2YFUA

Cbm62 from clostridium thermocellum xyl5a
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
140
structure length
140
Chain Sequence
SYPKLTGTVIGTQGSWNNIGNTIHKAFDGDLNTFFDGPTANGCWLGLDFGEGVRNVITQIKFCPRSGYEQRMIGGIFQGANKEDFSDAVTLFTITSLPGSGTLTSVDVDNPTGFRYVRYLSPDGSNGNIAELQFFGTPAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARBOHYDRATE BINDING FAMILY 6
publication title A Novel, Noncatalytic Carbohydrate-Binding Module Displays Specificity for Galactose-Containing Polysaccharides Through Calcium-Mediated Oligomerization.
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 32
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2011-04-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2yfuA00
3DYMA 2YB7A 4ZXEA 1JZ3A 3K75B 1JI6A 2C26A 2Y6HA 2YFUA 3CDZB 3WNPA 4E8CA 2C4XA 5LCWL 1OF3A 3I97A 4Z2AA 3BN6A 4QB1A 2HLEA 2QQNA 2VZRA 2W87A 2ZEXA 3A21A 2B4KA 1SHWB 1OH4A 4LKSA 2YFZA 3T08A 5G04L 3F2ZA 4M4RA 5JXIA 2E31A 4A3ZA 1W8NA 4BK5A 3K4DA 1NUKA 3VDCA 5DMYA 5B4XA 3OBAA 2KD7A 1L7QA 1TG7A 4XURA 3C7HA 1J83A 3VD9A 2W94A 1ULPA 1DLCA 3A7QA 3I2HA 1EUTA 2WABA 4UAPA 2WO1A 1JZ8A 2BGPA 5JXHA 1K45A 1GOGA 1I5PA 3HEIA 4CUBA 3C7FA 4PQQA 1H6XA 5IYYA 3LE0A 1GNYA 1NX9A 2WBKA 4QX2A 4QB6A 2DCJA 3MV11 3K46A 1SDDB 1GU3A 1D7PM 4TXWA 1UY1A 3OEBA 1US2A 4OMCA 4A41A 3I2GA 1JYWA 3T2OA 4QDRA 2VOTA 3PUIA 3U37A 2J22A 2WZEA 1XNAA 4AG4A 1L7RA 2XQXA 5JXGA 5EJ1B 2V72A 3CZUA 2VMFA 4P08A 1JYXA 2PQSA 1EUUA 1XNTA 4ET7A 4E8DA 2VO5A 2X10A 3C7OA 1PX3A 2W95A 1W99A 2VZQA 3LPFA 4JX0A 4ZZ8A 4DUXA 3CIHA 4IUGA 3HNMA 5CZKA 3T0BA 1GOHA 1GUIA 3FL7A 1NKGA 1JZ2A 4D0QA 2YC2A 3GM8A 2JDAA 4XUPA 2EIBA 2WAOA 2VZUA 1NAEA 1KEXA 1XC6A 5EIYB 2Y6JA 1H6YA 2VCCA 3LEIA 2WZ8A 3VD3A 1CZTA 1UX7A 2Z4FA 5FUIA 1CX1A 2W3JA 2WN2A 4BXSV 3NRUA 1W9TA 2W1QA 1JZ4A 3E1F1 4QX3A 1CZVA 2BBAA 3T2QA 2J1VA 3SEPA 3HNYM 2YG0A 3CKHA 4PT6A 2W47A 3ACIA 2WO2A 3AC0A 2EIDA 2OKXA 3P6BA 5C7GA 2ZEZA 4DXTA 5JUVA 1OT5A 2WDBA 3WNLA 2WUHA 1MPXA 1RYYA 4BDVB 3EYPA 3W5MA 3HOBA 3THCA 3I2JA 2E33A 4QX1A 2LS6A 3PUHA 2BERA 3I2IA 4A42A 1DYOA 4A4AA 2VR4A 4XUNA 4MGQA 2QQIA 2V5DA 2W1UA 3NJVA 1T2XA 4TTGA 2R7EB 1F4HA 1R64A 5LA0A 3HN3A 4KWUA 4BK4A 1ULOA 4XUQA 3LQCA 1UXXX 3W5NA 4DUVA 2W46A 3ZM8A 2DCKA 3FN9A 3P1IA 1OF4A 3LPGA 3MBWA 4OYUA 3I2KA 4L0PA 1LNSA 2J1AA 4JHZA 4QB2A 2W91A 4CUCA 5J1XA 3WF3A 2J1SA 3I3EA 4OMDA 2B9VA 4FI9A 1GMMA 4W50A 3OB8A 4QPWA 1W0NA 4MO3M 4A44A 1O59A 4XZUG 2VZTA 4MOAA 2JKXA 3IB3A 4OZOA 4ZZ5A 2VQTA 3C7GA 1DP0A 1WKYA 4RYDA 5JMOA 4PF1A 1HN1A 2J1RA 3OGSA 1F4AA 3T09A 4GZ9A 2VZ3A 3SKJE 3HPNA 3EB7A 4HG6B 2W9XA 2EICA 2RV9A 4A6OA 3K4AA 1JZ6A 4XUTA 3J7HA 5A1AA 5JXJA 1UY4A 4JKMA 1JYNA 1XPWA 2QQLA 5IHRA 1BHGA 4QDSA 2ZEWA 1UY3A 5DQ0A 2VCAA 2VZ1A 3WEZA 2VZOA 4QAWA 3ACHA 1UWWA 1K42A 1JU4A 1UY0A 4P02B 2WO3A 3CQOA 3SKVA 3VD7A 2W1SA 3VD5A 2WQ8A 4DXRA 4ARYA 4XVHA 4W4ZA 2Y6LA 2EIEA 1TVGA 4ARXA 1K12A 3HJRA 1JYVA 2W1WA 1WCQA 1O8PA 2E26A 3FHQA 3THDA 2VMEA 3A23A 3ACGA 4QX0A 3T0DA 3WF1A 3LEGA 3ABZA 3DYPA 4UI9L 1JU3A 1O8SA 2VTFA 5DN2A 2ZEYA 1GQPA 3FHAA 1UYYA 2VMDA 3NQHA 3WNOA 3MUY1 4A45A 1IQDC 3UNPA 3K4ZA 3WNMA 2DDUA 2ID4A 4QDQA 4CU8A 1UMIA 5LA2A 2Y6KA 3NNGA 1UXZA 2CDOA 1W9SA 5IFPA 3IAQA 2J1TA 3CZJA 2JD9A 3IDAA 2W5FA 1W9WA 2VCBA 3C8XA 3UETA 3D3AA 4LPLA 5F7UA 4MADA 5CYYA 3BGAA 3MUZ1 1KGYA 4YPJA 3IIIA 3C7EA 2BGOA 2XHNA 3CMGA 4D8MA 1JHJA 4DEQA 2C9KA 3JXSA 4CU6A 4BJ0A 3WF0A 3A22A 3MO4A 3WNKA 2ORXA 4DEVA 4AAXA 1J84A 4XUOA 2HYXA 2ZXQA 2VZPA 3GXUA 3VDAA 1SG3A 2LW8A 2QQJA 1CZSA 3OGRA 3MV01 1UZ0A 2E32A 3I3DA 2J1EA 3DECA 3OG2A 2VL4A 3IAPA 2QBXA 5HXMA 3WQBA 3VDBA 2L9LA 2VC9A 3ACFA 2Y64A 2JE8A 2VJXA 1YQ2A 4GWJA 5C71A 3ECQA 1UYXA 2VZVA 1GOFA 1CIYA 4JKKA 1PX4A 4DXSA 2ORZA 3UESA 5EJZB 5B4NA 2X09A 3I2FA 2BZDA 3WF2A 3GGLA 3SEEA 1W8OA 5I0DA 4KMQA 4MGSA 4P5YA 1UMHA 1K3IA 2WYSA 2WN3A 5DPNA 2X05A 2QQKA 3VD4A 4ZY9A 3DYOA 4RN5A 4P00B 5HPOA 3LEKA 1UYZA 1PMHX 2RVAA 3WNNA 5JR2A 4KI5M 4LHSA 1OD3A 2YC4A 3GDBA 4OUEA 1JZ5A 2J1UA 2VQUA 1UY2A 5LA1A 2WAAA 4JKLA 3K77A 1P8JA 3OGVA 2QQOA 2QQMA 3T0AA 3I3BA 1PMJX 2V4VA 1JZ7A 4CU9A 2XOMA 2XONA 4DUWA 2W92A 2VZSA 3OEAA 3T2PA 4CVUA 1US3A 4CU7A 2Y8KA 5IFTA 5IJRA 4M4PA 3WF4A 5C70A 3NJXA 5G05L 3ETPA 4W8JA 4GWIA 2CDPA 2J7MA 4LQRA 2VMCA 4UOJA 3WSOA 2Y6GA 2VM9A 4CUAA 2RJ2A 3HNBM
chains in the Genus database with same CATH superfamily
1SPPA 3CO2A 4ZXEA 1EAH3 2R6QA 3I59A 1H2NA 4FPCA 4LA2A 1AXKA 2Y6HA 2YFUA 4LK6A 5KHJA 2ENRA 3PUQA 2C4XA 3I97A 2XVKA 1HV0A 4Z2AA 3BN6A 1RJ8A 2QQNA 1MVEA 4Q4X2 5EHDA 5F5QA 2ZEXA 1QF3A 2B4KA 3A21A 4IV1A 4IEXA 1F2NA 1Z7S3 4K8FA 2D3PA 1RL3A 4XILA 3H8XA 3SHRA 3OPTA 3MDPA 4HN1A 2JICA 1T6BX 1GYKA 3IDBB 4A3ZA 5BNNC 2FDJA 1WMFA 4LHKA 4LITA 5FPVA 4YWAA 2FMYA 1HIXA 5FZIA 4XMIA 2RJKA 3C7HA 1S2EA 2JENA 2YGLA 1J83A 4YM0A 1JN2P 1GP5A 4PLMA 4S2GA 3ZFEA 1EUTA 4UAPA 3RI9A 1JZ8A 1LGCA 5BYNA 3PVBB 2BGPA 1B09A 1D2SA 1WBFA 3SH4A 5JXHA 2JE7A 1K45A 2PYTA 4GB32 4HK8A 2VXJA 1RINA 4Q4V3 1C8M3 1RMU1 4FPFA 4JDOA 3S30A 3LKJA 1JOJA 2EIGA 3B9IA 4PQQA 2R073 4XDPA 1KJRA 1HX6A 4Q4Y1 1ZZ9A 4K7JA 4FTEA 1NX9A 2R49A 1OPMA 1YLLA 3KGZA 3O5SA 5FPXA 3VBSB 3U0ZA 4JGYB 2ZX1A 4Q5OA 3KQRA 1SDDB 5A3TA 1LTEA 2PAMA 4D3WA 1D7PM 3S0MA 1Y9MA 4NUBA 4ZZ5A 3SCFA 5BNNA 1D0GA 1VBD2 3O1UA 3NNJA 3AZXA 2P17A 1LR5A 1PO13 3MI8A 1AZDA 2E51A 3THPA 3VZNA 5FZOA 4JGZB 3U37A 4YW1A 2WZEA 1XNAA 1ULEA 3T2TA 2IXJA 5IWFA 1F35A 4FOWA 4Q2FA 1PM4A 5L9RA 5CFDB 5FXWA 3GBFA 3CZUA 1DCSA 3JD71 5E1RA 3ZPOA 2XJTA 3LSDA 4K1ZA 2XG3A 4XDQA 5CFCB 4AVAA 1EUUA 1XNTA 3MFAA 4AHYA 4E8DA 4KU7A 4QXHA 3FMGA 4AFBA 4MGTA 4BIFA 3JQXA 5T55A 4GQ7A 5KBFA 5A7SA 2AACA 2A6XA 2ZGRA 1RJ7A 4CP2A 2JDMA 3N9MA 4XABA 2HJIA 2VZQA 5KWRA 4ZZ8A 3INAA 1QEXA 3OF1A 2PLV1 3O14A 4R9BA 4IUGA 2E9QA 2YGMA 3HNMA 4Y3OA 4N7IA 1GUIA 4QXBA 2JB4A 3T0BA 4BQ4A 3SITA 1JZ2A 3UGGA 2JXAA 5A7WB 4GIQA 1W2OA 3WG1A 4YM3A 1VRH3 4I09A 1NAEA 4TSVA 1JYIA 3GYDA 4D0QA 1XC6A 3N9LA 1A3KA 2CL2A 2Y6JA 4HVRA 3LEIA 2WNVB 5FK8A 4NVPA 1CZTA 1HB1A 2Z4FA 2I45A 4IE5A 1S0EA 2WN2A 2XBO1 3VL8A 4PQ9A 1RUI3 4B7KA 5A3OA 4HT1T 1GLHA 2XL7A 1G9AA 1H2MA 1RMU2 3WHTA 1X82A 2Z5WA 4CCKA 3V0BB 3E1F1 1CZVA 2V73A 2ZA9A 3U78A 2BBAA 3D0JA 4CP1A 4UF0B 3T2QA 3WP6A 1J1LA 1VBC3 3EQEA 4RD7A 2ET7A 2VNGA 4FAHA 5BNPB 1GWKA 3HNYM 2YG0A 3H8RA 2ADEA 3ILRA 5F6KA 1N1YA 2EXIA 3WW4A 2YXSA 4BB3A 2MNGA 3KB5A 3PHMA 2WFF1 5L7OC 4DXTA 5JUVA 1XB9A 5HI0A 1BXHA 2XHKA 2WUHA 3MIBA 4MX3A 4BDVB 4JAAA 2P4EA 2UYAA 3KT4A 2RMU1 4J6GA 1C1LA 1QH7A 1S0FA 4MYEA 3THCA 5FYTA 2PHXA 1MEC2 4EWDA 1D4M1 4LT5A 4ZHNA 5C4WC 5J09A 2LS6A 3KQ4B 4RR3A 5FPBA 2QVSB 4YFWA 4FTSA 2BERA 1AJOA 4F7ZA 4LBLA 5ISLA 4G4FA 4IETA 2QQWA 2XUMA 4QHBA 1W03A 4XUNA 2W68A 1HDKA 4HOOA 2QQIA 2V5DA 2W1UA 5FO9B 2A3YA 3ZVXA 4L11A 2XKOA 1MZEA 3NJVA 3CU7A 1LGBA 1LOEA 4PIZA 2H0BA 1I6XA 4GH4A 2HWC3 4K9SA 1W8WA 3VBHB 4CCNA 3UL2A 1DFQA 2ZGQA 1PVC3 2Y38A 5A3PA 2FD8A 2D6OX 3USUA 3ZN6A 3HN1A 4QU2A 5FZBA 2ZX3A 2O14A 3VBFA 1J3PA 4B4RA 4AGRA 2AREA 4NO4A 4BMBA 3QOPA 4QMAA 1VR3A 2ZMLA 1QJU3 4R9CA 1UZWA 1UX6A 2QTWB 2R1BA 3FN9A 4AHZA 5FRAA 4AL9A 2QUOA 5H9SA 2GP3A 1DGRN 4XHBA 1TME1 4A7YA 4CDQB 2R0HA 3LPGA 2Y26A 5C4WA 1C28A 4CCEA 2XBO2 2WKKA 4JHZA 4LLFA 4MVTA 4NPLA 4MHRA 3ZXFA 4EQVA 2J1SA 1SDWA 3AVSA 2XJQA 2JKBA 2ZZQA 4LO4B 3IMMA 5LW9A 3PU8A 5L9BA 1DU3D 1W6QB 2B9VA 2CAUA 2XVGA 3VBOC 5E6HA 1QNWA 3WDYA 1KFUL 5A6XA 2Z69A 1EAH1 2DU1A 3DPRC 4A44A 1O59A 3PMEA 3VGIA 1WBLA 2I74A 4XZUG 4OHVA 1W6NB 1W8ZA 2VZTA 2Q8CA 4MOAA 2JKXA 2WFF2 4L97A 4CEYC 1R1ZA 2XMLA 1DP0A 1TNRA 2AH2A 2DUPA 4K20A 4PF1A 4XJWA 2ZGTA 4P9XA 4QGMA 1Z7S1 2OUHA 3WG3A 2P3YA 1O7FA 4XZPA 3OUIA 1G9BA 4XJ9A 2RS33 3HPNA 3SKJE 2OA2A 4KL1A 1D4M2 1OOPC 2RV9A 3KF5A 5T3NA 2MHFA 1V6LA 2OPKA 1HQLA 3FUQA 5FXXA 2E53A 3K2OA 1CWPA 3LB9A 3LOIA 3ZYGA 4EE2A 1LCLA 1FX5A 1Q56A 1FNZA 3N9QA 2YDEA 5FP9A 2AYHA 5CBLA 5KXEA 4E2SA 1IHMA 4Y5Z0 1GZ9A 2QQLA 2W52A 5IHRA 4YVWC 1H8TB 1JTZX 4YVSC 3RI8A 3WEZA 2ZGPA 2GH2A 2JECA 3DPRA 4Q4V1 1C8M1 3KS7A 5FJKA 1OLME 3WP5A 3ENRA 1ENQA 2R071 3AYCA 1K42A 4XAEA 2ZBJA 3WG2A 4CEYA 2BOJA 2WO3A 2YHJA 3M4FA 4A6SA 3SKVA 3NO8A 5JDBA 1AYM2 1FNYA 2WQ8A 4DXRA 5JLVA 4YNIA 2P3KA 4HMZA 4XVHA 4M01A 2Y6LA 5KC5A 3NAPB 1TME2 3ORJA 4B4PA 4W6WA 2GP5A 3U75A 4GWMA 4DIQA 2BWAA 4ZPIA 3LFMA 1XU1A 1PO11 3ME2A 1O8PA 1GZWB 2VUJA 1XNDA 1NA1C 1NLQA 3A23A 1UIKA 3RYKA 3ACGA 4DXZA 4DZGA 5I0TA 4QQLA 4QX0A 5LEJA 1ODNA 2MEV3 1F5JA 1NXMA 3N35A 3KV5A 1XE7A 5BUVA 4N9HA 4YVSA 3ZLIA 1ZRCA 1KJLA 1O8SA 3J7NA 2VTFA 3M1HA 4FPHA 4HKOA 5DAQA 4BHPA 2FZ2A 1Z7S2 3H8UA 1JUIA 3NV4A 5DN2A 5F3GA 3HMYA 3GNEA 3V0AB 2YY1A 4FP3A 4DNYA 3ZN4A 3NW4A 4NRPA 2OQ7A 2A6ZA 3KSCA 4OHWA 1H1AA 3EJKA 2GNDA 5GLZA 1LAJA 4LOSA 4JRLA 2RR13 5DUXA 1UMIA 4XTMA 1UIJA 4NRQA 1VRH1 4NN0A 4BLIA 4COUA 3ST7A 3CJIC 3WOGA 2IFWA 1SPPB 2PHFA 2Y6FA 5FZ4A 1CGPA 5JOYA 2A6WA 3I59B 2OS2A 4PJYA 5C3PA 4FOQA 3ZYHA 1RUI1 1NA1A 2RDSA 5IFPA 2YPJA 2BUKA 2JD9A 4AQTA 4BQXA 2R30A 1JYTA 2FQPA 1W9WA 5TSWA 3ZYFA 4QHZA 5FUNA 5FOBB 3QLQA 4IV1B 4JGZC 2R072 4LPLA 1VBC1 4INDA 1W3VA 4Q8KA 3ZYRA 5F8PA 2WL1A 1VAVA 5CKMA 5C3SA 1VBA2 2UYBA 3BGAA 3MUZ1 4Y26A 5L19A 1KGYA 3BI3A 3POYA 4P9WA 1YIFA 3MIHA 5FZ6A 1QHDA 2OPWA 5T50A 2WT2A 4AW7A 3T1LA 3PNAA 1W0PA 4YGCA 5AC93 2ZGSA 2AEYA 2ZHKA 4AE2A 4AFCA 1JW6A 1QKQA 4E4SA 4LULA 4A7KA 3S57A 5L9VA 4RFRB 2GC3A 4CU6A 1PO12 1W2NA 2HH9A 4BIOA 4IE6A 2I07B 2GH8A 3DL3A 4CDWC 5ACA3 3ZFEB 2VW1A 1RUD2 2XJRA 3I2DA 1ZYBA 2CSGA 3CJIA 5K0UC 4ES9A 3WD5A 1MS8A 1GANA 1J84A 3PVNA 3K51A 3ZXKA 4DRRA 4CPBA 2OW4A 3OGRA 4GWNA 3MV01 4AZZA 1UZ0A 1UYPA 4BMEA 5FZGA 2TEPA 2J1EA 5JSRA 3PJYA 3DECA 1JMUB 3FX3A 3LIGA 1QOOA 4Z8BA 3I7DA 4LKFA 2HWC1 3NJYA 2BFUL 2QBXA 2OXBA 4CCMA 3U1XA 4XW3A 3QD6A 3WQBA 1PVC1 1RTVA 2B7YA 3H3ZA 1GFF2 3U4SA 2VC9A 1IZ3A 4KGGA 4QX7A 4UW5A 3QCWA 5BXXA 4CPBD 5BNNB 1W3XA 1OFNA 3JZVA 4JCKA 5GKAC 5CEHA 5KXCA 1UOBA 4R8HA 1ULFA 1QJU1 2WLPA 4XJAA 4LO5B 2IXHA 3AP5A 1N3OA 4YM2A 4EJRA 2MPFA 3T3YA 5FWJA 5FZOB 2AUYA 1PX4A 2IXCA 3AZYA 2ORZA 2WR9A 3UESA 3F95A 1CESA 4CDWA 5B4NA 1AF9A 1ZRDA 3I2FA 2BZDA 1RUI2 1PZ8A 3IDEA 4IGOA 3WVJA 3U11A 2B5HA 5K0UA 4MGSA 4IW3A 2EAKA 4UBHA 1UMHA 1UZZA 3WDTA 2WN3A 5DPNA 1VBC2 3KCYA 2WWJA 2X05A 1SBFA 4GJZA 1W6PB 3ZSEA 3PIGA 4XE9A 3DYOA 2QZ2A 1LOGA 4JTNA 2RDRA 4R9AA 3TN93 2RVAA 3POGA 4KI5M 1OXCA 1BYHA 3OY8A 3H3UA 2KA3A 2C1FA 5EXOA 5KHIA 4LHSA 3EO6A 1GNZA 3GF6A 4OUEA 5CB7A 1V70A 2CU5A 5IVEA 2VTXJ 4JKLA 5LY1A 5LBBA 3VBHC 1XJAA 2RS31 3HQXA 4XIKA 1GKBA 4RQPC 1OH3A 3WCRA 4XFIA 3WHUA 4XXAA 4UT5A 1ZRIA 2V4VA 2V4AA 4XACA 4AXOA 4FTBA 3A0KA 5IK8A 4AQ6A 1RUJ1 2W92A 1EV13 3JU9A 4HSLA 1EPZA 4URTA 5I8YA 1LODA 2VZSA 3LFIA 3OEAA 2EA7A 2WYFA 5T5LA 