2YFUA

Cbm62 from clostridium thermocellum xyl5a
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
140
structure length
140
Chain Sequence
b'SYPKLTGTVIGTQGSWNNIGNTIHKAFDGDLNTFFDGPTANGCWLGLDFGEGVRNVITQIKFCPRSGYEQRMIGGIFQGANKEDFSDAVTLFTITSLPGSGTLTSVDVDNPTGFRYVRYLSPDGSNGNIAELQFFGTPAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARBOHYDRATE BINDING FAMILY 6
molecule tags Sugar binding protein
publication title A Novel, Noncatalytic Carbohydrate-Binding Module Displays Specificity for Galactose-Containing Polysaccharides Through Calcium-Mediated Oligomerization.
pubmed doi rcsb
total genus 32
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2011-04-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2yfuA00
4JX0A 3C7OA 4BK5A 3UETA 1J84A 3I2GA 2ZEWA 2E32A 3WF1A 4LKSA 4IUGA 5DMYA 1H6YA 1XNAA 2W3JA 4A6OA 3MV01 4DUWA 4QX1A 3ABZA 2RVAA 5DQ0A 3HNBM 1JYNA 2V5DA 1KEXA 1UMIA 3IB3A 3VD3A 4W4ZA 3WNOA 1GMMA 1GOFA 2YG0A 3MV11 1EUUA 1WKYA 1F4HA 3C7HA 1US3A 3MUZ1 2W91A 4DEQA 4E8CA 4MGQA 3IDAA 5IYYA 3T0AA 3ZM8A 4PQQA 1DP0A 2VM9A 3SKVA 3GDBA 3I3DA 3LEKA 2XQXA 3WNMA 3K4ZA 1UY1A 1GNYA 2BZDA 2QBXA 2L9LA 1CIYA 5J1XA 5LCWL 4LPLA 5LA0A 3EYPA 5JUVA 2WAOA 3I97A 3LE0A 1UY0A 1NKGA 4XUOA 5JXHA 2ZEXA 4DXSA 1US2A 2DCKA 3T09A 2VZSA 1UXXX 2W9XA 3OGVA 5I0DA 3IAQA 3HJRA 1EUTA 2W1WA 3ACGA 1LNSA 4ARYA 1W9TA 3FL7A 3CDZB 3A22A 4XVHA 2WUHA 1W9SA 3HEIA 2C26A 2VJXA 3T2QA 2XONA 1F4AA 4TTGA 2YFZA 3WF3A 2QQMA 4XUQA 3THCA 4A41A 1JU3A 4JKMA 1GQPA 3T2OA 5JXIA 1UY4A 4OMDA 3ACFA 2BGPA 1GU3A 2VQUA 3NJXA 2CDPA 3OGSA 4GZ9A 2LS6A 4FI9A 1TVGA 3UNPA 3VDBA 1UY2A 3T2PA 3NQHA 2LW8A 5A1AA 1HN1A 2VZ1A 1KGYA 3AC0A 3CMGA 4DEVA 2YB7A 1L7QA 2W94A 1O8PA 1JU4A 1H6XA 4XURA 2VMCA 3OEBA 2VZ3A 2Y6GA 2WDBA 1O8SA 2E31A 2W5FA 4JKKA 5B4NA 4BJ0A 1RYYA 2QQKA 1O59A 1UWWA 4JKLA 1WCQA 2J7MA 1GOHA 2VZOA 5HPOA 3ACIA 3C8XA 2CDOA 2J1AA 4OYUA 3A7QA 