2YFUA

Cbm62 from clostridium thermocellum xyl5a
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
140
structure length
140
Chain Sequence
SYPKLTGTVIGTQGSWNNIGNTIHKAFDGDLNTFFDGPTANGCWLGLDFGEGVRNVITQIKFCPRSGYEQRMIGGIFQGANKEDFSDAVTLFTITSLPGSGTLTSVDVDNPTGFRYVRYLSPDGSNGNIAELQFFGTPAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Novel, Noncatalytic Carbohydrate-Binding Module Displays Specificity for Galactose-Containing Polysaccharides Through Calcium-Mediated Oligomerization.
pubmed doi rcsb
molecule tags Sugar binding protein
molecule keywords CARBOHYDRATE BINDING FAMILY 6
total genus 32
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2011-04-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2yfuA00
2WAOA 2VZ3A 3WNOA 1UZ0A 2QQKA 3FHAA 2LS6A 3J7HA 2VTFA 4QAWA 1JZ5A 1DLCA 1L7RA 4CU6A 1W99A 3WNMA 4L0PA 4AAXA 2EIEA 2Y8KA 3VDCA 4XUNA 2XOMA 3E1F1 2J22A 3CZUA 5EJZB 4OZOA 4P00B 1W8OA 3VD9A 3NNGA 4GWIA 1CZVA 1GQPA 4P08A 3WF2A 2QQJA 3A23A 2ZEWA 4XUPA 4ZY9A 5JMOA 3DYOA 4ARYA 1JZ6A 5J1XA 1K12A 3A22A 4DEVA 1K3IA 4P5YA 3W5MA 2E26A 2J1TA 2Y6HA 1OT5A 1W9SA 2WN3A 4CVUA 1UXXX 3WF1A 2C4XA 4DEQA 4QX0A 1UYZA 4DUWA 3WEZA 2W87A 3OEBA 2V72A 5B4XA 1RYYA 4A41A 1HN1A 2JE8A 4MGQA 1I5PA 4D0QA 1CIYA 3K4AA 2B9VA 2W91A 1NUKA 1UXZA 3C7FA 2VMEA 1W9WA 1JU4A 2DCJA 5LCWL 3U37A 1UMHA 2W9XA 2VCBA 3I2GA 5JUVA 2B4KA 2VC9A 3IDAA 4PT6A 1L7QA 5JXIA 4LPLA 5DN2A 3T0BA 5C70A 2QBXA 3IAPA 1KEXA 5I0DA 1ULPA 1H6YA 2VM9A 3EYPA 1MPXA 1SDDB 2VJXA 3D3AA 2W94A 1JYWA 2LW8A 3C7GA 4CU8A 4QB6A 4BXSV 3SKVA 4UI9L 2VCAA 2VMFA 4XVHA 3THCA 2BERA 4CUBA 1JHJA 3C7HA 4E8DA 1PX4A 2Z4FA 2WBKA 2J1SA 1F4AA 2YFZA 1XPWA 2HYXA 3HOBA 3T08A 2OKXA 3I3BA 3NJVA 1CZTA 3VD4A 4XUOA 1J83A 1GMMA 2W47A 1W8NA 2J1AA 3BN6A 2JKXA 4PQQA 4RN5A 2VZPA 2W1SA 3MUZ1 3NQHA 2ID4A 2E31A 5LA1A 3CQOA 4TXWA 5IFTA 3PUHA 1BHGA 1JU3A 2J1VA 1TG7A 1JI6A 2RVAA 3K46A 2W1WA 2VCCA 1F4HA 1W0NA 2YC2A 4YPJA 3A7QA 1K45A 2C26A 5DQ0A 3T2PA 4ZZ5A 3SKJE 3I2IA 2VOTA 2WO3A 2V4VA 3WF4A 2X10A 3GXUA 2VMCA 1UY1A 2R7EB 4QB1A 3GM8A 2C9KA 3OEAA 4OMCA 4DXTA 2VZRA 5DPNA 5G05L 2RJ2A 3CKHA 1US3A 3FL7A 1GOGA 2QQMA 3MO4A 4CUCA 2E33A 2KD7A 5IYYA 3UESA 5HPOA 3UNPA 3HN3A 1UMIA 5LA2A 2QQOA 3LEIA 2QQLA 3LPGA 4BDVB 1IQDC 4JKLA 2YB7A 2W1UA 4PF1A 4TTGA 2XONA 4MOAA 1ULOA 3AC0A 1NAEA 3T0AA 2WYSA 1EUTA 4QDRA 5JXJA 5CZKA 4KI5M 1WCQA 2VZVA 2EICA 2J1RA 1US2A 2E32A 2VZUA 4OUEA 5IHRA 1TVGA 2BGPA 5C71A 2WQ8A 5IJRA 3SEPA 1OH4A 4GZ9A 4DXSA 3OGRA 3VD3A 1OD3A 1CX1A 2QQIA 3WSOA 3MBWA 2DDUA 1GU3A 5LA0A 4QX3A 2VZQA 2X09A 4BJ0A 1UY3A 2YC4A 3P6BA 1JZ8A 2V5DA 4XURA 3WNNA 3I2HA 5CYYA 4GWJA 2W5FA 2XQXA 1D7PM 3IAQA 1GOHA 3DYMA 2CDPA 5C7GA 3OGSA 1SG3A 2JD9A 3OBAA 2EIDA 3A21A 3WNKA 1YQ2A 1PX3A 3C7OA 4D8MA 2WDBA 2BZDA 4QDQA 3HEIA 4DUXA 3P1IA 4OMDA 5B4NA 4ET7A 2WAAA 3MV01 3VDBA 1K42A 1SHWB 2Y6GA 3ZM8A 3LQCA 4QX2A 3T2OA 3CMGA 3CZJA 1CZSA 2YG0A 3ABZA 1PMHX 2ORXA 5EIYB 1DP0A 4JHZA 2PQSA 4CUAA 2VMDA 4HG6B 3DYPA 1P8JA 3CIHA 3K77A 2WUHA 3WF3A 2L9LA 2WO2A 1JYXA 4RYDA 2CDOA 2VO5A 2VR4A 1DYOA 3ETPA 4BK5A 4DUVA 4KMQA 2Y6KA 3CDZB 3VD7A 3FHQA 4BK4A 2JDAA 2Y64A 1UY2A 2WABA 3NJXA 4MADA 3I2KA 2J7MA 1GOFA 4QB2A 1JYVA 4P02B 1O8PA 4FI9A 3BGAA 2Y6JA 1UX7A 4W50A 5IFPA 3WQBA 5JXHA 4W8JA 4A6OA 3T09A 1XC6A 2W92A 2W46A 4ZXEA 2VZSA 4M4RA 1JZ3A 3NRUA 1UYYA 2VQUA 5F7UA 4ZZ8A 3ACHA 3W5NA 1OF4A 3OB8A 1WKYA 1JZ7A 4IUGA 1PMJX 4UAPA 3PUIA 4MGSA 4MO3M 4W4ZA 4LHSA 1OF3A 3HPNA 3IIIA 4CU9A 3HNBM 2J1EA 4XUTA 3ACGA 3OG2A 4OYUA 4CU7A 2ZXQA 3LPFA 4LQRA 2DCKA 3C8XA 3SEEA 3LEGA 1UY0A 4UOJA 3VDAA 3MV11 3I2JA 3I3EA 3ACIA 3I3DA 1GUIA 3MUY1 5FUIA 2XHNA 3WF0A 1XNAA 4QPWA 2Y6LA 2VZOA 3I97A 3DECA 1GNYA 3WNPA 2VQTA 1O8SA 2EIBA 5JXGA 4XZUG 5DMYA 2RV9A 4A45A 2W95A 2HLEA 3GGLA 2ORZA 2ZEXA 3HNMA 2W1QA 1JZ4A 5HXMA 1UY4A 1H6XA 2VZ1A 4JKKA 1UYXA 3IB3A 1O59A 4ARXA 3ACFA 2ZEYA 5A1AA 4A42A 4AG4A 1JZ2A 1NKGA 2BBAA 3T2QA 3WNLA 4DXRA 4JKMA 5EJ1B 3EB7A 3FN9A 2VZTA 2BGOA 3F2ZA 4A4AA 2VL4A 1EUUA 4Z2AA 3K4ZA 2WZ8A 3THDA 2WO1A 2X05A 3K75B 4JX0A 4LKSA 5G04L 4XUQA 3K4DA 1W9TA 3VD5A 4A44A 2QQNA 4M4PA 3OGVA 1KGYA 3HNYM 4KWUA 3LEKA 2J1UA 4QDSA 3T0DA 2YFUA 3LE0A 1UWWA 1XNTA 2W3JA 1R64A 3ECQA 1NX9A 3I2FA 4A3ZA 2WZEA 3C7EA 2ZEZA 4QX1A 2WN2A 1J84A 4E8CA 3GDBA 1T2XA 1LNSA 3HJRA 1JYNA 3JXSA 5JR2A 3UETA
chains in the Genus database with same CATH superfamily
1UYPA 3WNOA 1GP6A 1Q5OA 2Y0IA 1DGRA 1UZ0A 2OPWA 4LO4B 3W9AA 4AHXA 5AC93 3DF0A 2UWAA 2HWC3 1LOBA 1WCKA 1DLCA 1L7RA 1RUG1 3OGJA 2UY8A 1W99A 3WNMA 4XJWA 2Y8KA 2J22A 3NNFA 5EJZB 3SCFA 3VZKA 1H8TB 1HJFA 5F5AA 3VD9A 2QVSB 4HONA 1V9U3 1OUSA 3H9AA 2ZEWA 3I59B 3PMSA 4LTAA 4ZY9A 2LALA 5JMOA 1JN2P 5CVRA 1JZ6A 1G9BA 3RS6A 4HVOA 4X8PA 2ZBJA 3ZYJB 1ZZ8A 2WJSA 5IVFA 1RTVA 3W5MA 4UW5A 3AMHA 4BXFA 1AZDA 1HRI3 2E26A 1GBGA 4RGGA 1W39A 1STMA 2Y6HA 2R32A 5EJ3A 5KHGA 3KF5A 3NO8A 1D4M3 4QT6A 3RSJA 3AYAA 3DUIA 3AZWA 4DEQA 3RDIA 2CGPA 2R061 4TN7A 3UJQA 2WFF3 3G7DA 3ZXAC 3S5AA 2CAUA 3N35A 3AYCA 3NV3A 1UU5A 5BNOA 4AVSA 3DPRB 3MEPA 3BCWA 3PUQA 4JGZC 3ZFFB 4A41A 3LIGA 4OI0A 2QQPA 2JDYA 3KZ4C 2WNOA 4N9IA 5FLIA 4R9CA 4UBHA 4F83A 2BWAA 5A7QA 5L19A 3K4AA 3IDEA 2B9VA 4PBPA 2ZX3A 1VRH3 4YVWC 3QH7A 1F35A 1HXS3 1OA3A 1NUKA 3S7IA 3C7FA 3R4SA 3ETQA 1AL21 1JU4A 1SCRA 2HEVF 3SQOA 2GC3A 3FLPA 4I0BA 4NPRA 3KD4A 2D6MA 4GD4A 4IEUA 5L7OB 1UMHA 3DV8A 3EXUA 5A3OA 1QJU3 4KBZA 4QHBA 2W52A 5JOZA 1OPMA 3Q8CA 3PLQA 5FWEA 5JXIA 5DN2A 3ZIXA 3T0BA 5C70A 2R49A 1YFUA 3KWVA 3IAPA 3H8OA 2D98A 3AM2A 4COVA 2MHFA 3C2UA 1H6YA 1UNBA 2A6XA 1CN1A 1Y3TA 5FAXA 1BMV1 4DZGA 1UIKA 1OQEA 5FPAA 3RJ2X 3AJYA 5T5LA 1W3VA 2H6CA 1BZWA 5C6CA 1IHMA 1NY71 2HWB3 4Q8LA 4CU8A 1E5HA 1KXGA 5FY4A 1Y43B 2JE9A 3WDYA 1O3RA 3WUCA 1QDCA 3ZYIB 4IW3A 4XILA 4XVHA 3R6SA 2BERA 2GP5A 4QPIA 5D8AA 1A34A 4YG6A 2YU2A 4N90A 1AYM1 4X6RB 4E8DA 1W2UA 1VBD2 4HK8A 5K7PA 1GANA 2E7TA 3JBG2 2ZPXA 1ULGA 2J1SA 4WM8C 4Q5OA 3VBOA 1BXHA 1U5YA 5FY0A 4EN7B 4P14A 5SV5A 4LEJA 2QTWB 5I8YA 3ZFGA 1XPWA 2KA3A 1QWRA 4Y26A 4LT5A 3PVOA 3UJOA 3M3EA 1TNFA 3NJVA 3FBYA 1FPN1 4JGYC 3O1OA 5FLHA 2JECA 5HV0A 1UZWA 2WFF2 3VKFC 3WP5A 3PTYA 4AVBA 1OVPA 5JZGB 2JKXA 3POIA 1GSLA 4QPIB 2GU9A 1YJLA 3C3VA 5D8AB 1ND2B 3ACLA 1GLHA 2RG4A 4Y1VA 4IEYA 2XDVA 3WT3A 4CP0A 5JIUA 2CYFA 2BOIA 5FIXA 3W59A 2E31A 5LA1A 5CB7A 5IFTA 1J3QA 2Y60A 3PUHA 1BHGA 1MQTA 5L73A 1ASJ1 2G9ZA 5T3NA 2RHPA 2RM23 2SBAA 3VGIA 2ET1A 1OOPB 1K5MC 1Z7S1 4FO9A 4ITCA 3ZFEC 1F4HA 1W0NA 3A7QA 2C26A 4CDWA 1WW4A 2HBUA 1AYN1 2OS2A 4CEYC 3RZMA 3POEA 3PURA 5AC91 3MYXA 3OPTA 2VOTA 1YQ6A 2GNMA 3TEYA 2V4VA 1QU0A 3BU0A 1H4GA 3MIFA 1XRUA 3JB4C 4FFHA 4RR3C 2WZPP 1AR61 4QB1A 1UPIA 4N43B 3VBRC 5JWPA 2RJKA 3RJRA 2GNTA 1VRH1 2C9KA 4CEYA 3LCPA 4NIIA 1GV9A 4N7UA 5C9AC 5DPNA 3NAPA 1LOEA 5EPAA 4C91A 2DVAA 5F3CA 2ARAA 3CKHA 2VGDA 1W0PA 2Q0AA 3D8CA 3FL7A 4KGGA 5E89A 3SH3A 2QQMA 1R1A3 1VR3A 1W8FA 2VMHA 3BPZA 5FYBA 4R4ZA 5BPXA 4HN0A 2KD7A 4AVTA 2D7FA 3QLQA 4AQSA 5FJHA 5HPOA 2JXAA 3UV9A 4CCLA 4EZ4A 3T2TA 4A7YA 4EWEA 3LEIA 1LHUA 1QHDA 3PVEA 2QQLA 1R083 1T6GC 3H3UA 3HQUA 4Q4W3 5I0UA 5L9BA 4AHWA 4JKLA 2WLQA 1OQDA 3J7NA 1PNFA 3N9NA 1W05A 1EY2A 2B45X 3RMYA 1RIRA 1K5MB 3ME2A 2JD4A 3N7LA 2JB4A 3E5QA 3WD5A 1FV2A 4QDRA 5FXXA 5FFOC 3KV4A 4CA9A 4DPNA 3GZAA 4E4HA 5IVBA 4FXGB 3N4MA 1TME1 1C57A 2OT7A 5KWRA 2VZVA 1AL23 1SBEA 3J4UH 4MG2A 5FZHA 3KM5A 4HFSA 4Q4Y2 5DDJ1 4BYYA 3RVHA 1PVC1 1XYOA 2CWMA 2G1MA 5CFDA 5FZ9A 5C9AB 1DYKA 4XIKA 4AF9A 5GALA 2ZGLA 1OHFA 4CEWA 1UU6A 5F3GA 4B4QA 4C1XA 1Q8VA 2YUEA 4LA3A 2GC2A 4LOTA 3B9CA 2G4IA 3ZR5A 3JCIA 3WW1A 3AJZA 4L9BA 1SEFA 4LHKA 3MBWA 5DAXA 2EXJA 1BCXA 4YG0A 1IS4A 3HVDA 3HBZA 4QX3A 1NCRA 5CKMA 2BNNA 4BJ0A 1UY3A 2IVJA 5L9VA 1XOYA 2PELA 2H0VA 4KWKA 1JZ8A 2V5DA 3ZYBA 4E4SA 3OBZA 3NV1A 5L7OA 1GZCA 3I2HA 4Y5Z0 1EYBA 5CYYA 1GR3A 1WWYA 2P6CA 1D7PM 4RQPB 1J1TA 3IAQA 1QH6A 3DYMA 2C9AA 2A70A 3MIGA 1RUF1 2CDPA 3GF6A 4CTEA 1WW7A 5L36A 2V4AA 2V09A 3OGSA 2JD9A 4EWAA 4F3JA 1NCQA 2EIDA 4P9JA 1RUC1 1PX3A 4OUMA 3ELNA 5DAWA 1LHWA 1B35A 5F5QA 3WP4A 1V6JA 1VBA3 4YGBA 2A6ZA 1MZ5A 2VXRA 2DUQA 2BZDA 2WWJA 5FY7A 2NQYA 1RXGA 2VUCA 4L2NA 2OA2A 5CFDB 1SLIA 3V0BA 4OMDA 3AP5A 4AR2A 1RVF2 4E2GA 3ATGA 3VHOA 2FD8A 4YNIA 3I7DA 2WAAA 4GJZA 1K42A 3B5LB 4NAMA 3AB0A 3ZM8A 3LQCA 3T2OA 3CMGA 3CZJA 3POGA 4YFWA 5I0RA 2CGOA 3KB5A 4QWNA 5FQ0A 3VBUC 4CP9A 2P6HA 5LBFA 1A6CA 1W06A 4R9BA 2JDUA 2FDJA 1I3HA 1AL0G 1DGWA 3Q8FA 2P3YA 2YZ4A 4IERA 5FY1A 4LKEA 4I0AA 4Q8KA 2B46X 1J59A 4PDWA 3WLUA 2PN5A 3BOWA 3ZYRA 2CAVA 4XJ9A 1IKPA 2L9LA 4RYDA 3USSA 1R092 2RR13 1X7NA 4DUVA 1W6NB 5GZCA 4KMQA 2RS53 4LIVA 3Q8AA 3CDZB 2WSUA 2Q8DA 2XJTA 2JDKA 1ZRIA 2LTNA 1HIXA 3K3NA 4ZU5A 5IWFA 4HL0A 5JCTA 2QCSB 2Y64A 1XE0A 5CISA 4FAGA 3RYPA 3O0XA 1W6MA 4S2FA 3RPQA 5FYTA 5KBFA 4N43C 1MZEA 1IS6A 2Y33A 4P02B 2RR11 1V6KA 1O4YA 4M0NA 3AKQA 1DZQA 1RUE1 1CESA 1J1LA 5GLUA 3TEXA 1QQP3 2JX9A 2IUWA 5FZ1A 4CDQB 4LK6A 1OH3A 2GALA 1PGL1 1SZBA 3O1RA 1XE7A 4IE5A 4O9EA 1ZRDA 1Z7S2 1OOPC 2VZSA 3Q9OA 4M4RA 3ZN6A 1XB9A 2BRTA 1V6OA 4K40A 1TMF3 1SFPA 5LATA 5C9AA 5LBEA 3NRUA 4YG3A 1C5HA 4Y5TA 5A7OA 5CFCA 3SITA 4CDUB 3KGZA 3ACHA 3MICA 3KHBA 3NSTA 2R071 4QXKA 4ZZ8A 2RM22 3OY8A 4AHZA 3NNMA 1IKQA 1PMJX 1SFNA 4P9XA 4K7JA 4OHWA 1G86A 5LY2A 1OSGA 4LHSA 1PK6A 4GAZA 4XFHA 1MEC2 1TMF1 2JDZA 4QQHA 4LHNA 4CU9A 5J09A 2A73B 4HSLA 2FCVA 2QDRA 5FK8A 4WM7A 1DQ1A 4URTA 2D6LX 4OQ9A 1SLCA 4NN0A 3SNMA 1XQNA 3OG2A 4OYUA 1QH7A 3AKSA 5LRRA 2DCKA 3FC0A 1LRHA 4XBLA 2P17A 4QXHA 1NXMA 4IXLA 3AYEA 1SACA 2VBPA 1IPKA 1AYM2 3LEGA 1KQRA 1N1TA 1Y9QA 1PZ9A 2ZX0A 2AR6A 4MGZE 4NRPA 3AL6A 4XCAA 4CCJA 4FBFA 1JOPA 4XBNA 5FUIA 3O1SA 3R05A 3S57A 2ZGTA 1COV3 1Q43A 2IXIA 3WF0A 2WFF1 3ZN5A 2VE1A 1WBLA 1FXZA 3WW2A 3LZZA 4AFMA 1QXRA 3M3CA 2HWE1 1JODA 1RJ7A 4RQPA 5LWBA 5JOXA 2GNDA 4LA2A 1F5JA 4I0WB 2P5BA 4XPVA 1OLMA 3V0AA 4CSWA 4FTBA 1HLCA 3S5QA 1W0OA 2CWSA 1MS9A 1RUC2 4HVRA 1LU1A 4AK3A 2ORZA 4WVZA 1H2NA 2TEPA 5AFEA 5ANQA 3FBMA 1K5JA 2WINB 2A6WA 4HPKA 4NMIA 3FLTA 5JSOA 3H1YA 5F32A 2P3IA 3LIHA 4LUMA 4HKOA 5GLTA 4ARXA 4KQ7A 3U11A 3FHIB 4QHZA 4A42A 4AG4A 5ABJC 4LOSA 2BBAA 4AGRA 2DVBA 1O3TA 5FZ4A 1PM4A 4MX3A 4DXRA 1NQJA 1YEWA 5EJ1B 1CAXA 3AZXA 2VZTA 5A6QA 3SLIA 5BNOB 5CAZA 1JBCA 1RXFA 2WNEA 3CO2A 4A4AA 2ZOEB 4YW5A 4Q4V2 4DINB 5FCCA 1RUF3 4BPZA 2RS32 2IXHA 2WO1A 1G6NA 1YQ8A 3QCWA 5FJKA 3S0MA 1AR71 3IDBB 1PVXA 4GH4B 3SC7X 3K75B 4B8EA 3MIDA 4ES9A 2WA4A 3WVJA 2XGXA 5E6HA 3T4HB 3LFIA 4CXXA 2ARXA 1V6MA 4LO8A 1AXYA 3VD5A 1RUD1 4A44A 1PO13 2QQNA 2XWJB 3JUUA 1BBT1 1OPOA 5FWJA 5H9QA 3U75A 4DS0A 3O7OA 5JVVA 2Q8OA 2A3XA 5FZCA 4EN9B 3UT0A 3ILRA 3H1WA 2W3JA 4QPGC 3VBSB 3WQ0A 3D4KA 3IKWA 3MF9A 