3T2PA 4CVUA 5IVCA 4CU7A 5IFTA 1RUF3 4M0HA 4CDQC 5IJRA 4QHOA 1OD5A 1DGWA 2K2SA 3BPSA 4M4PA 3OYWA 4C91A 3KHBA 2LRPA 2UWAA 5EFUA 3NJXA 3ZIWA 1JUHA 2HWC2 2QFEA 2CHHA 2P6HA 2OYZA 4AVVA 2PHUA 3POEA 5BY5A 1S4CA 4YZ3A 5C9AC 2PHWA 4GWIA 2ZJCA 2CDPA 2VECA 4XFHA 2J7MA 5E16A 2D6MA 2RM23 2RS12 4X8NA 4BOWA 3S7IA 1QJU2 1BJQA 5HV0A 3BTXA 1YWKA 1POV0 3M70A 4FXKB 4IQPA 4Y20A 5FV3A 3VKFC 3E6BA 1JZ3A 5LWBA 5F5AA 4RQPA 4HKWA 3TNPB 4CYDA 4BA6A 4E8CA 3PMSA 1VB4A 5LCWL 3AKPA 1WA6X 3OCPA 5FQ0A 1LRHA 3AXEA 1MEC3 2YFZA 3E6DA 3RYRA 3T30A 3ZYIB 4Y1YA 1DGRA 1KITA 1POV3 3NSTA 4LKEA 2FCUA 3GCWA 2NMOA 4GH4B 4YM1A 3WUDA 4BM8A 1F31A 1DF0A 4QX5A 3H8OA 1ZZ8A 2GNBA 3K4DA 1NUKA 2BFUS 3FLTA 5EWSA 2ZZJA 2HBTA 4XJ8A 4XJUA 3GJBA 5E88A 4GAZA 3ZN6B 4AEKA 5DMYA 1LHWA 2DBNA 2KD7A 2WJSA 3FC0A 3NV2A 1J3QA 3OBAA 4UWDA 5LRRA 2CGNA 5C9AA 5JPMB 1BMV1 4D7SA 3H42B 2CGPA 2JG9C 1DLCA 2ZHNA 3I2HA 5GJ6A 1SLCA 2RS32 3RRDA 2BTVC 3W21A 1NZIA 4KQ7A 2WO1A 3ZDSA 1JYCA 2F6BA 2B46X 3BTYA 5KHGA 5DABA 2VQAA 1ACCA 4QT6A 2DCTA 5C4WB 3Q8BA 5HCHA 3HEIA 1GNHA 1F15A 3OD0A 3SQOA 1AVBA 5F5IA 2RR11 4P14A 1RUJ2 1RUH2 3C7FA 4P9LA 5IYYA 1GV9A 4MXWA 3KCXA 1SLBA 5ANNA 2PXJA 4G9SB 2UURA 3MZHA 2D3RA 3NAPC 4QX2A 4QB6A 1IQAA 4LLOA 2RG4A 5FZEA 4C90A 3RJRA 1DYKA 3ON7A 4IEWA 2DVFA 3K46A 5IK4A 4ISQA 5EZWA 5JZGA 3OGGA 2PMWB 1BK0A 5FYHA 3VHPA 4TZDA 4TXWA 4MXVA 1PGSA 3OEBA 1MS3A 2VUDA 1US2A 4OMCA 4A41A 5FPAA 1FV2A 4BZ4A 3I2GA 3IBMA 3LA2A 1W6OA 1RB8G 1DG6A 4PDWC 2DVDA 4QDRA 2JDKA 2G9FA 2WC2A 1H4HA 1HB2A 2J22A 2O0OA 5FZ1A 1Y4WA 1CJPA 4FCAA 4XETA 1L7RA 3VL9A 2JG9A 2BPA2 4Q8LA 5AC91 5F6LB 2V72A 2WNEA 3GHNA 3OBRA 4CDXC 1JYXA 3VLBB 3IZOA 1J58A 1X33A 3M3IA 3PVOA 5D2AA 5A33A 3N4MA 1CD3G 4TWTA 2Y34A 2B45X 3D0SA 5FTTC 3SISA 5ACA1 2FDKA 5C8WA 2XLAA 3JCIA 3OTFA 3ZFFA 4LOTA 5DUVA 2W95A 1OQDA 1S2BA 3LPFA 2CGOA 4JX0A 3DPRB 4FPYA 3ZYPA 4H7LA 4Q0PA 1GOHA 1AR63 3EMRA 2D6LX 1IS3A 1NKGA 1M4WA 4CEYB 2HWF1 3WXPA 4ZU5A 4OI0A 5A6QA 2JDAA 4XUPA 2OVUA 2WAOA 2ZPXA 1T6GC 5DXDA 5KXDA 4H2AA 1ZBA3 3IDCB 2YYOA 5FZ7A 3TEYA 4QGLA 4DMIA 1BVP1 2VMIA 1H6YA 4XMAA 4PDWA 3KT7A 5T52A 4GKYA 4LR4A 3VD3A 4AK3A 1WZXA 3B00A 1R091 4IV1C 3R05A 4W6YA 4BXSV 3MF9A 4QPGA 4WVWA 4OI2A 1OOPB 3NRUA 3FLRA 4RS5C 3WP4A 5I0SA 3AKRA 3ZSMA 3I4IA 1LKNA 1ZZ6A 1JZ4A 4NE9A 2ADDA 3ZIXA 4CDXA 3UJOA 1AYM3 4GULA 3CKHA 4PT6A 4IEVA 2W47A 4L8QA 4XQ4A 3ZR5A 2WO2A 2A6VA 2OKXA 5K8SA 3ETQA 4NWVA 2G19A 4ATEA 5D1IA 1YYNA 2Z79A 3MIEA 5FOJB 4YVSB 2EXKA 4N43A 5FZLA 3ROUA 4EN9B 5JPNB 5F39A 4Y4YA 1XYOA 5A1LA 3RNSA 2HEWF 1MZ5A 1DQ5A 3EYPA 5DG1A 3ZXGA 1O5LA 2VOKA 4CEWC 3LDKA 2XR4A 4AVBA 1WWYA 2E33A 4B3NA 1G8WA 3IWZA 2GMPA 1S0BA 3MYXA 1UNBA 3TN91 4UW6A 5DZGA 2BJSA 2FCVA 4Y5SA 1UU4A 5AC92 3RSJA 5FZCA 3RWKX 4Q0VA 2VR4A 1WMEA 1GR3A 4IEPA 4XEZA 2SLIA 4MGQA 5CADA 4NR1A 4CXYA 5IK5A 4RS5A 4FXGB 3KZ4C 3VKOA 1DDLA 5ACA2 4P9JA 1AL23 5A3MA 1VE0A 2XUEA 5IVJA 1UPSA 2TBVA 4MGYE 4KH9A 1NA1B 2ZCWA 5FY9A 4NHLA 4KWUA 1BZWA 5D21A 4ATFA 3IT8A 1EV11 5FJHA 2W08A 2XJPA 3L2YA 4XUQA 1S0JA 2HEYF 3VKNA 4FQ4A 4XBQA 5HCAA 3NNMA 1RUF1 1GP6A 4NHKA 2HWF2 1CAVB 3VBUC 3W5NA 4DUVA 1QXJA 2GU9A 2CY6A 2W46A 3ZXAC 4HK9A 2DCKA 5FZ8A 2VBBA 4CEWA 5FO7B 4LXLA 3VZOA 4OYUA 2PHLA 1R092 3I2KA 4L0PA 2J1AA 4QB2A 5J7MA 4MLOA 4AWDA 2RM21 5LBFA 2BRTA 4BQ3A 4CDUC 2DF7A 3CEWA 2LALA 2ZGOA 1RUC3 4FI9A 1AX0A 1VBA3 4AI3A 1GMMA 3OB8A 1HB3A 3LSEA 4QPWA 3N9NA 1W0NA 1NY72 2XJSA 4MO3M 4PLOA 4BQ5A 1QOSA 2IXLA 3CJIB 4WM8C 2O1QA 4XFGA 2Q30A 1OVPA 1YRZA 4LJHA 4FOYA 2W0XA 1KXGA 5GZEA 3PTRB 4AFMA 4NHXA 5H9RA 1HN1A 1MEC1 4FVVA 4ASMB 4QU1A 4FBFA 2A73B 3BCWA 1F4AA 1POV1 1RUD3 4QM8A 4QM9A 4H3WA 3H50A 3VBUA 1WLDA 3TYJA 3TN92 1OUSA 3HQRA 1YI7A 3RVHA 1RUG3 3J7HA 2IVJA 4IEUA 4UBGA 2JDUA 5IT6A 3C3VA 5FCCA 1UY4A 3H9AA 4QKNA 4F3JA 5FBJA 3KV4A 4CDUA 5FKCA 1W90A 4JZRA 1U5XA 1BHGA 1G86A 1JOBA 4I0WB 4CDWB 5DQ0A 4IV3C 1R1A2 3AMPA 2VZOA 2WNOA 4UFIA 1IS5A 4JV4A 4WM8A 2ZACA 5K0UB 3AP7A 1NT0A 2PAKA 5A80A 1EV12 1H1IA 1UWWA 4XQDA 1WLCA 5FPLA 1J1TA 2ZAAA 4RR3C 4Z07A 4MG2A 3QACA 3CNAA 4M3CA 1RUF2 3D82A 1MQTA 4I3GA 5AVAA 2WZPP 4ZU7A 4JQRA 4BXFA 5ABJA 1W8FA 1W2UA 4DS0A 2JG8A 2D6KA 4Y5TA 3HBZA 4ARXA 2ZGMA 3APBA 1K12A 3OY8B 1JXNA 1PGL1 2XGXA 2W1WA 1YFWA 5GLUA 2VW2A 4GH4C 2RM22 2XVLA 2NN8A 2XLGA 1QJFA 2E63A 5A3UA 1YJKA 3FHQA 5IUQA 3THDA 4CZSA 1WGPA 1IKQA 1O3QA 3ZKUA 2DFCA 5F5CA 1SZBA 3VBFC 2VMHA 3S5QA 2OZJA 4I0BA 1NLSA 2X5IA 2WA4A 4ZU4A 4C1XA 3FJSA 2B42B 4FPKA 3B7MA 3ABZA 3NKGA 3DYPA 4IGQA 4IV3A 3TNQA 2ZOEB 4OHXA 1AR82 2LROA 3BTZA 3POWA 3RS6A 3OYWB 4PIYA 4YSFA 3FHAA 1X36A 1LHUA 4L99A 1V9U3 2VMDA 1QNYA 3NWKA 4NHMA 4NWWA 3MUY1 2GC1A 2Y0IA 1X8MA 1IQDC 1SCRA 2ZKNA 1Q8VA 5DZEA 1AR61 2VW0A 4FO9A 3FUOA 5FLJA 5A6ZA 4QDQA 3OJBA 1UZYA 5FZHA 4UFLA 3KHCA 1VB2A 5LA2A 3NNLA 1RITA 3O1OA 1ZBA1 1OMIA 3NNGA 4Y20B 3W9AA 2WINB 1W06A 4YG0A 3N9OA 4COYA 5FYMA 3WW3A 1CJDA 2GN7A 1W9SA 3MLJA 4KGQA 4RQPB 1N3QA 1IGOA 5DAVA 1R083 2VAUA 1I1EA 4OHZA 5FQ0B 2RS13 2IZWA 1KDMA 2G9ZA 4AQ2A 3DXUA 3VDDC 1ZA4A 5FY0A 1APNA 2VUAA 1AYM1 2JEMA 5B2GB 5F7UA 1H0BA 5KHKA 2GALA 4N9IA 3LIHA 4HXCA 4IDZA 1K5JA 2EAAA 5CYYA 1N47A 3H0OA 4PBOA 2QJVA 3IIIA 4HETA 4E2GA 2NQYA 1GZCA 1HKDA 2BGOA 2DBIA 4UFKA 1W28A 4ZXKA 5FYYA 3GZAA 2Y60A 1JHJA 2TNFA 2IWGB 4KBBA 1VRBA 3JXSA 4DEQA 2BOIA 4JQTA 4KWLA 4OCTA 5C9AB 1PGL2 1U5YA 4LK7A 5DG2A 1NE4A 1G9DA 2RJLA 4AEDC 2NZ9A 5F37A 3U4XA 5CG8A 1XYNA 2JE9A 1O3RA 1V6IA 2VMGA 3L2HA 4WVMA 5FYIA 1Z78A 3MW3A 5FWEA 2Q0AA 3MO4A 1HQWA 1KFXL 3Q9OA 4XXPA 3E97A 3OSDA 1ZZBA 2XPJA 3AJZA 4GXLA 3AL6A 1H9WA 1ALYA 3ILFA 4XUOA 2VZPA 2XXZA 3B94A 4YFZA 3UJQA 2QQJA 1W05A 1CAUA 2YMZA 1XE0A 2E32A 3HIFA 3H1YA 3S6PA 5FLHA 4D94A 3VDDA 1MVQA 1AL21 1O6UA 2B9UA 4OZXA 3IAPA 2YPDA 3R4SA 4MH0E 4XCAA 2C0ZA 5HXMA 3UGHA 2R1DA 1RHI3 4L92A 1HJGA 4E9KA 1W8TA 1L3JA 1UF2C 4RGAA 4CCCA 2Y64A 1RUJ3 1RUH3 2JE8A 2UY9A 2DWRA 5T54A 4BQWA 4EN6B 3MLKA 2VJXA 1AR62 2BQPA 4L2NA 4AFAA 4ASKA 4C0HA 1W6OB 3NMBA 2IXIA 3DF0A 5FZMA 5JOZA 5FY5A 1IS6A 2H0VA 3O1PA 1ZBA2 4JKKA 2VD7A 2A6YA 3AP6A 4AEDA 4DXSA 4XF3A 1HLCA 1MZ6A 4YG3A 2JG9B 4HKLA 4LO7A 5BNOA 4DO0A 3WF2A 4NIHA 4JVAA 4K1YA 4XJZA 1W8OA 1QGLA 1SCSA 4V2WA 2B8MA 3SEEA 3BIEA 2BNOA 2V5YA 4BLJA 3SH3A 2FMDA 4I0AA 5BNQA 4HPKA 3RZMA 1RUC1 3AKTA 5SV5A 1VBA1 5E89A 1XNBA 1G7YA 2D40A 2D93A 3HAGA 3PL0A 1DZRA 4P00B 4QQHA 3ZFFB 3J7MA 1UOGA 5HPOA 3ZXDA 3O7OA 5FYVA 1PMHX 2PHDA 4EN8B 2ATFA 4H55A 3WNNA 1JS9A 4I2OA 1DQ2A 1OFSA 3VZLA 2AENA 2D5FA 5LEKA 3A4UA 1OD3A 3RQ0A 4DRVA 3AZVA 2VQUA 1UY2A 3ZMOA 5A1FA 5LA1A 2WAAA 1YXWA 4I01A 2GNTA 1RUD1 4W65A 2QQOA 4SLIA 4PDWB 3I3BA 2ES3A 5C3OA 3N7KA 2VOVA 1PMJX 2VG9A 3V64A 4EN0A 2D5HA 2PELA 4LNVA 2JIGA 4QPGB 3AB0A 3I54A 2NLRA 1O4YA 5A32B 1RUG1 2HWD3 2RS52 5FXVA 5IAVA 4PI2A 5A7PA 4HANA 4CDXB 1QH6A 2UU8A 2Y8KA 2QKDA 5GZDA 1SMVA 3KV6A 4WVZA 1WD4A 3GBWA 3WF4A 1AL22 1K5MC 2DFBA 4HN0A 2ZHMA 5G05L 5FMCA 1LHVA 1TE1B 1V6OA 1Y43B 4H14A 1S0CA 4W8JA 4N43B 2D98A 1GWMA 3EXUA 3KWVA 3U14A 4LTAA 4Q0UA 4WV8A 2Y6GA 1ZM1A 4CUAA 1OKQA 5APAA 3PJQA 3WQ7A 1YFUA 2CYFA 4YW4A 4N7UA 2CV6A 4IGPA 3VBRC 1S2KA 1JI6A 4Z92B 2HEVF 3VKMA 3L9JT 3CDZB 2RHPA 1I3HA 3AK0A 4IL7A 3SLIA 3RZZA 3I3MA 3UT0A 3M2MA 4FPGA 5FKBA 4ZONA 2VZRA 4EWAA 1D2QA 2XL9A 1SHWB 3Q8FA 1XRUA 1OH4A 1ZNPA 4RS5B 4EZHA 4LO8A 4DB5A 2BVBA 4YGDA 1RUC2 4QXCA 5G04L 1O3TA 4KBZA 3A0NA 4M4RA 5LZ6A 1LENA 1AJKA 2D97A 1IOAA 4AI0A 4BK5A 2DU0A 4AAPA 1OA3A 1OC1A 2ZS6B 4XYXA 1K5MA 2P3IA 2ILMA 4QQPA 3TAYA 2ARCA 1O3SA 3RPQA 4UFJA 1SBDA 4X6RB 3TB0A 1XNCA 3BALA 3LGRA 4SBVA 5B4XA 3ZMNA 1L7QA 1XU2A 2ZAHA 4PIXA 1A34A 4YZ1A 4Q0QA 3O1VA 2A71A 3M7AA 1KS4A 3AMQA 4Q0SA 2W94A 3AFGA 5A7NA 4ZS2A 5HV4A 2WABA 1VLNA 2JD4A 3KM5A 1V9U1 3VHRA 3VHOA 3X29B 4CEWB 5JIUA 5KR7A 2WLQA 4KWKA 5FAXA 5JSOA 1GOGA 3VBRA 1BVVA 1QXRA 4CUBA 4U2AA 5FZAA 1BLZA 5IVBA 1EPWA 1RUG2 1Z0HA 2HWB3 1H6XA 4D7TA 2HWF3 2VULA 1GNYA 3LE0A 3POIA 5FYCA 2WBKA 5F3EA 4JRAA 1YQCA 2XB6C 5JI9A 4V1PA 2F4PA 1NOVA 1X9TA 4GKXA 1NZCA 1R093 1GU3A 4Y1VA 3QBQA 3WW1A 1UN1A 3WX5A 4AR2A 1R081 1AXZA 4PHZA 5HXVA 1UY1A 2BW8A 1WCDJ 2E7AA 2RS11 2VCMA 3AVRA 4OFGA 2AZ5A 1S1AA 3SH5A 2GSYA 1JYWA 2XDVA 2Q5TA 4IEOA 1V00A 3URFA 2DUQA 5CA6A 4FT8A 4LHLA 1V6NA 2VOTA 4AI2A 3VBUB 4HVQA 4XBNA 1A8DA 4QPIA 2FCTA 1PIV3 3WINE 1COV3 1FXZA 1LOAA 3KMHA 5CFDA 2D44A 3AYDA 4LBQA 4XCBA 1SEFA 2NYYA 4UFMA 1YEWA 2OUJA 2X10A 4CDUB 4O9EA 4G3YC 4O7XA 3KVBA 1E57A 3Q8AA 1CQ9A 1QU0A 2YROA 1OA4A 2IVIB 3GZUC 1ENSA 2BVVA 4KG0A 4LBQD 3WT3A 3CIHA 2VBDA 4WM8B 5CZKA 3R6SA 4YW7A 4LMFA 5FY7A 5HCBA 5DUUA 4WZFA 1V6JA 2FDHA 1NCQA 1VPHA 1ZZCA 2FBEA 2G1MA 3DCQA 3POSA 3PUSA 2YC2A 5CNAA 1XBFA 5DAXA 4BE3A 1MQTB 2EIBA 2VZUA 1TNFA 3AJYA 3HWJA 3NV3A 1KEXA 1UKRA 2NP0A 2ZX0A 5EIYB 5SV8A 1R1A3 1RHI1 1DHKB 1V9U2 2EALA 2WQZC 2WZ8A 3CJXA 1ULDA 4WZCA 2BBVA 3M8LA 2W3JA 2PHTA 3M3CA 4KWJA 1H9PA 1RUH1 3M3QA 4RGKA 2X8KA 1NYWA 5A3NA 4Y4RA 2HBUA 4QX3A 1PMIA 2BWCA 2R043 1Q8OA 3SEPA 5BNPA 3B69A 1DIWA 3ACIA 3ZFGC 4NAMA 2EIDA 3N3HA 5C7GA 2HYKA 2ZEZA 3O0VA 1MS5A 3PDQA 1R082 2WDBA 3WNLA 4IV3B 1MPXA 1RYYA 1W9FA 1YFXA 4HBNA 3MF6A 1W04A 3W5MA 3MW2A 1OVSA 4YGBA 3NVCA 4CP0A 1RUOA 5BV6A 4AGVA 3POJA 3HT1A 4RR3B 3RGBA 1YNAA 3VZMA 1ZRFA 4QX1A 4D6SA 4HFSA 4Q4W3 4GALA 1O5UA 1LU1A 1WCSA 2IXKA 2W39A 5A3WA 1OBNA 4PLNA 4LHNA 3RZJA 4LBMA 3BOPA 3I2IA 1DYOA 2QCSB 1AR83 4A4AA 4I30A 1YI9A 2BEOA 4A2UA 4ZKTB 5JZGC 3OUHA 1EYBA 1RUE3 4LE4A 4YW3A 5GLTA 1IS4A 1CPNA 1O4ZA 1XE8A 4XFFA 4QX8A 2R7EB 2EF6A 4OI4A 5C3RA 4PI0A 2ZX4A 2R062 1R64A 4IXLA 3USUB 3BYWA 4S2HA 4CRQA 5LA0A 2JX9A 2VVEA 2QZ3A 3ZFGA 4AFDA 2HWD1 4RSUA 3VBFB 4BK4A 4EV0A 1OPOA 2IC1A 1HXS3 3WP3A 3LQCA 3BU0A 1UXXX 1SLLA 2UWCA 2QNKA 4RHV3 1VBE3 4HONA 5JOWA 2WNUA 3KF3A 1MR5A 3POFA 2D6NA 4EYUA 1IPSA 1RHI2 1AXYA 1BEV3 4E2QA 1VMJA 1TEIA 5ANQA 2GMEA 5T5OA 1WMXA 3IN9A 5J1XA 1Y3TA 2A70A 2PN5A 3ZFFC 3WF3A 4AGGA 3I3EA 4OMDA 1Q8QA 1PK6C 4WVMB 1QJEA 3UK9A 4OI1A 2Q8DA 5FXZA 3LWCA 5J48A 4YW6A 5F32A 2DURA 3TEXA 3IB3A 4OZOA 3UYJA 2A75A 2BDRA 2VQTA 4HVOA 1WKYA 1WW4A 5FPZA 5FYZA 1CAUB 5LBCA 3RWNA 3N9PA 4WM7A 5A7QA 3VKLA 3ZOIA 4B29A 4J25A 2J1RA 3AKSA 4LEJA 1HW5A 2KXLA 2WT1A 3J9SA 3P3NA 3T09A 1QJX2 2VZ3A 4GZ9A 3VDDB 4QPGC 1QJY3 3EB7A 3WG4A 5I93A 3PURA 1KD7A 5CIRA 2W9XA 1W39A 2R0FA 2EXHA 3H1MA 3W20A 3DKWA 2WQ4A 1IG3A 4XHXA 4JTOA 4A6OA 1E5SA 2BV4A 1QQP3 1MS0A 1UO9A 2A3WA 2BGCA 2KR2A 2W2IA 3K4AA 1JZ6A 4R9DA 1ZRRA 2ZGNA 3ZSJA 1Q8SA 2D3SA 4E4HA 5C8CC 3UV9A 1REEA 2F4LA 3IIAA 5GZFA 5JXJA 5JOXA 5FDBA 1YHFA 3VZJA 1RGSA 1XPWA 5JCTA 4AEDB 1XSQA 4N43C 2K0GA 4QDSA 4C8DA 4LUKA 1PK6A 4XF0A 4DOUA 2VCAA 2VZ1A 2YBPA 3LZZA 1FPN3 2ZMKA 3KGLA 4QAWA 5CVRA 1CX1A 1W9YA 5A6YA 2WS93 2HWD2 2HWB1 3ACHA 