKV A;  3ZYI B;  4JVA A;  5CYY A;  1F5J A;  4QX5 A;  5LRR A;  2VCM A;  3N7J A;  3AP9 A;  3JD7 1;  1EPZ A;  1HXS 2;  4AI8 A;  1IG3 A;  4CEW C;  1QGL A;  2IZW A;  4N53 C;  2VMI A;  4GH4 A;  4GUL A;  1E5I A;  3PJQ A;  4PF1 A;  2CNA A;  4XJU A;  3WW4 A;  5JXH A;  4Y1V A;  4BQY A;  5DZF A;  1DDL A;  1LOF A;  1NXM A;  1X9T A;  1VE0 A;  4UXA A;  4ZU5 A;  2J7M A;  2B9U A;  3HBZ A;  2W1W A;  1YUD A;  1F9K A;  4V1P A;  1HQW A;  4OUE A;  3ALQ A;  2JIC A;  4HSJ A;  2A6W A;  3TN9 2;  4CU6 A;  4IES A;  3LOB A;  2ARC A;  3M1H A;  4SLI A;  3JQX A;  3OY8 B;  1CIY A;  3GHN A;  4Q2F A;  1H8T C;  1FI2 A;  1TMF 2;  1XB9 A;  2GP3 A;  5DDJ 1;  4YW6 A;  3ZFE B;  4Q4W 1;  4RGA A;  4HXC A;  5FK7 A;  4RN5 A;  4QKN A;  4QPG B;  1OA4 A;  4M01 A;  4YSF A;  1JHN A;  1NA1 A;  3BPZ A;  5LA2 A;  1QJX 1;  4OQ8 A;  1WW5 A;  1HIX A;  1S0D A;  1YHF A;  3VGI A;  2AC1 A;  5LEK A;  5A3N A;  2D44 A;  2VZU A;  5GZD A;  2F6B A;  2Q1M A;  2VQU A;  1ZRR A;  2VM9 A;  3DPR B;  1GV9 A;  3M70 A;  2ERF A;  4FOW A;  1WD4 A;  4K7J A;  1IG0 A;  4KGG A;  4Q0Q A;  4Z1V A;  1JBC A;  4EZH A;  2ZX0 A;  2FDI A;  1GAN A;  3ATG A;  3VKN A;  2X10 A;  1VBC 1;  2IXK A;  4HN0 A;  5JXG A;  4QDS A;  3NKT A;  4KL1 A;  1W8W A;  3LFI A;  3RZH A;  2WNE A;  1H9P A;  2PHX A;  4Q0P A;  3ZLI A;  4LBL A;  1WD3 A;  4XBN A;  4XZP A;  2E6V A;  5DDJ 2;  5CG8 A;  4CCL A;  2WAO A;  4M3C A;  3POB A;  4LBM A;  2RR1 2;  4FPJ A;  5FO7 B;  4YVW A;  2PQQ A;  3MIH A;  4QGL A;  1UPS A;  3SIS A;  3PIJ A;  4CDU B;  2PFW A;  1W9F A;  2TUN A;  1CAW A;  4AFM A;  1SQ4 A;  2AR6 A;  3HOB A;  2Y6J A;  1A3K A;  1FMD 2;  1DLC A;  2MEV 1;  2V4V A;  1EUT A;  3AB0 A;  3E97 A;  1UY4 A;  1ASJ 3;  5LBB A;  4ARY A;  1EAH 2;  5BV6 A;  2CY6 A;  3T2T A;  4MGI E;  4XCB A;  2EXH A;  2X29 A;  5FMC A;  1Y4W A;  3AKP A;  3VLB B;  4AHX A;  4LBQ D;  1K42 A;  3ZXK A;  1AYN 3;  1Z7S 2;  2Q0A A;  1R1A 3;  5F3E A;  3WNO A;  1ODN A;  1PNG A;  3NNJ A;  3VBS B;  1W05 A;  4JGZ A;  4XFC A;  2WZ8 A;  1RXF A;  1I5P A;  1UCX A;  5LBC A;  3TEW A;  2QZ3 A;  1LCL A;  4Z2A A;  3R0R A;  3VDD A;  1PO2 1;  2FBE A;  1AYM 2;  1OQ1 A;  3OD4 A;  3LCP A;  5FLI A;  2GNT A;  2YV8 A;  5FYT A;  5E88 A;  2IC1 A;  4ZHN A;  4UFI A;  1W6P B;  4M3C E;  1NZI A;  3M2M A;  3III A;  1PK6 B;  4Q4V 1;  1HX6 A;  2VUC A;  4RGG A;  5HCH A;  1JZ5 A;  4BB3 A;  1RMU 3;  4D6R A;  2BFU S;  3CLP A;  2D6M A;  4UBG A;  1LJ7 A;  1O91 A;  1GIC A;  2D3S A;  5IAV A;  3WP4 A;  1MQT C;  4LKE A;  2O1Q A;  5L9V A;  3LWC A;  4IL7 A;  1WCK A;  4YM1 A;  4BQX A;  2WS9 1;  4IE7 A;  2YRO A;  1PVC 3;  3FLP A;  2FD8 A;  2VZR A;  3J7N A;  1GBG A;  5GLT A;  4TN7 A;  5FP8 A;  2FDH A;  1VBC 2;  4QQH A;  2HWF 1;  4AI3 A;  4XJW A;  4QT6 A;  3RYP A;  2WUH A;  3J26 N;  1VRH 3;  5ANN A;  2HKX A;  3N7K A;  1RVF 2;  2WZP P;  2YDE A;  3TWI A;  1WW4 A;  2ZAB A;  3MIB A;  5FWE A;  1RL3 A;  4P08 A;  4ZKT B;  1KXG A;  2W87 A;  4ET7 A;  1GP5 A;  1PO1 3;  3MIE A;  2B9V A;  3EQE A;  3PUQ A;  2HWE 1;  4BOW A;  4FAH A;  1UX6 A;  3ES4 A;  1O7F A;  2R7E B;  1LEM A;  2WAA A;  1TNF A;  4COW A;  1T6G C;  1PGL 1;  1UY2 A;  1OOP A;  4YZ1 A;  2RS3 2;  1DQ4 A;  1F5F A;  3LZZ A;  4M3C B;  2XHN A;  3FX3 A;  3DPR A;  2EAL A;  5JXI A;  1KDM A;  1XOY A;  2B4K A;  4E2S A;  1N3Q A;  2WS9 2;  4QQO A;  4O9E A;  4BK4 A;  2MEV 3;  1QJY 2;  4B1L A;  1O3S A;  2Z42 A;  