2YFUA

Cbm62 from clostridium thermocellum xyl5a
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
140
structure length
140
Chain Sequence
SYPKLTGTVIGTQGSWNNIGNTIHKAFDGDLNTFFDGPTANGCWLGLDFGEGVRNVITQIKFCPRSGYEQRMIGGIFQGANKEDFSDAVTLFTITSLPGSGTLTSVDVDNPTGFRYVRYLSPDGSNGNIAELQFFGTPAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords CARBOHYDRATE BINDING FAMILY 6
publication title A Novel, Noncatalytic Carbohydrate-Binding Module Displays Specificity for Galactose-Containing Polysaccharides Through Calcium-Mediated Oligomerization.
pubmed doi rcsb
total genus 32
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2011-04-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2yfuA00
2VTFA 3WSOA 1CIYA 1US2A 4E8CA 1NX9A 1UY2A 5DPNA 5IFPA 2QBXA 1JZ4A 3IIIA 2KD7A 1PMJX 4DUVA 2YC4A 3MUZ1 1JZ3A 3T2QA 2RJ2A 3VD3A 2WABA 2VCCA 3W5MA 1GMMA 4TXWA 1MPXA 3ETPA 4ZXEA 1L7RA 4ZZ5A 2EICA 1K3IA 2V5DA 2VQTA 4XVHA 4OYUA 1WCQA 1UYXA 3A23A 3DYOA 5LCWL 1GNYA 3HJRA 3EB7A 2J1TA 2J1EA 1ULOA 3PUHA 2OKXA 1J83A 4MOAA 3IB3A 3JXSA 2CDPA 3OEAA 3NQHA 3OG2A 3EYPA 4QX2A 4JHZA 3WNNA 3MBWA 3ECQA 4ARXA 4OMDA 3CQOA 3IDAA 2VZRA 2VR4A 2VOTA 4Z2AA 2VZ1A 3ABZA 3NRUA 3VD9A 3SEEA 2W5FA 2VZVA 1W0NA 2Y6GA 2W3JA 2PQSA 4LKSA 2C4XA 5C71A 3J7HA 2BERA 1RYYA 1JZ8A 1W8OA 4JX0A 2V72A 4QAWA 1K45A 2ORXA 3WF1A 3U37A 1OH4A 3A22A 5IYYA 2EIEA 4AG4A 1UYZA 4DXTA 5JR2A 3OGSA 5JXIA 2BZDA 2WAOA 5IJRA 3GGLA 4DUWA 1SHWB 1XPWA 1JZ5A 2ZXQA 4XUPA 3T08A 3OEBA 1GUIA 4XZUG 2J1VA 3MUY1 4RYDA 2XOMA 4HG6B 3NJXA 4FI9A 2B4KA 3WF4A 3C7OA 4D8MA 2ZEZA 2DCJA 3GM8A 2QQOA 5J1XA 1O8SA 1DLCA 2E31A 4IUGA 3WNKA 4ZZ8A 3T0BA 3P1IA 2BGPA 4JKKA 2WO1A 2VMDA 4AAXA 2VZTA 3OGRA 4XUTA 1CX1A 1I5PA 2WYSA 4GWJA 3CZUA 2VZPA 5I0DA 3FHAA 3ACFA 2VC9A 1GOFA 1UMHA 4ZY9A 4OUEA 4BDVB 3GXUA 1L7QA 4CU9A 3WNLA 3I2JA 3OBAA 3I2HA 2WZEA 3I3BA 4JKMA 1GOHA 2WQ8A 4CU7A 2VCBA 3WEZA 1W9TA 1PX3A 2VZOA 3BGAA 2VQUA 2VZ3A 1O8PA 4DEVA 2ZEYA 3FN9A 5B4XA 1WKYA 2XHNA 2B9VA 1JZ2A 3MO4A 1KEXA 1GU3A 1TVGA 1NKGA 4W8JA 2ID4A 2QQLA 2X05A 3D3AA 4A42A 2Y6JA 3HOBA 5FUIA 3K4ZA 2W91A 3DYPA 3THCA 3NJVA 2YC2A 3DYMA 3IAQA 1BHGA 4PT6A 3MV01 2VMFA 2VZQA 5CYYA 4PQQA 1JI6A 3WNOA 4KWUA 4P5YA 3A7QA 3T09A 4DEQA 2VMEA 3LEGA 4LHSA 3LPGA 3THDA 3SEPA 2VMCA 1DYOA 2J1RA 3I2GA 4W50A 2JDAA 4DXRA 1OF3A 1K12A 3T2OA 1GQPA 2C9KA 4QB2A 4ET7A 1YQ2A 3HN3A 3LQCA 4OZOA 2Z4FA 2ZEWA 1EUTA 2VL4A 2QQNA 2QQKA 4LQRA 5JUVA 3E1F1 4QDQA 3NNGA 5CZKA 2EIBA 5JMOA 1XC6A 2E32A 2J1UA 5EJ1B 3UETA 3CDZB 2WN3A 4BK4A 3I97A 1UY4A 1OF4A 1W9SA 2EIDA 5IHRA 4A4AA 3GDBA 1SG3A 5LA2A 2VZSA 4A3ZA 4E8DA 5C70A 3W5NA 3HNBM 3HNMA 2VCAA 4A41A 2J1SA 1JU4A 4A6OA 1TG7A 2L9LA 3SKJE 3K75B 4QX1A 3DECA 3VD5A 2LS6A 4UI9L 2ORZA 4P00B 1F4AA 2J1AA 4M4PA 4A45A 1JYWA 2RV9A 3HPNA 4QX3A 2W94A 3SKVA 4BJ0A 5LA1A 4BXSV 1W99A 5LA0A 3AC0A 4TTGA 2JE8A 2E26A 1DP0A 2W95A 4QDSA 4XURA 3VDCA 3I2FA 2RVAA 2W92A 5F7UA 4MGQA 2V4VA 1JU3A 4MO3M 4QX0A 3CIHA 5HPOA 2WDBA 4QPWA 4CUBA 3K77A 4XUNA 3BN6A 4CU6A 1R64A 4QDRA 3ACHA 3K46A 3ZM8A 2XQXA 5EIYB 4BK5A 1K42A 4RN5A 1PX4A 1SDDB 2Y6HA 4LPLA 4UOJA 4YPJA 3T2PA 3LPFA 3WQBA 3HNYM 3MV11 1ULPA 1H6YA 2YG0A 3C8XA 2XONA 4QB1A 1UMIA 2WAAA 2W47A 2WBKA 2JKXA 2W1UA 3UESA 3VD7A 2LW8A 3HEIA 5C7GA 1CZTA 2E33A 3I3EA 3LE0A 3LEIA 4MADA 5DQ0A 1JYVA 2W46A 3A21A 1GOGA 3UNPA 2JD9A 1OD3A 3WF0A 2DDUA 3I2KA 4OMCA 4UAPA 2W1SA 3VDBA 2YFUA 1UWWA 2VO5A 2WO2A 4PF1A 2W9XA 2W1QA 2DCKA 2WUHA 1UY0A 3IAPA 3T0DA 1HN1A 5IFTA 5JXJA 3PUIA 3VD4A 3FHQA 4GZ9A 1UX7A 1F4HA 4DXSA 2WO3A 2Y8KA 2QQMA 3C7HA 1CZVA 2WZ8A 3VDAA 1J84A 1EUUA 4QB6A 2Y6KA 4JKLA 1OT5A 2Y64A 4W4ZA 4CVUA 1JYXA 1IQDC 2VJXA 4L0PA 1D7PM 2CDOA 2X10A 5G04L 2HYXA 3OB8A 1NAEA 1CZSA 3ACIA 3ACGA 1UXXX 4P08A 5G05L 4KI5M 2ZEXA 2VZUA 3C7EA 3CMGA 5B4NA 3CKHA 5JXGA 3OGVA 5JXHA 2J7MA 4P02B 1UZ0A 5HXMA 5DMYA 3C7GA 4XUQA 1H6XA 1T2XA 4M4RA 1W9WA 1XNAA 1O59A 2WN2A 1PMHX 5A1AA 2YFZA 3K4DA 1UY3A 2W1WA 3WNPA 3CZJA 2J22A 4CUCA 2VM9A 2Y6LA 1JYNA 2QQIA 3T0AA 4DUXA 1UY1A 2YB7A 2HLEA 3WF3A 4D0QA 2BBAA 1LNSA 2R7EB 3F2ZA 3FL7A 1W8NA 4MGSA 1JHJA 5DN2A 1P8JA 3WF2A 1US3A 3LEKA 1NUKA 3WNMA 3C7FA 3I3DA 1JZ7A 1XNTA 1KGYA 1UXZA 4XUOA 4A44A 4KMQA 1UYYA 2W87A 2QQJA 3K4AA 4ARYA 2C26A 4CU8A 1JZ6A 4GWIA 3P6BA 2BGOA 3I2IA 5EJZB 2X09A 4CUAA
chains in the Genus database with same CATH superfamily
2Q1ZB 2AYHA 5KWRA 4C91A 3I2OA 3WY6A 2QQUA 3ZYRA 4IL7A 4D3WA 1ULCA 1O91A 1QJY1 5KR7A 4YVWA 1CIYA 2W52A 4IE4A 3HQRA 4MGZE 5AVPA 1AL22 4YM2A 1CJPA 1D4M1 1NX9A 3MIEA 2GU9A 4AAPA 4CEWB 4KNCA 5IFPA 5KBFA 4EYUA 3A0NA 3LGRA 3M3QA 3VBUB 2GN7A 1JZ4A 3VBRB 2AREA 2WT0A 3SHRA 3OCPA 3MFAA 3CJIC 4PBPA 1S1AA 4BLIA 4DUVA 5HV4A 2FHRA 1W06A 4AHXA 1OA2A 5LEKA 3W5MA 1GMMA 4TXWA 1VR3A 4E4HA 1UU5A 4IXLA 1BMV2 4GB32 4KH9A 4KL1A 3KMHA 4UF0B 1JMUB 1RTVA 2XH6A 5BNNB 1GSLA 4Y22B 4FPKA 4YVSA 5GZDA 1BVP1 2GC1A 2VQTA 1ODMA 1YJKA 1DGWA 4XVHA 1QDOA 3A23A 4UW4A 4AEKA 5DDJ3 4Y1XA 2R0HA 2ZGUA 3HJRA 2J1EA 3ES1A 3IPVA 2A70A 1S2EA 5FZKA 1XNCA 3JXSA 3VBOB 3AKTA 4BA6A 3ZN4A 2VOXA 3VZJA 4A7ZA 5FMDA 4IE6A 1J1LA 2AUYA 1ZBE1 3UJOA 3LD8A 3N3HA 2IC1A 4XHBA 5JLVA 2VZRA 2XWJB 3O7OA 2VR4A 1HN0A 2VOTA 2VZ1A 3PIGA 2JDMA 4COYA 3UT0A 1PM4A 2EF6A 5IVBA 3M1HA 4XJUA 1KJRA 4YW6A 1VBD3 3O1UA 1PK6C 2VZVA 3C2UA 1RXGA 1ND3B 2Y6GA 2PQSA 4LKSA 2XR4A 1NLRA 3AXDA 3B9IA 5FZ3A 2HWC1 2XKOA 4FPJA 1J59A 4MG2A 1SLAA 3DPRB 1OLMA 3PTYA 4KQ7A 2CHHA 3UYJA 5I91A 2DCYA 3WLUA 5FP7A 1HKDA 1W8OA 3ZXAC 4AF9A 4QAWA 1NCQB 4KWJA 4AVAA 1YYNA 2VVFA 3RZLA 3WZ1A 2WA4A 1RUE3 1LU1A 3NKTA 4XJ8A 3K51A 3U37A 4WV8A 4Q0UA 5J96B 3OJBA 4OCTA 1W2NA 4KWLA 5JWPA 3H8OA 3BI3A 3N9MA 1OI6A 4YW2A 2F6BA 4NRPA 4AG4A 4BIFA 4IESA 1LEDA 1LGCA 2QE3A 1AYM3 4GJZA 4KWKA 4RHV1 2WAOA 4UFMA 2Q5TA 4RGKA 2X8KA 1QXPA 1COV1 1TME1 2A6ZA 2P37A 1Q8VA 5IJRA 5JSOA 2VVEA 1SHWB 4GALA 4GMP1 4MZUA 5C8WA 5FR3A 1OQ1A 4QPIA 3LA2A 2ZXQA 1JZ5A 2VECA 4L99A 2JG8A 4PLMA 4ZS3A 4FPOB 3MUY1 5LATA 1DGLA 1S55A 1WCSA 2PHDA 4HG6B 4LA3A 1IOAA 1ASJ2 2Q4SA 3IKWA 5FQ0B 3V64A 4N9HA 2FZ2A 1XNDA 3WF4A 1C8M3 5FMBA 2ZEZA 3MLKA 3TEWA 3GM8A 5J1XA 1RUD1 2NLRA 3KGLA 4GJYA 5FP9A 2EAAA 1AR62 3OUIA 1XYOA 4AVVA 4IUGA 4R4ZA 3WNKA 3KT4A 4XMIA 4R4XA 5CG9A 3AP7A 1VB2A 2K46A 1SZBA 2Y33A 4JKKA 2VMDA 4CEYA 2VZTA 4XUTA 3T1MA 4AEDA 5C9AC 3ZLIA 4WVMB 4DXZA 2V73A 4GWJA 3CZUA 2RDNA 4FPEA 2XVLA 3VBRC 4Y33A 4QPYA 1BK1A 2RS31 4Q4W2 5C8CA 1TZOA 3ZYIB 1N1SA 1QQP1 1C5IA 3MIHA 3USSA 3WNLA 1V6IA 3I2JA 3MHZA 3OBAA 4K7JA 4AGRA 3PL0A 2PAMA 2WZEA 3KVAA 2A6XA 3I3BA 3WINE 1XSRA 3CBNA 1AX2A 1H9WA 3DEMA 2WWUA 1R1ZA 1CIWA 1Y3TA 1W9TA 5BNNC 5C33A 2BNNA 1S0EA 1AL23 2Z2SB 2VZOA 3V65A 4B3NA 2GDFA 2VQ0A 3LSEA 1CAWB 4DEVA 1JHNA 3FN9A 1GANA 2JG9A 2IXKA 3IMNA 3ZXGA 4BQ5A 3B01A 2XHNA 1GZWA 5K4LA 3AYDA 2B9VA 4Q4Y2 3MO4A 1H1MA 1APNA 1JUHA 5FZ9A 2D97A 1TVGA 3CF6E 4LO7A 1H1AA 1KS4A 4LLFA 4EZ4A 4IEVA 1NKGA 4JDOA 5IVEA 5D8AC 3RMYA 2ZAAA 3MPBA 3B93A 4GB33 1S0DA 2O8QA 1OVPA 2PELA 1ULEA 2YBPA 1ZRIA 3AP4A 4IV1A 1W6OB 3WDVA 4BMEA 4N90A 5FLIA 3HOBA 1YQ6A 3MF9A 5FUIA 4ZU7A 2W91A 4XF4A 4XDPA 2QQVA 1LCLA 1MQTA 4DFSA 4YW4A 3POEA 3OYWA 1UIKA 5FYZA 3DYMA 2VUCA 5CFCC 5AC91 4GH4A 4MGYE 4OI2A 4AFBA 5E89A 3DPRC 1V70A 4FOYA 4BPZA 2VOVA 4W6YA 2PAKA 1WA4A 5HI0A 1DZQA 3HR9A 3N35A 4AI0A 3T09A 3A7QA 1UO9A 3DGTA 4DEQA 2QQPA 5H9RA 2HYKA 4C0BA 4B4QA 2X5IB 2PAEA 2YV8A 1N3PA 3RWKX 3TBDA 3MIBA 1W9YA 1UOGA 1RITA 1OOPC 2XJRA 3THDA 5FFOC 2VMCA 4I0AA 3JD71 1CAUA 2WZR2 1XU1A 2AC1A 3T2OA 2I45A 1BBT1 2C9KA 1L7LA 1HXS1 5FY4A 3RPQA 4ET7A 1ULGA 3LQCA 2ZEWA 3AM2A 4LUMA 3PHMA 5DAQA 3NV3A 1ZA7A 5JUVA 2P5BA 1F15A 1SFYA 2GNMA 2KA3A 2C0ZA 2ZMNA 3E1F1 4IEYA 5DUWA 2ES3A 3VZMA 4LOTA 1OQEA 2YU2A 3PVOA 5C5UA 3N4MA 5AFEA 1FPN1 1VAKA 2CTVA 3PUQA 2P17A 2J1UA 3SCHA 3CDZB 1FI2A 3WP5A 2WN3A 2Z42A 1UY4A 4TSVA 5EHDA 2OXBA 5IK8A 1RUG1 3KGZA 4HN0A 4MGTA 3PNAA 4H14A 2VG9A 2VZSA 1Y7BA 2XG3A 2WNVA 5FZHA 3HNBM 3HNMA 3UJQA 2OVUA 5KHIA 3H9AA 2VXJA 4EN7B 2J1SA 1JU4A 3ORJA 4YM1A 4J1XA 5FZ8A 2L9LA 2VBDA 1H8TC 4HPKA 3ZXJA 3ZSLA 3IDBB 1STMA 3LA3A 3VZOA 1NOVA 2LS6A 3O12A 5A3UA 4A7YA 4AGVA 3RNSA 3OPWA 1WW7A 5IVJA 2ORZA 1LRHA 3I59B 1AYM1 4Y1UA 1GZTA 1XRUA 4OUMA 1GWMA 5CKQA 4C1XA 4ISQA 4XFIA 1OHFA 1Z7S2 3O1MA 2PHRA 4JAAA 5T52A 4K9SA 3H42B 3HIFA 5LA1A 5LA0A 1QJEA 3AC0A 3E97A 3FLTA 4W6XA 4AEMA 4DY3A 1CVNA 1ZBA2 2IVIB 3ZXEA 1AR63 2HEWF 3ZVXA 2W95A 3KV5A 4LE3A 4N53B 2GN3A 1C8M1 3K3OA 3ZX7A 2RVAA 5FXXA 2P34A 5FKBA 2V4VA 4B4PA 1JU3A 3M8LA 3AP6A 4AYUA 4BMBA 1ZNPA 4P9XA 4K8FA 4UFKA 5FYBA 1FXZA 5HPOA 3VKOA 1HJFA 4LKFA 3TAYA 4AVSA 4MSVA 4Y1ZA 4CPBA 4Q4W3 1CN1A 1RUOA 2X53S 3AMNA 3ACHA 3TNPB 3K46A 2W39A 4DPNA 2CY6A 4COZA 3ZN6A 1AX1A 4R9CA 1SCSA 4XZPA 2E7TA 5T50A 2WR9A 3ZM8A 1UZZA 1Y43B 4OHYA 4XAAA 4W65A 4BCUA 1XOYA 1Q5OA 3H3ZA 1J1TA 4Y5SA 3GJBA 1RUH1 3DXUA 4LE4A 4XXPA 3RGBA 4FPYA 4Q4Y3 4YPJA 3WV6A 2TBVA 1VP6A 3ENRA 3T2PA 4UWDA 1AL21 4LIVA 1MZFA 5LY1A 3MV11 2YPJA 1YWKA 4J6GA 2VTXJ 4JTNA 1H6YA 2XL7A 4NPRA 1BLZA 4YVWC 2WLPA 2KR2A 4ISRA 4BHPA 2UYAA 5K7PA 2D6PA 4IEOA 3MEPA 1S2KA 2GNTA 2JKXA 5T5JA 1RJ8A 3VD7A 3HEIA 4Q5OA 2HBUA 3BTXA 1S0GA 2XLFA 2E33A 2PQQA 3KWVA 5FZ4A 4YZ2A 3ZSJA 3LEIA 1HRI2 4QKDA 5DQ0A 2W46A 2XMLA 5F2SA 3FUQA 1QEXA 4YGCA 4BXFA 3UNPA 4H7MA 3KHCA 4FPCA 4OHXA 3WF0A 2ZOEB 3TN92 3I2KA 4OMCA 4UAPA 4LITA 2W1SA 1MVQA 1REFA 1ZZBA 4QU1A 4R9AA 4YVSC 4B1LA 2W9XA 2JG9B 4PDWA 1R1A1 2WUHA 2BRTA 1UY0A 1RVF2 3POGA 4FPFA 2HWE3 5H9SA 2WZR3 4NOTA 5CFDA 5A7OA 3A0KA 5JVVA 5JXJA 3VD4A 1RUJ1 4QD2A 3W59A 2DURA 4HLTA 5DXDA 1W0OA 4DZGA 3WG3A 1BCXA 2K9ZA 2WZ8A 1LR5A 1YFWA 1J84A 1SDWA 1HRV2 3J7MA 2RS52 4LHNA 4DRRA 5B2GB 1O3TA 1MS8A 1KJLA 1EUUA 4IGPA 5BXXA 3U75A 4QB6A 1N3OA 5A7NA 1U12A 5LA9A 2AR6A 3MI8A 1UMZA 1DYKA 3MW2A 5C3QA 2BVBA 3TB0A 3LSDA 4AI9A 4BYYA 1JYXA 1XE8A 2VJXA 5D1IA 1YFUA 2FD8A 1O4YA 1NXD1 2XJVA 4XFAA 1U5ZA 2IVJA 1AR82 3BALA 4QHOA 1ZZ9A 2AGSA 3UKVA 2GC3A 4G3YC 2O1QA 2UY9A 3VKMA 1D0GA 3B5LB 2VMGA 3RQ0A 3SH3A 2BGCA 1UXXX 1HQWA 2MNGA 3ACGA 3GCWA 4KI5M 1LAJA 3BODA 1ZZ8A 3POWA 1ZRRA 2VNVA 2QVSB 5JXGA 3ME2A 1YLLA 1J58A 1Z7S3 4H7LA 4O9EA 2JDUA 4LJHA 4Q4V3 4N43A 4EWEA 1IPKA 4BISA 5LRSA 3MPPG 3IMMA 4QPIC 1ZBA3 3PURA 1IKQA 1ASJ1 3CU7A 3ALQA 1RIRA 2JG8C 1W6QA 3RZKA 3BUCA 3Q8FA 4M4RA 4XACA 3SCFA 4AOCA 1MS3A 1RINA 2Q0AA 4PJYA 5L9RA 1AJKA 1O59A 2VY0A 4ITCA 4CSWA 2WKKA 2TEPA 2VULA 1W8TA 2DFBA 4FP3A 4YW5A 5A1AA 1AR61 5DAVA 3ILNA 3WX5A 3FLPA 1ULFA 3K4DA 1REDA 3POSA 1Q8OA 1VAMA 4I3GA 1UY3A 2GZWA 3A4UA 4RR3A 2A3XA 2WT1A 1BKZA 2E7AA 5FPXA 2RHPA 1DF0A 3E6BA 2D6LX 2Y6LA 4P9LA 4AI1A 2EAKA 4CEYC 4BQ1A 3T0AA 2JENA 4P9YA 1QOTA 4AEDC 1RL3A 1XE7A 3WF3A 2BBAA 1NG0A 4Q4W1 3DUIA 4PIYA 5FY9A 