5FMOL 3B9CA 1UY0A 4HPKB 4P02B 4COVA 3VD7A 2W1SA 1V0AA 2ZMNA 3OBTA 5I91A 4TLGA 2ZX2A 5EPAA 3JBG3 3VD5A 4F83A 1XNKA 1MS9A 1UPIA 3MHZA 1FI2A 1WCKA 4YG6A 3MLLA 1TVGA 3O0XA 4Q1PA 3HJRA 1ENRA 2FDFA 4XFAA 3USSA 3N36A 4MGKE 2GC0A 2YUEA 4AI9A 3BKZA 4OHYA 1NY71 1REFA 5FZFA 4DINB 5FY1A 4DUXA 4CXWA 1LOCA 5C8CA 3AFKA 5K7PA 2ZGUA 4IERA 4JDNA 4META 3ZSKA 3BVCA 5C33A 1LEDA 3HQUA 3AX4A 4B4QA 1PIV1 4LBKA 1COV1 3WY6A 3ZR6A 4B1LA 3T0DA 3WF1A 3H7JA 3LEGA 1N1TA 2DUOA 3DKQA 4RFT0 3E5XA 2C5DA 2HWE2 2V09A 3VUOA 2PQQA 3BU7A 2DVBA 2QDRA 3LA7A 2E7TA 1GQGA 4QKBA 1HV1A 1TQ5A 3SXWA 3WQ0A 3EBRA 1N3PA 2ZEYA 1GQPA 2VNRA 3IPVA 5FP8A 1ND2A 5FY8A 4A7ZA 5CISA 5FLIA 1AYN3 5D8AC 5LA9A 1FATA 5JSPA 2RS53 4A45A 2DDUA 2XLFA 3J8F1 4CU8A 1WCUA 2Q1ZB 4N8MA 1NE6A 3T4VA 1FT9A 2XJUA 1OURA 4LBNA 5DDJ2 1KQRA 4BYYA 5J36A 3OGJA 1SQ4A 1R1A1 3THTA 5K4LA 4E4DX 4YRDA 2CDOA 4D7YA 3G6JB 5LK5A 5IK7A 2AC1A 3IAQA 2J1TA 2QQVA 2O8OA 2Q8OA 3ALQA 1RVF3 1SLAA 3IDAA 4M3CE 1HRI3 4ITCA 1OQ1A 4O61A 2YZ4A 2VVFA 3UETA 2HWB2 2C6SA 3D3AA 3QH6A 4BISA 2R041 1FOD3 3P5BA 3S7EA 4OVEA 2A1XA 1HRV2 3J4UH 3OBZA 4FPJA 1FMD3 1URXA 4Q26A 5C6CA 1WD3A 1H8VA 1RC6A 5EYXA 5FZ9A 3K48A 3C7EA 1K5MB 1VBB3 3P3PA 2Y0OA 1H4GA 2Q8EA 4D8MA 1AL0G 2C9KA 2VGDA 3B5LB 5D8AA 3WCSA 4XFCA 1X9PA 4XF1A 3WDUA 4E27A 5IW0A 1OI6A 4EWEA 3W58A 1DYPA 1OSGA 1TMF3 4GD4A 5KC6A 4Q4W1 1G9FA 3MPBA 2UWBA 3A22A 1YO8A 1I9RA 3PTYA 1ND3A 3WNKA 3TRSB 2ORXA 5CG9A 4AAXA 3ELNA 3AM2A 1SFNA 3VBRB 1PIV2 2HYXA 1COV2 2ARAA 2ZXQA 3FBMA 2CWSA 1AR81 1MQTC 3WQ1A 4CP9A 2LW8A 2RDQA 1OKOA 1VALA 2NMNA 5F3IA 5FYUA 1UZVA 2D7FA 4NAOA 3H3LA 2VVDA 4IEZA 5FZDA 5BPXA 1RUE1 1W0OA 4N90A 5ABJC 5FMOS 2ZKLA 2JG8C 3PUAA 3OOXA 2DCZA 2YBKA 2JDPA 3KVAA 4FFIA 1W2AX 1KRIA 3U10A 4WBBA 2P1BA 4YARA 5DAPA 3TOJA 3CBNA 1HXS1 2J42A 3J8F2 4RGGA 4R4ZA 3MFCA 1YQ2A 4GWJA 5C71A 2GAUA 1UYXA 1Q5OA 1CN1A 1VBE1 2X5IC 4RHV1 4CCOA 4NIGA 1AR73 3RMYA 5J37A 2LM3A 4FFGA 2VXRA 2RE9A 1BEV1 4FFFA 4QPIB 4DPNA 3ZPYA 2X09A 1DBNA 3B01A 1G9CA 5LBEA 4LBQB 5I0DA 4KMQA 3ACLA 1JOPA 4P5YA 3JUUA 4DY3A 2WFPA 1K3IA 2R042 2WRAA 3K3OA 1QXPA 2QQKA 3VD4A 5FY4A 1UU6A 4ZY9A 2E6VA 4MZUA 1SLIA 1LOBA 4OUSA 1W6PA 1YC61 3LEKA 3LDBA 5GLWA 1NQDA 1QY4A 3KD4A 5JR2A 5EYYA 4XQWA 3Q8CA 2VNVA 3DUIA 3GDBA 1NCQB 1NXD1 3ATGA 5GM0A 4P5HA 2YBSA 4RL7A 1ST8A 4IESA 5FBZA 1IPJA 3ASIA 3OGVA 1YCIA 1QJY1 2DTWA 2ZABA 4TN7A 1XOYA 3AMMA 5LB6A 3TEWA 2QQMA 4Q4W2 5CKQA 3T0AA 4ES8A 2E7QA 3ZYJB 1JHNA 5EP9A 3POBA 1DGLA 1H1MA 4XF4A 1QQP1 1CAWA 1PGW1 4CU9A 4E4ZA 1FV3A 1JZ7A 4RA0A 2FHRA 2XOMA 4DUWA 4HZFA 2QE3A 1MS4A 5DZFA 1B35C 3PU3A 3BOWA 2XKPA 2TUNA 1ZBE3 1VAMA 2GC2A 1RUE2 3WDWA 5F9TA 4Q4Y2 4AVCA 3CLPA 4MV2A 1FPN1 2G9GA 4MGIE 1VMFA 4BCUA 2WS91 1AR93 2VMCA 1VIWB 4UOJA 1HXS2 4LORA 2ZGKA 4NIIA 4B7EA 2VM9A 2GZWA 3R4UA 3LA3A 4XIOA 2NM1A 1NQJA 5ERLA 3ZN5A 3N7MA 1DQ4A 3JBG1 4RHV2 1G6NA 1RIRA 1VBE2 2LTNA 3DYMA 1SLTA 1PM7A 1PNFA 2YB7A 3JB4C 3T1MA 3LDRA 3K75B 5EJ3A 4AHWA 1J59A 2C26A 1DGWX 2VY0A 3IMNA 5AFBA 3SCHA 2GN3A 4Y1ZA 3WNPA 1BEV2 1OF3A 2RDNA 4QB1A 3ZXEA 2HLEA 1LB2A 1SACA 2W87A 3JD72 4QKDA 1UL9A 1UW8A 3AP9A 4YGEA 4ZS3A 4J1WA 2JDZA 1LESA 4LKSA 4QD2A 4OQ9A 1F8VA 3UKTA 1ZA7A 1W8HA 4LBOA 3T08A 4Z82A 3WV6A 3B93A 5FP4A 1B35A 1N1VA 3F2ZA 5CU1A 1C3HA 5JXIA 2E31A 1W8NA 4TLFA 1C1FA 1PNGA 3ZFGB 1HQNA 3VDCA 3RFRA 2Z42A 5LATA 2WWSA 2PLV2 1FYUA 3E5QA 1TG7A 4LA3A 4XURA 3O1MA 1SFPA 2DYCA 5L7OA 1ODMA 1VAKA 3FWEA 1NCRC 3H7YA 3SNMA 2Q1FA 5BNOC 1ULPA 3VD9A 3A7QA 4CSWA 2WNUB 1QJY2 4PCRA 1AYN1 4BQ2A 2R063 4NMIA 3FBYA 4D6QA 1QOTA 1UOFA 2RS51 1PO23 3LD8A 2ERFA 1I5PA 1KS5A 1CAXA 1PGW2 1QQP2 3NL1A 5LRSA 2JB8A 4MXWB 3I3QA 1EY2A 4LIVA 2YV8A 4QKFA 4HSJA 1ASJ3 2OT7A 3U07A 1GZTA 1YQ6A 2DCJA 3E5UA 5JZGB 1DZTA 3MV11 4GA9A 3DGTA 3PLQA 1LHOA 2VPVA 4AVTA 3JQWA 1RVF1 1NLRA 1FPN2 3H1WA 3AXDA 5FMDA 3RJ2X 4U36A 1WUVA 4D69A 2JDYA 1HRI1 2UY8A 2DCYA 4XTPA 3ZXLA 2YU1A 2WS92 4WM7B 3GCXA 1FOD1 4UYBA 3T2OA 4DY5A 2RMU2 4UXAA 1FMD1 3JBG2 5FP3A 3PUIA 2XH6A 4AG4A 1NCRA 4V2VA 3R0RA 2DVGA 2XQXA 4K8RB 5JXGA 2Y33A 1VBB1 1YFYA 4N53C 4R4XA 5EJ1B 2XQRA 4HL0A 4AQSA 2VMFA 4P08A 3O0WA 2CWMA 2P34A 1W6MA 4OULA 5A33B 2PQSA 4ET7A 4W6XA 1HB4A 1JH5A 1PVXA 1QJX3 2N7GA 2VO5A 3B02A 1TMF1 4MHUA 5DUWA 2YC0A 3WW2A 2DTYA 3C7OA 2GDFA 2C24A 4I02A 4OQ8A 1PK6B 1PX3A 4AEJA 4NPMA 1W99A 1BK1A 1D4VB 5FUPA 3VBOA 4DQAA 3BUCA 4C1WA 4COZA 2FDGA 2A7AA 2P6CA 3GZEA 3T4HB 3FL7A 4A3XA 5FMBA 1OUXA 5JR7B 3GM8A 5FZKA 5T5PA 5DAWA 4LUMA 3IKWA 1RXGA 1E5RA 3ITQA 3EHKA 3RYPA 2IFRA 2QQUA 1FAYA 4Y1UA 5FPUA 2VCCA 3WUCA 3AMNA 3HBKA 1AYN2 2Q4SA 1Q8PA 5FUIA 1UX7A 3GBGA 1H2LA 1PZ7A 5JWPA 1GBGA 4Z1VA 1S0IA 1W9TA 3AYAA 2W1QA 1OOPA 2WZR3 4N53A 1DZQA 5J98B 2BP6A 4BWOA 1HN0A 2J1VA 2VOWA 2WIIB 4Y22A 4L9BA 4XOGA 1AR71 5C8CB 5FP7A 5IVYA 3RZGA 3MW4A 4ORFA 5CAZA 3MICA 4JHTA 1J3RA 2ET1A 2X53S 2ETEA 3AC0A 4NJ4A 1EAH2 4O65A 3P6BA 4C0BA 3AP4A 1OT5A 4D6RA 1RVF2 5JI7A 2I2SA 4YVWA 1MZFA 3WDXA 1HRI2 1WLWA 1S0GA 3HOBA 3O12A 1FOD2 3RMXA 1LEMA 2ARXA 4YZ2A 3I2JA 1OLQA 2PAEA 3IPVB 3BPZA 5T5JA 1YUDA 1FMD2 1ND2B 4Y33A 4YZ5A 3PUHA 1BBT3 4LE3A 1RUNA 2WWUA 4NOTA 3O1SA 1LOFC 2JJ6A 5E8AA 2Q1MA 1GSLA 1VBB2 2HWE3 1LHNA 4A42A 1A8MA 2EXJA 4X6QB 1ULCA 4XFBA 4AI1A 4LBJA 3VBSC 1ENXA 4JGYC 1OLRA 3CHXA 4ASLA 1YQ8A 3O1RA 1ULGA 3N7LA 3AL5A 3DEMA 1T2XA 1TMF2 4IE7A 1AX1A 4TTGA 2XWJB 3AZWA 1U5IA 2VBPA 3G7DA 3TEZA 1F4HA 3MEPA 3FFZA 1REDA 2VTXA 2HKXA 3HN3A 4OLLA 4WVVA 2AGSA 3VN4A 1VP6A 1ULOA 2DVAA 1BQPA 2BU9A 4Q4V2 1C8M2 3OPZA 4YLZA 1UD1A 5DDJ3 1ZBE1 4UFHA 1OLMA 1H2KA 2XWBB 3WLUA 3ZO0B 4IE0A 1ZVFA 4QPIC 1CAVA 3ZM8A 3IM0A 5CFDC 1TZOA 1KDKA 1VMHA 2WO7A 3P1IA 4FP2A 4EN7B 5IVFA 3SCGA 5AFEA 1OF4A 3MBWA 3NV1A 3WNXA 5CFCC 1LNSA 1AR91 1VJ2A 2BYVE 2XJVA 2W91A 4CUCA 4Q4X3 5D8AB 5K9YA 2VUCA 1LOFA 2Z2SB 4JC1A 4QQ2A 2WT0A 5KXBA 1HRV3 3K3NA 3PIJA 5F3CA 1C57A 1O4TA 4W50A 1SBEA 3OUJA 3VBSA 3KT1A 1AR72 1CIWA 4JGYA 4P9IA 1UMZA 4FFHA 2H6CA 3NKTA 3VB9A 2NPIA 1ND3B 3GZTB 5F1RA 1NCQC 2F17A 3M3OA 3KLSA 3ZX7A 1WW7A 4NHYA 4CP9B 3FLPA 4K6BA 3C7GA 4GMP0 4CCJA 4RYDA 5JMOA 1F9KA 4YYOA 1M06G 1CX4A 2P5BA 3OGSA 4Q27A 3O1TA 1O91A 2WNVC 3CL1A 2SBAA 2ZTNA 2WA3A 4B8EA 4HG6B 2VH9A 4JGZA 4XPVA 2PA7A 2EICA 1LU2A 3R4DB 1POQA 1IKPA 4FPLA 4GB33 1Y9QA 4GMP3 4XUTA 1JODA 1C8NA 5BNPC 5JVVA 3KV9A 5CFCA 3RZHA 1NG0A 1GICA 5FZ3A 4MUVA 1BKZA 3UGFA 5A1AA 5GZGA 2JWPA 5FK7A 5JMCA 2FDIA 5A7OA 4JKMA 2H6BA 5GZCA 1C5HA 1JYNA 2DV9A 1VRH2 1PZ9A 2R061 4K40A 2ZEWA 1UY3A 1PO21 4OUMA 1DQ0A 3FFQA 3NNFA 3J8F3 3RG0A 1Q43A 1VBD3 2K9ZA 5A70A 1JU4A 4M3CB 4URAA 4Z2WA 5A7WA 1ASJ1 1ZBE2 5FZ0A 3OD4A 3CQOA 2EVXA 4ISRA 1S0DA 4AYUA 4B1MA 2VOXA 3UKNA 1OQEA 3C2UA 5ABJB 2X29A 1Q3EA 4ARYA 1LJ7A 2JG8B 2CTVA 2WNVA 1WA4A 4W4ZA 2ZGLA 3D4KA 2EIEA 1C5IA 4P9YA 3MPPG 3KCCA 2WSVA 1CONA 1E5HA 1X50A 1AR92 5FYSA 1JYVA 3ES4A 4Q1RA 1U0AA 3V0BA 3QH7A 1WCQA 3AKQA 4AVSA 4UF0A 2E26A 4KNCA 4BH9A 1RXFA 2VMEA 1QJZA 3D6EA 2CNAA 4QGNA 2X5IB 4FPEA 1XQNA 1N1SA 4XDOA 4BQYA 5C3QA 1CAWB 3SMHA 1UCXA 2JIJA 3VHNA 5IATA 1Y9GA 1YJLA 5J3UA 3AMHA 5AVPA 2OZ6A 1BCXA 5FIXA 3E6CC 2K46A 4UI9L 1JU3A 2P2KA 4QPYA 4XBLA 2WNUC 3ZXJA 1OA2A 1E5IA 1QJX1 2O8QA 4QXKA 3M3EA 3W59A 4I3PA 1UYYA 4MGZE 1XYPA 5M0TA 5H9PA 3V65A 2D6PA 3NQHA 4IEQA 4CCDA 3WNOA 3GJAA 4FAGA 3GALA 1XSRA 1D0HA 3RDIA 3UNPA 3K4ZA 3WNMA 1PVC2 2KM2A 2ID4A 4FOVA 1RMU3 1V6MA 1PHMA 3ZSLA 4R52A 2WSUA 4Q4Y3 1AHSA 4PF5A 2ARBA 2A3XA 2Y6KA 4JDMA 4NIAA 3FHIB 3ZYBA 4MSVA 4FPOB 5GLVA 5H9QA 3MIFA 3ES1A 1UXZA 4WM7C 1IG0A 1UAIA 3VBHA 5HCFA 1YQ5A 2D43A 3CZJA 1PO22 1H30A 2PFWA 4AF9A 2W5FA 5FFOC 2VCBA 5I0RA 3AYEA 1C4RA 2WZR1 3C8XA 4CXXA 2VE1A 4NIDA 1X8EA 4CE8A 1MACA 1Y7BA 5IAXA 1ASJ2 3ILNA 1UOJA 4MADA 1B35B 3BIWE 3FE5A 3Q8EA 2ZHLA 5I0UA 4YPJA 5CKNA 3LEMA 5I8TA 4CDQA 4HLTA 2XHNA 2GNMA 2MEV1 2CAVA 5HBAA 3RZKA 3LOBA 1WW6A 4IE4A 3CMGA 2JDHA 4NRMA 3JD73 4Q29A 3J7LA 5L73A 4K21A 4KU8A 5L7OB 1U12A 4UW3A 4EROA 5LASA 1H8TC 1W6QA 3V56A 5EV7A 3BB6A 2P37A 4M0NA 4BJ0A 3WF0A 5LK7B 4DFSA 3I8TA 1BBT1 4IEYA 4XAAA 2P3JA 4F8AA 3TWIA 1LULA 2R16A 1ONAA 3AZZA 1W6NA 4DEVA 5C5UA 1W8UA 2HWE1 1CAXB 3GXUA 2AEZA 2PLV3 3VDAA 1SG3A 5J96B 1CZSA 1QIQA 4AEMA 4H7MA 3D8CA 4BQ1A 1S55A 1W2TA 3WZ1A 1AX2A 4X8PA 3I3DA 4QWNA 2AR6A 3OG2A 2VL4A 1A6CA 4GJYA 4S2DA 3DN7A 3LF7A 4XF9A 3NJZA 4O9GA 4BPZA 3VDBA 1JBCA 3HT2A 2L9LA 2XBO3 3ACFA 3DXTA 1V6KA 1EP0A 1I5ZA 1QMJA 2FZ1A 5DDJ1 1AUYA 5GALA 1UKGA 4AOCA 1X7NA 3ECQA 4CUGA 4CTEA 2VZVA 1GOFA 1YIPA 1CIYA 3JB8A 2BNMA 2G4IA 4J1XA 3DV8A 5KHHA 1NCRB 4K3UA 3D5OA 1H8TA 1WMDA 4QQOA 4COWA 5BNOB 1CR7A 2QDNA 5EJZB 5FREA 1GP4A 3PVEA 2WFF3 2IUWA 1GQHA 3GGLA 1L7LA 3VZKA 2B39A 4Q4X1 2JDNA 1W6MB 1LECA 3WDVA 4Y24A 2WZR2 1HRV1 1ND2C 3LAGA 5FYBA 2RMU3 2WYSA 3HVDA 4P9GA 1DQ1A 1OHFA 4Y1XA 1F5FA 4ONUA 2OIIA 2GMMA 2A5ZA 4RN5A 1D4M3 4BU2A 3CF6E 1UYZA 4M3CF 4S2FA 2VNOA 4NROA 1QDCA 3VBOB 3LCPA 3NAPA 3ZDVA 2BNNA 4CA9A 3SC7X 5L36A 1UQXA 2MEV2 2VQ0A 2YU2A 3J26N 4CCLA 4YW5A 4UW4A 2YC4A 1XXNA 1JZ5A 3RZLA 1U5ZA 2J1UA 2OX0A 4LKDA 5FO8B 4FQZA 5IVVA 4NPRA 1IPKA 4YW2A 3K77A 1P8JA 3GHMA 1GZWA 2OQ6A 1WW5A 5F2SA 5JAXA 1MS1A 1WLTA 4M00A 3UKVA 5I8SA 5A3LA 3VV1A 1ZREA 1BBT2 1BMV2 4XC9A 1LGNA 1CPMA 3N7JA 4GB31 4AHXA 3B3QE 4GMP1 1ZZ7A 3BODA 2XONA 5FR3A 2LUWA 1SFYA 4YZ4A 2QQPA 5A32A 1CVNA 4N53B 4TYSA 5JIAA 2VU9A 3I49A 5C5TA 1US3A 2RR12 1UU5A 1GWLA 4Y22B 4EZ4A 5LY2A 2C9AA 1QDOA 4LO6B 3FZ3A 5C70A 1DQ6A 4KG8A 3V0AA 3I2OA 3HR9A 1HJFA 1A78A 3TBDA 3WR0A 3MIGA 3MGUA 1QWRA 1TME3 2PTMA 3ETPA 1DLLA 3MIDA 5F2WA 5EQUA 4AI8A 1VBD1 4YVWB 3ZKYA 1ZX5A 4LQRA 4LIUA 3WSOA 2R32A 3S5AA 4FSJA 3OPWA 3HD8B 4PBPA 3BTAA 3ZFEC 1STMA 1ND3C 2RJ2A 2PHRA 3HNBM
chains in the Genus database with same CATH topology