3D3A A;  1ZBE 3;  1VP6 A;  4R9B A;  4M4P A;  5CFC B;  2DVA A;  3AP4 A;  4LUK A;  1RB8 G;  2QCS B;  1Y9G A;  2D43 A;  2DUO A;  5A7W A;  3CIH A;  5EWS A;  3SKJ E;  1AJK A;  2UY9 A;  5I91 A;  3DCQ A;  3PUS A;  1X7N A;  4MAD A;  3UJO A;  4C0B A;  1HB2 A;  2GMM A;  1D0G A;  3OD0 A;  3ZPO A;  1K3I A;  2C6S A;  4FP2 A;  4GMP 1;  4L11 A;  5FOB B;  5K7P A;  4AVV A;  2G9Z A;  3EBR A;  4YW2 A;  3S5A A;  2RS1 3;  3DYP A;  4A2U A;  1G9F A;  4MH0 E;  3VDC A;  2GNB A;  4GIQ A;  5CU1 A;  2VOW A;  5J37 A;  2MPF A;  3VUO A;  1H1I A;  1BJQ A;  1SPP B;  2WWJ A;  4MOA A;  2VBP A;  3SH5 A;  3U1X A;  4A3X A;  4NWV A;  2VZP A;  4NR1 A;  4OMD A;  5FLJ A;  1U0A A;  4PJY A;  4CDX A;  2VUL A;  1W9T A;  1NLQ A;  3ABZ A;  3GXU A;  1QKQ A;  2PMW B;  3VZJ A;  2WSV A;  4HSL A;  3ZIX A;  5BNP B;  5F39 A;  3NJZ A;  3TRS B;  2KM2 A;  2W0X A;  2XLG A;  3SNM A;  4HAN A;  4BQW A;  2VZO A;  4QU1 A;  5CEH A;  3BUC A;  1J83 A;  4NWW A;  2VMG A;  2MHF A;  3MID A;  5FXZ A;  1K5J A;  2DUP A;  3A0K A;  1SFN A;  1DGR A;  3VL8 A;  2IUW A;  3AYD A;  3NAP B;  3OUJ A;  1ZBA 3;  4RHV 1;  2BGO A;  4BHP A;  5J96 B;  4HKL A;  3RNS A;  1XE8 A;  2OS2 A;  2ZGP A;  4V2V A;  2RDR A;  4XJ9 A;  2GC2 A;  4Q5O A;  3ZMO A;  1ZRI A;  2WYS A;  3LPG A;  3ZFG A;  3MV0 1;  2A7A A;  1UYY A;  1PZ7 A;  3NJX A;  1ULO A;  3N36 A;  2KA3 A;  3POJ A;  3WVJ A;  3NNM A;  4AHY A;  4Z92 B;  2VUA A;  1I5Z A;  4OCT A;  3K75 B;  5JDB A;  4QQL A;  1AUY A;  1KFX L;  1W8N A;  4XAE A;  4RYD A;  5FZO B;  3B5L B;  4ARX A;  1E5H A;  1R1A 1;  1GYK A;  2WQ8 A;  2CGO A;  2XOM A;  3I59 A;  4L92 A;  1XYO A;  4IET A;  4Q29 A;  4QGN A;  4RSU A;  2IXJ A;  5DG2 A;  5J1X A;  4TZD A;  1DGW X;  3PUA A;  3CEW A;  5FY1 A;  4UOJ A;  4XUR A;  1HQN A;  1QJX 2;  3ZXG A;  1DYO A;  4CUG A;  1EV1 1;  1OKO A;  1ND2 A;  4LBK A;  1X33 A;  4BH9 A;  3U0Z A;  3HJR A;  5F3G A;  4BDV B;  3J7L A;  1TME 3;  3PVB B;  5JMO A;  3H8O A;  2HJI A;  4JQT A;  3WP6 A;  5A70 A;  1RUG 2;  1X8E A;  1GMM A;  1SZB A;  2BOJ A;  3NMB A;  4MXV A;  5FO9 B;  1QNW A;  2VEC A;  3FBM A;  5E6H A;  3AX4 A;  4XFB A;  1KJL A;  5FMD A;  3WNK A;  2YGL A;  3WG2 A;  5C5T A;  1Q8P A;  2P1B A;  2P6C A;  4CZS A;  5K0U C;  1EAH 3;  3KCC A;  3VZK A;  3KVB A;  4J6G A;  1LOD A;  2A5Z A;  4NAO A;  3UGG A;  5T5J A;  5B4N A;  1WCS A;  2IVI B;  3VBR B;  4FPK A;  3N9N A;  2YFZ A;  3WNP A;  4ZZ5 A;  4BZ4 A;  2FCV A;  2HWC 2;  4EN8 B;  3U78 A;  1R1Z A;  4Q4V 2;  3WP3 A;  2DVF A;  5G05 L;  1QJZ A;  4ZZ8 A;  4LIT A;  1KDK A;  1SPP A;  1NKG A;  1G6N A;  5CFD C;  1PK6 A;  2RHP A;  5D8A C;  5F2S A;  1RJ8 A;  2VCB A;  3KS7 A;  3NJY A;  1CON A;  3TN9 3;  1XNB A;  2JB8 A;  5F5Q A;  5C8W A;  2HYK A;  1CJD A;  4COZ A;  3GZA A;  2VNV A;  5AFE A;  5CIS A;  1NLS A;  4NUB A;  3SIT A;  1YLL A;  4FPY A;  4EWD A;  4FOV A;  5FYM A;  2BNO A;  3AZY A;  4RR3 A;  3POG A;  5JZG A;  2PAE A;  2YBS A;  3RZZ A;  3VZM A;  1JYW A;  5I93 A;  1LGB A;  1H2K A;  4XJZ A;  5D8A B;  4Y5T A;  1KS4 A;  2DVB A;  3FHQ A;  4JHZ A;  4DRR A;  1DIW A;  4Y24 A;  1IKQ A;  1ULP A;  2WDB A;  2H0B A;  2VOV A;  2D97 A;  4N43 C;  5F6L B;  1JOB A;  2A73 B;  3WNM A;  4AQ2 A;  1PVC 2;  5FZE A;  4CP9 B;  3O1S A;  1LU2 A;  4HT1 T;  2W3J A;  5D21 A;  5DUV A;  3M7A A;  4EN7 B;  4BYY A;  1M4W A;  1WMD A;  5AC9 3;  2RMU 2;  3Q8F A;  5H9S A;  5TSW A;  3AVR A;  4MYE A;  1JYI