3GBGA 3ECQA 3V65A 4NPLA 4Y4RA 1EAH3 3I2FA 2ZEZA 4QX1A 1MVQA 1KD7A 2HYKA 2Z2SB 3E97A 1F5FA 2VVFA 1J84A 3SMHA 4E8CA 1LGBA 2NMNA 2CHHA 3JXSA 3HN1A 4CUCA 2WAOA 1MZ6A 2JG8B 4QKDA 1O91A 1Z0HA 2QQKA 3GBWA 5FZIA 3APBA 2LS6A 1MS0A 1N3OA 3I4IA 3H7JA 3V56A 1JZ5A 3CJIB 2HWF2 2PMWB 3KF3A 4XQWA 2HWB2 5EXOA 2RMU3 4AAXA 2RE9A 4GJYA 4QQPA 3VDCA 5BNPA 3ZO0B 4XUNA 2GSYA 2XOMA 3E1F1 1ZBE1 1PIV3 2D3SA 3M3IA 1RUJ2 2RDRA 4P00B 2VG9A 3NNGA 1PMIA 1CZVA 2YROA 2D6OX 5GLZA 3WF2A 1KS4A 4BQWA 2LRPA 1QJY2 3A23A 3BTAA 1W6OB 1D2QA 3DYOA 5JAXA 1KDMA 1ZRRA 1SLAA 4GULA 1K12A 3A22A 4NR1A 4AEMA 4P9WA 4P5YA 1HB1A 2E9QA 5C8WA 3H50A 1WUVA 1LKNA 1OT5A 3VDDA 4BQ1A 4EZHA 2ZJCA 4AAPA 4QPGB 4CVUA 1BBT3 2DVDA 3WF1A 2O1QA 4O7XA 2UU8A 1NCQC 1UYZA 5J96B 4ORFA 3WXPA 1L3JA 2A3YA 3OCPA 2YXSA 2QE3A 3PJQA 5FK7A 3DXUA 2QQVA 3OEBA 3WQ7A 1YLLA 1RYYA 4AFAA 4I01A 3E5XA 5GKAC 4BMEA 4N7IA 3MLJA 3TEWA 1DBNA 3AL5A 4C8DA 4MGQA 1I5PA 1MVEA 5EFUA 1CIYA 4LLFA 4LO6B 4OI4A 4MGKE 3WUDA 1H1IA 1WD3A 4XOGA 4TYSA 3ZPYA 1JW6A 2W91A 4XJAA 2R1BA 2VMEA 3VZJA 3RQ0A 2EXIA 3ENRA 3ZN6B 5A6ZA 1GZWB 3BB6A 2XBO1 4XFIA 3U37A 2AH2A 3PUSA 4ZU7A 3SH4A 4CPBA 2VCBA 3I2GA 3AVSA 5FZEA 2TNFA 5JUVA 4CEWC 4LE4A 2W0XA 4PT6A 1HXS1 2P37A 4AGGA 1SCSA 4P9LA 1GP5A 1UD1A 4FFGA 5F1RA 5F3EA 3VZLA 3NMBA 5A3UA 1UKRA 5A1FA 3RG0A 4YVSC 1ULPA 1GYKA 2PTMA 2DURA 1IPSA 2H6BA 2JJ6A 4PIYA 5K9YA 2HWD3 5JI7A 3EYPA 1E5SA 1ZZ6A 3ROUA 3HIFA 2W94A 1NA1B 1JYWA 1S0IA 2JKBA 3C7GA 4META 5IVYA 4YARA 1O3QA 1QDOA 1O7FA 1RINA 1YXWA 2VAUA 4LBNA 3SKVA 1UO9A 1DIWA 1WMEA 4MHUA 2WRAA 5T5OA 1WA6X 1VRBA 4N9HA 2VCAA 1KDKA 1W6PA 4KG0A 3WW4A 3B93A 1JHJA 3WCRA 3L2YA 1E57A 2O0OA 2XG3A 3BUCA 1OA4A 1VBB1 5FP7A 3C7HA 2XLGA 4YGEA 3U0ZA 2Y6FA 1VAMA 1FMD1 2XHKA 1ZZCA 2Z4FA 4Q4Y3 3LGRA 4FPHA 4ISRA 3ES1A 2XJQA 3CEWA 4XIOA 2ZGSA 3OUHA 4AOCA 4FAHA 1KJLA 1CONA 4JCKA 3ILFA 2HYXA 2ATFA 2X53S 4P9IA 1HW5A 4UFMA 2WC2A 1MS8A 3B9IA 5DZGA 3QOPA 4COWA 1W6QA 2NZ9A 3I3BA 1W2AX 2Q1MA 1UW8A 3B01A 2QQUA 2C1FA 3VBHC 2C0ZA 5BXXA 1XYPA 1IG0A 5FP3A 4RS5C 1W8NA 2XXZA 3R4UA 2UYBA 1VBE1 2BQPA 3LB9A 1HRV1 1Y9MA 3KMHA 1UOGA 2B7YA 2C6SA 2YBPA 2VNVA 1RVF1 2W1SA 2CU5A 2AGSA 3GZEA 2HWD1 3HWJA 1C4RA 2PHTA 3JB8A 5I8TA 3WV6A 5KHJA 1QNYA 4IE6A 2AYHA 2HH9A 2JDMA 4IV3C 1XNKA 5LK5A 3O1UA 1JHNA 5FP9A 2AC1A 5JIAA 2ID4A 1W6OA 4TXWA 4NWWA 5GLVA 1JU3A 2J1VA 2R0FA 1TG7A 3ZOIA 2VULA 5LBCA 4DRRA 2E53A 2OUHA 3N7JA 1AUYA 1W6NA 2W1WA 3WCSA 5J36A 2F17A 1CPMA 2JG9C 3MIHA 1QQP1 2VXJA 4KNCA 3SKJE 4YZ2A 5A3TA 3I2IA 4XF9A 2XJUA 4BQ3A 4EJRA 5LEJA 3VBOC 5JPMB 1B09A 5EHDA 2HKXA 1CWPA 3HQRA 2X10A 1POV3 4JQTA 2HWC2 1UY1A 1CIWA 1FOD3 2R7EB 4RHV1 1AR93 3KQ4B 4GALA 5CKQA 2E7QA 3OEAA 1S2BA 4OMCA 1AYN3 2G9FA 1V00A 3LWCA 4IV1B 5G05L 5I91A 3LAGA 2Y0OA 3NAPB 2BNMA 2RJ2A 2OQ6A 5LB6A 4AVVA 1J3PA 1GQHA 5J98B 1ACCA 1HKDA 3MO4A 1D0GA 5ERLA 4WZCA 2FDGA 2VBBA 4NWVA 4OZXA 4BWOA 4JRLA 4BLIA 1OMIA 1QKQA 2X29A 2RS52 4IGOA 2K0GA 4O9GA 5T55A 1CAVA 4U36A 2OZ6A 2XPJA 4JRAA 1UX6A 1VBC1 4E9KA 2ZS6B 5FPBA 5GLWA 3M4FA 4XHBA 3ZMNA 1BK0A 1W8WA 4IEZA 3RYKA 3GBFA 4MXWA 4LBMA 3T4VA 1RUJ3 1IQDC 3B69A 1O5UA 3DCQA 1F15A 4RA0A 4WVMA 3E6CC 1Q3EA 2R1DA 2WNVA 2W1UA 1OLQA 3TEZA 1CJPA 1NE6A 4HANA 4PF1A 5IK8A 4TTGA 2R062 4MOAA 2HWB1 1ULOA 1ASJ3 1NAEA 2WYSA 1EUTA 4AI1A 4IGQA 1VMHA 1GWKA 1OLME 5DXDA 3ORJA 5JXJA 1MEC1 1TMF2 4KI5M 5FYCA 3BIWE 1UZZA 5JDBA 2E32A 2P2KA 2VZUA 4OUEA 4EE2A 3LSEA 2YDEA 3B3QE 3IPVB 2JIJA 5FO9B 2VY0A 5IJRA 1FOD1 1OH4A 4AI8A 2IXCA 4GZ9A 3ZLIA 2ES3A 2LUWA 3OGRA 5A70A 1RHI2 4DO0A 4ZS2A 2QQIA 1Q8QA 5EWSA 5HV4A 1MS4A 2V73A 2DDUA 5K4LA 4UXAA 5KHHA 5EYXA 4W65A 3I3QA 5FZLA 4FPOB 5ISLA 2X09A 3V0AB 3WDUA 1IPJA 1RUH1 3TNQA 4INDA 5IVCA 1FT9A 1QJZA 4XF0A 3KT1A 3WNNA 5A32A 1JYIA 1ZBA3 3M1HA 3WHUA 4AI3A 5HCAA 1NQDA 2W5FA 2E63A 3CHXA 1U0AA 1W04A 3RI8A 2GH2A 3KVAA 4MZUA 1LTEA 1COV1 3POYA 1LULA 2WSVA 1UOBA 2RDQA 1RC6A 4B4RA 1SG3A 3OBAA 2XBO2 4LMFA 2HWE3 3JZVA 4M01A 4WM7C 4NO4A 1NT0A 1AF9A 3ZDSA 4UF0A 4EN6B 5CKNA 4FPLA 4K21A 3HEIA 2PLV2 1S0JA 3MFAA 3R4DB 1WCUA 1VIWB 2VQ0A 2OPKA 1FMD3 4Z82A 2PXJA 2DU1A 2BFUL 4RSUA 3RZLA 2CTVA 4PHZA 3TN92 1GWMA 1XYNA 5C5TA 3KV9A 3JBG3 1M06G 2E7AA 1LHNA 1CZSA 4HSJA 4GH4A 3OF1A 4Y24A 3ZSLA 4CCCA 4Y5SA 1QXPA 3S6PA 3SXWA 4AVCA 1NA1C 5FQ0B 3POFA 2ILMA 2XQRA 4OCTA 1WD4A 2GH8A 4LHLA 4SBVA 4Z8BA 1OFNA 5FO8B 1U5XA 3BIEA 3NNJA 4AE2A 4CUAA 2VMDA 1LOCA 1MR5A 4HG6B 1AR91 2XR4A 4GWMA 4MYEA 3DYPA 4JGYA 3NJYA 1NCRC 2ERFA 2GC0A 2D3PA 4XJUA 3VBRB 3VDDC 3CIHA 3K77A 2WUHA 3VBSA 5DG1A 1OBNA 1VBE3 4WV8A 1JXNA 4ZPIA 1KJRA 1DYOA 2RS11 3ETPA 5EQUA 1H2KA 3J9SA 3RZZA 1RUG3 1LOFC 1RUH3 2PA7A 4KU7A 1QGLA 1NY72 5FYHA 2BWCA 3K2OA 4TZDA 1N47A 3ZYHA 4RS5B 1WA4A 1BQPA 2Q5TA 2WA3A 1U5ZA 3NJXA 4BA6A 1YCIA 1BEV1 3FE5A 2VVDA 3DPRA 2QKDA 1RUD3 5IAVA 4FI9A 2VOWA 3N9QA 1LOFA 5A6XA 5KR7A 2FDHA 1UX7A 5CBLA 1G9CA 1GNZA 1X33A 2VW1A 1C8NA 2ZMKA 4CDQA 2X5IC 4LJHA 3NKTA 4D6SA 5JXHA 1O3SA 4A6OA 5FMBA 1XC6A 2NMOA 1APNA 5A3NA 2DTWA 3T1LA 3U10A 3I49A 2B5HA 2FHRA 1JZ3A 1UYYA 3OBTA 5ACA3 4M3CA 2VQUA 1AVBA 4FCAA 4LO7A 4XXPA 1HRV2 1OF4A 5E1RA 4YWAA 3J8F3 4DB5A 3VHPA 4UFLA 4UAPA 4MHRA 4MGSA 1RUOA 1YC61 4MO3M 4H55A 2QNKA 3GJBA 3FJSA 4BHPA 1OF3A 3AMNA 4WVVA 1UL9A 3SISA 2YYOA 4J6GA 4JGZA 3HPNA 2Q8CA 1C8M3 3IIIA 2HWF3 1Y4WA 5A3MA 5FZGA 5JLVA 3OYWB 4KWJA 1REFA 1ZBE3 2BFUS 1W2NA 1YWKA 1HJGA 2RMU2 1XSQA 2ZX4A 3ACGA 5F9TA 1WLCA 1S0EA 2F6BA 2PHDA 2ZXQA 4Q4X3 1AHSA 3LPFA 4CXWA 3AP9A 2XBO3 2RS13 1RJ8A 4JVAA 2PHFA 1I9RA 5FY5A 3SEEA 3POJA 4YFZA 1AYN2 4AYUA 3PDQA 1NXD1 1UMZA 2BPA2 2VCMA 1QJU1 2G19A 5KHKA 3VBFA 3U07A 4Q4W2 4DQAA 5HXVA 4Q0VA 2VMGA 5CADA 5CNAA 1FMD2 4UF0B 4OFGA 4BZ4A 2XUMA 5J37A 2BNOA 4Q0SA 3MV11 4NOTA 2XVGA 4JV4A 4QHOA 4R9AA 3MUY1 1GUIA 5LBBA 4RFT0 5A7PA 5HBAA 2XHNA 5K0UA 3WP6A 1C3HA 2VNOA 2ADDA 2Y38A 4L8QA 2ZX1A 1XNAA 5A7WA 4QPWA 5C3PA 1ZA4A 2Y6LA 5BNOC 3NNLA 3LDBA 1GNYA 4I3GA 1HN0A 4BQ5A 1O8SA 2EIBA 5JXGA 4XZUG 5CG9A 5IK7A 1YIPA 3BVCA 4MGIE 3RZGA 1SPPA 1EP0A 2ZGRA 3VL9A 1EAH1 4QMAA 1LU2A 2EXKA 4A45A 1VBC2 1TZOA 2EVXA 1VBD1 2JDPA 2PAMA 1W6MB 1ASJ2 1W28A 3JBG1 4LBLA 1F8VA 2XJRA 1G9FA 3J8F1 3HNMA 5FPVA 3GZTB 1ENSA 3GCWA 1CPNA 3HAGA 1H6XA 2IVIB 2MPFA 5KXBA 2D43A 4HN1A 2V5YA 4HKLA 3KCYA 3VBFB 2K9ZA 4ASKA 5K8SA 1O59A 3VUOA 1WMDA 1W8TA 5FYVA 4NROA 1W2OA 5FKCA 1V6NA 1OKOA 1W8UA 3E6BA 5LY1A 4DRVA 4ISQA 1HV1A 4P9GA 3VLBB 5IVVA 1PO23 1V70A 1ZYBA 5FYSA 3EB7A 3FN9A 1CAVB 1WMXA 2QDNA 3VKLA 3D0JA 4QX5A 1EUUA 2D97A 1PM7A 3K4ZA 2WZ8A 1YFYA 1EV13 4Q2FA 1O4ZA 5FYYA 4E2QA 2ZGPA 1C28A 3I8TA 5CFCC 2Z42A 2Z5WA 4QQLA 2AACA 3QH6A 1DQ5A 1VBA1 1CGPA 3ZXFA 4LLOA 4WVMB 4XUQA 1LESA 2EXHA 3K4DA 1RMU3 1OKQA 2WO7A 4DFSA 4C90A 3VKMA 4M4PA 3IDCB 3OGVA 2D3RA 1GZWA 3HNYM 4M3CB 5FZOB 5C3OA 4CYDA 1JMUB 1RVF3 4FQ4A 3I59A 4GA9A 3LE0A 3U78A 1WLTA 1XNTA 3BTXA 3VB9A 4YW1A 1R64A 1FI2A 2Q1FA 4Z2WA 3RZHA 3OD4A 1Q8PA 5DAVA 3K48A 5AC92 1YFXA 2WZEA 4L92A 3ZFGB 3C7EA 5IAXA 2BBVA 4L99A 4AQTA 1VP6A 3G6JB 3HJRA 1JYNA 4M00A 3O14A 3P5BA 1WBFA 5IVEA 3EBRA 3UETA 2VZ3A 1XU2A 4Q1PA 3VBFC 5KHIA 3RMXA 2PAKA 3FHAA 3NJZA 5H9PA 4CDXB 2UYAA 4HKWA 1XXNA 4UFJA 2P3JA 3LD8A 4DY3A 1H30A 1A8MA 4Z07A 1IZ3A 4XDQA 3RGBA 4WZFA 1WW6A 5AVAA 3O5SA 4BOWA 3ZSKA 4FFIA 5K0UC 4JDNA 2JWPA 5FBZA 4GXLA 4XZPA 4Y4YA 5TSWA 3CZUA 1PO21 4RR3A 1S1AA 2XKPA 3N7KA 3PIGA 2VBDA 1W8OA 4OZOA 4B29A 4GWIA 4P08A 2QQJA 5EIYB 1X9PA 4CDUA 2R6QA 1IG3A 4XUPA 1CD3G 3VZOA 2UWCA 4ARYA 4N53A 1IS3A 1H2LA 4M0HA 1K3IA 1BKZA 1PIV1 5GZFA 1R093 1QQP2 2JENA 2RR12 1VBC3 4QX8A 4AXOA 5FR3A 2J1TA 5F39A 4ONUA 3LSDA 4YW4A 4PLOA 1W9SA 4UW4A 2WN3A 5FZKA 5LASA 3PVNA 5DABA 3TBDA 1UXXX 4NIHA 2C4XA 5FPXA 4ZHNA 1R081 2F4PA 2NM1A 2O14A 3DGTA 5FZBA 3IMMA 3FLRA 2W87A 4YZ4A 4FPCA 4LBQB 3KLSA 2ZHLA 1QF3A 1DQ4A 4YVSB 2QJVA 2V72A 1GFF2 3UKNA 4QQOA 1D4M2 1VRH2 1LODA 1AXKA 3RZJA 5A7SA 1GZTA 4D0QA 3P3PA 5JZGC 2BGCA 1HDKA 3LF7A 1BEV2 4FPKA 2ZMNA 4QPIC 5D8AC 5FZ7A 2VVEA 5CG8A 5FMCA 2EIGA 5I0SA 2DCJA 5JPNB 1DGLA 3J7LA 5HCFA 1MZFA 5JOYA 1RHI1 1D0HA 2ZGKA 4CZSA 1R1A1 4CPBD 2B4KA 3IDAA 2RMU1 1X82A 4CCNA 3VKNA 1L7LA 4LR4A 4CEYB 1UZVA 1L7QA 1V6LA 5BNNB 3CBNA 2HBTA 2QBXA 3KT4A 5FZDA 4JGZB 1WLDA 3CNAA 3N36A 2R0HA 3AP6A 1HQNA 3CU7A 1WMFA 3GZUC 3V0BB 1COV2 2YGLA 1XBFA 2RS12 1MPXA 1SDDB 4XE9A 3V64A 3ZXJA 4NUBA 1A3KA 2E6VA 1URXA 1HRI1 2ZKLA 1ND2C 1VB4A 5FMOS 1AR92 4FT8A 4CCDA 2O8OA 2VOVA 5FMDA 4QB6A 4K9SA 4BXSV 2DTYA 4S2DA 3MW3A 2RM21 4K8FA 4QGNA 4UI9L 1AX1A 1VBD3 4ES8A 5KC5A 2N7GA 2VMFA 3O1TA 5H9SA 4KL1A 2ZAHA 4XACA 2D5HA 3ZFEB 1ND2A 1W8HA 4Q29A 3USUB 1LGNA 5BYNA 1EPWA 2C5DA 2G9GA 1CX4A 3DEMA 4E2SA 4G3YC 4AEDA 1YUDA 1KFXL 1SLLA 2IC1A 4XABA 1YNAA 3VL8A 3IM0A 3PNAA 1F4AA 5FP4A 1DCSA 2EA7A 4COUA 1HQLA 1SPPB 3B7MA 2J42A 3T08A 3HOBA 1I5ZA 5D21A 2ZACA 3POWA 2PHWA 1CZTA 2VW0A 4UW3A 4FSJA 1RUF2 4XYXA 1AX0A 4XUOA 3DKQA 1JS9A 4XF4A 3WOGA 3ZFGC 5LW9A 1GMMA 3GJAA 3H7YA 3A4UA 2W39A 2XJVA 1OXCA 3CLPA 2VTXJ 5FOBB 4KH9A 4P9YA 1AR72 1CAUB 2PHXA 2PLV1 2BJSA 1O4TA 2WYFA 1JH5A 3BN6A 3HT2A 3I2DA 4LUKA 4PQQA 4CDWC 4URAA 2QFEA 4CDUC 5KXCA 4V2WA 4YGCA 3ZFEA 2JIGA 1VMFA 3MUZ1 2PHRA 4WM8B 4MSVA 3DKWA 3NQHA 4AVAA 4B1MA 3CQOA 2XLFA 3CJIA 2IFRA 2OZJA 4FTSA 4GQ7A 4BB3A 1F9KA 3SHRA 2A3WA 2TBVA 1W03A 2PLV3 3LA2A 2WFPA 2BU9A 4YPJA 4QKBA 3PMEA 1NCQB 5DQ0A 5FUPA 3T1MA 4ZZ5A 2CL2A 3AP4A 4XFGA 2A5ZA 2RS33 2ZGNA 1PO12 2WO3A 4HLTA 4NRMA 5D1IA 4LBQA 2XJSA 2DUOA 3D6EA 4UYBA 4X6QB 3GM8A 1ULCA 5I0TA 2B8MA 3WDXA 5BNPC 3KCCA 1N1SA 3WG1A 2VZRA 5CU1A 2XMLA 2ENRA 3IT8A 4OHXA 3RRDA 4QPGA 2DCYA 2WS93 3A0KA 2WNVC 1US3A 2HWE2 3QACA 4H7MA 4JZRA 2E33A 3D5OA 4Y1XA 3LEMA 2Q30A 4YW2A 2P4EA 3OUIA 3NL1A 4AQ6A 3UESA 1EAH2 4CUGA 4CEWB 1DG6A 1RL3A 4K20A 1IS5A 3HN3A 1BYHA 1ZX5A 3LOIA 2OXBA 2QQOA 2WS91 4M3CF 3OPZA 4Q0QA 2X5IB 4LK7A 3LPGA 4UBGA 3LOBA 5DZEA 2XKOA 2YBKA 3RI9A 1PIV2 1OURA 2CY6A 4I09A 4AWDA 2DVGA 4RR3B 4NVPA 4ZU4A 3ZXDA 4B1LA 1G9AA 4YZ1A 1ZRFA 4K3UA 2XONA 4FFFA 3NWKA 4DIQA 1GQGA 1R082 2H0BA 1VALA 4LNVA 5DDJ3 3AC0A 5SV8A 1HB2A 4O61A 4I02A 4B4PA 1QJFA 4XFBA 4TLFA 3CF6E 3FUQA 2D44A 3IIAA 3JD72 2R073 2Q8EA 4OI2A 4OI1A 4XMAA 1Z78A 1QJY3 3MLLA 2EICA 3B94A 1US2A 3H8UA 1U12A 3NKGA 4RS5A 3EQEA 1B35B 4AHYA 3J8F2 3E6DA 5A6YA 2BYVE 3H42B 3M70A 1SLTA 2BGPA 3OOXA 2WQ8A 3SEPA 1H8VA 3IZOA 1POQA 4OUSA 4S2HA 1AR63 4COZA 5HCHA 4YM1A 5FZMA 2C24A 1W3XA 2IXKA 2FZ2A 4A7ZA 1BJQA 1GICA 1ENQA 1RUD2 3AK0A 3VD3A 1OD3A 4XFFA 1CX1A 1QJY1 1BBT2 4IETA 2GP3A 4XQ4A 2VOXA 4XEZA 4NHXA 4NE9A 1UIJA 3GALA 5J48A 2ZABA 1DDLA 1GU3A 5LA0A 4Q4X2 2YHJA 3KV5A 3ZXKA 1YI9A 3ZIWA 1SQ4A 1WZXA 4D7TA 3P6BA 3L9JT 5FZ8A 1A78A 1X36A 1OD5A 4IEVA 1WCDJ 4A6SA 2QUOA 5BUVA 5KC6A 2VW2A 4YVWB 2I2SA 