4UFLA 3POYA 2ZHNA 3FL7A 4B4RA 3N7JA 5FZMA 2ZACA 4KGQA 5IUQA 4LNVA 2WWSA 1JHJA 3VBSA 5EYXA 1IS5A 4LBLA 3EO6A 1NA1B 4GD4A 1RUC1 5C8CC 5C6CA 4PIZA 1US3A 5FZ0A 5FWJA 3AMPA 4YYOA 4H2AA 4XDOA 1E5HA 5FY0A 4KMQA 2RJKA 3W58A 4RS5A 1RXFA 1Z78A 4CU8A 1YEWA 5ABJA 3KD4A 3TEYA 1UD1A 2JG9C 4B1MA 3W9AA 4FCAA 4CP1A 2GC0A 3NSTA 4Q0PA 3WXPA 4CUAA 2CGNA 3WSOA 4AZZA 3GHMA 5IVVA 1HRI3 4ASLA 4FFFA 1US2A 3RZMA 1UF2C 5F2WA 3ON7A 4Z8BA 2ET1A 5DPNA 1UNBA 2ET7A 4BQYA 5GJ6A 3E5QA 3AYCA 3TN93 4IV1C 3ZN6B 1OVSA 2YHJA 1AZDA 1U5YA 1ZM1A 4HK8A 2WNEA 4UW6A 4AE2A 5J3UA 2KD7A 1PMJX 1W8UA 4JRLA 2RJ2A 3FBYA 1TMF3 2BOJA 5FYSA 1MQTC 2C6SA 2Y60A 3DXTA 1POV3 1PHMA 1B35A 1LTEA 3AB0A 4ATEA 4UBHA 1RVF3 1MPXA 3OUHA 1LOEA 4LBQA 4GH4C 1CAXA 2DFCA 1QJX2 4L2NA 1L7RA 4QXKA 4KBBA 4Y26A 3VGIA 4ZZ5A 1W3XA 1I5ZA 2R041 4PHZA 4ASMB 1X36A 2XJSA 5T55A 3O1OA 3VDDA 1MS5A 2G9GA 4OYUA 1WCQA 3DYOA 2WZR1 2A73B 5L19A 4A2UA 3AZWA 4BIOA 1QDCA 2J1TA 1ULOA 3PUHA 1QNYA 4BWOA 1HRV3 5DDJ2 2RS53 2Q8EA 4LBMA 1J83A 1POV0 3CJIB 3IB3A 2B46X 2CDPA 5FLJA 3NQHA 2ATFA 3OG2A 3UK9A 1AVBA 1GZCA 1JXNA 5A3WA 5DAWA 1MVEA 2E63A 4D7SA 4Z2AA 3ABZA 4XOGA 2OQ6A 2N7GA 4JDMA 1DQ5A 3VD9A 4MYEA 1ZRCA 3IBMA 2I07B 3K2OA 1J3PA 1ZVFA 1YQCA 4CP9B 1F2NA 4CXXA 1W0NA 2PLV1 1CD3G 2XJPA 4WM8A 3VBFA 4C90A 1X82A 2G4IA 3AFKA 4PLOA 4SBVA 4CCJA 4DS0A 2Y34A 3THTA 4I30A 5FKCA 5JOZA 5LZ6A 4QGLA 2FCUA 2WNVC 4Y5Z0 3D82A 1SCRA 3KS7A 1K5JA 1DGWX 1LULA 3L2YA 3N9NA 4JGYA 1ZZ7A 1WW6A 2Q30A 3QH7A 1RYYA 5T5LA 1JZ8A 5GZGA 4NIGA 3N7LA 5L36A 3SCGA 4COUA 4NHKA 2ORXA 5C4WA 3MLLA 4WBBA 3JU9A 4HVOA 2D93A 1OH4A 5FZ1A 5FY7A 4CE8A 5IYYA 2VCMA 2Y6FA 1M4WA 4MH0E 4X6RB 4DXTA 5JR2A 3OGSA 1PVC2 1BVVA 2UU8A 1VBA2 3OPZA 5C3SA 5FZFA 3MLJA 2BZDA 1F35A 1PK6B 5FOBB 2BOIA 1W90A 2EXKA 2XBO2 5I8TA 2R1BA 5FXVA 4DUWA 3RZHA 4I2OA 5GLWA 4CZSA 4R9BA 4EN0A 3OEBA 3FZ3A 2UURA 2PFWA 4WZFA 3B3QE 2DCTA 3PDQA 3NJXA 4XBLA 4GMP0 3CJXA 4PI2A 2YU1A 3QCWA 3RG0A 1W2AX 3AZYA 4DIQA 5GALA 2D44A 2ZGMA 4CDUA 1QMJA 2ZX1A 4LEJA 5A80A 2V5YA 1FX5A 4B8EA 3INAA 5F1RA 3ZIWA 4K40A 5DAXA 1WLCA 2PMWB 5I0SA 2CAUA 4L11A 3PJYA 1N47A 4YSFA 4CDWA 5J36A 1LJ7A 2IWGB 4LMFA 4KU7A 4N43B 3AL5A 3WD5A 4Y20A 1VBB3 5F3GA 4NAMA 4BQWA 5GZCA 5KHHA 4NJ4A 2DVGA 5KXEA 3RDIA 2HWD2 2VUAA 3IT8A 1ZREA 1S0BA 3SXWA 4XJZA 5JZGA 3ZR6A 4C1WA 3NVCA 1YFXA 1PM7A 3RJ2X 4CU9A 5E8AA 5IK7A 2CU5A 1OSGA 5D21A 1QF3A 1JYTA 4NHMA 2HH9A 4OI4A 3S0MA 3V0AA 4MVTA 1E5IA 2GMPA 4CU7A 4LO5B 2B7YA 2NZ9A 3WEZA 2YDEA 4UW3A 1G8WA 1VALA 4DY5A 1V6JA 2FDGA 2VZ3A 1RHI2 5T54A 2AACA 2BWAA 2ZEYA 3SQOA 4J25A 2IFWA 2HBTA 2CL2A 5C9AB 1NXMA 5DUXA 3U0ZA 4LBOA 4DMIA 1KEXA 2VUDA 2BEOA 4SLIA 4F7ZA 1W28A 3LAGA 1OLME 3HT1A 5HV0A 5BNQA 1W9FA 2A5ZA 1BXHA 2F4PA 4FPHA 5APAA 3WW1A 4E9KA 3T4HB 4NPLA 3J9SA 4ZXKA 1O3QA 1AR72 1QJX3 1Y9MA 5A7WB 4HONA 1UU4A 1XSQA 5BUVA 5J09A 3WNXA 2A3WA 2E9QA 3OF1A 3ZFEA 3K4ZA 1RMU1 1I1EA 1OMIA 1POV1 3R05A 4WVWA 2R6QA 3AZVA 3N36A 5FYVA 5FXZA 4NHXA 5JI7A 3THCA 5CA6A 1RVF1 2D6OX 3O14A 3NJVA 4Z07A 5ERLA 5ABJB 4OQ9A 2ARCA 2YBSA 4S2DA 2QJVA 4PDWC 1CR7A 2JKBA 1X7NA 2WFPA 3IIAA 3MV01 4LUKA 4NUBA 2XJQA 5CFDC 1UZYA 1G9BA 2BNMA 5CYYA 4QQLA 4Q0VA 4UXAA 5A6ZA 5LBEA 3WNOA 4ES8A 1PZ9A 3SH5A 5D8AB 4AHZA 4H3WA 1V9U1 3ILRA 1WD3A 3LEGA 1HRV1 1H2LA 1RC6A 2PHFA 1SLLA 2RS51 4LHSA 5KXCA 3MYXA 3WQ1A 1ZRDA 2ZBJA 4NPMA 3Q8CA 1DYOA 5JCTA 3BPSA 4DXRA 2CWSA 1OF3A 3B02A 4NROA 3CEWA 4MV2A 3GNEA 1ZX5A 4LIUA 4XIKA 4EQVA 3QLQA 1EUTA 5JSRA 4HZFA 5CFCB 2RR12 3H3LA 2P6HA 4K1ZA 4HXCA 1PZ8A 1AR81 1FOD1 4BB3A 3U4XA 3WT3A 4WVZA 4PQ9A 4Q0SA 5F3IA 2E32A 2FDHA 1A8MA 3UETA 4JDNA 4AR2A 4BK4A 3FUOA 4NIAA 4B7KA 1LHVA 1WA6X 4A4AA 5IHRA 2A3YA 3WP3A 4HANA 1D0HA 4A3ZA 2P4EA 4E8DA 1LB2A 2HKXA 3Q8EA 1VJ2A 1OOPB 2RJLA 3VBHA 4A41A 4QKFA 5I0UA 1PVC3 2EA7A 1VBA3 3PVNA 1TG7A 1O4ZA 1Q3EA 2D98A 2VUJA 3T3YA 3SKJE 3WHTA 2XBO3 4P9IA 2QFEA 4N43C 2HEYF 5FZOA 1AXZA 2VU9A 3ZPOA 2B8MA 3VHPA 2D40A 1F4AA 1V6MA 3RYRA 4ZS2A 1VBC2 4QX7A 2ZS6B 4F83A 1IQAA 1EY2A 2Y0IA 1HV1A 4QXBA 1S0CA 4RGAA 4U2AA 4X8NA 5ACA2 3IN9A 1MEC2 4XMAA 3SKVA 4RGGA 4BJ0A 1REEA 3NV1A 5ISLA 4D94A 4LORA 4TTGA 5CNAA 4QX5A 3S5AA 1UQXA 1DP0A 1FV3A 3FBMA 4QDSA 4RR3C 4XURA 4YW1A 5FV3A 1H8TB 1DGRN 2FMDA 5EZWA 5GZFA 4QT6A 3RZZA 3WP4A 5F7UA 4MGQA 1D4VB 3EJKA 4QX0A 2D6NA 1Y4WA 1KDKA 1QH6A 2PN5A 2Y0OA 3KT1A 1SPPB 2RG4A 2JWPA 2GNBA 2WDBA 1ENRA 2HWD3 3J7LA 3NNJA 3ZN5A 4TN7A 1QJFA 2OPKA 2H0BA 3K77A 4FTEA 2BWCA 1PO22 4BOWA 1OURA 5KC5A 5D2AA 1BEV2 1R64A 2QKDA 1JN2P 1I6XA 4QDRA 3VBSC 1UZWA 1BZWA 2QCSB 3V0BA 3ELNA 1NY72 1EAH3 3ZYFA 3HMYA 3BOPA 2LTNA 3WQ0A 4HK9A 4YG0A 4HSJA 1WLTA 5KXDA 4EWDA 2CYFA 1RHI3 5FZ6A 4RS5C 4Y1YA 1E57A 4NIIA 3ZXKA 3B94A 5T5OA 1K42A 5ABJC 4RN5A 1PX4A 2PTMA 5FPBA 4LPLA 4D7TA 1F9KA 4FFHA 4IQPA 5I0RA 2ZX4A 4BU2A 5JI9A 3M70A 4MUVA 4EN8B 3HNYM 4NMIA 2B42B 3APBA 3AKSA 2XONA 4JVAA 2WAAA 1AR73 1CPMA 1W6MA 3PIJA 1C4RA 5FY8A 3BVCA 3KV9A 3O0WA 2IXJA 4N7IA 1WBFA 5C7GA 2VBBA 1RUF2 4MHRA 3AK0A 2JECA 4MADA 4MLOA 2FDKA 4V1PA 3A21A 4R9DA 1B35C 4XBQA 5J7MA 4JHTA 4XILA 4YGDA 4BE3A 3JB4C 5A7PA 2XQRA 1H1IA 3BIEA 4XHXA 3H8UA 4Q1PA 3N7KA 2GP3A 3T4VA 3RZJA 4IEZA 4RQPA 2VO5A 2WO2A 4M00A 4YVWB 3SMHA 4URAA 3NL1A 5DDJ1 3VDDC 1N1TA 3B7MA 2W1QA 3UGHA 3WQ7A 2DCKA 1BQPA 2BVVA 5GM0A 2D3PA 2DTYA 2IXCA 3BB6A 1L3JA 5C3RA 5FYHA 1FMD2 2Q8DA 5LBCA 5IFTA 3S57A 2HWE2 2VTXA 1GKBA 2EXJA 2R072 1W6PA 3FHQA 4GZ9A 4JRAA 5LEJA 2HEVF 4H55A 1UX7A 2EALA 2RR13 1F4HA 5CVRA 2F4LA 1I3HA 4NHYA 4AGGA 4LBJA 1ALYA 4KG8A 2WRAA 3VDAA 3WCRA 2BU9A 3OGJA 1JOBA 1VBD1 2E7QA 4Q4X3 1G86A 2ZGQA 4QPGA 4Y24A 2GH8A 4YVSB 5A32A 1WW5A 3LZZA 4COVA 3VBFC 4WM8C 5FTTC 3P3PA 3NNMA 1OT5A 5K0UA 2Z5WA 3WG2A 3WDYA 5KHGA 1C8NA 1SFPA 1XNBA 1IQDC 4NWVA 1S4CA 1ENQA 3KHBA 5C5TA 3IPVB 5FP3A 4JGYC 5EWSA 4YLZA 2X10A 5G04L 2H6CA 2ZGTA 2RM22 5F6KA 5IVYA 1PO12 4M3CA 1HB1A 4CTEA 2Y26A 3VZKA 3S30A 1GR3A 1CZSA 1RUE1 1Y9QA 4IE5A 5FLHA 3ZR5A 2VW2A 4F8AA 4FPGA 3MIDA 5FP4A 5FREA 4ONUA 3VHRA 1CAVA 3KQ4B 4ZU4A 5C4WC 1IG3A 3VV1A 1VBA1 2ZEXA 3AZXA 1VBC3 3C7EA 2B5HA 3R0RA 4WM7A 4YM0A 2XBO1 1EV12 4RFT0 1VRH2 3RMXA 2ZCWA 5FZDA 3WUDA 1YI7A 3Q8AA 1NCRA 1VRBA 5TSWA 3UGGA 5ACA3 2FCTA 2VE1A 4YGBA 1MEC3 1IS3A 1HB2A 3FC0A 5JXHA 5FMOS 1XQNA 2J7MA 4QX8A 2WC2A 1PIV2 3LKJA 4P02B 2WNUA 4Q4V2 2Q8OA 1UZ0A 4LULA 4S2HA 1OBNA 1Q56A 4YFWA 3RWNA 1ZZCA 5FYIA 4XUQA 5ANNA 3ZYGA 5FMOL 2BW8A 4TWTA 5EPAA 1W9WA 1NQJA 2XUEA 4AXOA 4BLJA 3JQWA 5LBFA 4D6QA 2OA2A 3PJQA 4WVVA 2XL9A 4JGZA 4Q1RA 2JIJA 2VMHA 2WSVA 2YGMA 2QTWB 3MGUA 5FY5A 4CDUC 2KXLA 2W1WA 4XJWA 3WNPA 4LO6B 4XCAA 2AEYA 1LU2A 1H4HA 1PO23 1QOOA 2MEV2 3M2MA 3M3EA 4OLLA 1BEV3 5FZCA 3ZMNA 2VM9A 5F5IA 4E4ZA 3H8RA 4M0HA 2MPFA 4CDWC 2FBEA 1LOGA 1V6OA 1DHKB 1UY1A 2HWD1 2BDRA 2HLEA 2FQPA 2J42A 4QPIB 4XETA 4FFGA 3KZ4C 2BV4A 2JG8B 1KD7A 3KB5A 1KFXL 2VD7A 3F2ZA 3WG4A 1R082 5JZGC 4XJAA 3AJYA 2A7AA 1LGBA 2R49A 1UOJA 2E51A 3C7FA 2ERFA 1XNTA 4FO9A 4AVTA 1YRZA 3R4SA 1RHI1 1EPWA 1V0AA 2WFF2 3H1WA 2A1XA 2QQJA 3K4AA 1X9TA 4ARYA 1VAVA 4EJRA 1WD4A 5L9BA 1DLLA 1JZ6A 3BU0A 4CEYB 4JZRA 4KG0A 4XTPA 3P6BA 2A71A 3LDKA 1TNRA 4Q26A 4CPBD 5BY5A 5JPMB 4AEDB 5K9YA 2VW0A 2X09A 3DKWA 1W8WA 1RUF3 2DUOA 4GWNA 2VTFA 2ZGRA 4AEJA 5JOYA 3AL6A 1BMV1 1AR71 4E8CA 3MW4A 4IE0A 3OY8A 4GB31 4LBKA 1W8ZA 3KF3A 5C8CB 4XF1A 2BPA2 1H8VA 1UY2A 1RUI2 1N1YA 1ODNA 1OLRA 3LFIA 3CO2A 5CKMA 3V0BB 2QBXA 4BQ2A 2Y38A 3OBTA 2HWB2 2IUWA 4PLNA 5IT6A 4XF3A 3ZFEC 3ATGA 4FBFA 1UAIA 1H2MA 2PA7A 2RDRA 2YC4A 3MUZ1 5FBZA 5CB7A 1V6NA 5FYUA 3T2QA 2VCCA 1Q8SA 1W2UA 5CEHA 2WINB 1W6NA 1TMF2 4OVEA 4CDQA 1QJY2 4NWWA 5K8SA 5A7QA 4ZXEA 3ETPA 4YZ3A 1D4M2 1FMD3 1GZWB 1WCUA 2OS2A 4Z2WA 4YARA 1YQ5A 3ZO0B 1IKPA 1FAYA 1V6LA 3KVBA 1JODA 3ZFFA 2LUWA 1G9DA 2R073 1W3VA 3ASIA 1MZ5A 4OQ8A 4XDQA 1NLSA 1EP0A 3H7JA 1UYXA 4JQTA 5LCWL 1NZCA 4L9BA 1GNYA 3I49A 4IV1B 2OKXA 3LOIA 5IVCA 1OA4A 4JV4A 4MOAA 3WDUA 3VZNA 4XFCA 4AK3A 2NN8A 5GLUA 3OEAA 2RR11 4MX3A 4IV3A 5BNOA 2NPIA 1MQTB 2DTWA 3EYPA 1YIFA 5FPZA 4JHZA 5JMCA 3OYWB 1NT0A 4HETA 3IDEA 3QACA 4ARXA 2RMU2 2XJUA 2VBPA 5EQUA 2BQPA 3CQOA 4GH4B 3WDXA 2ZGLA 4IETA 2IXLA 2PHUA 2VW1A 2FZ1A 2RM23 1PO13 2WQ4A 3KCXA 3IZOA 2OUHA 2B39A 3SLIA 4INDA 3TYJA 4NVPA 3I3MA 2W3JA 3H50A 3HQXA 5A1FA 1OKOA 3GBGA 3I2DA 2O8OA 5C71A 1EV13 3VBHC 1VRH3 1KDMA 2D5FA 1CAUB 4GKYA 1GQGA 1CGPA 3H7YA 2IXIA 1OQDA 2V72A 1K45A 1HV0A 2JJ6A 3OUJA 1E5SA 1XB9A 3WF1A 1PIV3 2ZGNA 4WZCA 1X8EA 4QWNA 4V2VA 4YNIA 1XNKA 1CONA 2EIEA 4NR1A 4DOUA 1UYZA 4D69A 5LK7B 5JXIA 2VPVA 1AF9A 2NYYA 4S2GA 2CSGA 1MEC1 3O1TA 4Q27A 3UL2A 3T2TA 3VKLA 5AVAA 2OUJA 2JDHA 2XHKA 1F5JA 4XUPA 2G1MA 3T08A 2ILMA 1GUIA 2WNVB 5L7OA 4LT5A 3HBZA 2ZHLA 2MEV3 3LDBA 4RYDA 5DABA 4QXCA 1A78A 5FO8B 5KHKA 1H4GA 1SEFA 1MACA 3LF7A 4HPKB 2EXHA 4FI9A 3QBQA 4CDXA 4MXWA 5HCHA 2X29A 2GMEA 4FFIA 5LY2A 3POFA 1UOBA 3NV2A 2C1FA 5I93A 4LTAA 1FATA 3DN7A 4KU8A 1O8SA 1R083 3RRDA 2E31A 1ND2A 1NCRB 1C57A 1OA3A 4JTOA 4P9WA 3T0BA 2BGPA 3OOXA 2HJIA 5F3EA 4ZZ8A 3AYEA 2WO1A 1QOSA 5DG2A 4FT8A 3AYAA 3KCCA 4E2QA 1CX1A 2WNUB 4GKXA 2WYSA 2G9ZA 2VZPA 1VBB2 2WFF3 3FHAA 5FK7A 2VC9A 1UMHA 1RUD2 4LO8A 3KSCA 3J26N 4BDVB 3H0OA 3KQRA 1AL0G 4XQ4A 4CEWA 4CCEA 4Q4Y1 3S5QA 2D7FA 3VBUA 4BQ3A 3AKPA 3UV9A 4ATFA 1GOHA 5FYCA 5GLZA 2VCBA 3TWIA 2BP6A 3H1YA 1IG0A 1PGW2 3ILFA 4P9JA 1PX3A 2XDVA 3H8XA 2WA3A 5F37A 1LHUA 4R52A 3ZSEA 2VQUA 1O8PA 1RUI3 4XFGA 2DU1A 4XF9A 1A6CA 4LR4A 4EE2A 1RUF1 1WKYA 2HWB3 1WCDJ 4UF0A 5F8PA 4IGOA 3DL3A 2YC0A 4XQWA 2JICA 3FFQA 2PHLA 2WIIB 5LWBA 1MR5A 1QJY3 2BBVA 3NJZA 2QNKA 4MXVA 2VH9A 4HOOA 2YGLA 4UBGA 2X05A 1D4M3 3HQUA 4M01A 1T6BX 4LHKA 1OFSA 3D0JA 1VMHA 2W68A 2XLAA 3VBOA 1QU0A 3NNLA 1T6GC 3DYPA 2D6MA 4RQPC 3S7EA 1GQHA 2QZ2A 2ZA9A 3JB8A 4HFSA 4QQPA 1SLTA 4FP2A 4XAEA 3K3NA 2HWE1 4Q0QA 4QGNA 1BHGA 1PNGA 3VZLA 2VMFA 2R071 2OPWA 2VZQA 3EQEA 4RSUA 1QJU2 4OULA 1TNFA 3FE5A 4KWUA 1ND3A 4P5YA 4PI0A 1UU6A 5JIUA 2NM1A 2VMEA 2RMU3 2Q1FA 2ZHMA 2ZHKA 2ZMLA 2JIGA 1WWYA 4D6RA 3GCXA 3WG1A 5AC92 3SEPA 3GALA 1C5HA 1H9PA 1LGNA 1QH7A 4W50A 1DQ1A 3WW3A 3GBFA 5M0TA 1K12A 2PHXA 1GQPA 1NCQA 4QB2A 4QPGC 5A3LA 1UX6A 2QQWA 2Z4FA 4CDQB 2VL4A 2QQNA 1HX6A 2QQKA 3MIFA 4OZXA 3ZXFA 5KC6A 3KF5A 4PDWB 4QDQA 1HLCA 2YZ4A 5K0UC 1LENA 2RM21 4MGKE 1PO11 2EIBA 2P3KA 5CAZA 1Y9GA 5CFDB 2FCVA 1WGPA 1IZ3A 5EJ1B 2ZKLA 3JD72 3RJRA 1X8MA 2LM3A 3PMSA 1GWKA 1OF4A 1S2BA 1SACA 1W9SA 2XB6C 3GDBA 4NHLA 1EV11 2UWCA 3HVDA 5C70A 2EXIA 5JSPA 3LCPA 4S2FA 3CNAA 4WM7C 1Z7S1 1SBEA 5F39A 1OKQA 4YW3A 4AVCA 4DRVA 4AHWA 1PIV1 3K75B 1FPN2 1NCRC 3DECA 4MHUA 4Q29A 4Q4V1 3JCIA 2PXJA 1D2QA 2VXRA 1UYPA 3FX3A 5A3PA 4ZHNA 1ZBA1 4G9SB 1W0PA 2WNUC 2NP0A 2WT2A 3F95A 3SNMA 2K0GA 3Q8BA 4OHZA 3MICA 3ZMOA 