2YFUA

Cbm62 from clostridium thermocellum xyl5a
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
140
structure length
140
Chain Sequence
b'SYPKLTGTVIGTQGSWNNIGNTIHKAFDGDLNTFFDGPTANGCWLGLDFGEGVRNVITQIKFCPRSGYEQRMIGGIFQGANKEDFSDAVTLFTITSLPGSGTLTSVDVDNPTGFRYVRYLSPDGSNGNIAELQFFGTPAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARBOHYDRATE BINDING FAMILY 6
publication title A Novel, Noncatalytic Carbohydrate-Binding Module Displays Specificity for Galactose-Containing Polysaccharides Through Calcium-Mediated Oligomerization.
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 32
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2011-04-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2yfuA00
3I2FA 4A45A 1TG7A 3WF3A 3OGVA 3T09A 4E8CA 1UXXX 3ACGA 4HG6B 2VZPA 1EUUA 2ORXA 4DXRA 1K42A 3EB7A 3GXUA 4AG4A 2X09A 3I2GA 1SG3A 2J1VA 1GOGA 1GMMA 1JU4A 4CVUA 1UY2A 1H6YA 2W1UA 2WZEA 3IIIA 4XUQA 4OUEA 1W9SA 1OF4A 3VD4A 1JYNA 2OKXA 3WQBA 1DLCA 4GZ9A 3T2PA 4TTGA 1WCQA 2QBXA 3OEAA 4LHSA 4D8MA 3T2OA 2VQUA 1OH4A 4XZUG 2YG0A 4ARYA 4QX0A 1W99A 1UMHA 2QQIA 3C7FA 3HN3A 2VCAA 5HXMA 3OGSA 3T08A 2E26A 2KD7A 4MADA 3NRUA 2WZ8A 3K75B 2E32A 2WO2A 2VO5A 3DECA 2Y6KA 4A41A 1DYOA 1I5PA 3SEEA 4IUGA 3OEBA 2VZSA 4KMQA 4XVHA 1PMJX 1SDDB 4ZZ8A 4BJ0A 4GWIA 1UYYA 1GU3A 3WF1A 1O8SA 3C7GA 3CDZB 2J1EA 4DEVA 4W8JA 3MBWA 3CQOA 3A7QA 3WNMA 2VCCA 3GDBA 3OGRA 3I3DA 4QDSA 3ACHA 1JZ4A 4FI9A 5DPNA 4KWUA 2WAOA 3SKJE 3T0AA 3J7HA 2J1RA 1BHGA 2VZVA 2WDBA 2WUHA 1ULOA 1UY3A 3LEIA 1F4AA 3K4AA 4KI5M 5IJRA 3I3EA 4CU8A 3A23A 2BERA 2J1SA 3HNMA 1J84A 3I2IA 4A6OA 5C70A 2VTFA 1UXZA 2V4VA 3WNOA 2W3JA 3CIHA 1MPXA 2E31A 3THDA 3WF0A 4MO3M 2WBKA 2Y64A 3LQCA 2Y6HA 4JX0A 1O8PA 5JUVA 2VJXA 4JKMA 2W46A 3MV01 4ZZ5A 2CDOA 3VD5A 3ACIA 3HPNA 4P02B 2B4KA 3HNBM 2W47A 5DN2A 1UYZA 4BK5A 2WN3A 3PUIA 3C8XA 4QB2A 3VD3A 5EJZB 2VOTA 4QB1A 4CU6A 2VZOA 3BN6A 4LPLA 3HNYM 4XURA 3DYPA 5G04L 3SEPA 4DEQA 2JDAA 2BGPA 1UWWA 4D0QA 1OT5A 3IB3A 2YFZA 1JYXA 2JE8A 2HYXA 3THCA 4RYDA 2ZEZA 3HEIA 2X10A 1D7PM 1W9WA 3NJXA 5LA0A 2J22A 3OB8A 3CZJA 3WNPA 4QX3A 1J83A 2YB7A 4QDQA 2W1WA 2ZEXA 2V5DA 5IHRA 3I2JA 2YC4A 1W0NA 2J7MA 2W95A 4DXSA 1JZ5A 1CZVA 3E1F1 2ZEYA 4XUNA 2VMEA 3WNLA 3F2ZA 2BZDA 2W1SA 1YQ2A 2J1UA 4MGSA 2VZQA 4RN5A 2WN2A 2B9VA 3ACFA 1WKYA 1XNAA 3IAQA 4W50A 1L7RA 1XC6A 4JKKA 3K77A 3WF2A 3ECQA 4MGQA 3UETA 1GUIA 2VZ3A 1JHJA 2V72A 4CU9A 4JKLA 2W87A 2XONA 3ABZA 2JD9A 5LA1A 2W1QA 2X05A 1F4HA 4QAWA 4A4AA 3MUY1 5JXJA 3C7OA 2ID4A 4AAXA 1PX3A 2QQMA 1UMIA 4Z2AA 2QQOA 4DUXA 3I97A 2EIBA 1CZSA 3CKHA 3UNPA 5C7GA 2LW8A 4L0PA 1DP0A 2C4XA 4OMCA 4PT6A 2VC9A 4CUAA 1L7QA 1OF3A 2L9LA 3CMGA 4MOAA 4PQQA 2WAAA 4XUOA 1NKGA 1UY4A 2JKXA 2WQ8A 5F7UA 2CDPA 2ZXQA 3WNKA 1GOHA 1K45A 4ET7A 1NX9A 1RYYA 2J1TA 1CIYA 2EIDA 1CZTA 4ARXA 1UY1A 1K3IA 1JZ2A 1JU3A 3NJVA 1UZ0A 2W9XA 2C9KA 2XHNA 2YC2A 3T0DA 3I3BA 3A21A 1W8NA 5LCWL 4W4ZA 3WNNA 5EIYB 3CZUA 5J1XA 2PQSA 4QX1A 3T2QA 2DDUA 1KEXA 4P08A 4XUPA 3K4ZA 2VZRA 1JZ3A 2BBAA 5CYYA 3MUZ1 3WF4A 5DMYA 1UX7A 1JYWA 3OBAA 4GWJA 4UI9L 2WO1A 2WYSA 3MO4A 3WSOA 1NUKA 3FHAA 4QPWA 2W94A 3NQHA 2RV9A 4P00B 2E33A 4LKSA 4QX2A 4LQRA 4CUCA 2VR4A 1GOFA 2VL4A 5HPOA 2Y6GA 3LEKA 2QQNA 1EUTA 2Y8KA 5C71A 4TXWA 1XNTA 3JXSA 4BK4A 2RVAA 5G05L 1TVGA 1GQPA 3LPGA 1UY0A 4UOJA 1T2XA 5FUIA 2BGOA 3FL7A 3ETPA 3EYPA 1PMHX 2XOMA 1US3A 5B4XA 3LPFA 2ORZA 1OD3A 3C7EA 3NNGA 3MV11 3HOBA 5CZKA 5LA2A 2W91A 2WABA 5I0DA 4CU7A 4QDRA 2EICA 2QQLA 3BGAA 3AC0A 1R64A 4OYUA 5EJ1B 1K12A 2EIEA 4OZOA 5JXGA 4PF1A 3LEGA 5JR2A 5JXHA 1UYXA 5IYYA 4A42A 4DXTA 2VMDA 3VD9A 3K46A 4DUWA 3D3AA 1H6XA 1IQDC 1GNYA 4QB6A 4M4PA 3FHQA 2VM9A 4ZY9A 2VZUA 2RJ2A 3VD7A 5JXIA 1JYVA 1W9TA 4BDVB 1KGYA 2ZEWA 3I2KA 3LE0A 5IFTA 5IFPA 3VDAA 4A3ZA 4CUBA 2VZ1A 3VDBA 2QQJA 1JZ7A 4P5YA 3ZM8A 3VDCA 1JZ6A 2DCJA 3GGLA 2VMFA 1JI6A 2VQTA 5DQ0A 1CX1A 2QQKA 3PUHA 1HN1A 2R7EB 1XPWA 1W8OA 1LNSA 2VZTA 2Y6JA 2Z4FA 2J1AA 2VCBA 5JMOA 1NAEA 4YPJA 1ULPA 2HLEA 5A1AA 3SKVA 1PX4A 4M4RA 3HJRA 3P1IA 4JHZA 1US2A 5B4NA 2W92A 2LS6A 3FN9A 3I2HA 2YFUA 3DYMA 3WEZA 3U37A 3DYOA 4ZXEA 2C26A 2XQXA 1P8JA 3W5MA 1SHWB 3OG2A 3T0BA 3GM8A 4XUTA 2W5FA 3W5NA 2VMCA 3K4DA 4DUVA 4OMDA 4UAPA 4E8DA 3A22A 2Y6LA 3IAPA 4BXSV 3UESA 3IDAA 1O59A 4A44A 3C7HA 2DCKA 2WO3A 1JZ8A 3P6BA
chains in the Genus database with same CATH superfamily
1I5ZA 1SLCA 4FOQA 4A45A 3WF3A 1CN1A 2WQ4A 2WKKA 1Z7S1 2HWF2 2DU1A 4E8CA 1PM7A 3S5QA 3ACGA 2O14A 3I2DA 4HG6B 4D7YA 1K42A 4AI3A 2B7YA 1ZBA1 3GJBA 2VOVA 1WW4A 3GXUA 3VBOC 2XVKA 1UD1A 3I2GA 2J1VA 5FZBA 1BBT1 3D5OA 2K0GA 1GMMA 2W52A 2UY9A 2XH6A 3RZZA 5J98B 3ZSEA 5IVYA 2W1UA 3BCWA 1G86A 1VBA2 2NP0A 4XUQA 4OUEA 3WG1A 1IPKA 1HN0A 2EA7A 1J3PA 2JEMA 3PVOA 4I0AA 4OFGA 2YGMA 1DQ6A 4AEJA 2OKXA 4E4ZA 1G9FA 1QOOA 3T2PA 3E5QA 3SC7X 3KMHA 1C8M2 4MV2A 3ZFGC 3BYWA 4BIFA 2KA3A 2X5IC 4Z8BA 3LFMA 3IT8A 1U12A 2JXAA 4WV8A 5A7NA 4CP9B 2ADEA 4IXLA 4CEYB 5E8AA 1NCRB 3GYDA 4INDA 5FWJA 4EWAA 3PTYA 4FSJA 4W6WA 1HJGA 2E7QA 4XZPA 1WMXA 3T08A 1HQWA 4KWLA 3USUA 1KRIA 3NRUA 4M0HA 2WZ8A 1RUNA 2WO2A 1S0IA 5DDJ1 2I74A 4A41A 3DF0A 4NHLA 4BISA 2ZGRA 4B4QA 2IXIA 4D94A 1TEIA 2CGNA 1MEC1 3AXEA 1ENRA 3AK0A 3ON7A 2RR12 4XF1A 4XVHA 4QQ2A 4YW7A 4YW4A 4QMAA 3ZYBA 4K1YA 1YC61 4FPHA 3WUCA 3LSDA 4W65A 4IEYA 1GU3A 3H8RA 1FOD2 5ACA1 3DEMA 4XMAA 2J1EA 4DEVA 4W8JA 3Q8CA 2PHUA 2NZ9A 5JR7B 5CB7A 4K21A 4BXFA 3NAPB 2KXLA 3GDBA 3ZIWA 1U5YA 1AR61 3SMHA 3TEWA 1QJY3 1N1TA 4FT8A 3D82A 2A3WA 3WP4A 3ZYPA 1HRI2 4FI9A 1GFF2 2WAOA 3T0AA 3JU9A 3J7HA 2WUHA 1IZ3A 4FPCA 3LEIA 1O91A 4EN0A 1QDOA 2VOXA 5A3NA 1YFWA 3VKLA 5C33A 1UKRA 2P34A 1STMA 3A23A 4I02A 4XPVA 2OVUA 3BKZA 4CDUC 1A34A 4XJUA 4Q4X2 4Y1XA 3I7DA 5FZKA 2OUJA 5AFEA 1VE0A 3DPRB 1Q8PA 2WZR2 1AVBA 1AR72 2YXSA 4AFBA 2GAUA 1V9U1 1GZWA 3CIHA 1W8ZA 1VBB3 2BU9A 2WFPA 3HD8B 4LBQB 3WNOA 1XNBA 2JENA 3WF0A 1HKDA 1AXKA 3GHMA 4H14A 5A7WA 4M00A 5FYMA 1CD3G 2D97A 2Y6HA 3D0SA 2ZA9A 4NO4A 5FZDA 3VZNA 4CDQA 2VJXA 4XMIA 1GP5A 1F8VA 1ZBE2 2JE7A 2CDOA 1WD3A 4FO9A 1PMIA 3HPNA 3WG4A 3BIEA 1RUG3 3ZX7A 3FFQA 3W20A 5A3OA 3N9QA 2ZHLA 1DYPA 2D6LX 5LRRA 3H7JA 1C4RA 4WM8C 3VZJA 3PUIA 3C8XA 3L2YA 1N3OA 1AL22 4R4ZA 1QWRA 3OBRA 5CU1A 4MGTA 4X8NA 3VD3A 1XSRA 2VOTA 3WV6A 1JW6A 2BVVA 2MEV2 5FYCA 1YWKA 4CU6A 2GNBA 2F4LA 4LBOA 1K5MC 3J7NA 1O5LA 3JBG3 5DAXA 2P2KA 3BN6A 4LE4A 5AVPA 3SISA 5J48A 4LPLA 5JLVA 2JDMA 3C2UA 1NLRA 3BU7A 3DYPA 4XURA 1ODMA 1ODNA 4J6GA 1O4ZA 1OFSA 1QQP1 4DY3A 5JOXA 4META 2FMDA 2R0FA 5FZLA 2HWB3 4AEDA 4COYA 1G9BA 2ZGNA 2DCTA 2I2SA 1UIKA 5FMOS 3KS7A 2BOIA 3E6CC 4RS5C 1W6NB 5F5CA 3THCA 5CG8A 5HV4A 2WFF1 1LULA 2GSYA 5FR3A 3OYWA 5I91A 4HKWA 1QXRA 1W9WA 2PAMA 5LA0A 2HBUA 3AVRA 3GBWA 3ILFA 2CTVA 4RQPA 1OBNA 1DQ2A 1XYPA 1W6PA 2HEWF 3CZJA 1O6UA 4OHVA 5F5IA 1VRH3 5GJ6A 3KD4A 1J83A 4OULA 3ZXLA 3V0AA 1CAVB 2ERFA 4UF0B 4UXAA 5EYYA 5A7OA 2VCMA 2GALA 1TME1 4B29A 1N47A 4YGCA 1J59A 1LOCA 2IXCA 2W95A 4DXSA 3ZIXA 2XMLA 1X82A 4XXAA 4XUNA 3JD72 3KT7A 2RS12 1JOJA 2H0BA 4JDOA 2VMEA 3WHTA 4RGKA 4D7SA 4RSUA 5T54A 2J1UA 4FOVA 1OLRA 4XACA 4OHZA 2YY1A 1LHVA 3PNAA 3VDDC 4CDWA 2WN2A 4BOWA 1NZIA 2B9VA 3WY6A 1DQ0A 4Q4Y3 1HJFA 1WKYA 3IAQA 2PHXA 1XC6A 4B7KA 4CDXC 3ECQA 4W6XA 4YVWC 4BQ4A 1DZQA 1Q8QA 3UETA 4YGEA 2VPVA 1BK1A 4O61A 4KBZA 4AGVA 4M3CB 1PGL2 2V72A 4FXGB 2W87A 1ASJ3 2VTXA 2YDEA 1RUI3 3N7JA 3ABZA 2RS31 4NIIA 2ARBA 3WINE 5AC93 1RUH2 5LA1A 1UOJA 5KBFA 1M4WA 1X8MA 4R4XA 2FZ1A 3VB9A 3FC0A 1ND2B 5FUNA 2Z79A 3T2TA 1PVC3 3IDBB 3NV4A 2WINB 4A4AA 1D2SA 1X9TA 3NJYA 1OKOA 1YCIA 3MUY1 1D0GA 5F1RA 5JXJA 3QLQA 2ENRA 4LLOA 5A32B 4CP0A 3LDKA 1PX3A 4PJYA 5LBFA 3RDIA 3CJIC 2RE9A 5ABJC 2GNMA 3RZKA 4N53B 1KFUL 3PU3A 2R061 3CKHA 2Q30A 5LRSA 1SBFA 2BRTA 4NHKA 4XE9A 5IATA 4Q4W2 2Q8EA 2BFUS 2FZ2A 1RHI2 1DP0A 2C4XA 4L0PA 3HBKA 3T4VA 4QX5A 5CFDB 3VLBB 4PQ9A 4OI1A 2VU9A 1OF3A 1TNRA 1LOAA 1R1A2 1NY71 4CCMA 4ES9A 1O3TA 2WO7A 1R091 1NOVA 3GZTB 4JRAA 2ZAHA 3NL1A 3ZFFA 4Y24A 2WQ8A 5FREA 5HXVA 4D69A 1W8UA 2CDPA 3IPVA 4LA2A 3JQXA 1ZX5A 3ZSJA 2IFWA 3POJA 1FPN1 1OPMA 4RHV3 4GULA 3VZKA 3WNKA 4DUXA 1K45A 3T1LA 4HVQA 1C57A 4ET7A 3RWNA 3ST7A 5BNOA 2J1TA 2GN3A 1ND3B 1CIYA 1RUJ3 1KFXL 1JODA 4AHYA 1VIWB 3BI3A 1CZTA 1WGPA 2EIGA 2XJSA 4TLGA 4QQHA 1A6CA 2YYOA 3ORJA 4OVEA 2D44A 5IVVA 4EV0A 4ONUA 1UZ0A 4Y22B 4YM2A 5L36A 1FI2A 2XHNA 5JI7A 1W90A 1RMU1 4B1MA 2P3IA 5BNNA 3T0DA 4AXOA 1W8NA 4YW3A 5LCWL 4QKDA 4YZ3A 1QNYA 3J26N 4HPKA 4UWDA 3POBA 1NLSA 1MR5A 3CZUA 1WLTA 1CAWA 4I0BA 3ZKYA 5J1XA 4IV3A 2KM2A 2WQZC 4XCBA 5I0RA 4BWOA 1AYM2 1UL9A 4P08A 4RFT0 3KSCA 4LUMA 2VVFA 4CEYC 1SMVA 1CQ9A 1NCRC 3QH7A 1JZ3A 1IKQA 1D0HA 3O1MA 2OUHA 5GZDA 1CR7A 1QJX1 2JJ6A 5FMBA 4Z2WA 2WYSA 1AX2A 3E97A 3MO4A 5A3PA 3W21A 4XFCA 3FHAA 1FMD2 3VBSB 5DUWA 4QPWA 1J58A 4FTEA 2RV9A 4AE2A 1ENXA 4CCCA 4Q8LA 3LDBA 3AFKA 1N3PA 1REFA 1PO12 1DGRN 2DBIA 3AZWA 3ENRA 2CL2A 4S2HA 4PIZA 3BOPA 2VL4A 2ZKLA 1UOFA 2XBO3 1HDKA 1SQ4A 1ENQA 2ZZQA 3CEWA 1HLCA 1JS9A 1AHSA 2VTXJ 1AL0G 2Y8KA 4QX7A 1G7YA 3KVBA 4TXWA 1XNTA 4M3CF 5LEKA 3VBHA 1X9PA 1W06A 1JXNA 4XFFA 5G05L 1IS4A 1DCSA 1H2LA 1W39A 4FPKA 4HKLA 5ISLA 4YGDA 1CPNA 1W0OA 4AAPA 1KDKA 1A8DA 4ASKA 4MGIE 3SQOA 3MIHA 1KJRA 3VBUB 1WCSA 3KGZA 2RDSA 4CCOA 4FTSA 1F31A 3EBRA 1UQXA 2VBDA 2PAKA 1OD3A 1UCXA 2JWPA 3HOBA 3SLIA 2IXHA 1KITA 2OIIA 2WABA 1SPPB 4L9BA 4AW7A 1VAKA 1EV12 1H2KA 1V6KA 3OF1A 4CU7A 3FBYA 5GZGA 2XR4A 4AGRA 4R9CA 2EICA 4OUMA 4Q0UA 4V1PA 1UKGA 1VAVA 2B42B 3DPRC 4QKBA 3QH6A 2RMU3 1DU3D 5FXWA 4CXWA 4XILA 1LU2A 1K12A 4ZU4A 4PF1A 5JR2A 1S0EA 2VAUA 5FYHA 1UYXA 4PLNA 3RFRA 5JDBA 2E9QA 4PBOA 2SBAA 1L3JA 1TMF3 4CCJA 1LU1A 1PHMA 1FV2A 4IV1C 1GNYA 4HZFA 2H6CA 2NQYA 4AVSA 2RJ2A 3MF6A 3AMHA 2ZGKA 1W9TA 5JXIA 4BDVB 2ZEWA 4QQLA 2UURA 3U0ZA 1IS3A 4XC9A 4GMP3 2D40A 1RUE2 3POIA 2UU8A 3TB0A 3WX5A 5IFTA 5CKQA 3VDAA 4A3ZA 5EV7A 1HXS3 3VDBA 3O5SA 4N90A 3UKNA 2A6XA 4N9HA 4ATFA 1Z7S2 1AR91 3UV9A 1AR83 2HBTA 1VBE3 3GGLA 1TNFA 3UJQA 4BLJA 3JQWA 4IEUA 1ZBA2 1WA4A 1C3HA 1JI6A 4GH4A 4XXPA 1V6LA 1AYN2 2CYFA 3ROUA 3SCGA 2XPJA 5DQ0A 1BBT2 5A1LA 1CX1A 3ZFGB 2C24A 2X5IB 1HN1A 4J1WA 4LOTA 5GKAC 4E4SA 1XPWA 2RG4A 2WA4A 5FYZA 2VZTA 2G1MA 3BTAA 1MQTC 2D7FA 5JMOA 4PCRA 3S0MA 4S2GA 4NIHA 4YPJA 3DKWA 1W2TA 2HLEA 4N43B 3R4UA 5A1AA 2VUAA 4UT5A 1PX4A 4AWDA 3WR0A 3P1IA 4DB5A 2IVJA 5IK4A 3ZSMA 2XKPA 3LIHA 4QGLA 2WNUA 2ET7A 3M8LA 1UAIA 4UFJA 1WMFA 5C8CB 1W6QB 3RJ2X 2OZJA 3NNJA 3GHNA 2OQ6A 2BV4A 3RVHA 1LOFA 1S0DA 2PYTA 3ILRA 3FLPA 2PHLA 4YWAA 3WVJA 1JUIA 2E7AA 2OA2A 4JGZA 5FIXA 4YZ1A 1SHWB 3OG2A 4LO6B 1OXCA 5LW9A 3B7MA 5IK7A 4FAHA 3DKQA 5EWSA 4NIAA 3AP7A 2DFCA 5CA6A 5BXXA 1H8VA 2E53A 1UZZA 2DCZA 4LBNA 