5F3IA 4I2OA 5FUNA 3MZHA 4OQ8A 3AX4A 2XQXA 1W90A 2GMEA 2VUJA 5C8CC 2O8QA 1GOHA 1Q8SA 1HRV3 4NHLA 5C7GA 1RUE3 4I3PA 4BCUA 1FATA 4AGVA 3WNKA 3ZDVA 4MGYE 3UK9A 3C7OA 4LIUA 3GCXA 2RJLA 2SLIA 3M3OA 3QD6A 4QDQA 4W6YA 1Q56A 3DXTA 1W6QB 4XXAA 1DLLA 2P34A 5B4NA 4ET7A 2PHLA 3MV01 2PFWA 3VDBA 3UNPA 2ZA9A 1ST8A 1SHWB 4MLOA 2DUPA 5HI0A 2I74A 2WL1A 3BYWA 4IEOA 5GJ6A 4QX2A 2WWUA 3U1XA 3ZXLA 4YZ3A 2YG0A 1QOSA 2JDHA 1XE8A 3ABZA 3PTRB 4N8MA 1HB4A 2ORXA 1MS1A 1DP0A 4OVEA 4GB33 4I30A 4R4XA 2DV9A 1PZ8A 1CAXB 2WNUA 3BPSA 4RQPC 1QY4A 3WDTA 1DZRA 2BEOA 3USUA 4OLLA 4IQPA 1RB8G 2VUDA 1DGWX 3ES4A 1PK6C 4YW6A 2WO2A 1JYXA 2X5IA 1PO22 2VO5A 2VR4A 2A71A 4BK5A 3N7MA 5E8AA 4K1ZA 3OJBA 4B7KA 2Y6KA 3ITQA 4MGTA 4BK4A 1EV12 1UY2A 4NJ4A 2DWRA 2LM3A 4BMBA 5I93A 1LHOA 2DCTA 1UPSA 2FMDA 2J7MA 3FFZA 4XQDA 4CRQA 1JYVA 4LKDA 1O8PA 4HOOA 4JQRA 5T50A 2JICA 4EYUA 1CAWB 2Y6JA 1VBB2 2A75A 4W50A 3AZYA 3VBHA 2NLRA 3WQBA 4IV1A 1XJAA 2WR9A 4V2VA 2XH6A 4XJ8A 2MNGA 2A6YA 4YGDA 2JB8A 4Y1ZA 2BP6A 4LE3A 4CCEA 4AI2A 1PGW2 4B7EA 2IZWA 4K6BA 5EP9A 4PLNA 3FUOA 2BUKA 3PJYA 2P3KA 4XTMA 4ZXKA 3U14A 4FP3A 3WQ1A 4AZZA 1TME3 3W5NA 2A7AA 3OB8A 1WKYA 1JZ7A 5FO7B 4IUGA 4IE0A 4FTEA 1FX5A 4BIFA 1OOPA 2ZZJA 5L7OC 3ZXEA 5IT6A 1LOGA 2I07B 2NYYA 4BISA 3MF6A 3M8LA 1N1VA 3S7EA 1GZ9A 3WINE 3HNBM 2J1EA 3MDPA 4XUTA 4QQ2A 5IK5A 2VNGA 3VBSC 4EQVA 3RYRA 4IESA 4EROA 4JDOA 4XTPA 3AKPA 1QIQA 2AREA 2KXLA 2R042 3C8XA 4N43A 5FZ0A 4E27A 2OYZA 1DU3D 3H1MA 4TWTA 1A8DA 5FY9A 2XUEA 2UURA 3KSCA 4CE8A 1UY0A 4XC9A 1S0DA 5LEKA 2CGNA 1FPN2 1REDA 3VDAA 1ZBA1 4GH4C 1HV0A 3ACIA 2YPDA 1KRIA 1SLBA 4CXYA 1D4M1 2D93A 1AXZA 2DFBA 5KXDA 2R063 4RL7A 1BVP1 3M2MA 2Y26A 1PNGA 1TE1B 4IL7A 4CDQC 5FOJB 1MQTB 2BDRA 1H0BA 2IXLA 3I97A 3AFKA 4LBKA 4WBBA 5FPZA 4A2UA 1XNCA 3WNPA 2OX0A 4FQZA 1YRZA 2VQTA 4KG8A 4LITA 4EN0A 3H3ZA 1R1ZA 1X9TA 4QM9A 4CP9B 1DF0A 4K8RB 1JYTA 3OGGA 1IGOA 1S2EA 2WNUB 3B02A 3RWNA 5DUUA 3SCGA 1H9WA 2RV9A 5A33A 4AI9A 3O12A 2W95A 4CCKA 5C8CB 3BI3A 1LEDA 3WW3A 5DAPA 2W1QA 1JZ4A 4ATEA 3PUAA 4RGKA 2A1XA 1TNRA 4YW3A 1RHI3 3JD73 2VZ1A 1ND3A 5F8PA 3X29B 2LROA 3IB3A 3TRSB 1XSRA 1X8MA 4L97A 1DQ2A 1BK1A 2FDFA 3HD8B 4SLIA 3T2QA 3WNLA 1AR62 2XVKA 1JUHA 1ZM1A 4JKMA 4LO5B 4Q4X1 4XHXA 3O1PA 1BMV2 3RFRA 2BGOA 3F2ZA 3WG2A 2VL4A 4Z2AA 4R9DA 1GWLA 4A3XA 1CAWA 5CIRA 4QXBA 2X05A 3OBRA 5APAA 2ETEA 4XMIA 3ZMOA 4DOUA 2D5FA 4DXZA 4YYOA 2E51A 1UU4A 4W6WA 5IUQA 4BE3A 4JX0A 1S0CA 4LKSA 3AVRA 4RHV2 5JI9A 5G04L 1BEV3 2ZGOA 1QNWA 4IDZA 1QJEA 4P5HA 4XW3A 5FPUA 3ZXGA 3DN7A 1TME2 4NHYA 5C3QA 2WLPA 4YM0A 5FBJA 1FNYA 5DAQA 3LEKA 1EV11 2Q4SA 2ZMLA 2YFUA 3KS7A 5F6LB 3OY8B 5F2SA 2D6NA 1UWWA 3Q8EA 4MXVA 2WNUC 3WDVA 4C0HA 3I3MA 1N3PA 5FV3A 3NAPC 1ND3B 1NX9A 4FOVA 4L11A 2AUYA 2X8KA 1ULDA 2OUJA 4PJYA 2WN2A 5FTTC 4HVQA 1LAJA 3E5UA 1XNBA 1DHKB 3D82A 3OUJA 1T2XA 1LNSA 1W2TA 1M4WA 3M3QA 1SBFA 3L2HA 2B39A 4CP2A 4QU1A 4FOYA 1IOAA 3NV4A 3TB0A 3PIJA 4ZONA 3U4SA 5IATA 1BVVA 3J7HA 4QAWA 2VTFA 1WCSA 3JD71 3MI8A 5JOWA 2BTVC 2OVUA 2ZHKA 1S0GA 4CU6A 5ABJB 2VOKA 4PBOA 5A7NA 1FPN3 2GN3A 4X8NA 3WY6A 4GKYA 1J3RA 4L0PA 2JDNA 3N9MA 1CVNA 2EIEA 3ASIA 1NCRB 3BODA 3INAA 1PK6B 4CDWB 2ET7A 5E88A 1LOAA 1GQPA 1FNZA 4YSFA 5C5UA 4NIAA 5GM0A 2ADEA 2ARCA 2ZGQA 4N53B 2XJPA 1I1EA 3MIBA 3UGGA 5J1XA 1PVC2 2PYTA 3H0OA 4DEVA 5FZ6A 5LA9A 2A6VA 1PZ7A 4IE7A 4JAAA 2XL7A 3T3YA 4QXCA 1UQXA 3FFQA 4BM8A 3OSDA 3EMRA 1RMU1 4Q0UA 3K3OA 1PO11 1HB3A 3URFA 4QX0A 4DUWA 5I8SA 2XVLA 3NVCA 4NHMA 1ND3C 3WEZA 4CCOA 2JG8A 4QKNA 5JZGA 5B4XA 1VBB3 2FCUA 3O1VA 1HN1A 1RUH2 1KFUL 2ZHNA 3VV1A 1U5IA 2JE8A 2FDKA 1KITA 1ODNA 1YIFA 2OIIA 1PGSA 1C8M1 1OFSA 1VPHA 1J58A 3ZSMA 1S0FA 1UXZA 2ZZQA 4Y1UA 3THTA 1CR7A 1W9WA 2D40A 1YFWA 5LCWL 1MQTC 5A32B 1N1YA 1RUI1 4XDOA 4JTNA 1NLRA 4Z1VA 1ZZBA 2W9XA 3N9PA 1DYPA 3GHMA 2VC9A 1VAKA 3CJXA 1POV0 2VU9A 3UL2A 4IE4A 5FKBA 5FPLA 5T5JA 2DCZA 4H2AA 1ZZ7A 1JOJA 4LPLA 4Y20A 4N53C 2Q1ZB 2GDFA 5FXZA 2WNVB 1V9U1 3B00A 1N3QA 1KEXA 1OQ1A 3LFMA 4Q4W1 3DPRC 1RUI3 2BVBA 1SFYA 5FY8A 4BH9A 5I0DA 2GC1A 1RGSA 4IEPA 5F37A 3IWZA 1SBDA 2VM9A 1VJ2A 2PAEA 5FXVA 2R043 2VJXA 1LENA 2B9UA 3D3AA 2ARBA 1PGW1 2JG8C 3BKZA 5IW0A 2LW8A 3ZYGA 3PL0A 4Z92B 1W9YA 2D6KA 3CJIC 4S2GA 4TLGA 4XJZA 4B3NA 4Q4Y1 3EJKA 2VMIA 4PF5A 5BNQA 2XLAA 2JEMA 4MXWB 1PHMA 1FYUA 2FBEA 2VH9A 4HBNA 4XFAA 1VBA2 3THCA 2R041 4CUBA 4XAEA 2KR2A 2WT0A 3HT1A 2VUAA 4BQYA 1OI6A 2FCTA 1PX4A 4J1XA 5FXWA 2WBKA 4AEDB 2EF6A 4U2AA 3U4XA 2VPVA 4IV3B 4EWDA 4E4ZA 1NZCA 4H3WA 4IEQA 2YFZA 1WW5A 3AKTA 4QD2A 2HEWF 3HMYA 4MVTA 1JTZX 1NG0A 1XU1A 3QBQA 3I2OA 3AMPA 5FZOA 1S0BA 4MV2A 4XF3A 2W2IA 2OKXA 3VHRA 4FPFA 1PGL2 3WNXA 1QOTA 2GN7A 3TAYA 5DZFA 1NZIA 1O5LA 4FOQA 2AENA 5AVPA 5FZAA 3ZSEA 3VD4A 5ANNA 1NA1A 2MEV1 4HPKB 4KWLA 3ZYFA 1J83A 3ALQA 2W47A 2J1AA 1G7YA 4PLMA 3ZVXA 2DFCA 4NHKA 4QU2A 5C33A 2R072 4PQ9A 5BNPB 1NE4A 5KXEA 3KHCA 1H8TC 2XL9A 3LA3A 1NOVA 1Z7S3 2VZPA 3N9OA 2AEZA 2WKKA 4RN5A 5FYIA 5FZFA 3IBMA 5AFBA 5H9RA 3KV6A 2GMPA 3TN91 5T52A 5FYUA 1TEIA 1AJKA 1RUNA 1QJU2 3KT7A 2YGMA 3O0WA 5FMOL 4COYA 3P3NA 3AYDA 5LK7B 1DQ0A 2DU0A 1JI6A 4RHV3 2RVAA 3K46A 1ALYA 3LDRA 1D2SA 2IXJA 2VCCA 2YC2A 4Q27A 5FYZA 1MEC3 1NLSA 1ENRA 1H8TA 1K45A 5JMCA 4Q4V1 3GHNA 3T2PA 1E5RA 1GP4A 1RMU2 1AYM3 3N3HA 4ZS3A 4JGYB 1Q8OA 3WF4A 3O0VA 3WZ1A 3GXUA 3O1MA 2VMCA 4OULA 3ON7A 4GB32 4K1YA 4OHVA 3AZZA 1MS5A 3HQXA 4PCRA 3ZSJA 4BQXA 2FMYA 4HZFA 3VKOA 4DXTA 3MFCA 1F2NA 1LECA 1OVSA 2IWGB 4QM8A 1TQ5A 4YW7A 2RS31 2Z69A 1UOFA 2EALA 4YLZA 4DMIA 3OD0A 3ZKYA 3MHZA 1XNDA 1GOGA 1IQAA 1S2KA 5FREA 4NIGA 1LR5A 5JR7B 3TYJA 3NV2A 5K0UB 5IYYA 1AJOA 2BVVA 3W58A 5A7WB 5EV7A 2AZ5A 4AI0A 2WQ4A 3AXDA 4Q26A 1ONAA 1W8ZA 1ZVFA 4H14A 4FPYA 4H7LA 1UMIA 3GYDA 4UFIA 1UF2C 5GZGA 5LA2A 3CL1A 3AMMA 3UKVA 4F8AA 4W6XA 4YM2A 3KQRA 3VBOB 3J7MA 4LKFA 4BDVB 5IK4A 4D6QA 2K46A 4UT5A 4Y22B 3ILNA 3RNSA 2YB7A 2QZ2A 4HT1T 2D6PA 1HQWA 2JG9A 1RUC3 2WZR1 1OC1A 2K2SA 2PHUA 3H3LA 3HR9A 2YU1A 5JSPA 2IFWA 1CQ9A 1PVC3 1YQCA 3T0AA 4D7SA 3POSA 4A7KA 4G9SB 4HMZA 2WWSA 3RWKX 5ACA1 1RUJ1 5C3RA 1QJX1 3FWEA 5CZKA 4D3WA 4Q4V3 1VAVA 5C4WC 1WCQA 2EAKA 5CA6A 2J1RA 2W68A 1UKGA 5D2AA 1CAUA 5IHRA 4XFCA 1TVGA 4AFBA 4ZKTB 1S55A 2B42B 1W9FA 2QZ3A 4HK9A 3ZKUA 5C71A 5BY5A 4J1WA 1OLRA 4D94A 3H8XA 1C1LA 4DNYA 4DXSA 3J26N 4GMP0 3DL3A 2HEYF 4KU8A 4PDWC 5IVJA 3LA7A 4KGQA 2UWBA 1X50A 2R16A 2XWBB 5T5PA 3WSOA 4IV3A 5F5CA 1YQ5A 1ZBA2 1B35C 1F31A 2VZQA 2WT2A 5E16A 3WG3A 3AKRA 1V0AA 2YC4A 2CNAA 2CV6A 1UZYA 1YJKA 2JG9B 5A33B 4BLJA 1ODMA 2RDNA 2MEV3 3FMGA 2NPIA 4XURA 2NN8A 3D0SA 5CFDC 4GWJA 2OW4A 4D69A 4Y33A 4FP2A 1AR82 5GZDA 3K51A 4Y3OA 1Y7BA 2NP0A 4LXLA 5F2WA 3JU9A 3PVBB 4QGMA 1WGPA 3OTFA 3AP7A 4BQ2A 4MUVA 3VDDB 2CSGA 2YMZA 3FX3A 3A21A 3TN93 1YQ2A 1ZRCA 1RUI2 4YM3A 1R1A2 3IMNA 4IV1C 5C3SA 4D8MA 3IPVA 4RGAA 5FRAA 2WDBA 1D4VB 1QOOA 2DF7A 4DUXA 5JSRA 1BLZA 3P1IA 4XBQA 2PQQA 4R52A 4HETA 2I45A 2VECA 3KGLA 1UCXA 3ZFFA 2Y6GA 4F7ZA 4JHTA 4EN8B 2WT1A 2FDIA 1YO8A 5A80A 1H9PA 3PU8A 5FP8A 4QGLA 5CEHA 1PMHX 4PI0A 2ZX2A 1G8WA 4JHZA 1LEMA 2PQSA 3ZYPA 5BNNC 1W6PB 2VQAA 4AW7A 1REEA 4C1WA 2HWF1 1RUG2 2DVFA 2Z79A 1P8JA 1V9U2 1ULFA 1I6XA 3I54A 4V1PA 3THPA 4FPEA 4ATFA 5LZ6A 4RFRB 3A0NA 3KCXA 2KM2A 4R8HA 4XCBA 1ZNPA 3WF3A 1OA2A 2CDOA 3ST7A 1AL22 1H1MA 2GNBA 1V6IA 4NIDA 1HRI2 2WIIB 3SCHA 3VD7A 4DY5A 3BTZA 1AR73 3FHQA 3MPPG 4TSVA 4AEDC 5BNNA 4AQ2A 1MS3A 4CCMA 2JDAA 1VBE2 4FOWA 2WABA 5J7MA 1EPZA 4MADA 5C8CA 3I2KA 5DUXA 1GOFA 4FVVA 1LJ7A 4QB2A 4YVSA 4ASMB 1Y9GA 1YYNA 2VD7A 1LGCA 3W21A 4NRQA 2RS51 3BGAA 2HJIA 4LBJA 3TWIA 5FLJA 5ABJA 2VNRA 5IFPA 2Y34A 2XB6C 3JQXA 1ENXA 2FQPA 4GMP3 1UAIA 4MH0E 5GZEA 3VBHB 4BU2A 5A3PA 1C1FA 4PIXA 4W8JA 2WZR3 2ZGMA 4JC1A 1JOBA 3T09A 5C4WB 5B2GB 2W92A 2ZCWA 3EO6A 4Y22A 3ZN4A 4LULA 2AEYA 3VN4A 2QQWA 1LHVA 2W46A 4ZXEA 1H2MA 1POV1 1HXS2 1HX6A 1YHFA 2TUNA 4FPGA 4AEKA 2GMMA 4UFKA 5F5IA 1KS5A 5J3UA 1QJX3 5F7UA 3VBRA 5CFCB 1T6BX 2YV8A 3BTYA 4M3CE 3WP3A 4UWDA 5T54A 1C8M2 1FAYA 1JUIA 2YPJA 1SDWA 4UW6A 1LB2A 5EZWA 3PUIA 4GIQA 2EAAA 2HWC1 1ZBE2 2ZKNA 2HWD2 5A3WA 1VMJA 1UN1A 4KBBA 4W4ZA 5ACA2 4O65A 4GB31 2MEV2 3VZMA 4D6RA 3NW4A 3UGFA 4BQ4A 3MGUA 4PI2A 4WVWA 3VZNA 3VHNA 3N9LA 2DBNA 4WM7B 3LDKA 1K5MA 1NYWA 3WR0A 1RITA 3IN9A 1SMVA 5FDBA 4CU7A 1JYCA 1FV3A 4Y1YA 3WHTA 4LQRA 4OHZA 4CDXA 1CJDA 4Q0PA 1GNHA 5HCBA 3HBKA 4NPMA 1H1AA 3PU3A 1X8EA 2ZTNA 4UFHA 4AFCA 2UY9A 5FZ3A 3VBUA 4UOJA 2WS92 3OPWA 2JE7A 3I2JA 3I3EA 3TOJA 3I3DA 4IGPA 3SH5A 4GKXA 4D7YA 3FZ3A 4LBOA 3ZPOA 1DZTA 1VE0A 1H4HA 2DYCA 1ZZ9A 4PDWB 3UGHA 2VZOA 3MLKA 4GMP1 3DECA 3WG4A 4QPYA 1LCLA 2FZ1A 1DFQA 1YI7A 2BV4A 2RDSA 4AEJA 5M0TA 3F95A 4XDPA 1WLWA 4Y20B 4LORA 1ULEA 1QMJA 3AZVA 4YZ5A 5DMYA 3PHMA 5DUWA 4FPJA 3WDWA 3OYWA 2HLEA 3GGLA 3BU7A 3LKJA 4YVWA 2ZEXA 3ZFFC 5DDJ2 1NLQA 4BIOA 5LRSA 1GKBA 3S30A 4XF1A 5HXMA 1MACA 2W08A 1UY4A 3ZX7A 1VLNA 4JKKA 3H8RA 1UYXA 1ZA7A 3AMQA 3TNPB 2VTXA 2ZAAA 3ZR6A 4CDXC 3BALA 4NAOA 3ACFA 4CP1A 1O6UA 2ZEYA 3VBUB 2P1BA 2YC0A 4G4FA 5A1AA 4XETA 4C0BA 1JZ2A 1NKGA 3T30A 3RZKA 3R0RA 3W20A 2DBIA 4GWNA 2YY1A 3GNEA 4WM8A 2F4LA 4AL9A 4EV0A 1C5IA 4LBQD 4XAAA 2WZR2 3THDA 4OHYA 1AX2A 4E4DX 3Q8BA 4FXKB 4Q1RA 2YBSA 1DGRN 1S4CA 3MIEA 3MW4A 1QXJA 4HXCA 3EHKA 4IEXA 5L9RA 1G9DA 4AFDA 4ASLA 2ZGUA 1FOD2 5FYMA 3BOPA 1R091 5DG2A 5DUVA 1ZREA 2ZHMA 1QJX2 1W9TA 1E5IA 4PIZA 4RD7A 3WX5A 5A1LA 5A3LA 3POBA 2WQZC 1KGYA 4KWUA 4QX7A 4QDSA 2J1UA 3T0DA 3M7AA 2OQ7A 1AR83 3JQWA 4JTOA 4QKFA 1OUXA 4IEWA 1UOJA 1DQ6A 2GAUA 3AFGA 5F6KA 1RUE2 4JDMA 4A3ZA 1QEXA 3KVBA 3AXEA 3MPBA 4YRDA 3MW2A 5C4WA 3UYJA 2BOJA 2BW8A 3GDBA 2GZWA 5EYYA 1VB2A 4J25A 1AR81 3UKTA 5BV6A 5JR2A 2R30A
chains in the Genus database with same CATH topology