A;  4ONU A;  5KR7 A;  2YPJ A;  1POV 0;  4HKW A;  3AYC A;  3UGH A;  4PHZ A;  1JZ2 A;  2ADE A;  3ZVX A;  4AOC A;  3TEY A;  4NRQ A;  5A3L A;  3GBW A;  3CMG A;  4A3Z A;  4G3Y C;  4S2D A;  4BQ5 A;  3MGU A;  1NCR B;  4A44 A;  4K21 A;  5L73 A;  4WVM B;  3VBH C;  4AL9 A;  3H1M A;  1W2A X;  3RI8 A;  1NZC A;  1RUE 3;  2G1M A;  1AXZ A;  1QJY 1;  1RUG 1;  4PIZ A;  3P5B A;  5F3C A;  3CNA A;  3O1M A;  5A7S A;  1TME 1;  2P4E A;  3NKG A;  2ATF A;  5DAB A;  1GQP A;  1L7L A;  3W58 A;  1NQD A;  1O8P A;  1QF3 A;  4PT6 A;  4BPZ A;  1WWY A;  1XNK A;  2WNV B;  1QOS A;  1C57 A;  3LEM A;  3PIG A;  2R0F A;  3NV4 A;  3RVH A;  4JDO A;  3ZN6 B;  1U5X A;  2GC1 A;  3KZ4 C;  4I30 A;  3EJK A;  2CDP A;  4LE4 A;  1N1V A;  5I0U A;  4F7Z A;  4OHY A;  1GZT A;  4QXK A;  5CFC C;  4RS5 A;  3EHK A;  4Q4Y 3;  2IFW A;  4YPJ A;  1YJL A;  3OPT A;  4WZC A;  4O65 A;  4P00 B;  1UYZ A;  1F35 A;  2PYT A;  3KVA A;  4U36 A;  2OT7 A;  4P9X A;  3WZ1 A;  3I3D A;  2I74 A;  2ZGU A;  3FFQ A;  2CGN A;  2Q8D A;  4LBO A;  3WR0 A;  2E7A A;  3APB A;  4EN6 B;  3WDT A;  5KXE A;  2FDF A;  4HVO A;  3EYP A;  3R4D B;  4YGC A;  4W6Y A;  3V0B A;  2A70 A;  5CA6 A;  2FHR A;  2NMN A;  3FLT A;  1EPW A;  4HOO A;  4YW3 A;  1DQ6 A;  1ZA7 A;  4PBP A;  3OEA A;  2W68 A;  2XUM A;  5EJ1 B;  2AH2 A;  4YGD A;  3RGB A;  3K2O A;  2YHJ A;  2VVF A;  3BB6 A;  5F37 A;  1RMU 1;  1TZO A;  3VDD C;  4XDP A;  2W1Q A;  1GQH A;  4I09 A;  5KHJ A;  1D0H A;  5FP7 A;  2D6O X;  1X82 A;  1QXR A;  2NM1 A;  1EP0 A;  2YU1 A;  3J8F 2;  4L2N A;  2X5I C;  2DCJ A;  5F1R A;  4QDR A;  3FBY A;  4MXW B;  1F2N A;  3CJX A;  3B01 A;  3MW2 A;  1LKN A;  1SLL A;  1TVG A;  3A22 A;  3DPR C;  3WLU A;  3O1V A;  4K9S A;  4DUX A;  4Y1Y A;  1OSG A;  4BIF A;  1XRU A;  2J1V A;  3H3U A;  2Q8C A;  4QGM A;  3RFR A;  3Q8E A;  3FLR A;  3ZXD A;  2J22 A;  1VBD 3;  5FZO A;  1MQT B;  4LHL A;  3KCY A;  3ZIW A;  2C26 A;  4HFS A;  5LY2 A;  2E26 A;  1JZ8 A;  2EAA A;  3GJB A;  1V6I A;  2RS3 3;  2DUQ A;  4B4Q A;  4XUT A;  3JB4 C;  3P3N A;  3FZ3 A;  3KLS A;  4QM8 A;  5LRS A;  1QJE A;  3H8X A;  3I8T A;  1OPO A;  1DCS A;  2ZCW A;  5FIX A;  2WFF 1;  2J1U A;  4LXL A;  1DLL A;  1WA4 A;  2R06 3;  2XL7 A;  1Y7B A;  4HLT A;  5HCF A;  4CDU C;  3PNA A;  3VHO A;  1QJX 3;  1MZF A;  4OUL A;  1BEV 2;  3I3Q A;  2XXZ A;  3KSC A;  4NRP A;  3T2P A;  5FYC A;  5L7O C;  1W6Q B;  3ITQ A;  3AMN A;  4BA6 A;  1HJG A;  1L7R A;  1V6J A;  4DOU A;  1HRV 2;  2UYB A;  1U5I A;  3JXS A;  1VPH A;  2YPD A;  3BU7 A;  1ND3 C;  1S2E A;  1COV 2;  1ZZC A;  1POQ A;  1GQG A;  1WLW A;  1ZZ6 A;  3D4K A;  3GAL A;  3POF A;  1RHI 2;  4MET A;  1UF2 C;  3RJR A;  2ETE A;  4Q0S A;  5FZH A;  2OQ7 A;  2W46 A;  5C3R A;  2XJP A;  3E5Q A;  4KH9 A;  4IEV A;  4D6Q A;  3GZT B;  1PM7 A;  1DZQ A;  2JEN A;  2ET1 A;  2E51 A;  1XSR A;  4XDO A;  3B02 A;  1YQ8 A;  5E1R A;  1O4Y A;  5KC5 A;  3WG3 A;  3VBR C;  1LEC A;  1ND3 B;  3S30 A;  2PEL A;  3AL5 A;  2VTX A;  2R6Q A;  4WM8 A;  4YZ3 A;  1AJO A;  2FMY A;  5LA9 A;  5K8S A;  4XUN A;  3T2Q A;  1JYT A;  3TYJ A;  3D0J A;  2DCT A;  1IS5 A;  3AFK A;  1SDD B;  4QPI C;  1JYV A;  5FXW A;  2IXC A;  1NAE A;  3H9A A;  4WVV A;  4HG6 B;  3C7G A;  2ES3 A;  5FYH A;  2W1S A;  1NCQ B;  4LKS A;  1WKY A;  5JCT A;  1R09 2;  2ZGO A;  5SV5 A;  3PHM A;  3VKO A;  4GWI A;  3ILN A;  2DTY A;  3VBU B;  1HW5 A;  2NZ9 A;  4IDZ A;  3ZPY