4OHYA 1Y43B 2Q4SA 3AMNA 1REDA 1M06G 5C3PA 2JDUA 3JZVA 1RUG1 4HK8A 2ZBJA 3GALA 5DDJ2 3J9SA 3H3LA 1W8HA 4X6RB 1MEC2 5C4WB 2PFWA 4GJYA 4JCKA 2O8QA 3A22A 4WVVA 4M0NA 3OY8B 2GH8A 2HWD3 2VQAA 2Y6LA 3RWKX 1POV3 3WQ0A 2IXLA 4BXSV 3UESA 2BEOA 3IDAA 3MIGA 1ND2C 1O59A 2XDVA 3C3VA 5ACA2 2VW0A 3DCQA 1WCDJ 5FPAA 3I2FA 3DXUA 2CWSA 1TG7A 1SFNA 3AP9A 5DG1A 5H9PA 4OHXA 2E6VA 4P9GA 4XQWA 1HX6A 4TSVA 4CDUB 2JDZA 2Y6FA 4L11A 1AR62 2HWB1 4N53C 3T1MA 4COWA 4FAGA 4QPGC 1AUYA 4XF9A 4DXRA 1VBD3 3EB7A 1H2MA 2TNFA 1XBFA 2QE3A 3ACLA 2X09A 3DUIA 2QUOA 1LEDA 1QKQA 1GOGA 3O12A 1W05A 2GC3A 1RVF1 1XNKA 2VUJA 4YW2A 1LB2A 5DABA 2JG9B 4CP2A 4CVUA 1AXYA 2O1QA 3TEYA 2D5FA 5FKBA 2IXJA 3KHBA 4XF4A 5K4LA 3RI8A 3O0VA 3CJXA 5CG9A 3AVSA 5GLUA 1XQNA 4MHUA 5FZ4A 3VKNA 1VRH1 1OF4A 1COV1 1IGOA 3FLRA 4Z82A 1T6BX 3RJRA 3CHXA 4Y20B 1GP6A 4I3GA 4K40A 3URFA 1H2NA 1OUXA 2ZOEB 4HSLA 4TTGA 4FPFA 1V9U2 3HQRA 3ES1A 4K20A 1WCQA 1YQCA 4DFSA 5KHKA 3RI9A 2QQPA 3E5UA 3ZVXA 4CTEA 2DFBA 3IMNA 1CX4A 2Q1MA 5ANNA 1JYTA 4AVVA 4FP2A 5FZAA 3O1UA 4N7UA 4Y33A 3DV8A 3KLSA 1Z0HA 4AOCA 2VQUA 2VNGA 1OH4A 4XZUG 2A5ZA 2I45A 3UGFA 3VBRA 4QX0A 5FCCA 3ZXAC 1UMHA 2QQIA 3C7FA 4LLFA 2QTWB 3HN3A 4XBQA 5HXMA 4H55A 1GZTA 4XETA 2KD7A 4X6QB 4ATEA 1RUD1 3WT3A 3JUUA 1SZBA 4UFMA 2FDFA 2E32A 1W8WA 2GP5A 3LFIA 2V4AA 2FMYA 2TBVA 1Y9MA 3DECA 4HK9A 5D8AC 5CFCC 1WW6A 3ZYIB 3N3HA 1PK6A 3KV6A 2DV9A 4B1LA 1L7LA 2D6NA 4KMQA 2ZAAA 3LD8A 5GZEA 4XEZA 2IZWA 5IUQA 5GZCA 1QQP2 1PMJX 1SDDB 4Q4V3 1YNAA 4FPEA 2FBEA 1PVC1 5EYXA 4BJ0A 5KXBA 1PM4A 5A33B 1HRV1 1O8SA 2HKXA 1WLWA 3C7GA 2NMOA 4P9XA 4K1ZA 2HWF3 3MBWA 4QU2A 1YUDA 5FBJA 2WFF2 2VUCA 3WNMA 1DGWX 1BXHA 3WNXA 4Y4YA 1W6OB 3OJBA 3O1PA 1J1TA 2CY6A 2DUPA 3BU0A 1VMJA 1V70A 3I3DA 4LJHA 5AFBA 5A1FA 1OLMA 2K46A 2O0OA 1W04A 1V6OA 5DPNA 5E1RA 1OFNA 3VDDB 2J1RA 2CWMA 2WRAA 1VBA3 5HCFA 2IC1A 5LBCA 3O0WA 1QEXA 1TME2 1DGWA 3HVDA 4RA0A 4ZS2A 4D7TA 4CDXB 3T30A 5J3UA 5L7OA 2JG8C 2BTVC 3I3EA 3LDRA 1IHMA 5FO9B 2XJQA 5C70A 2BQPA 2QVSB 1IPSA 4YVSA 3MLKA 2GN7A 4P14A 2V4VA 4YW5A 2W3JA 2E31A 1G9AA 4EE2A 3POGA 2Y64A 3VBUC 2HWC3 4UYBA 2LTNA 4JX0A 1QJFA 1O8PA 1OPOA 1RUJ1 5JUVA 3MLJA 1SLAA 4FFIA 3Q9OA 2W46A 1ZRDA 4FOWA 2HEVF 2YZ4A 5APAA 4CEWB 2DBNA 2ZGSA 2XJTA 2ARAA 2NYYA 4NMIA 1OOPA 5FZ3A 5LB6A 1WLDA 3N9MA 5DN2A 4LUKA 5C9AA 1A8MA 2RS32 2YPJA 4NWVA 5F6KA 4XIOA 4QD2A 4MGZE 4JGYA 2VUDA 2RR13 3FBMA 4EN9B 4P9JA 5T3NA 4LO8A 4D3WA 1XSQA 1WBLA 4XHBA 4DEQA 3AL5A 2C6SA 2ZX4A 3GZUC 2R062 3KB5A 1CESA 4WVWA 3IB3A 3WDYA 1FV3A 1BEV3 2WSUA 3ZMNA 4IE0A 3VBOA 1GBGA 1YEWA 2WNEA 4XJ9A 3KHCA 1JYXA 2XGXA 1QJU1 5T5OA 3L2HA 1SBDA 1FNYA 3HEIA 2X10A 2ES3A 1D7PM 4HKOA 3NJXA 1O4TA 3GBGA 1HRI3 1NY72 3QD6A 2J22A 1LTEA 1NCQA 3OB8A 2GMMA 1SCSA 1R092 3MW3A 3AKRA 4KU8A 5GALA 4AI9A 1MS5A 3AMQA 4QX3A 1MZFA 4QDQA 2DU0A 1F5FA 2ZEXA 3V0BB 3PUSA 2N7GA 5FZMA 2OYZA 2YC4A 2XJRA 3RZMA 3MPBA 1FPN2 3GF6A 2XQRA 1N1VA 5KC6A 4QXKA 3IIAA 3HQUA 1CAUA 4L92A 4OHWA 3E1F1 4AQ2A 1DZTA 2D3SA 2ZEYA 4U36A 3NV3A 3POYA 1EAH1 1PZ7A 2PHTA 4JQTA 5A80A 5KHHA 2DF7A 1YQ2A 4MGSA 5JZGB 3ZDSA 4N43C 4O9EA 3CF6E 4Q29A 3KCXA 4FFGA 3ACFA 4W50A 1U0AA 3GCWA 1RMU2 2P3KA 4C1WA 3ALQA 4JKKA 2VH9A 5T5LA 1RJ8A 3EHKA 1Q43A 4NPMA 5FXZA 4NPRA 5C8CC 1GQGA 1X36A 3ZXDA 1JHJA 3JB4C 3VZOA 4CU9A 1IKPA 2GU9A 4ZHNA 1GP4A 1AL23 1W6MA 2YROA 4XHXA 2P1BA 4GB33 2RMU1 3D6EA 2FCTA 2YBPA 4NRQA 4ZXKA 1QJX2 3WDWA 5FLJA 5FOJB 2WS93 1GV9A 4CZSA 1ENSA 1GZCA 1S1AA 4FXKB 1NXMA 4YM1A 5I0SA 3P3NA 1D4M3 2QQMA 4DRRA 5KHIA 1TMF1 5A6YA 4NWWA 4NRPA 2AC1A 2EIBA 1CZSA 2WT2A 3N7LA 2YV8A 3K2OA 4HN1A 4MHRA 1LEMA 2NN8A 4QXBA 4QX8A 5C4WC 1JUHA 2OT7A 5C7GA 1S0BA 4OMCA 3EQEA 5DZFA 5H9SA 3LWCA 4GMP0 2R30A 4CUAA 1X7NA 1CAXA 4OLLA 4GMP1 3CMGA 1N1YA 1KS4A 2RDNA 4MZUA 5DAPA 1JN2P 2VOKA 4PQQA 2FDKA 1HXS1 2XL7A 4RL7A 2ILMA 5KHGA 3PMSA 1NKGA 5FPUA 3NNLA 4LA3A 4E9KA 5FO8B 3ZSKA 5F7UA 1AR81 3ZMOA 3CBNA 1GANA 3O14A 4MXWA 2ZGPA 1S0JA 2VMIA 1HIXA 4Q2FA 3K3OA 2ZXQA 3Q8AA 3ZYGA 2R16A 1KS5A 4MLOA 3D8CA 5FZOB 5EP9A 5K8SA 1NX9A 3JD73 3H0OA 3I59A 4IEWA 4F7ZA 1YFYA 2JG9C 4Q0QA 1Y4WA 1MVEA 5FZOA 2F6BA 2R041 1Q3EA 1K3IA 4DOUA 1JHNA 1JTZX 1O3QA 3M70A 3SH5A 3ZN4A 5FPXA 5JI9A 4AFAA 1JZ2A 3MW2A 5E6HA 3BALA 4IV1B 4IEVA 2QDNA 3KT4A 2YC2A 3NJZA 4WM8A 5T52A 4GKYA 4DO0A 2PA7A 1SLBA 4IE6A 1XB9A 1ZZ9A 4JTNA 3H7YA 2EXJA 1K5MA 1RUH3 2PQSA 2XJUA 4QX1A 3T2QA 1CJDA 4I0WB 5L19A 4K7JA 4NE9A 1XNCA 4XUPA 3K4ZA 3V65A 4JZRA 4RR3B 1WBFA 3WQ7A 4DRVA 3BTYA 2MNGA 1G9DA 4AI0A 4GALA 4XAAA 5DMYA 2D6KA 1JYWA 3OBAA 1QJEA 5FZ1A 3VHOA 3ES4A 1K5JA 4AEKA 5EFUA 2WO1A 3FLTA 4QHOA 4AFCA 4PI2A 4NJ4A 4YZ2A 2F17A 2G9FA 3WSOA 5JSOA 4RS5A 1OA4A 1HQNA 3ZN6A 1F5JA 5F6LB 1TE1B 2A6YA 2W94A 2Z2SB 1QXPA 2ZHMA 4XFGA 5CVRA 4Q4W3 2Q0AA 4CSWA 1RUC1 1MQTB 3ZOIA 4CCNA 3ETQA 1WD4A 4KG8A 3VKMA 4D6RA 1GOFA 1UOGA 2HWD1 4HN0A 4EYUA 5HPOA 1AR92 2UWAA 4DIQA 5IVCA 1R1A3 5FZCA 2D6OX 2QQNA 3W59A 4KBBA 1GYKA 2GNDA 3B3QE 2RS53 1KQRA 1RUF1 4BLIA 2A6VA 2EXIA 1C5HA 2PHFA 1OURA 3K48A 5F2WA 3WP6A 4AEDC 1WUVA 1IG3A 3I4IA 1YFUA 3ZFEA 2Q1ZB 1DYKA 1UY0A 3AP6A 3KV9A 4UOJA 5GLWA 3LAGA 4Y26A 3MEPA 4AR2A 4C0BA 2BGOA 3MGUA 4EN8B 1I9RA 4HL0A 1JYCA 1EPWA 1PMHX 3BPZA 3EYPA 2XOMA 1OA2A 3VBFA 1US3A 5EHDA 3LPFA 3E6DA 3H1YA 2GC0A 3NNGA 3OUJA 2Z5WA 4YVWA 2WNUB 1ULDA 3E5XA 1S0CA 5A7QA 1B09A 4WZFA 3ATGA 2HEYF 1CWPA 4NUBA 3BGAA 1QGLA 1URXA 5K0UA 5I0UA 5FMCA 1R64A 2ZPXA 3KT1A 3VZMA 4AHZA 3FJSA 3AJYA 2PMWB 1QY4A 3RYRA 3MI8A 3SCHA 3LEGA 1AYM3 1X33A 2I07B 4KU7A 4B3NA 4PF5A 3NV1A 4PIXA 4WM7A 3TAYA 2YGLA 2VY0A 4A42A 5H9QA 2DURA 3CJIA 4CDWC 4CEWC 1RUG2 5ABJA 3VD9A 3M7AA 4DUWA 3KF3A 4Y1UA 5FBZA 1H6XA 1IQDC 1V6JA 4QPGB 3L9JT 4BU2A 3ILNA 4GAZA 2IWGB 2XUEA 2YPDA 3FHQA 2G9ZA 2VM9A 1PNGA 3LKJA 3PHMA 1ZZ8A 1DFQA 1H1AA 1SLLA 4FPLA 3UYJA 4ASMB 4AVBA 1E5IA 2R073 3I2KA 1PO13 4FCAA 4BMEA 4ZKTB 3LE0A 1W28A 2FDGA 2HYKA 3BOWA 5IVJA 4RFRB 4XYXA 2QQJA 1JZ7A 1YI7A 1UPSA 2BUKA 2EF6A 3ZM8A 3VDCA 2DCJA 2GMPA 2HWB2 2VMFA 3RPQA 2NLRA 2RM21 3ZN5A 4OI0A 4WVMB 2WNVB 4A3XA 1NG0A 3HMYA 1RVF2 4XTPA 3GZAA 5A7PA 4LT5A 1W8OA 1H9WA 4KH9A 3WLUA 2J1AA 2VCBA 4A6SA 1GSLA 1YXWA 2QCSB 2C1FA 5FRAA 1VRH2 3SKVA 4CRQA 1COV2 3ZXFA 5IT6A 1R083 4N8MA 5M0TA 2ZX3A 4P9YA 1J1LA 4TZDA 1SEFA 4XCAA 2PAEA 4PDWB 5FP9A 3OSDA 2UYBA 3OPZA 3NWKA 1KJLA 2AREA 5DAQA 5FQ0B 1GQHA 2LS6A 4BMBA 1MZ5A 2W0XA 3AJZA 3DYMA 4QGMA 1ULEA 2EXKA 4Q0PA 5BPXA 5CFCB 1IS5A 3DYOA 5D8AB 4R8HA 2YU1A 2XJPA 3G7DA 2ADDA 1LGBA 2C26A 2XQXA 5KHJA 4CP9A 4CEYA 4Y5SA 4YNIA 1NCRA 3OTFA 3W5MA 1VBC1 1W2UA 1V00A 1MZEA 5JZGC 5EPAA 1UN1A 2HWC1 3IN9A 3B94A 4XDPA 3FFZA 1S4CA 1E57A 4WBBA 4HMZA 5DZGA 1RUD2 3G6JB 3TEZA 2ZKNA 4JQRA 5A3WA 3O7OA 1I3HA 5JCTA 1QOSA 3WOGA 2NPIA 4YM0A 3BPSA 2ZGMA 2ZMLA 1N1SA 4NHXA 1PIV1 4DUVA 1ZVFA 1PO23 5BNPB 2EVXA 4OQ9A 2LRPA 2C9AA 2C0ZA 4OMDA 3LA3A 4UAPA 5CADA 1HB3A 4PLMA 5FDBA 3QOPA 4H3WA 1ZZ7A 2OX0A 2V5YA 1SACA 1W3VA 3P5BA 1YYNA 1MS1A 3PJQA 1HRV2 3KQ4B 4LBQD 2RR11 3H3ZA 2DCKA 2OZ6A 2WO3A 3OOXA 2V09A 1Z7S3 2VVEA 1LKNA 2JG8B 4IEXA 1AF9A 2ZMNA 3CU7A 1QOTA 1UXXX 5F2SA 5L73A 3NAPA 1YQ5A 1ZBA3 4MGKE 3RZGA 1W2OA 1EUUA 1AYN3 2ORXA 1BEV1 5HCAA 3FZ3A 4AG4A 1F15A 1DIWA 1NA1B 1YI9A 3RMXA 4AHWA 2B39A 1XE8A 1UY2A 4IGOA 1H6YA 4BYYA 3ZO0B 2WZEA 1PGW1 3TWIA 1FX5A 3D4KA 2PHDA 5FZ6A 4R9BA 3FUQA 3I8TA 3KVAA 1OUSA 1VR3A 1ZA7A 1W9SA 2JX9A 3VD4A 1HQLA 2OS2A 4CYDA 1CONA 1NQDA 1JYNA 1ZZCA 3ZYHA 2FDHA 4QQOA 1J3QA 1O5UA 5F37A 4AQTA 4LTAA 3WCSA 3DPRA 1F35A 2QJVA 4L99A 5IVFA 4CUGA 4QPIB 4LBQA 4IW3A 5EQUA 1AX0A 1RIRA 3DGTA 3OGGA 3VHRA 3A0KA 4UW3A 1PZ8A 3S57A 1UIJA 1GR3A 4EJRA 2CSGA 4LK6A 1S55A 2P3JA 5F9TA 5FWEA 2KR2A 2JDNA 4BZ4A 4Q0SA 5DUUA 1W99A 3S6PA 2OQ7A 5JPNB 4YM3A 5KWRA 3A4UA 3JCIA 4JV4A 2E26A 4TLFA 4FQZA 2JDKA 3NKTA 4HBNA 4MADA 4MH0E 3Q8EA 5DDJ3 3UK9A 5KC5A 5KXCA 3K75B 2OPKA 1OQ1A 4IGQA 4L8QA 2R32A 4C0HA 2ZGOA 1IQAA 1D2QA 1I6XA 1I5PA 1CPMA 4AVCA 3SEEA 1WMEA 1AL21 4DPNA 2VZSA 2DVDA 1W9YA 2ZMKA 3V56A 4EQVA 4EZHA 1Q56A 1TZOA 3WZ1A 4YLZA 4GB31 1V6NA 1WZXA 3NMBA 4RR3C 3J8F3 1ZZBA 2B45X 5FYIA 1B35B 1Q8SA 1PNFA 2WS91 2VECA 3PDQA 4XAEA 1H8TB 4LBKA 3WF1A 4A7KA 5FY9A 4ES8A 5K9YA 3IDEA 5BNQA 5F8PA 4CA9A 3AP4A 3HAGA 1D4M1 1QJU2 3KWVA 3PU8A 3WDUA 4AFMA 3A7QA 1AR63 1W6NA 5FY4A 2VCCA 4YSFA 1BJQA 2PXJA 1UU6A 3VL8A 4CXYA 3JB8A 3FE5A 1CGPA 4G9SB 3LF7A 1QJY1 1HB4A 2C5DA 1SFPA 3ACHA 4JDNA 3THTA 1JZ4A 2VNRA 3SCFA 1OLME 3RQ0A 4BQYA 2X8KA 2H0VA 2VZVA 1C28A 1ULOA 1VAMA 3AYCA 4UW5A 3TN93 3M3IA 1UMZA 1F4AA 1CAVA 4UF0A 1ZYBA 4CU8A 3RYKA 1S2KA 3KM5A 1GZ9A 4IL7A 2Y0IA 2J1SA 4MVTA 1J84A 4P5HA 4A6OA 5C5UA 5EJ3A 3A0NA 3MIDA 1QMJA 3ZPYA 4AFDA 1OLQA 1EAH2 1UXZA 2ZGQA 1ZZ6A 4GWMA 4QHZA 5GLZA 1WCUA 3SNMA 3BODA 1J3RA 2A3YA 4IEPA 4MO3M 1VBB1 3JD71 3LQCA 4NVPA 2GDFA 5GZFA 5J7MA 4JKMA 5I0TA 2BJSA 2B4KA 5L9RA 3N7MA 4AVTA 4DZGA 2WNUC 2O8OA 1UYZA 4LO7A 1WCKA 3USUB 4M3CA 4XF0A 3B93A 3ZYRA 2W39A 2FCUA 2WN3A 2A3XA 1CJPA 3LIGA 4QB2A 2RMU2 1BKZA 1NQJA 3IM0A 5JWPA 1LOFC 4GA9A 2G19A 1A3KA 5F5AA 1ND2A 5JOZA 2FD8A 1RUOA 1XU1A 1LECA 3N36A 3Q8FA 4JGZC 5FP8A 1YLLA 3SXWA 3I2OA 1SLIA 1JOBA 4CCEA 2BWCA 5FK8A 2WC2A 3JBG1 3BUCA 5A32A 4LBLA 5G04L 3R6SA 2P17A 1TMF2 4I01A 4WVZA 2JDAA 4CCKA 1JMUB 1UWWA 5FY5A 4D0QA 1OT5A 4N53A 4Y5Z0 5LEJA 2VG9A 5A3UA 3DXTA 2BW8A 1IPJA 1LRHA 3I54A 1V0AA 3QACA 5H9RA 1UX6A 5A6XA 2HYXA 2CGOA 4HVOA 4IDZA 2CAUA 2XB6C 3LSEA 1VB2A 3B9CA 5FK7A 1UF2C 4HETA 5CFDA 1OMIA 5FY0A 3HWJA 4XQ4A 4HANA 1EYBA 1HXS2 1FATA 3LOIA 4XDQA 3ITQA 4OI2A 2RDRA 2AR6A 3LA2A 2W1WA 4V2WA 4G4FA 1AR82 3HT2A 3J4UH 1TME3 1HV1A 5IHRA 3I2JA 5AVAA 2RS51 1OC1A 2WNVC 2D43A 3EMRA 3ZXEA 3THPA 2R0HA 4Q0VA 2EAKA 1U5ZA 4ORFA 1GNHA 1GZWB 5LK5A 5ERLA 1ND3A 3WNLA 2UWCA 2R042 3F2ZA 2GC2A 2Y33A 4Q1PA 2HWE3 4KG0A 5A7WB 3H9AA 5DAWA 3FWEA 2VZQA 4FPOB 4RN5A 2WT1A 1GWMA 2DCYA 4JAAA 4XJWA 4CDQB 3RZLA 5J37A 4LKFA 3FUOA 4PDWC 1L7RA 2AZ5A 1AXZA 4Y22A 3MW4A 4Q4Y1 4URAA 3WF2A 4IQPA 1RITA 4HLTA 2PN5A 5F39A 3M4FA 5F3IA 3EO6A 1GUIA 3EXUA 1RC6A 2A70A 2BGCA 2VZ3A 5FUPA 4JKLA 4XOGA 2XONA 2ZZJA 1Z78A 2JD9A 5CIRA 4IGPA 1ASJ1 3H8OA 1RUI1 2W1QA 4K3UA 5AC91 5FJHA 5C5TA 3RZHA 1LJ7A 3AKQA 2LROA 4AL9A 5JOYA 2PLV3 1HB2A 3NW4A 1LOEA 1ZRIA 1ULFA 1S2BA 1YRZA 2ID4A 4SBVA 4UBHA 4AAXA 4BCUA 2UWBA 3F95A 4HT1T 4YARA 3W58A 1ZREA 3ZXJA 4I09A 4AEDB 4NHYA 1UMIA 3M3CA 4COVA 4Z2AA 3KF5A 3VBSA 1RUC2 3AYDA 4QHBA 2AH2A 1X50A 2RJLA 5BNPC 1RTVA 1HW5A 5IVEA 2HWD2 3VKOA 5E16A 4O65A 3TNQA 3M3EA 3OYWB 4BQ5A 3N9OA 1XYOA 4M01A 3UL2A 2VC9A 2R071 1L7QA 3OPTA 1LOBA 2L9LA 2YBSA 1R093 4RQPB 1W6PB 3WHUA 3BTXA 1LAJA 1RUF2 3ZDVA 3J7LA 2VE1A 1VRBA 1XJAA 3V0AB 3UGHA 1UY4A 1ONAA 2A7AA 5A6ZA 5FJKA 1WLCA 2VULA 4GIQA 2IXKA 3WG2A 2K2SA 