3MBWA 1UYXA 2J1VA 1XC6A 1UXZA 4XUNA 4ZZ8A 2Y6KA 3A21A 3U37A 3CZUA 2VO5A 1L7RA 1XNTA 1JZ8A 4BDVB 2VC9A 3WEZA 3HPNA 4A3ZA 4Z2AA 3WNPA 2VMEA 4ARXA 5JR2A 4QDRA 5G05L 2JE8A 4AG4A 2J1UA 2E33A 3HN3A 1NAEA 5CZKA 4MOAA 4M4RA 2VZPA 4DXTA 4ZY9A 3OBAA 3SKJE 3K4DA 4CU7A 2R7EB 3FN9A 1J83A 3K4AA 2VCBA 1DLCA 1K42A 4BK4A 3J7HA 1JYVA 2X09A 2JKXA 3W5NA 3I3BA 3ECQA 3HNYM 5LA1A 4OZOA 1NUKA 1PX3A 3DYOA 2W92A 3LEGA 4QB6A 2WO3A 4OUEA 2WO2A 3PUIA 3CKHA 1DYOA 2E26A 4UOJA 2WN2A 2W1QA 4P5YA 1CZTA 1OH4A 2WQ8A 2EIEA 5C7GA 2PQSA 5DPNA 2Y64A 4QAWA 1NX9A 3WF0A 2RJ2A 2V4VA 2HLEA 1W0NA 4D8MA 4CU9A 3LPGA 1XPWA 4XZUG 4CU8A 4A44A 3LPFA 4KWUA 1T2XA 3VD5A 1ULOA 1OF4A 2J1EA 1JYXA 2ZXQA 4D0QA 1UX7A 5IHRA 3VDAA 4DUXA 3SEEA 2VZUA 4PF1A 3OGRA 3OG2A 2OKXA 3T0DA 2W95A 2Y8KA 4LHSA 3I2HA 2VR4A 4QX0A 1JHJA 3CQOA 3MUY1 4CUAA 3UESA 3CIHA 3LQCA 4QB1A 1SHWB 2B9VA 1TG7A 2QQNA 1R64A 3ACHA 3GGLA 2W46A 2ORZA 3LEIA 2WN3A 3BN6A 3K77A 2DCJA 4AAXA 4ZZ5A 4L0PA 2ID4A 5JXJA 2DDUA 3BGAA 3WNKA 4MGSA 1UMHA 4W50A 2YC4A 1OD3A 1PX4A 1OT5A 2V72A 4QX3A 2J1TA 2X10A 5F7UA 2ZEZA 5G04L 2VZQA 4CUCA 5FUIA 2EIDA 4CUBA 2EIBA 2WABA 2YFUA 4XUTA 4W8JA 3NRUA 4RYDA 2VQTA 5B4XA 3IIIA 1GOGA 1JZ7A 3E1F1 5IJRA 4QPWA 1GUIA 3I2KA 3I2FA 3T08A 1D7PM 4LQRA 4DUVA 1K3IA 2VMFA 2Y6LA 5LA2A 2WYSA 2QQJA 4KMQA 3WF2A 2W47A 1JZ4A 3VD7A 3FHAA 3NJVA 3K75B 2YC2A 4A4AA 1JZ3A 3ETPA 3I2IA 2JD9A 3P6BA 4QDQA 2X05A 3GXUA 1IQDC 2JDAA 1SDDB 1UYYA 4P08A 4HG6B 2C9KA 4P02B 2QQIA 2QQLA 2EICA 2ORXA 3JXSA 4ZXEA 2RV9A 1JYWA 3IAPA 4UAPA 3W5MA 5JXGA 4A45A 3WNLA 1CZVA 3EB7A 4MO3M 1UZ0A 1W8NA 1JI6A 3VD9A 3K46A 4XUPA 5EJZB 3THDA 2Z4FA 2XOMA 3T0BA 1BHGA 4OMCA 4A42A 1JZ5A 3DYMA 4DXRA 3SEPA 4YPJA 1SG3A 1P8JA 2KD7A 3MO4A 2WO1A 2BGOA 1K45A 2VL4A 1CZSA 2WAAA 3OB8A 5IFTA 3WQBA 5EIYB 1JZ2A 2VCAA 2VOTA 3WF4A 2HYXA 4MADA 3VDCA 3PUHA 3P1IA 2C4XA 1OF3A 2XHNA 4QX2A 4QB2A 2VZRA 3NNGA 1PMJX 2WZEA 3DYPA 4BXSV 2WZ8A 