2WAOA 2VZ3A 3WNOA 1UZ0A 2QQKA 3FHAA 2LS6A 3J7HA 2VTFA 4QAWA 1JZ5A 1DLCA 1L7RA 4CU6A 1W99A 3WNMA 4L0PA 4AAXA 2EIEA 2Y8KA 3VDCA 4XUNA 2XOMA 3E1F1 2J22A 3CZUA 5EJZB 4OZOA 4P00B 1W8OA 3VD9A 3NNGA 4GWIA 1CZVA 1GQPA 4P08A 3WF2A 2QQJA 3A23A 2ZEWA 4XUPA 4ZY9A 5JMOA 3DYOA 4ARYA 1JZ6A 5J1XA 1K12A 3A22A 4DEVA 1K3IA 4P5YA 3W5MA 2E26A 2J1TA 2Y6HA 1OT5A 1W9SA 2WN3A 4CVUA 1UXXX 3WF1A 2C4XA 4DEQA 4QX0A 1UYZA 4DUWA 3WEZA 2W87A 3OEBA 2V72A 5B4XA 1RYYA 4A41A 1HN1A 2JE8A 4MGQA 1I5PA 4D0QA 1CIYA 3K4AA 2B9VA 2W91A 1NUKA 1UXZA 3C7FA 2VMEA 1W9WA 1JU4A 2DCJA 5LCWL 3U37A 1UMHA 2W9XA 2VCBA 3I2GA 5JUVA 2B4KA 2VC9A 3IDAA 4PT6A 1L7QA 5JXIA 4LPLA 5DN2A 3T0BA 5C70A 2QBXA 3IAPA 1KEXA 5I0DA 1ULPA 1H6YA 2VM9A 3EYPA 1MPXA 1SDDB 2VJXA 3D3AA 2W94A 1JYWA 2LW8A 3C7GA 4CU8A 4QB6A 4BXSV 3SKVA 4UI9L 2VCAA 2VMFA 4XVHA 3THCA 2BERA 4CUBA 1JHJA 3C7HA 4E8DA 1PX4A 2Z4FA 2WBKA 2J1SA 1F4AA 2YFZA 1XPWA 2HYXA 3HOBA 3T08A 2OKXA 3I3BA 3NJVA 1CZTA 3VD4A 4XUOA 1J83A 1GMMA 2W47A 1W8NA 2J1AA 3BN6A 2JKXA 4PQQA 4RN5A 2VZPA 2W1SA 3MUZ1 3NQHA 2ID4A 2E31A 5LA1A 3CQOA 4TXWA 5IFTA 3PUHA 1BHGA 1JU3A 2J1VA 1TG7A 1JI6A 2RVAA 3K46A 2W1WA 2VCCA 1F4HA 1W0NA 2YC2A 4YPJA 3A7QA 1K45A 2C26A 5DQ0A 3T2PA 4ZZ5A 3SKJE 3I2IA 2VOTA 2WO3A 2V4VA 3WF4A 2X10A 3GXUA 2VMCA 1UY1A 2R7EB 4QB1A 3GM8A 2C9KA 3OEAA 4OMCA 4DXTA 2VZRA 5DPNA 5G05L 2RJ2A 3CKHA 1US3A 3FL7A 1GOGA 2QQMA 3MO4A 4CUCA 2E33A 2KD7A 5IYYA 3UESA 5HPOA 3UNPA 3HN3A 1UMIA 5LA2A 2QQOA 3LEIA 2QQLA 3LPGA 4BDVB 1IQDC 4JKLA 2YB7A 2W1UA 4PF1A 4TTGA 2XONA 4MOAA 1ULOA 3AC0A 1NAEA 3T0AA 2WYSA 1EUTA 4QDRA 5JXJA 5CZKA 4KI5M 1WCQA 2VZVA 2EICA 2J1RA 1US2A 2E32A 2VZUA 4OUEA 5IHRA 1TVGA 2BGPA 5C71A 2WQ8A 5IJRA 3SEPA 1OH4A 4GZ9A 4DXSA 3OGRA 3VD3A 1OD3A 1CX1A 2QQIA 3WSOA 3MBWA 2DDUA 1GU3A 5LA0A 4QX3A 2VZQA 2X09A 4BJ0A 1UY3A 2YC4A 3P6BA 1JZ8A 2V5DA 4XURA 3WNNA 3I2HA 5CYYA 4GWJA 2W5FA 2XQXA 1D7PM 3IAQA 1GOHA 3DYMA 2CDPA 5C7GA 3OGSA 1SG3A 2JD9A 3OBAA 2EIDA 3A21A 3WNKA 1YQ2A 1PX3A 3C7OA 4D8MA 2WDBA 2BZDA 4QDQA 3HEIA 4DUXA 3P1IA 4OMDA 5B4NA 4ET7A 2WAAA 3MV01 3VDBA 1K42A 1SHWB 2Y6GA 3ZM8A 3LQCA 4QX2A 3T2OA 3CMGA 3CZJA 1CZSA 2YG0A 3ABZA 1PMHX 2ORXA 5EIYB 1DP0A 4JHZA 2PQSA 4CUAA 2VMDA 4HG6B 3DYPA 1P8JA 3CIHA 3K77A 2WUHA 3WF3A 2L9LA 2WO2A 1JYXA 4RYDA 2CDOA 2VO5A 2VR4A 1DYOA 3ETPA 4BK5A 4DUVA 4KMQA 2Y6KA 3CDZB 3VD7A 3FHQA 4BK4A 2JDAA 2Y64A 1UY2A 2WABA 3NJXA 4MADA 3I2KA 2J7MA 1GOFA 4QB2A 1JYVA 4P02B 1O8PA 4FI9A 3BGAA 2Y6JA 1UX7A 4W50A 5IFPA 3WQBA 5JXHA 4W8JA 4A6OA 3T09A 1XC6A 2W92A 2W46A 4ZXEA 2VZSA 4M4RA 1JZ3A 3NRUA 1UYYA 2VQUA 5F7UA 4ZZ8A 3ACHA 3W5NA 1OF4A 3OB8A 1WKYA 1JZ7A 4IUGA 1PMJX 4UAPA 3PUIA 4MGSA 4MO3M 4W4ZA 4LHSA 1OF3A 3HPNA 3IIIA 4CU9A 3HNBM 2J1EA 4XUTA 3ACGA 3OG2A 4OYUA 4CU7A 2ZXQA 3LPFA 4LQRA 2DCKA 3C8XA 3SEEA 3LEGA 1UY0A 4UOJA 3VDAA 3MV11 3I2JA 3I3EA 3ACIA 3I3DA 1GUIA 3MUY1 5FUIA 2XHNA 3WF0A 1XNAA 4QPWA 2Y6LA 2VZOA 3I97A 3DECA 1GNYA 3WNPA 2VQTA 1O8SA 2EIBA 5JXGA 4XZUG 5DMYA 2RV9A 4A45A 2W95A 2HLEA 3GGLA 2ORZA 2ZEXA 3HNMA 2W1QA 1JZ4A 5HXMA 1UY4A 1H6XA 2VZ1A 4JKKA 1UYXA 3IB3A 1O59A 4ARXA 3ACFA 2ZEYA 5A1AA 4A42A 4AG4A 1JZ2A 1NKGA 2BBAA 3T2QA 3WNLA 4DXRA 4JKMA 5EJ1B 3EB7A 3FN9A 2VZTA 2BGOA 3F2ZA 4A4AA 2VL4A 1EUUA 4Z2AA 3K4ZA 2WZ8A 3THDA 2WO1A 2X05A 3K75B 4JX0A 4LKSA 5G04L 4XUQA 3K4DA 1W9TA 3VD5A 4A44A 2QQNA 4M4PA 3OGVA 1KGYA 3HNYM 4KWUA 3LEKA 2J1UA 4QDSA 3T0DA 2YFUA 3LE0A 1UWWA 1XNTA 2W3JA 1R64A 3ECQA 1NX9A 3I2FA 4A3ZA 2WZEA 3C7EA 2ZEZA 4QX1A 2WN2A 1J84A 4E8CA 3GDBA 1T2XA 1LNSA 3HJRA 1JYNA 3JXSA 5JR2A 3UETA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WAO A;  2VZ3 A;  3WNO A;  1UZ0 A;  2QQK A;  3FHA A;  2LS6 A;  3J7H A;  2VTF A;  4QAW A;  1JZ5 A;  1DLC A;  1L7R A;  4CU6 A;  1W99 A;  3WNM A;  4L0P A;  4AAX A;  2EIE A;  2Y8K A;  3VDC A;  4XUN A;  2XOM A;  3E1F 1;  2J22 A;  3CZU A;  5EJZ B;  4OZO A;  4P00 B;  1W8O A;  3VD9 A;  3NNG A;  4GWI A;  1CZV A;  1GQP A;  4P08 A;  3WF2 A;  2QQJ A;  3A23 A;  2ZEW A;  4XUP A;  4ZY9 A;  5JMO A;  3DYO A;  4ARY A;  1JZ6 A;  5J1X A;  1K12 A;  3A22 A;  4DEV A;  1K3I A;  4P5Y A;  3W5M A;  2E26 A;  2J1T A;  2Y6H A;  1OT5 A;  1W9S A;  2WN3 A;  4CVU A;  1UXX X;  3WF1 A;  2C4X A;  4DEQ A;  4QX0 A;  1UYZ A;  4DUW A;  3WEZ A;  2W87 A;  3OEB A;  2V72 A;  5B4X A;  1RYY A;  4A41 A;  1HN1 A;  2JE8 A;  4MGQ A;  1I5P A;  4D0Q A;  1CIY A;  3K4A A;  2B9V A;  2W91 A;  1NUK A;  1UXZ A;  3C7F A;  2VME A;  1W9W A;  1JU4 A;  2DCJ A;  5LCW L;  3U37 A;  1UMH A;  2W9X A;  2VCB A;  3I2G A;  5JUV A;  2B4K A;  2VC9 A;  3IDA A;  4PT6 A;  1L7Q A;  5JXI A;  4LPL A;  5DN2 A;  3T0B A;  5C70 A;  2QBX A;  3IAP A;  1KEX A;  5I0D A;  1ULP A;  1H6Y A;  2VM9 A;  3EYP A;  1MPX A;  1SDD B;  2VJX A;  3D3A A;  2W94 A;  1JYW A;  2LW8 A;  3C7G A;  4CU8 A;  4QB6 A;  4BXS V;  3SKV A;  4UI9 L;  2VCA A;  2VMF A;  4XVH A;  3THC A;  2BER A;  4CUB A;  1JHJ A;  3C7H A;  4E8D A;  1PX4 A;  2Z4F A;  2WBK A;  2J1S A;  1F4A A;  2YFZ A;  1XPW A;  2HYX A;  3HOB A;  3T08 A;  2OKX A;  3I3B A;  3NJV A;  1CZT A;  3VD4 A;  4XUO A;  1J83 A;  1GMM A;  2W47 A;  1W8N A;  2J1A A;  3BN6 A;  2JKX A;  4PQQ A;  4RN5 A;  2VZP A;  2W1S A;  3MUZ 1;  3NQH A;  2ID4 A;  2E31 A;  5LA1 A;  3CQO A;  4TXW A;  5IFT A;  3PUH A;  1BHG A;  1JU3 A;  2J1V A;  1TG7 A;  1JI6 A;  2RVA A;  3K46 A;  2W1W A;  2VCC A;  1F4H A;  1W0N A;  2YC2 A;  4YPJ A;  3A7Q A;  1K45 A;  2C26 A;  5DQ0 A;  3T2P A;  4ZZ5 A;  3SKJ E;  3I2I A;  2VOT A;  2WO3 A;  2V4V A;  3WF4 A;  2X10 A;  3GXU A;  2VMC A;  1UY1 A;  2R7E B;  4QB1 A;  3GM8 A;  2C9K A;  3OEA A;  4OMC A;  4DXT A;  2VZR A;  5DPN A;  5G05 L;  2RJ2 A;  3CKH A;  1US3 A;  3FL7 A;  1GOG A;  2QQM A;  3MO4 A;  4CUC A;  2E33 A;  2KD7 A;  5IYY A;  3UES A;  5HPO A;  3UNP A;  3HN3 A;  1UMI A;  5LA2 A;  2QQO A;  3LEI A;  2QQL A;  3LPG A;  4BDV B;  1IQD C;  4JKL A;  2YB7 A;  2W1U A;  4PF1 A;  4TTG A;  2XON A;  4MOA A;  1ULO A;  3AC0 A;  1NAE A;  3T0A A;  2WYS A;  1EUT A;  4QDR A;  5JXJ A;  5CZK A;  4KI5 M;  1WCQ A;  2VZV A;  2EIC A;  2J1R A;  1US2 A;  2E32 A;  2VZU A;  4OUE A;  5IHR A;  1TVG A;  2BGP A;  5C71 A;  2WQ8 A;  5IJR A;  3SEP A;  1OH4 A;  4GZ9 A;  4DXS A;  3OGR A;  3VD3 A;  1OD3 A;  1CX1 A;  2QQI A;  3WSO A;  3MBW A;  2DDU A;  1GU3 A;  5LA0 A;  4QX3 A;  2VZQ A;  2X09 A;  4BJ0 A;  1UY3 A;  2YC4 A;  3P6B A;  1JZ8 A;  2V5D A;  4XUR A;  3WNN A;  3I2H A;  5CYY A;  4GWJ A;  2W5F A;  2XQX A;  1D7P M;  3IAQ A;  1GOH A;  3DYM A;  2CDP A;  5C7G A;  3OGS A;  1SG3 A;  2JD9 A;  3OBA A;  2EID A;  3A21 A;  3WNK A;  1YQ2 A;  1PX3 A;  3C7O A;  4D8M A;  2WDB A;  2BZD A;  4QDQ A;  3HEI A;  4DUX A;  3P1I A;  4OMD A;  5B4N A;  4ET7 A;  2WAA A;  3MV0 1;  3VDB A;  1K42 A;  1SHW B;  2Y6G A;  3ZM8 A;  3LQC A;  4QX2 A;  3T2O A;  3CMG A;  3CZJ A;  1CZS A;  2YG0 A;  3ABZ A;  1PMH X;  2ORX A;  5EIY B;  1DP0 A;  4JHZ A;  2PQS A;  4CUA A;  2VMD A;  4HG6 B;  3DYP A;  1P8J A;  3CIH A;  3K77 A;  2WUH A;  3WF3 A;  2L9L A;  2WO2 A;  1JYX A;  4RYD A;  2CDO A;  2VO5 A;  2VR4 A;  1DYO A;  3ETP A;  4BK5 A;  4DUV A;  4KMQ A;  2Y6K A;  3CDZ B;  3VD7 A;  3FHQ A;  4BK4 A;  2JDA A;  2Y64 A;  1UY2 A;  2WAB A;  3NJX A;  4MAD A;  3I2K A;  2J7M A;  1GOF A;  4QB2 A;  1JYV A;  4P02 B;  1O8P A;  4FI9 A;  3BGA A;  2Y6J A;  1UX7 A;  4W50 A;  5IFP A;  3WQB A;  5JXH A;  4W8J A;  4A6O A;  3T09 A;  1XC6 A;  2W92 A;  2W46 A;  4ZXE A;  2VZS A;  4M4R A;  1JZ3 A;  3NRU A;  1UYY A;  2VQU A;  5F7U A;  4ZZ8 A;  3ACH A;  3W5N A;  1OF4 A;  3OB8 A;  1WKY A;  1JZ7 A;  4IUG A;  1PMJ X;  4UAP A;  3PUI A;  4MGS A;  4MO3 M;  4W4Z A;  4LHS A;  1OF3 A;  3HPN A;  3III A;  4CU9 A;  3HNB M;  2J1E A;  4XUT A;  3ACG A;  3OG2 A;  4OYU A;  4CU7 A;  2ZXQ A;  3LPF A;  4LQR A;  2DCK A;  3C8X A;  3SEE A;  3LEG A;  1UY0 A;  4UOJ A;  3VDA A;  3MV1 1;  3I2J A;  3I3E A;  3ACI A;  3I3D A;  1GUI A;  3MUY 1;  5FUI A;  2XHN A;  3WF0 A;  1XNA A;  4QPW A;  2Y6L A;  2VZO A;  3I97 A;  3DEC A;  1GNY A;  3WNP A;  2VQT A;  1O8S A;  2EIB A;  5JXG A;  4XZU G;  5DMY A;  2RV9 A;  4A45 A;  2W95 A;  2HLE A;  3GGL A;  2ORZ A;  2ZEX A;  3HNM A;  2W1Q A;  1JZ4 A;  5HXM A;  1UY4 A;  1H6X A;  2VZ1 A;  4JKK A;  1UYX A;  3IB3 A;  1O59 A;  4ARX A;  3ACF A;  2ZEY A;  5A1A A;  4A42 A;  4AG4 A;  1JZ2 A;  1NKG A;  2BBA A;  3T2Q A;  3WNL A;  4DXR A;  4JKM A;  5EJ1 B;  3EB7 A;  3FN9 A;  2VZT A;  2BGO A;  3F2Z A;  4A4A A;  2VL4 A;  1EUU A;  4Z2A A;  3K4Z A;  2WZ8 A;  3THD A;  2WO1 A;  2X05 A;  3K75 B;  4JX0 A;  4LKS A;  5G04 L;  4XUQ A;  3K4D A;  1W9T A;  3VD5 A;  4A44 A;  2QQN A;  4M4P A;  3OGV A;  1KGY A;  3HNY M;  4KWU A;  3LEK A;  2J1U A;  4QDS A;  3T0D A;  2YFU A;  3LE0 A;  1UWW A;  1XNT A;  2W3J A;  1R64 A;  3ECQ A;  1NX9 A;  3I2F A;  4A3Z A;  2WZE A;  3C7E A;  2ZEZ A;  4QX1 A;  2WN2 A;  1J84 A;  4E8C A;  3GDB A;  1T2X A;  1LNS A;  3HJR A;  1JYN A;  3JXS A;  5JR2 A;  3UET A; 
#chains in the Genus database with same CATH topology
 1UYP A;  3WNO A;  1GP6 A;  1Q5O A;  2Y0I A;  1DGR A;  1UZ0 A;  2OPW A;  4LO4 B;  3W9A A;  4AHX A;  5AC9 3;  3DF0 A;  2UWA A;  2HWC 3;  1LOB A;  1WCK A;  1DLC A;  1L7R A;  1RUG 1;  3OGJ A;  2UY8 A;  1W99 A;  3WNM A;  4XJW A;  2Y8K A;  2J22 A;  3NNF A;  5EJZ B;  3SCF A;  3VZK A;  1H8T B;  1HJF A;  5F5A A;  3VD9 A;  2QVS B;  4HON A;  1V9U 3;  1OUS A;  3H9A A;  2ZEW A;  3I59 B;  3PMS A;  4LTA A;  4ZY9 A;  2LAL A;  5JMO A;  1JN2 P;  5CVR A;  1JZ6 A;  1G9B A;  3RS6 A;  4HVO A;  4X8P A;  2ZBJ A;  3ZYJ B;  1ZZ8 A;  2WJS A;  5IVF A;  1RTV A;  3W5M A;  4UW5 A;  3AMH A;  4BXF A;  1AZD A;  1HRI 3;  2E26 A;  1GBG A;  4RGG A;  1W39 A;  1STM A;  2Y6H A;  2R32 A;  5EJ3 A;  5KHG A;  3KF5 A;  3NO8 A;  1D4M 3;  4QT6 A;  3RSJ A;  3AYA A;  3DUI A;  3AZW A;  4DEQ A;  3RDI A;  2CGP A;  2R06 1;  4TN7 A;  3UJQ A;  2WFF 3;  3G7D A;  3ZXA C;  3S5A A;  2CAU A;  3N35 A;  3AYC A;  3NV3 A;  1UU5 A;  5BNO A;  4AVS A;  3DPR B;  3MEP A;  3BCW A;  3PUQ A;  4JGZ C;  3ZFF B;  4A41 A;  3LIG A;  4OI0 A;  2QQP A;  2JDY A;  3KZ4 C;  2WNO A;  4N9I A;  5FLI A;  4R9C A;  4UBH A;  4F83 A;  2BWA A;  5A7Q A;  5L19 A;  3K4A A;  3IDE A;  2B9V A;  4PBP A;  2ZX3 A;  1VRH 3;  4YVW C;  3QH7 A;  1F35 A;  1HXS 3;  1OA3 A;  1NUK A;  3S7I A;  3C7F A;  3R4S A;  3ETQ A;  1AL2 1;  1JU4 A;  1SCR A;  2HEV F;  3SQO A;  2GC3 A;  3FLP A;  4I0B A;  4NPR A;  3KD4 A;  2D6M A;  4GD4 A;  4IEU A;  5L7O B;  1UMH A;  3DV8 A;  3EXU A;  5A3O A;  1QJU 3;  4KBZ A;  4QHB A;  2W52 A;  5JOZ A;  1OPM A;  3Q8C A;  3PLQ A;  5FWE A;  5JXI A;  5DN2 A;  3ZIX A;  3T0B A;  5C70 A;  2R49 A;  1YFU A;  3KWV A;  3IAP A;  3H8O A;  2D98 A;  3AM2 A;  4COV A;  2MHF A;  3C2U A;  1H6Y A;  1UNB A;  2A6X A;  1CN1 A;  1Y3T A;  5FAX A;  1BMV 1;  4DZG A;  1UIK A;  1OQE A;  5FPA A;  3RJ2 X;  3AJY A;  5T5L A;  1W3V A;  2H6C A;  1BZW A;  5C6C A;  1IHM A;  1NY7 1;  2HWB 3;  4Q8L A;  4CU8 A;  1E5H A;  1KXG A;  5FY4 A;  1Y43 B;  2JE9 A;  3WDY A;  1O3R A;  3WUC A;  1QDC A;  3ZYI B;  4IW3 A;  4XIL A;  4XVH A;  3R6S A;  2BER A;  2GP5 A;  4QPI A;  5D8A A;  1A34 A;  4YG6 A;  2YU2 A;  4N90 A;  1AYM 1;  4X6R B;  4E8D A;  1W2U A;  1VBD 2;  4HK8 A;  5K7P A;  1GAN A;  2E7T A;  3JBG 2;  2ZPX A;  1ULG A;  2J1S A;  4WM8 C;  4Q5O A;  3VBO A;  1BXH A;  1U5Y A;  5FY0 A;  4EN7 B;  4P14 A;  5SV5 A;  4LEJ A;  2QTW B;  5I8Y A;  3ZFG A;  1XPW A;  2KA3 A;  1QWR A;  4Y26 A;  4LT5 A;  3PVO A;  3UJO A;  3M3E A;  1TNF A;  3NJV A;  3FBY A;  1FPN 1;  4JGY C;  3O1O A;  5FLH A;  2JEC A;  5HV0 A;  1UZW A;  2WFF 2;  3VKF C;  3WP5 A;  3PTY A;  4AVB A;  1OVP