1EPZA 1C8M3 4MG2A 4DS0A 1BK0A 1UZWA 4RHV1 3VBUA 1RYYA 1OH3A 1NA1C 1YO8A 2FQPA 4F3JA 3D0JA 3O0XA 1UY1A 4QKNA 1BVP1 5BUVA 3MF9A 5FMDA 5FO7B 4CDWB 3IKWA 2WT0A 1R081 5DUVA 3FMGA 1JU3A 1NLQA 2W9XA 3TOJA 1SPPA 3UGGA 5F5QA 2WIIB 5LASA 1FT9A 5FZFA 3I3BA 2ZX2A 1POQA 3A21A 4JC1A 4NR1A 3WUDA 4LKDA 4Q1RA 4UFHA 1BLZA 1KXGA 2VNOA 4W4ZA 4HXCA 3WNNA 2ZTNA 5FZ7A 5IW0A 5EIYB 1H30A 4QPIC 1H4GA 1O7FA 2VMGA 5FPVA 1BYHA 4IERA 1LHNA 2WZPP 1C5IA 1GICA 2Q8DA 5I8YA 4ISQA 1MACA 2VZRA 3K51A 5DUXA 5CKNA 3MUZ1 3W9AA 3WF4A 4KL1A 3BVCA 1S0GA 3CLPA 2QKDA 4BHPA 1QH6A 1FOD3 4UI9L 1DG6A 1RJ7A 5CBLA 1YJKA 5BV6A 4O9GA 1NUKA 2Y38A 4HOOA 4E4DX 5JMCA 3GBFA 2IUWA 2D6MA 5FYVA 5T5PA 4E2QA 4BQ1A 3H3UA 1MZ6A 3NQHA 5FY8A 4C90A 1DGLA 2E33A 4XJ8A 1PO21 3TNPB 3VV1A 4LQRA 3HBZA 3UT0A 3TRSB 4E4HA 5D1IA 3AMPA 5J96B 4JGYC 3MIBA 2Y6GA 3OD0A 5GLTA 2DUOA 4BH9A 2ZX1A 4UBGA 2XBO1 2Y34A 3H42B 2RM22 1DQ5A 4XBLA 1B35C 1UU5A 4S2DA 5C71A 1H8TC 3MZHA 1W9FA 2ZHNA 3ZFFB 4Y5TA 3AMMA 1ULGA 2ZACA 4BK4A 3GNEA 1KD7A 2CNAA 1XNDA 4IE7A 3ZFGA 3IPVB 3M3QA 4Q4X3 5A3MA 2X5IA 2E63A 1AYN1 2WZR3 1QXJA 1AR73 3B9IA 4MSVA 2Z69A 1E5HA 1NZCA 3ZLIA 4XFIA 3LCPA 3ZSLA 3N35A 3I3MA 5BNOB 4N43A 3ETPA 4KNCA 1UZYA 3AYAA 4E27A 3CO2A 2AUYA 1NCQC 4OZXA 4B4PA 2ZX0A 4I3PA 3O1RA 3I49A 3C7EA 3AL6A 3MV11 2XLFA 1ZBE3 5EZWA 5CZKA 5LA2A 3NKGA 2W91A 4MXVA 2AENA 5C8CA 1W6QA 2CGPA 3B02A 2XHKA 2WL1A 5BNNB 4FFFA 2VW1A 3ME2A 1NXD1 4ASLA 1ST8A 4NPLA 1XRUA 3EJKA 4HPKB 2AEYA 1VBC2 5FPZA 2J42A 1CAWB 5EJ1B 4COUA 2EIEA 2MEV3 4IV3B 5JXGA 2HWC2 2Y60A 3PVBB 2LALA 5IYYA 1MS3A 2WWSA 2B5HA 2VMDA 1C1LA 2X29A 5DXDA 1NE4A 5GLVA 3RYPA 1SDWA 1VJ2A 1PIV2 2R49A 3M2MA 5B2GB 4HONA 3UKVA 4QB6A 4M4PA 5C4WA 3RGBA 2BDRA 1BZWA 4MX3A 1SBEA 5FYSA 2VZUA 3VD7A 2AEZA 2ZGUA 3OY8A 1KGYA 2JDHA 2BBVA 3AZVA 2TEPA 5HCBA 4XFAA 3RNSA 4CPBD 1H9PA 4XDOA 1FYUA 1WA6X 3HR9A 1AR93 2OW4A 2QDRA 4L97A 5A70A 3MLLA 1AX1A 4P5YA 4TWTA 3J8F1 1LOGA 3WP5A 4CDUA 4CP1A 1BEV2 4A2UA 1VBE1 4BM8A 2VOWA 2VBPA 3VBHB 3OUIA 1IS6A 1YJLA 1XYNA 4I30A 2WNOA 3PUHA 4LMFA 4XFHA 2R7EB 2B9UA 1UOBA 1LNSA 1QJZA 2Z4FA 5LA9A 3QCWA 3RG0A 2RS13 2JG9A 3RSJA 1PGW2 4Z92B 1NAEA 1V6MA 4B4RA 3AKSA 5HCHA 3WDXA 2CAVA 4JHZA 3X29B 1AZDA 4D6SA 1US2A 4K6BA 5B4NA 3TN91 1VP6A 2W92A 2A6ZA 3OBTA 4MYEA 4Y20A 4AHXA 4EN7B 3RMYA 4CPBA 2VXJA 3AZZA 3I2HA 3VHPA 4K9SA 5F3EA 2JDYA 3WEZA 1NT0A 1U5IA 3U10A 4ZXEA 4SLIA 5FPBA 2E7TA 2D3PA 2VNVA 5FP4A 1P8JA 1Q8VA 2JECA 4IE4A 3HIFA 3WXPA 4BQXA 3PTRB 4N9IA 1D4VB 1E5SA 1OQEA 5T55A 3GM8A 3ZKUA 4E2SA 3PIJA 4YW1A 1UPIA 3KCCA 4UW4A 3WDTA 2WSVA 3BIWE 4LHNA 4FFHA 4CDQC 4YGBA 5JIAA 2W5FA 4YZ4A 1PGSA 1WMDA 2D93A 1OI6A 5LATA 5FFOC 1XE7A 5LY2A 5FYBA 2ATFA 1C1FA 2DTYA 4LBJA 4K8RB 4I2OA 2G9GA 1VALA 1O3RA 2QFEA 4PBPA 2PHRA 1RHI3 4GB32 4HFSA 5F3GA 2XXZA 1QHDA 1POV0 4DNYA 3KZ4C 1POV1 3O1SA 4IEZA 2B8MA 3LGRA 2WS92 2DVGA 2VD7A 2X53S 1BMV1 3ZYFA 5A33A 1GNZA 4QM9A 2V73A 3CNAA 4GD4A 1D4M2 1X8EA 3WW4A 4XF3A 3OGVA 3T09A 5FZEA 4IEQA 1YFXA 3S5AA 4JTOA 5IVBA 1N3QA 5L9BA 1G8WA 2VZPA 5FY7A 4GH4B 3AFGA 1W6OA 1YIFA 4PLOA 5FV3A 2Q5TA 1XU2A 3TYJA 1QJY2 2XG3A 1RVF3 1SG3A 1VBD1 1W8TA 2B46X 1BVVA 3WG3A 1T6GC 3H8UA 1JU4A 4AQSA 3KQRA 4XW3A 3VDDA 1OVSA 5FYTA 5F32A 4Y1ZA 5HBAA 4C1XA 2RDQA 4R9DA 3IIIA 1COV3 4RQPC 4BQ2A 2WJSA 2XLGA 1LCLA 1EP0A 3MICA 4CDXA 4QU1A 2WLQA 3WQBA 1DLCA 2YU2A 4GZ9A 3UJOA 3M1HA 2EAAA 4KQ7A 2NMNA 1W0PA 2QBXA 2Y26A 3AB0A 3OEAA 4BB3A 3ZFEC 4Q27A 4F83A 4LHSA 1VBB2 1OHFA 4D8MA 2K9ZA 2VXRA 4JGZB 5C3SA 3T2OA 1LODA 2P6HA 1RINA 2JKBA 4KGGA 3RZJA 2YG0A 1SLTA 4ARYA 2HWE1 3HQXA 3MFAA 5JSPA 3NSTA 2P3YA 4CEWA 2Q1FA 1VPHA 1TQ5A 1GWKA 4P9IA 3VBFC 2VCAA 4S2FA 1RUD3 3OGSA 3U11A 1O3SA 3LZZA 1F2NA 3N9NA 1F9KA 3U75A 1I1EA 1ZRCA 1SCRA 4UFKA 4NAOA 1S2EA 2DVFA 2TUNA 1FMD3 4A7ZA 2OPWA 1Y7BA 2W68A 2VO5A 2Y6KA 4YW6A 5CKMA 1DYOA 4FBFA 2XKOA 3IZOA 3POFA 2ZABA 4Q8KA 5K0UC 5IK5A 4IUGA 2Z42A 3OEBA 4GWNA 3JBG2 4UFLA 5EXOA 5JVVA 5FOBB 3E6BA 3AX4A 3J7MA 3KV5A 4ZZ8A 1HRV3 4GWIA 1UYYA 3T4HB 4OUSA 4O7XA 2ARXA 2PLV1 4Q4V1 3OPWA 4WM7C 5FTTC 5C8WA 2MHFA 3CDZB 3AM2A 4LKEA 2ZCWA 3MYXA 3LOBA 4Y1VA 3CQOA 4V2VA 4YYOA 1Q5OA 3MIEA 3AYEA 4NAMA 4UW6A 2HWF1 2P5BA 2MPFA 3PURA 3NO8A 3N4MA 5LBBA 2QQUA 3OGRA 3ZPOA 4QDSA 1QF3A 4URTA 1OSGA 2CU5A 1AJOA 3AKPA 5DAVA 5J09A 1DQ1A 4KWUA 3SKJE 3RRDA 2JIGA 4B7EA 1BHGA 4QXCA 5I8TA 2WDBA 4KGQA 1UY3A 4YG6A 3GJAA 4P9WA 5FZ0A 2RS52 1VBA1 3K4AA 4KI5M 5FZHA 4YFZA 3V0BA 1VLNA 5IJRA 1JBCA 1RGSA 1ZM1A 2BERA 3LB9A 3HNMA 1EV13 3I2IA 1AJKA 3ZFFC 1OA3A 4IE5A 1ULCA 4LORA 2VTFA 1OKQA 3AXDA 3IBMA 4Y1YA 4AZZA 2DUQA 4TN7A 3APBA 3INAA 3H1MA 4QWNA 1MPXA 1VMFA 5JSRA 3THDA 2JD4A 1C8M1 5ANQA 2WBKA 4Z1VA 5JZGA 3B00A 3VKFC 1UYPA 2W08A 5BNOC 4FP3A 4HVRA 3M3OA 1KDMA 4J1XA 3PIGA 3MV01 4Q4Y2 3VBRB 4ZZ5A 1GWLA 1PVXA 2JE9A 2HH9A 3VD5A 3ACIA 2GNTA 4P02B 2AACA 3HNBM 3RS6A 5CEHA 4XJAA 2W47A 2JICA 2UY8A 1UNBA 3POSA 4BK5A 1DBNA 2YUEA 3TBDA 4OQ8A 3OGJA 5BNNC 3IMMA 1ASJ2 1DQ4A 1RUI2 4RGGA 4M3CE 5AC92 4EZ4A 5EJZB 3S30A 4QB1A 1PK6B 5FXXA 2VZOA 1PVC2 5F3CA 2XVLA 2W2IA 4IV3C 4LO5B 3UKTA 1RUE3 3Q8BA 2VGDA 3HNYM 4EWDA 2ZGLA 1W8FA 2UYAA 2FDJA 3SEPA 1XE0A 1GKBA 3KV4A 2BGPA 4FOYA 1YQ6A 3HT1A 1EY2A 1G6NA 4IESA 1FOD1 3ASIA 4Y4RA 1NYWA 3WD5A 1QJU3 2RJKA 3BTZA 4XQDA 4FPJA 2YFZA 2ZHKA 1BBT3 1DZRA 4X8PA 2JE8A 3SITA 4BPZA 4CXXA 4RYDA 2XJVA 1O4YA 2ZEZA 5JIUA 4AI2A 4NN0A 2R072 5DG2A 2ARCA 4AEMA 4LNVA 2BVBA 1LGNA 3R0RA 4FQ4A 4P9LA 1HRI1 3WNPA 2YB7A 4HSJA 2YBKA 4Z07A 3IWZA 3N9LA 3OUHA 2V5DA 5L7OB 1FNZA 1Y9GA 1JH5A 2WLPA 5K7PA 4DXZA 1W0NA 2J7MA 4DINB 2ZGTA 4LITA 3NAPC 3K3NA 4RHV2 3VBHC 4YVSB 1JZ5A 1CZVA 1DLLA 4Y3OA 1EAH3 4Q4X1 1DGRA 2EXHA 3PVNA 3AP5A 3IDCB 5FPLA 4R9AA 2A71A 3BB6A 1LENA 2QZ3A 2WZR1 1AR71 1RUJ2 2WWUA 2BZDA 3MFCA 3PUQA 4NOTA 4WZCA 2W1SA 5IAVA 4AI1A 5L9VA 1R082 2QZ2A 3QBQA 1MS0A 2D5HA 1WWYA 1XNAA 1FAYA 2VMHA 4IV1A 4NRMA 3K77A 5FP3A 1OOPB 1ZBE1 2ET1A 2YHJA 4MGQA 3VZLA 4C91A 2JB4A 2XUMA 1ZNPA 3O1OA 3VN4A 5C9AB 1E5RA 3LA7A 2FDIA 2P6CA 4OI4A 2R1BA 1QIQA 4XTMA 1MEC3 1LESA 1W2NA 4ZU5A 3T3YA 2A75A 1Q8OA 5LZ6A 2OXBA 1A78A 5A3LA 2PHWA 4JGYB 2X05A 1DF0A 1F4HA 1XOYA 3MDPA 2CHHA 2ZJCA 3DN7A 1W2AX 4RR3A 4QAWA 2MEV1 1ZRRA 3P3PA 5FZ9A 2D6PA 2F4PA 4J25A 5ACA3 3ZXGA 4BIOA 3C7OA 3U14A 4CE8A 2CV6A 1Y3TA 4PHZA 3O1VA 3ZXKA 2BYVE 3WDVA 3CL1A 5FYUA 4COZA 2D3RA 2QQOA 1V6IA 1QU0A 3I97A 1PO22 3ELNA 3H50A 3POWA 3VBOB 1DHKB 4JHTA 4LEJA 1QDCA 2R1DA 3GCXA 4N7IA 5KXEA 1MQTA 4FTBA 3UNPA 1CVNA 2LW8A 4IEOA 5C3QA 2BPA2 1XXNA 5SV5A 5KXDA 5C3RA 2BWAA 4MGYE 4FPGA 2GZWA 4PT6A 4F8AA 3B5LB 2XBO2 1NCQB 1OQDA 1H1IA 3TEXA 4BA6A 2BNNA 1H1MA 4MOAA 4C8DA 3KGLA 1S0FA 2DTWA 3MIFA 2WAAA 4XUOA 3PVEA 3WQ1A 4LIUA 3B01A 4EROA 2JKXA 4ZS3A 1QNWA 1UZVA 3AKTA 1LHOA 1PZ9A 1V9U3 4GH4C 1CAUB 5FXVA 3NVCA 1GOHA 4LHKA 3WCRA 3U07A 2A73B 2R043 2EIDA 2RS11 4DY5A 1WW7A 4L2NA 4ARXA 4NIDA 2DVBA 4MUVA 4QPYA 5FAXA 3R4DB 5E89A 5FY1A 4CCDA 3SH3A 3NJVA 4XIKA 4H2AA 1OVPA 2C9KA 1CIWA 5T50A 5JAXA 1JOPA 4YRDA 4JDMA 3WW2A 1PGL1 3PMEA 4RD7A 2WR9A 5LWBA 1W6MB 2WYFA 2HJIA 5JPMB 2DDUA 4BQ3A 1KEXA 3B69A 1RUH1 4Q26A 2BNMA 4LULA 1QQP3 2BBAA 5CYYA 4LOSA 1UX7A 5LY1A 1MS9A 4GWJA 1ALYA 5A7SA 4RGAA 2Q8CA 3VL9A 3POEA 4QPGA 4QQPA 2PTMA 4DMIA 2GMEA 4H7LA 2NM1A 2WFF3 1RUC3 4NROA 3LEMA 4P00B 4LO4B 4LHLA 4LKSA 4QX2A 1BQPA 2FHRA 3N9PA 1IG0A 2VR4A 1R1ZA 1ZA4A 4UFIA 4CUCA 4Q4W1 3WW3A 1Y9QA 2G4IA 1HB1A 2DWRA 1RHI1 3LEKA 1GLHA 5FZIA 4QXHA 1CAXB 3NNMA 4LR4A 3J8F2 4TYSA 1EUTA 1LHWA 1RUF3 1DDLA 2QNKA 1VBE2 1R1A1 1YIPA 2ZS6B 3JXSA 3HN1A 4WVMA 4GKXA 2RVAA 2WNVA 4XJZA 1TVGA 1GQPA 3LPGA 4MXWB 1MS4A 1RXFA 1ZRFA 3ZYJB 5FP7A 4AK3A 4FVVA 4Q5OA 4U2AA 4LBMA 4XABA 1T2XA 5E88A 5D2AA 5FUIA 2Q8OA 3FL7A 5TSWA 4GJZA 4QT6A 2LUWA 3I59B 4K8FA 5CFDC 1MVQA 2PELA 2XWBB 3OBZA 4XBNA 2P37A 2WWJA 5B4XA 4PDWA 3TN92 4AQ6A 4BE3A 4D6QA 2ORZA 4OCTA 4XFBA 5A3TA 2QQVA 5C6CA 1JYIA 5FQ0A 1UO9A 4ZU7A 1QH7A 2IFRA 3PL0A 3WP3A 5I0DA 4JRLA 4WM8B 5CFCA 1UW8A 4QDRA 3FX3A 4E2GA 5D8AA 4KWKA 2QQLA 2RS33 2FCVA 1RL3A 3AC0A 4G3YC 4OYUA 5CAZA 3I3QA 2ETEA 1G9CA 4BQWA 1K5MB 2YC0A 4OZOA 5FMOL 5LBEA 5JXHA 2JDPA 1ACCA 1IOAA 1ND3C 2DYCA 2PQQA 2XWJB 1SFYA 2VBBA 4YG3A 1AYM1 3U78A 3OD4A 4ITCA 4ZONA 2XL9A 4LE3A 5GM0A 3VBRC 4DXTA 2AYHA 4LK7A 5D21A 4NHMA 3K46A 5I8SA 1VMHA 2R063 3D3AA 5A6QA 2SLIA 2QQWA 2A6WA 4DQAA 5LK7B 4QGNA 4RS5B 5BNPA 2XLAA 5JOWA 2LM3A 4ZY9A 3ZN6B 1JYVA 2GH2A 4JVAA 4PI0A 1LR5A 4YFWA 2H6BA 1FMD1 3ZR6A 2RHPA 5CISA 5CNAA 1UU4A 1VB4A 3KCYA 1BMV2 1PK6C 3U4SA 2GP3A 1LHUA 1MS8A 1PO11 5HI0A 5IFPA 4YZ5A 3SHRA 5FYYA 2AGSA 2VZ1A 4QM8A 4CUBA 1YHFA 1RB8G 5SV8A 5IWFA 2JG8A 3GZEA 3FHIB 2GC1A 2EALA 2RM23 1JZ6A 1FXZA 3N7KA 4AF9A 3NV2A 4NIGA 4AI8A 1FPN3 1WW5A 3NNFA 2VQTA 1REEA 1VBD2 2QQKA 4KWJA 2JIJA 3ZFEB 4EWEA 2VW2A 4ZPIA 5BYNA 3R05A 3VBSC 5I93A 3PLQA 1NA1A 3DL3A 3SH4A 2Y6JA 4A7YA 5FZGA 3VGIA 4EN6B 3OCPA 1ULPA 3USSA 4PIYA 5FZ8A 4M4RA 3HJRA 3VBFB 2WA3A 2R6QA 4CCLA 5FKCA 3AZYA 4LIVA 2IVIB 1W03A 4GXLA 4QKFA 5IK8A 1RMU3 3MHZA 2Y0OA 3U4XA 4YVWB 5L7OC 3R4SA 3FN9A 4FPYA 5J36A 2YFUA 2A1XA 3H1WA 4LXLA 2BOJA 3MPPG 4QPIA 3S7EA 3U37A 1EV11 1OD5A 3AZXA 5K0UB 3VUOA 2DVAA 4YVSC 5KR7A 1C8NA 1VBC3 2D98A 2HWE2 4ISRA 5HV0A 1RXGA 3T0BA 5IAXA 2P4EA 1QJX3 2BP6A 4GQ7A 1U5XA 2BFUL 4XUTA 4WM7B 1BCXA 1NE6A 2XVGA 4AVAA 2VVDA 3CJIB 3U1XA 3WW1A 3ZR5A 4H7MA 3H8XA 5ABJB 3O1TA 3V64A 4IETA 1PIV3 3W5NA 2JB8A 1OOPC 1APNA 2VMCA 2BNOA 3K4DA 3S7IA 5C9AC 4B8EA 3PJYA 5BY5A 2YMZA 4E8DA 1W3XA 3PUAA 1LGCA 4YG0A 5T5JA 4R52A 5FLIA 1HV0A 3VHNA 3IAPA 4AGGA 4W6YA 1H0BA 1YQ8A 2PLV2 4Q4V2 4A44A 1H4HA 2E51A 2VQ0A 3C7HA 5FLHA 4AYUA 5C3OA 5DZEA 1B35A 1RUE1 1JZ8A 1H8TA 3P6BA
chains in the Genus database with same CATH topology