3DYMA 2YB7A 4ZXEA 1JZ3A 3K75B 1JI6A 2C26A 2Y6HA 2YFUA 3CDZB 3WNPA 4E8CA 2C4XA 5LCWL 1OF3A 3I97A 4Z2AA 3BN6A 4QB1A 2HLEA 2QQNA 2VZRA 2W87A 2ZEXA 3A21A 2B4KA 1SHWB 1OH4A 4LKSA 2YFZA 3T08A 5G04L 3F2ZA 4M4RA 5JXIA 2E31A 4A3ZA 1W8NA 4BK5A 3K4DA 1NUKA 3VDCA 5DMYA 5B4XA 3OBAA 2KD7A 1L7QA 1TG7A 4XURA 3C7HA 1J83A 3VD9A 2W94A 1ULPA 1DLCA 3A7QA 3I2HA 1EUTA 2WABA 4UAPA 2WO1A 1JZ8A 2BGPA 5JXHA 1K45A 1GOGA 1I5PA 3HEIA 4CUBA 3C7FA 4PQQA 1H6XA 5IYYA 3LE0A 1GNYA 1NX9A 2WBKA 4QX2A 4QB6A 2DCJA 3MV11 3K46A 1SDDB 1GU3A 1D7PM 4TXWA 1UY1A 3OEBA 1US2A 4OMCA 4A41A 3I2GA 1JYWA 3T2OA 4QDRA 2VOTA 3PUIA 3U37A 2J22A 2WZEA 1XNAA 4AG4A 1L7RA 2XQXA 5JXGA 5EJ1B 2V72A 3CZUA 2VMFA 4P08A 1JYXA 2PQSA 1EUUA 1XNTA 4ET7A 4E8DA 2VO5A 2X10A 3C7OA 1PX3A 2W95A 1W99A 2VZQA 3LPFA 4JX0A 4ZZ8A 4DUXA 3CIHA 4IUGA 3HNMA 5CZKA 3T0BA 1GOHA 1GUIA 3FL7A 1NKGA 1JZ2A 4D0QA 2YC2A 3GM8A 2JDAA 4XUPA 2EIBA 2WAOA 2VZUA 1NAEA 1KEXA 1XC6A 5EIYB 2Y6JA 1H6YA 2VCCA 3LEIA 2WZ8A 3VD3A 1CZTA 1UX7A 2Z4FA 5FUIA 1CX1A 2W3JA 2WN2A 4BXSV 3NRUA 1W9TA 2W1QA 1JZ4A 3E1F1 4QX3A 1CZVA 2BBAA 3T2QA 2J1VA 3SEPA 3HNYM 2YG0A 3CKHA 4PT6A 2W47A 3ACIA 2WO2A 3AC0A 2EIDA 2OKXA 3P6BA 5C7GA 2ZEZA 4DXTA 5JUVA 1OT5A 2WDBA 3WNLA 2WUHA 1MPXA 1RYYA 4BDVB 3EYPA 3W5MA 3HOBA 3THCA 3I2JA 2E33A 4QX1A 2LS6A 3PUHA 2BERA 3I2IA 4A42A 1DYOA 4A4AA 2VR4A 4XUNA 4MGQA 2QQIA 2V5DA 2W1UA 3NJVA 1T2XA 4TTGA 2R7EB 1F4HA 1R64A 5LA0A 3HN3A 4KWUA 4BK4A 1ULOA 4XUQA 3LQCA 1UXXX 3W5NA 4DUVA 2W46A 3ZM8A 2DCKA 3FN9A 3P1IA 1OF4A 3LPGA 3MBWA 4OYUA 3I2KA 4L0PA 1LNSA 2J1AA 4JHZA 4QB2A 2W91A 4CUCA 5J1XA 3WF3A 2J1SA 3I3EA 4OMDA 2B9VA 4FI9A 1GMMA 4W50A 3OB8A 4QPWA 1W0NA 4MO3M 4A44A 1O59A 4XZUG 2VZTA 4MOAA 2JKXA 3IB3A 4OZOA 4ZZ5A 2VQTA 3C7GA 1DP0A 1WKYA 4RYDA 5JMOA 4PF1A 1HN1A 2J1RA 3OGSA 1F4AA 3T09A 4GZ9A 2VZ3A 3SKJE 3HPNA 3EB7A 4HG6B 2W9XA 2EICA 2RV9A 4A6OA 3K4AA 1JZ6A 4XUTA 3J7HA 5A1AA 5JXJA 1UY4A 4JKMA 1JYNA 1XPWA 2QQLA 5IHRA 1BHGA 4QDSA 2ZEWA 1UY3A 5DQ0A 2VCAA 2VZ1A 3WEZA 2VZOA 4QAWA 3ACHA 1UWWA 1K42A 1JU4A 1UY0A 4P02B 2WO3A 3CQOA 3SKVA 3VD7A 2W1SA 3VD5A 2WQ8A 4DXRA 4ARYA 4XVHA 4W4ZA 2Y6LA 2EIEA 1TVGA 4ARXA 1K12A 3HJRA 1JYVA 2W1WA 1WCQA 1O8PA 2E26A 3FHQA 3THDA 2VMEA 3A23A 3ACGA 4QX0A 3T0DA 3WF1A 3LEGA 3ABZA 3DYPA 4UI9L 1JU3A 1O8SA 2VTFA 5DN2A 2ZEYA 1GQPA 3FHAA 1UYYA 2VMDA 3NQHA 3WNOA 3MUY1 4A45A 1IQDC 3UNPA 3K4ZA 3WNMA 2DDUA 2ID4A 4QDQA 4CU8A 1UMIA 5LA2A 2Y6KA 3NNGA 1UXZA 2CDOA 1W9SA 5IFPA 3IAQA 2J1TA 3CZJA 2JD9A 3IDAA 2W5FA 1W9WA 2VCBA 3C8XA 3UETA 3D3AA 4LPLA 5F7UA 4MADA 5CYYA 3BGAA 3MUZ1 1KGYA 4YPJA 3IIIA 3C7EA 2BGOA 2XHNA 3CMGA 4D8MA 1JHJA 4DEQA 2C9KA 3JXSA 4CU6A 4BJ0A 3WF0A 3A22A 3MO4A 3WNKA 2ORXA 4DEVA 4AAXA 1J84A 4XUOA 2HYXA 2ZXQA 2VZPA 3GXUA 3VDAA 1SG3A 2LW8A 2QQJA 1CZSA 3OGRA 3MV01 1UZ0A 2E32A 3I3DA 2J1EA 3DECA 3OG2A 2VL4A 3IAPA 2QBXA 5HXMA 3WQBA 3VDBA 2L9LA 2VC9A 3ACFA 2Y64A 2JE8A 2VJXA 1YQ2A 4GWJA 5C71A 3ECQA 1UYXA 2VZVA 1GOFA 1CIYA 4JKKA 1PX4A 4DXSA 2ORZA 3UESA 5EJZB 5B4NA 2X09A 3I2FA 2BZDA 3WF2A 3GGLA 3SEEA 1W8OA 5I0DA 4KMQA 4MGSA 4P5YA 1UMHA 1K3IA 2WYSA 2WN3A 5DPNA 2X05A 2QQKA 3VD4A 4ZY9A 3DYOA 4RN5A 4P00B 5HPOA 3LEKA 1UYZA 1PMHX 2RVAA 3WNNA 5JR2A 4KI5M 4LHSA 1OD3A 2YC4A 3GDBA 4OUEA 1JZ5A 2J1UA 2VQUA 1UY2A 5LA1A 2WAAA 4JKLA 3K77A 1P8JA 3OGVA 2QQOA 2QQMA 3T0AA 3I3BA 1PMJX 2V4VA 1JZ7A 4CU9A 2XOMA 2XONA 4DUWA 2W92A 2VZSA 3OEAA 3T2PA 4CVUA 1US3A 4CU7A 2Y8KA 5IFTA 5IJRA 4M4PA 3WF4A 5C70A 3NJXA 5G05L 3ETPA 4W8JA 4GWIA 2CDPA 2J7MA 4LQRA 2VMCA 4UOJA 3WSOA 2Y6GA 2VM9A 4CUAA 2RJ2A 3HNBM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DYM A;  2YB7 A;  4ZXE A;  1JZ3 A;  3K75 B;  1JI6 A;  2C26 A;  2Y6H A;  2YFU A;  3CDZ B;  3WNP A;  4E8C A;  2C4X A;  5LCW L;  1OF3 A;  3I97 A;  4Z2A A;  3BN6 A;  4QB1 A;  2HLE A;  2QQN A;  2VZR A;  2W87 A;  2ZEX A;  3A21 A;  2B4K A;  1SHW B;  1OH4 A;  4LKS A;  2YFZ A;  3T08 A;  5G04 L;  3F2Z A;  4M4R A;  5JXI A;  2E31 A;  4A3Z A;  1W8N A;  4BK5 A;  3K4D A;  1NUK A;  3VDC A;  5DMY A;  5B4X A;  3OBA A;  2KD7 A;  1L7Q A;  1TG7 A;  4XUR A;  3C7H A;  1J83 A;  3VD9 A;  2W94 A;  1ULP A;  1DLC A;  3A7Q A;  3I2H A;  1EUT A;  2WAB A;  4UAP A;  2WO1 A;  1JZ8 A;  2BGP A;  5JXH A;  1K45 A;  1GOG A;  1I5P A;  3HEI A;  4CUB A;  3C7F A;  4PQQ A;  1H6X A;  5IYY A;  3LE0 A;  1GNY A;  1NX9 A;  2WBK A;  4QX2 A;  4QB6 A;  2DCJ A;  3MV1 1;  3K46 A;  1SDD B;  1GU3 A;  1D7P M;  4TXW A;  1UY1 A;  3OEB A;  1US2 A;  4OMC A;  4A41 A;  3I2G A;  1JYW A;  3T2O A;  4QDR A;  2VOT A;  3PUI A;  3U37 A;  2J22 A;  2WZE A;  1XNA A;  4AG4 A;  1L7R A;  2XQX A;  5JXG A;  5EJ1 B;  2V72 A;  3CZU A;  2VMF A;  4P08 A;  1JYX A;  2PQS A;  1EUU A;  1XNT A;  4ET7 A;  4E8D A;  2VO5 A;  2X10 A;  3C7O A;  1PX3 A;  2W95 A;  1W99 A;  2VZQ A;  3LPF A;  4JX0 A;  4ZZ8 A;  4DUX A;  3CIH A;  4IUG A;  3HNM A;  5CZK A;  3T0B A;  1GOH A;  1GUI A;  3FL7 A;  1NKG A;  1JZ2 A;  4D0Q A;  2YC2 A;  3GM8 A;  2JDA A;  4XUP A;  2EIB A;  2WAO A;  2VZU A;  1NAE A;  1KEX A;  1XC6 A;  5EIY B;  2Y6J A;  1H6Y A;  2VCC A;  3LEI A;  2WZ8 A;  3VD3 A;  1CZT A;  1UX7 A;  2Z4F A;  5FUI A;  1CX1 A;  2W3J A;  2WN2 A;  4BXS V;  3NRU A;  1W9T A;  2W1Q A;  1JZ4 A;  3E1F 1;  4QX3 A;  1CZV A;  2BBA A;  3T2Q A;  2J1V A;  3SEP A;  3HNY M;  2YG0 A;  3CKH A;  4PT6 A;  2W47 A;  3ACI A;  2WO2 A;  3AC0 A;  2EID A;  2OKX A;  3P6B A;  5C7G A;  2ZEZ A;  4DXT A;  5JUV A;  1OT5 A;  2WDB A;  3WNL A;  2WUH A;  1MPX A;  1RYY A;  4BDV B;  3EYP A;  3W5M A;  3HOB A;  3THC A;  3I2J A;  2E33 A;  4QX1 A;  2LS6 A;  3PUH A;  2BER A;  3I2I A;  4A42 A;  1DYO A;  4A4A A;  2VR4 A;  4XUN A;  4MGQ A;  2QQI A;  2V5D A;  2W1U A;  3NJV A;  1T2X A;  4TTG A;  2R7E B;  1F4H A;  1R64 A;  5LA0 A;  3HN3 A;  4KWU A;  4BK4 A;  1ULO A;  4XUQ A;  3LQC A;  1UXX X;  3W5N A;  4DUV A;  2W46 A;  3ZM8 A;  2DCK A;  3FN9 A;  3P1I A;  1OF4 A;  3LPG A;  3MBW A;  4OYU A;  3I2K A;  4L0P A;  1LNS A;  2J1A A;  4JHZ A;  4QB2 A;  2W91 A;  4CUC A;  5J1X A;  3WF3 A;  2J1S A;  3I3E A;  4OMD A;  2B9V A;  4FI9 A;  1GMM A;  4W50 A;  3OB8 A;  4QPW A;  1W0N A;  4MO3 M;  4A44 A;  1O59 A;  4XZU G;  2VZT A;  4MOA A;  2JKX A;  3IB3 A;  4OZO A;  4ZZ5 A;  2VQT A;  3C7G A;  1DP0 A;  1WKY A;  4RYD A;  5JMO A;  4PF1 A;  1HN1 A;  2J1R A;  3OGS A;  1F4A A;  3T09 A;  4GZ9 A;  2VZ3 A;  3SKJ E;  3HPN A;  3EB7 A;  4HG6 B;  2W9X A;  2EIC A;  2RV9 A;  4A6O A;  3K4A A;  1JZ6 A;  4XUT A;  3J7H A;  5A1A A;  5JXJ A;  1UY4 A;  4JKM A;  1JYN A;  1XPW A;  2QQL A;  5IHR A;  1BHG A;  4QDS A;  2ZEW A;  1UY3 A;  5DQ0 A;  2VCA A;  2VZ1 A;  3WEZ A;  2VZO A;  4QAW A;  3ACH A;  1UWW A;  1K42 A;  1JU4 A;  1UY0 A;  4P02 B;  2WO3 A;  3CQO A;  3SKV A;  3VD7 A;  2W1S A;  3VD5 A;  2WQ8 A;  4DXR A;  4ARY A;  4XVH A;  4W4Z A;  2Y6L A;  2EIE A;  1TVG A;  4ARX A;  1K12 A;  3HJR A;  1JYV A;  2W1W A;  1WCQ A;  1O8P A;  2E26 A;  3FHQ A;  3THD A;  2VME A;  3A23 A;  3ACG A;  4QX0 A;  3T0D A;  3WF1 A;  3LEG A;  3ABZ A;  3DYP A;  4UI9 L;  1JU3 A;  1O8S A;  2VTF A;  5DN2 A;  2ZEY A;  1GQP A;  3FHA A;  1UYY A;  2VMD A;  3NQH A;  3WNO A;  3MUY 1;  4A45 A;  1IQD C;  3UNP A;  3K4Z A;  3WNM A;  2DDU A;  2ID4 A;  4QDQ A;  4CU8 A;  1UMI A;  5LA2 A;  2Y6K A;  3NNG A;  1UXZ A;  2CDO A;  1W9S A;  5IFP A;  3IAQ A;  2J1T A;  3CZJ A;  2JD9 A;  3IDA A;  2W5F A;  1W9W A;  2VCB A;  3C8X A;  3UET A;  3D3A A;  4LPL A;  5F7U A;  4MAD A;  5CYY A;  3BGA A;  3MUZ 1;  1KGY A;  4YPJ A;  3III A;  3C7E A;  2BGO A;  2XHN A;  3CMG A;  4D8M A;  1JHJ A;  4DEQ A;  2C9K A;  3JXS A;  4CU6 A;  4BJ0 A;  3WF0 A;  3A22 A;  3MO4 A;  3WNK A;  2ORX A;  4DEV A;  4AAX A;  1J84 A;  4XUO A;  2HYX A;  2ZXQ A;  2VZP A;  3GXU A;  3VDA A;  1SG3 A;  2LW8 A;  2QQJ A;  1CZS A;  3OGR A;  3MV0 1;  1UZ0 A;  2E32 A;  3I3D A;  2J1E A;  3DEC A;  3OG2 A;  2VL4 A;  3IAP A;  2QBX A;  5HXM A;  3WQB A;  3VDB A;  2L9L A;  2VC9 A;  3ACF A;  2Y64 A;  2JE8 A;  2VJX A;  1YQ2 A;  4GWJ A;  5C71 A;  3ECQ A;  1UYX A;  2VZV A;  1GOF A;  1CIY A;  4JKK A;  1PX4 A;  4DXS A;  2ORZ A;  3UES A;  5EJZ B;  5B4N A;  2X09 A;  3I2F A;  2BZD A;  3WF2 A;  3GGL A;  3SEE A;  1W8O A;  5I0D A;  4KMQ A;  4MGS A;  4P5Y A;  1UMH A;  1K3I A;  2WYS A;  2WN3 A;  5DPN A;  2X05 A;  2QQK A;  3VD4 A;  4ZY9 A;  3DYO A;  4RN5 A;  4P00 B;  5HPO A;  3LEK A;  1UYZ A;  1PMH X;  2RVA A;  3WNN A;  5JR2 A;  4KI5 M;  4LHS A;  1OD3 A;  2YC4 A;  3GDB A;  4OUE A;  1JZ5 A;  2J1U A;  2VQU A;  1UY2 A;  5LA1 A;  2WAA A;  4JKL A;  3K77 A;  1P8J A;  3OGV A;  2QQO A;  2QQM A;  3T0A A;  3I3B A;  1PMJ X;  2V4V A;  1JZ7 A;  4CU9 A;  2XOM A;  2XON A;  4DUW A;  2W92 A;  2VZS A;  3OEA A;  3T2P A;  4CVU A;  1US3 A;  4CU7 A;  2Y8K A;  5IFT A;  5IJR A;  4M4P A;  3WF4 A;  5C70 A;  3NJX A;  5G05 L;  3ETP A;  4W8J A;  4GWI A;  2CDP A;  2J7M A;  4LQR A;  2VMC A;  4UOJ A;  3WSO A;  2Y6G A;  2VM9 A;  4CUA A;  2RJ2 A;  3HNB M; 
#chains in the Genus database with same CATH topology
 1SPP A;  3CO2 A;  4ZXE A;  1EAH 3;  2R6Q A;  3I59 A;  1H2N A;  4FPC A;  4LA2 A;  1AXK A;  2Y6H A;  2YFU A;  4LK6 A;  5KHJ A;  2ENR A;  3PUQ A;  2C4X A;  3I97 A;  2XVK A;  1HV0 A;  4Z2A A;  3BN6 A;  1RJ8 A;  2QQN A;  1MVE A;  4Q4X 2;  5EHD A;  5F5Q A;  2ZEX A;  1QF3 A;  2B4K A;  3A21 A;  4IV1 A;  4IEX A;  1F2N A;  1Z7S 3;  4K8F A;  2D3P A;  1RL3 A;  4XIL A;  3H8X A;  3SHR A;  3OPT A;  3MDP A;  4HN1 A;  2JIC A;  1T6B X;  1GYK A;  3IDB B;  4A3Z A;  5BNN C;  2FDJ A;  1WMF A;  4LHK A;  4LIT A;  5FPV A;  4YWA A;  2FMY A;  1HIX A;  5FZI A;  4XMI A;  2RJK A;  3C7H A;  1S2E A;  2JEN A;  2YGL A;  1J83 A;  4YM0 A;  1JN2 P;  1GP5 A;  4PLM A;  4S2G A;  3ZFE A;  1EUT A;  4UAP A;  3RI9 A;  1JZ8 A;  1LGC A;  5BYN A;  3PVB B;  2BGP A;  1B09 A;  1D2S A;  1WBF A;  3SH4 A;  5JXH A;  2JE7 A;  1K45 A;  2PYT A;  4GB3 2;  4HK8 A;  2VXJ A;  1RIN A;  4Q4V 3;  1C8M 3;  1RMU 1;  4FPF A;  4JDO A;  3S30 A;  3LKJ A;  1JOJ A;  2EIG A;  3B9I A;  4PQQ A;  2R07 3;  4XDP A;  1KJR A;  1HX6 A;  4Q4Y 1;  1ZZ9 A;  4K7J A;  4FTE A;  1NX9 A;  2R49 A;  1OPM A;  1YLL A;  3KGZ A;  3O5S A;  5FPX A;  3VBS B;  3U0Z A;  4JGY B;  2ZX1 A;  4Q5O A;  3KQR A;  1SDD B;  5A3T A;  1LTE A;  2PAM A;  4D3W A;  1D7P M;  3S0M A;  1Y9M A;  4NUB A;  4ZZ5 A;  3SCF A;  5BNN A;  1D0G A;  1VBD 2;  3O1U A;  3NNJ A;  3AZX A;  2P17 A;  1LR5 A;  1PO1 3;  3MI8 A;  1AZD A;  2E51 A;  3THP A;  3VZN A;  5FZO A;  4JGZ B;  3U37 A;  4YW1 A;  2WZE A;  1XNA A;  1ULE A;  3T2T A;  2IXJ A;  5IWF A;  1F35 A;  4FOW A;  4Q2F A;  1PM4 A;  5L9R A;  5CFD B;  5FXW A;  3GBF A;  3CZU A;  1DCS A;  3JD7 1;  5E1R A;  3ZPO A;  2XJT A;  3LSD A;  4K1Z A;  2XG3 A;  4XDQ A;  5CFC B;  4AVA A;  1EUU A;  1XNT A;  3MFA A;  4AHY A;  4E8D A;  4KU7 A;  4QXH A;  3FMG A;  4AFB A;  4MGT A;  4BIF A;  3JQX A;  5T55 A;  4GQ7 A;  5KBF A;  5A7S A;  2AAC A;  2A6X A;  2ZGR A;  1RJ7 A;  4CP2 A;  2JDM A;  3N9M A;  4XAB A;  2HJI A;  2VZQ A;  5KWR A;  4ZZ8 A;  3INA A;  1QEX A;  3OF1 A;  2PLV 1;  3O14 A;  4R9B A;  4IUG A;  2E9Q A;  2YGM A;  3HNM A;  4Y3O A;  4N7I A;  1GUI A;  4QXB A;  2JB4 A;  3T0B A;  4BQ4 A;  3SIT A;  1JZ2 A;  3UGG A;  2JXA A;  5A7W B;  4GIQ A;  1W2O A;  3WG1 A;  4YM3 A;  1VRH 3;  4I09 A;  1NAE A;  4TSV A;  1JYI A;  3GYD A;  4D0Q A;  1XC6 A;  3N9L A;  1A3K A;  2CL2 A;  2Y6J A;  4HVR A;  3LEI A;  2WNV B;  5FK8 A;  4NVP A;  1CZT A;  1HB1 A;  2Z4F A;  2I45 A;  4IE5 A;  1S0E A;  2WN2 A;  2XBO 1;  3VL8 A;  4PQ9 A;  1RUI 3;  4B7K A;  5A3O A;  4HT1 T;  1GLH A;  2XL7 A;  1G9A A;  1H2M A;  1RMU 2;  3WHT A;  1X82 A;  2Z5W A;  4CCK A;  