3HOBA 2VMDA 3CZJA 3C7EA 2J1SA 2ZEYA 4PT6A 4QDSA 3I3EA 4M4PA 4GWIA 3DECA 3F2ZA 4GWJA 4CU6A 5CYYA 1I5PA 1W8OA 3FHQA 2VCCA 1UYZA 2W87A 3WSOA 1PMHX 1CX1A 2Y6HA 4CVUA 5HXMA 2VZVA 2B4KA 1K12A 5EJ1B 3OEAA 4UI9L 5C71A 2W1SA 2QQOA 2BBAA 5JMOA 3VD4A 1YQ2A 1ULPA 2Y6JA 3WNNA 4E8DA 3HNMA 2W1UA 1JZ6A 1UY3A 3D3AA 3C7GA 2BERA 4KI5M 4ET7A 4RN5A 2J1RA 2VTFA 5IFPA 2VZTA 3I2JA 4P00B 5DN2A 2J22A 2WBKA 4TXWA 4JHZA 1W9WA 3C7FA 1W99A 5C70A 3A23A 1MPXA 3GM8A
chains in the Genus database with same CATH superfamily
3SMHA 5E8AA 2KR2A 5HCBA 3PIGA 5BNPA 5C4WB 1PZ9A 1XNCA 2VNOA 4JX0A 4KG8A 4PDWB 1GZWA 3NV2A 3VBSA 1LJ7A 1QDOA 1S2EA 3MPPG 4LKSA 3TNQA 1VMFA 4DNYA 1RUJ3 3MIEA 4PDWC 2D7FA 3IZOA 2NP0A 1BK1A 3UGHA 4XJZA 5K9YA 1POV3 2HWB2 2DUOA 4QX1A 3SCFA 5KC5A 1A3KA 2JE9A 5DQ0A 4DZGA 2P3KA 4COWA 1UD1A 1G7YA 3ZPYA 1OH3A 1S0GA 3FBMA 3RYRA 2JG9C 4MX3A 1GWLA 1NQJA 2YG0A 3ZOIA 3DF0A 1YFYA 1X36A 3G6JB 4QPYA 3BCWA 3LFIA 4P9XA 4JHTA 2ADDA 1YC61 3CJIC 3BI3A 3N7LA 5BV6A 2XQRA 4JVAA 4E8CA 2W91A 4DEQA 1BEV2 5EZWA 2C5DA 1W0OA 5ANQA 1REFA 1YQCA 5FOBB 1CAVA 3I3MA 2WR9A 3SKVA 3I3DA 1K5JA 4U36A 4HPKB 4AW7A 1MS4A 1AL0G 3APBA 2R30A 3K4ZA 1GQGA 1T6BX 1UU5A 2AYHA 4UYBA 4QPGC 3ZKUA 1CIYA 1V6MA 5JOZA 4YW5A 4CP0A 3I4IA 1RL3A 5FK7A 1DGWA 3VBOA 1C57A 5JUVA 3I97A 3EMRA 1V0AA 1NKGA 2XKPA 3NNLA 5C5UA 1Y7BA 5JXHA 2UYBA 3ZR5A 1CAUA 2GU9A 1QH6A 4D7TA 4B8EA 4UW6A 3TAYA 3BU7A 4HFSA 1ZNPA 4MXWB 3F95A 4OI4A 3T09A 2B8MA 1Y43B 1UXXX 3HIFA 3M4FA 4Q4W1 4DB5A 1CGPA 5DDJ3 1RUI2 3HJRA 3J9SA 4ARYA 3VBOB 5HV0A 1PZ8A 2ZX2A 1NLSA 1XXNA 1DQ0A 2OYZA 4EZ4A 3CDZB 5L7OC 3NV4A 4FAGA 3ZYGA 1QJU3 4IV3C 4UWDA 1W9SA 1HXS2 3RYKA 5F37A 1T6GC 2YU1A 5AC91 2VQAA 4CEYA 5IWFA 4H3WA 1YI7A 2WRAA 4GH4B 1YFWA 3KV4A 4XJAA 1FPN2 4AYUA 4WVZA 3WF3A 4KGQA 4QX7A 4XUQA 1JU3A 4JKMA 5L9RA 1JMUB 1GQPA 4CCJA 4L99A 4Q0PA 4YRDA 1GZTA 1ZVFA 2PAMA 3RWNA 4FTBA 2QQWA 4OZXA 1RUD2 3WINE 4R8HA 4DPNA 