3I2FA 4A45A 1TG7A 3WF3A 3OGVA 3T09A 4E8CA 1UXXX 3ACGA 4HG6B 2VZPA 1EUUA 2ORXA 4DXRA 1K42A 3EB7A 3GXUA 4AG4A 2X09A 3I2GA 1SG3A 2J1VA 1GOGA 1GMMA 1JU4A 4CVUA 1UY2A 1H6YA 2W1UA 2WZEA 3IIIA 4XUQA 4OUEA 1W9SA 1OF4A 3VD4A 1JYNA 2OKXA 3WQBA 1DLCA 4GZ9A 3T2PA 4TTGA 1WCQA 2QBXA 3OEAA 4LHSA 4D8MA 3T2OA 2VQUA 1OH4A 4XZUG 2YG0A 4ARYA 4QX0A 1W99A 1UMHA 2QQIA 3C7FA 3HN3A 2VCAA 5HXMA 3OGSA 3T08A 2E26A 2KD7A 4MADA 3NRUA 2WZ8A 3K75B 2E32A 2WO2A 2VO5A 3DECA 2Y6KA 4A41A 1DYOA 1I5PA 3SEEA 4IUGA 3OEBA 2VZSA 4KMQA 4XVHA 1PMJX 1SDDB 4ZZ8A 4BJ0A 4GWIA 1UYYA 1GU3A 3WF1A 1O8SA 3C7GA 3CDZB 2J1EA 4DEVA 4W8JA 3MBWA 3CQOA 3A7QA 3WNMA 2VCCA 3GDBA 3OGRA 3I3DA 4QDSA 3ACHA 1JZ4A 4FI9A 5DPNA 4KWUA 2WAOA 3SKJE 3T0AA 3J7HA 2J1RA 1BHGA 2VZVA 2WDBA 2WUHA 1ULOA 1UY3A 3LEIA 1F4AA 3K4AA 4KI5M 5IJRA 3I3EA 4CU8A 3A23A 2BERA 2J1SA 3HNMA 1J84A 3I2IA 4A6OA 5C70A 2VTFA 1UXZA 2V4VA 3WNOA 2W3JA 3CIHA 1MPXA 2E31A 3THDA 3WF0A 4MO3M 2WBKA 2Y64A 3LQCA 2Y6HA 4JX0A 1O8PA 5JUVA 2VJXA 4JKMA 2W46A 3MV01 4ZZ5A 2CDOA 3VD5A 3ACIA 3HPNA 4P02B 2B4KA 3HNBM 2W47A 5DN2A 1UYZA 4BK5A 2WN3A 3PUIA 3C8XA 4QB2A 3VD3A 5EJZB 2VOTA 4QB1A 4CU6A 2VZOA 3BN6A 4LPLA 3HNYM 4XURA 3DYPA 5G04L 3SEPA 4DEQA 2JDAA 2BGPA 1UWWA 4D0QA 1OT5A 3IB3A 2YFZA 1JYXA 2JE8A 2HYXA 3THCA 4RYDA 2ZEZA 3HEIA 2X10A 1D7PM 1W9WA 3NJXA 5LA0A 2J22A 3OB8A 3CZJA 3WNPA 4QX3A 1J83A 2YB7A 4QDQA 2W1WA 2ZEXA 2V5DA 5IHRA 3I2JA 2YC4A 1W0NA 2J7MA 2W95A 4DXSA 1JZ5A 1CZVA 3E1F1 2ZEYA 4XUNA 2VMEA 3WNLA 3F2ZA 2BZDA 2W1SA 1YQ2A 2J1UA 4MGSA 2VZQA 4RN5A 2WN2A 2B9VA 3ACFA 1WKYA 1XNAA 3IAQA 4W50A 1L7RA 1XC6A 4JKKA 3K77A 3WF2A 3ECQA 4MGQA 3UETA 1GUIA 2VZ3A 1JHJA 2V72A 4CU9A 4JKLA 2W87A 2XONA 3ABZA 2JD9A 5LA1A 2W1QA 2X05A 1F4HA 4QAWA 4A4AA 3MUY1 5JXJA 3C7OA 2ID4A 4AAXA 1PX3A 2QQMA 1UMIA 4Z2AA 2QQOA 4DUXA 3I97A 2EIBA 1CZSA 3CKHA 3UNPA 5C7GA 2LW8A 4L0PA 1DP0A 2C4XA 4OMCA 4PT6A 2VC9A 4CUAA 1L7QA 1OF3A 2L9LA 3CMGA 4MOAA 4PQQA 2WAAA 4XUOA 1NKGA 1UY4A 2JKXA 2WQ8A 5F7UA 2CDPA 2ZXQA 3WNKA 1GOHA 1K45A 4ET7A 1NX9A 1RYYA 2J1TA 1CIYA 2EIDA 1CZTA 4ARXA 1UY1A 1K3IA 1JZ2A 1JU3A 3NJVA 1UZ0A 2W9XA 2C9KA 2XHNA 2YC2A 3T0DA 3I3BA 3A21A 1W8NA 5LCWL 4W4ZA 3WNNA 5EIYB 3CZUA 5J1XA 2PQSA 4QX1A 3T2QA 2DDUA 1KEXA 4P08A 4XUPA 3K4ZA 2VZRA 1JZ3A 2BBAA 5CYYA 3MUZ1 3WF4A 5DMYA 1UX7A 1JYWA 3OBAA 4GWJA 4UI9L 2WO1A 2WYSA 3MO4A 3WSOA 1NUKA 3FHAA 4QPWA 2W94A 3NQHA 2RV9A 4P00B 2E33A 4LKSA 4QX2A 4LQRA 4CUCA 2VR4A 1GOFA 2VL4A 5HPOA 2Y6GA 3LEKA 2QQNA 1EUTA 2Y8KA 5C71A 4TXWA 1XNTA 3JXSA 4BK4A 2RVAA 5G05L 1TVGA 1GQPA 3LPGA 1UY0A 4UOJA 1T2XA 5FUIA 2BGOA 3FL7A 3ETPA 3EYPA 1PMHX 2XOMA 1US3A 5B4XA 3LPFA 2ORZA 1OD3A 3C7EA 3NNGA 3MV11 3HOBA 5CZKA 5LA2A 2W91A 2WABA 5I0DA 4CU7A 4QDRA 2EICA 2QQLA 3BGAA 3AC0A 1R64A 4OYUA 5EJ1B 1K12A 2EIEA 4OZOA 5JXGA 4PF1A 3LEGA 5JR2A 5JXHA 1UYXA 5IYYA 4A42A 4DXTA 2VMDA 3VD9A 3K46A 4DUWA 3D3AA 1H6XA 1IQDC 1GNYA 4QB6A 4M4PA 3FHQA 2VM9A 4ZY9A 2VZUA 2RJ2A 3VD7A 5JXIA 1JYVA 1W9TA 4BDVB 1KGYA 2ZEWA 3I2KA 3LE0A 5IFTA 5IFPA 3VDAA 4A3ZA 4CUBA 2VZ1A 3VDBA 2QQJA 1JZ7A 4P5YA 3ZM8A 3VDCA 1JZ6A 2DCJA 3GGLA 2VMFA 1JI6A 2VQTA 5DQ0A 1CX1A 2QQKA 3PUHA 1HN1A 2R7EB 1XPWA 1W8OA 1LNSA 2VZTA 2Y6JA 2Z4FA 2J1AA 2VCBA 5JMOA 1NAEA 4YPJA 1ULPA 2HLEA 5A1AA 3SKVA 1PX4A 4M4RA 3HJRA 3P1IA 4JHZA 1US2A 5B4NA 2W92A 2LS6A 3FN9A 3I2HA 2YFUA 3DYMA 3WEZA 3U37A 3DYOA 4ZXEA 2C26A 2XQXA 1P8JA 3W5MA 1SHWB 3OG2A 3T0BA 3GM8A 4XUTA 2W5FA 3W5NA 2VMCA 3K4DA 4DUVA 4OMDA 4UAPA 4E8DA 3A22A 2Y6LA 3IAPA 4BXSV 3UESA 3IDAA 1O59A 4A44A 3C7HA 2DCKA 2WO3A 1JZ8A 3P6BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I2F A;  4A45 A;  1TG7 A;  3WF3 A;  3OGV A;  3T09 A;  4E8C A;  1UXX X;  3ACG A;  4HG6 B;  2VZP A;  1EUU A;  2ORX A;  4DXR A;  1K42 A;  3EB7 A;  3GXU A;  4AG4 A;  2X09 A;  3I2G A;  1SG3 A;  2J1V A;  1GOG A;  1GMM A;  1JU4 A;  4CVU A;  1UY2 A;  1H6Y A;  2W1U A;  2WZE A;  3III A;  4XUQ A;  4OUE A;  1W9S A;  1OF4 A;  3VD4 A;  1JYN A;  2OKX A;  3WQB A;  1DLC A;  4GZ9 A;  3T2P A;  4TTG A;  1WCQ A;  2QBX A;  3OEA A;  4LHS A;  4D8M A;  3T2O A;  2VQU A;  1OH4 A;  4XZU G;  2YG0 A;  4ARY A;  4QX0 A;  1W99 A;  1UMH A;  2QQI A;  3C7F A;  3HN3 A;  2VCA A;  5HXM A;  3OGS A;  3T08 A;  2E26 A;  2KD7 A;  4MAD A;  3NRU A;  2WZ8 A;  3K75 B;  2E32 A;  2WO2 A;  2VO5 A;  3DEC A;  2Y6K A;  4A41 A;  1DYO A;  1I5P A;  3SEE A;  4IUG A;  3OEB A;  2VZS A;  4KMQ A;  4XVH A;  1PMJ X;  1SDD B;  4ZZ8 A;  4BJ0 A;  4GWI A;  1UYY A;  1GU3 A;  3WF1 A;  1O8S A;  3C7G A;  3CDZ B;  2J1E A;  4DEV A;  4W8J A;  3MBW A;  3CQO A;  3A7Q A;  3WNM A;  2VCC A;  3GDB A;  3OGR A;  3I3D A;  4QDS A;  3ACH A;  1JZ4 A;  4FI9 A;  5DPN A;  4KWU A;  2WAO A;  3SKJ E;  3T0A A;  3J7H A;  2J1R A;  1BHG A;  2VZV A;  2WDB A;  2WUH A;  1ULO A;  1UY3 A;  3LEI A;  1F4A A;  3K4A A;  4KI5 M;  5IJR A;  3I3E A;  4CU8 A;  3A23 A;  2BER A;  2J1S A;  3HNM A;  1J84 A;  3I2I A;  4A6O A;  5C70 A;  2VTF A;  1UXZ A;  2V4V A;  3WNO A;  2W3J A;  3CIH A;  1MPX A;  2E31 A;  3THD A;  3WF0 A;  4MO3 M;  2WBK A;  2Y64 A;  3LQC A;  2Y6H A;  4JX0 A;  1O8P A;  5JUV A;  2VJX A;  4JKM A;  2W46 A;  3MV0 1;  4ZZ5 A;  2CDO A;  3VD5 A;  3ACI A;  3HPN A;  4P02 B;  2B4K A;  3HNB M;  2W47 A;  5DN2 A;  1UYZ A;  4BK5 A;  2WN3 A;  3PUI A;  3C8X A;  4QB2 A;  3VD3 A;  5EJZ B;  2VOT A;  4QB1 A;  4CU6 A;  2VZO A;  3BN6 A;  4LPL A;  3HNY M;  4XUR A;  3DYP A;  5G04 L;  3SEP A;  4DEQ A;  2JDA A;  2BGP A;  1UWW A;  4D0Q A;  1OT5 A;  3IB3 A;  2YFZ A;  1JYX A;  2JE8 A;  2HYX A;  3THC A;  4RYD A;  2ZEZ A;  3HEI A;  2X10 A;  1D7P M;  1W9W A;  3NJX A;  5LA0 A;  2J22 A;  3OB8 A;  3CZJ A;  3WNP A;  4QX3 A;  1J83 A;  2YB7 A;  4QDQ A;  2W1W A;  2ZEX A;  2V5D A;  5IHR A;  3I2J A;  2YC4 A;  1W0N A;  2J7M A;  2W95 A;  4DXS A;  1JZ5 A;  1CZV A;  3E1F 1;  2ZEY A;  4XUN A;  2VME A;  3WNL A;  3F2Z A;  2BZD A;  2W1S A;  1YQ2 A;  2J1U A;  4MGS A;  2VZQ A;  4RN5 A;  2WN2 A;  2B9V A;  3ACF A;  1WKY A;  1XNA A;  3IAQ A;  4W50 A;  1L7R A;  1XC6 A;  4JKK A;  3K77 A;  3WF2 A;  3ECQ A;  4MGQ A;  3UET A;  1GUI A;  2VZ3 A;  1JHJ A;  2V72 A;  4CU9 A;  4JKL A;  2W87 A;  2XON A;  3ABZ A;  2JD9 A;  5LA1 A;  2W1Q A;  2X05 A;  1F4H A;  4QAW A;  4A4A A;  3MUY 1;  5JXJ A;  3C7O A;  2ID4 A;  4AAX A;  1PX3 A;  2QQM A;  1UMI A;  4Z2A A;  2QQO A;  4DUX A;  3I97 A;  2EIB A;  1CZS A;  3CKH A;  3UNP A;  5C7G A;  2LW8 A;  4L0P A;  1DP0 A;  2C4X A;  4OMC A;  4PT6 A;  2VC9 A;  4CUA A;  1L7Q A;  1OF3 A;  2L9L A;  3CMG A;  4MOA A;  4PQQ A;  2WAA A;  4XUO A;  1NKG A;  1UY4 A;  2JKX A;  2WQ8 A;  5F7U A;  2CDP A;  2ZXQ A;  3WNK A;  1GOH A;  1K45 A;  4ET7 A;  1NX9 A;  1RYY A;  2J1T A;  1CIY A;  2EID A;  1CZT A;  4ARX A;  1UY1 A;  1K3I A;  1JZ2 A;  1JU3 A;  3NJV A;  1UZ0 A;  2W9X A;  2C9K A;  2XHN A;  2YC2 A;  3T0D A;  3I3B A;  3A21 A;  1W8N A;  5LCW L;  4W4Z A;  3WNN A;  5EIY B;  3CZU A;  5J1X A;  2PQS A;  4QX1 A;  3T2Q A;  2DDU A;  1KEX A;  4P08 A;  4XUP A;  3K4Z A;  2VZR A;  1JZ3 A;  2BBA A;  5CYY A;  3MUZ 1;  3WF4 A;  5DMY A;  1UX7 A;  1JYW A;  3OBA A;  4GWJ A;  4UI9 L;  2WO1 A;  2WYS A;  3MO4 A;  3WSO A;  1NUK A;  3FHA A;  4QPW A;  2W94 A;  3NQH A;  2RV9 A;  4P00 B;  2E33 A;  4LKS A;  4QX2 A;  4LQR A;  4CUC A;  2VR4 A;  1GOF A;  2VL4 A;  5HPO A;  2Y6G A;  3LEK A;  2QQN A;  1EUT A;  2Y8K A;  5C71 A;  4TXW A;  1XNT A;  3JXS A;  4BK4 A;  2RVA A;  5G05 L;  1TVG A;  1GQP A;  3LPG A;  1UY0 A;  4UOJ A;  1T2X A;  5FUI A;  2BGO A;  3FL7 A;  3ETP A;  3EYP A;  1PMH X;  2XOM A;  1US3 A;  5B4X A;  3LPF A;  2ORZ A;  1OD3 A;  3C7E A;  3NNG A;  3MV1 1;  3HOB A;  5CZK A;  5LA2 A;  2W91 A;  2WAB A;  5I0D A;  4CU7 A;  4QDR A;  2EIC A;  2QQL A;  3BGA A;  3AC0 A;  1R64 A;  4OYU A;  5EJ1 B;  1K12 A;  2EIE A;  4OZO A;  5JXG A;  4PF1 A;  3LEG A;  5JR2 A;  5JXH A;  1UYX A;  5IYY A;  4A42 A;  4DXT A;  2VMD A;  3VD9 A;  3K46 A;  4DUW A;  3D3A A;  1H6X A;  1IQD C;  1GNY A;  4QB6 A;  4M4P A;  3FHQ A;  2VM9 A;  4ZY9 A;  2VZU A;  2RJ2 A;  3VD7 A;  5JXI A;  1JYV A;  1W9T A;  4BDV B;  1KGY A;  2ZEW A;  3I2K A;  3LE0 A;  5IFT A;  5IFP A;  3VDA A;  4A3Z A;  4CUB A;  2VZ1 A;  3VDB A;  2QQJ A;  1JZ7 A;  4P5Y A;  3ZM8 A;  3VDC A;  1JZ6 A;  2DCJ A;  3GGL A;  2VMF A;  1JI6 A;  2VQT A;  5DQ0 A;  1CX1 A;  2QQK A;  3PUH A;  1HN1 A;  2R7E B;  1XPW A;  1W8O A;  1LNS A;  2VZT A;  2Y6J A;  2Z4F A;  2J1A A;  2VCB A;  5JMO A;  1NAE A;  4YPJ A;  1ULP A;  2HLE A;  5A1A A;  3SKV A;  1PX4 A;  4M4R A;  3HJR A;  3P1I A;  4JHZ A;  1US2 A;  5B4N A;  2W92 A;  2LS6 A;  3FN9 A;  3I2H A;  2YFU A;  3DYM A;  3WEZ A;  3U37 A;  3DYO A;  4ZXE A;  2C26 A;  2XQX A;  1P8J A;  3W5M A;  1SHW B;  3OG2 A;  3T0B A;  3GM8 A;  4XUT A;  2W5F A;  3W5N A;  2VMC A;  3K4D A;  4DUV A;  4OMD A;  4UAP A;  4E8D A;  3A22 A;  2Y6L A;  3IAP A;  4BXS V;  3UES A;  3IDA A;  1O59 A;  4A44 A;  3C7H A;  2DCK A;  2WO3 A;  1JZ8 A;  3P6B A; 
#chains in the Genus database with same CATH topology
 1I5Z A;  1SLC A;  4FOQ A;  4A45 A;  3WF3 A;  1CN1 A;  2WQ4 A;  2WKK A;  1Z7S 1;  2HWF 2;  2DU1 A;  4E8C A;  1PM7 A;  3S5Q A;  3ACG A;  2O14 A;  3I2D A;  4HG6 B;  4D7Y A;  1K42 A;  4AI3 A;  2B7Y A;  1ZBA 1;  3GJB A;  2VOV A;  1WW4 A;  3GXU A;  3VBO C;  2XVK A;  1UD1 A;  3I2G A;  2J1V A;  5FZB A;  1BBT 1;  3D5O A;  2K0G A;  1GMM A;  2W52 A;  2UY9 A;  2XH6 A;  3RZZ A;  5J98 B;  3ZSE A;  5IVY A;  2W1U A;  3BCW A;  1G86 A;  1VBA 2;  2NP0 A;  4XUQ A;  4OUE A;  3WG1 A;  1IPK A;  1HN0 A;  2EA7 A;  1J3P A;  2JEM A;  3PVO A;  4I0A A;  4OFG A;  2YGM A;  1DQ6 A;  4AEJ A;  2OKX A;  4E4Z A;  1G9F A;  1QOO A;  3T2P A;  3E5Q A;  3SC7 X;  3KMH A;  1C8M 2;  4MV2 A;  3ZFG C;  3BYW A;  4BIF A;  2KA3 A;  2X5I C;  4Z8B A;  3LFM A;  3IT8 A;  1U12 A;  2JXA A;  4WV8 A;  5A7N A;  4CP9 B;  2ADE A;  4IXL A;  4CEY B;  5E8A A;  1NCR B;  3GYD A;  4IND A;  5FWJ A;  4EWA A;  3PTY A;  4FSJ A;  4W6W A;  1HJG A;  2E7Q A;  4XZP A;  1WMX A;  3T08 A;  1HQW A;  4KWL A;  3USU A;  1KRI A;  3NRU A;  4M0H A;  2WZ8 A;  1RUN A;  2WO2 A;  1S0I A;  5DDJ 1;  2I74 A;  4A41 A;  3DF0 A;  4NHL A;  4BIS A;  2ZGR A;  4B4Q A;  2IXI A;  4D94 A;  1TEI A;  2CGN A;  1MEC 1;  3AXE A;  1ENR A;  3AK0 A;  3ON7 A;  2RR1 2;  4XF1 A;  4XVH A;  4QQ2 A;  4YW7 A;  4YW4 A;  4QMA A;  3ZYB A;  4K1Y A;  1YC6 1;  4FPH A;  3WUC A;  3LSD A;  4W65 A;  4IEY A;  1GU3 A;  3H8R A;  1FOD 2;  5ACA 1;  3DEM A;  4XMA A;  2J1E A;  4DEV A;  4W8J A;  3Q8C A;  2PHU A;  2NZ9 A;  5JR7 B;  5CB7 A;  4K21 A;  4BXF A;  3NAP B;  2KXL A;  3GDB A;  3ZIW A;  1U5Y A;  1AR6 1;  3SMH A;  3TEW A;  1QJY 3;  1N1T A;  4FT8 A;  3D82 A;  2A3W A;  3WP4 A;  3ZYP A;  1HRI 2;  4FI9 A;  1GFF 2;  2WAO A;  3T0A A;  3JU9 A;  3J7H A;  2WUH A;  1IZ3 A;  4FPC A;  3LEI A;  1O91 A;  4EN0 A;  1QDO A;  2VOX A;  5A3N A;  1YFW A;  3VKL A;  5C33 A;  1UKR A;  2P34 A;  1STM A;  3A23 A;  4I02 A;  4XPV A;  2OVU A;  3BKZ A;  4CDU C;  1A34 A;  4XJU A;  4Q4X 2;  4Y1X A;  3I7D A;  5FZK A;  2OUJ A;  5AFE A;  1VE0 A;  3DPR B;  1Q8P A;  2WZR 2;  1AVB A;  1AR7 2;  2YXS A;  4AFB A;  2GAU A;  1V9U 1;  1GZW A;  3CIH A;  1W8Z A;  1VBB 3;  2BU9 A;  2WFP A;  3HD8 B;  4LBQ B;  3WNO A;  1XNB A;  2JEN A;  3WF0 A;  1HKD A;  1AXK A;  3GHM A;  4H14 A;  5A7W A;  4M00 A;  5FYM A;  1CD3 G;  2D97 A;  2Y6H A;  3D0S A;  2ZA9 A;  4NO4 A;  5FZD A;  3VZN A;  4CDQ A;  2VJX A;  4XMI A;  1GP5 A;  1F8V A;  1ZBE 2;  2JE7 A;  2CDO A;  1WD3 A;  4FO9 A;  1PMI A;  3HPN A;  3WG4 A;  3BIE A;  1RUG 3;  3ZX7 A;  3FFQ A;  3W20 A;  5A3O A;  3N9Q A;  2ZHL A;  1DYP A;  2D6L X;  5LRR A;  3H7J A;  