2J1AA 3AKRA 4GIQA 1JYWA 2RV9A 4QX3A 1M06G 4QXHA 4RHV3 1GP5A 3BTAA 1GLHA 2W94A 1COV3 1KRIA 2MHFA 3KLSA 1RGSA 4WVMA 1W99A 3W21A 4JGZC 4XABA 1CQ9A 2JE8A 1D2SA 4PBOA 1AXYA 2JX9A 5J37A 2VNGA 3AP9A 3I2FA 3OSDA 5IK4A 1LHWA 4PIXA 4UFHA 4XQDA 1MS9A 5CIRA 4CCCA 4QMAA 2JDZA 5H9QA 4QPWA 4NRQA 1W6QB 2BUKA 1RUD3 3O1VA 3WR0A 3M3CA 4A6SA 2ZGPA 2ZKNA 5A6XA 1CAWA 4K20A 1WMFA 3D5OA 5ANQA 1LHOA 2BJSA 3BOWA 1VBE1 4UFIA 4B29A 4YM3A 1EYBA 3LDRA 3MDPA 5FO9B 2BYVE 2D3RA 4AL9A 4ASKA 4GXLA 2VAUA 4YRDA 1SQ4A 1EAH2 1SLIA 2GMMA 1CPNA 1S0FA 3AP5A 4RR3B 4QU2A 2LROA 4XFHA 3VKNA 4BK5A 4QKBA 4CA9A 5EIYB 5EYYA 4MXWB 2DVBA 3EXUA 4XFFA 5E16A 5IAXA 2CAVA 1SDDB 1PVXA 4XW3A 3JBG2 3AMMA 3ZFGA 1W6OA 1C1FA 1Q8PA 3LPFA 4RD7A 4AI8A 3WQBA 1HRI1 2ZMKA 1VMFA 3AX4A 4BZ4A 4YW7A 1ND2B 2AZ5A 4ES9A 2I74A 1ULPA 5J48A 2DV9A 4M0NA 2YG0A 3C8XA 3PMEA 4YZ1A 1GP4A 1UMIA 3J8F2 3TN91 3VBSB 2W47A 1HQLA 2WBKA 1QHDA 4PCRA 4URTA 3UESA 1RUH2 2PHTA 2OIIA 4AWDA 4C0HA 4TZDA 5F9TA 3KT7A 4QHZA 1CZTA 5FK8A 3RFRA 3I3EA 1TMF1 3LIHA 3THPA 4QGMA 3ZPYA 1R092 3HD8B 3LE0A 5DZGA 3DCQA 5F5QA 5FZ7A 4HVQA 4RS5B 4L8QA 2YXSA 1S0IA 4CYDA 2X5IA 1GOGA 2ZGKA 3HAGA 4FPLA 4QQ2A 4CDQC 2JD9A 1OD3A 1SFNA 2VNRA 2DDUA 3S7IA 3LWCA 2ENRA 1ST8A 3FWEA 5JOXA 3AMHA 4CCOA 4LBNA 3VDBA 3VUOA 1QJU3 1YIPA 3FHIB 1OUXA 5CU1A 3ZFFC 4D7YA 2YFUA 4IGQA 5A3TA 1UWWA 1XJAA 5H9PA 1PNFA 2KM2A 3OD4A 4CCKA 1QWRA 2PYTA 4GQ7A 4NE9A 1YNAA 3N9LA 5AC93 3ROUA 5LB6A 3ST7A 2OT7A 3T0DA 1GNHA 1HN1A 3H3UA 1LHNA 5A70A 3GJAA 4HSLA 3ZYPA 2RMU1 5T5PA 4IV3C 5BNOC 4QQOA 4QM8A 1B35B 4DXSA 2FDJA 2WO3A 5F3CA 4LBQB 2G19A 1CAXB 5LASA 4EROA 1R1A2 2DWRA 2RE9A 1W03A 5HXVA 3JD73 1LKNA 2QDNA 3BIWE 4P9GA 5DUUA 1BBT3 4Q4X2 2P3YA 1MZEA 1HXS3 4UFJA 4I0BA 5FUPA 3VDDB 1RUJ2 3SC7X 1YQ8A 4OI1A 4CVUA 4RA0A 1URXA 3I59A 1O5LA 4NN0A 5F5CA 2FMYA 1XE0A 1D7PM 3GYDA 4K8RB 5E6HA 4HKOA 1FPN3 1NAEA 3PTRB 3UKNA 2H6BA 3U07A 2JB8A 1UW8A 4P14A 4O61A 4P08A 2DCZA 1RUG3 2F17A 5EV7A 4Q8KA 1LOBA 4E4DX 1DZRA 2P2KA 2VZUA 5F5AA 1G9FA 3NO8A 3BTYA 5FZIA 1JOPA 1KXGA 4N53A 5F32A 2XKPA 4FVVA 4EN9B 1OLQA 1U5XA 4Y4RA 3VBFB 1OXCA 4WM8B 4AQTA 5LW9A 4K1YA 2WWJA 3DV8A 4RL7A 4XBNA 5GKAC 5FYTA 2GAUA 5EXOA 1JYCA 5DMYA 4YFZA 1F8VA 2DVFA 2CNAA 1LOFA 5L7OC 3FLRA 4FXKB 3WW4A 4JGYB 1T2XA 4HVRA 4Y1VA 4XYXA 3U1XA 3AFGA 3T1LA 1WMEA 2JB4A 5FCCA 5I8SA 3RI9A 1XNAA 2RDSA 4CDXC 5C4WB 2ZGOA 4LA2A 2UY8A 1NYWA 1XYNA 1YI9A 1C3HA 1H0BA 1LESA 5FZBA 3CZJA 3M4FA 1DQ6A 4HN1A 4LLOA 1ND2C 4CUCA 1IPSA 4XTMA 1NQDA 1VBB1 2QQIA 3BU7A 5FAXA 2DBNA 1XU2A 3TEZA 2SLIA 3D8CA 2DBIA 4L92A 1OH3A 3LEMA 3MFCA 1NLQA 4XPVA 3UKTA 2JE9A 4FOQA 5FUNA 1LNSA 1LOAA 5IW0A 3WUCA 4CRQA 1PGL2 1BYHA 2EVXA 4CUGA 1YUDA 2O0OA 1W8NA 4MGSA 4ORFA 1DQ2A 5DN2A 5A6YA 2TNFA 4CEWC 3JBG3 1C1LA 5EP9A 3FJSA 3RVHA 5CBLA 3LEKA 2EIGA 1PGW1 3T30A 3I3DA 1DIWA 2HWF2 3VBUC 3WNMA 1JZ7A 1UXZA 2XLGA 4CDUB 4XUOA 1B09A 2UWBA 4A44A 3GF6A 1PMIA 2BTVC 2I2SA 2PHWA 1HW5A 4OHWA 4UYBA 1WMDA 3J8F3 5FRAA 2AH2A 2OYZA 2C9AA 4CDWB 1H30A 4GWIA 1RUH3 3I2IA 3ZIXA 2C5DA 1JOJA 4Y20B 3U14A 5BNPA 4X8PA 1RUC2 1DYPA 4Y5TA 5C3OA 5FZGA 3JZVA 5BPXA 3E5XA 2JE7A 1R093 4DO0A 4Z1VA 5FO7B 1AX0A 2SBAA 5JZGB 2D43A 5A1LA 4M3CE 4GULA 2VQAA 1QJX1 4HT1T 4IEWA 1CJDA 1EPZA 1H2NA 2R30A 5SV5A 3WP6A 5FYYA 5FOJB 5I8YA 2WQZC 1NZIA 3GZAA 3P5BA 3V0AB 3RZGA 3IIIA 1HB3A 3VBOC 1JZ3A 3IDCB 3VD3A 2WABA 3WCSA 1TQ5A 1AUYA 1SLBA 1A34A 1IS6A 3ZFGB 4AHYA 1QJU1 2RDQA 4N8MA 4HKLA 4LK7A 4DQAA 2ARXA 2R062 2EICA 3FFZA 3ZSKA 4J1WA 1K3IA 2YMZA 3AJZA 1FNZA 1DQ4A 3C3VA 4META 1JW6A 2V5DA 1ND3C 4YG3A 1AHSA 4EZHA 4YGEA 1WUVA 3FMGA 3O1PA 2VOWA 4ZONA 2P3IA 1O3SA 4FOVA 2D5HA 3EB7A 5E1RA 1R1A3 1QGLA 4F3JA 5FBJA 3MIGA 3B9CA 3ZFEB 4GA9A 1O6UA 4EN6B 1NCQC 3ETQA 1GP6A 4NAOA 1DDLA 2WZPP 4FTBA 1U5IA 3D4KA 4QX2A 3WNNA 1RUJ3 3MBWA 3ECQA 2R042 1X50A 2P3JA 2YROA 3NJYA 4KBZA 3NW4A 4OMDA 2Z79A 1CWPA 3IDAA 3I3QA 1F31A 1ZRFA 4ZKTB 4QQHA 1F5FA 3NRUA 4C8DA 3SEEA 2W5FA 1AR92 2Q8CA 1AYN2 3LB9A 2C4XA 5SV8A 1K5MA 3LIGA 3KV6A 1PVC1 5FP8A 5A33A 1UKGA 1N3QA 2BERA 2G9FA 3J7HA 1YHFA 3JUUA 1A8DA 2W08A 2XVGA 5DZFA 5KXBA 3KCYA 3N9PA 4JX0A 1QXJA 4TLFA 3RSJA 4JQRA 4V2WA 3RYKA 2ZGSA 1UPIA 1HIXA 3CL1A 2GNDA 1O4TA 4CP2A 5L9VA 4AI3A 2PLV2 3A22A 4QHBA 1ONAA 2WO7A 5FPUA 5BV6A 1DZTA 1MS1A 2LALA 1QNWA 1LECA 5FWEA 4N9IA 4I09A 1JTZX 3EMRA 3I4IA 5FY1A 3O5SA 3UGFA 3GGLA 1XPWA 2YYOA 4XXAA 4G4FA 3PU3A 4FAGA 4FTSA 3NAPA 4CCDA 2WL1A 1VLNA 1MZ6A 2A6VA 5LRRA 2UYBA 1LODA 2VVDA 3L9JT 4XZUG 3VBHB 3PVBB 2J1VA 4CCMA 1ASJ3 3J7NA 3WDWA 4AFCA 1O7FA 2CWMA 5EJZB 3OTFA 2XOMA 4YZ4A 4EV0A 2JDNA 4XF0A 3ZDVA 5AFBA 3HT2A 1WBLA 2B4KA 1NA1A 3NV4A 2C24A 2K2SA 3C7OA 4D8MA 1KFUL 1GNZA 2RS12 2DCJA 5FZOB 5CADA 4E2SA 2NMNA 2QQOA 4FAHA 2R16A 1WLWA 1DU3D 2ZAHA 1BK0A 1UL9A 3O1SA 3VLBB 1DLCA 2VMIA 4IERA 4XC9A 1OC1A 1UIJA 3P1IA 1ZZ6A 3S6PA 1DGRA 4AAXA 2VGDA 1YXWA 4RFRB 3OGRA 4E27A 5DG1A 2HWF3 5IVFA 2ZZQA 1EAH1 1I5PA 1QKQA 5IK5A 2TUNA 2VOKA 2WS92 5I0DA 2DYCA 2ZX2A 3ACFA 1GOFA 1WMXA 2WLQA 5CISA 4NIDA 1V6KA 4ZY9A 3JBG1 4OUEA 4XIOA 3GXUA 1L7QA 3N9OA 4XCBA 2FDIA 3AMQA 2ARAA 3ES4A 2FDFA 3I2HA 1RUC3 1V00A 5IAVA 3ZFGC 1JBCA 1ENXA 3HN1A 4FXGB 2GH2A 4JKMA 4Q2FA 3LA7A 4TYSA 3MZHA 2WQ8A 1KITA 2QUOA 1H2KA 3J8F1 4AFAA 1TE1B 3BGAA 3IM0A 3QOPA 5FPVA 2JXAA 3R4DB 3GZUC 5B4XA 1JUIA 5A3OA 5KHJA 3P3NA 1PGSA 4IW3A 1R091 2OX0A 3GBWA 1JZ2A 1GU3A 1J3QA 3B69A 1LOCA 2ZX3A 5FZAA 1DFQA 1VBE2 2P1BA 2ZTNA 4FQZA 4Z92B 1YJLA 3PLQA 4GAZA 4W8JA 2ID4A 3RI8A 2QQLA 5A6QA 5L73A 2X5IC 1OPOA 3D3AA 2XGXA 2DVAA 1BJQA 2YY1A 4NRMA 4A42A 4O65A 2R063 2Y6JA 3CJIA 4K3UA 3MW3A 1HDKA 3TEXA 4W6WA 3DF0A 4IEPA 2YC2A 4HKWA 2O14A 3IAQA 3CHXA 3E5UA 1W6MB 4BQ4A 1VIWB 1DG6A 4PT6A 5BNPB 2CGOA 5JPNB 4DINB 4FQ4A 5T3NA 3OBRA 1OD5A 2GALA 4PQQA 1JI6A 2A75A 2IZWA 3ACLA 4CP9A 1RMU2 4LKEA 3LOBA 2R043 3VHNA 1QXRA 3LPGA 1WW4A 3PUSA 3NKGA 1CESA 4Q4X1 2J1RA 3I2GA 2OZJA 2JDAA 5FJHA 2LRPA 3TRSB 1AR93 3OBZA 4OUSA 2XJTA 4RQPB 5JIAA 1GWLA 2V4AA 4X6QB 3WOGA 1AYN3 1YQ2A 3HN3A 3GHNA 3AZZA 4OZOA 4BM8A 3W5NA 3H1MA 4Y4YA 4YWAA 2YPDA 4LQRA 3ZYBA 4AQ2A 4AQ6A 5A3NA 1RUNA 5GLTA 2A6YA 2P6CA 3NNGA 1V9U2 1Z0HA 1ZA4A 5CZKA 3PVEA 1GV9A 1ZBE2 4IE7A 5JMOA 2V09A 3NWKA 1XC6A 5J98B 3POBA 1PK6A 3G7DA 4M3CF 1W6PB 3I97A 4CXYA 4OI0A 2DUPA 2EIDA 2PLV3 3RS6A 1SG3A 4I02A 2Q1MA 1G6NA 3M3OA 1QIQA 1VBC1 5LA2A 4CXWA 1DBNA 1JYIA 2GP5A 3K48A 2UWAA 2VCAA 1WLDA 4LO4B 3OGGA 1Q8QA 3ZOIA 4A6OA 2HWC2 2ADEA 4BQXA 1FOD2 3HWJA 5ACA1 4N53C 2W0XA 3ITQA 1FV2A 4QPGB 4QX1A 1W8FA 3VN4A 2GC2A 3BCWA 5A32B 3E6CC 2OW4A 3VD5A 3BKZA 1AJOA 3WVJA 4UI9L 2DUQA 5K0UB 1OPMA 4U36A 3IWZA 4P00B 5I0TA 1LOFC 3WW2A 1A3KA 4M4PA 2JDPA 2ZABA 4A45A 1Q43A 4M3CB 3ZDSA 5HBAA 3HPNA 1WCKA 2JEMA 1K5MB 1NE4A 2RS13 1FYUA 1VPHA 3I7DA 4RHV2 4UW5A 1CAVB 4CP0A 4BXSV 1HQNA 5IATA 5EJ3A 1COV2 1TME2 5A33B 4MGIE 1FNYA 1PO21 2E26A 1PZ7A 4WM7B 1BEV1 3USUA 1UPSA 2WSUA 3PU8A 3URFA 3VL9A 5BYNA 3U78A 3VDCA 2BFUS 2W92A 1NY71 2QZ3A 1KQRA 4AFDA 4MO3M 1VE0A 3RYPA 1AXKA 3ZKUA 1PGL1 4FOWA 2WS93 3CIHA 1XBFA 1GFF2 4B7EA 2BFUL 1G9CA 1J3RA 3U11A 2JDYA 4CUBA 3PUAA 1QJZA 3O0XA 1O5UA 4XUNA 4P5HA 3WDTA 1W39A 2HWF1 3BN6A 4CU6A 3ZXLA 1X9PA 2ZZJA 4COWA 2WNOA 5C9AA 3N7MA 2R0FA 3NAPB 4YG6A 4KGGA 4AQSA 4HBNA 3SH4A 4ZPIA 4JGZB 3VBRA 1DQ0A 1XXNA 2DU0A 5F6LB 2XQXA 5A7SA 3OPTA 2ARBA 3AVSA 4O7XA 5E88A 4A7KA 4NIHA 3GZTB 4JCKA 1GBGA 2XPJA 5CKNA 3LFMA 4E2GA 4Y3OA 2Y6HA 2GSYA 4UOJA 5A7WA 4CCNA 4I3PA 2RS32 5DZEA 2VNOA 5EFUA 5BNPC 2E53A 3BPZA 4IDZA 1QQP2 5BNNA 5GZEA 1SBFA 1VBE3 4Y22A 3VB9A 3E6DA 1NE6A 2XUMA 3DKQA 2AEZA 1JS9A 5LBBA 4QB1A 1GICA 4I0WB 1ENSA 1G7YA 1I9RA 5FPLA 2W1UA 2B9UA 3NMBA 1KS5A 2NMOA 2LW8A 4LOSA 2XVKA 5IWFA 2JDKA 3MF6A 5FYMA 2BNOA 3POJA 1YCIA 4AFMA 3SISA 1U0AA 5D8AA 3CLPA 3VHOA 1JYVA 1VMJA 4I01A 3ZYHA 3M7AA 2NQYA 1FMD1 2R061 5JAXA 2E6VA 2OQ7A 5CG8A 2QDRA 4LK6A 3ZSMA 5HCBA 4YZ5A 2DF7A 1ULDA 4TLGA 1RMU3 4CCLA 3L2HA 4IEXA 4PF1A 1O3RA 2YBKA 2OZ6A 2WYFA 3OY8B 5CFCA 4R8HA 5FZLA 4GWMA 4LKDA 4N7UA 1SBDA 4UT5A 3SITA 4BH9A 1POQA 3WHUA 4E4SA 3DPRA 3IAPA 5JOWA 1UCXA 4L97A 3PUIA 3ZKYA 3AVRA 4LBQD 4AVBA 1X33A 4IEUA 1MS0A 2ZPXA 4OHVA 3V56A 1W05A 1W6NB 3J4UH 5FZEA 2Y8KA 1V9U3 1VB4A 2QQMA 3X29B 3C7HA 1CZVA 1OOPA 2R32A 1ZBE3 2ADDA 4XEZA 1AR91 3KV4A 5FXWA 1AYN1 4D6SA 3BYWA 3ZFFB 1YC61 1GYKA 1OUSA 3AXEA 4HMZA 4LHLA 1UOFA 3EHKA 2Y6KA 1YFYA 4JKLA 1IS4A 3O1RA 2W2IA 2D3SA 2YUEA 1BBT2 3O0VA 1K5MC 1HXS2 2Y64A 4W4ZA 3R4UA 5FMCA 1VRH1 1WZXA 2XWBB 3BTZA 5A3MA 2HWC3 1ACCA 4L0PA 1AR83 1FOD3 1C28A 2CDOA 4DNYA 2HYXA 4HL0A 3OB8A 1SLCA 4IV3B 1VBD2 5BNOB 1RJ7A 5FQ0A 4K21A 5DAPA 5C3PA 3ACIA 4NO4A 5G05L 4FSJA 2D6KA 1N1VA 1HJGA 1RUG2 4XE9A 3W20A 3CMGA 5B4NA 3CKHA 3HBKA 3POIA 1E5RA 2H0VA 1IPJA 1H8TA 1HB4A 1YO8A 3OGVA 4LXLA 2ZX0A 5LK5A 5FIXA 1CX4A 1S0JA 1RUE2 1TME3 3ZYJB 1SPPA 3NAPC 5HXMA 1XYPA 4GMP3 5FJKA 2MEV1 3EBRA 4AW7A 3ZXDA 3C7GA 1H6XA 1QY4A 3D6EA 4JC1A 3VL8A 2RS11 1UZVA 1AYM2 1LEMA 4O9GA 1W2TA 3U10A 1JH5A 1FT9A 1NA1C 2WN2A 3NNFA 4K6BA 3TOJA 1PMHX 1IHMA 3KM5A 2YFZA 2Z69A 5DUVA 2A6WA 2CGPA 1R081 2DVDA 4Z82A 4OFGA 1UKRA 1W2OA 4PF5A 5HCAA 5HCFA 4QKNA 2J22A 2ZJCA 3D0SA 1W8HA 1MS4A 3VKFC 1W04A 3I8TA 2B45X 2WS91 5JDBA 1JYNA 3Q9OA 1TEIA 4Q8LA 1C8M2 2YB7A 4DUXA 5FPAA 3GZEA 2WJSA 2WFF1 2ETEA 2IFRA 4D0QA 4DB5A 4XJ9A 5L7OB 3QD6A 3B00A 2R7EB 4AI2A 1UN1A 2XXZA 4CDXB 1GZ9A 1P8JA 3WF2A 2JD4A 5FDBA 3OD0A 3G6JB 3TNQA 2RS33 1NUKA 2CV6A 1QQP3 1OFNA 1KGYA 1IGOA 3N9QA 1DCSA 4IEQA 4EWAA 4QM9A 5GLVA 4XFBA 4ZU5A 3USUB 1UYYA 1SMVA 2W87A 3U4SA 1RUI1 2C26A 5JR7B 1RB8G 3QH6A 3AKQA 3JQXA 2HWB1 2IXHA 3M3IA 2R1DA 3I54A 1G9AA 1ZYBA 2AENA 2BGOA 4A3XA 3R6SA
chains in the Genus database with same CATH topology