3V0B B;  3E1F 1;  1CZV A;  2V73 A;  2ZA9 A;  3U78 A;  2BBA A;  3D0J A;  4CP1 A;  4UF0 B;  3T2Q A;  3WP6 A;  1J1L A;  1VBC 3;  3EQE A;  4RD7 A;  2ET7 A;  2VNG A;  4FAH A;  5BNP B;  1GWK A;  3HNY M;  2YG0 A;  3H8R A;  2ADE A;  3ILR A;  5F6K A;  1N1Y A;  2EXI A;  3WW4 A;  2YXS A;  4BB3 A;  2MNG A;  3KB5 A;  3PHM A;  2WFF 1;  5L7O C;  4DXT A;  5JUV A;  1XB9 A;  5HI0 A;  1BXH A;  2XHK A;  2WUH A;  3MIB A;  4MX3 A;  4BDV B;  4JAA A;  2P4E A;  2UYA A;  3KT4 A;  2RMU 1;  4J6G A;  1C1L A;  1QH7 A;  1S0F A;  4MYE A;  3THC A;  5FYT A;  2PHX A;  1MEC 2;  4EWD A;  1D4M 1;  4LT5 A;  4ZHN A;  5C4W C;  5J09 A;  2LS6 A;  3KQ4 B;  4RR3 A;  5FPB A;  2QVS B;  4YFW A;  4FTS A;  2BER A;  1AJO A;  4F7Z A;  4LBL A;  5ISL A;  4G4F A;  4IET A;  2QQW A;  2XUM A;  4QHB A;  1W03 A;  4XUN A;  2W68 A;  1HDK A;  4HOO A;  2QQI A;  2V5D A;  2W1U A;  5FO9 B;  2A3Y A;  3ZVX A;  4L11 A;  2XKO A;  1MZE A;  3NJV A;  3CU7 A;  1LGB A;  1LOE A;  4PIZ A;  2H0B A;  1I6X A;  4GH4 A;  2HWC 3;  4K9S A;  1W8W A;  3VBH B;  4CCN A;  3UL2 A;  1DFQ A;  2ZGQ A;  1PVC 3;  2Y38 A;  5A3P A;  2FD8 A;  2D6O X;  3USU A;  3ZN6 A;  3HN1 A;  4QU2 A;  5FZB A;  2ZX3 A;  2O14 A;  3VBF A;  1J3P A;  4B4R A;  4AGR A;  2ARE A;  4NO4 A;  4BMB A;  3QOP A;  4QMA A;  1VR3 A;  2ZML A;  1QJU 3;  4R9C A;  1UZW A;  1UX6 A;  2QTW B;  2R1B A;  3FN9 A;  4AHZ A;  5FRA A;  4AL9 A;  2QUO A;  5H9S A;  2GP3 A;  1DGR N;  4XHB A;  1TME 1;  4A7Y A;  4CDQ B;  2R0H A;  3LPG A;  2Y26 A;  5C4W A;  1C28 A;  4CCE A;  2XBO 2;  2WKK A;  4JHZ A;  4LLF A;  4MVT A;  4NPL A;  4MHR A;  3ZXF A;  4EQV A;  2J1S A;  1SDW A;  3AVS A;  2XJQ A;  2JKB A;  2ZZQ A;  4LO4 B;  3IMM A;  5LW9 A;  3PU8 A;  5L9B A;  1DU3 D;  1W6Q B;  2B9V A;  2CAU A;  2XVG A;  3VBO C;  5E6H A;  1QNW A;  3WDY A;  1KFU L;  5A6X A;  2Z69 A;  1EAH 1;  2DU1 A;  3DPR C;  4A44 A;  1O59 A;  3PME A;  3VGI A;  1WBL A;  2I74 A;  4XZU G;  4OHV A;  1W6N B;  1W8Z A;  2VZT A;  2Q8C A;  4MOA A;  2JKX A;  2WFF 2;  4L97 A;  4CEY C;  1R1Z A;  2XML A;  1DP0 A;  1TNR A;  2AH2 A;  2DUP A;  4K20 A;  4PF1 A;  4XJW A;  2ZGT A;  4P9X A;  4QGM A;  1Z7S 1;  2OUH A;  3WG3 A;  2P3Y A;  1O7F A;  4XZP A;  3OUI A;  1G9B A;  4XJ9 A;  2RS3 3;  3HPN A;  3SKJ E;  2OA2 A;  4KL1 A;  1D4M 2;  1OOP C;  2RV9 A;  3KF5 A;  5T3N A;  2MHF A;  1V6L A;  2OPK A;  1HQL A;  3FUQ A;  5FXX A;  2E53 A;  3K2O A;  1CWP A;  3LB9 A;  3LOI A;  3ZYG A;  4EE2 A;  1LCL A;  1FX5 A;  1Q56 A;  1FNZ A;  3N9Q A;  2YDE A;  5FP9 A;  2AYH A;  5CBL A;  5KXE A;  4E2S A;  1IHM A;  4Y5Z 0;  1GZ9 A;  2QQL A;  2W52 A;  5IHR A;  4YVW C;  1H8T B;  1JTZ X;  4YVS C;  3RI8 A;  3WEZ A;  2ZGP A;  2GH2 A;  2JEC A;  3DPR A;  4Q4V 1;  1C8M 1;  3KS7 A;  5FJK A;  1OLM E;  3WP5 A;  3ENR A;  1ENQ A;  2R07 1;  3AYC A;  1K42 A;  4XAE A;  2ZBJ A;  3WG2 A;  4CEY A;  2BOJ A;  2WO3 A;  2YHJ A;  3M4F A;  4A6S A;  3SKV A;  3NO8 A;  5JDB A;  1AYM 2;  1FNY A;  2WQ8 A;  4DXR A;  5JLV A;  4YNI A;  2P3K A;  4HMZ A;  4XVH A;  4M01 A;  2Y6L A;  5KC5 A;  3NAP B;  1TME 2;  3ORJ A;  4B4P A;  4W6W A;  2GP5 A;  3U75 A;  4GWM A;  4DIQ A;  2BWA A;  4ZPI A;  3LFM A;  1XU1 A;  1PO1 1;  3ME2 A;  1O8P A;  1GZW B;  2VUJ A;  1XND A;  1NA1 C;  1NLQ A;  3A23 A;  1UIK A;  3RYK A;  3ACG A;  4DXZ A;  4DZG A;  5I0T A;  4QQL A;  4QX0 A;  5LEJ A;  1ODN A;  2MEV 3;  1F5J A;  1NXM A;  3N35 A;  3KV5 A;  1XE7 A;  5BUV A;  4N9H A;  4YVS A;  3ZLI A;  1ZRC A;  1KJL A;  1O8S A;  3J7N A;  2VTF A;  3M1H A;  4FPH A;  4HKO A;  5DAQ A;  4BHP A;  2FZ2 A;  1Z7S 2;  3H8U A;  1JUI A;  3NV4 A;  5DN2 A;  5F3G A;  3HMY A;  3GNE A;  3V0A B;  2YY1 A;  4FP3 A;  4DNY A;  3ZN4 A;  3NW4 A;  4NRP A;  2OQ7 A;  2A6Z A;  3KSC A;  4OHW A;  1H1A A;  3EJK A;  2GND A;  5GLZ A;  1LAJ A;  4LOS A;  4JRL A;  2RR1 3;  5DUX A;  1UMI A;  4XTM A;  1UIJ A;  4NRQ A;  1VRH 1;  4NN0 A;  4BLI A;  4COU A;  3ST7 A;  3CJI C;  3WOG A;  2IFW A;  1SPP B;  2PHF A;  2Y6F A;  5FZ4 A;  1CGP A;  5JOY A;  2A6W A;  3I59 B;  2OS2 A;  4PJY A;  5C3P A;  4FOQ A;  3ZYH A;  1RUI 1;  1NA1 A;  2RDS A;  5IFP A;  2YPJ A;  2BUK A;  2JD9 A;  4AQT A;  4BQX A;  2R30 A;  1JYT A;  2FQP A;  1W9W A;  5TSW A;  3ZYF A;  4QHZ A;  5FUN A;  5FOB B;  3QLQ A;  4IV1 B;  4JGZ C;  2R07 2;  4LPL A;  1VBC 1;  4IND A;  1W3V A;  4Q8K A;  3ZYR A;  5F8P A;  2WL1 A;  1VAV A;  5CKM A;  5C3S A;  1VBA 2;  2UYB A;  3BGA A;  3MUZ 1;  4Y26 A;  5L19 A;  1KGY A;  3BI3 A;  3POY A;  4P9W A;  1YIF A;  3MIH A;  5FZ6 A;  1QHD A;  2OPW A;  5T50 A;  2WT2 A;  4AW7 A;  3T1L A;  3PNA A;  1W0P A;  4YGC A;  5AC9 3;  2ZGS A;  2AEY A;  2ZHK A;  4AE2 A;  4AFC A;  1JW6 A;  1QKQ A;  4E4S A;  4LUL A;  4A7K A;  3S57 A;  5L9V A;  4RFR B;  2GC3 A;  4CU6 A;  1PO1 2;  1W2N A;  2HH9 A;  4BIO A;  4IE6 A;  2I07 B;  2GH8 A;  3DL3 A;  4CDW C;  5ACA 3;  3ZFE B;  2VW1 A;  1RUD 2;  2XJR A;  3I2D A;  1ZYB A;  2CSG A;  3CJI A;  5K0U C;  4ES9 A;  3WD5 A;  1MS8 A;  1GAN A;  1J84 A;  3PVN A;  3K51 A;  3ZXK A;  4DRR A;  4CPB A;  2OW4 A;  3OGR A;  4GWN A;  3MV0 1;  4AZZ A;  1UZ0 A;  1UYP A;  4BME A;  5FZG A;  2TEP A;  2J1E A;  5JSR A;  3PJY A;  3DEC A;  1JMU B;  3FX3 A;  3LIG A;  1QOO A;  4Z8B A;  3I7D A;  4LKF A;  2HWC 1;  3NJY A;  2BFU L;  2QBX A;  2OXB A;  4CCM A;  3U1X A;  4XW3 A;  3QD6 A;  3WQB A;  1PVC 1;  1RTV A;  2B7Y A;  3H3Z A;  1GFF 2;  3U4S A;  2VC9 A;  1IZ3 A;  4KGG A;  4QX7 A;  4UW5 A;  3QCW A;  5BXX A;  4CPB D;  5BNN B;  1W3X A;  1OFN A;  3JZV A;  4JCK A;  5GKA C;  5CEH A;  5KXC A;  1UOB A;  4R8H A;  1ULF A;  1QJU 1;  2WLP A;  4XJA A;  4LO5 B;  2IXH A;  3AP5 A;  1N3O A;  4YM2 A;  4EJR A;  2MPF A;  3T3Y A;  5FWJ A;  5FZO B;  2AUY A;  1PX4 A;  2IXC A;  3AZY A;  2ORZ A;  2WR9 A;  3UES A;  3F95 A;  1CES A;  4CDW A;  5B4N A;  1AF9 A;  1ZRD A;  3I2F A;  2BZD A;  1RUI 2;  1PZ8 A;  3IDE A;  4IGO A;  3WVJ A;  3U11 A;  2B5H A;  5K0U A;  4MGS A;  4IW3 A;  2EAK A;  4UBH A;  1UMH A;  1UZZ A;  3WDT A;  2WN3 A;  5DPN A;  1VBC 2;  3KCY A;  2WWJ A;  2X05 A;  1SBF A;  4GJZ A;  1W6P B;  3ZSE A;  3PIG A;  4XE9 A;  3DYO A;  2QZ2 A;  1LOG A;  4JTN A;  2RDR A;  4R9A A;  3TN9 3;  2RVA A;  3POG A;  4KI5 M;  1OXC A;  1BYH A;  3OY8 A;  3H3U A;  2KA3 A;  2C1F A;  5EXO A;  5KHI A;  4LHS A;  3EO6 A;  1GNZ A;  3GF6 A;  4OUE A;  5CB7 A;  1V70 A;  2CU5 A;  5IVE A;  2VTX J;  4JKL A;  5LY1 A;  5LBB A;  3VBH C;  1XJA A;  2RS3 1;  3HQX A;  4XIK A;  1GKB A;  4RQP C;  1OH3 A;  3WCR A;  4XFI A;  3WHU A;  4XXA A;  4UT5 A;  1ZRI A;  2V4V A;  2V4A A;  4XAC A;  4AXO A;  4FTB A;  3A0K A;  5IK8 A;  4AQ6 A;  1RUJ 1;  2W92 A;  1EV1 3;  3JU9 A;  4HSL A;  1EPZ A;  4URT A;  5I8Y A;  1LOD A;  2VZS A;  3LFI A;  3OEA A;  2EA7 A;  2WYF A;  5T5L A;  3T2P A;  4CVU A;  5IVC A;  4CU7 A;  5IFT A;  1RUF 3;  4M0H A;  4CDQ C;  5IJR A;  4QHO A;  1OD5 A;  1DGW A;  2K2S A;  3BPS A;  4M4P A;  3OYW A;  4C91 A;  3KHB A;  2LRP A;  2UWA A;  5EFU A;  3NJX A;  3ZIW A;  1JUH A;  2HWC 2;  2QFE A;  2CHH A;  2P6H A;  2OYZ A;  4AVV A;  2PHU A;  3POE A;  5BY5 A;  1S4C A;  4YZ3 A;  5C9A C;  2PHW A;  4GWI A;  2ZJC A;  2CDP A;  2VEC A;  4XFH A;  2J7M A;  5E16 A;  2D6M A;  2RM2 3;  2RS1 2;  4X8N A;  4BOW A;  3S7I A;  1QJU 2;  1BJQ A;  5HV0 A;  3BTX A;  1YWK A;  1POV 0;  3M70 A;  4FXK B;  4IQP A;  4Y20 A;  5FV3 A;  3VKF C;  3E6B A;  1JZ3 A;  5LWB A;  5F5A A;  4RQP A;  4HKW A;  3TNP B;  4CYD A;  4BA6 A;  4E8C A;  3PMS A;  1VB4 A;  5LCW L;  3AKP A;  1WA6 X;  3OCP A;  5FQ0 A;  1LRH A;  3AXE A;  1MEC 3;  2YFZ A;  3E6D A;  3RYR A;  3T30 A;  3ZYI B;  4Y1Y A;  1DGR A;  1KIT A;  1POV 3;  3NST A;  4LKE A;  2FCU A;  3GCW A;  2NMO A;  4GH4 B;  4YM1 A;  3WUD A;  4BM8 A;  1F31 A;  1DF0 A;  4QX5 A;  3H8O A;  1ZZ8 A;  2GNB A;  3K4D A;  1NUK A;  2BFU S;  3FLT A;  5EWS A;  2ZZJ A;  2HBT A;  4XJ8 A;  4XJU A;  3GJB A;  5E88 A;  4GAZ A;  3ZN6 B;  4AEK A;  5DMY A;  1LHW A;  2DBN A;  2KD7 A;  2WJS A;  3FC0 A;  3NV2 A;  1J3Q A;  3OBA A;  4UWD A;  5LRR A;  2CGN A;  5C9A A;  5JPM B;  1BMV 1;  4D7S A;  3H42 B;  2CGP A;  2JG9 C;  1DLC A;  2ZHN A;  3I2H A;  5GJ6 A;  1SLC A;  2RS3 2;  3RRD A;  2BTV C;  3W21 A;  1NZI A;  4KQ7 A;  2WO1 A;  3ZDS A;  1JYC A;  2F6B A;  2B46 X;  3BTY A;  5KHG A;  5DAB A;  2VQA A;  1ACC A;  4QT6 A;  2DCT A;  5C4W B;  3Q8B A;  5HCH A;  3HEI A;  1GNH A;  1F15 A;  3OD0 A;  3SQO A;  1AVB A;  5F5I A;  2RR1 1;  4P14 A;  1RUJ 2;  1RUH 2;  3C7F A;  4P9L A;  5IYY A;  1GV9 A;  4MXW A;  3KCX A;  1SLB A;  5ANN A;  2PXJ A;  4G9S B;  2UUR A;  3MZH A;  2D3R A;  3NAP C;  4QX2 A;  4QB6 A;  1IQA A;  4LLO A;  2RG4 A;  5FZE A;  4C90 A;  3RJR A;  1DYK A;  3ON7 A;  4IEW A;  2DVF A;  3K46 A;  5IK4 A;  4ISQ A;  5EZW A;  5JZG A;  3OGG A;  2PMW B;  1BK0 A;  5FYH A;  3VHP A;  4TZD A;  4TXW A;  4MXV A;  1PGS A;  3OEB A;  1MS3 A;  2VUD A;  1US2 A;  4OMC A;  4A41 A;  5FPA A;  1FV2 A;  4BZ4 A;  3I2G A;  3IBM A;  3LA2 A;  1W6O A;  1RB8 G;  1DG6 A;  4PDW C;  2DVD A;  4QDR A;  2JDK A;  2G9F A;  2WC2 A;  1H4H A;  1HB2 A;  2J22 A;  2O0O A;  5FZ1 A;  1Y4W A;  1CJP A;  4FCA A;  4XET A;  1L7R A;  3VL9 A;  2JG9 A;  2BPA 2;  4Q8L A;  5AC9 1;  5F6L B;  2V72 A;  2WNE A;  3GHN A;  3OBR A;  4CDX C;  1JYX A;  3VLB B;  3IZO A;  1J58 A;  1X33 A;  3M3I A;  3PVO A;  5D2A A;  5A33 A;  3N4M A;  1CD3 G;  4TWT A;  2Y34 A;  2B45 X;  3D0S A;  5FTT C;  3SIS A;  5ACA 1;  2FDK A;  5C8W A;  2XLA A;  3JCI A;  3OTF A;  3ZFF A;  4LOT A;  5DUV A;  2W95 A;  1OQD A;  1S2B A;  3LPF A;  2CGO A;  4JX0 A;  3DPR B;  4FPY A;  3ZYP A;  4H7L A;  4Q0P A;  1GOH A;  1AR6 3;  3EMR A;  2D6L X;  1IS3 A;  1NKG A;  1M4W A;  4CEY B;  2HWF 1;  3WXP A;  4ZU5 A;  4OI0 A;  5A6Q A;  2JDA A;  4XUP A;  2OVU A;  2WAO A;  2ZPX A;  1T6G C;  5DXD A;  5KXD A;  4H2A A;  1ZBA 3;  3IDC B;  2YYO A;  5FZ7 A;  3TEY A;  4QGL A;  4DMI A;  1BVP 1;  2VMI A;  1H6Y A;  4XMA A;  4PDW A;  3KT7 A;  5T52 A;  4GKY A;  4LR4 A;  3VD3 A;  4AK3 A;  1WZX A;  3B00 A;  1R09 1;  4IV1 C;  3R05 A;  4W6Y A;  4BXS V;  3MF9 A;  4QPG A;  4WVW A;  4OI2 A;  1OOP B;  3NRU A;  3FLR A;  4RS5 C;  3WP4 A;  5I0S A;  3AKR A;  3ZSM A;  3I4I A;  1LKN A;  1ZZ6 A;  1JZ4 A;  4NE9 A;  2ADD A;  3ZIX A;  4CDX A;  3UJO A;  1AYM 3;  4GUL A;  3CKH A;  4PT6 A;  4IEV A;  2W47 A;  4L8Q A;  4XQ4 A;  3ZR5 A;  2WO2 A;  2A6V A;  2OKX A;  5K8S A;  3ETQ A;  4NWV A;  2G19 A;  4ATE A;  5D1I A;  1YYN A;  2Z79 A;  3MIE A;  5FOJ B;  4YVS B;  2EXK A;  4N43 A;  5FZL A;  3ROU A;  4EN9 B;  5JPN B;  5F39 A;  4Y4Y A;  1XYO A;  5A1L A;  3RNS A;  2HEW F;  1MZ5 A;  1DQ5 A;  3EYP A;  5DG1 A;  3ZXG A;  