A;  4E9K A;  1ZZ9 A;  4I3G A;  5DG1 A;  3SEE A;  1RJ7 A;  4FXK B;  4FPF A;  1AXY A;  4GWJ A;  1ZBA 2;  1G8W A;  3ORJ A;  3ZSL A;  4YAR A;  4NPM A;  3LF7 A;  2WZR 1;  4QX1 A;  1DG6 A;  5A3O A;  1EV1 2;  4QKF A;  5J09 A;  4KQ7 A;  2O8O A;  1ODM A;  1HRI 3;  4XEZ A;  2QQK A;  1UW8 A;  3JD7 2;  3LGR A;  1VMF A;  1OLM A;  2Y6L A;  3NV2 A;  2P3I A;  2RMU 3;  4IV1 A;  5FAX A;  1CAU B;  4X6R B;  3AP5 A;  1LUL A;  1HB4 A;  3CF6 E;  4LQR A;  1BYH A;  3BGA A;  5KHH A;  1D2Q A;  1ND2 B;  3I2D A;  3UV9 A;  2W47 A;  4LUL A;  4ZPI A;  5C3Q A;  4CCM A;  2J1A A;  2P37 A;  2QQL A;  1OQE A;  5BNO C;  2HBT A;  1GLH A;  4FPC A;  3PU3 A;  5C9A A;  1UOF A;  1KIT A;  4IV1 C;  1MZE A;  2PTM A;  5JSO A;  1J84 A;  1RUE 2;  1XSQ A;  2VOX A;  1SLC A;  3IB3 A;  5FTT C;  3VBH B;  2ZMK A;  5DN2 A;  1UKR A;  3ZYR A;  1Q5O A;  3MIC A;  1S0C A;  4DY3 A;  1WCU A;  4L8Q A;  3PVE A;  1ULC A;  2R32 A;  2Z4F A;  4CCO A;  1MS9 A;  3O0X A;  2BQP A;  3B7M A;  3GZU C;  4UI9 L;  1RUG 3;  5DAP A;  5LAT A;  4HVQ A;  1C1L A;  2EVX A;  1RUJ 1;  3T30 A;  4UWD A;  4N53 B;  4XTP A;  4FOQ A;  1QJU 1;  3H42 B;  3QD6 A;  3TEX A;  3E5U A;  2NQY A;  4QDQ A;  4PLM A;  5FYV A;  4AVS A;  1GWM A;  1PO1 1;  4CDQ B;  2O14 A;  1NUK A;  5FZ4 A;  5HV4 A;  3CDZ B;  3LB9 A;  2RM2 3;  4W6X A;  1C1F A;  4Q4V 3;  5FPX A;  4LHN A;  4AHW A;  4EN0 A;  1JH5 A;  2BTV C;  1JHJ A;  4LLO A;  1PMH X;  3C7E A;  3ZFE C;  4CRQ A;  2R07 1;  4CEY A;  1FPN 2;  2ZAC A;  2BUK A;  1ULE A;  1W03 A;  2P3J A;  3IZO A;  4Z2W A;  4KG8 A;  3VBS C;  3WQ1 A;  3WSO A;  2P17 A;  3HNM A;  5FZA A;  3BAL A;  3FFZ A;  3QOP A;  5T54 A;  5FYS A;  4AI0 A;  4M4R A;  1UWW A;  2RS3 1;  4JKL A;  3ZFF C;  2BW8 A;  1ND3 A;  2Q4S A;  2W52 A;  3R6S A;  2Y6H A;  2L9L A;  3OBT A;  4CUA A;  1DFQ A;  3HT2 A;  1ZX5 A;  1AX2 A;  3T4H B;  3WEZ A;  3OF1 A;  3SCG A;  4JRL A;  5LK5 A;  2ZGL A;  1OMI A;  2NN8 A;  2XL9 A;  3MUZ 1;  3QH6 A;  1AL0 G;  3N9M A;  5ABJ A;  2B42 B;  1J1L A;  4MV2 A;  5IVF A;  4Y22 A;  1RUH 2;  2VO5 A;  1QQP 3;  2EXI A;  3K4A A;  4J1X A;  3FUO A;  1RUD 2;  3RYK A;  5C70 A;  1UY1 A;  1PGW 1;  1OH4 A;  5JPN B;  4RS5 C;  4JKK A;  4IE0 A;  3WQ0 A;  4Y33 A;  5A3W A;  1YQ2 A;  4JV4 A;  1ZBA 1;  3UK9 A;  1G9D A;  5E89 A;  3T2O A;  2VH9 A;  3VDA A;  1N3P A;  4QPW A;  2F17 A;  3OTF A;  1S0E A;  4LK7 A;  1AL2 1;  2BVB A;  3WG4 A;  3INA A;  4XF0 A;  4LMF A;  1N47 A;  1LHU A;  3GJA A;  4OLL A;  4DXR A;  1OI6 A;  3ACG A;  4IEY A;  1GUI A;  1Q8Q A;  4LA2 A;  4DB5 A;  2NP0 A;  3BTX A;  1A8D A;  4WZF A;  4JAA A;  2LAL A;  3U10 A;  5FZ6 A;  3WHU A;  4BXF A;  3A7Q A;  3WCR A;  1VB2 A;  4D7Y A;  3VZN A;  4P14 A;  4LO4 B;  5FUI A;  1DZT A;  4CE8 A;  5C3O A;  4RFR B;  2G9G A;  2IFR A;  3CL1 A;  5FXV A;  4XF9 A;  4E4D X;  5BPX A;  2ZX1 A;  4NIA A;  4DPN A;  1VBE 2;  1RYY A;  3EXU A;  4O61 A;  2WFF 3;  5C4W A;  2RDS A;  1K45 A;  1AHS A;  2O8Q A;  3GBG A;  2X8K A;  1JZ4 A;  1PX3 A;  5B4X A;  1NA1 B;  4QX3 A;  4ATE A;  4XQ4 A;  2VD7 A;  1OD3 A;  3S6P A;  4QKB A;  3OOX A;  1AZD A;  1CVN A;  1S0I A;  2RM2 1;  3IDB B;  3ENR A;  2KXL A;  3KQ4 B;  1EY2 A;  4Q4X 3;  4CP9 A;  1YQ5 A;  3AYE A;  4MXW A;  2RJK A;  4OI4 A;  4GAL A;  4W6W A;  3E6B A;  4XZU G;  3MFA A;  3AFG A;  3RQ0 A;  4CU7 A;  1D4M 3;  1LOB A;  2JE9 A;  1WMF A;  4N43 A;  4QU2 A;  4M0N A;  3IMM A;  4I2O A;  4CA9 