2VTFA 3WSOA 1CIYA 1US2A 4E8CA 1NX9A 1UY2A 5DPNA 5IFPA 2QBXA 1JZ4A 3IIIA 2KD7A 1PMJX 4DUVA 2YC4A 3MUZ1 1JZ3A 3T2QA 2RJ2A 3VD3A 2WABA 2VCCA 3W5MA 1GMMA 4TXWA 1MPXA 3ETPA 4ZXEA 1L7RA 4ZZ5A 2EICA 1K3IA 2V5DA 2VQTA 4XVHA 4OYUA 1WCQA 1UYXA 3A23A 3DYOA 5LCWL 1GNYA 3HJRA 3EB7A 2J1TA 2J1EA 1ULOA 3PUHA 2OKXA 1J83A 4MOAA 3IB3A 3JXSA 2CDPA 3OEAA 3NQHA 3OG2A 3EYPA 4QX2A 4JHZA 3WNNA 3MBWA 3ECQA 4ARXA 4OMDA 3CQOA 3IDAA 2VZRA 2VR4A 2VOTA 4Z2AA 2VZ1A 3ABZA 3NRUA 3VD9A 3SEEA 2W5FA 2VZVA 1W0NA 2Y6GA 2W3JA 2PQSA 4LKSA 2C4XA 5C71A 3J7HA 2BERA 1RYYA 1JZ8A 1W8OA 4JX0A 2V72A 4QAWA 1K45A 2ORXA 3WF1A 3U37A 1OH4A 3A22A 5IYYA 2EIEA 4AG4A 1UYZA 4DXTA 5JR2A 3OGSA 5JXIA 2BZDA 2WAOA 5IJRA 3GGLA 4DUWA 1SHWB 1XPWA 1JZ5A 2ZXQA 4XUPA 3T08A 3OEBA 1GUIA 4XZUG 2J1VA 3MUY1 4RYDA 2XOMA 4HG6B 3NJXA 4FI9A 2B4KA 3WF4A 3C7OA 4D8MA 2ZEZA 2DCJA 3GM8A 2QQOA 5J1XA 1O8SA 1DLCA 2E31A 4IUGA 3WNKA 4ZZ8A 3T0BA 3P1IA 2BGPA 4JKKA 2WO1A 2VMDA 4AAXA 2VZTA 3OGRA 4XUTA 1CX1A 1I5PA 2WYSA 4GWJA 3CZUA 2VZPA 5I0DA 3FHAA 3ACFA 2VC9A 1GOFA 1UMHA 4ZY9A 4OUEA 4BDVB 3GXUA 1L7QA 4CU9A 3WNLA 3I2JA 3OBAA 3I2HA 2WZEA 3I3BA 4JKMA 1GOHA 2WQ8A 4CU7A 2VCBA 3WEZA 1W9TA 1PX3A 2VZOA 3BGAA 2VQUA 2VZ3A 1O8PA 4DEVA 2ZEYA 3FN9A 5B4XA 1WKYA 2XHNA 2B9VA 1JZ2A 3MO4A 1KEXA 1GU3A 1TVGA 1NKGA 4W8JA 2ID4A 2QQLA 2X05A 3D3AA 4A42A 2Y6JA 3HOBA 5FUIA 3K4ZA 2W91A 3DYPA 3THCA 3NJVA 2YC2A 3DYMA 3IAQA 1BHGA 4PT6A 3MV01 2VMFA 2VZQA 5CYYA 4PQQA 1JI6A 3WNOA 4KWUA 4P5YA 3A7QA 3T09A 4DEQA 2VMEA 3LEGA 4LHSA 3LPGA 3THDA 3SEPA 2VMCA 1DYOA 2J1RA 3I2GA 4W50A 2JDAA 4DXRA 1OF3A 1K12A 3T2OA 1GQPA 2C9KA 4QB2A 4ET7A 1YQ2A 3HN3A 3LQCA 4OZOA 2Z4FA 2ZEWA 1EUTA 2VL4A 2QQNA 2QQKA 4LQRA 5JUVA 3E1F1 4QDQA 3NNGA 5CZKA 2EIBA 5JMOA 1XC6A 2E32A 2J1UA 5EJ1B 3UETA 3CDZB 2WN3A 4BK4A 3I97A 1UY4A 1OF4A 1W9SA 2EIDA 5IHRA 4A4AA 3GDBA 1SG3A 5LA2A 2VZSA 4A3ZA 4E8DA 5C70A 3W5NA 3HNBM 3HNMA 2VCAA 4A41A 2J1SA 1JU4A 4A6OA 1TG7A 2L9LA 3SKJE 3K75B 4QX1A 3DECA 3VD5A 2LS6A 4UI9L 2ORZA 4P00B 1F4AA 2J1AA 4M4PA 4A45A 1JYWA 2RV9A 3HPNA 4QX3A 2W94A 3SKVA 4BJ0A 5LA1A 4BXSV 1W99A 5LA0A 3AC0A 4TTGA 2JE8A 2E26A 1DP0A 2W95A 4QDSA 4XURA 3VDCA 3I2FA 2RVAA 2W92A 5F7UA 4MGQA 2V4VA 1JU3A 4MO3M 4QX0A 3CIHA 5HPOA 2WDBA 4QPWA 4CUBA 3K77A 4XUNA 3BN6A 4CU6A 1R64A 4QDRA 3ACHA 3K46A 3ZM8A 2XQXA 5EIYB 4BK5A 1K42A 4RN5A 1PX4A 1SDDB 2Y6HA 4LPLA 4UOJA 4YPJA 3T2PA 3LPFA 3WQBA 3HNYM 3MV11 1ULPA 1H6YA 2YG0A 3C8XA 2XONA 4QB1A 1UMIA 2WAAA 2W47A 2WBKA 2JKXA 2W1UA 3UESA 3VD7A 2LW8A 3HEIA 5C7GA 1CZTA 2E33A 3I3EA 3LE0A 3LEIA 4MADA 5DQ0A 1JYVA 2W46A 3A21A 1GOGA 3UNPA 2JD9A 1OD3A 3WF0A 2DDUA 3I2KA 4OMCA 4UAPA 2W1SA 3VDBA 2YFUA 1UWWA 2VO5A 2WO2A 4PF1A 2W9XA 2W1QA 2DCKA 2WUHA 1UY0A 3IAPA 3T0DA 1HN1A 5IFTA 5JXJA 3PUIA 3VD4A 3FHQA 4GZ9A 1UX7A 1F4HA 4DXSA 2WO3A 2Y8KA 2QQMA 3C7HA 1CZVA 2WZ8A 3VDAA 1J84A 1EUUA 4QB6A 2Y6KA 4JKLA 1OT5A 2Y64A 4W4ZA 4CVUA 1JYXA 1IQDC 2VJXA 4L0PA 1D7PM 2CDOA 2X10A 5G04L 2HYXA 3OB8A 1NAEA 1CZSA 3ACIA 3ACGA 1UXXX 4P08A 5G05L 4KI5M 2ZEXA 2VZUA 3C7EA 3CMGA 5B4NA 3CKHA 5JXGA 3OGVA 5JXHA 2J7MA 4P02B 1UZ0A 5HXMA 5DMYA 3C7GA 4XUQA 1H6XA 1T2XA 4M4RA 1W9WA 1XNAA 1O59A 2WN2A 1PMHX 5A1AA 2YFZA 3K4DA 1UY3A 2W1WA 3WNPA 3CZJA 2J22A 4CUCA 2VM9A 2Y6LA 1JYNA 2QQIA 3T0AA 4DUXA 1UY1A 2YB7A 2HLEA 3WF3A 4D0QA 2BBAA 1LNSA 2R7EB 3F2ZA 3FL7A 1W8NA 4MGSA 1JHJA 5DN2A 1P8JA 3WF2A 1US3A 3LEKA 1NUKA 3WNMA 3C7FA 3I3DA 1JZ7A 1XNTA 1KGYA 1UXZA 4XUOA 4A44A 4KMQA 1UYYA 2W87A 2QQJA 3K4AA 4ARYA 2C26A 4CU8A 1JZ6A 4GWIA 3P6BA 2BGOA 3I2IA 5EJZB 2X09A 4CUAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VTF A;  3WSO A;  1CIY A;  1US2 A;  4E8C A;  1NX9 A;  1UY2 A;  5DPN A;  5IFP A;  2QBX A;  1JZ4 A;  3III A;  2KD7 A;  1PMJ X;  4DUV A;  2YC4 A;  3MUZ 1;  1JZ3 A;  3T2Q A;  2RJ2 A;  3VD3 A;  2WAB A;  2VCC A;  3W5M A;  1GMM A;  4TXW A;  1MPX A;  3ETP A;  4ZXE A;  1L7R A;  4ZZ5 A;  2EIC A;  1K3I A;  2V5D A;  2VQT A;  4XVH A;  4OYU A;  1WCQ A;  1UYX A;  3A23 A;  3DYO A;  5LCW L;  1GNY A;  3HJR A;  3EB7 A;  2J1T A;  2J1E A;  1ULO A;  3PUH A;  2OKX A;  1J83 A;  4MOA A;  3IB3 A;  3JXS A;  2CDP A;  3OEA A;  3NQH A;  3OG2 A;  3EYP A;  4QX2 A;  4JHZ A;  3WNN A;  3MBW A;  3ECQ A;  4ARX A;  4OMD A;  3CQO A;  3IDA A;  2VZR A;  2VR4 A;  2VOT A;  4Z2A A;  2VZ1 A;  3ABZ A;  3NRU A;  3VD9 A;  3SEE A;  2W5F A;  2VZV A;  1W0N A;  2Y6G A;  2W3J A;  2PQS A;  4LKS A;  2C4X A;  5C71 A;  3J7H A;  2BER A;  1RYY A;  1JZ8 A;  1W8O A;  4JX0 A;  2V72 A;  4QAW A;  1K45 A;  2ORX A;  3WF1 A;  3U37 A;  1OH4 A;  3A22 A;  5IYY A;  2EIE A;  4AG4 A;  1UYZ A;  4DXT A;  5JR2 A;  3OGS A;  5JXI A;  2BZD A;  2WAO A;  5IJR A;  3GGL A;  4DUW A;  1SHW B;  1XPW A;  1JZ5 A;  2ZXQ A;  4XUP A;  3T08 A;  3OEB A;  1GUI A;  4XZU G;  2J1V A;  3MUY 1;  4RYD A;  2XOM A;  4HG6 B;  3NJX A;  4FI9 A;  2B4K A;  3WF4 A;  3C7O A;  4D8M A;  2ZEZ A;  2DCJ A;  3GM8 A;  2QQO A;  5J1X A;  1O8S A;  1DLC A;  2E31 A;  4IUG A;  3WNK A;  4ZZ8 A;  3T0B A;  3P1I A;  2BGP A;  4JKK A;  2WO1 A;  2VMD A;  4AAX A;  2VZT A;  3OGR A;  4XUT A;  1CX1 A;  1I5P A;  2WYS A;  4GWJ A;  3CZU A;  2VZP A;  5I0D A;  3FHA A;  3ACF A;  2VC9 A;  1GOF A;  1UMH A;  4ZY9 A;  4OUE A;  4BDV B;  3GXU A;  1L7Q A;  4CU9 A;  3WNL A;  3I2J A;  3OBA A;  3I2H A;  2WZE A;  3I3B A;  4JKM A;  1GOH A;  2WQ8 A;  4CU7 A;  2VCB A;  3WEZ A;  1W9T A;  1PX3 A;  2VZO A;  3BGA A;  2VQU A;  2VZ3 A;  1O8P A;  4DEV A;  2ZEY A;  3FN9 A;  5B4X A;  1WKY A;  2XHN A;  2B9V A;  1JZ2 A;  3MO4 A;  1KEX A;  1GU3 A;  1TVG A;  1NKG A;  4W8J A;  2ID4 A;  2QQL A;  2X05 A;  3D3A A;  4A42 A;  2Y6J A;  3HOB A;  5FUI A;  3K4Z A;  2W91 A;  3DYP A;  3THC A;  3NJV A;  2YC2 A;  3DYM A;  3IAQ A;  1BHG A;  4PT6 A;  3MV0 1;  2VMF A;  2VZQ A;  5CYY A;  4PQQ A;  1JI6 A;  3WNO A;  4KWU A;  4P5Y A;  3A7Q A;  3T09 A;  4DEQ A;  2VME A;  3LEG A;  4LHS A;  3LPG A;  3THD A;  3SEP A;  2VMC A;  1DYO A;  2J1R A;  3I2G A;  4W50 A;  2JDA A;  4DXR A;  1OF3 A;  1K12 A;  3T2O A;  1GQP A;  2C9K A;  4QB2 A;  4ET7 A;  1YQ2 A;  3HN3 A;  3LQC A;  4OZO A;  2Z4F A;  2ZEW A;  1EUT A;  2VL4 A;  2QQN A;  2QQK A;  4LQR A;  5JUV A;  3E1F 1;  4QDQ A;  3NNG A;  5CZK A;  2EIB A;  5JMO A;  1XC6 A;  2E32 A;  2J1U A;  5EJ1 B;  3UET A;  3CDZ B;  2WN3 A;  4BK4 A;  3I97 A;  1UY4 A;  1OF4 A;  1W9S A;  2EID A;  5IHR A;  4A4A A;  3GDB A;  1SG3 A;  5LA2 A;  2VZS A;  4A3Z A;  4E8D A;  5C70 A;  3W5N A;  3HNB M;  3HNM A;  2VCA A;  4A41 A;  2J1S A;  1JU4 A;  4A6O A;  1TG7 A;  2L9L A;  3SKJ E;  3K75 B;  4QX1 A;  3DEC A;  3VD5 A;  2LS6 A;  4UI9 L;  2ORZ A;  4P00 B;  1F4A A;  2J1A A;  4M4P A;  4A45 A;  1JYW A;  2RV9 A;  3HPN A;  4QX3 A;  2W94 A;  3SKV A;  4BJ0 A;  5LA1 A;  4BXS V;  1W99 A;  5LA0 A;  3AC0 A;  4TTG A;  2JE8 A;  2E26 A;  1DP0 A;  2W95 A;  4QDS A;  4XUR A;  3VDC A;  3I2F A;  2RVA A;  2W92 A;  5F7U A;  4MGQ A;  2V4V A;  1JU3 A;  4MO3 M;  4QX0 A;  3CIH A;  5HPO A;  2WDB A;  4QPW A;  4CUB A;  3K77 A;  4XUN A;  3BN6 A;  4CU6 A;  1R64 A;  4QDR A;  3ACH A;  3K46 A;  3ZM8 A;  2XQX A;  5EIY B;  4BK5 A;  1K42 A;  4RN5 A;  1PX4 A;  1SDD B;  2Y6H A;  4LPL A;  4UOJ A;  4YPJ A;  3T2P A;  3LPF A;  3WQB A;  3HNY M;  3MV1 1;  1ULP A;  1H6Y A;  2YG0 A;  3C8X A;  2XON A;  4QB1 A;  1UMI A;  2WAA A;  2W47 A;  2WBK A;  2JKX A;  2W1U A;  3UES A;  3VD7 A;  2LW8 A;  3HEI A;  5C7G A;  1CZT A;  2E33 A;  3I3E A;  3LE0 A;  3LEI A;  4MAD A;  5DQ0 A;  1JYV A;  2W46 A;  3A21 A;  1GOG A;  3UNP A;  2JD9 A;  1OD3 A;  3WF0 A;  2DDU A;  3I2K A;  4OMC A;  4UAP A;  2W1S A;  3VDB A;  2YFU A;  1UWW A;  2VO5 A;  2WO2 A;  4PF1 A;  2W9X A;  2W1Q A;  2DCK A;  2WUH A;  1UY0 A;  3IAP A;  3T0D A;  1HN1 A;  5IFT A;  5JXJ A;  3PUI A;  3VD4 A;  3FHQ A;  4GZ9 A;  1UX7 A;  1F4H A;  4DXS A;  2WO3 A;  2Y8K A;  2QQM A;  3C7H A;  1CZV A;  2WZ8 A;  3VDA A;  1J84 A;  1EUU A;  4QB6 A;  2Y6K A;  4JKL A;  1OT5 A;  2Y64 A;  4W4Z A;  4CVU A;  1JYX A;  1IQD C;  2VJX A;  4L0P A;  1D7P M;  2CDO A;  2X10 A;  5G04 L;  2HYX A;  3OB8 A;  1NAE A;  1CZS A;  3ACI A;  3ACG A;  1UXX X;  4P08 A;  5G05 L;  4KI5 M;  2ZEX A;  2VZU A;  3C7E A;  3CMG A;  5B4N A;  3CKH A;  5JXG A;  3OGV A;  5JXH A;  2J7M A;  4P02 B;  1UZ0 A;  5HXM A;  5DMY A;  3C7G A;  4XUQ A;  1H6X A;  1T2X A;  4M4R A;  1W9W A;  1XNA A;  1O59 A;  2WN2 A;  1PMH X;  5A1A A;  2YFZ A;  3K4D A;  1UY3 A;  2W1W A;  3WNP A;  3CZJ A;  2J22 A;  4CUC A;  2VM9 A;  2Y6L A;  1JYN A;  2QQI A;  3T0A A;  4DUX A;  1UY1 A;  2YB7 A;  2HLE A;  3WF3 A;  4D0Q A;  2BBA A;  1LNS A;  2R7E B;  3F2Z A;  3FL7 A;  1W8N A;  4MGS A;  1JHJ A;  5DN2 A;  1P8J A;  3WF2 A;  1US3 A;  3LEK A;  1NUK A;  3WNM A;  3C7F A;  3I3D A;  1JZ7 A;  1XNT A;  1KGY A;  1UXZ A;  4XUO A;  4A44 A;  4KMQ A;  1UYY A;  2W87 A;  2QQJ A;  3K4A A;  4ARY A;  2C26 A;  4CU8 A;  1JZ6 A;  4GWI A;  3P6B A;  2BGO A;  3I2I A;  5EJZ B;  2X09 A;  4CUA A; 
#chains in the Genus database with same CATH topology
 2Q1Z B;  2AYH A;  5KWR A;  4C91 A;  3I2O A;  3WY6 A;  2QQU A;  3ZYR A;  4IL7 A;  4D3W A;  1ULC A;  1O91 A;  1QJY 1;  5KR7 A;  4YVW A;  1CIY A;  2W52 A;  4IE4 A;  3HQR A;  4MGZ E;  5AVP A;  1AL2 2;  4YM2 A;  1CJP A;  1D4M 1;  1NX9 A;  3MIE A;  2GU9 A;  4AAP A;  4CEW B;  4KNC A;  5IFP A;  5KBF A;  4EYU A;  3A0N A;  3LGR A;  3M3Q A;  3VBU B;  2GN7 A;  1JZ4 A;  3VBR B;  2ARE A;  2WT0 A;  3SHR A;  3OCP A;  3MFA A;  3CJI C;  4PBP A;  1S1A A;  4BLI A;  4DUV A;  5HV4 A;  2FHR A;  1W06 A;  4AHX A;  1OA2 A;  5LEK A;  3W5M A;  1GMM A;  4TXW A;  1VR3 A;  4E4H A;  1UU5 A;  4IXL A;  1BMV 2;  4GB3 2;  4KH9 A;  4KL1 A;  3KMH A;  4UF0 B;  1JMU B;  1RTV A;  2XH6 A;  5BNN B;  1GSL A;  4Y22 B;  4FPK A;  4YVS A;  5GZD A;  1BVP 1;  2GC1 A;  2VQT A;  1ODM A;  1YJK A;  1DGW A;  4XVH A;  1QDO A;  3A23 A;  4UW4 A;  4AEK A;  5DDJ 3;  4Y1X A;  2R0H A;  2ZGU A;  3HJR A;  2J1E A;  3ES1 A;  3IPV A;  2A70 A;  1S2E A;  5FZK A;  1XNC A;  3JXS A;  3VBO B;  3AKT A;  4BA6 A;  3ZN4 A;  2VOX A;  3VZJ A;  4A7Z A;  5FMD A;  4IE6 A;  1J1L A;  2AUY A;  1ZBE 1;  3UJO A;  3LD8 A;  3N3H A;  2IC1 A;  4XHB A;  5JLV A;  2VZR A;  2XWJ B;  3O7O A;  2VR4 A;  1HN0 A;  2VOT A;  2VZ1 A;  3PIG A;  2JDM A;  4COY A;  3UT0 A;  1PM4 A;  2EF6 A;  5IVB A;  3M1H A;  4XJU A;  1KJR A;  4YW6 A;  1VBD 3;  3O1U A;  1PK6 C;  2VZV A;  3C2U A;  1RXG A;  1ND3 B;  2Y6G A;  2PQS A;  4LKS A;  2XR4 A;  1NLR A;  3AXD A;  3B9I A;  5FZ3 A;  2HWC 1;  2XKO A;  4FPJ A;  1J59 A;  4MG2 A;  1SLA A;  3DPR B;  1OLM A;  3PTY A;  4KQ7 A;  2CHH A;  3UYJ A;  5I91 A;  2DCY A;  3WLU A;  5FP7 A;  1HKD A;  1W8O A;  3ZXA C;  4AF9 A;  4QAW A;  1NCQ B;  4KWJ A;  4AVA A;  1YYN A;  2VVF A;  3RZL A;  3WZ1 A;  2WA4 A;  1RUE 3;  1LU1 A;  3NKT A;  4XJ8 A;  3K51 A;  3U37 A;  4WV8 A;  4Q0U A;  5J96 B;  3OJB A;  4OCT A;  1W2N A;  4KWL A;  5JWP A;  3H8O A;  3BI3 A;  3N9M A;  1OI6 A;  4YW2 A;  2F6B A;  4NRP A;  4AG4 A;  4BIF A;  4IES A;  1LED A;  1LGC A;  2QE3 A;  1AYM 3;  4GJZ A;  4KWK A;  4RHV 1;  2WAO A;  4UFM A;  2Q5T A;  4RGK A;  2X8K A;  1QXP A;  1COV 1;  1TME 1;  2A6Z A;  2P37 A;  1Q8V A;  5IJR A;  5JSO A;  2VVE A;  1SHW B;  4GAL A;  4GMP 1;  4MZU A;  5C8W A;  5FR3 A;  1OQ1 A;  4QPI A;  3LA2 A;  2ZXQ A;  1JZ5 A;  2VEC A;  4L99 A;  2JG8 A;  4PLM A;  4ZS3 A;  4FPO B;  3MUY 1;  5LAT A;  1DGL A;  1S55 A;  1WCS A;  2PHD A;  4HG6 B;  4LA3 A;  1IOA A;  1ASJ 2;  2Q4S A;  3IKW A;  5FQ0 B;  3V64 A;  4N9H A;  2FZ2 A;  1XND A;  3WF4 A;  1C8M 3;  5FMB A;  2ZEZ A;  3MLK A;  3TEW A;  3GM8 A;  5J1X A;  1RUD 1;  2NLR A;  3KGL A;  4GJY A;  5FP9 A;  2EAA A;  1AR6 2;  3OUI A;  1XYO A;  4AVV A;  4IUG A;  4R4Z A;  3WNK A;  3KT4 A;  4XMI A;  4R4X A;  5CG9 A;  3AP7 A;  1VB2 A;  2K46 A;  1SZB A;  2Y33 A;  4JKK A;  2VMD A;  4CEY A;  2VZT A;  4XUT A;  3T1M A;  4AED A;  5C9A C;  3ZLI A;  4WVM B;  4DXZ A;  2V73 A;  4GWJ A;  3CZU A;  2RDN A;  4FPE A;  2XVL A;  3VBR C;  4Y33 A;  4QPY A;  1BK1 A;  2RS3 1;  4Q4W 2;  5C8C A;  1TZO A;  3ZYI B;  1N1S A;  1QQP 1;  1C5I A;  3MIH A;  3USS A;  3WNL A;  1V6I A;  3I2J A;  3MHZ A;  3OBA A;  4K7J A;  4AGR A;  3PL0 A;  2PAM A;  2WZE A;  3KVA A;  2A6X A;  3I3B A;  3WIN E;  1XSR A;  3CBN A;  1AX2 A;  1H9W A;  3DEM A;  2WWU A;  1R1Z A;  1CIW A;  1Y3T A;  1W9T A;  5BNN C;  5C33 A;  2BNN A;  1S0E A;  1AL2 3;  2Z2S B;  2VZO A;  3V65 A;  4B3N A;  2GDF A;  2VQ0 A;  3LSE A;  1CAW B;  4DEV A;  1JHN A;  3FN9 A;  1GAN A;  2JG9 A;  2IXK A;  3IMN A;  3ZXG A;  4BQ5 A;  3B01 A;  2XHN A;  1GZW A;  5K4L A;  3AYD A;  2B9V A;  4Q4Y 2;  3MO4 A;  1H1M A;  1APN A;  1JUH A;  5FZ9 A;  2D97 A;  1TVG A;  3CF6 E;  4LO7 A;  1H1A A;  1KS4 A;  4LLF A;  4EZ4 A;  4IEV A;  1NKG A;  4JDO A;  5IVE A;  5D8A C;  3RMY A;  2ZAA A;  3MPB A;  3B93 A;  4GB3 3;  1S0D A;  2O8Q A;  1OVP A;  2PEL A;  1ULE A;  2YBP A;  1ZRI A;  3AP4 A;  4IV1 A;  1W6O B;  3WDV A;  4BME A;  4N90 A;  5FLI A;  3HOB A;  1YQ6 A;  3MF9 A;  5FUI A;  4ZU7 A;  2W91 A;  4XF4 A;  4XDP A;  2QQV A;  1LCL A;  1MQT A;  4DFS A;  4YW4 A;  3POE A;  3OYW A;  1UIK A;  5FYZ A;  3DYM A;  2VUC A;  5CFC C;  5AC9 1;  4GH4 A;  4MGY E;  4OI2 A;  4AFB A;  5E89 A;  3DPR C;  1V70 A;  4FOY A;  4BPZ A;  2VOV A;  4W6Y A;  2PAK A;  1WA4 A;  5HI0 A;  1DZQ A;  3HR9 A;  3N35 A;  4AI0 A;  3T09 A;  3A7Q A;  1UO9 A;  3DGT A;  4DEQ A;  2QQP A;  5H9R A;  2HYK A;  4C0B A;  4B4Q A;  2X5I B;  2PAE A;  2YV8 A;  1N3P A;  3RWK X;  3TBD A;  3MIB A;  1W9Y A;  1UOG A;  1RIT A;  1OOP C;  2XJR A;  3THD A;  5FFO C;  2VMC A;  4I0A A;  3JD7 1;  1CAU A;  2WZR 2;  1XU1 A;  2AC1 A;  3T2O A;  2I45 A;  1BBT 1;  2C9K A;  1L7L A;  1HXS 1;  5FY4 A;  3RPQ A;  4ET7 A;  1ULG A;  3LQC A;  2ZEW A;  3AM2 A;  4LUM A;  3PHM A;  5DAQ A;  3NV3 A;  1ZA7 A;  5JUV A;  2P5B A;  1F15 A;  1SFY A;  2GNM A;  2KA3 A;  2C0Z A;  2ZMN A;  3E1F 1;  4IEY A;  5DUW A;  2ES3 A;  3VZM A;  4LOT A;  1OQE A;  2YU2 A;  3PVO A;  5C5U A;  3N4M A;  5AFE A;  1FPN 1;  1VAK A;  2CTV A;  3PUQ A;  2P17 A;  2J1U A;  3SCH A;  3CDZ B;  1FI2 A;  3WP5 A;  2WN3 A;  2Z42 A;  1UY4 A;  4TSV A;  5EHD A;  2OXB A;  5IK8 A;  1RUG 1;  3KGZ A;  4HN0 A;  4MGT A;  3PNA A;  4H14 A;  2VG9 A;  2VZS A;  1Y7B A;  2XG3 A;  2WNV A;  5FZH A;  3HNB M;  3HNM A;  3UJQ A;  2OVU A;  5KHI A;  3H9A A;  2VXJ A;  4EN7 B;  2J1S A;  1JU4 A;  3ORJ A;  4YM1 A;  4J1X A;  5FZ8 A;  2L9L A;  2VBD A;  1H8T C;  4HPK A;  3ZXJ A;  3ZSL A;  3IDB B;  1STM A;  3LA3 A;  3VZO A;  1NOV A;  2LS6 A;  3O12 A;  5A3U A;  4A7Y A;  4AGV A;  3RNS A;  3OPW A;  1WW7 A;  5IVJ A;  2ORZ A;  1LRH A;  3I59 B;  1AYM 1;  4Y1U A;  1GZT A;  1XRU A;  4OUM A;  1GWM A;  5CKQ A;  4C1X A;  4ISQ A;  4XFI A;  1OHF A;  1Z7S 2;  3O1M A;  2PHR A;  4JAA A;  5T52 A;  4K9S A;  3H42 B;  3HIF A;  5LA1 A;  5LA0 A;  1QJE A;  3AC0 A;  3E97 A;  3FLT A;  4W6X A;  4AEM A;  4DY3 A;  1CVN A;  1ZBA 2;  2IVI B;  3ZXE A;  1AR6 3;  2HEW F;  3ZVX A;  2W95 A;  3KV5 A;  4LE3 A;  4N53 B;  2GN3 A;  1C8M 1;  3K3O A;  3ZX7 A;  2RVA A;  5FXX A;  2P34 A;  5FKB A;  2V4V A;  4B4P A;  1JU3 A;  3M8L A;  3AP6 A;  4AYU A;  4BMB A;  1ZNP A;  4P9X A;  4K8F A;  4UFK A;  5FYB A;  1FXZ A;  5HPO A;  3VKO A;  1HJF A;  4LKF A;  3TAY A;  4AVS A;  4MSV A;  4Y1Z A;  4CPB A;  4Q4W 3;  1CN1 A;  1RUO A;  2X53 S;  3AMN A;  3ACH A;  3TNP B;  3K46 A;  2W39 A;  4DPN A;  2CY6 A;  4COZ A;  3ZN6 A;  1AX1 A;  4R9C A;  1SCS A;  4XZP A;  2E7T A;  5T50 A;  2WR9 A;  3ZM8 A;  1UZZ A;  1Y43 B;  4OHY A;  4XAA A;  4W65 A;  4BCU A;  1XOY A;  1Q5O A;  3H3Z A;  1J1T A;  4Y5S A;  3GJB A;  1RUH 1;  3DXU A;  4LE4 A;  4XXP A;  3RGB A;  4FPY A;  4Q4Y 3;  4YPJ A;  3WV6 A;  2TBV A;  1VP6 A;  3ENR A;  3T2P A;  4UWD A;  1AL2 1;  4LIV A;  1MZF A;  5LY1 A;  3MV1 1;  2YPJ A;  1YWK A;  4J6G A;  2VTX J;  4JTN A;  1H6Y A;  2XL7 A;  4NPR A;  1BLZ A;  4YVW C;  2WLP A;  2KR2 A;  4ISR A;  4BHP A;  2UYA A;  5K7P A;  2D6P A;  4IEO A;  3MEP A;  1S2K A;  2GNT A;  2JKX A;  5T5J A;  1RJ8 A;  3VD7 A;  3HEI A;  4Q5O A;  2HBU A;  3BTX A;  1S0G A;  2XLF A;  2E33 A;  2PQQ A;  3KWV A;  5FZ4 A;  4YZ2 A;  3ZSJ A;  3LEI A;  1HRI 2;  4QKD A;  5DQ0 A;  2W46 A;  2XML A;  5F2S A;  3FUQ A;  1QEX A;  4YGC A;  4BXF A;  3UNP A;  4H7M A;  3KHC A;  4FPC A;  4OHX A;  3WF0 A;  2ZOE B;  3TN9 2;  3I2K A;  4OMC A;  4UAP A;  4LIT A;  2W1S A;  1MVQ A;  1REF A;  1ZZB A;  4QU1 A;  4R9A A;  4YVS C;  4B1L A;  2W9X A;  2JG9 B;  4PDW A;  1R1A 1;  2WUH A;  2BRT A;  1UY0 A;  1RVF 2;  3POG A;  4FPF A;  2HWE 3;  5H9S A;  2WZR 3;  4NOT A;  5CFD A;  5A7O A;  3A0K A;  5JVV A;  5JXJ A;  3VD4 A;  1RUJ 1;  4QD2 A;  3W59 A;  2DUR A;  4HLT A;  5DXD A;  1W0O A;  4DZG A;  3WG3 A;  1BCX A;  2K9Z A;  2WZ8 A;  1LR5 A;  1YFW A;  1J84 A;  1SDW A;  1HRV 2;  3J7M A;  2RS5 2;  4LHN A;  4DRR A;  5B2G B;  1O3T A;  1MS8 A;  1KJL A;  1EUU A;  4IGP A;  5BXX A;  3U75 A;  4QB6 A;  1N3O A;  5A7N A;  1U12 A;  5LA9 A;  2AR6 A;  3MI8 A;  1UMZ A;  1DYK A;  3MW2 A;  5C3Q A;  2BVB A;  3TB0 A;  3LSD A;  4AI9 A;  4BYY A;  1JYX A;  1XE8 A;  2VJX A;  5D1I A;  1YFU A;  2FD8 A;  1O4Y A;  1NXD 1;  2XJV A;  4XFA A;  1U5Z A;  2IVJ A;  1AR8 2;  3BAL A;  4QHO A;  1ZZ9 A;  2AGS A;  3UKV A;  2GC3 A;  4G3Y C;  2O1Q A;  2UY9 A;  3VKM A;  1D0G A;  3B5L B;  2VMG A;  3RQ0 A;  3SH3 A;  2BGC A;  1UXX X;  1HQW A;  2MNG A;  3ACG A;  3GCW A;  4KI5 M;  1LAJ A;  3BOD A;  1ZZ8 A;  3POW A;  1ZRR A;  2VNV A;  2QVS B;  5JXG A;  3ME2 A;  1YLL A;  1J58 A;  1Z7S 3;  4H7L A;  4O9E A;  2JDU A;  4LJH A;  4Q4V 3;  4N43 A;  4EWE A;  1IPK A;  4BIS A;  5LRS A;  3MPP G;  3IMM A;  4QPI C;  1ZBA 3;  3PUR A;  1IKQ A;  1ASJ 1;  3CU7 A;  3ALQ A;  1RIR A;  2JG8 C;  1W6Q A;  3RZK A;  3BUC A;  3Q8F A;  4M4R A;  4XAC A;  3SCF A;  4AOC A;  1MS3 A;  1RIN A;  2Q0A A;  4PJY A;  5L9R A;  1AJK A;  1O59 A;  2VY0 A;  4ITC A;  4CSW A;  2WKK A;  2TEP A;  2VUL A;  1W8T A;  2DFB A;  4FP3 A;  4YW5 A;  5A1A A;  1AR6 1;  5DAV A;  3ILN A;  3WX5 A;  3FLP A;  1ULF A;  3K4D A;  1RED A;  3POS A;  1Q8O A;  1VAM A;  4I3G A;  1UY3 A;  2GZW A;  3A4U A;  4RR3 A;  2A3X A;  2WT1 A;  1BKZ A;  2E7A A;  5FPX A;  2RHP A;  1DF0 A;  3E6B A;  2D6L X;  2Y6L A;  4P9L A;  4AI1 A;  2EAK A;  4CEY C;  4BQ1 A;  3T0A A;  2JEN A;  4P9Y A;  1QOT A;  4AED C;  1RL3 A;  1XE7 A;  3WF3 A;  2BBA A;  1NG0 A;  4Q4W 1;  3DUI A;  4PIY A;  5FY9 A;  4UFL A;  3POY A;  2ZHN A;  3FL7 A;  4B4R A;  3N7J A;  5FZM A;  2ZAC A;  4KGQ A;  5IUQ A;  4LNV A;  2WWS A;  1JHJ A;  3VBS A;  5EYX A;  1IS5 A;  4LBL A;  3EO6 A;  1NA1 B;  4GD4 A;  1RUC 1;  5C8C C;  5C6C A;  4PIZ A;  1US3 A;  5FZ0 A;  5FWJ A;  3AMP A;  4YYO A;  4H2A A;  4XDO A;  1E5H A;  5FY0 A;  4KMQ A;  2RJK A;  3W58 A;  4RS5 A;  1RXF A;  1Z78 A;  4CU8 A;  1YEW A;  5ABJ A;  3KD4 A;  3TEY A;  1UD1 A;  2JG9 C;  4B1M A;  3W9A A;  4FCA A;  4CP1 A;  2GC0 A;  3NST A;  4Q0P A;  3WXP A;  4CUA A;  2CGN A;  3WSO A;  4AZZ A;  3GHM A;  5IVV A;  1HRI 3;  4ASL A;  4FFF A;  1US2 A;  3RZM A;  1UF2 C;  5F2W A;  3ON7 A;  4Z8B A;  2ET1 A;  5DPN A;  1UNB A;  2ET7 A;  4BQY A;  5GJ6 A;  3E5Q A;  3AYC A;  3TN9 3;  4IV1 C;  3ZN6 B;  1OVS A;  2YHJ A;  1AZD A;  1U5Y A;  1ZM1 A;  4HK8 A;  2WNE A;  4UW6 A;  4AE2 A;  5J3U A;  2KD7 A;  1PMJ X;  1W8U A;  4JRL A;  2RJ2 A;  3FBY A;  1TMF 3;  2BOJ A;  5FYS A;  1MQT C;  2C6S A;  2Y60 A;  3DXT A;  1POV 3;  1PHM A;  1B35 A;  1LTE A;  3AB0 A;  4ATE A;  4UBH A;  1RVF 3;  1MPX A;  3OUH A;  1LOE A;  4LBQ A;  4GH4 C;  1CAX A;  2DFC A;  1QJX 2;  4L2N A;  1L7R A;  4QXK A;  4KBB A;  4Y26 A;  3VGI A;  4ZZ5 A;  1W3X A;  1I5Z A;  2R04 1;  4PHZ A;  4ASM B;  1X36 A;  2XJS A;  5T55 A;  3O1O A;  3VDD A;  1MS5 A;  2G9G A;  4OYU A;  1WCQ A;  3DYO A;  2WZR 1;  2A73 B;  5L19 A;  4A2U A;  3AZW A;  4BIO A;  1QDC A;  2J1T A;  1ULO A;  3PUH A;  1QNY A;  4BWO A;  1HRV 3;  5DDJ 2;  2RS5 3;  2Q8E A;  4LBM A;  1J83 A;  1POV 0;  3CJI B;  3IB3 A;  2B46 X;  2CDP A;  5FLJ A;  3NQH A;  2ATF A;  3OG2 A;  3UK9 A;  1AVB A;  1GZC A;  1JXN A;  5A3W A;  5DAW A;  1MVE A;  2E63 A;  4D7S A;  4Z2A A;  3ABZ A;  4XOG A;  2OQ6 A;  2N7G A;  4JDM A;  1DQ5 A;  3VD9 A;  4MYE A;  1ZRC A;  3IBM A;  2I07 B;  3K2O A;  1J3P A;  1ZVF A;  1YQC A;  4CP9 B;  1F2N A;  4CXX A;  1W0N A;  2PLV 1;  1CD3 G;  2XJP A;  4WM8 A;  3VBF A;  4C90 A;  1X82 A;  2G4I A;  3AFK A;  4PLO A;  4SBV A;  4CCJ A;  4DS0 A;  2Y34 A;  3THT A;  4I30 A;  5FKC A;  5JOZ A;  5LZ6 A;  4QGL A;  2FCU A;  2WNV C;  4Y5Z 0;  3D82 A;  1SCR A;  3KS7 A;  1K5J A;  1DGW X;  1LUL A;  3L2Y A;  3N9N A;  4JGY A;  1ZZ7 A;  1WW6 A;  2Q30 A;  3QH7 A;  1RYY A;  5T5L A;  1JZ8 A;  5GZG A;  4NIG A;  3N7L A;  5L36 A;  3SCG A;  4COU A;  4NHK A;  2ORX A;  5C4W A;  3MLL A;  4WBB A;  3JU9 A;  4HVO A;  2D93 A;  1OH4 A;  5FZ1 A;  5FY7 A;  4CE8 A;  5IYY A;  2VCM A;  2Y6F A;  1M4W A;  4MH0 E;  4X6R B;  4DXT A;  5JR2 A;  3OGS A;  1PVC 2;  1BVV A;  2UU8 A;  1VBA 2;  3OPZ A;  5C3S A;  5FZF A;  3MLJ A;  2BZD A;  1F35 A;  1PK6 B;  5FOB B;  2BOI A;  1W90 A;  2EXK A;  2XBO 2;  5I8T A;  2R1B A;  5FXV A;  4DUW A;  3RZH A;  4I2O A;  5GLW A;  4CZS A;  4R9B A;  4EN0 A;  3OEB A;  3FZ3 A;  2UUR A;  2PFW A;  4WZF A;  3B3Q E;  2DCT A;  3PDQ A;  3NJX A;  4XBL A;  4GMP 0;  3CJX A;  4PI2 A;  2YU1 A;  3QCW A;  3RG0 A;  1W2A X;  3AZY A;  4DIQ A;  5GAL A;  2D44 A;  2ZGM A;  4CDU A;  1QMJ A;  2ZX1 A;  4LEJ A;  5A80 A;  2V5Y A;  1FX5 A;  4B8E A;  3INA A;  5F1R A;  3ZIW A;  4K40 A;  5DAX A;  1WLC A;  2PMW B;  5I0S A;  2CAU A;  4L11 A;  3PJY A;  1N47 A;  4YSF A;  4CDW A;  5J36 A;  1LJ7 A;  2IWG B;  4LMF A;  4KU7 A;  4N43 B;  3AL5 A;  3WD5 A;  4Y20 A;  1VBB 3;  5F3G A;  4NAM A;  4BQW A;  5GZC A;  5KHH A;  4NJ4 A;  2DVG A;  5KXE A;  3RDI A;  2HWD 2;  2VUA A;  3IT8 A;  1ZRE A;  1S0B A;  3SXW A;  4XJZ A;  5JZG A;  3ZR6 A;  4C1W A;  3NVC A;  1YFX A;  1PM7 A;  3RJ2 X;  4CU9 A;  5E8A A;  5IK7 A;  2CU5 A;  1OSG A;  5D21 A;  1QF3 A;  1JYT A;  4NHM A;  2HH9 A;  4OI4 A;  3S0M A;  3V0A A;  4MVT A;  1E5I A;  2GMP A;  4CU7 A;  4LO5 B;  2B7Y A;  2NZ9 A;  3WEZ A;  2YDE A;  4UW3 A;  1G8W A;  1VAL A;  4DY5 A;  1V6J A;  2FDG A;  2VZ3 A;  1RHI 2;  5T54 A;  2AAC A;  2BWA A;  2ZEY A;  3SQO A;  4J25 