1O5L A;  2VOK A;  4CEW C;  3LDK A;  2XR4 A;  4AVB A;  1WWY A;  2E33 A;  4B3N A;  1G8W A;  3IWZ A;  2GMP A;  1S0B A;  3MYX A;  1UNB A;  3TN9 1;  4UW6 A;  5DZG A;  2BJS A;  2FCV A;  4Y5S A;  1UU4 A;  5AC9 2;  3RSJ A;  5FZC A;  3RWK X;  4Q0V A;  2VR4 A;  1WME A;  1GR3 A;  4IEP A;  4XEZ A;  2SLI A;  4MGQ A;  5CAD A;  4NR1 A;  4CXY A;  5IK5 A;  4RS5 A;  4FXG B;  3KZ4 C;  3VKO A;  1DDL A;  5ACA 2;  4P9J A;  1AL2 3;  5A3M A;  1VE0 A;  2XUE A;  5IVJ A;  1UPS A;  2TBV A;  4MGY E;  4KH9 A;  1NA1 B;  2ZCW A;  5FY9 A;  4NHL A;  4KWU A;  1BZW A;  5D21 A;  4ATF A;  3IT8 A;  1EV1 1;  5FJH A;  2W08 A;  2XJP A;  3L2Y A;  4XUQ A;  1S0J A;  2HEY F;  3VKN A;  4FQ4 A;  4XBQ A;  5HCA A;  3NNM A;  1RUF 1;  1GP6 A;  4NHK A;  2HWF 2;  1CAV B;  3VBU C;  3W5N A;  4DUV A;  1QXJ A;  2GU9 A;  2CY6 A;  2W46 A;  3ZXA C;  4HK9 A;  2DCK A;  5FZ8 A;  2VBB A;  4CEW A;  5FO7 B;  4LXL A;  3VZO A;  4OYU A;  2PHL A;  1R09 2;  3I2K A;  4L0P A;  2J1A A;  4QB2 A;  5J7M A;  4MLO A;  4AWD A;  2RM2 1;  5LBF A;  2BRT A;  4BQ3 A;  4CDU C;  2DF7 A;  3CEW A;  2LAL A;  2ZGO A;  1RUC 3;  4FI9 A;  1AX0 A;  1VBA 3;  4AI3 A;  1GMM A;  3OB8 A;  1HB3 A;  3LSE A;  4QPW A;  3N9N A;  1W0N A;  1NY7 2;  2XJS A;  4MO3 M;  4PLO A;  4BQ5 A;  1QOS A;  2IXL A;  3CJI B;  4WM8 C;  2O1Q A;  4XFG A;  2Q30 A;  1OVP A;  1YRZ A;  4LJH A;  4FOY A;  2W0X A;  1KXG A;  5GZE A;  3PTR B;  4AFM A;  4NHX A;  5H9R A;  1HN1 A;  1MEC 1;  4FVV A;  4ASM B;  4QU1 A;  4FBF A;  2A73 B;  3BCW A;  1F4A A;  1POV 1;  1RUD 3;  4QM8 A;  4QM9 A;  4H3W A;  3H50 A;  3VBU A;  1WLD A;  3TYJ A;  3TN9 2;  1OUS A;  3HQR A;  1YI7 A;  3RVH A;  1RUG 3;  3J7H A;  2IVJ A;  4IEU A;  4UBG A;  2JDU A;  5IT6 A;  3C3V A;  5FCC A;  1UY4 A;  3H9A A;  4QKN A;  4F3J A;  5FBJ A;  3KV4 A;  4CDU A;  5FKC A;  1W90 A;  4JZR A;  1U5X A;  1BHG A;  1G86 A;  1JOB A;  4I0W B;  4CDW B;  5DQ0 A;  4IV3 C;  1R1A 2;  3AMP A;  2VZO A;  2WNO A;  4UFI A;  1IS5 A;  4JV4 A;  4WM8 A;  2ZAC A;  5K0U B;  3AP7 A;  1NT0 A;  2PAK A;  5A80 A;  1EV1 2;  1H1I A;  1UWW A;  4XQD A;  1WLC A;  5FPL A;  1J1T A;  2ZAA A;  4RR3 C;  4Z07 A;  4MG2 A;  3QAC A;  3CNA A;  4M3C A;  1RUF 2;  3D82 A;  1MQT A;  4I3G A;  5AVA A;  2WZP P;  4ZU7 A;  4JQR A;  4BXF A;  5ABJ A;  1W8F A;  1W2U A;  4DS0 A;  2JG8 A;  2D6K A;  4Y5T A;  3HBZ A;  4ARX A;  2ZGM A;  3APB A;  1K12 A;  3OY8 B;  1JXN A;  1PGL 1;  2XGX A;  2W1W A;  1YFW A;  5GLU A;  2VW2 A;  4GH4 C;  2RM2 2;  2XVL A;  2NN8 A;  2XLG A;  1QJF A;  2E63 A;  5A3U A;  1YJK A;  3FHQ A;  5IUQ A;  3THD A;  4CZS A;  1WGP A;  1IKQ A;  1O3Q A;  3ZKU A;  2DFC A;  5F5C A;  1SZB A;  3VBF C;  2VMH A;  3S5Q A;  2OZJ A;  4I0B A;  1NLS A;  2X5I A;  2WA4 A;  4ZU4 A;  4C1X A;  3FJS A;  2B42 B;  4FPK A;  3B7M A;  3ABZ A;  3NKG A;  3DYP A;  4IGQ A;  4IV3 A;  3TNQ A;  2ZOE B;  4OHX A;  1AR8 2;  2LRO A;  3BTZ A;  3POW A;  3RS6 A;  3OYW B;  4PIY A;  4YSF A;  3FHA A;  1X36 A;  1LHU A;  4L99 A;  1V9U 3;  2VMD A;  1QNY A;  3NWK A;  4NHM A;  4NWW A;  3MUY 1;  2GC1 A;  2Y0I A;  1X8M A;  1IQD C;  1SCR A;  2ZKN A;  1Q8V A;  5DZE A;  1AR6 1;  2VW0 A;  4FO9 A;  3FUO A;  5FLJ A;  5A6Z A;  4QDQ A;  3OJB A;  1UZY A;  5FZH A;  4UFL A;  3KHC A;  1VB2 A;  5LA2 A;  3NNL A;  1RIT A;  3O1O A;  1ZBA 1;  1OMI A;  3NNG A;  4Y20 B;  3W9A A;  2WIN B;  1W06 A;  4YG0 A;  3N9O A;  4COY A;  5FYM A;  3WW3 A;  1CJD A;  2GN7 A;  1W9S A;  3MLJ A;  4KGQ A;  4RQP B;  1N3Q A;  1IGO A;  5DAV A;  1R08 3;  2VAU A;  1I1E A;  4OHZ A;  5FQ0 B;  2RS1 3;  2IZW A;  1KDM A;  2G9Z A;  4AQ2 A;  3DXU A;  3VDD C;  1ZA4 A;  5FY0 A;  1APN A;  2VUA A;  1AYM 1;  2JEM A;  5B2G B;  5F7U A;  1H0B A;  5KHK A;  2GAL A;  4N9I A;  3LIH A;  4HXC A;  4IDZ A;  1K5J A;  2EAA A;  5CYY A;  1N47 A;  3H0O A;  4PBO A;  2QJV A;  3III A;  4HET A;  4E2G A;  2NQY A;  1GZC A;  1HKD A;  2BGO A;  2DBI A;  4UFK A;  1W28 A;  4ZXK A;  5FYY A;  3GZA A;  2Y60 A;  1JHJ A;  2TNF A;  2IWG B;  4KBB A;  1VRB A;  3JXS A;  4DEQ A;  2BOI A;  4JQT A;  4KWL A;  4OCT A;  5C9A B;  1PGL 2;  1U5Y A;  4LK7 A;  5DG2 A;  1NE4 A;  1G9D A;  2RJL A;  4AED C;  2NZ9 A;  5F37 A;  3U4X A;  5CG8 A;  1XYN A;  2JE9 A;  1O3R A;  1V6I A;  2VMG A;  3L2H A;  4WVM A;  5FYI A;  1Z78 A;  3MW3 A;  5FWE A;  2Q0A A;  3MO4 A;  1HQW A;  1KFX L;  3Q9O A;  4XXP A;  3E97 A;  3OSD A;  1ZZB A;  2XPJ A;  3AJZ A;  4GXL A;  3AL6 A;  1H9W A;  1ALY A;  3ILF A;  4XUO A;  2VZP A;  2XXZ A;  3B94 A;  4YFZ A;  3UJQ A;  2QQJ A;  1W05 A;  1CAU A;  2YMZ A;  1XE0 A;  2E32 A;  3HIF A;  3H1Y A;  3S6P A;  5FLH A;  4D94 A;  3VDD A;  1MVQ A;  1AL2 1;  1O6U A;  2B9U A;  4OZX A;  3IAP A;  2YPD A;  3R4S A;  4MH0 E;  4XCA A;  2C0Z A;  5HXM A;  3UGH A;  2R1D A;  1RHI 3;  4L92 A;  1HJG A;  4E9K A;  1W8T A;  1L3J A;  1UF2 C;  4RGA A;  4CCC A;  2Y64 A;  1RUJ 3;  1RUH 3;  2JE8 A;  2UY9 A;  2DWR A;  5T54 A;  4BQW A;  4EN6 B;  3MLK A;  2VJX A;  1AR6 2;  2BQP A;  4L2N A;  4AFA A;  4ASK A;  4C0H A;  1W6O B;  3NMB A;  2IXI A;  3DF0 A;  5FZM A;  5JOZ A;  5FY5 A;  1IS6 A;  2H0V A;  3O1P A;  1ZBA 2;  4JKK A;  2VD7 A;  2A6Y A;  3AP6 A;  4AED A;  4DXS A;  4XF3 A;  1HLC A;  1MZ6 A;  4YG3 A;  2JG9 B;  4HKL A;  4LO7 A;  5BNO A;  4DO0 A;  3WF2 A;  4NIH A;  4JVA A;  4K1Y A;  4XJZ A;  1W8O A;  1QGL A;  1SCS A;  4V2W A;  2B8M A;  3SEE A;  3BIE A;  2BNO A;  2V5Y A;  4BLJ A;  3SH3 A;  2FMD A;  4I0A A;  5BNQ A;  4HPK A;  3RZM A;  1RUC 1;  3AKT A;  5SV5 A;  1VBA 1;  5E89 A;  1XNB A;  1G7Y A;  2D40 A;  2D93 A;  3HAG A;  3PL0 A;  1DZR A;  4P00 B;  4QQH A;  3ZFF B;  3J7M A;  1UOG A;  5HPO A;  3ZXD A;  3O7O A;  5FYV A;  1PMH X;  2PHD A;  4EN8 B;  2ATF A;  4H55 A;  3WNN A;  1JS9 A;  4I2O A;  1DQ2 A;  1OFS A;  3VZL A;  2AEN A;  2D5F A;  5LEK A;  3A4U A;  1OD3 A;  3RQ0 A;  4DRV A;  3AZV A;  2VQU A;  1UY2 A;  3ZMO A;  5A1F A;  5LA1 A;  2WAA A;  1YXW A;  4I01 A;  2GNT A;  1RUD 1;  4W65 A;  2QQO A;  4SLI A;  4PDW B;  3I3B A;  2ES3 A;  5C3O A;  3N7K A;  2VOV A;  1PMJ X;  2VG9 A;  3V64 A;  4EN0 A;  2D5H A;  2PEL A;  4LNV A;  2JIG A;  4QPG B;  3AB0 A;  3I54 A;  2NLR A;  1O4Y A;  5A32 B;  1RUG 1;  2HWD 3;  2RS5 2;  5FXV A;  5IAV A;  4PI2 A;  5A7P A;  4HAN A;  4CDX B;  1QH6 A;  2UU8 A;  2Y8K A;  2QKD A;  5GZD A;  1SMV A;  3KV6 A;  4WVZ A;  1WD4 A;  3GBW A;  3WF4 A;  1AL2 2;  1K5M C;  2DFB A;  4HN0 A;  2ZHM A;  5G05 L;  5FMC A;  1LHV A;  1TE1 B;  1V6O A;  1Y43 B;  4H14 A;  1S0C A;  4W8J A;  4N43 B;  2D98 A;  1GWM A;  3EXU A;  3KWV A;  3U14 A;  4LTA A;  4Q0U A;  4WV8 A;  2Y6G A;  1ZM1 A;  4CUA A;  1OKQ A;  5APA A;  3PJQ A;  3WQ7 A;  1YFU A;  2CYF A;  4YW4 A;  4N7U A;  2CV6 A;  4IGP A;  3VBR C;  1S2K A;  1JI6 A;  4Z92 B;  2HEV F;  3VKM A;  3L9J T;  3CDZ B;  2RHP A;  1I3H A;  3AK0 A;  4IL7 A;  3SLI A;  3RZZ A;  3I3M A;  3UT0 A;  3M2M A;  4FPG A;  5FKB A;  4ZON A;  2VZR A;  4EWA A;  1D2Q A;  2XL9 A;  1SHW B;  3Q8F A;  1XRU A;  1OH4 A;  1ZNP A;  4RS5 B;  4EZH A;  4LO8 A;  4DB5 A;  2BVB A;  4YGD A;  1RUC 2;  4QXC A;  5G04 L;  1O3T A;  4KBZ A;  3A0N A;  4M4R A;  5LZ6 A;  1LEN A;  1AJK A;  2D97 A;  1IOA A;  4AI0 A;  4BK5 A;  2DU0 A;  4AAP A;  1OA3 A;  1OC1 A;  2ZS6 B;  4XYX A;  1K5M A;  2P3I A;  2ILM A;  4QQP A;  3TAY A;  2ARC A;  1O3S A;  3RPQ A;  4UFJ A;  1SBD A;  4X6R B;  3TB0 A;  1XNC A;  3BAL A;  3LGR A;  4SBV A;  5B4X A;  3ZMN A;  1L7Q A;  1XU2 A;  2ZAH A;  4PIX A;  1A34 A;  4YZ1 A;  4Q0Q A;  3O1V A;  2A71 A;  3M7A A;  1KS4 A;  3AMQ A;  4Q0S A;  2W94 A;  3AFG A;  5A7N A;  4ZS2 A;  5HV4 A;  2WAB A;  1VLN A;  2JD4 A;  3KM5 A;  1V9U 1;  3VHR A;  3VHO A;  3X29 B;  4CEW B;  5JIU A;  5KR7 A;  2WLQ A;  4KWK A;  5FAX A;  5JSO A;  1GOG A;  3VBR A;  1BVV A;  1QXR A;  4CUB A;  4U2A A;  5FZA A;  1BLZ A;  5IVB A;  1EPW A;  1RUG 2;  1Z0H A;  2HWB 3;  1H6X A;  4D7T A;  2HWF 3;  2VUL A;  1GNY A;  3LE0 A;  3POI A;  5FYC A;  2WBK A;  5F3E A;  4JRA A;  1YQC A;  2XB6 C;  5JI9 A;  4V1P A;  2F4P A;  1NOV A;  1X9T A;  4GKX A;  1NZC A;  1R09 3;  1GU3 A;  4Y1V A;  3QBQ A;  3WW1 A;  1UN1 A;  3WX5 A;  4AR2 A;  1R08 1;  1AXZ A;  4PHZ A;  5HXV A;  1UY1 A;  2BW8 A;  1WCD J;  2E7A A;  2RS1 1;  2VCM A;  3AVR A;  4OFG A;  2AZ5 A;  1S1A A;  3SH5 A;  2GSY A;  1JYW A;  2XDV A;  2Q5T A;  4IEO A;  1V00 A;  3URF A;  2DUQ A;  5CA6 A;  4FT8 A;  4LHL A;  1V6N A;  2VOT A;  4AI2 A;  3VBU B;  4HVQ A;  4XBN A;  1A8D A;  4QPI A;  2FCT A;  1PIV 3;  3WIN E;  1COV 3;  1FXZ A;  1LOA A;  3KMH A;  5CFD A;  2D44 A;  3AYD A;  4LBQ A;  4XCB A;  1SEF A;  2NYY A;  4UFM A;  1YEW A;  2OUJ A;  2X10 A;  4CDU B;  4O9E A;  4G3Y C;  4O7X A;  3KVB A;  1E57 A;  3Q8A A;  1CQ9 A;  1QU0 A;  2YRO A;  1OA4 A;  2IVI B;  3GZU C;  1ENS A;  2BVV A;  4KG0 A;  4LBQ D;  3WT3 A;  3CIH A;  2VBD A;  4WM8 B;  5CZK A;  3R6S A;  4YW7 A;  4LMF A;  5FY7 A;  5HCB A;  5DUU A;  4WZF A;  1V6J A;  2FDH A;  1NCQ A;  1VPH A;  1ZZC A;  2FBE A;  2G1M A;  3DCQ A;  3POS A;  3PUS A;  2YC2 A;  5CNA A;  1XBF A;  5DAX A;  4BE3 A;  1MQT B;  2EIB A;  2VZU A;  1TNF A;  3AJY A;  3HWJ A;  3NV3 A;  1KEX A;  1UKR A;  2NP0 A;  2ZX0 A;  5EIY B;  5SV8 A;  1R1A 3;  1RHI 1;  1DHK B;  1V9U 2;  2EAL A;  2WQZ C;  2WZ8 A;  3CJX A;  1ULD A;  4WZC A;  2BBV A;  3M8L A;  2W3J A;  2PHT A;  3M3C A;  4KWJ A;  1H9P A;  1RUH 1;  3M3Q A;  4RGK A;  2X8K A;  1NYW A;  5A3N A;  4Y4R A;  2HBU A;  4QX3 A;  1PMI A;  2BWC A;  2R04 3;  1Q8O A;  3SEP A;  5BNP A;  3B69 A;  1DIW A;  3ACI A;  3ZFG C;  4NAM A;  2EID A;  3N3H A;  5C7G A;  2HYK A;  2ZEZ A;  3O0V A;  1MS5 A;  3PDQ A;  1R08 2;  2WDB A;  3WNL A;  4IV3 B;  1MPX A;  1RYY A;  1W9F A;  1YFX A;  4HBN A;  3MF6 A;  1W04 A;  3W5M A;  3MW2 A;  1OVS A;  4YGB A;  3NVC A;  4CP0 A;  1RUO A;  5BV6 A;  4AGV A;  3POJ A;  3HT1 A;  4RR3 B;  3RGB A;  1YNA A;  3VZM A;  1ZRF A;  4QX1 A;  4D6S A;  4HFS A;  4Q4W 3;  4GAL A;  1O5U A;  1LU1 A;  1WCS A;  2IXK A;  2W39 A;  5A3W A;  1OBN A;  4PLN A;  4LHN A;  3RZJ A;  4LBM A;  3BOP A;  3I2I A;  1DYO A;  2QCS B;  1AR8 3;  4A4A A;  4I30 A;  1YI9 A;  2BEO A;  4A2U A;  4ZKT B;  5JZG C;  3OUH A;  1EYB A;  1RUE 3;  4LE4 A;  4YW3 A;  5GLT A;  1IS4 A;  1CPN A;  1O4Z A;  1XE8 A;  4XFF A;  4QX8 A;  2R7E B;  2EF6 A;  4OI4 A;  5C3R A;  4PI0 A;  2ZX4 A;  2R06 2;  1R64 A;  4IXL A;  3USU B;  3BYW A;  4S2H A;  4CRQ A;  5LA0 A;  2JX9 A;  2VVE A;  2QZ3 A;  3ZFG A;  4AFD A;  2HWD 1;  4RSU A;  3VBF B;  4BK4 A;  4EV0 A;  1OPO A;  2IC1 A;  1HXS 3;  3WP3 A;  3LQC A;  3BU0 A;  1UXX X;  1SLL A;  2UWC A;  2QNK A;  4RHV 3;  1VBE 3;  4HON A;  5JOW A;  2WNU A;  3KF3 A;  1MR5 