A;  1QDO A;  2QQU A;  3LA3 A;  2BDR A;  2RJ2 A;  2LTN A;  2XLF A;  4D69 A;  1CX1 A;  4NPR A;  4JTO A;  1LHO A;  2YC4 A;  2JEC A;  4IV3 A;  4QPY A;  2YYO A;  1IKP A;  5F5A A;  1SLA A;  3ACL A;  1PIV 3;  3AJY A;  3ZM8 A;  1C8M 2;  4B7E A;  3BPS A;  2QQI A;  3X29 B;  2B39 A;  3LKJ A;  2DU0 A;  2N7G A;  4I0W B;  5J36 A;  2ZGQ A;  2QVS B;  2SBA A;  3IM0 A;  4L99 A;  3WW2 A;  2HEV F;  2IXL A;  3PTR B;  1IHM A;  1W8F A;  3JU9 A;  3POY A;  4NHY A;  4UW4 A;  2WAB A;  3OGR A;  3WXP A;  5IK7 A;  5JOW A;  1CAW B;  4IEU A;  1SEF A;  3C3V A;  2ZPX A;  3O1T A;  2D5F A;  3U4S A;  2XQX A;  1WLD A;  2XR4 A;  3ZSE A;  1NXD 1;  4AED C;  5FP3 A;  3VD7 A;  4Q8K A;  5FR3 A;  2Y6F A;  5FY0 A;  2UWC A;  4P5Y A;  3CHX A;  3HBK A;  4XVH A;  4IEP A;  4XAB A;  5GLZ A;  2RDQ A;  2YFU A;  4GA9 A;  1RTV A;  4QX0 A;  3JD7 3;  5FYZ A;  3AKS A;  1WBL A;  5FBZ A;  2XBO 3;  1TNR A;  2FDJ A;  4LK6 A;  4YVS B;  1UNB A;  1PM4 A;  3S57 A;  4XC9 A;  5L9R A;  3MZH A;  4F83 A;  4NHM A;  3BI3 A;  1NCR C;  1U12 A;  4MLO A;  4H2A A;  4NAM A;  4RQP B;  4AFD A;  2HWC 1;  4AQS A;  4B8E A;  1J3Q A;  3MF6 A;  1POV 1;  1LTE A;  1ND2 C;  2JJ6 A;  4JCK A;  4WV8 A;  3HD8 B;  3T1M A;  3AJZ A;  3IAQ A;  1BKZ A;  2R16 A;  3AKT A;  4XCA A;  5FPA A;  5FZD A;  3WD5 A;  4AXO A;  4CCK A;  4CYD A;  4NO4 A;  4RA0 A;  4X6Q B;  5DDJ 3;  5JOY A;  5LZ6 A;  3ZR6 A;  4GKX A;  1OLR A;  5F3I A;  3AL6 A;  1C8N A;  5C3S A;  1B35 C;  2XHK A;  3WCS A;  1F8V A;  2VZQ A;  4NHL A;  4ISR A;  5BNO B;  4YG6 A;  1GFF 2;  5A6Y A;  4YYO A;  5I8T A;  3O14 A;  1NCR A;  4FP3 A;  4IW3 A;  3MLL A;  4NOT A;  4CXY A;  3I2H A;  4UF0 B;  3SCH A;  2WFP A;  5A1A A;  1RUF 2;  5F2W A;  1OD5 A;  3D0S A;  3N35 A;  5JSR A;  2FZ2 A;  4HPK A;  1QIQ A;  1ASJ 2;  1RUC 1;  2PHW A;  4XHX A;  4ISQ A;  2VNO A;  1B35 B;  2R07 2;  1Y43 B;  2K0G A;  2D40 A;  4LOR A;  4XJ8 A;  3WHT A;  3NQH A;  1Z7S 3;  3J4U H;  3JZV A;  2FMD A;  2IXI A;  2OQ6 A;  4XBQ A;  2VTX J;  1WME A;  5JOZ A;  4HET A;  3UKT A;  2VME A;  1LAJ A;  3SXW A;  2VMD A;  3AYA A;  5IT6 A;  3LPF A;  4M00 A;  1UU6 A;  3I97 A;  2XJR A;  2QE3 A;  2Y26 A;  4IV3 B;  3DKW A;  2TNF A;  4BQ3 A;  1RXG A;  3BCW A;  5A6Q A;  3ILF A;  4P5H A;  2Q8E A;  5FOJ B;  1CAV B;  3NAP C;  3MIG A;  2WQ4 A;  5B2G B;  5JZG B;  1CZV A;  2JDK A;  3KF5 A;  4Q0V A;  2ZHK A;  3A0N A;  4EV0 A;  4XQD A;  1V0A A;  4XFA A;  1I1E A;  4CPB A;  1XQN A;  1UMH A;  3LSD A;  3RZL A;  2VMF A;  5FLH A;  3RDI A;  4A7Z A;  4MUV A;  3N9O A;  4QX7 A;  1VR3 A;  3THP A;  3MF9 A;  2WWS A;  2VW1 A;  1IQA A;  1RUE 1;  1RUD 1;  4FOY A;  3T3Y A;  5CKM A;  2OX0 A;  3WQB A;  2DUR A;  5GLV A;  1HRI 2;  1R08 1;  1W6M B;  2VAU A;  3ZXJ A;  1LB2 A;  5FZ7 A;  3NW4 A;  1FAT A;  4WVW A;  4Z07 A;  2R04 3;  2JDP A;  5C9A B;  5FO8 B;  1KD7 A;  4DQA A;  3OYW A;  3S5Q A;  1DGR N;  1QQP 2;  1YFY A;  1KGY A;  1VRH 2;  3QCW A;  4BWO A;  4D7S A;  2ZGK A;  4MHR A;  2ZEX A;  3ELN A;  5JXJ A;  1W6O B;  4IEX A;  1WUV A;  1UXZ A;  3KGL A;  4TXW A;  3RSJ A;  1CJP A;  5C4W C;  2YBK A;  1O6U A;  1XXN A;  1UAI A;  2CAU A;  3N9L A;  5ANQ A;  2Q8O A;  5G04 L;  1PO1 2;  1AR6 3;  1H0B A;  1CAX B;  5LAS A;  4W65 A;  2CDO A;  2V4A A;  3MLK A;  2WA4 A;  3T4V A;  3IPV A;  1F4H A;  1WCD J;  3VBF B;  4H14 A;  3GHM A;  1YYN A;  2ENR A;  1W0P A;  3BTZ A;  2FZ1 A;  4AED A;  2R30 A;  1UOJ A;  3RRD A;  2GNM A;  3VD5 A;  3ETP A;  4SBV A;  5GZE A;  2WS9 3;  4CCJ A;  4YZ5 A;  4JC1 A;  2ID4 A;  1CAU A;  4KI5 M;  1YEW A;  1QNY A;  3WNL A;  3KT1 A;  3HMY A;  4DY5 A;  5JI7 A;  3I2O A;  3HN3 A;  3OB8 A;  4PLO A;  5FZM A;  4BME A;  5C3P A;  3KV9 A;  3HPN A;  2JDZ A;  1EYB A;  3ZKU A;  1CPM A;  4EWE A;  5CFD B;  4LO8 A;  4XQW A;  4A7K A;  5DMY A;  1MZ5 A;  1PGL 2;  3PDQ A;  1YCI A;  5GZG A;  1Z0H A;  4GH4 B;  3KGZ A;  4TSV A;  3ACH A;  3N9P A;  1D4M 2;  4YFZ A;  2LW8 A;  5FUP A;  1H9W A;  3ACF A;  4QB1 A;  2BER A;  3O5S A;  4ZS3 A;  3DYM A;  1DYK A;  2Z2S B;  2ZHN A;  1NE6 A;  4BU2 A;  2VQT A;  4WM7 A;  1QHD A;  4XFF A;  2WO3 A;  1OLQ A;  4FFI A;  4YW5 A;  2EIG A;  2JE8 A;  1RMU 2;  3HNY M;  5C33 A;  5F7U A;  2HH9 A;  2ZJC A;  2BV4 A;  5BNP C;  4JKM A;  4E4Z A;  4TWT A;  1POV 3;  4LA3 A;  1LED A;  3K4Z A;  1JZ6 A;  1HV1 A;  2VMC A;  5T50 A;  2ZGM A;  2P3Y A;  4LKD A;  3VD9 A;  3NWK A;  4LUM A;  1O3T A;  1RUO A;  3OBR A;  2BYV E;  4OZO A;  2IVJ A;  3ZXA C;  1Q8O A;  3J7H A;  2QQM A;  5FJK A;  2EXK A;  3M8L A;  3OPW A;  2ZHL A;  5FZG A;  1V6N A;  5FYY A;  1W3X A;  1W9W A;  3ZDV A;  4NHX A;  4C90 A;  2DBI A;  1VBC 3;  3DV8 A;  2DBN A;  1STM A;  4FI9 A;  4FPE A;  3K77 A;  3O0W A;  4HVR A;  3RZM A;  5FK8 A;  3ZN5 A;  1RVF 3;  3EB7 A;  3LIG A;  4BQ1 A;  1OT5 A;  1SCR A;  3ZO0 B;  3RS6 A;  1W8H A;  4FFF A;  2LRO A;  3AP6 A;  1C28 A;  4L97 A;  4BM8 A;  4DRV A;  1OOP C;  1O4Z A;  2QUO A;  1SFP A;  3NNF A;  1YIP A;  3T0B A;  1LRH A;  2V5D A;  4Q0U A;  5C71 A;  2W5F A;  1S4C A;  4H55 A;  1HRI 1;  1VRH 1;  3LQC A;  3AKR A;  3ZSM A;  4DO0 A;  3E6C C;  1V9U 2;  2QTW B;  2C4X A;  3HEI A;  1JUH A;  5FKB A;  5FRE A;  2WBK A;  2JIJ A;  3IN9 A;  1AX1 A;  3B00 A;  3SLI A;  5GM0 A;  3C8X A;  3GCX A;  1W6N B;  3VBF A;  2HWD 3;  4JGY C;  3AMQ A;  3NL1 A;  4BMB A;  4EQV A;  1EAH 1;  3WG1 A;  1LEN A;  2WNO A;  3J9S A;  3MEP A;  5HXM A;  2BBV A;  3ZMN A;  2MEV 2;  1LES A;  2V73 A;  4CSW A;  4KWK A;  1JOP A;  1XE0 A;  2XB6 C;  4O9G A;  2QQJ A;  2ZAH A;  1TME 2;  1SBE A;  2XJQ A;  2XVL A;  3O7O A;  4GB3 1;  4IEZ A;  2JG8 A;  1S0J A;  1MPX A;  4BLI A;  2G4I A;  5IWF A;  5IVY A;  3RMY A;  3ZXL A;  4CP1 A;  1LGN A;  1YRZ A;  5JR7 B;  3PMS A;  3CZU A;  1HDK A;  1RUF 3;  1Z78 A;  3P3P A;  5FPL A;  1NT0 A;  3HWJ A;  5FRA A;  2A3Y A;  1UYX A;  4HZF A;  2OII A;  1QOO A;  4LLF A;  4YRD A;  3UES A;  5I0D A;  4QKD A;  3VBS A;  5LEJ A;  4OHX A;  4OUS A;  4UFH A;  3PLQ A;  2A75 A;  2JDN A;  3DF0 A;  1AR9 1;  2BRT A;  5C8C A;  1DHK B;  4IEO A;  5FZ0 A;  1YI9 A;  3OJB A;  3WDY A;  1HN1 A;  5EJZ B;  2RS1 1;  1ULF A;  2ZZQ A;  1G86 A;  2EF6 A;  1UYP A;  2LUW A;  1I6X A;  4XTM A;  5F5C A;  4V2W A;  5ACA 3;  4UFM A;  5ERL A;  4NID A;  1JYX A;  4YVW B;  1VAM A;  3VDB A;  1ONA A;  4ZS2 A;  4P9I A;  4BE3 A;  2ZHM A;  1FPN 1;  1XYP A;  1BBT 3;  4ES9 A;  5ISL A;  4DNY A;  1VAK A;  2P6H A;  3N7L A;  3IDC B;  3RWN A;  3ZYB A;  1AX0 A;  3O1P A;  1RIT A;  1PMI A;  5FZC A;  1REE A;  5C8C C;  2K9Z A;  1SHW B;  3G7D A;  3VBR A;  2Z79 A;  3VL9 A;  2ZGS A;  5IW0 A;  1U5Y A;  1NCQ C;  3Q9O A;  5FQ0 B;  5A33 B;  1K5M B;  4PQ9 A;  5T52 A;  4YVW C;  3W20 A;  4UW3 A;  5DUU A;  1V6O A;  4RS5 B;  5D2A A;  3S0M A;  5HV0 A;  3PJY A;  3V64 A;  4H7M A;  2OVU A;  4FCA A;  3ZXE A;  2R04 2;  3CQO A;  5AC9 2;  1ACC