A;  5JZG B;  2JKX A;  3POI A;  1GSL A;  4QPI B;  2GU9 A;  1YJL A;  3C3V A;  5D8A B;  1ND2 B;  3ACL A;  1GLH A;  2RG4 A;  4Y1V A;  4IEY A;  2XDV A;  3WT3 A;  4CP0 A;  5JIU A;  2CYF A;  2BOI A;  5FIX A;  3W59 A;  2E31 A;  5LA1 A;  5CB7 A;  5IFT A;  1J3Q A;  2Y60 A;  3PUH A;  1BHG A;  1MQT A;  5L73 A;  1ASJ 1;  2G9Z A;  5T3N A;  2RHP A;  2RM2 3;  2SBA A;  3VGI A;  2ET1 A;  1OOP B;  1K5M C;  1Z7S 1;  4FO9 A;  4ITC A;  3ZFE C;  1F4H A;  1W0N A;  3A7Q A;  2C26 A;  4CDW A;  1WW4 A;  2HBU A;  1AYN 1;  2OS2 A;  4CEY C;  3RZM A;  3POE A;  3PUR A;  5AC9 1;  3MYX A;  3OPT A;  2VOT A;  1YQ6 A;  2GNM A;  3TEY A;  2V4V A;  1QU0 A;  3BU0 A;  1H4G A;  3MIF A;  1XRU A;  3JB4 C;  4FFH A;  4RR3 C;  2WZP P;  1AR6 1;  4QB1 A;  1UPI A;  4N43 B;  3VBR C;  5JWP A;  2RJK A;  3RJR A;  2GNT A;  1VRH 1;  2C9K A;  4CEY A;  3LCP A;  4NII A;  1GV9 A;  4N7U A;  5C9A C;  5DPN A;  3NAP A;  1LOE A;  5EPA A;  4C91 A;  2DVA A;  5F3C A;  2ARA A;  3CKH A;  2VGD A;  1W0P A;  2Q0A A;  3D8C A;  3FL7 A;  4KGG A;  5E89 A;  3SH3 A;  2QQM A;  1R1A 3;  1VR3 A;  1W8F A;  2VMH A;  3BPZ A;  5FYB A;  4R4Z A;  5BPX A;  4HN0 A;  2KD7 A;  4AVT A;  2D7F A;  3QLQ A;  4AQS A;  5FJH A;  5HPO A;  2JXA A;  3UV9 A;  4CCL A;  4EZ4 A;  3T2T A;  4A7Y A;  4EWE A;  3LEI A;  1LHU A;  1QHD A;  3PVE A;  2QQL A;  1R08 3;  1T6G C;  3H3U A;  3HQU A;  4Q4W 3;  5I0U A;  5L9B A;  4AHW A;  4JKL A;  2WLQ A;  1OQD A;  3J7N A;  1PNF A;  3N9N A;  1W05 A;  1EY2 A;  2B45 X;  3RMY A;  1RIR A;  1K5M B;  3ME2 A;  2JD4 A;  3N7L A;  2JB4 A;  3E5Q A;  3WD5 A;  1FV2 A;  4QDR A;  5FXX A;  5FFO C;  3KV4 A;  4CA9 A;  4DPN A;  3GZA A;  4E4H A;  5IVB A;  4FXG B;  3N4M A;  1TME 1;  1C57 A;  2OT7 A;  5KWR A;  2VZV A;  1AL2 3;  1SBE A;  3J4U H;  4MG2 A;  5FZH A;  3KM5 A;  4HFS A;  4Q4Y 2;  5DDJ 1;  4BYY A;  3RVH A;  1PVC 1;  1XYO A;  2CWM A;  2G1M A;  5CFD A;  5FZ9 A;  5C9A B;  1DYK A;  4XIK A;  4AF9 A;  5GAL A;  2ZGL A;  1OHF A;  4CEW A;  1UU6 A;  5F3G A;  4B4Q A;  4C1X A;  1Q8V A;  2YUE A;  4LA3 A;  2GC2 A;  4LOT A;  3B9C A;  2G4I A;  3ZR5 A;  3JCI A;  3WW1 A;  3AJZ A;  4L9B A;  1SEF A;  4LHK A;  3MBW A;  5DAX A;  2EXJ A;  1BCX A;  4YG0 A;  1IS4 A;  3HVD A;  3HBZ A;  4QX3 A;  1NCR A;  5CKM A;  2BNN A;  4BJ0 A;  1UY3 A;  2IVJ A;  5L9V A;  1XOY A;  2PEL A;  2H0V A;  4KWK A;  1JZ8 A;  2V5D A;  3ZYB A;  4E4S A;  3OBZ A;  3NV1 A;  5L7O A;  1GZC A;  3I2H A;  4Y5Z 0;  1EYB A;  5CYY A;  1GR3 A;  1WWY A;  2P6C A;  1D7P M;  4RQP B;  1J1T A;  3IAQ A;  1QH6 A;  3DYM A;  2C9A A;  2A70 A;  3MIG A;  1RUF 1;  2CDP A;  3GF6 A;  4CTE A;  1WW7 A;  5L36 A;  2V4A A;  2V09 A;  3OGS A;  2JD9 A;  4EWA A;  4F3J A;  1NCQ A;  2EID A;  4P9J A;  1RUC 1;  1PX3 A;  4OUM A;  3ELN A;  5DAW A;  1LHW A;  1B35 A;  5F5Q A;  3WP4 A;  1V6J A;  1VBA 3;  4YGB A;  2A6Z A;  1MZ5 A;  2VXR A;  2DUQ A;  2BZD A;  2WWJ A;  5FY7 A;  2NQY A;  1RXG A;  2VUC A;  4L2N A;  2OA2 A;  5CFD B;  1SLI A;  3V0B A;  4OMD A;  3AP5 A;  4AR2 A;  1RVF 2;  4E2G A;  3ATG A;  3VHO A;  2FD8 A;  4YNI A;  3I7D A;  2WAA A;  4GJZ A;  1K42 A;  3B5L B;  4NAM A;  3AB0 A;  3ZM8 A;  3LQC A;  3T2O A;  3CMG A;  3CZJ A;  3POG A;  4YFW A;  5I0R A;  2CGO A;  3KB5 A;  4QWN A;  5FQ0 A;  3VBU C;  4CP9 A;  2P6H A;  5LBF A;  1A6C A;  1W06 A;  4R9B A;  2JDU A;  2FDJ A;  1I3H A;  1AL0 G;  1DGW A;  3Q8F A;  2P3Y A;  2YZ4 A;  4IER A;  5FY1 A;  4LKE A;  4I0A A;  4Q8K A;  2B46 X;  1J59 A;  4PDW A;  3WLU A;  2PN5 A;  3BOW A;  3ZYR A;  2CAV A;  4XJ9 A;  1IKP A;  2L9L A;  4RYD A;  3USS A;  1R09 2;  2RR1 3;  1X7N A;  4DUV A;  1W6N B;  5GZC A;  4KMQ A;  2RS5 3;  4LIV A;  3Q8A A;  3CDZ B;  2WSU A;  2Q8D A;  2XJT A;  2JDK A;  1ZRI A;  2LTN A;  1HIX A;  3K3N A;  4ZU5 A;  5IWF A;  4HL0 A;  5JCT A;  2QCS B;  2Y64 A;  1XE0 A;  5CIS A;  4FAG A;  3RYP A;  3O0X A;  1W6M A;  4S2F A;  3RPQ A;  5FYT A;  5KBF A;  4N43 C;  1MZE A;  1IS6 A;  2Y33 A;  4P02 B;  2RR1 1;  1V6K A;  1O4Y A;  4M0N A;  3AKQ A;  1DZQ A;  1RUE 1;  1CES A;  1J1L A;  5GLU A;  3TEX A;  1QQP 3;  2JX9 A;  2IUW A;  5FZ1 A;  4CDQ B;  4LK6 A;  1OH3 A;  2GAL A;  1PGL 1;  1SZB A;  3O1R A;  1XE7 A;  4IE5 A;  4O9E A;  1ZRD A;  1Z7S 2;  1OOP C;  2VZS A;  3Q9O A;  4M4R A;  3ZN6 A;  1XB9 A;  2BRT A;  1V6O A;  4K40 A;  1TMF 3;  1SFP A;  5LAT A;  5C9A A;  5LBE A;  3NRU A;  4YG3 A;  1C5H A;  4Y5T A;  5A7O A;  5CFC A;  3SIT A;  4CDU B;  3KGZ A;  3ACH A;  3MIC A;  3KHB A;  3NST A;  2R07 1;  4QXK A;  4ZZ8 A;  2RM2 2;  3OY8 A;  4AHZ A;  3NNM A;  1IKQ A;  1PMJ X;  1SFN A;  4P9X A;  4K7J A;  4OHW A;  1G86 A;  5LY2 A;  1OSG A;  4LHS A;  1PK6 A;  4GAZ A;  4XFH A;  1MEC 2;  1TMF 1;  2JDZ A;  4QQH A;  4LHN A;  4CU9 A;  5J09 A;  2A73 B;  4HSL A;  2FCV A;  2QDR A;  5FK8 A;  4WM7 A;  1DQ1 A;  4URT A;  2D6L X;  4OQ9 A;  1SLC A;  4NN0 A;  3SNM A;  1XQN A;  3OG2 A;  4OYU A;  1QH7 A;  3AKS A;  5LRR A;  2DCK A;  3FC0 A;  1LRH A;  4XBL A;  2P17 A;  4QXH A;  1NXM A;  4IXL A;  3AYE A;  1SAC A;  2VBP A;  1IPK A;  1AYM 2;  3LEG A;  1KQR A;  1N1T A;  1Y9Q A;  1PZ9 A;  2ZX0 A;  2AR6 A;  4MGZ E;  4NRP A;  3AL6 A;  4XCA A;  4CCJ A;  4FBF A;  1JOP A;  4XBN A;  5FUI A;  3O1S A;  3R05 A;  3S57 A;  2ZGT A;  1COV 3;  1Q43 A;  2IXI A;  3WF0 A;  2WFF 1;  3ZN5 A;  2VE1 A;  1WBL A;  1FXZ A;  3WW2 A;  3LZZ A;  4AFM A;  1QXR A;  3M3C A;  2HWE 1;  1JOD A;  1RJ7 A;  4RQP A;  5LWB A;  5JOX A;  2GND A;  4LA2 A;  1F5J A;  4I0W B;  2P5B A;  4XPV A;  1OLM A;  3V0A A;  4CSW A;  4FTB A;  1HLC A;  3S5Q A;  1W0O A;  2CWS A;  1MS9 A;  1RUC 2;  4HVR A;  1LU1 A;  4AK3 A;  2ORZ A;  4WVZ A;  1H2N A;  2TEP A;  5AFE A;  5ANQ A;  3FBM A;  1K5J A;  2WIN B;  2A6W A;  4HPK A;  4NMI A;  3FLT A;  5JSO A;  3H1Y A;  5F32 A;  2P3I A;  3LIH A;  4LUM A;  4HKO A;  5GLT A;  4ARX A;  4KQ7 A;  3U11 A;  3FHI B;  4QHZ A;  4A42 A;  4AG4 A;  5ABJ C;  4LOS A;  2BBA A;  4AGR A;  2DVB A;  1O3T A;  5FZ4 A;  1PM4 A;  4MX3 A;  4DXR A;  1NQJ A;  1YEW A;  5EJ1 B;  1CAX A;  3AZX A;  2VZT A;  5A6Q A;  3SLI A;  5BNO B;  5CAZ A;  1JBC A;  1RXF A;  2WNE A;  3CO2 A;  4A4A A;  2ZOE B;  4YW5 A;  4Q4V 2;  4DIN B;  5FCC A;  1RUF 3;  4BPZ A;  2RS3 2;  2IXH A;  2WO1 A;  1G6N A;  1YQ8 A;  3QCW A;  5FJK A;  3S0M A;  1AR7 1;  3IDB B;  1PVX A;  4GH4 B;  3SC7 X;  3K75 B;  4B8E A;  3MID A;  4ES9 A;  2WA4 A;  3WVJ A;  2XGX A;  5E6H A;  3T4H B;  3LFI A;  4CXX A;  2ARX A;  1V6M A;  4LO8 A;  1AXY A;  3VD5 A;  1RUD 1;  4A44 A;  1PO1 3;  2QQN A;  2XWJ B;  3JUU A;  1BBT 1;  1OPO A;  5FWJ A;  5H9Q A;  3U75 A;  4DS0 A;  3O7O A;  5JVV A;  2Q8O A;  2A3X A;  5FZC A;  4EN9 B;  3UT0 A;  3ILR A;  3H1W A;  2W3J A;  4QPG C;  3VBS B;  3WQ0 A;  3D4K A;  3IKW A;  3MF9 A;  3GBG A;  3ECQ A;  3V65 A;  4NPL A;  4Y4R A;  1EAH 3;  3I2F A;  2ZEZ A;  4QX1 A;  1MVQ A;  1KD7 A;  2HYK A;  2Z2S B;  3E97 A;  1F5F A;  2VVF A;  1J84 A;  3SMH A;  4E8C A;  1LGB A;  2NMN A;  2CHH A;  3JXS A;  3HN1 A;  4CUC A;  2WAO A;  1MZ6 A;  2JG8 B;  4QKD A;  1O91 A;  1Z0H A;  2QQK A;  3GBW A;  5FZI A;  3APB A;  2LS6 A;  1MS0 A;  1N3O A;  3I4I A;  3H7J A;  3V56 A;  1JZ5 A;  3CJI B;  2HWF 2;  2PMW B;  3KF3 A;  4XQW A;  2HWB 2;  5EXO A;  2RMU 3;  4AAX A;  2RE9 A;  4GJY A;  4QQP A;  3VDC A;  5BNP A;  3ZO0 B;  4XUN A;  2GSY A;  2XOM A;  3E1F 1;  1ZBE 1;  1PIV 3;  2D3S A;  3M3I A;  1RUJ 2;  2RDR A;  4P00 B;  2VG9 A;  3NNG A;  1PMI A;  1CZV A;  2YRO A;  2D6O X;  5GLZ A;  3WF2 A;  1KS4 A;  4BQW A;  2LRP A;  1QJY 2;  3A23 A;  3BTA A;  1W6O B;  1D2Q A;  3DYO A;  5JAX A;  1KDM A;  1ZRR A;  1SLA A;  4GUL A;  1K12 A;  3A22 A;  4NR1 A;  4AEM A;  4P9W A;  4P5Y A;  1HB1 A;  2E9Q A;  5C8W A;  3H50 A;  1WUV A;  1LKN A;  1OT5 A;  3VDD A;  4BQ1 A;  4EZH A;  2ZJC A;  4AAP A;  4QPG B;  4CVU A;  1BBT 3;  2DVD A;  3WF1 A;  2O1Q A;  4O7X A;  2UU8 A;  1NCQ C;  1UYZ A;  5J96 B;  4ORF A;  3WXP A;  1L3J A;  2A3Y A;  3OCP A;  2YXS A;  2QE3 A;  3PJQ A;  5FK7 A;  3DXU A;  2QQV A;  3OEB A;  3WQ7 A;  1YLL A;  1RYY A;  4AFA A;  4I01 A;  3E5X A;  5GKA C;  4BME A;  4N7I A;  3MLJ A;  3TEW A;  1DBN A;  3AL5 A;  4C8D A;  4MGQ A;  1I5P A;  1MVE A;  5EFU A;  1CIY A;  4LLF A;  4LO6 B;  4OI4 A;  4MGK E;  3WUD A;  1H1I A;  1WD3 A;  4XOG A;  4TYS A;  3ZPY A;  1JW6 A;  2W91 A;  4XJA A;  2R1B A;  2VME A;  3VZJ A;  3RQ0 A;  2EXI A;  3ENR A;  3ZN6 B;  5A6Z A;  1GZW B;  3BB6 A;  2XBO 1;  4XFI A;  3U37 A;  2AH2 A;  3PUS A;  4ZU7 A;  3SH4 A;  4CPB A;  2VCB A;  3I2G A;  3AVS A;  5FZE A;  2TNF A;  5JUV A;  4CEW C;  4LE4 A;  2W0X A;  4PT6 A;  1HXS 1;  2P37 A;  4AGG A;  1SCS A;  4P9L A;  1GP5 A;  1UD1 A;  4FFG A;  5F1R A;  5F3E A;  3VZL A;  3NMB A;  5A3U A;  1UKR A;  5A1F A;  3RG0 A;  4YVS C;  1ULP A;  1GYK A;  2PTM A;  2DUR A;  1IPS A;  2H6B A;  2JJ6 A;  4PIY A;  5K9Y A;  2HWD 3;  5JI7 A;  3EYP A;  1E5S A;  1ZZ6 A;  3ROU A;  3HIF A;  2W94 A;  1NA1 B;  1JYW A;  1S0I A;  2JKB A;  3C7G A;  4MET A;  5IVY A;  4YAR A;  1O3Q A;  1QDO A;  1O7F A;  1RIN A;  1YXW A;  2VAU A;  4LBN A;  3SKV A;  1UO9 A;  1DIW A;  1WME A;  4MHU A;  2WRA A;  5T5O A;  1WA6 X;  1VRB A;  4N9H A;  2VCA A;  1KDK A;  1W6P A;  4KG0 A;  3WW4 A;  3B93 A;  1JHJ A;  3WCR A;  3L2Y A;  1E57 A;  2O0O A;  2XG3 A;  3BUC A;  1OA4 A;  1VBB 1;  5FP7 A;  3C7H A;  2XLG A;  4YGE A;  3U0Z A;  2Y6F A;  1VAM A;  1FMD 1;  2XHK A;  1ZZC A;  2Z4F A;  4Q4Y 3;  3LGR A;  4FPH A;  4ISR A;  3ES1 A;  2XJQ A;  3CEW A;  4XIO A;  2ZGS A;  3OUH A;  4AOC A;  4FAH A;  1KJL A;  1CON A;  4JCK A;  3ILF A;  2HYX A;  2ATF A;  2X53 S;  4P9I A;  1HW5 A;  4UFM A;  2WC2 A;  1MS8 A;  3B9I A;  5DZG A;  3QOP A;  4COW A;  1W6Q A;  2NZ9 A;  3I3B A;  1W2A X;  2Q1M A;  1UW8 A;  3B01 A;  2QQU A;  2C1F A;  3VBH C;  2C0Z A;  5BXX A;  1XYP A;  1IG0 A;  5FP3 A;  4RS5 C;  1W8N A;  2XXZ A;  3R4U A;  2UYB A;  1VBE 1;  2BQP A;  3LB9 A;  1HRV 1;  1Y9M A;  3KMH A;  1UOG A;  2B7Y A;  2C6S A;  2YBP A;  2VNV A;  1RVF 1;  2W1S A;  2CU5 A;  2AGS A;  3GZE A;  2HWD 1;  3HWJ A;  1C4R A;  2PHT A;  3JB8 A;  5I8T A;  3WV6 A;  5KHJ A;  1QNY A;  4IE6 A;  2AYH A;  2HH9 A;  2JDM A;  4IV3 C;  1XNK A;  5LK5 A;  3O1U A;  1JHN A;  5FP9 A;  2AC1 A;  5JIA A;  2ID4 A;  1W6O A;  4TXW A;  4NWW A;  5GLV A;  1JU3 A;  2J1V A;  2R0F A;  1TG7 A;  3ZOI A;  2VUL A;  5LBC A;  4DRR A;  2E53 A;  2OUH A;  3N7J A;  1AUY A;  1W6N A;  2W1W A;  3WCS A;  5J36 A;  2F17 A;  1CPM A;  2JG9 C;  3MIH A;  1QQP 1;  2VXJ A;  4KNC A;  3SKJ E;  4YZ2 A;  5A3T A;  3I2I A;  4XF9 A;  2XJU A;  4BQ3 A;  4EJR A;  5LEJ A;  3VBO C;  5JPM B;  1B09 A;  5EHD A;  2HKX A;  1CWP A;  3HQR