1C4R A;  4WM8 C;  3VZJ A;  3PUI A;  3C8X A;  3L2Y A;  1N3O A;  1AL2 2;  4R4Z A;  1QWR A;  3OBR A;  5CU1 A;  4MGT A;  4X8N A;  3VD3 A;  1XSR A;  2VOT A;  3WV6 A;  1JW6 A;  2BVV A;  2MEV 2;  5FYC A;  1YWK A;  4CU6 A;  2GNB A;  2F4L A;  4LBO A;  1K5M C;  3J7N A;  1O5L A;  3JBG 3;  5DAX A;  2P2K A;  3BN6 A;  4LE4 A;  5AVP A;  3SIS A;  5J48 A;  4LPL A;  5JLV A;  2JDM A;  3C2U A;  1NLR A;  3BU7 A;  3DYP A;  4XUR A;  1ODM A;  1ODN A;  4J6G A;  1O4Z A;  1OFS A;  1QQP 1;  4DY3 A;  5JOX A;  4MET A;  2FMD A;  2R0F A;  5FZL A;  2HWB 3;  4AED A;  4COY A;  1G9B A;  2ZGN A;  2DCT A;  2I2S A;  1UIK A;  5FMO S;  3KS7 A;  2BOI A;  3E6C C;  4RS5 C;  1W6N B;  5F5C A;  3THC A;  5CG8 A;  5HV4 A;  2WFF 1;  1LUL A;  2GSY A;  5FR3 A;  3OYW A;  5I91 A;  4HKW A;  1QXR A;  1W9W A;  2PAM A;  5LA0 A;  2HBU A;  3AVR A;  3GBW A;  3ILF A;  2CTV A;  4RQP A;  1OBN A;  1DQ2 A;  1XYP A;  1W6P A;  2HEW F;  3CZJ A;  1O6U A;  4OHV A;  5F5I A;  1VRH 3;  5GJ6 A;  3KD4 A;  1J83 A;  4OUL A;  3ZXL A;  3V0A A;  1CAV B;  2ERF A;  4UF0 B;  4UXA A;  5EYY A;  5A7O A;  2VCM A;  2GAL A;  1TME 1;  4B29 A;  1N47 A;  4YGC A;  1J59 A;  1LOC A;  2IXC A;  2W95 A;  4DXS A;  3ZIX A;  2XML A;  1X82 A;  4XXA A;  4XUN A;  3JD7 2;  3KT7 A;  2RS1 2;  1JOJ A;  2H0B A;  4JDO A;  2VME A;  3WHT A;  4RGK A;  4D7S A;  4RSU A;  5T54 A;  2J1U A;  4FOV A;  1OLR A;  4XAC A;  4OHZ A;  2YY1 A;  1LHV A;  3PNA A;  3VDD C;  4CDW A;  2WN2 A;  4BOW A;  1NZI A;  2B9V A;  3WY6 A;  1DQ0 A;  4Q4Y 3;  1HJF A;  1WKY A;  3IAQ A;  2PHX A;  1XC6 A;  4B7K A;  4CDX C;  3ECQ A;  4W6X A;  4YVW C;  4BQ4 A;  1DZQ A;  1Q8Q A;  3UET A;  4YGE A;  2VPV A;  1BK1 A;  4O61 A;  4KBZ A;  4AGV A;  4M3C B;  1PGL 2;  2V72 A;  4FXG B;  2W87 A;  1ASJ 3;  2VTX A;  2YDE A;  1RUI 3;  3N7J A;  3ABZ A;  2RS3 1;  4NII A;  2ARB A;  3WIN E;  5AC9 3;  1RUH 2;  5LA1 A;  1UOJ A;  5KBF A;  1M4W A;  1X8M A;  4R4X A;  2FZ1 A;  3VB9 A;  3FC0 A;  1ND2 B;  5FUN A;  2Z79 A;  3T2T A;  1PVC 3;  3IDB B;  3NV4 A;  2WIN B;  4A4A A;  1D2S A;  1X9T A;  3NJY A;  1OKO A;  1YCI A;  3MUY 1;  1D0G A;  5F1R A;  5JXJ A;  3QLQ A;  2ENR A;  4LLO A;  5A32 B;  4CP0 A;  3LDK A;  1PX3 A;  4PJY A;  5LBF A;  3RDI A;  3CJI C;  2RE9 A;  5ABJ C;  2GNM A;  3RZK A;  4N53 B;  1KFU L;  3PU3 A;  2R06 1;  3CKH A;  2Q30 A;  5LRS A;  1SBF A;  2BRT A;  4NHK A;  4XE9 A;  5IAT A;  4Q4W 2;  2Q8E A;  2BFU S;  2FZ2 A;  1RHI 2;  1DP0 A;  2C4X A;  4L0P A;  3HBK A;  3T4V A;  4QX5 A;  5CFD B;  3VLB B;  4PQ9 A;  4OI1 A;  2VU9 A;  1OF3 A;  1TNR A;  1LOA A;  1R1A 2;  1NY7 1;  4CCM A;  4ES9 A;  1O3T A;  2WO7 A;  1R09 1;  1NOV A;  3GZT B;  4JRA A;  2ZAH A;  3NL1 A;  3ZFF A;  4Y24 A;  2WQ8 A;  5FRE A;  5HXV A;  4D69 A;  1W8U A;  2CDP A;  3IPV A;  4LA2 A;  3JQX A;  1ZX5 A;  3ZSJ A;  2IFW A;  3POJ A;  1FPN 1;  1OPM A;  4RHV 3;  4GUL A;  3VZK A;  3WNK A;  4DUX A;  1K45 A;  3T1L A;  4HVQ A;  1C57 A;  4ET7 A;  3RWN A;  3ST7 A;  5BNO A;  2J1T A;  2GN3 A;  1ND3 B;  1CIY A;  1RUJ 3;  1KFX L;  1JOD A;  4AHY A;  1VIW B;  3BI3 A;  1CZT A;  1WGP A;  2EIG A;  2XJS A;  4TLG A;  4QQH A;  1A6C A;  2YYO A;  3ORJ A;  4OVE A;  2D44 A;  5IVV A;  4EV0 A;  4ONU A;  1UZ0 A;  4Y22 B;  4YM2 A;  5L36 A;  1FI2 A;  2XHN A;  5JI7 A;  1W90 A;  1RMU 1;  4B1M A;  2P3I A;  5BNN A;  3T0D A;  4AXO A;  1W8N A;  4YW3 A;  5LCW L;  4QKD A;  4YZ3 A;  1QNY A;  3J26 N;  4HPK A;  4UWD A;  3POB A;  1NLS A;  1MR5 A;  3CZU A;  1WLT A;  1CAW A;  4I0B A;  3ZKY A;  5J1X A;  4IV3 A;  2KM2 A;  2WQZ C;  4XCB A;  5I0R A;  4BWO A;  1AYM 2;  1UL9 A;  4P08 A;  4RFT 0;  3KSC A;  4LUM A;  2VVF A;  4CEY C;  1SMV A;  1CQ9 A;  1NCR C;  3QH7 A;  1JZ3 A;  1IKQ A;  1D0H A;  3O1M A;  2OUH A;  5GZD A;  1CR7 A;  1QJX 1;  2JJ6 A;  5FMB A;  4Z2W A;  2WYS A;  1AX2 A;  3E97 A;  3MO4 A;  5A3P A;  3W21 A;  4XFC A;  3FHA A;  1FMD 2;  3VBS B;  5DUW A;  4QPW A;  1J58 A;  4FTE A;  2RV9 A;  4AE2 A;  1ENX A;  4CCC A;  4Q8L A;  3LDB A;  3AFK A;  1N3P A;  1REF A;  1PO1 2;  1DGR N;  2DBI A;  3AZW A;  3ENR A;  2CL2 A;  4S2H A;  4PIZ A;  3BOP A;  2VL4 A;  2ZKL A;  1UOF A;  2XBO 3;  1HDK A;  1SQ4 A;  1ENQ A;  2ZZQ A;  3CEW A;  1HLC A;  1JS9 A;  1AHS A;  2VTX J;  1AL0 G;  2Y8K A;  4QX7 A;  1G7Y A;  3KVB A;  4TXW A;  1XNT A;  4M3C F;  5LEK A;  3VBH A;  1X9P A;  1W06 A;  1JXN A;  4XFF A;  5G05 L;  1IS4 A;  1DCS A;  1H2L A;  1W39 A;  4FPK A;  4HKL A;  5ISL A;  4YGD A;  1CPN A;  1W0O A;  4AAP A;  1KDK A;  1A8D A;  4ASK A;  4MGI E;  3SQO A;  3MIH A;  1KJR A;  3VBU B;  1WCS A;  3KGZ A;  2RDS A;  4CCO A;  4FTS A;  1F31 A;  3EBR A;  1UQX A;  2VBD A;  2PAK A;  1OD3 A;  1UCX A;  2JWP A;  3HOB A;  3SLI A;  2IXH A;  1KIT A;  2OII A;  2WAB A;  1SPP B;  4L9B A;  4AW7 A;  1VAK A;  1EV1 2;  1H2K A;  1V6K A;  3OF1 A;  4CU7 A;  3FBY A;  5GZG A;  2XR4 A;  4AGR A;  4R9C A;  2EIC A;  4OUM A;  4Q0U A;  4V1P A;  1UKG A;  1VAV A;  2B42 B;  3DPR C;  4QKB A;  3QH6 A;  2RMU 3;  1DU3 D;  5FXW A;  4CXW A;  4XIL A;  1LU2 A;  1K12 A;  4ZU4 A;  4PF1 A;  5JR2 A;  1S0E A;  2VAU A;  5FYH A;  1UYX A;  4PLN A;  3RFR A;  5JDB A;  2E9Q A;  4PBO A;  2SBA A;  1L3J A;  1TMF 3;  4CCJ A;  1LU1 A;  1PHM A;  1FV2 A;  4IV1 C;  1GNY A;  4HZF A;  2H6C A;  2NQY A;  4AVS A;  2RJ2 A;  3MF6 A;  3AMH A;  2ZGK A;  1W9T A;  5JXI A;  4BDV B;  2ZEW A;  4QQL A;  2UUR A;  3U0Z A;  1IS3 A;  4XC9 A;  4GMP 3;  2D40 A;  1RUE 2;  3POI A;  2UU8 A;  3TB0 A;  3WX5 A;  5IFT A;  5CKQ A;  3VDA A;  4A3Z A;  5EV7 A;  1HXS 3;  3VDB A;  3O5S A;  4N90 A;  3UKN A;  2A6X A;  4N9H A;  4ATF A;  1Z7S 2;  1AR9 1;  3UV9 A;  1AR8 3;  2HBT A;  1VBE 3;  3GGL A;  1TNF A;  3UJQ A;  4BLJ A;  3JQW A;  4IEU A;  1ZBA 2;  1WA4 A;  1C3H A;  1JI6 A;  4GH4 A;  4XXP A;  1V6L A;  1AYN 2;  2CYF A;  3ROU A;  3SCG A;  2XPJ A;  5DQ0 A;  1BBT 2;  5A1L A;  1CX1 A;  3ZFG B;  2C24 A;  2X5I B;  1HN1 A;  4J1W A;  4LOT A;  5GKA C;  4E4S A;  1XPW A;  2RG4 A;  2WA4 A;  5FYZ A;  2VZT A;  2G1M A;  3BTA A;  1MQT C;  2D7F A;  5JMO A;  4PCR A;  3S0M A;  4S2G A;  4NIH A;  4YPJ A;  3DKW A;  1W2T A;  2HLE A;  4N43 B;  3R4U A;  5A1A A;  2VUA A;  4UT5 A;  1PX4 A;  4AWD A;  3WR0 A;  3P1I A;  4DB5 A;  2IVJ A;  5IK4 A;  3ZSM A;  2XKP A;  3LIH A;  4QGL A;  2WNU A;  2ET7 A;  3M8L A;  1UAI A;  4UFJ A;  1WMF A;  5C8C B;  1W6Q B;  3RJ2 X;  2OZJ A;  3NNJ A;  3GHN A;  2OQ6 A;  2BV4 A;  3RVH A;  1LOF A;  1S0D A;  2PYT A;  3ILR A;  3FLP A;  2PHL A;  4YWA A;  3WVJ A;  1JUI A;  2E7A A;  2OA2 A;  4JGZ A;  5FIX A;  4YZ1 A;  1SHW B;  3OG2 A;  4LO6 B;  1OXC A;  5LW9 A;  3B7M A;  5IK7 A;  4FAH A;  3DKQ A;  5EWS A;  4NIA A;  3AP7 A;  2DFC A;  5CA6 A;  5BXX A;  1H8V A;  2E53 A;  1UZZ A;  2DCZ A;  4LBN A;  4OHY A;  1Y43 B;  2Q4S A;  3AMN A;  1RED A;  1M06 G;  5C3P A;  2JDU A;  3JZV A;  1RUG 1;  4HK8 A;  2ZBJ A;  3GAL A;  5DDJ 2;  3J9S A;  3H3L A;  1W8H A;  4X6R B;  1MEC 2;  5C4W B;  2PFW A;  4GJY A;  4JCK A;  2O8Q A;  3A22 A;  4WVV A;  4M0N A;  3OY8 B;  2GH8 A;  2HWD 3;  2VQA A;  2Y6L A;  3RWK X;  1POV 3;  3WQ0 A;  2IXL A;  4BXS V;  3UES A;  2BEO A;  3IDA A;  3MIG A;  1ND2 C;  1O59 A;  2XDV A;  3C3V A;  5ACA 2;  2VW0 A;  3DCQ A;  1WCD J;  5FPA A;  3I2F A;  3DXU A;  2CWS A;  1TG7 A;  1SFN A;  3AP9 A;  5DG1 A;  5H9P A;  4OHX A;  2E6V A;  4P9G A;  4XQW A;  1HX6 A;  4TSV A;  4CDU B;  2JDZ A;  2Y6F A;  4L11 A;  1AR6 2;  2HWB 1;  4N53 C;  3T1M A;  4COW A;  4FAG A;  4QPG C;  1AUY A;  4XF9 A;  4DXR A;  1VBD 3;  3EB7 A;  1H2M A;  2TNF A;  1XBF A;  2QE3 A;  3ACL A;  2X09 A;  3DUI A;  2QUO A;  1LED A;  1QKQ A;  1GOG A;  3O12 A;  1W05 A;  2GC3 A;  1RVF 1;  1XNK A;  2VUJ A;  4YW2 A;  1LB2 A;  5DAB A;  2JG9 B;  4CP2 A;  4CVU A;  1AXY A;  2O1Q A;  3TEY A;  2D5F A;  5FKB A;  2IXJ A;  3KHB A;  4XF4 A;  5K4L A;  3RI8 A;  3O0V A;  3CJX A;  5CG9 A;  3AVS A;  5GLU A;  1XQN A;  4MHU A;  5FZ4 A;  3VKN A;  1VRH 1;  1OF4 A;  1COV 1;  1IGO A;  3FLR A;  4Z82 A;  1T6B X;  3RJR A;  3CHX A;  4Y20 B;  1GP6 A;  4I3G A;  4K40 A;  3URF A;  1H2N A;  1OUX A;  2ZOE B;  4HSL A;  4TTG A;  4FPF A;  1V9U 2;  3HQR A;  3ES1 A;  4K20 A;  1WCQ A;  1YQC A;  4DFS A;  5KHK A;  3RI9 A;  2QQP A;  3E5U A;  3ZVX A;  4CTE A;  2DFB A;  3IMN A;  1CX4 A;  2Q1M A;  5ANN A;  1JYT A;  4AVV A;  4FP2 A;  5FZA A;  3O1U A;  4N7U A;  4Y33 A;  3DV8 A;  3KLS A;  1Z0H A;  4AOC A;  2VQU A;  2VNG A;  1OH4 A;  4XZU G;  2A5Z A;  2I45 A;  3UGF A;  3VBR A;  4QX0 A;  5FCC A;  3ZXA C;  1UMH A;  2QQI A;  3C7F A;  4LLF A;  2QTW B;  3HN3 A;  4XBQ A;  5HXM A;  4H55 A;  1GZT A;  4XET A;  2KD7 A;  4X6Q B;  4ATE A;  1RUD 1;  3WT3 A;  3JUU A;  1SZB A;  4UFM A;  2FDF A;  2E32 A;  1W8W A;  2GP5 A;  3LFI A;  2V4A A;  2FMY A;  2TBV A;  1Y9M A;  3DEC A;  4HK9 A;  5D8A C;  5CFC C;  1WW6 A;  3ZYI B;  3N3H A;  1PK6 A;  3KV6 A;  2DV9 A;  4B1L A;  1L7L A;  2D6N A;  4KMQ A;  2ZAA A;  3LD8 A;  5GZE A;  4XEZ A;  2IZW A;  5IUQ A;  5GZC A;  1QQP 2;  1PMJ X;  1SDD B;  4Q4V 3;  1YNA A;  4FPE A;  2FBE A;  1PVC 1;  5EYX A;  4BJ0 A;  5KXB A;  1PM4 A;  5A33 B;  1HRV 1;  1O8S A;  2HKX A;  1WLW A;  3C7G A;  2NMO A;  4P9X A;  4K1Z A;  2HWF 3;  3MBW A;  4QU2 A;  1YUD A;  5FBJ A;  2WFF 2;  2VUC A;  3WNM A;  1DGW X;  1BXH A;  3WNX A;  4Y4Y A;  1W6O B;  3OJB A;  3O1P A;  1J1T A;  2CY6 A;  2DUP A;  3BU0 A;  1VMJ A;  1V70 A;  3I3D A;  4LJH A;  5AFB A;  5A1F A;  1OLM A;  2K46 A;  2O0O A;  1W04 A;  1V6O A;  5DPN A;  5E1R A;  1OFN A;  3VDD B;  2J1R A;  2CWM A;  2WRA A;  1VBA 3;  5HCF A;  2IC1 A;  5LBC A;  3O0W A;  1QEX A;  1TME 2;  1DGW A;  3HVD A;  4RA0 A;  4ZS2 A;  4D7T A;  4CDX B;  3T30 A;  5J3U A;  5L7O A;  2JG8 C;  2BTV C;  3I3E A;  3LDR A;  1IHM A;  5FO9 B;  2XJQ A;  5C70 A;  2BQP A;  2QVS B;  1IPS A;  4YVS A;  3MLK A;  2GN7 A;  4P14 A;  2V4V A;  4YW5 A;  2W3J A;  2E31 A;  1G9A A;  4EE2 A;  3POG A;  2Y64 A;  3VBU C;  2HWC 3;  4UYB A;  2LTN A;  4JX0 A;  1QJF A;  1O8P A;  1OPO A;  1RUJ 1;  5JUV A;  3MLJ A;  1SLA A;  4FFI A;  3Q9O A;  2W46 A;  1ZRD A;  4FOW A;  2HEV F;  2YZ4 A;  5APA A;  4CEW B;  2DBN A;  2ZGS A;  2XJT A;  2ARA A;  2NYY A;  4NMI A;  1OOP A;  5FZ3 A;  5LB6 A;  1WLD A;  3N9M A;  5DN2 A;  4LUK A;  5C9A A;  1A8M A;  2RS3 2;  2YPJ A;  4NWV A;  5F6K A;  4XIO A;  4QD2 A;  4MGZ E;  4JGY A;  2VUD A;  2RR1 3;  3FBM A;  4EN9 B;  4P9J A;  5T3N A;  4LO8 A;  4D3W A;  1XSQ A;  1WBL A;  4XHB A;  4DEQ A;  3AL5 A;  2C6S A;  2ZX4 A;  3GZU C;  2R06 2;  3KB5 A;  1CES A;  4WVW A;  3IB3 A;  3WDY A;  1FV3 A;  1BEV 3;  2WSU A;  3ZMN A;  4IE0 A;  3VBO A;  1GBG A;  1YEW A;  2WNE A;  4XJ9 