A;  4XFG A;  5FY9 A;  5C9A C;  2GN7 A;  1S2K A;  1XE7 A;  4AVB A;  4QHO A;  3AXD A;  2Y38 A;  4AFC A;  1K5M C;  1RUI 2;  4EYU A;  5A7W B;  4DXS A;  5L7O A;  2VJX A;  5EP9 A;  4NIG A;  4LPL A;  4A7Y A;  1VBD 1;  5FCC A;  1UMI A;  3LSE A;  2WJS A;  1DGL A;  1W2O A;  2EID A;  4CU8 A;  1YQ6 A;  5A7O A;  5A6Z A;  1ZYB A;  2R1B A;  3UNP A;  1E5S A;  4E2Q A;  1AYM 1;  3IIA A;  4KU8 A;  4Q1R A;  5FZL A;  1AR6 1;  2FCT A;  5FKC A;  3N4M A;  2GC0 A;  2WNV C;  2Y0I A;  4GB3 3;  2IWG B;  4IQP A;  2XPJ A;  2BZD A;  1RIN A;  2PXJ A;  1SLB A;  4XF1 A;  2B46 X;  2EIE A;  5BNN B;  4YVS A;  1CWP A;  3MPB A;  4CVU A;  4ZXE A;  4K6B A;  1H8T A;  2QQV A;  4LT5 A;  5I8S A;  1L7Q A;  1JUI A;  5T3N A;  1VBA 3;  1L3J A;  2R07 3;  2QFE A;  3MPP G;  1PZ9 A;  1VMJ A;  2V09 A;  4Q4Y 2;  4EJR A;  2VU9 A;  1AL2 3;  3HAG A;  1UN1 A;  3JB8 A;  5IK4 A;  3GCW A;  3WNX A;  1RUC 3;  5JIA A;  4QQP A;  4D94 A;  3ON7 A;  1XND A;  1BMV 2;  4QPI B;  3PL0 A;  1LOF C;  4H3W A;  1MS4 A;  3D5O A;  3HR9 A;  3I54 A;  4LOS A;  4GJY A;  5JPM B;  1GP4 A;  2D3P A;  5H9Q A;  1A78 A;  1S2B A;  3ILR A;  4GH4 C;  4QX2 A;  2XGX A;  5EXO A;  4S2G A;  4CEW A;  1HB1 A;  3V56 A;  1J3P A;  1MS0 A;  2ADD A;  4KBZ A;  2YG0 A;  4LBJ A;  3MO4 A;  4K8F A;  3IT8 A;  1CGP A;  3F95 A;  2ZMN A;  5BNP A;  3A23 A;  4GWM A;  4MGQ A;  1P8J A;  4LIV A;  2DVG A;  2ZOE B; 
#chains in the Genus database with same CATH homology
 3HNM A;  4M4R A;  1UWW A;  4JKL A;  2Y6H A;  2L9L A;  4CUA A;  4DXT A;  2XON A;  1IQD C;  3WEZ A;  1F4A A;  3MUZ 1;  2VZR A;  3WF3 A;  3VD4 A;  2E32 A;  1XNA A;  2VO5 A;  2WUH A;  3K4A A;  1JU4 A;  3GGL A;  5C70 A;  1UY1 A;  1OH4 A;  2EIB A;  4UAP A;  4JKK A;  4A6O A;  1YQ2 A;  2VCA A;  3VDA A;  3T2O A;  1D7P M;  2VC9 A;  4QPW A;  4P08 A;  5IHR A;  2W87 A;  4ET7 A;  3C7H A;  2B9V A;  4JX0 A;  4W8J A;  2VZ1 A;  2LS6 A;  2R7E B;  4W4Z A;  4DXR A;  2WAA A;  4BK5 A;  1UY2 A;  3ACG A;  4DEQ A;  1GUI A;  3NRU A;  4P02 B;  3AC0 A;  2JDA A;  2XHN A;  3PUI A;  1XC6 A;  2QQN A;  1GNY A;  3A7Q A;  5JUV A;  5JXI A;  5FUI A;  1BHG A;  2B4K A;  3IDA A;  3I2J A;  2PQS A;  3GM8 A;  4BK4 A;  4QB6 A;  3CKH A;  4A41 A;  2W95 A;  1EUU A;  3FHA A;  4M4P A;  1RYY A;  1K45 A;  2VCC A;  3T08 A;  3CIH A;  1JZ4 A;  3SKJ E;  1PX3 A;  5B4X A;  4QX3 A;  3HNB M;  4MAD A;  1OD3 A;  4DUV A;  2HYX A;  1K3I A;  4XZU G;  1NX9 A;  4CU7 A;  2VOT A;  3DYP A;  3VDC A;  4QB2 A;  1W8O A;  2RJ2 A;  1CX1 A;  4MOA A;  4OMD A;  2VZP A;  4E8D A;  2E31 A;  2YC4 A;  3LEI A;  1W9T A;  3ZM8 A;  3ABZ A;  1O8S A;  3GXU A;  1W99 A;  5LCW L;  2QQI A;  1JI6 A;  5IFP A;  1H6Y A;  2VZO A;  1J83 A;  2Y6K A;  2WAB A;  3OGR A;  3A21 A;  5HPO A;  2WO2 A;  2BGO A;  2XQX A;  3WF4 A;  4A42 A;  3VD7 A;  4P5Y A;  4XVH A;  3LPG A;  2WYS A;  2YFU A;  3MV0 1;  2Y6G A;  1UYY A;  4QX0 A;  3NJX A;  1ULO A;  3I2F A;  1CZS A;  3THC A;  5IFT A;  3SKV A;  4AG4 A;  3K75 B;  1W8N A;  2V72 A;  4RYD A;  4ARX A;  3BN6 A;  3P6B A;  2WQ8 A;  2XOM A;  5J1X A;  3IAQ A;  1UY3 A;  2VZV A;  3W5N A;  2VZT A;  4UOJ A;  3LEG A;  4XUR A;  4GZ9 A;  1JZ7 A;  1DYO A;  2ZEY A;  3T09 A;  2VZQ A;  3HJR A;  4BDV B;  5JMO A;  3CZJ A;  3ACI A;  3I3B A;  5DQ0 A;  2BGP A;  3I2H A;  1GMM A;  5A1A A;  3WNK A;  3LEK A;  5B4N A;  2JD9 A;  3WNP A;  2YFZ A;  4ZZ5 A;  3NQH A;  1TG7 A;  1XNT A;  5G05 L;  4ZZ8 