A;  2IFW A;  2HBT A;  2CL2 A;  5C9A B;  1NXM A;  5DUX A;  3U0Z A;  4LBO A;  4DMI A;  1KEX A;  2VUD A;  2BEO A;  4SLI A;  4F7Z A;  1W28 A;  3LAG A;  1OLM E;  3HT1 A;  5HV0 A;  5BNQ A;  1W9F A;  2A5Z A;  1BXH A;  2F4P A;  4FPH A;  5APA A;  3WW1 A;  4E9K A;  3T4H B;  4NPL A;  3J9S A;  4ZXK A;  1O3Q A;  1AR7 2;  1QJX 3;  1Y9M A;  5A7W B;  4HON A;  1UU4 A;  1XSQ A;  5BUV A;  5J09 A;  3WNX A;  2A3W A;  2E9Q A;  3OF1 A;  3ZFE A;  3K4Z A;  1RMU 1;  1I1E A;  1OMI A;  1POV 1;  3R05 A;  4WVW A;  2R6Q A;  3AZV A;  3N36 A;  5FYV A;  5FXZ A;  4NHX A;  5JI7 A;  3THC A;  5CA6 A;  1RVF 1;  2D6O X;  3O14 A;  3NJV A;  4Z07 A;  5ERL A;  5ABJ B;  4OQ9 A;  2ARC A;  2YBS A;  4S2D A;  2QJV A;  4PDW C;  1CR7 A;  2JKB A;  1X7N A;  2WFP A;  3IIA A;  3MV0 1;  4LUK A;  4NUB A;  2XJQ A;  5CFD C;  1UZY A;  1G9B A;  2BNM A;  5CYY A;  4QQL A;  4Q0V A;  4UXA A;  5A6Z A;  5LBE A;  3WNO A;  4ES8 A;  1PZ9 A;  3SH5 A;  5D8A B;  4AHZ A;  4H3W A;  1V9U 1;  3ILR A;  1WD3 A;  3LEG A;  1HRV 1;  1H2L A;  1RC6 A;  2PHF A;  1SLL A;  2RS5 1;  4LHS A;  5KXC A;  3MYX A;  3WQ1 A;  1ZRD A;  2ZBJ A;  4NPM A;  3Q8C A;  1DYO A;  5JCT A;  3BPS A;  4DXR A;  2CWS A;  1OF3 A;  3B02 A;  4NRO A;  3CEW A;  4MV2 A;  3GNE A;  1ZX5 A;  4LIU A;  4XIK A;  4EQV A;  3QLQ A;  1EUT A;  5JSR A;  4HZF A;  5CFC B;  2RR1 2;  3H3L A;  2P6H A;  4K1Z A;  4HXC A;  1PZ8 A;  1AR8 1;  1FOD 1;  4BB3 A;  3U4X A;  3WT3 A;  4WVZ A;  4PQ9 A;  4Q0S A;  5F3I A;  2E32 A;  2FDH A;  1A8M A;  3UET A;  4JDN A;  4AR2 A;  4BK4 A;  3FUO A;  4NIA A;  4B7K A;  1LHV A;  1WA6 X;  4A4A A;  5IHR A;  2A3Y A;  3WP3 A;  4HAN A;  1D0H A;  4A3Z A;  2P4E A;  4E8D A;  1LB2 A;  2HKX A;  3Q8E A;  1VJ2 A;  1OOP B;  2RJL A;  3VBH A;  4A41 A;  4QKF A;  5I0U A;  1PVC 3;  2EA7 A;  1VBA 3;  3PVN A;  1TG7 A;  1O4Z A;  1Q3E A;  2D98 A;  2VUJ A;  3T3Y A;  3SKJ E;  3WHT A;  2XBO 3;  4P9I A;  2QFE A;  4N43 C;  2HEY F;  5FZO A;  1AXZ A;  2VU9 A;  3ZPO A;  2B8M A;  3VHP A;  2D40 A;  1F4A A;  1V6M A;  3RYR A;  4ZS2 A;  1VBC 2;  4QX7 A;  2ZS6 B;  4F83 A;  1IQA A;  1EY2 A;  2Y0I A;  1HV1 A;  4QXB A;  1S0C A;  4RGA A;  4U2A A;  4X8N A;  5ACA 2;  3IN9 A;  1MEC 2;  4XMA A;  3SKV A;  4RGG A;  4BJ0 A;  1REE A;  3NV1 A;  5ISL A;  4D94 A;  4LOR A;  4TTG A;  5CNA A;  4QX5 A;  3S5A A;  1UQX A;  1DP0 A;  1FV3 A;  3FBM A;  4QDS A;  4RR3 C;  4XUR A;  4YW1 A;  5FV3 A;  1H8T B;  1DGR N;  2FMD A;  5EZW A;  5GZF A;  4QT6 A;  3RZZ A;  3WP4 A;  5F7U A;  4MGQ A;  1D4V B;  3EJK A;  4QX0 A;  2D6N A;  1Y4W A;  1KDK A;  1QH6 A;  2PN5 A;  2Y0O A;  3KT1 A;  1SPP B;  2RG4 A;  2JWP A;  2GNB A;  2WDB A;  1ENR A;  2HWD 3;  3J7L A;  3NNJ A;  3ZN5 A;  4TN7 A;  1QJF A;  2OPK A;  2H0B A;  3K77 A;  4FTE A;  2BWC A;  1PO2 2;  4BOW A;  1OUR A;  5KC5 A;  5D2A A;  1BEV 2;  1R64 A;  2QKD A;  1JN2 P;  1I6X A;  4QDR A;  3VBS C;  1UZW A;  1BZW A;  2QCS B;  3V0B A;  3ELN A;  1NY7 2;  1EAH 3;  3ZYF A;  3HMY A;  3BOP A;  2LTN A;  3WQ0 A;  4HK9 A;  4YG0 A;  4HSJ A;  1WLT A;  5KXD A;  4EWD A;  2CYF A;  1RHI 3;  5FZ6 A;  4RS5 C;  4Y1Y A;  1E57 A;  4NII A;  3ZXK A;  3B94 A;  5T5O A;  1K42 A;  5ABJ C;  4RN5 A;  1PX4 A;  2PTM A;  5FPB A;  4LPL A;  4D7T A;  1F9K A;  4FFH A;  4IQP A;  5I0R A;  2ZX4 A;  4BU2 A;  5JI9 A;  3M70 A;  4MUV A;  4EN8 B;  3HNY M;  4NMI A;  2B42 B;  3APB A;  3AKS A;  2XON A;  4JVA A;  2WAA A;  1AR7 3;  1CPM A;  1W6M A;  3PIJ A;  1C4R A;  5FY8 A;  3BVC A;  3KV9 A;  3O0W A;  2IXJ A;  4N7I A;  1WBF A;  5C7G A;  2VBB A;  1RUF 2;  4MHR A;  3AK0 A;  2JEC A;  4MAD A;  4MLO A;  2FDK A;  4V1P A;  3A21 A;  4R9D A;  1B35 C;  4XBQ A;  5J7M A;  4JHT A;  4XIL A;  4YGD A;  4BE3 A;  3JB4 C;  5A7P A;  2XQR A;  1H1I A;  3BIE A;  4XHX A;  3H8U A;  4Q1P A;  3N7K A;  2GP3 A;  3T4V A;  3RZJ A;  4IEZ A;  4RQP A;  2VO5 A;  2WO2 A;  4M00 A;  4YVW B;  3SMH A;  4URA A;  3NL1 A;  5DDJ 1;  3VDD C;  1N1T A;  3B7M A;  2W1Q A;  3UGH A;  3WQ7 A;  2DCK A;  1BQP A;  2BVV A;  5GM0 A;  2D3P A;  2DTY A;  2IXC A;  3BB6 A;  1L3J A;  5C3R A;  5FYH A;  1FMD 2;  2Q8D A;  5LBC A;  5IFT A;  3S57 A;  2HWE 2;  2VTX A;  1GKB A;  2EXJ A;  2R07 2;  1W6P A;  3FHQ A;  4GZ9 A;  4JRA A;  5LEJ A;  2HEV F;  4H55 A;  1UX7 A;  2EAL A;  2RR1 3;  1F4H A;  5CVR A;  2F4L A;  1I3H A;  4NHY A;  4AGG A;  4LBJ A;  1ALY A;  4KG8 A;  2WRA A;  3VDA A;  3WCR A;  2BU9 A;  3OGJ A;  1JOB A;  1VBD 1;  2E7Q A;  4Q4X 3;  1G86 A;  2ZGQ A;  4QPG A;  4Y24 A;  2GH8 A;  4YVS B;  5A32 A;  1WW5 A;  3LZZ A;  4COV A;  3VBF C;  4WM8 C;  5FTT C;  3P3P A;  3NNM A;  1OT5 A;  5K0U A;  2Z5W A;  3WG2 A;  3WDY A;  5KHG A;  1C8N A;  1SFP A;  1XNB A;  1IQD C;  4NWV A;  1S4C A;  1ENQ A;  3KHB A;  5C5T A;  3IPV B;  5FP3 A;  4JGY C;  5EWS A;  4YLZ A;  2X10 A;  5G04 L;  2H6C A;  2ZGT A;  2RM2 2;  5F6K A;  5IVY A;  1PO1 2;  4M3C A;  1HB1 A;  4CTE A;  2Y26 A;  3VZK A;  3S30 A;  1GR3 A;  1CZS A;  1RUE 1;  1Y9Q A;  4IE5 A;  5FLH A;  3ZR5 A;  2VW2 A;  4F8A A;  4FPG A;  3MID A;  5FP4 A;  5FRE A;  4ONU A;  3VHR A;  1CAV A;  3KQ4 B;  4ZU4 A;  5C4W C;  1IG3 A;  3VV1 A;  1VBA 1;  2ZEX A;  3AZX A;  1VBC 3;  3C7E A;  2B5H A;  3R0R A;  4WM7 A;  4YM0 A;  2XBO 1;  1EV1 2;  4RFT 0;  1VRH 2;  3RMX A;  2ZCW A;  5FZD A;  3WUD A;  1YI7 A;  3Q8A A;  1NCR A;  1VRB A;  5TSW A;  3UGG A;  5ACA 3;  2FCT A;  2VE1 A;  4YGB A;  1MEC 3;  1IS3 A;  1HB2 A;  3FC0 A;  5JXH A;  5FMO S;  1XQN A;  2J7M A;  4QX8 A;  2WC2 A;  1PIV 2;  3LKJ A;  4P02 B;  2WNU A;  4Q4V 2;  2Q8O A;  1UZ0 A;  4LUL A;  4S2H A;  1OBN A;  1Q56 A;  4YFW A;  3RWN A;  1ZZC A;  5FYI A;  4XUQ A;  5ANN A;  3ZYG A;  5FMO L;  2BW8 A;  4TWT A;  5EPA A;  1W9W A;  1NQJ A;  2XUE A;  4AXO A;  4BLJ A;  3JQW A;  5LBF A;  4D6Q A;  2OA2 A;  3PJQ A;  4WVV A;  2XL9 A;  4JGZ A;  4Q1R A;  2JIJ A;  2VMH A;  2WSV A;  2YGM A;  2QTW B;  3MGU A;  5FY5 A;  4CDU C;  2KXL A;  2W1W A;  4XJW A;  3WNP A;  4LO6 B;  4XCA A;  2AEY A;  1LU2 A;  1H4H A;  1PO2 3;  1QOO A;  2MEV 2;  3M2M A;  3M3E A;  4OLL A;  1BEV 3;  5FZC A;  3ZMN A;  2VM9 A;  5F5I A;  4E4Z A;  3H8R A;  4M0H A;  2MPF A;  4CDW C;  2FBE A;  1LOG A;  1V6O A;  1DHK B;  1UY1 A;  2HWD 1;  2BDR A;  2HLE A;  2FQP A;  2J42 A;  4QPI B;  4XET A;  4FFG A;  3KZ4 C;  2BV4 A;  2JG8 B;  1KD7 A;  3KB5 A;  1KFX L;  2VD7 A;  3F2Z A;  3WG4 A;  1R08 2;  5JZG C;  4XJA A;  3AJY A;  2A7A A;  1LGB A;  2R49 A;  1UOJ A;  2E51 A;  3C7F A;  2ERF A;  1XNT A;  4FO9 A;  4AVT A;  1YRZ A;  3R4S A;  1RHI 1;  1EPW A;  1V0A A;  2WFF 2;  3H1W A;  2A1X A;  2QQJ A;  3K4A A;  1X9T A;  4ARY A;  1VAV A;  4EJR A;  1WD4 A;  5L9B A;  1DLL A;  1JZ6 A;  3BU0 A;  4CEY B;  4JZR A;  4KG0 A;  4XTP A;  3P6B A;  2A71 A;  3LDK A;  1TNR A;  4Q26 A;  4CPB D;  5BY5 A;  5JPM B;  4AED B;  5K9Y A;  2VW0 A;  2X09 A;  3DKW A;  1W8W A;  1RUF 3;  2DUO A;  4GWN A;  2VTF A;  2ZGR A;  4AEJ A;  5JOY A;  3AL6 A;  1BMV 1;  1AR7 1;  4E8C A;  3MW4 A;  4IE0 A;  3OY8 A;  4GB3 1;  4LBK A;  1W8Z A;  3KF3 A;  5C8C B;  4XF1 A;  2BPA 2;  1H8V A;  1UY2 A;  1RUI 2;  1N1Y A;  1ODN A;  1OLR A;  3LFI A;  3CO2 A;  5CKM A;  3V0B B;  2QBX A;  4BQ2 A;  2Y38 A;  3OBT A;  2HWB 2;  2IUW A;  4PLN A;  5IT6 A;  4XF3 A;  3ZFE C;  3ATG A;  4FBF A;  1UAI A;  1H2M A;  2PA7 A;  2RDR A;  2YC4 A;  3MUZ 1;  5FBZ A;  5CB7 A;  1V6N A;  5FYU A;  3T2Q A;  2VCC A;  1Q8S A;  1W2U A;  5CEH A;  2WIN B;  1W6N A;  1TMF 2;  4OVE A;  4CDQ A;  1QJY 2;  4NWW A;  5K8S A;  5A7Q A;  4ZXE A;  3ETP A;  4YZ3 A;  1D4M 2;  1FMD 3;  1GZW B;  1WCU A;  2OS2 A;  4Z2W A;  4YAR A;  1YQ5 A;  3ZO0 B;  1IKP A;  1FAY A;  1V6L A;  3KVB A;  1JOD A;  3ZFF A;  2LUW A;  1G9D A;  2R07 3;  1W3V A;  3ASI A;  1MZ5 A;  4OQ8 A;  4XDQ A;  1NLS A;  1EP0 A;  3H7J A;  1UYX A;  4JQT A;  5LCW L;  1NZC A;  4L9B A;  1GNY A;  3I49 A;  4IV1 B;  2OKX A;  3LOI A;  5IVC A;  1OA4 A;  4JV4 A;  4MOA A;  3WDU A;  3VZN A;  4XFC A;  4AK3 A;  2NN8 A;  5GLU A;  3OEA A;  2RR1 1;  4MX3 A;  4IV3 A;  5BNO A;  2NPI A;  1MQT B;  2DTW A;  3EYP A;  1YIF A;  5FPZ A;  4JHZ A;  5JMC A;  3OYW B;  1NT0 A;  4HET A;  3IDE A;  3QAC A;  4ARX A;  2RMU 2;  2XJU A;  2VBP A;  5EQU A;  2BQP A;  3CQO A;  4GH4 B;  3WDX A;  2ZGL A;  4IET A;  2IXL A;  2PHU A;  2VW1 A;  2FZ1 A;  2RM2 3;  1PO1 3;  2WQ4 A;  3KCX A;  3IZO A;  2OUH A;  2B39 A;  3SLI A;  4IND A;  3TYJ A;  4NVP A;  3I3M A;  2W3J A;  3H50 A;  3HQX A;  5A1F A;  1OKO A;  3GBG A;  3I2D A;  2O8O A;  5C71 A;  1EV1 3;  3VBH C;  1VRH 3;  1KDM A;  2D5F A;  1CAU B;  4GKY A;  1GQG A;  1CGP A;  3H7Y A;  2IXI A;  1OQD A;  2V72 A;  1K45 A;  1HV0 A;  2JJ6 A;  3OUJ A;  1E5S A;  1XB9 A;  3WF1 A;  1PIV 3;  2ZGN A;  4WZC A;  1X8E A;  4QWN A;  4V2V A;  4YNI A;  1XNK A;  1CON A;  2EIE A;  4NR1 A;  4DOU A;  1UYZ A;  4D69 A;  5LK7 B;  5JXI A;  2VPV A;  1AF9 A;  2NYY A;  4S2G A;  2CSG A;  1MEC 1;  3O1T A;  4Q27 A;  3UL2 A;  3T2T A;  3VKL A;  5AVA A;  2OUJ A;  2JDH A;  2XHK A;  1F5J A;  4XUP A;  2G1M A;  3T08 A;  2ILM A;  1GUI A;  2WNV B;  5L7O A;  4LT5 A;  3HBZ A;  2ZHL A;  2MEV 3;  3LDB A;  4RYD A;  5DAB A;  4QXC A;  1A78 A;  5FO8 B;  5KHK A;  1H4G A;  1SEF A;  1MAC A;  3LF7 A;  4HPK B;  2EXH A;  4FI9 A;  3QBQ A;  4CDX A;  4MXW A;  5HCH A;  2X29 A;  2GME A;  4FFI A;  5LY2 A;  3POF A;  1UOB A;  3NV2 A;  2C1F A;  5I93 A;  4LTA A;  1FAT A;  3DN7 A;  4KU8 A;  1O8S A;  1R08 3;  3RRD A;  2E31 A;  1ND2 A;  1NCR B;  1C57 A;  1OA3 A;  4JTO A;  4P9W A;  3T0B A;  2BGP A;  3OOX A;  2HJI A;  5F3E A;  4ZZ8 A;  3AYE A;  2WO1 A;  1QOS A;  5DG2 A;  4FT8 A;  3AYA A;  3KCC A;  4E2Q A;  1CX1 A;  2WNU B;  4GKX A;  2WYS A;  2G9Z A;  2VZP A;  1VBB 2;  2WFF 3;  3FHA A;  5FK7 A;  2VC9 A;  1UMH A;  1RUD 2;  4LO8 A;  3KSC A;  3J26 N;  4BDV B;  3H0O A;  3KQR A;  1AL0 G;  4XQ4 A;  4CEW A;  4CCE A;  4Q4Y 1;  3S5Q A;  2D7F A;  3VBU A;  4BQ3 A;  3AKP A;  3UV9 A;  4ATF A;  1GOH A;  5FYC A;  5GLZ A;  2VCB A;  3TWI A;  2BP6 A;  3H1Y A;  1IG0 A;  1PGW 2;  3ILF A;  4P9J A;  1PX3 A;  2XDV A;  3H8X A;  2WA3 A;  5F37 A;  1LHU A;  4R52 A;  3ZSE A;  2VQU A;  1O8P A;  1RUI 3;  4XFG A;  2DU1 A;  4XF9 A;  1A6C A;  4LR4 A;  4EE2 A;  1RUF 1;  1WKY A;  2HWB 3;  1WCD J;  4UF0 A;  5F8P A;  4IGO A;  3DL3 A;  2YC0 A;  4XQW A;  2JIC A;  3FFQ A;  2PHL A;  2WII B;  5LWB A;  1MR5 A;  1QJY 3;  2BBV A;  3NJZ A;  2QNK A;  4MXV A;  2VH9 A;  4HOO A;  2YGL A;  4UBG A;  2X05 A;  1D4M 3;  3HQU A;  4M01 A;  1T6B X;  4LHK A;  1OFS A;  3D0J A;  1VMH A;  2W68 A;  2XLA A;  3VBO A;  1QU0 A;  3NNL A;  1T6G C;  3DYP A;  2D6M A;  4RQP C;  3S7E A;  1GQH A;  2QZ2 A;  2ZA9 A;  