A;  3KHC A;  1JYX A;  2XGX A;  1QJU 1;  5T5O A;  3L2H A;  1SBD A;  1FNY A;  3HEI A;  2X10 A;  2ES3 A;  1D7P M;  4HKO A;  3NJX A;  1O4T A;  3GBG A;  1HRI 3;  1NY7 2;  3QD6 A;  2J22 A;  1LTE A;  1NCQ A;  3OB8 A;  2GMM A;  1SCS A;  1R09 2;  3MW3 A;  3AKR A;  4KU8 A;  5GAL A;  4AI9 A;  1MS5 A;  3AMQ A;  4QX3 A;  1MZF A;  4QDQ A;  2DU0 A;  1F5F A;  2ZEX A;  3V0B B;  3PUS A;  2N7G A;  5FZM A;  2OYZ A;  2YC4 A;  2XJR A;  3RZM A;  3MPB A;  1FPN 2;  3GF6 A;  2XQR A;  1N1V A;  5KC6 A;  4QXK A;  3IIA A;  3HQU A;  1CAU A;  4L92 A;  4OHW A;  3E1F 1;  4AQ2 A;  1DZT A;  2D3S A;  2ZEY A;  4U36 A;  3NV3 A;  3POY A;  1EAH 1;  1PZ7 A;  2PHT A;  4JQT A;  5A80 A;  5KHH A;  2DF7 A;  1YQ2 A;  4MGS A;  5JZG B;  3ZDS A;  4N43 C;  4O9E A;  3CF6 E;  4Q29 A;  3KCX A;  4FFG A;  3ACF A;  4W50 A;  1U0A A;  3GCW A;  1RMU 2;  2P3K A;  4C1W A;  3ALQ A;  4JKK A;  2VH9 A;  5T5L A;  1RJ8 A;  3EHK A;  1Q43 A;  4NPM A;  5FXZ A;  4NPR A;  5C8C C;  1GQG A;  1X36 A;  3ZXD A;  1JHJ A;  3JB4 C;  3VZO A;  4CU9 A;  1IKP A;  2GU9 A;  4ZHN A;  1GP4 A;  1AL2 3;  1W6M A;  2YRO A;  4XHX A;  2P1B A;  4GB3 3;  2RMU 1;  3D6E A;  2FCT A;  2YBP A;  4NRQ A;  4ZXK A;  1QJX 2;  3WDW A;  5FLJ A;  5FOJ B;  2WS9 3;  1GV9 A;  4CZS A;  1ENS A;  1GZC A;  1S1A A;  4FXK B;  1NXM A;  4YM1 A;  5I0S A;  3P3N A;  1D4M 3;  2QQM A;  4DRR A;  5KHI A;  1TMF 1;  5A6Y A;  4NWW A;  4NRP A;  2AC1 A;  2EIB A;  1CZS A;  2WT2 A;  3N7L A;  2YV8 A;  3K2O A;  4HN1 A;  4MHR A;  1LEM A;  2NN8 A;  4QXB A;  4QX8 A;  5C4W C;  1JUH A;  2OT7 A;  5C7G A;  1S0B A;  4OMC A;  3EQE A;  5DZF A;  5H9S A;  3LWC A;  4GMP 0;  2R30 A;  4CUA A;  1X7N A;  1CAX A;  4OLL A;  4GMP 1;  3CMG A;  1N1Y A;  1KS4 A;  2RDN A;  4MZU A;  5DAP A;  1JN2 P;  2VOK A;  4PQQ A;  2FDK A;  1HXS 1;  2XL7 A;  4RL7 A;  2ILM A;  5KHG A;  3PMS A;  1NKG A;  5FPU A;  3NNL A;  4LA3 A;  4E9K A;  5FO8 B;  3ZSK A;  5F7U A;  1AR8 1;  3ZMO A;  3CBN A;  1GAN A;  3O14 A;  4MXW A;  2ZGP A;  1S0J A;  2VMI A;  1HIX A;  4Q2F A;  3K3O A;  2ZXQ A;  3Q8A A;  3ZYG A;  2R16 A;  1KS5 A;  4MLO A;  3D8C A;  5FZO B;  5EP9 A;  5K8S A;  1NX9 A;  3JD7 3;  3H0O A;  3I59 A;  4IEW A;  4F7Z A;  1YFY A;  2JG9 C;  4Q0Q A;  1Y4W A;  1MVE A;  5FZO A;  2F6B A;  2R04 1;  1Q3E A;  1K3I A;  4DOU A;  1JHN A;  1JTZ X;  1O3Q A;  3M70 A;  3SH5 A;  3ZN4 A;  5FPX A;  5JI9 A;  4AFA A;  1JZ2 A;  3MW2 A;  5E6H A;  3BAL A;  4IV1 B;  4IEV A;  2QDN A;  3KT4 A;  2YC2 A;  3NJZ A;  4WM8 A;  5T52 A;  4GKY A;  4DO0 A;  2PA7 A;  1SLB A;  4IE6 A;  1XB9 A;  1ZZ9 A;  4JTN A;  3H7Y A;  2EXJ A;  1K5M A;  1RUH 3;  2PQS A;  2XJU A;  4QX1 A;  3T2Q A;  1CJD A;  4I0W B;  5L19 A;  4K7J A;  4NE9 A;  1XNC A;  4XUP A;  3K4Z A;  3V65 A;  4JZR A;  4RR3 B;  1WBF A;  3WQ7 A;  4DRV A;  3BTY A;  2MNG A;  1G9D A;  4AI0 A;  4GAL A;  4XAA A;  5DMY A;  2D6K A;  1JYW A;  3OBA A;  1QJE A;  5FZ1 A;  3VHO A;  3ES4 A;  1K5J A;  4AEK A;  5EFU A;  2WO1 A;  3FLT A;  4QHO A;  4AFC A;  4PI2 A;  4NJ4 A;  4YZ2 A;  2F17 A;  2G9F A;  3WSO A;  5JSO A;  4RS5 A;  1OA4 A;  1HQN A;  3ZN6 A;  1F5J A;  5F6L B;  1TE1 B;  2A6Y A;  2W94 A;  2Z2S B;  1QXP A;  2ZHM A;  4XFG A;  5CVR A;  4Q4W 3;  2Q0A A;  4CSW A;  1RUC 1;  1MQT B;  3ZOI A;  4CCN A;  3ETQ A;  1WD4 A;  4KG8 A;  3VKM A;  4D6R A;  1GOF A;  1UOG A;  2HWD 1;  4HN0 A;  4EYU A;  5HPO A;  1AR9 2;  2UWA A;  4DIQ A;  5IVC A;  1R1A 3;  5FZC A;  2D6O X;  2QQN A;  3W59 A;  4KBB A;  1GYK A;  2GND A;  3B3Q E;  2RS5 3;  1KQR A;  1RUF 1;  4BLI A;  2A6V A;  2EXI A;  1C5H A;  2PHF A;  1OUR A;  3K48 A;  5F2W A;  3WP6 A;  4AED C;  1WUV A;  1IG3 A;  3I4I A;  1YFU A;  3ZFE A;  2Q1Z B;  1DYK A;  1UY0 A;  3AP6 A;  3KV9 A;  4UOJ A;  5GLW A;  3LAG A;  4Y26 A;  3MEP A;  4AR2 A;  4C0B A;  2BGO A;  3MGU A;  4EN8 B;  1I9R A;  4HL0 A;  1JYC A;  1EPW A;  1PMH X;  3BPZ A;  3EYP A;  2XOM A;  1OA2 A;  3VBF A;  1US3 A;  5EHD A;  3LPF A;  3E6D A;  3H1Y A;  2GC0 A;  3NNG A;  3OUJ A;  2Z5W A;  4YVW A;  2WNU B;  1ULD A;  3E5X A;  1S0C A;  5A7Q A;  1B09 A;  4WZF A;  3ATG A;  2HEY F;  1CWP A;  4NUB A;  3BGA A;  1QGL A;  1URX A;  5K0U A;  5I0U A;  5FMC A;  1R64 A;  2ZPX A;  3KT1 A;  3VZM A;  4AHZ A;  3FJS A;  3AJY A;  2PMW B;  1QY4 A;  3RYR A;  3MI8 A;  3SCH A;  3LEG A;  1AYM 3;  1X33 A;  2I07 B;  4KU7 A;  4B3N A;  4PF5 A;  3NV1 A;  4PIX A;  4WM7 A;  3TAY A;  2YGL A;  2VY0 A;  4A42 A;  5H9Q A;  2DUR A;  3CJI A;  4CDW C;  4CEW C;  1RUG 2;  5ABJ A;  3VD9 A;  3M7A A;  4DUW A;  3KF3 A;  4Y1U A;  5FBZ A;  1H6X A;  1IQD C;  1V6J A;  4QPG B;  3L9J T;  4BU2 A;  3ILN A;  4GAZ A;  2IWG B;  2XUE A;  2YPD A;  3FHQ A;  2G9Z A;  2VM9 A;  1PNG A;  3LKJ A;  3PHM A;  1ZZ8 A;  1DFQ A;  1H1A A;  1SLL A;  4FPL A;  3UYJ A;  4ASM B;  4AVB A;  1E5I A;  2R07 3;  3I2K A;  1PO1 3;  4FCA A;  4BME A;  4ZKT B;  3LE0 A;  1W28 A;  2FDG A;  2HYK A;  3BOW A;  5IVJ A;  4RFR B;  4XYX A;  2QQJ A;  1JZ7 A;  1YI7 A;  1UPS A;  2BUK A;  2EF6 A;  3ZM8 A;  3VDC A;  2DCJ A;  2GMP A;  2HWB 2;  2VMF A;  3RPQ A;  2NLR A;  2RM2 1;  3ZN5 A;  4OI0 A;  4WVM B;  2WNV B;  4A3X A;  1NG0 A;  3HMY A;  1RVF 2;  4XTP A;  3GZA A;  5A7P A;  4LT5 A;  1W8O A;  1H9W A;  4KH9 A;  3WLU A;  2J1A A;  2VCB A;  4A6S A;  1GSL A;  1YXW A;  2QCS B;  2C1F A;  5FRA A;  1VRH 2;  3SKV A;  4CRQ A;  1COV 2;  3ZXF A;  5IT6 A;  1R08 3;  4N8M A;  5M0T A;  2ZX3 A;  4P9Y A;  1J1L A;  4TZD A;  1SEF A;  4XCA A;  2PAE A;  4PDW B;  5FP9 A;  3OSD A;  2UYB A;  3OPZ A;  3NWK A;  1KJL A;  2ARE A;  5DAQ A;  5FQ0 B;  1GQH A;  2LS6 A;  4BMB A;  1MZ5 A;  2W0X A;  3AJZ A;  3DYM A;  4QGM A;  1ULE A;  2EXK A;  4Q0P A;  5BPX A;  5CFC B;  1IS5 A;  3DYO A;  5D8A B;  4R8H A;  2YU1 A;  2XJP A;  3G7D A;  2ADD A;  1LGB A;  2C26 A;  2XQX A;  5KHJ A;  4CP9 A;  4CEY A;  4Y5S A;  4YNI A;  1NCR A;  3OTF A;  3W5M A;  1VBC 1;  1W2U A;  1V00 A;  1MZE A;  5JZG C;  5EPA A;  1UN1 A;  2HWC 1;  3IN9 A;  3B94 A;  4XDP A;  3FFZ A;  1S4C A;  1E57 A;  4WBB A;  4HMZ A;  5DZG A;  1RUD 2;  3G6J B;  3TEZ A;  2ZKN A;  4JQR A;  5A3W A;  3O7O A;  1I3H A;  5JCT A;  1QOS A;  3WOG A;  2NPI A;  4YM0 A;  3BPS A;  2ZGM A;  2ZML A;  1N1S A;  4NHX A;  1PIV 1;  4DUV A;  1ZVF A;  1PO2 3;  5BNP B;  2EVX A;  4OQ9 A;  2LRP A;  2C9A A;  2C0Z A;  4OMD A;  3LA3 A;  4UAP A;  5CAD A;  1HB3 A;  4PLM A;  5FDB A;  3QOP A;  4H3W A;  1ZZ7 A;  2OX0 A;  2V5Y A;  1SAC A;  1W3V A;  3P5B A;  1YYN A;  1MS1 A;  3PJQ A;  1HRV 2;  3KQ4 B;  4LBQ D;  2RR1 1;  3H3Z A;  2DCK A;  2OZ6 A;  2WO3 A;  3OOX A;  2V09 A;  1Z7S 3;  2VVE A;  1LKN A;  2JG8 B;  4IEX A;  1AF9 A;  2ZMN A;  3CU7 A;  1QOT A;  1UXX X;  5F2S A;  5L73 A;  3NAP A;  1YQ5 A;  1ZBA 3;  4MGK E;  3RZG A;  1W2O A;  1EUU A;  1AYN 3;  2ORX A;  1BEV 1;  5HCA A;  3FZ3 A;  4AG4 A;  1F15 A;  1DIW A;  1NA1 B;  1YI9 A;  3RMX A;  4AHW A;  2B39 A;  1XE8 A;  1UY2 A;  4IGO A;  1H6Y A;  4BYY A;  3ZO0 B;  2WZE A;  1PGW 1;  3TWI A;  1FX5 A;  3D4K A;  2PHD A;  5FZ6 A;  4R9B A;  3FUQ A;  3I8T A;  3KVA A;  1OUS A;  1VR3 A;  1ZA7 A;  1W9S A;  2JX9 A;  3VD4 A;  1HQL A;  2OS2 A;  4CYD A;  1CON A;  1NQD A;  1JYN A;  1ZZC A;  3ZYH A;  2FDH A;  4QQO A;  1J3Q A;  1O5U A;  5F37 A;  4AQT A;  4LTA A;  3WCS A;  3DPR A;  1F35 A;  2QJV A;  4L99 A;  5IVF A;  4CUG A;  4QPI B;  4LBQ A;  4IW3 A;  5EQU A;  1AX0 A;  1RIR A;  3DGT A;  3OGG A;  3VHR A;  3A0K A;  4UW3 A;  1PZ8 A;  3S57 A;  1UIJ A;  1GR3 A;  4EJR A;  2CSG A;  4LK6 A;  1S55 A;  2P3J A;  5F9T A;  5FWE A;  2KR2 A;  2JDN A;  4BZ4 A;  4Q0S A;  5DUU A;  1W99 A;  3S6P A;  2OQ7 A;  5JPN B;  4YM3 A;  5KWR A;  3A4U A;  3JCI A;  4JV4 A;  2E26 A;  4TLF A;  4FQZ A;  2JDK A;  3NKT A;  4HBN A;  4MAD A;  4MH0 E;  3Q8E A;  5DDJ 3;  3UK9 A;  5KC5 A;  5KXC A;  3K75 B;  2OPK A;  1OQ1 A;  4IGQ A;  4L8Q A;  2R32 A;  4C0H A;  2ZGO A;  1IQA A;  1D2Q A;  1I6X A;  1I5P A;  1CPM A;  4AVC A;  3SEE A;  1WME A;  1AL2 1;  4DPN A;  2VZS A;  2DVD A;  1W9Y A;  2ZMK A;  3V56 A;  4EQV A;  4EZH A;  1Q56 A;  1TZO A;  3WZ1 A;  4YLZ A;  4GB3 1;  1V6N A;  1WZX A;  3NMB A;  4RR3 C;  3J8F 3;  1ZZB A;  2B45 X;  5FYI A;  1B35 B;  1Q8S A;  1PNF A;  2WS9 1;  2VEC A;  3PDQ A;  4XAE A;  1H8T B;  4LBK A;  3WF1 A;  4A7K A;  5FY9 A;  4ES8 A;  5K9Y A;  3IDE A;  5BNQ A;  5F8P A;  4CA9 A;  3AP4 A;  3HAG A;  1D4M 1;  1QJU 2;  3KWV A;  3PU8 A;  3WDU A;  4AFM A;  3A7Q A;  1AR6 3;  1W6N A;  5FY4 A;  2VCC A;  4YSF A;  1BJQ A;  2PXJ A;  1UU6 A;  3VL8 A;  4CXY A;  3JB8 A;  3FE5 A;  1CGP A;  4G9S B;  3LF7 A;  1QJY 1;  1HB4 A;  2C5D A;  1SFP A;  3ACH A;  4JDN A;  3THT A;  1JZ4 A;  2VNR A;  3SCF A;  1OLM E;  3RQ0 A;  4BQY A;  2X8K A;  2H0V A;  2VZV A;  1C28 A;  1ULO A;  1VAM A;  3AYC A;  4UW5 A;  3TN9 3;  3M3I A;  1UMZ A;  1F4A A;  1CAV A;  4UF0 A;  1ZYB A;  4CU8 A;  3RYK A;  1S2K A;  3KM5 A;  1GZ9 A;  4IL7 A;  2Y0I A;  2J1S A;  4MVT A;  1J84 A;  4P5H A;  4A6O A;  5C5U A;  5EJ3 A;  3A0N A;  3MID A;  1QMJ A;  3ZPY A;  4AFD A;  1OLQ A;  1EAH 2;  1UXZ A;  2ZGQ A;  1ZZ6 A;  4GWM A;  4QHZ A;  5GLZ A;  1WCU A;  3SNM A;  3BOD A;  1J3R A;  2A3Y A;  4IEP A;  4MO3 M;  1VBB 1;  3JD7 1;  3LQC A;  4NVP A;  2GDF A;  5GZF A;  5J7M A;  4JKM A;  5I0T A;  2BJS A;  2B4K A;  5L9R A;  3N7M A;  4AVT A;  4DZG A;  2WNU C;  2O8O A;  1UYZ A;  4LO7 A;  1WCK A;  3USU B;  4M3C A;  4XF0 A;  3B93 A;  3ZYR A;  2W39 A;  2FCU A;  2WN3 A;  2A3X A;  1CJP A;  3LIG A;  4QB2 A;  2RMU 2;  1BKZ A;  1NQJ A;  3IM0 A;  5JWP A;  1LOF C;  4GA9 A;  2G19 A;  1A3K A;  5F5A A;  1ND2 A;  5JOZ A;  2FD8 A;  1RUO A;  1XU1 A;  1LEC A;  3N36 A;  3Q8F A;  4JGZ C;  5FP8 A;  1YLL A;  3SXW A;  3I2O A;  1SLI A;  1JOB A;  4CCE A;  2BWC A;  5FK8 A;  2WC2 A;  3JBG 1;  3BUC A;  5A32 A;  4LBL A;  5G04 L;  3R6S A;  2P17 A;  1TMF 2;  4I01 A;  4WVZ A;  2JDA A;  4CCK A;  1JMU B;  1UWW A;  5FY5 A;  4D0Q A;  1OT5 A;  4N53 A;  4Y5Z 0;  5LEJ A;  2VG9 A;  5A3U A;  3DXT A;  2BW8 A;  1IPJ A;  1LRH A;  3I54 A;  1V0A A;  3QAC A;  5H9R A;  1UX6 A;  5A6X A;  2HYX A;  2CGO A;  4HVO A;  4IDZ A;  2CAU A;  2XB6 C;  3LSE A;  1VB2 A;  3B9C A;  5FK7 A;  1UF2 C;  4HET A;  5CFD A;  1OMI A;  5FY0 A;  3HWJ A;  4XQ4 A;  4HAN A;  1EYB A;  1HXS 2;  1FAT A;  3LOI A;  4XDQ A;  3ITQ A;  4OI2 A;  2RDR A;  2AR6 A;  3LA2 A;  2W1W A;  4V2W A;  4G4F A;  1AR8 2;  3HT2 A;  3J4U H;  1TME 3;  1HV1 A;  5IHR A;  3I2J A;  5AVA A;  2RS5 1;  1OC1 A;  2WNV C;  2D43 A;  3EMR A;  3ZXE A;  3THP A;  2R0H A;  4Q0V A;  2EAK A;  1U5Z A;  4ORF A;  1GNH A;  1GZW B;  5LK5 A;  5ERL A;  1ND3 A;  3WNL A;  2UWC A;  2R04 2;  3F2Z A;  2GC2 A;  2Y33 