A;  3POF A;  2D6N A;  4EYU A;  1IPS A;  1RHI 2;  1AXY A;  1BEV 3;  4E2Q A;  1VMJ A;  1TEI A;  5ANQ A;  2GME A;  5T5O A;  1WMX A;  3IN9 A;  5J1X A;  1Y3T A;  2A70 A;  2PN5 A;  3ZFF C;  3WF3 A;  4AGG A;  3I3E A;  4OMD A;  1Q8Q A;  1PK6 C;  4WVM B;  1QJE A;  3UK9 A;  4OI1 A;  2Q8D A;  5FXZ A;  3LWC A;  5J48 A;  4YW6 A;  5F32 A;  2DUR A;  3TEX A;  3IB3 A;  4OZO A;  3UYJ A;  2A75 A;  2BDR A;  2VQT A;  4HVO A;  1WKY A;  1WW4 A;  5FPZ A;  5FYZ A;  1CAU B;  5LBC A;  3RWN A;  3N9P A;  4WM7 A;  5A7Q A;  3VKL A;  3ZOI A;  4B29 A;  4J25 A;  2J1R A;  3AKS A;  4LEJ A;  1HW5 A;  2KXL A;  2WT1 A;  3J9S A;  3P3N A;  3T09 A;  1QJX 2;  2VZ3 A;  4GZ9 A;  3VDD B;  4QPG C;  1QJY 3;  3EB7 A;  3WG4 A;  5I93 A;  3PUR A;  1KD7 A;  5CIR A;  2W9X A;  1W39 A;  2R0F A;  2EXH A;  3H1M A;  3W20 A;  3DKW A;  2WQ4 A;  1IG3 A;  4XHX A;  4JTO A;  4A6O A;  1E5S A;  2BV4 A;  1QQP 3;  1MS0 A;  1UO9 A;  2A3W A;  2BGC A;  2KR2 A;  2W2I A;  3K4A A;  1JZ6 A;  4R9D A;  1ZRR A;  2ZGN A;  3ZSJ A;  1Q8S A;  2D3S A;  4E4H A;  5C8C C;  3UV9 A;  1REE A;  2F4L A;  3IIA A;  5GZF A;  5JXJ A;  5JOX A;  5FDB A;  1YHF A;  3VZJ A;  1RGS A;  1XPW A;  5JCT A;  4AED B;  1XSQ A;  4N43 C;  2K0G A;  4QDS A;  4C8D A;  4LUK A;  1PK6 A;  4XF0 A;  4DOU A;  2VCA A;  2VZ1 A;  2YBP A;  3LZZ A;  1FPN 3;  2ZMK A;  3KGL A;  4QAW A;  5CVR A;  1CX1 A;  1W9Y A;  5A6Y A;  2WS9 3;  2HWD 2;  2HWB 1;  3ACH A;  5FMO L;  3B9C A;  1UY0 A;  4HPK B;  4P02 B;  4COV A;  3VD7 A;  2W1S A;  1V0A A;  2ZMN A;  3OBT A;  5I91 A;  4TLG A;  2ZX2 A;  5EPA A;  3JBG 3;  3VD5 A;  4F83 A;  1XNK A;  1MS9 A;  1UPI A;  3MHZ A;  1FI2 A;  1WCK A;  4YG6 A;  3MLL A;  1TVG A;  3O0X A;  4Q1P A;  3HJR A;  1ENR A;  2FDF A;  4XFA A;  3USS A;  3N36 A;  4MGK E;  2GC0 A;  2YUE A;  4AI9 A;  3BKZ A;  4OHY A;  1NY7 1;  1REF A;  5FZF A;  4DIN B;  5FY1 A;  4DUX A;  4CXW A;  1LOC A;  5C8C A;  3AFK A;  5K7P A;  2ZGU A;  4IER A;  4JDN A;  4MET A;  3ZSK A;  3BVC A;  5C33 A;  1LED A;  3HQU A;  3AX4 A;  4B4Q A;  1PIV 1;  4LBK A;  1COV 1;  3WY6 A;  3ZR6 A;  4B1L A;  3T0D A;  3WF1 A;  3H7J A;  3LEG A;  1N1T A;  2DUO A;  3DKQ A;  4RFT 0;  3E5X A;  2C5D A;  2HWE 2;  2V09 A;  3VUO A;  2PQQ A;  3BU7 A;  2DVB A;  2QDR A;  3LA7 A;  2E7T A;  1GQG A;  4QKB A;  1HV1 A;  1TQ5 A;  3SXW A;  3WQ0 A;  3EBR A;  1N3P A;  2ZEY A;  1GQP A;  2VNR A;  3IPV A;  5FP8 A;  1ND2 A;  5FY8 A;  4A7Z A;  5CIS A;  5FLI A;  1AYN 3;  5D8A C;  5LA9 A;  1FAT A;  5JSP A;  2RS5 3;  4A45 A;  2DDU A;  2XLF A;  3J8F 1;  4CU8 A;  1WCU A;  2Q1Z B;  4N8M A;  1NE6 A;  3T4V A;  1FT9 A;  2XJU A;  1OUR A;  4LBN A;  5DDJ 2;  1KQR A;  4BYY A;  5J36 A;  3OGJ A;  1SQ4 A;  1R1A 1;  3THT A;  5K4L A;  4E4D X;  4YRD A;  2CDO A;  4D7Y A;  3G6J B;  5LK5 A;  5IK7 A;  2AC1 A;  3IAQ A;  2J1T A;  2QQV A;  2O8O A;  2Q8O A;  3ALQ A;  1RVF 3;  1SLA A;  3IDA A;  4M3C E;  1HRI 3;  4ITC A;  1OQ1 A;  4O61 A;  2YZ4 A;  2VVF A;  3UET A;  2HWB 2;  2C6S A;  3D3A A;  3QH6 A;  4BIS A;  2R04 1;  1FOD 3;  3P5B A;  3S7E A;  4OVE A;  2A1X A;  1HRV 2;  3J4U H;  3OBZ A;  4FPJ A;  1FMD 3;  1URX A;  4Q26 A;  5C6C A;  1WD3 A;  1H8V A;  1RC6 A;  5EYX A;  5FZ9 A;  3K48 A;  3C7E A;  1K5M B;  1VBB 3;  3P3P A;  2Y0O A;  1H4G A;  2Q8E A;  4D8M A;  1AL0 G;  2C9K A;  2VGD A;  3B5L B;  5D8A A;  3WCS A;  4XFC A;  1X9P A;  4XF1 A;  3WDU A;  4E27 A;  5IW0 A;  1OI6 A;  4EWE A;  3W58 A;  1DYP A;  1OSG A;  1TMF 3;  4GD4 A;  5KC6 A;  4Q4W 1;  1G9F A;  3MPB A;  2UWB A;  3A22 A;  1YO8 A;  1I9R A;  3PTY A;  1ND3 A;  3WNK A;  3TRS B;  2ORX A;  5CG9 A;  4AAX A;  3ELN A;  3AM2 A;  1SFN A;  3VBR B;  1PIV 2;  2HYX A;  1COV 2;  2ARA A;  2ZXQ A;  3FBM A;  2CWS A;  1AR8 1;  1MQT C;  3WQ1 A;  4CP9 A;  2LW8 A;  2RDQ A;  1OKO A;  1VAL A;  2NMN A;  5F3I A;  5FYU A;  1UZV A;  2D7F A;  4NAO A;  3H3L A;  2VVD A;  4IEZ A;  5FZD A;  5BPX A;  1RUE 1;  1W0O A;  4N90 A;  5ABJ C;  5FMO S;  2ZKL A;  2JG8 C;  3PUA A;  3OOX A;  2DCZ A;  2YBK A;  2JDP A;  3KVA A;  4FFI A;  1W2A X;  1KRI A;  3U10 A;  4WBB A;  2P1B A;  4YAR A;  5DAP A;  3TOJ A;  3CBN A;  1HXS 1;  2J42 A;  3J8F 2;  4RGG A;  4R4Z A;  3MFC A;  1YQ2 A;  4GWJ A;  5C71 A;  2GAU A;  1UYX A;  1Q5O A;  1CN1 A;  1VBE 1;  2X5I C;  4RHV 1;  4CCO A;  4NIG A;  1AR7 3;  3RMY A;  5J37 A;  2LM3 A;  4FFG A;  2VXR A;  2RE9 A;  1BEV 1;  4FFF A;  4QPI B;  4DPN A;  3ZPY A;  2X09 A;  1DBN A;  3B01 A;  1G9C A;  5LBE A;  4LBQ B;  5I0D A;  4KMQ A;  3ACL A;  1JOP A;  4P5Y A;  3JUU A;  4DY3 A;  2WFP A;  1K3I A;  2R04 2;  2WRA A;  3K3O A;  1QXP A;  2QQK A;  3VD4 A;  5FY4 A;  1UU6 A;  4ZY9 A;  2E6V A;  4MZU A;  1SLI A;  1LOB A;  4OUS A;  1W6P A;  1YC6 1;  3LEK A;  3LDB A;  5GLW A;  1NQD A;  1QY4 A;  3KD4 A;  5JR2 A;  5EYY A;  4XQW A;  3Q8C A;  2VNV A;  3DUI A;  3GDB A;  1NCQ B;  1NXD 1;  3ATG A;  5GM0 A;  4P5H A;  2YBS A;  4RL7 A;  1ST8 A;  4IES A;  5FBZ A;  1IPJ A;  3ASI A;  3OGV A;  1YCI A;  1QJY 1;  2DTW A;  2ZAB A;  4TN7 A;  1XOY A;  3AMM A;  5LB6 A;  3TEW A;  2QQM A;  4Q4W 2;  5CKQ A;  3T0A A;  4ES8 A;  2E7Q A;  3ZYJ B;  1JHN A;  5EP9 A;  3POB A;  1DGL A;  1H1M A;  4XF4 A;  1QQP 1;  1CAW A;  1PGW 1;  4CU9 A;  4E4Z A;  1FV3 A;  1JZ7 A;  4RA0 A;  2FHR A;  2XOM A;  4DUW A;  4HZF A;  2QE3 A;  1MS4 A;  5DZF A;  1B35 C;  3PU3 A;  3BOW A;  2XKP A;  2TUN A;  1ZBE 3;  1VAM A;  2GC2 A;  1RUE 2;  3WDW A;  5F9T A;  4Q4Y 2;  4AVC A;  3CLP A;  4MV2 A;  1FPN 1;  2G9G A;  4MGI E;  1VMF A;  4BCU A;  2WS9 1;  1AR9 3;  2VMC A;  1VIW B;  4UOJ A;  1HXS 2;  4LOR A;  2ZGK A;  4NII A;  4B7E A;  2VM9 A;  2GZW A;  3R4U A;  3LA3 A;  4XIO A;  2NM1 A;  1NQJ A;  5ERL A;  3ZN5 A;  3N7M A;  1DQ4 A;  3JBG 1;  4RHV 2;  1G6N A;  1RIR A;  1VBE 2;  2LTN A;  3DYM A;  1SLT A;  1PM7 A;  1PNF A;  2YB7 A;  3JB4 C;  3T1M A;  3LDR A;  3K75 B;  5EJ3 A;  4AHW A;  1J59 A;  2C26 A;  1DGW X;  2VY0 A;  3IMN A;  5AFB A;  3SCH A;  2GN3 A;  4Y1Z A;  3WNP A;  1BEV 2;  1OF3 A;  2RDN A;  4QB1 A;  3ZXE A;  2HLE A;  1LB2 A;  1SAC A;  2W87 A;  3JD7 2;  4QKD A;  1UL9 A;  1UW8 A;  3AP9 A;  4YGE A;  4ZS3 A;  4J1W A;  2JDZ A;  1LES A;  4LKS A;  4QD2 A;  4OQ9 A;  1F8V A;  3UKT A;  1ZA7 A;  1W8H A;  4LBO A;  3T08 A;  4Z82 A;  3WV6 A;  3B93 A;  5FP4 A;  1B35 A;  1N1V A;  3F2Z A;  5CU1 A;  1C3H A;  5JXI A;  2E31 A;  1W8N A;  4TLF A;  1C1F A;  1PNG A;  3ZFG B;  1HQN A;  3VDC A;  3RFR A;  2Z42 A;  5LAT A;  2WWS A;  2PLV 2;  1FYU A;  3E5Q A;  1TG7 A;  4LA3 A;  4XUR A;  3O1M A;  1SFP A;  2DYC A;  5L7O A;  1ODM A;  1VAK A;  3FWE A;  1NCR C;  3H7Y A;  3SNM A;  2Q1F A;  5BNO C;  1ULP A;  3VD9 A;  3A7Q A;  4CSW A;  2WNU B;  1QJY 2;  4PCR A;  1AYN 1;  4BQ2 A;  2R06 3;  4NMI A;  3FBY A;  4D6Q A;  1QOT A;  1UOF A;  2RS5 1;  1PO2 3;  3LD8 A;  2ERF A;  1I5P A;  1KS5 A;  1CAX A;  1PGW 2;  1QQP 2;  3NL1 A;  5LRS A;  2JB8 A;  4MXW B;  3I3Q A;  1EY2 A;  4LIV A;  2YV8 A;  4QKF A;  4HSJ A;  1ASJ 3;  2OT7 A;  3U07 A;  1GZT A;  1YQ6 A;  2DCJ A;  3E5U A;  5JZG B;  1DZT A;  3MV1 1;  4GA9 A;  3DGT A;  3PLQ A;  1LHO A;  2VPV A;  4AVT A;  3JQW A;  1RVF 1;  1NLR A;  1FPN 2;  3H1W A;  3AXD A;  5FMD A;  3RJ2 X;  4U36 A;  1WUV A;  4D69 A;  2JDY A;  1HRI 1;  2UY8 A;  2DCY A;  4XTP A;  3ZXL A;  2YU1 A;  2WS9 2;  4WM7 B;  3GCX A;  1FOD 1;  4UYB A;  3T2O A;  4DY5 A;  2RMU 2;  4UXA A;  1FMD 1;  3JBG 2;  5FP3 A;  3PUI A;  2XH6 A;  4AG4 A;  1NCR A;  4V2V A;  3R0R A;  2DVG A;  2XQX A;  4K8R B;  5JXG A;  2Y33 A;  1VBB 1;  1YFY A;  4N53 C;  4R4X A;  5EJ1 B;  2XQR A;  4HL0 A;  4AQS A;  2VMF A;  4P08 A;  3O0W A;  2CWM A;  2P34 A;  1W6M A;  4OUL A;  5A33 B;  2PQS A;  4ET7 A;  4W6X A;  1HB4 A;  1JH5 A;  1PVX A;  1QJX 3;  2N7G A;  2VO5 A;  3B02 A;  1TMF 1;  4MHU A;  5DUW A;  2YC0 A;  3WW2 A;  2DTY A;  3C7O A;  2GDF A;  2C24 A;  4I02 A;  4OQ8 A;  1PK6 B;  1PX3 A;  4AEJ A;  4NPM A;  1W99 A;  1BK1 A;  1D4V B;  5FUP A;  3VBO A;  4DQA A;  3BUC A;  4C1W A;  4COZ A;  2FDG A;  2A7A A;  2P6C A;  3GZE A;  3T4H B;  3FL7 A;  4A3X A;  5FMB A;  1OUX A;  5JR7 B;  3GM8 A;  5FZK A;  5T5P A;  5DAW A;  4LUM A;  3IKW A;  1RXG A;  1E5R A;  3ITQ A;  3EHK A;  3RYP A;  2IFR A;  2QQU A;  1FAY A;  4Y1U A;  5FPU A;  2VCC A;  3WUC A;  3AMN A;  3HBK A;  1AYN 2;  2Q4S A;  1Q8P A;  5FUI A;  1UX7 A;  3GBG A;  1H2L A;  1PZ7 A;  5JWP A;  1GBG A;  4Z1V A;  1S0I A;  1W9T A;  3AYA A;  2W1Q A;  1OOP A;  2WZR 3;  4N53 A;  1DZQ A;  5J98 B;  2BP6 A;  4BWO A;  1HN0 A;  2J1V A;  2VOW A;  2WII B;  4Y22 A;  4L9B A;  4XOG A;  1AR7 1;  5C8C B;  5FP7 A;  5IVY A;  3RZG A;  3MW4 A;  4ORF A;  5CAZ A;  3MIC A;  4JHT A;  1J3R A;  2ET1 A;  2X53 S;  2ETE A;  3AC0 A;  4NJ4 A;  1EAH 2;  4O65 A;  3P6B A;  4C0B A;  3AP4 A;  1OT5 A;  4D6R A;  1RVF 2;  5JI7 A;  2I2S A;  4YVW A;  1MZF A;  3WDX A;  1HRI 2;  1WLW A;  1S0G A;  3HOB A;  3O12 A;  1FOD 2;  3RMX A;  1LEM A;  2ARX A;  4YZ2 A;  3I2J A;  1OLQ A;  2PAE A;  3IPV B;  3BPZ A;  5T5J A;  1YUD A;  1FMD 2;  1ND2 B;  4Y33 A;  4YZ5 A;  3PUH A;  1BBT 3;  4LE3 A;  1RUN A;  2WWU A;  4NOT A;  3O1S A;  1LOF C;  2JJ6 A;  5E8A A;  2Q1M A;  1GSL A;  1VBB 2;  2HWE 3;  1LHN A;  4A42 A;  1A8M A;  2EXJ A;  4X6Q B;  1ULC A;  4XFB A;  4AI1 A;  4LBJ A;  3VBS C;  1ENX A;  4JGY C;  1OLR A;  3CHX A;  4ASL A;  1YQ8 A;  3O1R A;  1ULG A;  3N7L A;  3AL5 A;  3DEM A;  1T2X A;  1TMF 2;  4IE7 A;  1AX1 A;  4TTG A;  2XWJ B;  3AZW A;  1U5I A;  2VBP A;  3G7D A;  3TEZ A;  1F4H A;  3MEP A;  3FFZ A;  1RED A;  2VTX A;  2HKX A;  3HN3 A;  4OLL A;  4WVV A;  2AGS A;  3VN4 A;  1VP6 A;  1ULO A;  2DVA A;  1BQP A;  2BU9 A;  4Q4V 2;  1C8M 2;  3OPZ A;  4YLZ A;  1UD1 A;  5DDJ 3;  1ZBE 1;  4UFH A;  1OLM A;  1H2K A;  2XWB B;  3WLU A;  3ZO0 B;  4IE0 A;  1ZVF A;  4QPI C;  1CAV A;  3ZM8 A;  3IM0 A;  5CFD C;  1TZO A;  1KDK A;  1VMH A;  2WO7 A;  3P1I A;  4FP2 A;  4EN7 B;  5IVF A;  3SCG A;  5AFE A;  1OF4 A;  3MBW A;  3NV1 A;  3WNX A;  5CFC C;  1LNS A;  1AR9 1;  1VJ2 A;  2BYV E;  2XJV A;  2W91 A;  4CUC A;  4Q4X 3;  5D8A B;  5K9Y A;  2VUC A;  1LOF A;  2Z2S B;  4JC1 A;  4QQ2 A;  2WT0 A;  5KXB A;  1HRV 3;  3K3N A;  3PIJ A;  5F3C A;  1C57 A;  1O4T A;  4W50 A;  1SBE A;  3OUJ A;  3VBS A;  3KT1 A;  1AR7 2;  1CIW A;  4JGY A;  4P9I A;  1UMZ A;  4FFH A;  2H6C A;  3NKT A;  3VB9 A;  2NPI A;  1ND3 B;  3GZT B;  5F1R A;  1NCQ C;  2F17 A;  3M3O A;  3KLS A;  3ZX7 A;  1WW7 A;  4NHY A;  4CP9 B;  3FLP A;  4K6B A;  3C7G A;  4GMP 0;  4CCJ A;  4RYD A;  5JMO A;  1F9K A;  4YYO A;  1M06 G;  1CX4 A;  2P5B A;  3OGS A;  4Q27 A;  3O1T A;  1O91 A;  2WNV C;  3CL1 A;  2SBA A;  2ZTN A;  2WA3 