A;  2X10 A;  1POV 3;  4JQT A;  2HWC 2;  1UY1 A;  1CIW A;  1FOD 3;  2R7E B;  4RHV 1;  1AR9 3;  3KQ4 B;  4GAL A;  5CKQ A;  2E7Q A;  3OEA A;  1S2B A;  4OMC A;  1AYN 3;  2G9F A;  1V00 A;  3LWC A;  4IV1 B;  5G05 L;  5I91 A;  3LAG A;  2Y0O A;  3NAP B;  2BNM A;  2RJ2 A;  2OQ6 A;  5LB6 A;  4AVV A;  1J3P A;  1GQH A;  5J98 B;  1ACC A;  1HKD A;  3MO4 A;  1D0G A;  5ERL A;  4WZC A;  2FDG A;  2VBB A;  4NWV A;  4OZX A;  4BWO A;  4JRL A;  4BLI A;  1OMI A;  1QKQ A;  2X29 A;  2RS5 2;  4IGO A;  2K0G A;  4O9G A;  5T55 A;  1CAV A;  4U36 A;  2OZ6 A;  2XPJ A;  4JRA A;  1UX6 A;  1VBC 1;  4E9K A;  2ZS6 B;  5FPB A;  5GLW A;  3M4F A;  4XHB A;  3ZMN A;  1BK0 A;  1W8W A;  4IEZ A;  3RYK A;  3GBF A;  4MXW A;  4LBM A;  3T4V A;  1RUJ 3;  1IQD C;  3B69 A;  1O5U A;  3DCQ A;  1F15 A;  4RA0 A;  4WVM A;  3E6C C;  1Q3E A;  2R1D A;  2WNV A;  2W1U A;  1OLQ A;  3TEZ A;  1CJP A;  1NE6 A;  4HAN A;  4PF1 A;  5IK8 A;  4TTG A;  2R06 2;  4MOA A;  2HWB 1;  1ULO A;  1ASJ 3;  1NAE A;  2WYS A;  1EUT A;  4AI1 A;  4IGQ A;  1VMH A;  1GWK A;  1OLM E;  5DXD A;  3ORJ A;  5JXJ A;  1MEC 1;  1TMF 2;  4KI5 M;  5FYC A;  3BIW E;  1UZZ A;  5JDB A;  2E32 A;  2P2K A;  2VZU A;  4OUE A;  4EE2 A;  3LSE A;  2YDE A;  3B3Q E;  3IPV B;  2JIJ A;  5FO9 B;  2VY0 A;  5IJR A;  1FOD 1;  1OH4 A;  4AI8 A;  2IXC A;  4GZ9 A;  3ZLI A;  2ES3 A;  2LUW A;  3OGR A;  5A70 A;  1RHI 2;  4DO0 A;  4ZS2 A;  2QQI A;  1Q8Q A;  5EWS A;  5HV4 A;  1MS4 A;  2V73 A;  2DDU A;  5K4L A;  4UXA A;  5KHH A;  5EYX A;  4W65 A;  3I3Q A;  5FZL A;  4FPO B;  5ISL A;  2X09 A;  3V0A B;  3WDU A;  1IPJ A;  1RUH 1;  3TNQ A;  4IND A;  5IVC A;  1FT9 A;  1QJZ A;  4XF0 A;  3KT1 A;  3WNN A;  5A32 A;  1JYI A;  1ZBA 3;  3M1H A;  3WHU A;  4AI3 A;  5HCA A;  1NQD A;  2W5F A;  2E63 A;  3CHX A;  1U0A A;  1W04 A;  3RI8 A;  2GH2 A;  3KVA A;  4MZU A;  1LTE A;  1COV 1;  3POY A;  1LUL A;  2WSV A;  1UOB A;  2RDQ A;  1RC6 A;  4B4R A;  1SG3 A;  3OBA A;  2XBO 2;  4LMF A;  2HWE 3;  3JZV A;  4M01 A;  4WM7 C;  4NO4 A;  1NT0 A;  1AF9 A;  3ZDS A;  4UF0 A;  4EN6 B;  5CKN A;  4FPL A;  4K21 A;  3HEI A;  2PLV 2;  1S0J A;  3MFA A;  3R4D B;  1WCU A;  1VIW B;  2VQ0 A;  2OPK A;  1FMD 3;  4Z82 A;  2PXJ A;  2DU1 A;  2BFU L;  4RSU A;  3RZL A;  2CTV A;  4PHZ A;  3TN9 2;  1GWM A;  1XYN A;  5C5T A;  3KV9 A;  3JBG 3;  1M06 G;  2E7A A;  1LHN A;  1CZS A;  4HSJ A;  4GH4 A;  3OF1 A;  4Y24 A;  3ZSL A;  4CCC A;  4Y5S A;  1QXP A;  3S6P A;  3SXW A;  4AVC A;  1NA1 C;  5FQ0 B;  3POF A;  2ILM A;  2XQR A;  4OCT A;  1WD4 A;  2GH8 A;  4LHL A;  4SBV A;  4Z8B A;  1OFN A;  5FO8 B;  1U5X A;  3BIE A;  3NNJ A;  4AE2 A;  4CUA A;  2VMD A;  1LOC A;  1MR5 A;  4HG6 B;  1AR9 1;  2XR4 A;  4GWM A;  4MYE A;  3DYP A;  4JGY A;  3NJY A;  1NCR C;  2ERF A;  2GC0 A;  2D3P A;  4XJU A;  3VBR B;  3VDD C;  3CIH A;  3K77 A;  2WUH A;  3VBS A;  5DG1 A;  1OBN A;  1VBE 3;  4WV8 A;  1JXN A;  4ZPI A;  1KJR A;  1DYO A;  2RS1 1;  3ETP A;  5EQU A;  1H2K A;  3J9S A;  3RZZ A;  1RUG 3;  1LOF C;  1RUH 3;  2PA7 A;  4KU7 A;  1QGL A;  1NY7 2;  5FYH A;  2BWC A;  3K2O A;  4TZD A;  1N47 A;  3ZYH A;  4RS5 B;  1WA4 A;  1BQP A;  2Q5T A;  2WA3 A;  1U5Z A;  3NJX A;  4BA6 A;  1YCI A;  1BEV 1;  3FE5 A;  2VVD A;  3DPR A;  2QKD A;  1RUD 3;  5IAV A;  4FI9 A;  2VOW A;  3N9Q A;  1LOF A;  5A6X A;  5KR7 A;  2FDH A;  1UX7 A;  5CBL A;  1G9C A;  1GNZ A;  1X33 A;  2VW1 A;  1C8N A;  2ZMK A;  4CDQ A;  2X5I C;  4LJH A;  3NKT A;  4D6S A;  5JXH A;  1O3S A;  4A6O A;  5FMB A;  1XC6 A;  2NMO A;  1APN A;  5A3N A;  2DTW A;  3T1L A;  3U10 A;  3I49 A;  2B5H A;  2FHR A;  1JZ3 A;  1UYY A;  3OBT A;  5ACA 3;  4M3C A;  2VQU A;  1AVB A;  4FCA A;  4LO7 A;  4XXP A;  1HRV 2;  1OF4 A;  5E1R A;  4YWA A;  3J8F 3;  4DB5 A;  3VHP A;  4UFL A;  4UAP A;  4MHR A;  4MGS A;  1RUO A;  1YC6 1;  4MO3 M;  4H55 A;  2QNK A;  3GJB A;  3FJS A;  4BHP A;  1OF3 A;  3AMN A;  4WVV A;  1UL9 A;  3SIS A;  2YYO A;  4J6G A;  4JGZ A;  3HPN A;  2Q8C A;  1C8M 3;  3III A;  2HWF 3;  1Y4W A;  5A3M A;  5FZG A;  5JLV A;  3OYW B;  4KWJ A;  1REF A;  1ZBE 3;  2BFU S;  1W2N A;  1YWK A;  1HJG A;  2RMU 2;  1XSQ A;  2ZX4 A;  3ACG A;  5F9T A;  1WLC A;  1S0E A;  2F6B A;  2PHD A;  2ZXQ A;  4Q4X 3;  1AHS A;  3LPF A;  4CXW A;  3AP9 A;  2XBO 3;  2RS1 3;  1RJ8 A;  4JVA A;  2PHF A;  1I9R A;  5FY5 A;  3SEE A;  3POJ A;  4YFZ A;  1AYN 2;  4AYU A;  3PDQ A;  1NXD 1;  1UMZ A;  2BPA 2;  2VCM A;  1QJU 1;  2G19 A;  5KHK A;  3VBF A;  3U07 A;  4Q4W 2;  4DQA A;  5HXV A;  4Q0V A;  2VMG A;  5CAD A;  5CNA A;  1FMD 2;  4UF0 B;  4OFG A;  4BZ4 A;  2XUM A;  5J37 A;  2BNO A;  4Q0S A;  3MV1 1;  4NOT A;  2XVG A;  4JV4 A;  4QHO A;  4R9A A;  3MUY 1;  1GUI A;  5LBB A;  4RFT 0;  5A7P A;  5HBA A;  2XHN A;  5K0U A;  3WP6 A;  1C3H A;  2VNO A;  2ADD A;  2Y38 A;  4L8Q A;  2ZX1 A;  1XNA A;  5A7W A;  4QPW A;  5C3P A;  1ZA4 A;  2Y6L A;  5BNO C;  3NNL A;  3LDB A;  1GNY A;  4I3G A;  1HN0 A;  4BQ5 A;  1O8S A;  2EIB A;  5JXG A;  4XZU G;  5CG9 A;  5IK7 A;  1YIP A;  3BVC A;  4MGI E;  3RZG A;  1SPP A;  1EP0 A;  2ZGR A;  3VL9 A;  1EAH 1;  4QMA A;  1LU2 A;  2EXK A;  4A45 A;  1VBC 2;  1TZO A;  2EVX A;  1VBD 1;  2JDP A;  2PAM A;  1W6M B;  1ASJ 2;  1W28 A;  3JBG 1;  4LBL A;  1F8V A;  2XJR A;  1G9F A;  3J8F 1;  3HNM A;  5FPV A;  3GZT B;  1ENS A;  3GCW A;  1CPN A;  3HAG A;  1H6X A;  2IVI B;  2MPF A;  5KXB A;  2D43 A;  4HN1 A;  2V5Y A;  4HKL A;  3KCY A;  3VBF B;  2K9Z A;  4ASK A;  5K8S A;  1O59 A;  3VUO A;  1WMD A;  1W8T A;  5FYV A;  4NRO A;  1W2O A;  5FKC A;  1V6N A;  1OKO A;  1W8U A;  3E6B A;  5LY1 A;  4DRV A;  4ISQ A;  1HV1 A;  4P9G A;  3VLB B;  5IVV A;  1PO2 3;  1V70 A;  1ZYB A;  5FYS A;  3EB7 A;  3FN9 A;  1CAV B;  1WMX A;  2QDN A;  3VKL A;  3D0J A;  4QX5 A;  1EUU A;  2D97 A;  1PM7 A;  3K4Z A;  2WZ8 A;  1YFY A;  1EV1 3;  4Q2F A;  1O4Z A;  5FYY A;  4E2Q A;  2ZGP A;  1C28 A;  3I8T A;  5CFC C;  2Z42 A;  2Z5W A;  4QQL A;  2AAC A;  3QH6 A;  1DQ5 A;  1VBA 1;  1CGP A;  3ZXF A;  4LLO A;  4WVM B;  4XUQ A;  1LES A;  2EXH A;  3K4D A;  1RMU 3;  1OKQ A;  2WO7 A;  4DFS A;  4C90 A;  3VKM A;  4M4P A;  3IDC B;  3OGV A;  2D3R A;  1GZW A;  3HNY M;  4M3C B;  5FZO B;  5C3O A;  4CYD A;  1JMU B;  1RVF 3;  4FQ4 A;  3I59 A;  4GA9 A;  3LE0 A;  3U78 A;  1WLT A;  1XNT A;  3BTX A;  3VB9 A;  4YW1 A;  1R64 A;  1FI2 A;  2Q1F A;  4Z2W A;  3RZH A;  3OD4 A;  1Q8P A;  5DAV A;  3K48 A;  5AC9 2;  1YFX A;  2WZE A;  4L92 A;  3ZFG B;  3C7E A;  5IAX A;  2BBV A;  4L99 A;  4AQT A;  1VP6 A;  3G6J B;  3HJR A;  1JYN A;  4M00 A;  3O14 A;  3P5B A;  1WBF A;  5IVE A;  3EBR A;  3UET A;  2VZ3 A;  1XU2 A;  4Q1P A;  3VBF C;  5KHI A;  3RMX A;  2PAK A;  3FHA A;  3NJZ A;  5H9P A;  4CDX B;  2UYA A;  4HKW A;  1XXN A;  4UFJ A;  2P3J A;  3LD8 A;  4DY3 A;  1H30 A;  1A8M A;  4Z07 A;  1IZ3 A;  4XDQ A;  3RGB A;  4WZF A;  1WW6 A;  5AVA A;  3O5S A;  4BOW A;  3ZSK A;  4FFI A;  5K0U C;  4JDN A;  2JWP A;  5FBZ A;  4GXL A;  4XZP A;  4Y4Y A;  5TSW A;  3CZU A;  1PO2 1;  4RR3 A;  1S1A A;  2XKP A;  3N7K A;  3PIG A;  2VBD A;  1W8O A;  4OZO A;  4B29 A;  4GWI A;  4P08 A;  2QQJ A;  5EIY B;  1X9P A;  4CDU A;  2R6Q A;  1IG3 A;  4XUP A;  1CD3 G;  3VZO A;  2UWC A;  4ARY A;  4N53 A;  1IS3 A;  1H2L A;  4M0H A;  1K3I A;  1BKZ A;  1PIV 1;  5GZF A;  1R09 3;  1QQP 2;  2JEN A;  2RR1 2;  1VBC 3;  4QX8 A;  4AXO A;  5FR3 A;  2J1T A;  5F39 A;  4ONU A;  3LSD A;  4YW4 A;  4PLO A;  1W9S A;  4UW4 A;  2WN3 A;  5FZK A;  5LAS A;  3PVN A;  5DAB A;  3TBD A;  1UXX X;  4NIH A;  2C4X A;  5FPX A;  4ZHN A;  1R08 1;  2F4P A;  2NM1 A;  2O14 A;  3DGT A;  5FZB A;  3IMM A;  3FLR A;  2W87 A;  4YZ4 A;  4FPC A;  4LBQ B;  3KLS A;  2ZHL A;  1QF3 A;  1DQ4 A;  4YVS B;  2QJV A;  2V72 A;  1GFF 2;  3UKN A;  4QQO A;  1D4M 2;  1VRH 2;  1LOD A;  1AXK A;  3RZJ A;  5A7S A;  1GZT A;  4D0Q A;  3P3P A;  5JZG C;  2BGC A;  1HDK A;  3LF7 A;  1BEV 2;  4FPK A;  2ZMN A;  4QPI C;  5D8A C;  5FZ7 A;  2VVE A;  5CG8 A;  5FMC A;  2EIG A;  5I0S A;  2DCJ A;  5JPN B;  1DGL A;  3J7L A;  5HCF A;  1MZF A;  5JOY A;  1RHI 1;  1D0H A;  2ZGK A;  4CZS A;  1R1A 1;  4CPB D;  2B4K A;  3IDA A;  2RMU 1;  1X82 A;  4CCN A;  3VKN A;  1L7L A;  4LR4 A;  4CEY B;  1UZV A;  1L7Q A;  1V6L A;  5BNN B;  3CBN A;  2HBT A;  2QBX A;  3KT4 A;  5FZD A;  4JGZ B;  1WLD A;  3CNA A;  3N36 A;  2R0H A;  3AP6 A;  1HQN A;  3CU7 A;  1WMF A;  3GZU C;  3V0B B;  1COV 2;  2YGL A;  1XBF A;  2RS1 2;  1MPX A;  1SDD B;  4XE9 A;  3V64 A;  3ZXJ A;  4NUB A;  1A3K A;  2E6V A;  1URX A;  1HRI 1;  2ZKL A;  1ND2 C;  1VB4 A;  5FMO S;  1AR9 2;  4FT8 A;  4CCD A;  2O8O A;  2VOV A;  5FMD A;  4QB6 A;  4K9S A;  4BXS V;  2DTY A;  4S2D A;  3MW3 A;  2RM2 1;  4K8F A;  4QGN A;  4UI9 L;  1AX1 A;  1VBD 3;  4ES8 A;  5KC5 A;  2N7G A;  2VMF A;  3O1T A;  5H9S A;  4KL1 A;  2ZAH A;  4XAC A;  2D5H A;  3ZFE B;  1ND2 A;  1W8H A;  4Q29 A;  3USU B;  1LGN A;  5BYN A;  1EPW A;  2C5D A;  2G9G A;  1CX4 A;  3DEM A;  4E2S A;  4G3Y C;  4AED A;  1YUD A;  1KFX L;  1SLL A;  2IC1 A;  4XAB A;  1YNA A;  3VL8 A;  3IM0 A;  3PNA A;  1F4A A;  5FP4 A;  1DCS A;  2EA7 A;  4COU A;  1HQL A;  1SPP B;  3B7M A;  2J42 A;  3T08 A;  3HOB A;  1I5Z A;  5D21 A;  2ZAC A;  3POW A;  2PHW A;  1CZT A;  2VW0 A;  4UW3 A;  4FSJ A;  1RUF 2;  4XYX A;  1AX0 A;  4XUO A;  3DKQ A;  1JS9 A;  4XF4 A;  3WOG A;  3ZFG C;  5LW9 A;  1GMM A;  3GJA A;  3H7Y A;  3A4U A;  2W39 A;  2XJV A;  1OXC A;  3CLP A;  2VTX J;  5FOB B;  4KH9 A;  4P9Y A;  1AR7 2;  1CAU B;  2PHX A;  2PLV 1;  2BJS A;  1O4T A;  2WYF A;  1JH5 A;  3BN6 A;  3HT2 A;  3I2D A;  4LUK A;  4PQQ A;  4CDW C;  4URA A;  2QFE A;  4CDU C;  5KXC A;  4V2W A;  4YGC A;  3ZFE A;  2JIG A;  1VMF A;  3MUZ 1;  2PHR A;  4WM8 B;  4MSV A;  3DKW A;  3NQH A;  4AVA A;  4B1M A;  3CQO A;  2XLF A;  3CJI A;  2IFR A;  2OZJ A;  4FTS A;  4GQ7 A;  4BB3 A;  1F9K A;  3SHR A;  2A3W A;  2TBV A;  1W03 A;  2PLV 3;  3LA2 A;  2WFP A;  2BU9 A;  4YPJ A;  4QKB A;  3PME A;  1NCQ B;  5DQ0 A;  5FUP A;  3T1M A;  4ZZ5 A;  2CL2 A;  3AP4 A;  4XFG A;  2A5Z A;  2RS3 3;  2ZGN A;  1PO1 2;  2WO3 A;  4HLT A;  4NRM A;  5D1I A;  4LBQ A;  2XJS A;  2DUO A;  3D6E A;  4UYB A;  4X6Q B;  3GM8 A;  1ULC A;  5I0T A;  2B8M A;  3WDX A;  5BNP C;  3KCC A;  1N1S A;  3WG1 A;  2VZR A;  5CU1 A;  2XML A;  2ENR A;  3IT8 A;  4OHX A;  3RRD A;  4QPG A;  2DCY A;  2WS9 3;  3A0K A;  2WNV C;  1US3 A;  2HWE 2;  3QAC A;  4H7M A;  4JZR A;  2E33 A;  3D5O A;  4Y1X A;  3LEM A;  2Q30 A;  4YW2 A;  2P4E A;  3OUI A;  3NL1 A;  4AQ6 A;  3UES A;  1EAH 2;  4CUG A;  4CEW B;  1DG6 A;  1RL3 A;  4K20 A;  1IS5 A;  3HN3 A;  1BYH A;  1ZX5 