A;  4Q1P A;  2HWE 3;  4KG0 A;  5A7W B;  3H9A A;  5DAW A;  3FWE A;  2VZQ A;  4FPO B;  4RN5 A;  2WT1 A;  1GWM A;  2DCY A;  4JAA A;  4XJW A;  4CDQ B;  3RZL A;  5J37 A;  4LKF A;  3FUO A;  4PDW C;  1L7R A;  2AZ5 A;  1AXZ A;  4Y22 A;  3MW4 A;  4Q4Y 1;  4URA A;  3WF2 A;  4IQP A;  1RIT A;  4HLT A;  2PN5 A;  5F39 A;  3M4F A;  5F3I A;  3EO6 A;  1GUI A;  3EXU A;  1RC6 A;  2A70 A;  2BGC A;  2VZ3 A;  5FUP A;  4JKL A;  4XOG A;  2XON A;  2ZZJ A;  1Z78 A;  2JD9 A;  5CIR A;  4IGP A;  1ASJ 1;  3H8O A;  1RUI 1;  2W1Q A;  4K3U A;  5AC9 1;  5FJH A;  5C5T A;  3RZH A;  1LJ7 A;  3AKQ A;  2LRO A;  4AL9 A;  5JOY A;  2PLV 3;  1HB2 A;  3NW4 A;  1LOE A;  1ZRI A;  1ULF A;  1S2B A;  1YRZ A;  2ID4 A;  4SBV A;  4UBH A;  4AAX A;  4BCU A;  2UWB A;  3F95 A;  4HT1 T;  4YAR A;  3W58 A;  1ZRE A;  3ZXJ A;  4I09 A;  4AED B;  4NHY A;  1UMI A;  3M3C A;  4COV A;  4Z2A A;  3KF5 A;  3VBS A;  1RUC 2;  3AYD A;  4QHB A;  2AH2 A;  1X50 A;  2RJL A;  5BNP C;  1RTV A;  1HW5 A;  5IVE A;  2HWD 2;  3VKO A;  5E16 A;  4O65 A;  3TNQ A;  3M3E A;  3OYW B;  4BQ5 A;  3N9O A;  1XYO A;  4M01 A;  3UL2 A;  2VC9 A;  2R07 1;  1L7Q A;  3OPT A;  1LOB A;  2L9L A;  2YBS A;  1R09 3;  4RQP B;  1W6P B;  3WHU A;  3BTX A;  1LAJ A;  1RUF 2;  3ZDV A;  3J7L A;  2VE1 A;  1VRB A;  1XJA A;  3V0A B;  3UGH A;  1UY4 A;  1ONA A;  2A7A A;  5A6Z A;  5FJK A;  1WLC A;  2VUL A;  4GIQ A;  2IXK A;  3WG2 A;  2K2S A;  1EPZ A;  1C8M 3;  4MG2 A;  4DS0 A;  1BK0 A;  1UZW A;  4RHV 1;  3VBU A;  1RYY A;  1OH3 A;  1NA1 C;  1YO8 A;  2FQP A;  4F3J A;  3D0J A;  3O0X A;  1UY1 A;  4QKN A;  1BVP 1;  5BUV A;  3MF9 A;  5FMD A;  5FO7 B;  4CDW B;  3IKW A;  2WT0 A;  1R08 1;  5DUV A;  3FMG A;  1JU3 A;  1NLQ A;  2W9X A;  3TOJ A;  1SPP A;  3UGG A;  5F5Q A;  2WII B;  5LAS A;  1FT9 A;  5FZF A;  3I3B A;  2ZX2 A;  1POQ A;  3A21 A;  4JC1 A;  4NR1 A;  3WUD A;  4LKD A;  4Q1R A;  4UFH A;  1BLZ A;  1KXG A;  2VNO A;  4W4Z A;  4HXC A;  3WNN A;  2ZTN A;  5FZ7 A;  5IW0 A;  5EIY B;  1H30 A;  4QPI C;  1H4G A;  1O7F A;  2VMG A;  5FPV A;  1BYH A;  4IER A;  1LHN A;  2WZP P;  1C5I A;  1GIC A;  2Q8D A;  5I8Y A;  4ISQ A;  1MAC A;  2VZR A;  3K51 A;  5DUX A;  5CKN A;  3MUZ 1;  3W9A A;  3WF4 A;  4KL1 A;  3BVC A;  1S0G A;  3CLP A;  2QKD A;  4BHP A;  1QH6 A;  1FOD 3;  4UI9 L;  1DG6 A;  1RJ7 A;  5CBL A;  1YJK A;  5BV6 A;  4O9G A;  1NUK A;  2Y38 A;  4HOO A;  4E4D X;  5JMC A;  3GBF A;  2IUW A;  2D6M A;  5FYV A;  5T5P A;  4E2Q A;  4BQ1 A;  3H3U A;  1MZ6 A;  3NQH A;  5FY8 A;  4C90 A;  1DGL A;  2E33 A;  4XJ8 A;  1PO2 1;  3TNP B;  3VV1 A;  4LQR A;  3HBZ A;  3UT0 A;  3TRS B;  4E4H A;  5D1I A;  3AMP A;  5J96 B;  4JGY C;  3MIB A;  2Y6G A;  3OD0 A;  5GLT A;  2DUO A;  4BH9 A;  2ZX1 A;  4UBG A;  2XBO 1;  2Y34 A;  3H42 B;  2RM2 2;  1DQ5 A;  4XBL A;  1B35 C;  1UU5 A;  4S2D A;  5C71 A;  1H8T C;  3MZH A;  1W9F A;  2ZHN A;  3ZFF B;  4Y5T A;  3AMM A;  1ULG A;  2ZAC A;  4BK4 A;  3GNE A;  1KD7 A;  2CNA A;  1XND A;  4IE7 A;  3ZFG A;  3IPV B;  3M3Q A;  4Q4X 3;  5A3M A;  2X5I A;  2E63 A;  1AYN 1;  2WZR 3;  1QXJ A;  1AR7 3;  3B9I A;  4MSV A;  2Z69 A;  1E5H A;  1NZC A;  3ZLI A;  4XFI A;  3LCP A;  3ZSL A;  3N35 A;  3I3M A;  5BNO B;  4N43 A;  3ETP A;  4KNC A;  1UZY A;  3AYA A;  4E27 A;  3CO2 A;  2AUY A;  1NCQ C;  4OZX A;  4B4P A;  2ZX0 A;  4I3P A;  3O1R A;  3I49 A;  3C7E A;  3AL6 A;  3MV1 1;  2XLF A;  1ZBE 3;  5EZW A;  5CZK A;  5LA2 A;  3NKG A;  2W91 A;  4MXV A;  2AEN A;  5C8C A;  1W6Q A;  2CGP A;  3B02 A;  2XHK A;  2WL1 A;  5BNN B;  4FFF A;  2VW1 A;  3ME2 A;  1NXD 1;  4ASL A;  1ST8 A;  4NPL A;  1XRU A;  3EJK A;  4HPK B;  2AEY A;  1VBC 2;  5FPZ A;  2J42 A;  1CAW B;  5EJ1 B;  4COU A;  2EIE A;  2MEV 3;  4IV3 B;  5JXG A;  2HWC 2;  2Y60 A;  3PVB B;  2LAL A;  5IYY A;  1MS3 A;  2WWS A;  2B5H A;  2VMD A;  1C1L A;  2X29 A;  5DXD A;  1NE4 A;  5GLV A;  3RYP A;  1SDW A;  1VJ2 A;  1PIV 2;  2R49 A;  3M2M A;  5B2G B;  4HON A;  3UKV A;  4QB6 A;  4M4P A;  5C4W A;  3RGB A;  2BDR A;  1BZW A;  4MX3 A;  1SBE A;  5FYS A;  2VZU A;  3VD7 A;  2AEZ A;  2ZGU A;  3OY8 A;  1KGY A;  2JDH A;  2BBV A;  3AZV A;  2TEP A;  5HCB A;  4XFA A;  3RNS A;  4CPB D;  1H9P A;  4XDO A;  1FYU A;  1WA6 X;  3HR9 A;  1AR9 3;  2OW4 A;  2QDR A;  4L97 A;  5A70 A;  3MLL A;  1AX1 A;  4P5Y A;  4TWT A;  3J8F 1;  1LOG A;  3WP5 A;  4CDU A;  4CP1 A;  1BEV 2;  4A2U A;  1VBE 1;  4BM8 A;  2VOW A;  2VBP A;  3VBH B;  3OUI A;  1IS6 A;  1YJL A;  1XYN A;  4I30 A;  2WNO A;  3PUH A;  4LMF A;  4XFH A;  2R7E B;  2B9U A;  1UOB A;  1LNS A;  1QJZ A;  2Z4F A;  5LA9 A;  3QCW A;  3RG0 A;  2RS1 3;  2JG9 A;  3RSJ A;  1PGW 2;  4Z92 B;  1NAE A;  1V6M A;  4B4R A;  3AKS A;  5HCH A;  3WDX A;  2CAV A;  4JHZ A;  3X29 B;  1AZD A;  4D6S A;  1US2 A;  4K6B A;  5B4N A;  3TN9 1;  1VP6 A;  2W92 A;  2A6Z A;  3OBT A;  4MYE A;  4Y20 A;  4AHX A;  4EN7 B;  3RMY A;  4CPB A;  2VXJ A;  3AZZ A;  3I2H A;  3VHP A;  4K9S A;  5F3E A;  2JDY A;  3WEZ A;  1NT0 A;  1U5I A;  3U10 A;  4ZXE A;  4SLI A;  5FPB A;  2E7T A;  2D3P A;  2VNV A;  5FP4 A;  1P8J A;  1Q8V A;  2JEC A;  4IE4 A;  3HIF A;  3WXP A;  4BQX A;  3PTR B;  4N9I A;  1D4V B;  1E5S A;  1OQE A;  5T55 A;  3GM8 A;  3ZKU A;  4E2S A;  3PIJ A;  4YW1 A;  1UPI A;  3KCC A;  4UW4 A;  3WDT A;  2WSV A;  3BIW E;  4LHN A;  4FFH A;  4CDQ C;  4YGB A;  5JIA A;  2W5F A;  4YZ4 A;  1PGS A;  1WMD A;  2D93 A;  1OI6 A;  5LAT A;  5FFO C;  1XE7 A;  5LY2 A;  5FYB A;  2ATF A;  1C1F A;  2DTY A;  4LBJ A;  4K8R B;  4I2O A;  2G9G A;  1VAL A;  1O3R A;  2QFE A;  4PBP A;  2PHR A;  1RHI 3;  4GB3 2;  4HFS A;  5F3G A;  2XXZ A;  1QHD A;  1POV 0;  4DNY A;  3KZ4 C;  1POV 1;  3O1S A;  4IEZ A;  2B8M A;  3LGR A;  2WS9 2;  2DVG A;  2VD7 A;  2X53 S;  1BMV 1;  3ZYF A;  5A33 A;  1GNZ A;  4QM9 A;  2V73 A;  3CNA A;  4GD4 A;  1D4M 2;  1X8E A;  3WW4 A;  4XF3 A;  3OGV A;  3T09 A;  5FZE A;  4IEQ A;  1YFX A;  3S5A A;  4JTO A;  5IVB A;  1N3Q A;  5L9B A;  1G8W A;  2VZP A;  5FY7 A;  4GH4 B;  3AFG A;  1W6O A;  1YIF A;  4PLO A;  5FV3 A;  2Q5T A;  1XU2 A;  3TYJ A;  1QJY 2;  2XG3 A;  1RVF 3;  1SG3 A;  1VBD 1;  1W8T A;  2B46 X;  1BVV A;  3WG3 A;  1T6G C;  3H8U A;  1JU4 A;  4AQS A;  3KQR A;  4XW3 A;  3VDD A;  1OVS A;  5FYT A;  5F32 A;  4Y1Z A;  5HBA A;  4C1X A;  2RDQ A;  4R9D A;  3III A;  1COV 3;  4RQP C;  4BQ2 A;  2WJS A;  2XLG A;  1LCL A;  1EP0 A;  3MIC A;  4CDX A;  4QU1 A;  2WLQ A;  3WQB A;  1DLC A;  2YU2 A;  4GZ9 A;  3UJO A;  3M1H A;  2EAA A;  4KQ7 A;  2NMN A;  1W0P A;  2QBX A;  2Y26 A;  3AB0 A;  3OEA A;  4BB3 A;  3ZFE C;  4Q27 A;  4F83 A;  4LHS A;  1VBB 2;  1OHF A;  4D8M A;  2K9Z A;  2VXR A;  4JGZ B;  5C3S A;  3T2O A;  1LOD A;  2P6H A;  1RIN A;  2JKB A;  4KGG A;  3RZJ A;  2YG0 A;  1SLT A;  4ARY A;  2HWE 1;  3HQX A;  3MFA A;  5JSP A;  3NST A;  2P3Y A;  4CEW A;  2Q1F A;  1VPH A;  1TQ5 A;  1GWK A;  4P9I A;  3VBF C;  2VCA A;  4S2F A;  1RUD 3;  3OGS A;  3U11 A;  1O3S A;  3LZZ A;  1F2N A;  3N9N A;  1F9K A;  3U75 A;  1I1E A;  1ZRC A;  1SCR A;  4UFK A;  4NAO A;  1S2E A;  2DVF A;  2TUN A;  1FMD 3;  4A7Z A;  2OPW A;  1Y7B A;  2W68 A;  2VO5 A;  2Y6K A;  4YW6 A;  5CKM A;  1DYO A;  4FBF A;  2XKO A;  3IZO A;  3POF A;  2ZAB A;  4Q8K A;  5K0U C;  5IK5 A;  4IUG A;  2Z42 A;  3OEB A;  4GWN A;  3JBG 2;  4UFL A;  5EXO A;  5JVV A;  5FOB B;  3E6B A;  3AX4 A;  3J7M A;  3KV5 A;  4ZZ8 A;  1HRV 3;  4GWI A;  1UYY A;  3T4H B;  4OUS A;  4O7X A;  2ARX A;  2PLV 1;  4Q4V 1;  3OPW A;  4WM7 C;  5FTT C;  5C8W A;  2MHF A;  3CDZ B;  3AM2 A;  4LKE A;  2ZCW A;  3MYX A;  3LOB A;  4Y1V A;  3CQO A;  4V2V A;  4YYO A;  1Q5O A;  3MIE A;  3AYE A;  4NAM A;  4UW6 A;  2HWF 1;  2P5B A;  2MPF A;  3PUR A;  3NO8 A;  3N4M A;  5LBB A;  2QQU A;  3OGR A;  3ZPO A;  4QDS A;  1QF3 A;  4URT A;  1OSG A;  2CU5 A;  1AJO A;  3AKP A;  5DAV A;  5J09 A;  1DQ1 A;  4KWU A;  3SKJ E;  3RRD A;  2JIG A;  4B7E A;  1BHG A;  4QXC A;  5I8T A;  2WDB A;  4KGQ A;  1UY3 A;  4YG6 A;  3GJA A;  4P9W A;  5FZ0 A;  2RS5 2;  1VBA 1;  3K4A A;  4KI5 M;  5FZH A;  4YFZ A;  3V0B A;  1VLN A;  5IJR A;  1JBC A;  1RGS A;  1ZM1 A;  2BER A;  3LB9 A;  3HNM A;  1EV1 3;  3I2I A;  1AJK A;  3ZFF C;  1OA3 A;  4IE5 A;  1ULC A;  4LOR A;  2VTF A;  1OKQ A;  3AXD A;  3IBM A;  4Y1Y A;  4AZZ A;  2DUQ A;  4TN7 A;  3APB A;  3INA A;  3H1M A;  4QWN A;  1MPX A;  1VMF A;  5JSR A;  3THD A;  2JD4 A;  1C8M 1;  5ANQ A;  2WBK A;  4Z1V A;  5JZG A;  3B00 A;  3VKF C;  1UYP A;  2W08 A;  5BNO C;  4FP3 A;  4HVR A;  3M3O A;  1KDM A;  4J1X A;  3PIG A;  3MV0 1;  4Q4Y 2;  3VBR B;  4ZZ5 A;  1GWL A;  1PVX A;  2JE9 A;  2HH9 A;  3VD5 A;  3ACI A;  2GNT A;  4P02 B;  2AAC A;  3HNB M;  3RS6 A;  5CEH A;  4XJA A;  2W47 A;  2JIC A;  2UY8 A;  1UNB A;  3POS A;  4BK5 A;  1DBN A;  2YUE A;  3TBD A;  4OQ8 A;  3OGJ A;  5BNN C;  3IMM A;  1ASJ 2;  1DQ4 A;  1RUI 2;  4RGG A;  4M3C E;  5AC9 2;  4EZ4 A;  5EJZ B;  3S30 A;  4QB1 A;  1PK6 B;  5FXX A;  2VZO A;  1PVC 2;  5F3C A;  2XVL A;  2W2I A;  4IV3 C;  4LO5 B;  3UKT A;  1RUE 3;  3Q8B A;  2VGD A;  3HNY M;  4EWD A;  2ZGL A;  1W8F A;  2UYA A;  2FDJ A;  3SEP A;  1XE0 A;  1GKB A;  3KV4 A;  2BGP A;  4FOY A;  1YQ6 A;  3HT1 A;  1EY2 A;  1G6N A;  4IES A;  1FOD 1;  3ASI A;  4Y4R A;  1NYW A;  3WD5 A;  1QJU 3;  2RJK A;  3BTZ A;  4XQD A;  4FPJ A;  2YFZ A;  2ZHK A;  1BBT 3;  1DZR A;  4X8P A;  2JE8 A;  3SIT A;  4BPZ A;  4CXX A;  4RYD A;  2XJV A;  1O4Y A;  2ZEZ A;  5JIU A;  4AI2 A;  4NN0 A;  2R07 2;  5DG2 A;  2ARC A;  4AEM A;  4LNV A;  2BVB A;  1LGN A;  3R0R A;  4FQ4 A;  4P9L A;  1HRI 1;  3WNP A;  2YB7 A;  4HSJ A;  2YBK A;  4Z07 A;  3IWZ A;  3N9L A;  3OUH A;  2V5D A;  5L7O B;  1FNZ A;  1Y9G A;  1JH5 A;  2WLP A;  5K7P A;  4DXZ A;  1W0N A;  2J7M A;  4DIN B;  2ZGT A;  4LIT A;  3NAP C;  3K3N A;  4RHV 2;  3VBH C;  4YVS B;  1JZ5 A;  1CZV A;  1DLL A;  4Y3O A;  1EAH 3;  4Q4X 1;  1DGR A;  2EXH A;  3PVN A;  3AP5 A;  3IDC B;  5FPL A;  4R9A A;  2A71 A;  3BB6 A;  1LEN A;  2QZ3 A;  2WZR 1;  1AR7 1;  1RUJ 2;  2WWU A;  2BZD A;  3MFC A;  3PUQ A;  4NOT A;  4WZC A;  2W1S A;  5IAV A;  4AI1 A;  5L9V A;  1R08 2;  2QZ2 A;  3QBQ A;  1MS0 A;  2D5H A;  1WWY A;  1XNA A;  1FAY A;  2VMH A;  4IV1 A;  4NRM A;  3K77 A;  5FP3 A;  1OOP B;  1ZBE 1;  2ET1 A;  2YHJ A;  4MGQ A;  3VZL A;  4C91 A;  2JB4 A;  2XUM A;  1ZNP A;  3O1O A;  3VN4 A;  5C9A B;  1E5R A;  3LA7 A;  2FDI A;  2P6C A;  4OI4 A;  2R1B A;  1QIQ A;  4XTM A;  1MEC 3;  1LES A;  1W2N A;  4ZU5 A;  3T3Y A;  2A75 A;  1Q8O A;  5LZ6 A;  2OXB A;  1A78 A;  5A3L A;  2PHW A;  4JGY B;  2X05 A;  1DF0 A;  1F4H A;  1XOY A;  3MDP A;  2CHH A;  2ZJC A;  3DN7 A;  