3JB8 A;  4HFS A;  4QQP A;  1SLT A;  4FP2 A;  4XAE A;  3K3N A;  2HWE 1;  4Q0Q A;  4QGN A;  1BHG A;  1PNG A;  3VZL A;  2VMF A;  2R07 1;  2OPW A;  2VZQ A;  3EQE A;  4RSU A;  1QJU 2;  4OUL A;  1TNF A;  3FE5 A;  4KWU A;  1ND3 A;  4P5Y A;  4PI0 A;  1UU6 A;  5JIU A;  2NM1 A;  2VME A;  2RMU 3;  2Q1F A;  2ZHM A;  2ZHK A;  2ZML A;  2JIG A;  1WWY A;  4D6R A;  3GCX A;  3WG1 A;  5AC9 2;  3SEP A;  3GAL A;  1C5H A;  1H9P A;  1LGN A;  1QH7 A;  4W50 A;  1DQ1 A;  3WW3 A;  3GBF A;  5M0T A;  1K12 A;  2PHX A;  1GQP A;  1NCQ A;  4QB2 A;  4QPG C;  5A3L A;  1UX6 A;  2QQW A;  2Z4F A;  4CDQ B;  2VL4 A;  2QQN A;  1HX6 A;  2QQK A;  3MIF A;  4OZX A;  3ZXF A;  5KC6 A;  3KF5 A;  4PDW B;  4QDQ A;  1HLC A;  2YZ4 A;  5K0U C;  1LEN A;  2RM2 1;  4MGK E;  1PO1 1;  2EIB A;  2P3K A;  5CAZ A;  1Y9G A;  5CFD B;  2FCV A;  1WGP A;  1IZ3 A;  5EJ1 B;  2ZKL A;  3JD7 2;  3RJR A;  1X8M A;  2LM3 A;  3PMS A;  1GWK A;  1OF4 A;  1S2B A;  1SAC A;  1W9S A;  2XB6 C;  3GDB A;  4NHL A;  1EV1 1;  2UWC A;  3HVD A;  5C70 A;  2EXI A;  5JSP A;  3LCP A;  4S2F A;  3CNA A;  4WM7 C;  1Z7S 1;  1SBE A;  5F39 A;  1OKQ A;  4YW3 A;  4AVC A;  4DRV A;  4AHW A;  1PIV 1;  3K75 B;  1FPN 2;  1NCR C;  3DEC A;  4MHU A;  4Q29 A;  4Q4V 1;  3JCI A;  2PXJ A;  1D2Q A;  2VXR A;  1UYP A;  3FX3 A;  5A3P A;  4ZHN A;  1ZBA 1;  4G9S B;  1W0P A;  2WNU C;  2NP0 A;  2WT2 A;  3F95 A;  3SNM A;  2K0G A;  3Q8B A;  4OHZ A;  3MIC A;  3ZMO A;  2J1A A;  3AKR A;  4GIQ A;  1JYW A;  2RV9 A;  4QX3 A;  1M06 G;  4QXH A;  4RHV 3;  1GP5 A;  3BTA A;  1GLH A;  2W94 A;  1COV 3;  1KRI A;  2MHF A;  3KLS A;  1RGS A;  4WVM A;  1W99 A;  3W21 A;  4JGZ C;  4XAB A;  1CQ9 A;  2JE8 A;  1D2S A;  4PBO A;  1AXY A;  2JX9 A;  5J37 A;  2VNG A;  3AP9 A;  3I2F A;  3OSD A;  5IK4 A;  1LHW A;  4PIX A;  4UFH A;  4XQD A;  1MS9 A;  5CIR A;  4CCC A;  4QMA A;  2JDZ A;  5H9Q A;  4QPW A;  4NRQ A;  1W6Q B;  2BUK A;  1RUD 3;  3O1V A;  3WR0 A;  3M3C A;  4A6S A;  2ZGP A;  2ZKN A;  5A6X A;  1CAW A;  4K20 A;  1WMF A;  3D5O A;  5ANQ A;  1LHO A;  2BJS A;  3BOW A;  1VBE 1;  4UFI A;  4B29 A;  4YM3 A;  1EYB A;  3LDR A;  3MDP A;  5FO9 B;  2BYV E;  2D3R A;  4AL9 A;  4ASK A;  4GXL A;  2VAU A;  4YRD A;  1SQ4 A;  1EAH 2;  1SLI A;  2GMM A;  1CPN A;  1S0F A;  3AP5 A;  4RR3 B;  4QU2 A;  2LRO A;  4XFH A;  3VKN A;  4BK5 A;  4QKB A;  4CA9 A;  5EIY B;  5EYY A;  4MXW B;  2DVB A;  3EXU A;  4XFF A;  5E16 A;  5IAX A;  2CAV A;  1SDD B;  1PVX A;  4XW3 A;  3JBG 2;  3AMM A;  3ZFG A;  1W6O A;  1C1F A;  1Q8P A;  3LPF A;  4RD7 A;  4AI8 A;  3WQB A;  1HRI 1;  2ZMK A;  1VMF A;  3AX4 A;  4BZ4 A;  4YW7 A;  1ND2 B;  2AZ5 A;  4ES9 A;  2I74 A;  1ULP A;  5J48 A;  2DV9 A;  4M0N A;  2YG0 A;  3C8X A;  3PME A;  4YZ1 A;  1GP4 A;  1UMI A;  3J8F 2;  3TN9 1;  3VBS B;  2W47 A;  1HQL A;  2WBK A;  1QHD A;  4PCR A;  4URT A;  3UES A;  1RUH 2;  2PHT A;  2OII A;  4AWD A;  4C0H A;  4TZD A;  5F9T A;  3KT7 A;  4QHZ A;  1CZT A;  5FK8 A;  3RFR A;  3I3E A;  1TMF 1;  3LIH A;  3THP A;  4QGM A;  3ZPY A;  1R09 2;  3HD8 B;  3LE0 A;  5DZG A;  3DCQ A;  5F5Q A;  5FZ7 A;  4HVQ A;  4RS5 B;  4L8Q A;  2YXS A;  1S0I A;  4CYD A;  2X5I A;  1GOG A;  2ZGK A;  3HAG A;  4FPL A;  4QQ2 A;  4CDQ C;  2JD9 A;  1OD3 A;  1SFN A;  2VNR A;  2DDU A;  3S7I A;  3LWC A;  2ENR A;  1ST8 A;  3FWE A;  5JOX A;  3AMH A;  4CCO A;  4LBN A;  3VDB A;  3VUO A;  1QJU 3;  1YIP A;  3FHI B;  1OUX A;  5CU1 A;  3ZFF C;  4D7Y A;  2YFU A;  4IGQ A;  5A3T A;  1UWW A;  1XJA A;  5H9P A;  1PNF A;  2KM2 A;  3OD4 A;  4CCK A;  1QWR A;  2PYT A;  4GQ7 A;  4NE9 A;  1YNA A;  3N9L A;  5AC9 3;  3ROU A;  5LB6 A;  3ST7 A;  2OT7 A;  3T0D A;  1GNH A;  1HN1 A;  3H3U A;  1LHN A;  5A70 A;  3GJA A;  4HSL A;  3ZYP A;  2RMU 1;  5T5P A;  4IV3 C;  5BNO C;  4QQO A;  4QM8 A;  1B35 B;  4DXS A;  2FDJ A;  2WO3 A;  5F3C A;  4LBQ B;  2G19 A;  1CAX B;  5LAS A;  4ERO A;  1R1A 2;  2DWR A;  2RE9 A;  1W03 A;  5HXV A;  3JD7 3;  1LKN A;  2QDN A;  3BIW E;  4P9G A;  5DUU A;  1BBT 3;  4Q4X 2;  2P3Y A;  1MZE A;  1HXS 3;  4UFJ A;  4I0B A;  5FUP A;  3VDD B;  1RUJ 2;  3SC7 X;  1YQ8 A;  4OI1 A;  4CVU A;  4RA0 A;  1URX A;  3I59 A;  1O5L A;  4NN0 A;  5F5C A;  2FMY A;  1XE0 A;  1D7P M;  3GYD A;  4K8R B;  5E6H A;  4HKO A;  1FPN 3;  1NAE A;  3PTR B;  3UKN A;  2H6B A;  3U07 A;  2JB8 A;  1UW8 A;  4P14 A;  4O61 A;  4P08 A;  2DCZ A;  1RUG 3;  2F17 A;  5EV7 A;  4Q8K A;  1LOB A;  4E4D X;  1DZR A;  2P2K A;  2VZU A;  5F5A A;  1G9F A;  3NO8 A;  3BTY A;  5FZI A;  1JOP A;  1KXG A;  4N53 A;  5F32 A;  2XKP A;  4FVV A;  4EN9 B;  1OLQ A;  1U5X A;  4Y4R A;  3VBF B;  1OXC A;  4WM8 B;  4AQT A;  5LW9 A;  4K1Y A;  2WWJ A;  3DV8 A;  4RL7 A;  4XBN A;  5GKA C;  5FYT A;  2GAU A;  5EXO A;  1JYC A;  5DMY A;  4YFZ A;  1F8V A;  2DVF A;  2CNA A;  1LOF A;  5L7O C;  3FLR A;  4FXK B;  3WW4 A;  4JGY B;  1T2X A;  4HVR A;  4Y1V A;  4XYX A;  3U1X A;  3AFG A;  3T1L A;  1WME A;  2JB4 A;  5FCC A;  5I8S A;  3RI9 A;  1XNA A;  2RDS A;  4CDX C;  5C4W B;  2ZGO A;  4LA2 A;  2UY8 A;  1NYW A;  1XYN A;  1YI9 A;  1C3H A;  1H0B A;  1LES A;  5FZB A;  3CZJ A;  3M4F A;  1DQ6 A;  4HN1 A;  4LLO A;  1ND2 C;  4CUC A;  1IPS A;  4XTM A;  1NQD A;  1VBB 1;  2QQI A;  3BU7 A;  5FAX A;  2DBN A;  1XU2 A;  3TEZ A;  2SLI A;  3D8C A;  2DBI A;  4L92 A;  1OH3 A;  3LEM A;  3MFC A;  1NLQ A;  4XPV A;  3UKT A;  2JE9 A;  4FOQ A;  5FUN A;  1LNS A;  1LOA A;  5IW0 A;  3WUC A;  4CRQ A;  1PGL 2;  1BYH A;  2EVX A;  4CUG A;  1YUD A;  2O0O A;  1W8N A;  4MGS A;  4ORF A;  1DQ2 A;  5DN2 A;  5A6Y A;  2TNF A;  4CEW C;  3JBG 3;  1C1L A;  5EP9 A;  3FJS A;  3RVH A;  5CBL A;  3LEK A;  2EIG A;  1PGW 1;  3T30 A;  3I3D A;  1DIW A;  2HWF 2;  3VBU C;  3WNM A;  1JZ7 A;  1UXZ A;  2XLG A;  4CDU B;  4XUO A;  1B09 A;  2UWB A;  4A44 A;  3GF6 A;  1PMI A;  2BTV C;  2I2S A;  2PHW A;  1HW5 A;  4OHW A;  4UYB A;  1WMD A;  3J8F 3;  5FRA A;  2AH2 A;  2OYZ A;  2C9A A;  4CDW B;  1H30 A;  4GWI A;  1RUH 3;  3I2I A;  3ZIX A;  2C5D A;  1JOJ A;  4Y20 B;  3U14 A;  5BNP A;  4X8P A;  1RUC 2;  1DYP A;  4Y5T A;  5C3O A;  5FZG A;  3JZV A;  5BPX A;  3E5X A;  2JE7 A;  1R09 3;  4DO0 A;  4Z1V A;  5FO7 B;  1AX0 A;  2SBA A;  5JZG B;  2D43 A;  5A1L A;  4M3C E;  4GUL A;  2VQA A;  1QJX 1;  4HT1 T;  4IEW A;  1CJD A;  1EPZ A;  1H2N A;  2R30 A;  5SV5 A;  3WP6 A;  5FYY A;  5FOJ B;  5I8Y A;  2WQZ C;  1NZI A;  3GZA A;  3P5B A;  3V0A B;  3RZG A;  3III A;  1HB3 A;  3VBO C;  1JZ3 A;  3IDC B;  3VD3 A;  2WAB A;  3WCS A;  1TQ5 A;  1AUY A;  1SLB A;  1A34 A;  1IS6 A;  3ZFG B;  4AHY A;  1QJU 1;  2RDQ A;  4N8M A;  4HKL A;  4LK7 A;  4DQA A;  2ARX A;  2R06 2;  2EIC A;  3FFZ A;  3ZSK A;  4J1W A;  1K3I A;  2YMZ A;  3AJZ A;  1FNZ A;  1DQ4 A;  3C3V A;  4MET A;  1JW6 A;  2V5D A;  1ND3 C;  4YG3 A;  1AHS A;  4EZH A;  4YGE A;  1WUV A;  3FMG A;  3O1P A;  2VOW A;  4ZON A;  2P3I A;  1O3S A;  4FOV A;  2D5H A;  3EB7 A;  5E1R A;  1R1A 3;  1QGL A;  4F3J A;  5FBJ A;  3MIG A;  3B9C A;  3ZFE B;  4GA9 A;  1O6U A;  4EN6 B;  1NCQ C;  3ETQ A;  1GP6 A;  4NAO A;  1DDL A;  2WZP P;  4FTB A;  1U5I A;  3D4K A;  4QX2 A;  3WNN A;  1RUJ 3;  3MBW A;  3ECQ A;  2R04 2;  1X50 A;  2P3J A;  2YRO A;  3NJY A;  4KBZ A;  3NW4 A;  4OMD A;  2Z79 A;  1CWP A;  3IDA A;  3I3Q A;  1F31 A;  1ZRF A;  4ZKT B;  4QQH A;  1F5F A;  3NRU A;  4C8D A;  3SEE A;  2W5F A;  1AR9 2;  2Q8C A;  1AYN 2;  3LB9 A;  2C4X A;  5SV8 A;  1K5M A;  3LIG A;  3KV6 A;  1PVC 1;  5FP8 A;  5A33 A;  1UKG A;  1N3Q A;  2BER A;  2G9F A;  3J7H A;  1YHF A;  3JUU A;  1A8D A;  2W08 A;  2XVG A;  5DZF A;  5KXB A;  3KCY A;  3N9P A;  4JX0 A;  1QXJ A;  4TLF A;  3RSJ A;  4JQR A;  4V2W A;  3RYK A;  2ZGS A;  1UPI A;  1HIX A;  3CL1 A;  2GND A;  1O4T A;  4CP2 A;  5L9V A;  4AI3 A;  2PLV 2;  3A22 A;  4QHB A;  1ONA A;  2WO7 A;  5FPU A;  5BV6 A;  1DZT A;  1MS1 A;  2LAL A;  1QNW A;  1LEC A;  5FWE A;  4N9I A;  4I09 A;  1JTZ X;  3EMR A;  3I4I A;  5FY1 A;  3O5S A;  3UGF A;  3GGL A;  1XPW A;  2YYO A;  4XXA A;  4G4F A;  3PU3 A;  4FAG A;  4FTS A;  3NAP A;  4CCD A;  2WL1 A;  1VLN A;  1MZ6 A;  2A6V A;  5LRR A;  2UYB A;  1LOD A;  2VVD A;  3L9J T;  4XZU G;  3VBH B;  3PVB B;  2J1V A;  4CCM A;  1ASJ 3;  3J7N A;  3WDW A;  4AFC A;  1O7F A;  2CWM A;  5EJZ B;  3OTF A;  2XOM A;  4YZ4 A;  4EV0 A;  2JDN A;  4XF0 A;  3ZDV A;  5AFB A;  3HT2 A;  1WBL A;  2B4K A;  1NA1 A;  3NV4 A;  2C24 A;  2K2S A;  3C7O A;  4D8M A;  1KFU L;  1GNZ A;  2RS1 2;  2DCJ A;  5FZO B;  5CAD A;  4E2S A;  2NMN A;  2QQO A;  4FAH A;  2R16 A;  1WLW A;  1DU3 D;  2ZAH A;  1BK0 A;  1UL9 A;  3O1S A;  3VLB B;  1DLC A;  2VMI A;  4IER A;  4XC9 A;  1OC1 A;  1UIJ A;  3P1I A;  1ZZ6 A;  3S6P A;  1DGR A;  4AAX A;  2VGD A;  1YXW A;  4RFR B;  3OGR A;  4E27 A;  5DG1 A;  2HWF 3;  5IVF A;  2ZZQ A;  1EAH 1;  1I5P A;  1QKQ A;  5IK5 A;  2TUN A;  2VOK A;  2WS9 2;  5I0D A;  2DYC A;  2ZX2 A;  3ACF A;  1GOF A;  1WMX A;  2WLQ A;  5CIS A;  4NID A;  1V6K A;  4ZY9 A;  3JBG 1;  4OUE A;  4XIO A;  3GXU A;  1L7Q A;  3N9O A;  4XCB A;  2FDI A;  3AMQ A;  2ARA A;  3ES4 A;  2FDF A;  3I2H A;  1RUC 3;  1V00 A;  5IAV A;  3ZFG C;  1JBC A;  1ENX A;  3HN1 A;  4FXG B;  2GH2 A;  4JKM A;  4Q2F A;  3LA7 A;  4TYS A;  3MZH A;  2WQ8 A;  1KIT A;  2QUO A;  1H2K A;  3J8F 1;  4AFA A;  1TE1 B;  3BGA A;  3IM0 A;  3QOP A;  5FPV A;  2JXA A;  3R4D B;  3GZU C;  5B4X A;  1JUI A;  5A3O A;  5KHJ A;  3P3N A;  1PGS A;  4IW3 A;  1R09 1;  2OX0 A;  3GBW A;  1JZ2 A;  1GU3 A;  1J3Q A;  3B69 A;  1LOC A;  2ZX3 A;  5FZA A;  1DFQ A;  1VBE 2;  2P1B A;  2ZTN A;  4FQZ A;  4Z92 B;  1YJL A;  3PLQ A;  4GAZ A;  4W8J A;  2ID4 A;  3RI8 A;  2QQL A;  5A6Q A;  5L73 A;  2X5I C;  1OPO A;  3D3A A;  2XGX A;  2DVA A;  1BJQ A;  2YY1 A;  4NRM A;  4A42 A;  4O65 A;  2R06 3;  2Y6J A;  3CJI A;  4K3U A;  3MW3 A;  1HDK A;  3TEX A;  4W6W A;  3DF0 A;  4IEP A;  2YC2 A;  4HKW A;  2O14 A;  3IAQ A;  3CHX A;  3E5U A;  1W6M B;  4BQ4 A;  1VIW B;  1DG6 A;  4PT6 A;  5BNP B;  2CGO A;  5JPN B;  4DIN B;  4FQ4 A;  5T3N A;  3OBR A;  1OD5 A;  2GAL A;  4PQQ A;  1JI6 A;  2A75 A;  2IZW A;  3ACL A;  4CP9 A;  1RMU 2;  4LKE A;  3LOB A;  2R04 3;  3VHN A;  1QXR A;  3LPG A;  1WW4 A;  3PUS A;  3NKG A;  1CES A;  4Q4X 1;  2J1R A;  3I2G A;  2OZJ A;  2JDA A;  5FJH A;  2LRP A;  3TRS B;  1AR9 3;  3OBZ A;  4OUS A;  2XJT A;  4RQP B;  5JIA A;  1GWL A;  2V4A A;  4X6Q B;  3WOG A;  1AYN 3;  1YQ2 A;  3HN3 A;  3GHN A;  3AZZ A;  4OZO A;  4BM8 A;  3W5N A;  3H1M A;  4Y4Y A;  4YWA A;  2YPD A;  4LQR A;  3ZYB A;  4AQ2 A;  4AQ6 A;  5A3N A;  1RUN A;  5GLT A;  2A6Y A;  2P6C A;  3NNG A;  1V9U 2;  1Z0H A;  1ZA4 A;  5CZK