A;  3LOI A;  2OXB A;  2QQO A;  2WS9 1;  4M3C F;  3OPZ A;  4Q0Q A;  2X5I B;  4LK7 A;  3LPG A;  4UBG A;  3LOB A;  5DZE A;  2XKO A;  2YBK A;  3RI9 A;  1PIV 2;  1OUR A;  2CY6 A;  4I09 A;  4AWD A;  2DVG A;  4RR3 B;  4NVP A;  4ZU4 A;  3ZXD A;  4B1L A;  1G9A A;  4YZ1 A;  1ZRF A;  4K3U A;  2XON A;  4FFF A;  3NWK A;  4DIQ A;  1GQG A;  1R08 2;  2H0B A;  1VAL A;  4LNV A;  5DDJ 3;  3AC0 A;  5SV8 A;  1HB2 A;  4O61 A;  4I02 A;  4B4P A;  1QJF A;  4XFB A;  4TLF A;  3CF6 E;  3FUQ A;  2D44 A;  3IIA A;  3JD7 2;  2R07 3;  2Q8E A;  4OI2 A;  4OI1 A;  4XMA A;  1Z78 A;  1QJY 3;  3MLL A;  2EIC A;  3B94 A;  1US2 A;  3H8U A;  1U12 A;  3NKG A;  4RS5 A;  3EQE A;  1B35 B;  4AHY A;  3J8F 2;  3E6D A;  5A6Y A;  2BYV E;  3H42 B;  3M70 A;  1SLT A;  2BGP A;  3OOX A;  2WQ8 A;  3SEP A;  1H8V A;  3IZO A;  1POQ A;  4OUS A;  4S2H A;  1AR6 3;  4COZ A;  5HCH A;  4YM1 A;  5FZM A;  2C24 A;  1W3X A;  2IXK A;  2FZ2 A;  4A7Z A;  1BJQ A;  1GIC A;  1ENQ A;  1RUD 2;  3AK0 A;  3VD3 A;  1OD3 A;  4XFF A;  1CX1 A;  1QJY 1;  1BBT 2;  4IET A;  2GP3 A;  4XQ4 A;  2VOX A;  4XEZ A;  4NHX A;  4NE9 A;  1UIJ A;  3GAL A;  5J48 A;  2ZAB A;  1DDL A;  1GU3 A;  5LA0 A;  4Q4X 2;  2YHJ A;  3KV5 A;  3ZXK A;  1YI9 A;  3ZIW A;  1SQ4 A;  1WZX A;  4D7T A;  3P6B A;  3L9J T;  5FZ8 A;  1A78 A;  1X36 A;  1OD5 A;  4IEV A;  1WCD J;  4A6S A;  2QUO A;  5BUV A;  5KC6 A;  2VW2 A;  4YVW B;  2I2S A;  5F3I A;  4I2O A;  5FUN A;  3MZH A;  4OQ8 A;  3AX4 A;  2XQX A;  1W90 A;  2GME A;  2VUJ A;  5C8C C;  2O8Q A;  1GOH A;  1Q8S A;  1HRV 3;  4NHL A;  5C7G A;  1RUE 3;  4I3P A;  4BCU A;  1FAT A;  4AGV A;  3WNK A;  3ZDV A;  4MGY E;  3UK9 A;  3C7O A;  4LIU A;  3GCX A;  2RJL A;  2SLI A;  3M3O A;  3QD6 A;  4QDQ A;  4W6Y A;  1Q56 A;  3DXT A;  1W6Q B;  4XXA A;  1DLL A;  2P34 A;  5B4N A;  4ET7 A;  2PHL A;  3MV0 1;  2PFW A;  3VDB A;  3UNP A;  2ZA9 A;  1ST8 A;  1SHW B;  4MLO A;  2DUP A;  5HI0 A;  2I74 A;  2WL1 A;  3BYW A;  4IEO A;  5GJ6 A;  4QX2 A;  2WWU A;  3U1X A;  3ZXL A;  4YZ3 A;  2YG0 A;  1QOS A;  2JDH A;  1XE8 A;  3ABZ A;  3PTR B;  4N8M A;  1HB4 A;  2ORX A;  1MS1 A;  1DP0 A;  4OVE A;  4GB3 3;  4I30 A;  4R4X A;  2DV9 A;  1PZ8 A;  1CAX B;  2WNU A;  3BPS A;  4RQP C;  1QY4 A;  3WDT A;  1DZR A;  2BEO A;  3USU A;  4OLL A;  4IQP A;  1RB8 G;  2VUD A;  1DGW X;  3ES4 A;  1PK6 C;  4YW6 A;  2WO2 A;  1JYX A;  2X5I A;  1PO2 2;  2VO5 A;  2VR4 A;  2A71 A;  4BK5 A;  3N7M A;  5E8A A;  4K1Z A;  3OJB A;  4B7K A;  2Y6K A;  3ITQ A;  4MGT A;  4BK4 A;  1EV1 2;  1UY2 A;  4NJ4 A;  2DWR A;  2LM3 A;  4BMB A;  5I93 A;  1LHO A;  2DCT A;  1UPS A;  2FMD A;  2J7M A;  3FFZ A;  4XQD A;  4CRQ A;  1JYV A;  4LKD A;  1O8P A;  4HOO A;  4JQR A;  5T50 A;  2JIC A;  4EYU A;  1CAW B;  2Y6J A;  1VBB 2;  2A75 A;  4W50 A;  3AZY A;  3VBH A;  2NLR A;  3WQB A;  4IV1 A;  1XJA A;  2WR9 A;  4V2V A;  2XH6 A;  4XJ8 A;  2MNG A;  2A6Y A;  4YGD A;  2JB8 A;  4Y1Z A;  2BP6 A;  4LE3 A;  4CCE A;  4AI2 A;  1PGW 2;  4B7E A;  2IZW A;  4K6B A;  5EP9 A;  4PLN A;  3FUO A;  2BUK A;  3PJY A;  2P3K A;  4XTM A;  4ZXK A;  3U14 A;  4FP3 A;  3WQ1 A;  4AZZ A;  1TME 3;  3W5N A;  2A7A A;  3OB8 A;  1WKY A;  1JZ7 A;  5FO7 B;  4IUG A;  4IE0 A;  4FTE A;  1FX5 A;  4BIF A;  1OOP A;  2ZZJ A;  5L7O C;  3ZXE A;  5IT6 A;  1LOG A;  2I07 B;  2NYY A;  4BIS A;  3MF6 A;  3M8L A;  1N1V A;  3S7E A;  1GZ9 A;  3WIN E;  3HNB M;  2J1E A;  3MDP A;  4XUT A;  4QQ2 A;  5IK5 A;  2VNG A;  3VBS C;  4EQV A;  3RYR A;  4IES A;  4ERO A;  4JDO A;  4XTP A;  3AKP A;  1QIQ A;  2ARE A;  2KXL A;  2R04 2;  3C8X A;  4N43 A;  5FZ0 A;  4E27 A;  2OYZ A;  1DU3 D;  3H1M A;  4TWT A;  1A8D A;  5FY9 A;  2XUE A;  2UUR A;  3KSC A;  4CE8 A;  1UY0 A;  4XC9 A;  1S0D A;  5LEK A;  2CGN A;  1FPN 2;  1RED A;  3VDA A;  1ZBA 1;  4GH4 C;  1HV0 A;  3ACI A;  2YPD A;  1KRI A;  1SLB A;  4CXY A;  1D4M 1;  2D93 A;  1AXZ A;  2DFB A;  5KXD A;  2R06 3;  4RL7 A;  1BVP 1;  3M2M A;  2Y26 A;  1PNG A;  1TE1 B;  4IL7 A;  4CDQ C;  5FOJ B;  1MQT B;  2BDR A;  1H0B A;  2IXL A;  3I97 A;  3AFK A;  4LBK A;  4WBB A;  5FPZ A;  4A2U A;  1XNC A;  3WNP A;  2OX0 A;  4FQZ A;  1YRZ A;  2VQT A;  4KG8 A;  4LIT A;  4EN0 A;  3H3Z A;  1R1Z A;  1X9T A;  4QM9 A;  4CP9 B;  1DF0 A;  4K8R B;  1JYT A;  3OGG A;  1IGO A;  1S2E A;  2WNU B;  3B02 A;  3RWN A;  5DUU A;  3SCG A;  1H9W A;  2RV9 A;  5A33 A;  4AI9 A;  3O12 A;  2W95 A;  4CCK A;  5C8C B;  3BI3 A;  1LED A;  3WW3 A;  5DAP A;  2W1Q A;  1JZ4 A;  4ATE A;  3PUA A;  4RGK A;  2A1X A;  1TNR A;  4YW3 A;  1RHI 3;  3JD7 3;  2VZ1 A;  1ND3 A;  5F8P A;  3X29 B;  2LRO A;  3IB3 A;  3TRS B;  1XSR A;  1X8M A;  4L97 A;  1DQ2 A;  1BK1 A;  2FDF A;  3HD8 B;  4SLI A;  3T2Q A;  3WNL A;  1AR6 2;  2XVK A;  1JUH A;  1ZM1 A;  4JKM A;  4LO5 B;  4Q4X 1;  4XHX A;  3O1P A;  1BMV 2;  3RFR A;  2BGO A;  3F2Z A;  3WG2 A;  2VL4 A;  4Z2A A;  4R9D A;  1GWL A;  4A3X A;  1CAW A;  5CIR A;  4QXB A;  2X05 A;  3OBR A;  5APA A;  2ETE A;  4XMI A;  3ZMO A;  4DOU A;  2D5F A;  4DXZ A;  4YYO A;  2E51 A;  1UU4 A;  4W6W A;  5IUQ A;  4BE3 A;  4JX0 A;  1S0C A;  4LKS A;  3AVR A;  4RHV 2;  5JI9 A;  5G04 L;  1BEV 3;  2ZGO A;  1QNW A;  4IDZ A;  1QJE A;  4P5H A;  4XW3 A;  5FPU A;  3ZXG A;  3DN7 A;  1TME 2;  4NHY A;  5C3Q A;  2WLP A;  4YM0 A;  5FBJ A;  1FNY A;  5DAQ A;  3LEK A;  1EV1 1;  2Q4S A;  2ZML A;  2YFU A;  3KS7 A;  5F6L B;  3OY8 B;  5F2S A;  2D6N A;  1UWW A;  3Q8E A;  4MXV A;  2WNU C;  3WDV A;  4C0H A;  3I3M A;  1N3P A;  5FV3 A;  3NAP C;  1ND3 B;  1NX9 A;  4FOV A;  4L11 A;  2AUY A;  2X8K A;  1ULD A;  2OUJ A;  4PJY A;  2WN2 A;  5FTT C;  4HVQ A;  1LAJ A;  3E5U A;  1XNB A;  1DHK B;  3D82 A;  3OUJ A;  1T2X A;  1LNS A;  1W2T A;  1M4W A;  3M3Q A;  1SBF A;  3L2H A;  2B39 A;  4CP2 A;  4QU1 A;  4FOY A;  1IOA A;  3NV4 A;  3TB0 A;  3PIJ A;  4ZON A;  3U4S A;  5IAT A;  1BVV A;  3J7H A;  4QAW A;  2VTF A;  1WCS A;  3JD7 1;  3MI8 A;  5JOW A;  2BTV C;  2OVU A;  2ZHK A;  1S0G A;  4CU6 A;  5ABJ B;  2VOK A;  4PBO A;  5A7N A;  1FPN 3;  2GN3 A;  4X8N A;  3WY6 A;  4GKY A;  1J3R A;  4L0P A;  2JDN A;  3N9M A;  1CVN A;  2EIE A;  3ASI A;  1NCR B;  3BOD A;  3INA A;  1PK6 B;  4CDW B;  2ET7 A;  5E88 A;  1LOA A;  1GQP A;  1FNZ A;  4YSF A;  5C5U A;  4NIA A;  5GM0 A;  2ADE A;  2ARC A;  2ZGQ A;  4N53 B;  2XJP A;  1I1E A;  3MIB A;  3UGG A;  5J1X A;  1PVC 2;  2PYT A;  3H0O A;  4DEV A;  5FZ6 A;  5LA9 A;  2A6V A;  1PZ7 A;  4IE7 A;  4JAA A;  2XL7 A;  3T3Y A;  4QXC A;  1UQX A;  3FFQ A;  4BM8 A;  3OSD A;  3EMR A;  1RMU 1;  4Q0U A;  3K3O A;  1PO1 1;  1HB3 A;  3URF A;  4QX0 A;  4DUW A;  5I8S A;  2XVL A;  3NVC A;  4NHM A;  1ND3 C;  3WEZ A;  4CCO A;  2JG8 A;  4QKN A;  5JZG A;  5B4X A;  1VBB 3;  2FCU A;  3O1V A;  1HN1 A;  1RUH 2;  1KFU L;  2ZHN A;  3VV1 A;  1U5I A;  2JE8 A;  2FDK A;  1KIT A;  1ODN A;  1YIF A;  2OII A;  1PGS A;  1C8M 1;  1OFS A;  1VPH A;  1J58 A;  3ZSM A;  1S0F A;  1UXZ A;  2ZZQ A;  4Y1U A;  3THT A;  1CR7 A;  1W9W A;  2D40 A;  1YFW A;  5LCW L;  1MQT C;  5A32 B;  1N1Y A;  1RUI 1;  4XDO A;  4JTN A;  1NLR A;  4Z1V A;  1ZZB A;  2W9X A;  3N9P A;  1DYP A;  3GHM A;  2VC9 A;  1VAK A;  3CJX A;  1POV 0;  2VU9 A;  3UL2 A;  4IE4 A;  5FKB A;  5FPL A;  5T5J A;  2DCZ A;  4H2A A;  1ZZ7 A;  1JOJ A;  4LPL A;  4Y20 A;  4N53 C;  2Q1Z B;  2GDF A;  5FXZ A;  2WNV B;  1V9U 1;  3B00 A;  1N3Q A;  1KEX A;  1OQ1 A;  3LFM A;  4Q4W 1;  3DPR C;  1RUI 3;  2BVB A;  1SFY A;  5FY8 A;  4BH9 A;  5I0D A;  2GC1 A;  1RGS A;  4IEP A;  5F37 A;  3IWZ A;  1SBD A;  2VM9 A;  1VJ2 A;  2PAE A;  5FXV A;  2R04 3;  2VJX A;  1LEN A;  2B9U A;  3D3A A;  2ARB A;  1PGW 1;  2JG8 C;  3BKZ A;  5IW0 A;  2LW8 A;  3ZYG A;  3PL0 A;  4Z92 B;  1W9Y A;  2D6K A;  3CJI C;  4S2G A;  4TLG A;  4XJZ A;  4B3N A;  4Q4Y 1;  3EJK A;  2VMI A;  4PF5 A;  5BNQ A;  2XLA A;  2JEM A;  4MXW B;  1PHM A;  1FYU A;  2FBE A;  2VH9 A;  4HBN A;  4XFA A;  1VBA 2;  3THC A;  2R04 1;  4CUB A;  4XAE A;  2KR2 A;  2WT0 A;  3HT1 A;  2VUA A;  4BQY A;  1OI6 A;  2FCT A;  1PX4 A;  4J1X A;  5FXW A;  2WBK A;  4AED B;  2EF6 A;  4U2A A;  3U4X A;  2VPV A;  4IV3 B;  4EWD A;  4E4Z A;  1NZC A;  4H3W A;  4IEQ A;  2YFZ A;  1WW5 A;  3AKT A;  4QD2 A;  2HEW F;  3HMY A;  4MVT A;  1JTZ X;  1NG0 A;  1XU1 A;  3QBQ A;  3I2O A;  3AMP A;  5FZO A;  1S0B A;  4MV2 A;  4XF3 A;  2W2I A;  2OKX A;  3VHR A;  4FPF A;  1PGL 2;  3WNX A;  1QOT A;  2GN7 A;  3TAY A;  5DZF A;  1NZI A;  1O5L A;  4FOQ A;  2AEN A;  5AVP A;  5FZA A;  3ZSE A;  3VD4 A;  5ANN A;  1NA1 A;  2MEV 1;  4HPK B;  4KWL A;  3ZYF A;  1J83 A;  3ALQ A;  2W47 A;  2J1A A;  1G7Y A;  4PLM A;  3ZVX A;  2DFC A;  4NHK A;  4QU2 A;  5C33 A;  2R07 2;  4PQ9 A;  5BNP B;  1NE4 A;  5KXE A;  3KHC A;  1H8T C;  2XL9 A;  3LA3 A;  1NOV A;  1Z7S 3;  2VZP A;  3N9O A;  2AEZ A;  2WKK A;  4RN5 A;  5FYI A;  5FZF A;  3IBM A;  5AFB A;  5H9R A;  3KV6 A;  2GMP A;  3TN9 1;  5T52 A;  5FYU A;  1TEI A;  1AJK A;  1RUN A;  1QJU 2;  3KT7 A;  2YGM A;  3O0W A;  5FMO L;  4COY A;  3P3N A;  3AYD A;  5LK7 B;  1DQ0 A;  2DU0 A;  1JI6 A;  4RHV 3;  2RVA A;  3K46 A;  1ALY A;  3LDR A;  1D2S A;  2IXJ A;  2VCC A;  2YC2 A;  4Q27 A;  5FYZ A;  1MEC 3;  1NLS A;  1ENR A;  1H8T A;  1K45 A;  5JMC A;  4Q4V 1;  3GHN A;  3T2P A;  1E5R A;  1GP4 A;  1RMU 2;  1AYM 3;  3N3H A;  4ZS3 A;  4JGY B;  1Q8O A;  3WF4 A;  3O0V A;  3WZ1 A;  3GXU A;  3O1M A;  2VMC A;  4OUL A;  3ON7 A;  4GB3 2;  4K1Y A;  4OHV A;  3AZZ A;  1MS5 A;  3HQX A;  4PCR A;  3ZSJ A;  4BQX A;  2FMY A;  4HZF A;  3VKO A;  4DXT A;  3MFC A;  1F2N A;  1LEC A;  1OVS A;  2IWG B;  4QM8 A;  1TQ5 A;  4YW7 A;  2RS3 1;  2Z69 A;  1UOF A;  2EAL A;  4YLZ A;  4DMI A;  3OD0 A;  3ZKY A;  3MHZ A;  1XND A;  1GOG A;  1IQA A;  1S2K A;  5FRE A;  4NIG A;  1LR5 A;  5JR7 B;  3TYJ A;  3NV2 A;  5K0U B;  5IYY A;  1AJO A;  2BVV A;  3W58 A;  5A7W B;  5EV7 A;  2AZ5 A;  4AI0 A;  2WQ4 A;  3AXD A;  4Q26 A;  1ONA A;  1W8Z A;  1ZVF A;  4H14 A;  4FPY A;  4H7L A;  1UMI A;  3GYD A;  4UFI A;  1UF2 C;  5GZG A;  5LA2 A;  3CL1 A;  3AMM A;  3UKV A;  4F8A A;  4W6X A;  4YM2 A;  3KQR A;  3VBO B;  3J7M A;  4LKF A;  4BDV B;  5IK4 A;  4D6Q A;  2K46 A;  4UT5 A;  4Y22 B;  3ILN A;  3RNS A;  2YB7 A;  2QZ2 A;  4HT1 T;  2D6P A;  1HQW A;  2JG9 A;  1RUC 3;  2WZR 1;  1OC1 A;  2K2S A;  2PHU A;  3H3L A;  3HR9 A;  2YU1 A;  5JSP A;  2IFW A;  1CQ9 A;  1PVC 3;  1YQC A;  3T0A A;  4D7S A;  3POS A;  4A7K A;  4G9S B;  4HMZ A;  2WWS A;  3RWK X;  5ACA 1;  1RUJ 1;  5C3R A;  1QJX 1;  3FWE A;  5CZK A;  4D3W A;  4Q4V 3;  1VAV A;  5C4W C;  1WCQ A;  2EAK A;  5CA6 A;  2J1R A;  2W68 A;  1UKG A;  5D2A A;  1CAU A;  5IHR A;  