1W2A X;  4RR3 A;  4QAW A;  2MEV 1;  1ZRR A;  3P3P A;  5FZ9 A;  2D6P A;  2F4P A;  4J25 A;  5ACA 3;  3ZXG A;  4BIO A;  3C7O A;  3U14 A;  4CE8 A;  2CV6 A;  1Y3T A;  4PHZ A;  3O1V A;  3ZXK A;  2BYV E;  3WDV A;  3CL1 A;  5FYU A;  4COZ A;  2D3R A;  2QQO A;  1V6I A;  1QU0 A;  3I97 A;  1PO2 2;  3ELN A;  3H50 A;  3POW A;  3VBO B;  1DHK B;  4JHT A;  4LEJ A;  1QDC A;  2R1D A;  3GCX A;  4N7I A;  5KXE A;  1MQT A;  4FTB A;  3UNP A;  1CVN A;  2LW8 A;  4IEO A;  5C3Q A;  2BPA 2;  1XXN A;  5SV5 A;  5KXD A;  5C3R A;  2BWA A;  4MGY E;  4FPG A;  2GZW A;  4PT6 A;  4F8A A;  3B5L B;  2XBO 2;  1NCQ B;  1OQD A;  1H1I A;  3TEX A;  4BA6 A;  2BNN A;  1H1M A;  4MOA A;  4C8D A;  3KGL A;  1S0F A;  2DTW A;  3MIF A;  2WAA A;  4XUO A;  3PVE A;  3WQ1 A;  4LIU A;  3B01 A;  4ERO A;  2JKX A;  4ZS3 A;  1QNW A;  1UZV A;  3AKT A;  1LHO A;  1PZ9 A;  1V9U 3;  4GH4 C;  1CAU B;  5FXV A;  3NVC A;  1GOH A;  4LHK A;  3WCR A;  3U07 A;  2A73 B;  2R04 3;  2EID A;  2RS1 1;  4DY5 A;  1WW7 A;  4L2N A;  4ARX A;  4NID A;  2DVB A;  4MUV A;  4QPY A;  5FAX A;  3R4D B;  5E89 A;  5FY1 A;  4CCD A;  3SH3 A;  3NJV A;  4XIK A;  4H2A A;  1OVP A;  2C9K A;  1CIW A;  5T50 A;  5JAX A;  1JOP A;  4YRD A;  4JDM A;  3WW2 A;  1PGL 1;  3PME A;  4RD7 A;  2WR9 A;  5LWB A;  1W6M B;  2WYF A;  2HJI A;  5JPM B;  2DDU A;  4BQ3 A;  1KEX A;  3B69 A;  1RUH 1;  4Q26 A;  2BNM A;  4LUL A;  1QQP 3;  2BBA A;  5CYY A;  4LOS A;  1UX7 A;  5LY1 A;  1MS9 A;  4GWJ A;  1ALY A;  5A7S A;  4RGA A;  2Q8C A;  3VL9 A;  3POE A;  4QPG A;  4QQP A;  2PTM A;  4DMI A;  2GME A;  4H7L A;  2NM1 A;  2WFF 3;  1RUC 3;  4NRO A;  3LEM A;  4P00 B;  4LO4 B;  4LHL A;  4LKS A;  4QX2 A;  1BQP A;  2FHR A;  3N9P A;  1IG0 A;  2VR4 A;  1R1Z A;  1ZA4 A;  4UFI A;  4CUC A;  4Q4W 1;  3WW3 A;  1Y9Q A;  2G4I A;  1HB1 A;  2DWR A;  1RHI 1;  3LEK A;  1GLH A;  5FZI A;  4QXH A;  1CAX B;  3NNM A;  4LR4 A;  3J8F 2;  4TYS A;  1EUT A;  1LHW A;  1RUF 3;  1DDL A;  2QNK A;  1VBE 2;  1R1A 1;  1YIP A;  2ZS6 B;  3JXS A;  3HN1 A;  4WVM A;  4GKX A;  2RVA A;  2WNV A;  4XJZ A;  1TVG A;  1GQP A;  3LPG A;  4MXW B;  1MS4 A;  1RXF A;  1ZRF A;  3ZYJ B;  5FP7 A;  4AK3 A;  4FVV A;  4Q5O A;  4U2A A;  4LBM A;  4XAB A;  1T2X A;  5E88 A;  5D2A A;  5FUI A;  2Q8O A;  3FL7 A;  5TSW A;  4GJZ A;  4QT6 A;  2LUW A;  3I59 B;  4K8F A;  5CFD C;  1MVQ A;  2PEL A;  2XWB B;  3OBZ A;  4XBN A;  2P37 A;  2WWJ A;  5B4X A;  4PDW A;  3TN9 2;  4AQ6 A;  4BE3 A;  4D6Q A;  2ORZ A;  4OCT A;  4XFB A;  5A3T A;  2QQV A;  5C6C A;  1JYI A;  5FQ0 A;  1UO9 A;  4ZU7 A;  1QH7 A;  2IFR A;  3PL0 A;  3WP3 A;  5I0D A;  4JRL A;  4WM8 B;  5CFC A;  1UW8 A;  4QDR A;  3FX3 A;  4E2G A;  5D8A A;  4KWK A;  2QQL A;  2RS3 3;  2FCV A;  1RL3 A;  3AC0 A;  4G3Y C;  4OYU A;  5CAZ A;  3I3Q A;  2ETE A;  1G9C A;  4BQW A;  1K5M B;  2YC0 A;  4OZO A;  5FMO L;  5LBE A;  5JXH A;  2JDP A;  1ACC A;  1IOA A;  1ND3 C;  2DYC A;  2PQQ A;  2XWJ B;  1SFY A;  2VBB A;  4YG3 A;  1AYM 1;  3U78 A;  3OD4 A;  4ITC A;  4ZON A;  2XL9 A;  4LE3 A;  5GM0 A;  3VBR C;  4DXT A;  2AYH A;  4LK7 A;  5D21 A;  4NHM A;  3K46 A;  5I8S A;  1VMH A;  2R06 3;  3D3A A;  5A6Q A;  2SLI A;  2QQW A;  2A6W A;  4DQA A;  5LK7 B;  4QGN A;  4RS5 B;  5BNP A;  2XLA A;  5JOW A;  2LM3 A;  4ZY9 A;  3ZN6 B;  1JYV A;  2GH2 A;  4JVA A;  4PI0 A;  1LR5 A;  4YFW A;  2H6B A;  1FMD 1;  3ZR6 A;  2RHP A;  5CIS A;  5CNA A;  1UU4 A;  1VB4 A;  3KCY A;  1BMV 2;  1PK6 C;  3U4S A;  2GP3 A;  1LHU A;  1MS8 A;  1PO1 1;  5HI0 A;  5IFP A;  4YZ5 A;  3SHR A;  5FYY A;  2AGS A;  2VZ1 A;  4QM8 A;  4CUB A;  1YHF A;  1RB8 G;  5SV8 A;  5IWF A;  2JG8 A;  3GZE A;  3FHI B;  2GC1 A;  2EAL A;  2RM2 3;  1JZ6 A;  1FXZ A;  3N7K A;  4AF9 A;  3NV2 A;  4NIG A;  4AI8 A;  1FPN 3;  1WW5 A;  3NNF A;  2VQT A;  1REE A;  1VBD 2;  2QQK A;  4KWJ A;  2JIJ A;  3ZFE B;  4EWE A;  2VW2 A;  4ZPI A;  5BYN A;  3R05 A;  3VBS C;  5I93 A;  3PLQ A;  1NA1 A;  3DL3 A;  3SH4 A;  2Y6J A;  4A7Y A;  5FZG A;  3VGI A;  4EN6 B;  3OCP A;  1ULP A;  3USS A;  4PIY A;  5FZ8 A;  4M4R A;  3HJR A;  3VBF B;  2WA3 A;  2R6Q A;  4CCL A;  5FKC A;  3AZY A;  4LIV A;  2IVI B;  1W03 A;  4GXL A;  4QKF A;  5IK8 A;  1RMU 3;  3MHZ A;  2Y0O A;  3U4X A;  4YVW B;  5L7O C;  3R4S A;  3FN9 A;  4FPY A;  5J36 A;  2YFU A;  2A1X A;  3H1W A;  4LXL A;  2BOJ A;  3MPP G;  4QPI A;  3S7E A;  3U37 A;  1EV1 1;  1OD5 A;  3AZX A;  5K0U B;  3VUO A;  2DVA A;  4YVS C;  5KR7 A;  1C8N A;  1VBC 3;  2D98 A;  2HWE 2;  4ISR A;  5HV0 A;  1RXG A;  3T0B A;  5IAX A;  2P4E A;  1QJX 3;  2BP6 A;  4GQ7 A;  1U5X A;  2BFU L;  4XUT A;  4WM7 B;  1BCX A;  1NE6 A;  2XVG A;  4AVA A;  2VVD A;  3CJI B;  3U1X A;  3WW1 A;  3ZR5 A;  4H7M A;  3H8X A;  5ABJ B;  3O1T A;  3V64 A;  4IET A;  1PIV 3;  3W5N A;  2JB8 A;  1OOP C;  1APN A;  2VMC A;  2BNO A;  3K4D A;  3S7I A;  5C9A C;  4B8E A;  3PJY A;  5BY5 A;  2YMZ A;  4E8D A;  1W3X A;  3PUA A;  1LGC A;  4YG0 A;  5T5J A;  4R52 A;  5FLI A;  1HV0 A;  3VHN A;  3IAP A;  4AGG A;  4W6Y A;  1H0B A;  1YQ8 A;  2PLV 2;  4Q4V 2;  4A44 A;  1H4H A;  2E51 A;  2VQ0 A;  3C7H A;  5FLH A;  4AYU A;  5C3O A;  5DZE A;  1B35 A;  1RUE 1;  1JZ8 A;  1H8T A;  3P6B A; 
#chains in the Genus database with same CATH homology
 3I2F A;  4A45 A;  1TG7 A;  3WF3 A;  3OGV A;  3T09 A;  4E8C A;  1UXX X;  3ACG A;  4HG6 B;  2VZP A;  1EUU A;  2ORX A;  4DXR A;  1K42 A;  3EB7 A;  3GXU A;  4AG4 A;  2X09 A;  3I2G A;  1SG3 A;  2J1V A;  1GOG A;  1GMM A;  1JU4 A;  4CVU A;  1UY2 A;  1H6Y A;  2W1U A;  2WZE A;  3III A;  4XUQ A;  4OUE A;  1W9S A;  1OF4 A;  3VD4 A;  1JYN A;  2OKX A;  3WQB A;  1DLC A;  4GZ9 A;  3T2P A;  4TTG A;  1WCQ A;  2QBX A;  3OEA A;  4LHS A;  4D8M A;  3T2O A;  2VQU A;  1OH4 A;  4XZU G;  2YG0 A;  4ARY A;  4QX0 A;  1W99 A;  1UMH A;  2QQI A;  3C7F A;  3HN3 A;  2VCA A;  5HXM A;  3OGS A;  3T08 A;  2E26 A;  2KD7 A;  4MAD A;  3NRU A;  2WZ8 A;  3K75 B;  2E32 A;  2WO2 A;  2VO5 A;  3DEC A;  2Y6K A;  4A41 A;  1DYO A;  1I5P A;  3SEE A;  4IUG A;  3OEB A;  2VZS A;  4KMQ A;  4XVH A;  1PMJ X;  1SDD B;  4ZZ8 A;  4BJ0 A;  4GWI A;  1UYY A;  1GU3 A;  3WF1 A;  1O8S A;  3C7G A;  3CDZ B;  2J1E A;  4DEV A;  4W8J A;  3MBW A;  3CQO A;  3A7Q A;  3WNM A;  2VCC A;  3GDB A;  3OGR A;  3I3D A;  4QDS A;  3ACH A;  1JZ4 A;  4FI9 A;  5DPN A;  4KWU A;  2WAO A;  3SKJ E;  3T0A A;  3J7H A;  2J1R A;  1BHG A;  2VZV A;  2WDB A;  2WUH A;  1ULO A;  1UY3 A;  3LEI A;  1F4A A;  3K4A A;  4KI5 M;  5IJR A;  3I3E A;  4CU8 A;  3A23 A;  2BER A;  2J1S A;  3HNM A;  1J84 A;  3I2I A;  4A6O A;  5C70 A;  2VTF A;  1UXZ A;  2V4V A;  3WNO A;  2W3J A;  3CIH A;  1MPX A;  2E31 A;  3THD A;  3WF0 A;  4MO3 M;  2WBK A;  2Y64 A;  3LQC A;  2Y6H A;  4JX0 A;  1O8P A;  5JUV A;  2VJX A;  4JKM A;  2W46 A;  3MV0 1;  4ZZ5 A;  2CDO A;  3VD5 A;  3ACI A;  3HPN A;  4P02 B;  2B4K A;  3HNB M;  2W47 A;  5DN2 A;  1UYZ A;  4BK5 A;  2WN3 A;  3PUI A;  3C8X A;  4QB2 A;  3VD3 A;  5EJZ B;  2VOT A;  4QB1 A;  4CU6 A;  2VZO A;  3BN6 A;  4LPL A;  3HNY M;  4XUR A;  3DYP A;  5G04 L;  3SEP A;  4DEQ A;  2JDA A;  2BGP A;  1UWW A;  4D0Q A;  1OT5 A;  3IB3 A;  2YFZ A;  1JYX A;  2JE8 A;  2HYX A;  3THC A;  4RYD A;  2ZEZ A;  3HEI A;  2X10 A;  1D7P M;  1W9W A;  3NJX A;  5LA0 A;  2J22 A;  3OB8 A;  3CZJ A;  3WNP A;  4QX3 A;  1J83 A;  2YB7 A;  4QDQ A;  2W1W A;  2ZEX A;  2V5D A;  5IHR A;  3I2J A;  2YC4 A;  1W0N A;  2J7M A;  2W95 A;  4DXS A;  1JZ5 A;  1CZV A;  3E1F 1;  2ZEY A;  4XUN A;  2VME A;  3WNL A;  3F2Z A;  2BZD A;  2W1S A;  1YQ2 A;  2J1U A;  4MGS A;  2VZQ A;  4RN5 A;  2WN2 A;  2B9V A;  3ACF A;  1WKY A;  1XNA A;  3IAQ A;  4W50 A;  1L7R A;  1XC6 A;  4JKK A;  3K77 A;  3WF2 A;  3ECQ A;  4MGQ A;  3UET A;  1GUI A;  2VZ3 A;  1JHJ A;  2V72 A;  4CU9 A;  4JKL A;  2W87 A;  2XON A;  3ABZ A;  2JD9 A;  5LA1 A;  2W1Q A;  2X05 A;  1F4H A;  4QAW A;  4A4A A;  3MUY 1;  5JXJ A;  3C7O A;  2ID4 A;  4AAX A;  1PX3 A;  2QQM A;  1UMI A;  4Z2A A;  2QQO A;  4DUX A;  3I97 A;  2EIB A;  1CZS A;  3CKH A;  3UNP A;  5C7G A;  2LW8 A;  4L0P A;  1DP0 A;  2C4X A;  4OMC A;  4PT6 A;  2VC9 A;  4CUA A;  1L7Q A;  1OF3 A;  2L9L A;  3CMG A;  4MOA A;  4PQQ A;  2WAA A;  4XUO A;  1NKG A;  1UY4 A;  2JKX A;  2WQ8 A;  5F7U A;  2CDP A;  2ZXQ A;  3WNK A;  1GOH A;  1K45 A;  4ET7 A;  1NX9 A;  1RYY A;  2J1T A;  1CIY A;  2EID A;  1CZT A;  4ARX A;  1UY1 A;  1K3I A;  1JZ2 A;  1JU3 A;  3NJV A;  1UZ0 A;  2W9X A;  2C9K A;  2XHN A;  2YC2 A;  3T0D A;  3I3B A;  3A21 A;  1W8N A;  5LCW L;  4W4Z A;  3WNN A;  5EIY B;  3CZU A;  5J1X A;  2PQS A;  4QX1 A;  3T2Q A;  2DDU A;  1KEX A;  4P08 A;  4XUP A;  3K4Z A;  2VZR A;  1JZ3 A;  2BBA A;  5CYY A;  3MUZ 1;  3WF4 A;  5DMY A;  1UX7 A;  1JYW A;  3OBA A;  4GWJ A;  4UI9 L;  2WO1 A;  2WYS A;  3MO4 A;  3WSO A;  1NUK A;  3FHA A;  4QPW A;  2W94 A;  3NQH A;  2RV9 A;  4P00 B;  2E33 A;  4LKS A;  4QX2 A;  4LQR A;  4CUC A;  2VR4 A;  1GOF A;  2VL4 A;  5HPO A;  2Y6G A;  3LEK A;  2QQN A;  1EUT A;  2Y8K A;  5C71 A;  4TXW A;  1XNT A;  3JXS A;  4BK4 A;  2RVA A;  5G05 L;  1TVG A;  1GQP A;  3LPG A;  1UY0 A;  4UOJ A;  1T2X A;  5FUI A;  2BGO A;  3FL7 A;  3ETP A;  3EYP A;  1PMH X;  2XOM A;  1US3 A;  5B4X A;  3LPF A;  2ORZ A;  1OD3 A;  3C7E A;  3NNG A;  3MV1 1;  3HOB A;  5CZK A;  5LA2 A;  2W91 A;  2WAB A;  5I0D A;  4CU7 A;  4QDR A;  2EIC A;  2QQL A;  3BGA A;  3AC0 A;  1R64 A;  4OYU A;  5EJ1 B;  1K12 A;  2EIE A;  4OZO A;  5JXG A;  4PF1 A;  3LEG A;  5JR2 A;  5JXH A;  1UYX A;  5IYY A;  4A42 A;  4DXT A;  2VMD A;  3VD9 A;  3K46 A;  4DUW A;  3D3A A;  1H6X A;  1IQD C;  1GNY A;  4QB6 A;  4M4P A;  3FHQ A;  2VM9 A;  4ZY9 A;  2VZU A;  2RJ2 A;  3VD7 A;  5JXI A;  1JYV A;  1W9T A;  4BDV B;  1KGY A;  2ZEW A;  3I2K A;  3LE0 A;  5IFT A;  5IFP A;  3VDA A;  4A3Z A;  4CUB A;  2VZ1 A;  3VDB A;  2QQJ A;  1JZ7 A;  4P5Y A;  3ZM8 A;  3VDC A;  1JZ6 A;  2DCJ A;  3GGL A;  2VMF A;  1JI6 A;  2VQT A;  5DQ0 A;  1CX1 A;  2QQK A;  3PUH A;  1HN1 A;  2R7E B;  1XPW A;  1W8O A;  1LNS A;  2VZT A;  2Y6J A;  2Z4F A;  2J1A A;  2VCB A;  5JMO A;  1NAE A;  4YPJ A;  1ULP A;  2HLE A;  5A1A A;  3SKV A;  1PX4 A;  4M4R A;  3HJR A;  3P1I A;  4JHZ A;  1US2 A;  5B4N A;  2W92 A;  2LS6 A;  3FN9 A;  3I2H A;  2YFU A;  3DYM A;  3WEZ A;  3U37 A;  3DYO A;  4ZXE A;  2C26 A;  2XQX A;  1P8J A;  3W5M A;  1SHW B;  3OG2 A;  3T0B A;  3GM8 A;  4XUT A;  2W5F A;  3W5N A;  2VMC A;  3K4D A;  4DUV A;  4OMD A;  4UAP A;  4E8D A;  3A22 A;  2Y6L A;  3IAP A;  4BXS V;  3UES A;  3IDA A;  1O59 A;  4A44 A;  3C7H A;  2DCK A;  2WO3 A;  1JZ8 A;  3P6B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...