A;  4B8E A;  4HG6 B;  2VH9 A;  4JGZ A;  4XPV A;  2PA7 A;  2EIC A;  1LU2 A;  3R4D B;  1POQ A;  1IKP A;  4FPL A;  4GB3 3;  1Y9Q A;  4GMP 3;  4XUT A;  1JOD A;  1C8N A;  5BNP C;  5JVV A;  3KV9 A;  5CFC A;  3RZH A;  1NG0 A;  1GIC A;  5FZ3 A;  4MUV A;  1BKZ A;  3UGF A;  5A1A A;  5GZG A;  2JWP A;  5FK7 A;  5JMC A;  2FDI A;  5A7O A;  4JKM A;  2H6B A;  5GZC A;  1C5H A;  1JYN A;  2DV9 A;  1VRH 2;  1PZ9 A;  2R06 1;  4K40 A;  2ZEW A;  1UY3 A;  1PO2 1;  4OUM A;  1DQ0 A;  3FFQ A;  3NNF A;  3J8F 3;  3RG0 A;  1Q43 A;  1VBD 3;  2K9Z A;  5A70 A;  1JU4 A;  4M3C B;  4URA A;  4Z2W A;  5A7W A;  1ASJ 1;  1ZBE 2;  5FZ0 A;  3OD4 A;  3CQO A;  2EVX A;  4ISR A;  1S0D A;  4AYU A;  4B1M A;  2VOX A;  3UKN A;  1OQE A;  3C2U A;  5ABJ B;  2X29 A;  1Q3E A;  4ARY A;  1LJ7 A;  2JG8 B;  2CTV A;  2WNV A;  1WA4 A;  4W4Z A;  2ZGL A;  3D4K A;  2EIE A;  1C5I A;  4P9Y A;  3MPP G;  3KCC A;  2WSV A;  1CON A;  1E5H A;  1X50 A;  1AR9 2;  5FYS A;  1JYV A;  3ES4 A;  4Q1R A;  1U0A A;  3V0B A;  3QH7 A;  1WCQ A;  3AKQ A;  4AVS A;  4UF0 A;  2E26 A;  4KNC A;  4BH9 A;  1RXF A;  2VME A;  1QJZ A;  3D6E A;  2CNA A;  4QGN A;  2X5I B;  4FPE A;  1XQN A;  1N1S A;  4XDO A;  4BQY A;  5C3Q A;  1CAW B;  3SMH A;  1UCX A;  2JIJ A;  3VHN A;  5IAT A;  1Y9G A;  1YJL A;  5J3U A;  3AMH A;  5AVP A;  2OZ6 A;  1BCX A;  5FIX A;  3E6C C;  2K46 A;  4UI9 L;  1JU3 A;  2P2K A;  4QPY A;  4XBL A;  2WNU C;  3ZXJ A;  1OA2 A;  1E5I A;  1QJX 1;  2O8Q A;  4QXK A;  3M3E A;  3W59 A;  4I3P A;  1UYY A;  4MGZ E;  1XYP A;  5M0T A;  5H9P A;  3V65 A;  2D6P A;  3NQH A;  4IEQ A;  4CCD A;  3WNO A;  3GJA A;  4FAG A;  3GAL A;  1XSR A;  1D0H A;  3RDI A;  3UNP A;  3K4Z A;  3WNM A;  1PVC 2;  2KM2 A;  2ID4 A;  4FOV A;  1RMU 3;  1V6M A;  1PHM A;  3ZSL A;  4R52 A;  2WSU A;  4Q4Y 3;  1AHS A;  4PF5 A;  2ARB A;  2A3X A;  2Y6K A;  4JDM A;  4NIA A;  3FHI B;  3ZYB A;  4MSV A;  4FPO B;  5GLV A;  5H9Q A;  3MIF A;  3ES1 A;  1UXZ A;  4WM7 C;  1IG0 A;  1UAI A;  3VBH A;  5HCF A;  1YQ5 A;  2D43 A;  3CZJ A;  1PO2 2;  1H30 A;  2PFW A;  4AF9 A;  2W5F A;  5FFO C;  2VCB A;  5I0R A;  3AYE A;  1C4R A;  2WZR 1;  3C8X A;  4CXX A;  2VE1 A;  4NID A;  1X8E A;  4CE8 A;  1MAC A;  1Y7B A;  5IAX A;  1ASJ 2;  3ILN A;  1UOJ A;  4MAD A;  1B35 B;  3BIW E;  3FE5 A;  3Q8E A;  2ZHL A;  5I0U A;  4YPJ A;  5CKN A;  3LEM A;  5I8T A;  4CDQ A;  4HLT A;  2XHN A;  2GNM A;  2MEV 1;  2CAV A;  5HBA A;  3RZK A;  3LOB A;  1WW6 A;  4IE4 A;  3CMG A;  2JDH A;  4NRM A;  3JD7 3;  4Q29 A;  3J7L A;  5L73 A;  4K21 A;  4KU8 A;  5L7O B;  1U12 A;  4UW3 A;  4ERO A;  5LAS A;  1H8T C;  1W6Q A;  3V56 A;  5EV7 A;  3BB6 A;  2P37 A;  4M0N A;  4BJ0 A;  3WF0 A;  5LK7 B;  4DFS A;  3I8T A;  1BBT 1;  4IEY A;  4XAA A;  2P3J A;  4F8A A;  3TWI A;  1LUL A;  2R16 A;  1ONA A;  3AZZ A;  1W6N A;  4DEV A;  5C5U A;  1W8U A;  2HWE 1;  1CAX B;  3GXU A;  2AEZ A;  2PLV 3;  3VDA A;  1SG3 A;  5J96 B;  1CZS A;  1QIQ A;  4AEM A;  4H7M A;  3D8C A;  4BQ1 A;  1S55 A;  1W2T A;  3WZ1 A;  1AX2 A;  4X8P A;  3I3D A;  4QWN A;  2AR6 A;  3OG2 A;  2VL4 A;  1A6C A;  4GJY A;  4S2D A;  3DN7 A;  3LF7 A;  4XF9 A;  3NJZ A;  4O9G A;  4BPZ A;  3VDB A;  1JBC A;  3HT2 A;  2L9L A;  2XBO 3;  3ACF A;  3DXT A;  1V6K A;  1EP0 A;  1I5Z A;  1QMJ A;  2FZ1 A;  5DDJ 1;  1AUY A;  5GAL A;  1UKG A;  4AOC A;  1X7N A;  3ECQ A;  4CUG A;  4CTE A;  2VZV A;  1GOF A;  1YIP A;  1CIY A;  3JB8 A;  2BNM A;  2G4I A;  4J1X A;  3DV8 A;  5KHH A;  1NCR B;  4K3U A;  3D5O A;  1H8T A;  1WMD A;  4QQO A;  4COW A;  5BNO B;  1CR7 A;  2QDN A;  5EJZ B;  5FRE A;  1GP4 A;  3PVE A;  2WFF 3;  2IUW A;  1GQH A;  3GGL A;  1L7L A;  3VZK A;  2B39 A;  4Q4X 1;  2JDN A;  1W6M B;  1LEC A;  3WDV A;  4Y24 A;  2WZR 2;  1HRV 1;  1ND2 C;  3LAG A;  5FYB A;  2RMU 3;  2WYS A;  3HVD A;  4P9G A;  1DQ1 A;  1OHF A;  4Y1X A;  1F5F A;  4ONU A;  2OII A;  2GMM A;  2A5Z A;  4RN5 A;  1D4M 3;  4BU2 A;  3CF6 E;  1UYZ A;  4M3C F;  4S2F A;  2VNO A;  4NRO A;  1QDC A;  3VBO B;  3LCP A;  3NAP A;  3ZDV A;  2BNN A;  4CA9 A;  3SC7 X;  5L36 A;  1UQX A;  2MEV 2;  2VQ0 A;  2YU2 A;  3J26 N;  4CCL A;  4YW5 A;  4UW4 A;  2YC4 A;  1XXN A;  1JZ5 A;  3RZL A;  1U5Z A;  2J1U A;  2OX0 A;  4LKD A;  5FO8 B;  4FQZ A;  5IVV A;  4NPR A;  1IPK A;  4YW2 A;  3K77 A;  1P8J A;  3GHM A;  1GZW A;  2OQ6 A;  1WW5 A;  5F2S A;  5JAX A;  1MS1 A;  1WLT A;  4M00 A;  3UKV A;  5I8S A;  5A3L A;  3VV1 A;  1ZRE A;  1BBT 2;  1BMV 2;  4XC9 A;  1LGN A;  1CPM A;  3N7J A;  4GB3 1;  4AHX A;  3B3Q E;  4GMP 1;  1ZZ7 A;  3BOD A;  2XON A;  5FR3 A;  2LUW A;  1SFY A;  4YZ4 A;  2QQP A;  5A32 A;  1CVN A;  4N53 B;  4TYS A;  5JIA A;  2VU9 A;  3I49 A;  5C5T A;  1US3 A;  2RR1 2;  1UU5 A;  1GWL A;  4Y22 B;  4EZ4 A;  5LY2 A;  2C9A A;  1QDO A;  4LO6 B;  3FZ3 A;  5C70 A;  1DQ6 A;  4KG8 A;  3V0A A;  3I2O A;  3HR9 A;  1HJF A;  1A78 A;  3TBD A;  3WR0 A;  3MIG A;  3MGU A;  1QWR A;  1TME 3;  2PTM A;  3ETP A;  1DLL A;  3MID A;  5F2W A;  5EQU A;  4AI8 A;  1VBD 1;  4YVW B;  3ZKY A;  1ZX5 A;  4LQR A;  4LIU A;  3WSO A;  2R32 A;  3S5A A;  4FSJ A;  3OPW A;  3HD8 B;  4PBP A;  3BTA A;  3ZFE C;  1STM A;  1ND3 C;  2RJ2 A;  2PHR A;  3HNB M; 
#chains in the Genus database with same CATH homology
 3DYM A;  2YB7 A;  4ZXE A;  1JZ3 A;  3K75 B;  1JI6 A;  2C26 A;  2Y6H A;  2YFU A;  3CDZ B;  3WNP A;  4E8C A;  2C4X A;  5LCW L;  1OF3 A;  3I97 A;  4Z2A A;  3BN6 A;  4QB1 A;  2HLE A;  2QQN A;  2VZR A;  2W87 A;  2ZEX A;  3A21 A;  2B4K A;  1SHW B;  1OH4 A;  4LKS A;  2YFZ A;  3T08 A;  5G04 L;  3F2Z A;  4M4R A;  5JXI A;  2E31 A;  4A3Z A;  1W8N A;  4BK5 A;  3K4D A;  1NUK A;  3VDC A;  5DMY A;  5B4X A;  3OBA A;  2KD7 A;  1L7Q A;  1TG7 A;  4XUR A;  3C7H A;  1J83 A;  3VD9 A;  2W94 A;  1ULP A;  1DLC A;  3A7Q A;  3I2H A;  1EUT A;  2WAB A;  4UAP A;  2WO1 A;  1JZ8 A;  2BGP A;  5JXH A;  1K45 A;  1GOG A;  1I5P A;  3HEI A;  4CUB A;  3C7F A;  4PQQ A;  1H6X A;  5IYY A;  3LE0 A;  1GNY A;  1NX9 A;  2WBK A;  4QX2 A;  4QB6 A;  2DCJ A;  3MV1 1;  3K46 A;  1SDD B;  1GU3 A;  1D7P M;  4TXW A;  1UY1 A;  3OEB A;  1US2 A;  4OMC A;  4A41 A;  3I2G A;  1JYW A;  3T2O A;  4QDR A;  2VOT A;  3PUI A;  3U37 A;  2J22 A;  2WZE A;  1XNA A;  4AG4 A;  1L7R A;  2XQX A;  5JXG A;  5EJ1 B;  2V72 A;  3CZU A;  2VMF A;  4P08 A;  1JYX A;  2PQS A;  1EUU A;  1XNT A;  4ET7 A;  4E8D A;  2VO5 A;  2X10 A;  3C7O A;  1PX3 A;  2W95 A;  1W99 A;  2VZQ A;  3LPF A;  4JX0 A;  4ZZ8 A;  4DUX A;  3CIH A;  4IUG A;  3HNM A;  5CZK A;  3T0B A;  1GOH A;  1GUI A;  3FL7 A;  1NKG A;  1JZ2 A;  4D0Q A;  2YC2 A;  3GM8 A;  2JDA A;  4XUP A;  2EIB A;  2WAO A;  2VZU A;  1NAE A;  1KEX A;  1XC6 A;  5EIY B;  2Y6J A;  1H6Y A;  2VCC A;  3LEI A;  2WZ8 A;  3VD3 A;  1CZT A;  1UX7 A;  2Z4F A;  5FUI A;  1CX1 A;  2W3J A;  2WN2 A;  4BXS V;  3NRU A;  1W9T A;  2W1Q A;  1JZ4 A;  3E1F 1;  4QX3 A;  1CZV A;  2BBA A;  3T2Q A;  2J1V A;  3SEP A;  3HNY M;  2YG0 A;  3CKH A;  4PT6 A;  2W47 A;  3ACI A;  2WO2 A;  3AC0 A;  2EID A;  2OKX A;  3P6B A;  5C7G A;  2ZEZ A;  4DXT A;  5JUV A;  1OT5 A;  2WDB A;  3WNL A;  2WUH A;  1MPX A;  1RYY A;  4BDV B;  3EYP A;  3W5M A;  3HOB A;  3THC A;  3I2J A;  2E33 A;  4QX1 A;  2LS6 A;  3PUH A;  2BER A;  3I2I A;  4A42 A;  1DYO A;  4A4A A;  2VR4 A;  4XUN A;  4MGQ A;  2QQI A;  2V5D A;  2W1U A;  3NJV A;  1T2X A;  4TTG A;  2R7E B;  1F4H A;  1R64 A;  5LA0 A;  3HN3 A;  4KWU A;  4BK4 A;  1ULO A;  4XUQ A;  3LQC A;  1UXX X;  3W5N A;  4DUV A;  2W46 A;  3ZM8 A;  2DCK A;  3FN9 A;  3P1I A;  1OF4 A;  3LPG A;  3MBW A;  4OYU A;  3I2K A;  4L0P A;  1LNS A;  2J1A A;  4JHZ A;  4QB2 A;  2W91 A;  4CUC A;  5J1X A;  3WF3 A;  2J1S A;  3I3E A;  4OMD A;  2B9V A;  4FI9 A;  1GMM A;  4W50 A;  3OB8 A;  4QPW A;  1W0N A;  4MO3 M;  4A44 A;  1O59 A;  4XZU G;  2VZT A;  4MOA A;  2JKX A;  3IB3 A;  4OZO A;  4ZZ5 A;  2VQT A;  3C7G A;  1DP0 A;  1WKY A;  4RYD A;  5JMO A;  4PF1 A;  1HN1 A;  2J1R A;  3OGS A;  1F4A A;  3T09 A;  4GZ9 A;  2VZ3 A;  3SKJ E;  3HPN A;  3EB7 A;  4HG6 B;  2W9X A;  2EIC A;  2RV9 A;  4A6O A;  3K4A A;  1JZ6 A;  4XUT A;  3J7H A;  5A1A A;  5JXJ A;  1UY4 A;  4JKM A;  1JYN A;  1XPW A;  2QQL A;  5IHR A;  1BHG A;  4QDS A;  2ZEW A;  1UY3 A;  5DQ0 A;  2VCA A;  2VZ1 A;  3WEZ A;  2VZO A;  4QAW A;  3ACH A;  1UWW A;  1K42 A;  1JU4 A;  1UY0 A;  4P02 B;  2WO3 A;  3CQO A;  3SKV A;  3VD7 A;  2W1S A;  3VD5 A;  2WQ8 A;  4DXR A;  4ARY A;  4XVH A;  4W4Z A;  2Y6L A;  2EIE A;  1TVG A;  4ARX A;  1K12 A;  3HJR A;  1JYV A;  2W1W A;  1WCQ A;  1O8P A;  2E26 A;  3FHQ A;  3THD A;  2VME A;  3A23 A;  3ACG A;  4QX0 A;  3T0D A;  3WF1 A;  3LEG A;  3ABZ A;  3DYP A;  4UI9 L;  1JU3 A;  1O8S A;  2VTF A;  5DN2 A;  2ZEY A;  1GQP A;  3FHA A;  1UYY A;  2VMD A;  3NQH A;  3WNO A;  3MUY 1;  4A45 A;  1IQD C;  3UNP A;  3K4Z A;  3WNM A;  2DDU A;  2ID4 A;  4QDQ A;  4CU8 A;  1UMI A;  5LA2 A;  2Y6K A;  3NNG A;  1UXZ A;  2CDO A;  1W9S A;  5IFP A;  3IAQ A;  2J1T A;  3CZJ A;  2JD9 A;  3IDA A;  2W5F A;  1W9W A;  2VCB A;  3C8X A;  3UET A;  3D3A A;  4LPL A;  5F7U A;  4MAD A;  5CYY A;  3BGA A;  3MUZ 1;  1KGY A;  4YPJ A;  3III A;  3C7E A;  2BGO A;  2XHN A;  3CMG A;  4D8M A;  1JHJ A;  4DEQ A;  2C9K A;  3JXS A;  4CU6 A;  4BJ0 A;  3WF0 A;  3A22 A;  3MO4 A;  3WNK A;  2ORX A;  4DEV A;  4AAX A;  1J84 A;  4XUO A;  2HYX A;  2ZXQ A;  2VZP A;  3GXU A;  3VDA A;  1SG3 A;  2LW8 A;  2QQJ A;  1CZS A;  3OGR A;  3MV0 1;  1UZ0 A;  2E32 A;  3I3D A;  2J1E A;  3DEC A;  3OG2 A;  2VL4 A;  3IAP A;  2QBX A;  5HXM A;  3WQB A;  3VDB A;  2L9L A;  2VC9 A;  3ACF A;  2Y64 A;  2JE8 A;  2VJX A;  1YQ2 A;  4GWJ A;  5C71 A;  3ECQ A;  1UYX A;  2VZV A;  1GOF A;  1CIY A;  4JKK A;  1PX4 A;  4DXS A;  2ORZ A;  3UES A;  5EJZ B;  5B4N A;  2X09 A;  3I2F A;  2BZD A;  3WF2 A;  3GGL A;  3SEE A;  1W8O A;  5I0D A;  4KMQ A;  4MGS A;  4P5Y A;  1UMH A;  1K3I A;  2WYS A;  2WN3 A;  5DPN A;  2X05 A;  2QQK A;  3VD4 A;  4ZY9 A;  3DYO A;  4RN5 A;  4P00 B;  5HPO A;  3LEK A;  1UYZ A;  1PMH X;  2RVA A;  3WNN A;  5JR2 A;  4KI5 M;  4LHS A;  1OD3 A;  2YC4 A;  3GDB A;  4OUE A;  1JZ5 A;  2J1U A;  2VQU A;  1UY2 A;  5LA1 A;  2WAA A;  4JKL A;  3K77 A;  1P8J A;  3OGV A;  2QQO A;  2QQM A;  3T0A A;  3I3B A;  1PMJ X;  2V4V A;  1JZ7 A;  4CU9 A;  2XOM A;  2XON A;  4DUW A;  2W92 A;  2VZS A;  3OEA A;  3T2P A;  4CVU A;  1US3 A;  4CU7 A;  2Y8K A;  5IFT A;  5IJR A;  4M4P A;  3WF4 A;  5C70 A;  3NJX A;  5G05 L;  3ETP A;  4W8J A;  4GWI A;  2CDP A;  2J7M A;  4LQR A;  2VMC A;  4UOJ A;  3WSO A;  2Y6G A;  2VM9 A;  4CUA A;  2RJ2 A;  3HNB M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...