4XFC A;  1TVG A;  4AFB A;  4ZKT B;  1S55 A;  2B42 B;  1W9F A;  2QZ3 A;  4HK9 A;  3ZKU A;  5C71 A;  5BY5 A;  4J1W A;  1OLR A;  4D94 A;  3H8X A;  1C1L A;  4DNY A;  4DXS A;  3J26 N;  4GMP 0;  3DL3 A;  2HEY F;  4KU8 A;  4PDW C;  5IVJ A;  3LA7 A;  4KGQ A;  2UWB A;  1X50 A;  2R16 A;  2XWB B;  5T5P A;  3WSO A;  4IV3 A;  5F5C A;  1YQ5 A;  1ZBA 2;  1B35 C;  1F31 A;  2VZQ A;  2WT2 A;  5E16 A;  3WG3 A;  3AKR A;  1V0A A;  2YC4 A;  2CNA A;  2CV6 A;  1UZY A;  1YJK A;  2JG9 B;  5A33 B;  4BLJ A;  1ODM A;  2RDN A;  2MEV 3;  3FMG A;  2NPI A;  4XUR A;  2NN8 A;  3D0S A;  5CFD C;  4GWJ A;  2OW4 A;  4D69 A;  4Y33 A;  4FP2 A;  1AR8 2;  5GZD A;  3K51 A;  4Y3O A;  1Y7B A;  2NP0 A;  4LXL A;  5F2W A;  3JU9 A;  3PVB B;  4QGM A;  1WGP A;  3OTF A;  3AP7 A;  4BQ2 A;  4MUV A;  3VDD B;  2CSG A;  2YMZ A;  3FX3 A;  3A21 A;  3TN9 3;  1YQ2 A;  1ZRC A;  1RUI 2;  4YM3 A;  1R1A 2;  3IMN A;  4IV1 C;  5C3S A;  4D8M A;  3IPV A;  4RGA A;  5FRA A;  2WDB A;  1D4V B;  1QOO A;  2DF7 A;  4DUX A;  5JSR A;  1BLZ A;  3P1I A;  4XBQ A;  2PQQ A;  4R52 A;  4HET A;  2I45 A;  2VEC A;  3KGL A;  1UCX A;  3ZFF A;  2Y6G A;  4F7Z A;  4JHT A;  4EN8 B;  2WT1 A;  2FDI A;  1YO8 A;  5A80 A;  1H9P A;  3PU8 A;  5FP8 A;  4QGL A;  5CEH A;  1PMH X;  4PI0 A;  2ZX2 A;  1G8W A;  4JHZ A;  1LEM A;  2PQS A;  3ZYP A;  5BNN C;  1W6P B;  2VQA A;  4AW7 A;  1REE A;  4C1W A;  2HWF 1;  1RUG 2;  2DVF A;  2Z79 A;  1P8J A;  1V9U 2;  1ULF A;  1I6X A;  3I54 A;  4V1P A;  3THP A;  4FPE A;  4ATF A;  5LZ6 A;  4RFR B;  3A0N A;  3KCX A;  2KM2 A;  4R8H A;  4XCB A;  1ZNP A;  3WF3 A;  1OA2 A;  2CDO A;  3ST7 A;  1AL2 2;  1H1M A;  2GNB A;  1V6I A;  4NID A;  1HRI 2;  2WII B;  3SCH A;  3VD7 A;  4DY5 A;  3BTZ A;  1AR7 3;  3FHQ A;  3MPP G;  4TSV A;  4AED C;  5BNN A;  4AQ2 A;  1MS3 A;  4CCM A;  2JDA A;  1VBE 2;  4FOW A;  2WAB A;  5J7M A;  1EPZ A;  4MAD A;  5C8C A;  3I2K A;  5DUX A;  1GOF A;  4FVV A;  1LJ7 A;  4QB2 A;  4YVS A;  4ASM B;  1Y9G A;  1YYN A;  2VD7 A;  1LGC A;  3W21 A;  4NRQ A;  2RS5 1;  3BGA A;  2HJI A;  4LBJ A;  3TWI A;  5FLJ A;  5ABJ A;  2VNR A;  5IFP A;  2Y34 A;  2XB6 C;  3JQX A;  1ENX A;  2FQP A;  4GMP 3;  1UAI A;  4MH0 E;  5GZE A;  3VBH B;  4BU2 A;  5A3P A;  1C1F A;  4PIX A;  4W8J A;  2WZR 3;  2ZGM A;  4JC1 A;  1JOB A;  3T09 A;  5C4W B;  5B2G B;  2W92 A;  2ZCW A;  3EO6 A;  4Y22 A;  3ZN4 A;  4LUL A;  2AEY A;  3VN4 A;  2QQW A;  1LHV A;  2W46 A;  4ZXE A;  1H2M A;  1POV 1;  1HXS 2;  1HX6 A;  1YHF A;  2TUN A;  4FPG A;  4AEK A;  2GMM A;  4UFK A;  5F5I A;  1KS5 A;  5J3U A;  1QJX 3;  5F7U A;  3VBR A;  5CFC B;  1T6B X;  2YV8 A;  3BTY A;  4M3C E;  3WP3 A;  4UWD A;  5T54 A;  1C8M 2;  1FAY A;  1JUI A;  2YPJ A;  1SDW A;  4UW6 A;  1LB2 A;  5EZW A;  3PUI A;  4GIQ A;  2EAA A;  2HWC 1;  1ZBE 2;  2ZKN A;  2HWD 2;  5A3W A;  1VMJ A;  1UN1 A;  4KBB A;  4W4Z A;  5ACA 2;  4O65 A;  4GB3 1;  2MEV 2;  3VZM A;  4D6R A;  3NW4 A;  3UGF A;  4BQ4 A;  3MGU A;  4PI2 A;  4WVW A;  3VZN A;  3VHN A;  3N9L A;  2DBN A;  4WM7 B;  3LDK A;  1K5M A;  1NYW A;  3WR0 A;  1RIT A;  3IN9 A;  1SMV A;  5FDB A;  4CU7 A;  1JYC A;  1FV3 A;  4Y1Y A;  3WHT A;  4LQR A;  4OHZ A;  4CDX A;  1CJD A;  4Q0P A;  1GNH A;  5HCB A;  3HBK A;  4NPM A;  1H1A A;  3PU3 A;  1X8E A;  2ZTN A;  4UFH A;  4AFC A;  2UY9 A;  5FZ3 A;  3VBU A;  4UOJ A;  2WS9 2;  3OPW A;  2JE7 A;  3I2J A;  3I3E A;  3TOJ A;  3I3D A;  4IGP A;  3SH5 A;  4GKX A;  4D7Y A;  3FZ3 A;  4LBO A;  3ZPO A;  1DZT A;  1VE0 A;  1H4H A;  2DYC A;  1ZZ9 A;  4PDW B;  3UGH A;  2VZO A;  3MLK A;  4GMP 1;  3DEC A;  3WG4 A;  4QPY A;  1LCL A;  2FZ1 A;  1DFQ A;  1YI7 A;  2BV4 A;  2RDS A;  4AEJ A;  5M0T A;  3F95 A;  4XDP A;  1WLW A;  4Y20 B;  4LOR A;  1ULE A;  1QMJ A;  3AZV A;  4YZ5 A;  5DMY A;  3PHM A;  5DUW A;  4FPJ A;  3WDW A;  3OYW A;  2HLE A;  3GGL A;  3BU7 A;  3LKJ A;  4YVW A;  2ZEX A;  3ZFF C;  5DDJ 2;  1NLQ A;  4BIO A;  5LRS A;  1GKB A;  3S30 A;  4XF1 A;  5HXM A;  1MAC A;  2W08 A;  1UY4 A;  3ZX7 A;  1VLN A;  4JKK A;  3H8R A;  1UYX A;  1ZA7 A;  3AMQ A;  3TNP B;  2VTX A;  2ZAA A;  3ZR6 A;  4CDX C;  3BAL A;  4NAO A;  3ACF A;  4CP1 A;  1O6U A;  2ZEY A;  3VBU B;  2P1B A;  2YC0 A;  4G4F A;  5A1A A;  4XET A;  4C0B A;  1JZ2 A;  1NKG A;  3T30 A;  3RZK A;  3R0R A;  3W20 A;  2DBI A;  4GWN A;  2YY1 A;  3GNE A;  4WM8 A;  2F4L A;  4AL9 A;  4EV0 A;  1C5I A;  4LBQ D;  4XAA A;  2WZR 2;  3THD A;  4OHY A;  1AX2 A;  4E4D X;  3Q8B A;  4FXK B;  4Q1R A;  2YBS A;  1DGR N;  1S4C A;  3MIE A;  3MW4 A;  1QXJ A;  4HXC A;  3EHK A;  4IEX A;  5L9R A;  1G9D A;  4AFD A;  4ASL A;  2ZGU A;  1FOD 2;  5FYM A;  3BOP A;  1R09 1;  5DG2 A;  5DUV A;  1ZRE A;  2ZHM A;  1QJX 2;  1W9T A;  1E5I A;  4PIZ A;  4RD7 A;  3WX5 A;  5A1L A;  5A3L A;  3POB A;  2WQZ C;  1KGY A;  4KWU A;  4QX7 A;  4QDS A;  2J1U A;  3T0D A;  3M7A A;  2OQ7 A;  1AR8 3;  3JQW A;  4JTO A;  4QKF A;  1OUX A;  4IEW A;  1UOJ A;  1DQ6 A;  2GAU A;  3AFG A;  5F6K A;  1RUE 2;  4JDM A;  4A3Z A;  1QEX A;  3KVB A;  3AXE A;  3MPB A;  4YRD A;  3MW2 A;  5C4W A;  3UYJ A;  2BOJ A;  2BW8 A;  3GDB A;  2GZW A;  5EYY A;  1VB2 A;  4J25 A;  1AR8 1;  3UKT A;  5BV6 A;  5JR2 A;  2R30 A; 
#chains in the Genus database with same CATH homology
 2WAO A;  2VZ3 A;  3WNO A;  1UZ0 A;  2QQK A;  3FHA A;  2LS6 A;  3J7H A;  2VTF A;  4QAW A;  1JZ5 A;  1DLC A;  1L7R A;  4CU6 A;  1W99 A;  3WNM A;  4L0P A;  4AAX A;  2EIE A;  2Y8K A;  3VDC A;  4XUN A;  2XOM A;  3E1F 1;  2J22 A;  3CZU A;  5EJZ B;  4OZO A;  4P00 B;  1W8O A;  3VD9 A;  3NNG A;  4GWI A;  1CZV A;  1GQP A;  4P08 A;  3WF2 A;  2QQJ A;  3A23 A;  2ZEW A;  4XUP A;  4ZY9 A;  5JMO A;  3DYO A;  4ARY A;  1JZ6 A;  5J1X A;  1K12 A;  3A22 A;  4DEV A;  1K3I A;  4P5Y A;  3W5M A;  2E26 A;  2J1T A;  2Y6H A;  1OT5 A;  1W9S A;  2WN3 A;  4CVU A;  1UXX X;  3WF1 A;  2C4X A;  4DEQ A;  4QX0 A;  1UYZ A;  4DUW A;  3WEZ A;  2W87 A;  3OEB A;  2V72 A;  5B4X A;  1RYY A;  4A41 A;  1HN1 A;  2JE8 A;  4MGQ A;  1I5P A;  4D0Q A;  1CIY A;  3K4A A;  2B9V A;  2W91 A;  1NUK A;  1UXZ A;  3C7F A;  2VME A;  1W9W A;  1JU4 A;  2DCJ A;  5LCW L;  3U37 A;  1UMH A;  2W9X A;  2VCB A;  3I2G A;  5JUV A;  2B4K A;  2VC9 A;  3IDA A;  4PT6 A;  1L7Q A;  5JXI A;  4LPL A;  5DN2 A;  3T0B A;  5C70 A;  2QBX A;  3IAP A;  1KEX A;  5I0D A;  1ULP A;  1H6Y A;  2VM9 A;  3EYP A;  1MPX A;  1SDD B;  2VJX A;  3D3A A;  2W94 A;  1JYW A;  2LW8 A;  3C7G A;  4CU8 A;  4QB6 A;  4BXS V;  3SKV A;  4UI9 L;  2VCA A;  2VMF A;  4XVH A;  3THC A;  2BER A;  4CUB A;  1JHJ A;  3C7H A;  4E8D A;  1PX4 A;  2Z4F A;  2WBK A;  2J1S A;  1F4A A;  2YFZ A;  1XPW A;  2HYX A;  3HOB A;  3T08 A;  2OKX A;  3I3B A;  3NJV A;  1CZT A;  3VD4 A;  4XUO A;  1J83 A;  1GMM A;  2W47 A;  1W8N A;  2J1A A;  3BN6 A;  2JKX A;  4PQQ A;  4RN5 A;  2VZP A;  2W1S A;  3MUZ 1;  3NQH A;  2ID4 A;  2E31 A;  5LA1 A;  3CQO A;  4TXW A;  5IFT A;  3PUH A;  1BHG A;  1JU3 A;  2J1V A;  1TG7 A;  1JI6 A;  2RVA A;  3K46 A;  2W1W A;  2VCC A;  1F4H A;  1W0N A;  2YC2 A;  4YPJ A;  3A7Q A;  1K45 A;  2C26 A;  5DQ0 A;  3T2P A;  4ZZ5 A;  3SKJ E;  3I2I A;  2VOT A;  2WO3 A;  2V4V A;  3WF4 A;  2X10 A;  3GXU A;  2VMC A;  1UY1 A;  2R7E B;  4QB1 A;  3GM8 A;  2C9K A;  3OEA A;  4OMC A;  4DXT A;  2VZR A;  5DPN A;  5G05 L;  2RJ2 A;  3CKH A;  1US3 A;  3FL7 A;  1GOG A;  2QQM A;  3MO4 A;  4CUC A;  2E33 A;  2KD7 A;  5IYY A;  3UES A;  5HPO A;  3UNP A;  3HN3 A;  1UMI A;  5LA2 A;  2QQO A;  3LEI A;  2QQL A;  3LPG A;  4BDV B;  1IQD C;  4JKL A;  2YB7 A;  2W1U A;  4PF1 A;  4TTG A;  2XON A;  4MOA A;  1ULO A;  3AC0 A;  1NAE A;  3T0A A;  2WYS A;  1EUT A;  4QDR A;  5JXJ A;  5CZK A;  4KI5 M;  1WCQ A;  2VZV A;  2EIC A;  2J1R A;  1US2 A;  2E32 A;  2VZU A;  4OUE A;  5IHR A;  1TVG A;  2BGP A;  5C71 A;  2WQ8 A;  5IJR A;  3SEP A;  1OH4 A;  4GZ9 A;  4DXS A;  3OGR A;  3VD3 A;  1OD3 A;  1CX1 A;  2QQI A;  3WSO A;  3MBW A;  2DDU A;  1GU3 A;  5LA0 A;  4QX3 A;  2VZQ A;  2X09 A;  4BJ0 A;  1UY3 A;  2YC4 A;  3P6B A;  1JZ8 A;  2V5D A;  4XUR A;  3WNN A;  3I2H A;  5CYY A;  4GWJ A;  2W5F A;  2XQX A;  1D7P M;  3IAQ A;  1GOH A;  3DYM A;  2CDP A;  5C7G A;  3OGS A;  1SG3 A;  2JD9 A;  3OBA A;  2EID A;  3A21 A;  3WNK A;  1YQ2 A;  1PX3 A;  3C7O A;  4D8M A;  2WDB A;  2BZD A;  4QDQ A;  3HEI A;  4DUX A;  3P1I A;  4OMD A;  5B4N A;  4ET7 A;  2WAA A;  3MV0 1;  3VDB A;  1K42 A;  1SHW B;  2Y6G A;  3ZM8 A;  3LQC A;  4QX2 A;  3T2O A;  3CMG A;  3CZJ A;  1CZS A;  2YG0 A;  3ABZ A;  1PMH X;  2ORX A;  5EIY B;  1DP0 A;  4JHZ A;  2PQS A;  4CUA A;  2VMD A;  4HG6 B;  3DYP A;  1P8J A;  3CIH A;  3K77 A;  2WUH A;  3WF3 A;  2L9L A;  2WO2 A;  1JYX A;  4RYD A;  2CDO A;  2VO5 A;  2VR4 A;  1DYO A;  3ETP A;  4BK5 A;  4DUV A;  4KMQ A;  2Y6K A;  3CDZ B;  3VD7 A;  3FHQ A;  4BK4 A;  2JDA A;  2Y64 A;  1UY2 A;  2WAB A;  3NJX A;  4MAD A;  3I2K A;  2J7M A;  1GOF A;  4QB2 A;  1JYV A;  4P02 B;  1O8P A;  4FI9 A;  3BGA A;  2Y6J A;  1UX7 A;  4W50 A;  5IFP A;  3WQB A;  5JXH A;  4W8J A;  4A6O A;  3T09 A;  1XC6 A;  2W92 A;  2W46 A;  4ZXE A;  2VZS A;  4M4R A;  1JZ3 A;  3NRU A;  1UYY A;  2VQU A;  5F7U A;  4ZZ8 A;  3ACH A;  3W5N A;  1OF4 A;  3OB8 A;  1WKY A;  1JZ7 A;  4IUG A;  1PMJ X;  4UAP A;  3PUI A;  4MGS A;  4MO3 M;  4W4Z A;  4LHS A;  1OF3 A;  3HPN A;  3III A;  4CU9 A;  3HNB M;  2J1E A;  4XUT A;  3ACG A;  3OG2 A;  4OYU A;  4CU7 A;  2ZXQ A;  3LPF A;  4LQR A;  2DCK A;  3C8X A;  3SEE A;  3LEG A;  1UY0 A;  4UOJ A;  3VDA A;  3MV1 1;  3I2J A;  3I3E A;  3ACI A;  3I3D A;  1GUI A;  3MUY 1;  5FUI A;  2XHN A;  3WF0 A;  1XNA A;  4QPW A;  2Y6L A;  2VZO A;  3I97 A;  3DEC A;  1GNY A;  3WNP A;  2VQT A;  1O8S A;  2EIB A;  5JXG A;  4XZU G;  5DMY A;  2RV9 A;  4A45 A;  2W95 A;  2HLE A;  3GGL A;  2ORZ A;  2ZEX A;  3HNM A;  2W1Q A;  1JZ4 A;  5HXM A;  1UY4 A;  1H6X A;  2VZ1 A;  4JKK A;  1UYX A;  3IB3 A;  1O59 A;  4ARX A;  3ACF A;  2ZEY A;  5A1A A;  4A42 A;  4AG4 A;  1JZ2 A;  1NKG A;  2BBA A;  3T2Q A;  3WNL A;  4DXR A;  4JKM A;  5EJ1 B;  3EB7 A;  3FN9 A;  2VZT A;  2BGO A;  3F2Z A;  4A4A A;  2VL4 A;  1EUU A;  4Z2A A;  3K4Z A;  2WZ8 A;  3THD A;  2WO1 A;  2X05 A;  3K75 B;  4JX0 A;  4LKS A;  5G04 L;  4XUQ A;  3K4D A;  1W9T A;  3VD5 A;  4A44 A;  2QQN A;  4M4P A;  3OGV A;  1KGY A;  3HNY M;  4KWU A;  3LEK A;  2J1U A;  4QDS A;  3T0D A;  2YFU A;  3LE0 A;  1UWW A;  1XNT A;  2W3J A;  1R64 A;  3ECQ A;  1NX9 A;  3I2F A;  4A3Z A;  2WZE A;  3C7E A;  2ZEZ A;  4QX1 A;  2WN2 A;  1J84 A;  4E8C A;  3GDB A;  1T2X A;  1LNS A;  3HJR A;  1JYN A;  3JXS A;  5JR2 A;  3UET A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...