A;  3PVE A;  1GV9 A;  1ZBE 2;  4IE7 A;  5JMO A;  2V09 A;  3NWK A;  1XC6 A;  5J98 B;  3POB A;  1PK6 A;  3G7D A;  4M3C F;  1W6P B;  3I97 A;  4CXY A;  4OI0 A;  2DUP A;  2EID A;  2PLV 3;  3RS6 A;  1SG3 A;  4I02 A;  2Q1M A;  1G6N A;  3M3O A;  1QIQ A;  1VBC 1;  5LA2 A;  4CXW A;  1DBN A;  1JYI A;  2GP5 A;  3K48 A;  2UWA A;  2VCA A;  1WLD A;  4LO4 B;  3OGG A;  1Q8Q A;  3ZOI A;  4A6O A;  2HWC 2;  2ADE A;  4BQX A;  1FOD 2;  3HWJ A;  5ACA 1;  4N53 C;  2W0X A;  3ITQ A;  1FV2 A;  4QPG B;  4QX1 A;  1W8F A;  3VN4 A;  2GC2 A;  3BCW A;  5A32 B;  3E6C C;  2OW4 A;  3VD5 A;  3BKZ A;  1AJO A;  3WVJ A;  4UI9 L;  2DUQ A;  5K0U B;  1OPM A;  4U36 A;  3IWZ A;  4P00 B;  5I0T A;  1LOF C;  3WW2 A;  1A3K A;  4M4P A;  2JDP A;  2ZAB A;  4A45 A;  1Q43 A;  4M3C B;  3ZDS A;  5HBA A;  3HPN A;  1WCK A;  2JEM A;  1K5M B;  1NE4 A;  2RS1 3;  1FYU A;  1VPH A;  3I7D A;  4RHV 2;  4UW5 A;  1CAV B;  4CP0 A;  4BXS V;  1HQN A;  5IAT A;  5EJ3 A;  1COV 2;  1TME 2;  5A33 B;  4MGI E;  1FNY A;  1PO2 1;  2E26 A;  1PZ7 A;  4WM7 B;  1BEV 1;  3USU A;  1UPS A;  2WSU A;  3PU8 A;  3URF A;  3VL9 A;  5BYN A;  3U78 A;  3VDC A;  2BFU S;  2W92 A;  1NY7 1;  2QZ3 A;  1KQR A;  4AFD A;  4MO3 M;  1VE0 A;  3RYP A;  1AXK A;  3ZKU A;  1PGL 1;  4FOW A;  2WS9 3;  3CIH A;  1XBF A;  1GFF 2;  4B7E A;  2BFU L;  1G9C A;  1J3R A;  3U11 A;  2JDY A;  4CUB A;  3PUA A;  1QJZ A;  3O0X A;  1O5U A;  4XUN A;  4P5H A;  3WDT A;  1W39 A;  2HWF 1;  3BN6 A;  4CU6 A;  3ZXL A;  1X9P A;  2ZZJ A;  4COW A;  2WNO A;  5C9A A;  3N7M A;  2R0F A;  3NAP B;  4YG6 A;  4KGG A;  4AQS A;  4HBN A;  3SH4 A;  4ZPI A;  4JGZ B;  3VBR A;  1DQ0 A;  1XXN A;  2DU0 A;  5F6L B;  2XQX A;  5A7S A;  3OPT A;  2ARB A;  3AVS A;  4O7X A;  5E88 A;  4A7K A;  4NIH A;  3GZT B;  4JCK A;  1GBG A;  2XPJ A;  5CKN A;  3LFM A;  4E2G A;  4Y3O A;  2Y6H A;  2GSY A;  4UOJ A;  5A7W A;  4CCN A;  4I3P A;  2RS3 2;  5DZE A;  2VNO A;  5EFU A;  5BNP C;  2E53 A;  3BPZ A;  4IDZ A;  1QQP 2;  5BNN A;  5GZE A;  1SBF A;  1VBE 3;  4Y22 A;  3VB9 A;  3E6D A;  1NE6 A;  2XUM A;  3DKQ A;  2AEZ A;  1JS9 A;  5LBB A;  4QB1 A;  1GIC A;  4I0W B;  1ENS A;  1G7Y A;  1I9R A;  5FPL A;  2W1U A;  2B9U A;  3NMB A;  1KS5 A;  2NMO A;  2LW8 A;  4LOS A;  2XVK A;  5IWF A;  2JDK A;  3MF6 A;  5FYM A;  2BNO A;  3POJ A;  1YCI A;  4AFM A;  3SIS A;  1U0A A;  5D8A A;  3CLP A;  3VHO A;  1JYV A;  1VMJ A;  4I01 A;  3ZYH A;  3M7A A;  2NQY A;  1FMD 1;  2R06 1;  5JAX A;  2E6V A;  2OQ7 A;  5CG8 A;  2QDR A;  4LK6 A;  3ZSM A;  5HCB A;  4YZ5 A;  2DF7 A;  1ULD A;  4TLG A;  1RMU 3;  4CCL A;  3L2H A;  4IEX A;  4PF1 A;  1O3R A;  2YBK A;  2OZ6 A;  2WYF A;  3OY8 B;  5CFC A;  4R8H A;  5FZL A;  4GWM A;  4LKD A;  4N7U A;  1SBD A;  4UT5 A;  3SIT A;  4BH9 A;  1POQ A;  3WHU A;  4E4S A;  3DPR A;  3IAP A;  5JOW A;  1UCX A;  4L97 A;  3PUI A;  3ZKY A;  3AVR A;  4LBQ D;  4AVB A;  1X33 A;  4IEU A;  1MS0 A;  2ZPX A;  4OHV A;  3V56 A;  1W05 A;  1W6N B;  3J4U H;  5FZE A;  2Y8K A;  1V9U 3;  1VB4 A;  2QQM A;  3X29 B;  3C7H A;  1CZV A;  1OOP A;  2R32 A;  1ZBE 3;  2ADD A;  4XEZ A;  1AR9 1;  3KV4 A;  5FXW A;  1AYN 1;  4D6S A;  3BYW A;  3ZFF B;  1YC6 1;  1GYK A;  1OUS A;  3AXE A;  4HMZ A;  4LHL A;  1UOF A;  3EHK A;  2Y6K A;  1YFY A;  4JKL A;  1IS4 A;  3O1R A;  2W2I A;  2D3S A;  2YUE A;  1BBT 2;  3O0V A;  1K5M C;  1HXS 2;  2Y64 A;  4W4Z A;  3R4U A;  5FMC A;  1VRH 1;  1WZX A;  2XWB B;  3BTZ A;  5A3M A;  2HWC 3;  1ACC A;  4L0P A;  1AR8 3;  1FOD 3;  1C28 A;  2CDO A;  4DNY A;  2HYX A;  4HL0 A;  3OB8 A;  1SLC A;  4IV3 B;  1VBD 2;  5BNO B;  1RJ7 A;  5FQ0 A;  4K21 A;  5DAP A;  5C3P A;  3ACI A;  4NO4 A;  5G05 L;  4FSJ A;  2D6K A;  1N1V A;  1HJG A;  1RUG 2;  4XE9 A;  3W20 A;  3CMG A;  5B4N A;  3CKH A;  3HBK A;  3POI A;  1E5R A;  2H0V A;  1IPJ A;  1H8T A;  1HB4 A;  1YO8 A;  3OGV A;  4LXL A;  2ZX0 A;  5LK5 A;  5FIX A;  1CX4 A;  1S0J A;  1RUE 2;  1TME 3;  3ZYJ B;  1SPP A;  3NAP C;  5HXM A;  1XYP A;  4GMP 3;  5FJK A;  2MEV 1;  3EBR A;  4AW7 A;  3ZXD A;  3C7G A;  1H6X A;  1QY4 A;  3D6E A;  4JC1 A;  3VL8 A;  2RS1 1;  1UZV A;  1AYM 2;  1LEM A;  4O9G A;  1W2T A;  3U10 A;  1JH5 A;  1FT9 A;  1NA1 C;  2WN2 A;  3NNF A;  4K6B A;  3TOJ A;  1PMH X;  1IHM A;  3KM5 A;  2YFZ A;  2Z69 A;  5DUV A;  2A6W A;  2CGP A;  1R08 1;  2DVD A;  4Z82 A;  4OFG A;  1UKR A;  1W2O A;  4PF5 A;  5HCA A;  5HCF A;  4QKN A;  2J22 A;  2ZJC A;  3D0S A;  1W8H A;  1MS4 A;  3VKF C;  1W04 A;  3I8T A;  2B45 X;  2WS9 1;  5JDB A;  1JYN A;  3Q9O A;  1TEI A;  4Q8L A;  1C8M 2;  2YB7 A;  4DUX A;  5FPA A;  3GZE A;  2WJS A;  2WFF 1;  2ETE A;  2IFR A;  4D0Q A;  4DB5 A;  4XJ9 A;  5L7O B;  3QD6 A;  3B00 A;  2R7E B;  4AI2 A;  1UN1 A;  2XXZ A;  4CDX B;  1GZ9 A;  1P8J A;  3WF2 A;  2JD4 A;  5FDB A;  3OD0 A;  3G6J B;  3TNQ A;  2RS3 3;  1NUK A;  2CV6 A;  1QQP 3;  1OFN A;  1KGY A;  1IGO A;  3N9Q A;  1DCS A;  4IEQ A;  4EWA A;  4QM9 A;  5GLV A;  4XFB A;  4ZU5 A;  3USU B;  1UYY A;  1SMV A;  2W87 A;  3U4S A;  1RUI 1;  2C26 A;  5JR7 B;  1RB8 G;  3QH6 A;  3AKQ A;  3JQX A;  2HWB 1;  2IXH A;  3M3I A;  2R1D A;  3I54 A;  1G9A A;  1ZYB A;  2AEN A;  2BGO A;  4A3X A;  3R6S A; 
#chains in the Genus database with same CATH homology
 2VTF A;  3WSO A;  1CIY A;  1US2 A;  4E8C A;  1NX9 A;  1UY2 A;  5DPN A;  5IFP A;  2QBX A;  1JZ4 A;  3III A;  2KD7 A;  1PMJ X;  4DUV A;  2YC4 A;  3MUZ 1;  1JZ3 A;  3T2Q A;  2RJ2 A;  3VD3 A;  2WAB A;  2VCC A;  3W5M A;  1GMM A;  4TXW A;  1MPX A;  3ETP A;  4ZXE A;  1L7R A;  4ZZ5 A;  2EIC A;  1K3I A;  2V5D A;  2VQT A;  4XVH A;  4OYU A;  1WCQ A;  1UYX A;  3A23 A;  3DYO A;  5LCW L;  1GNY A;  3HJR A;  3EB7 A;  2J1T A;  2J1E A;  1ULO A;  3PUH A;  2OKX A;  1J83 A;  4MOA A;  3IB3 A;  3JXS A;  2CDP A;  3OEA A;  3NQH A;  3OG2 A;  3EYP A;  4QX2 A;  4JHZ A;  3WNN A;  3MBW A;  3ECQ A;  4ARX A;  4OMD A;  3CQO A;  3IDA A;  2VZR A;  2VR4 A;  2VOT A;  4Z2A A;  2VZ1 A;  3ABZ A;  3NRU A;  3VD9 A;  3SEE A;  2W5F A;  2VZV A;  1W0N A;  2Y6G A;  2W3J A;  2PQS A;  4LKS A;  2C4X A;  5C71 A;  3J7H A;  2BER A;  1RYY A;  1JZ8 A;  1W8O A;  4JX0 A;  2V72 A;  4QAW A;  1K45 A;  2ORX A;  3WF1 A;  3U37 A;  1OH4 A;  3A22 A;  5IYY A;  2EIE A;  4AG4 A;  1UYZ A;  4DXT A;  5JR2 A;  3OGS A;  5JXI A;  2BZD A;  2WAO A;  5IJR A;  3GGL A;  4DUW A;  1SHW B;  1XPW A;  1JZ5 A;  2ZXQ A;  4XUP A;  3T08 A;  3OEB A;  1GUI A;  4XZU G;  2J1V A;  3MUY 1;  4RYD A;  2XOM A;  4HG6 B;  3NJX A;  4FI9 A;  2B4K A;  3WF4 A;  3C7O A;  4D8M A;  2ZEZ A;  2DCJ A;  3GM8 A;  2QQO A;  5J1X A;  1O8S A;  1DLC A;  2E31 A;  4IUG A;  3WNK A;  4ZZ8 A;  3T0B A;  3P1I A;  2BGP A;  4JKK A;  2WO1 A;  2VMD A;  4AAX A;  2VZT A;  3OGR A;  4XUT A;  1CX1 A;  1I5P A;  2WYS A;  4GWJ A;  3CZU A;  2VZP A;  5I0D A;  3FHA A;  3ACF A;  2VC9 A;  1GOF A;  1UMH A;  4ZY9 A;  4OUE A;  4BDV B;  3GXU A;  1L7Q A;  4CU9 A;  3WNL A;  3I2J A;  3OBA A;  3I2H A;  2WZE A;  3I3B A;  4JKM A;  1GOH A;  2WQ8 A;  4CU7 A;  2VCB A;  3WEZ A;  1W9T A;  1PX3 A;  2VZO A;  3BGA A;  2VQU A;  2VZ3 A;  1O8P A;  4DEV A;  2ZEY A;  3FN9 A;  5B4X A;  1WKY A;  2XHN A;  2B9V A;  1JZ2 A;  3MO4 A;  1KEX A;  1GU3 A;  1TVG A;  1NKG A;  4W8J A;  2ID4 A;  2QQL A;  2X05 A;  3D3A A;  4A42 A;  2Y6J A;  3HOB A;  5FUI A;  3K4Z A;  2W91 A;  3DYP A;  3THC A;  3NJV A;  2YC2 A;  3DYM A;  3IAQ A;  1BHG A;  4PT6 A;  3MV0 1;  2VMF A;  2VZQ A;  5CYY A;  4PQQ A;  1JI6 A;  3WNO A;  4KWU A;  4P5Y A;  3A7Q A;  3T09 A;  4DEQ A;  2VME A;  3LEG A;  4LHS A;  3LPG A;  3THD A;  3SEP A;  2VMC A;  1DYO A;  2J1R A;  3I2G A;  4W50 A;  2JDA A;  4DXR A;  1OF3 A;  1K12 A;  3T2O A;  1GQP A;  2C9K A;  4QB2 A;  4ET7 A;  1YQ2 A;  3HN3 A;  3LQC A;  4OZO A;  2Z4F A;  2ZEW A;  1EUT A;  2VL4 A;  2QQN A;  2QQK A;  4LQR A;  5JUV A;  3E1F 1;  4QDQ A;  3NNG A;  5CZK A;  2EIB A;  5JMO A;  1XC6 A;  2E32 A;  2J1U A;  5EJ1 B;  3UET A;  3CDZ B;  2WN3 A;  4BK4 A;  3I97 A;  1UY4 A;  1OF4 A;  1W9S A;  2EID A;  5IHR A;  4A4A A;  3GDB A;  1SG3 A;  5LA2 A;  2VZS A;  4A3Z A;  4E8D A;  5C70 A;  3W5N A;  3HNB M;  3HNM A;  2VCA A;  4A41 A;  2J1S A;  1JU4 A;  4A6O A;  1TG7 A;  2L9L A;  3SKJ E;  3K75 B;  4QX1 A;  3DEC A;  3VD5 A;  2LS6 A;  4UI9 L;  2ORZ A;  4P00 B;  1F4A A;  2J1A A;  4M4P A;  4A45 A;  1JYW A;  2RV9 A;  3HPN A;  4QX3 A;  2W94 A;  3SKV A;  4BJ0 A;  5LA1 A;  4BXS V;  1W99 A;  5LA0 A;  3AC0 A;  4TTG A;  2JE8 A;  2E26 A;  1DP0 A;  2W95 A;  4QDS A;  4XUR A;  3VDC A;  3I2F A;  2RVA A;  2W92 A;  5F7U A;  4MGQ A;  2V4V A;  1JU3 A;  4MO3 M;  4QX0 A;  3CIH A;  5HPO A;  2WDB A;  4QPW A;  4CUB A;  3K77 A;  4XUN A;  3BN6 A;  4CU6 A;  1R64 A;  4QDR A;  3ACH A;  3K46 A;  3ZM8 A;  2XQX A;  5EIY B;  4BK5 A;  1K42 A;  4RN5 A;  1PX4 A;  1SDD B;  2Y6H A;  4LPL A;  4UOJ A;  4YPJ A;  3T2P A;  3LPF A;  3WQB A;  3HNY M;  3MV1 1;  1ULP A;  1H6Y A;  2YG0 A;  3C8X A;  2XON A;  4QB1 A;  1UMI A;  2WAA A;  2W47 A;  2WBK A;  2JKX A;  2W1U A;  3UES A;  3VD7 A;  2LW8 A;  3HEI A;  5C7G A;  1CZT A;  2E33 A;  3I3E A;  3LE0 A;  3LEI A;  4MAD A;  5DQ0 A;  1JYV A;  2W46 A;  3A21 A;  1GOG A;  3UNP A;  2JD9 A;  1OD3 A;  3WF0 A;  2DDU A;  3I2K A;  4OMC A;  4UAP A;  2W1S A;  3VDB A;  2YFU A;  1UWW A;  2VO5 A;  2WO2 A;  4PF1 A;  2W9X A;  2W1Q A;  2DCK A;  2WUH A;  1UY0 A;  3IAP A;  3T0D A;  1HN1 A;  5IFT A;  5JXJ A;  3PUI A;  3VD4 A;  3FHQ A;  4GZ9 A;  1UX7 A;  1F4H A;  4DXS A;  2WO3 A;  2Y8K A;  2QQM A;  3C7H A;  1CZV A;  2WZ8 A;  3VDA A;  1J84 A;  1EUU A;  4QB6 A;  2Y6K A;  4JKL A;  1OT5 A;  2Y64 A;  4W4Z A;  4CVU A;  1JYX A;  1IQD C;  2VJX A;  4L0P A;  1D7P M;  2CDO A;  2X10 A;  5G04 L;  2HYX A;  3OB8 A;  1NAE A;  1CZS A;  3ACI A;  3ACG A;  1UXX X;  4P08 A;  5G05 L;  4KI5 M;  2ZEX A;  2VZU A;  3C7E A;  3CMG A;  5B4N A;  3CKH A;  5JXG A;  3OGV A;  5JXH A;  2J7M A;  4P02 B;  1UZ0 A;  5HXM A;  5DMY A;  3C7G A;  4XUQ A;  1H6X A;  1T2X A;  4M4R A;  1W9W A;  1XNA A;  1O59 A;  2WN2 A;  1PMH X;  5A1A A;  2YFZ A;  3K4D A;  1UY3 A;  2W1W A;  3WNP A;  3CZJ A;  2J22 A;  4CUC A;  2VM9 A;  2Y6L A;  1JYN A;  2QQI A;  3T0A A;  4DUX A;  1UY1 A;  2YB7 A;  2HLE A;  3WF3 A;  4D0Q A;  2BBA A;  1LNS A;  2R7E B;  3F2Z A;  3FL7 A;  1W8N A;  4MGS A;  1JHJ A;  5DN2 A;  1P8J A;  3WF2 A;  1US3 A;  3LEK A;  1NUK A;  3WNM A;  3C7F A;  3I3D A;  1JZ7 A;  1XNT A;  1KGY A;  1UXZ A;  4XUO A;  4A44 A;  4KMQ A;  1UYY A;  2W87 A;  2QQJ A;  3K4A A;  4ARY A;  2C26 A;  4CU8 A;  1JZ6 A;  4GWI A;  3P6B A;  2BGO A;  3I2I A;  5EJZ B;  2X09 A;  4CUA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...