A;  2VME A;  2VMD A;  2X05 A;  3LPF A;  5EIY B;  2X09 A;  1NKG A;  3I97 A;  3T0A A;  4E8C A;  2VCB A;  1W0N A;  4ZY9 A;  2VL4 A;  4BXS V;  1KEX A;  3NJV A;  2BBA A;  1CZV A;  2ORX A;  4OMC A;  1H6X A;  1UZ0 A;  1UMH A;  1JU3 A;  2VMF A;  1JYW A;  2ZEW A;  3OEB A;  1W9S A;  3FHQ A;  4JHZ A;  4LHS A;  4TTG A;  1ULP A;  2WDB A;  3E1F 1;  3WQB A;  3WNM A;  2J1T A;  2W3J A;  2VR4 A;  4CUB A;  3OGS A;  1GOF A;  2W1U A;  1KGY A;  2ZEX A;  5JXJ A;  3OGV A;  5DPN A;  1UXZ A;  1UY0 A;  4TXW A;  4XUO A;  2C9K A;  1JZ2 A;  2W9X A;  2OKX A;  3U37 A;  4A3Z A;  3CMG A;  3FL7 A;  1OF3 A;  5G04 L;  4OYU A;  4A44 A;  2Y64 A;  2CDO A;  4D0Q A;  2WN3 A;  2WZE A;  1F4H A;  3WNN A;  1GQP A;  3P1I A;  1O8P A;  4PT6 A;  3VD5 A;  3ETP A;  2VZS A;  1GOH A;  3VD3 A;  4MO3 M;  2ID4 A;  4KI5 M;  3IAP A;  3WNL A;  3I2K A;  2CDP A;  3HN3 A;  1US3 A;  3NNG A;  3OB8 A;  4W50 A;  3HPN A;  1UX7 A;  2J1R A;  4DEV A;  4YPJ A;  2Y8K A;  1GU3 A;  4P00 B;  1UYZ A;  5DMY A;  3WF1 A;  3I3D A;  3F2Z A;  3ACH A;  3GDB A;  2W94 A;  2LW8 A;  1WCQ A;  3ACF A;  4QB1 A;  2BER A;  4DUW A;  3C7F A;  3DYM A;  3EYP A;  1CZT A;  1UXX X;  2J1S A;  2VQT A;  3OBA A;  2RV9 A;  2WO3 A;  4D8M A;  1K12 A;  2JE8 A;  4XUP A;  3HNY M;  5F7U A;  3OEA A;  4CU9 A;  4JKM A;  5EJ1 B;  5C7G A;  3K4Z A;  3MBW A;  1JZ6 A;  2VMC A;  3VD9 A;  2W1Q A;  2QBX A;  4OZO A;  2WO1 A;  3WF2 A;  1US2 A;  3J7H A;  2QQM A;  2DCJ A;  4QDR A;  1W9W A;  4A4A A;  3LE0 A;  3MV1 1;  4FI9 A;  1T2X A;  3K77 A;  1TVG A;  2ZEZ A;  1R64 A;  3A22 A;  4DUX A;  3EB7 A;  2J1V A;  1OT5 A;  4MGS A;  3DEC A;  3C7O A;  3I3E A;  2J22 A;  3T0B A;  1LNS A;  2V5D A;  3I2I A;  5C71 A;  2HLE A;  2W5F A;  2C26 A;  4XUQ A;  1GOG A;  3LQC A;  1JZ8 A;  2E26 A;  2C4X A;  3HEI A;  4QAW A;  2WBK A;  4KMQ A;  4XUT A;  4AAX A;  3C8X A;  3I2G A;  5LA0 A;  3OG2 A;  2W92 A;  2J1U A;  2KD7 A;  4IUG A;  5LA1 A;  2J1E A;  5HXM A;  3T0D A;  1PX4 A;  4PQQ A;  3T2P A;  5IJR A;  2QQJ A;  3THD A;  1L7R A;  2VZ3 A;  3JXS A;  1MPX A;  3D3A A;  5IYY A;  3CZU A;  5JR2 A;  2E33 A;  1JZ3 A;  2W46 A;  1UYX A;  3UES A;  1SG3 A;  5I0D A;  3WF0 A;  1JYN A;  5CYY A;  1XPW A;  3MUY 1;  3UET A;  5JXH A;  4PF1 A;  2DCK A;  4XUN A;  3T2Q A;  1HN1 A;  5EJZ B;  2DDU A;  4KWU A;  2ZXQ A;  3ECQ A;  2J7M A;  2W1W A;  1SDD B;  4BJ0 A;  1JYV A;  1JYX A;  3FN9 A;  1NAE A;  4HG6 B;  3C7G A;  4OUE A;  3VDB A;  2W1S A;  4LKS A;  4CU6 A;  1WKY A;  1CIY A;  4GWI A;  2YC2 A;  1O59 A;  1PMJ X;  3SEE A;  4RN5 A;  1SHW B;  4GWJ A;  1OF4 A;  4QX1 A;  5LA2 A;  3K46 A;  3PUH A;  4A45 A;  2QQK A;  4CUC A;  2VZU A;  2Y6L A;  3CQO A;  2VQU A;  2VM9 A;  5CZK A;  4LQR A;  3BGA A;  2W47 A;  2YB7 A;  2X10 A;  4DXS A;  2ORZ A;  2VJX A;  2J1A A;  5JXG A;  2QQL A;  4QDS A;  3W5M A;  2WN2 A;  4LPL A;  1UMI A;  2EID A;  4CU8 A;  1J84 A;  3K4D A;  2WAO A;  3IB3 A;  3UNP A;  5DN2 A;  3SEP A;  4L0P A;  2VTF A;  2JKX A;  2Z4F A;  2BZD A;  4UI9 L;  2RVA A;  2EIE A;  3HOB A;  2Y6J A;  1DLC A;  4CVU A;  4ZXE A;  2V4V A;  1EUT A;  1UY4 A;  4ARY A;  1L7Q A;  4QDQ A;  1NUK A;  1K42 A;  1DP0 A;  2QQO A;  3CDZ B;  3WNO A;  2WZ8 A;  2W91 A;  1I5P A;  1JHJ A;  4QX2 A;  1PMH X;  3C7E A;  4Z2A A;  2EIC A;  2YG0 A;  3MO4 A;  3DYO A;  3WSO A;  3A23 A;  4MGQ A;  1P8J A;  3III A;  1JZ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...