5A1LA 3B02A 4QU2A 3NJXA 2JDPA 1OPOA 2IXLA 3PNAA 4JC1A 2CDPA 2GZWA 2R6QA 4CZSA 2LS6A 1XBFA 2QDNA 4M00A 3UL2A 5K0UC 3VBSB 3B00A 3ENRA 1D0HA 4EWDA 5A1AA 4LLOA 5FPUA 3GZUC 2QDRA 2UU8A 3S5AA 3NSTA 4YGDA 5FMOS 3HQRA 4CDUB 3AC0A 3CMGA 1XNKA 2GC0A 4RA0A 5FZ9A 3PDQA 4FAHA 2W94A 5FZLA 5BUVA 2DVDA 5C3OA 2VMCA 4WV8A 2BOJA 4OHZA 1WLDA 1O8SA 3NVCA 3MLJA 1IS6A 4BJ0A 2QQKA 3R6SA 2RJLA 1G9BA 3NV1A 1W39A 1ND3B 4IE4A 2RDSA 1OPMA 3IDCB 4AI1A 3K3NA 3OCPA 1QKQA 4O9GA 2VZOA 2X5IC 2CTVA 1LOGA 2CDOA 2J1AA 4LO6B 2H0VA 4ATFA 2R063 5C6CA 4AGVA 5E6HA 3UGFA 5FLHA 4LUKA 3D0JA 2XL7A 3A7QA 2DU0A 1REDA 4PI0A 4OHWA 4BQ4A 1V9U2 3KF3A 4D3WA 2VMHA 3O7OA 3U37A 4M3CA 3RZKA 4AEJA 3VGIA 4KU8A 3TOJA 4ZU4A 1GANA 1KDMA 4BA6A 2GMPA 3E6CC 1DCSA 1H2MA 2P1BA 2WC2A 4YFZA 2RG4A 2VULA 5JIUA 5JLVA 4G3YC 4A3ZA 1LGBA 3WNPA 5IATA 2VXRA 3CJIB 3KB5A 4LEJA 4IV1A 1VBC2 3ON7A 4IEYA 1QJX3 4QDRA 2JE8A 5GZFA 1RUD1 2VMIA 3J8F2 1QEXA 2E33A 4O61A 2FCVA 4K6BA 4AVBA 5LRSA 1WMDA 1HRV3 1W3VA 1S0DA 4P9WA 4KH9A 2JX9A 3QCWA 4DXTA 1I5ZA 1DZTA 4ZY9A 2GP5A 1JYCA 3BKZA 3SKJE 1QJZA 4NPLA 4YLZA 2D3RA 2DUQA 2RM22 1ZRFA 4J1WA 5BNQA 4PDWA 2W52A 3E5UA 4JRAA 2OQ7A 2AH2A 1BXHA 1DLCA 3OSDA 2P37A 1Q56A 1JYVA 2X09A 5JI7A 1SLTA 3W5NA 3JCIA 5A7WB 2VOKA 4F8AA 3AMQA 4B4QA 3EQEA 4HKWA 5JSOA 4QKNA 1NUKA 4AQTA 1LOCA 4EV0A 4P9JA 3LEGA 4NMIA 5A6YA 1A78A 4QB6A 2WO3A 4OUEA 3PUIA 5L9VA 5KHKA 1ZZCA 2E6VA 2VBBA 5H9PA 1OD5A 2E26A 1GLHA 5JOYA 1ZM1A 2B46X 2FCUA 1IPSA 4WM8B 3RS6A 1EPZA 2YZ4A 3BOWA 3ES4A 2TBVA 1OKQA 4HN0A 4O9EA 3THTA 5I91A 1KXGA 1MEC2 1SLLA 1YCIA 2DTYA 2DF7A 2RS53 4DINB 5C8CB 1CZTA 4G9SB 3K51A 3V56A 1RUH2 3RMXA 2OXBA 5DG2A 1OH4A 4AL9A 1ZZBA 2YGMA 5BYNA 2E51A 2EXHA 2FD8A 4I30A 2PQSA 1VBE3 2TUNA 2Y64A 4R4ZA 4N53C 5DAWA 1WW5A 4NPMA 4QQPA 1BLZA 1NX9A 4MYEA 3VBUC 1WA4A 4XCBA 1YYNA 3RZHA 1WBFA 1MS8A 1QJY1 4AI8A 1XE8A 1RUJ1 2P6HA 2QZ3A 3QBQA 4XIOA 1T2XA 1W2TA 2NLRA 3WQ0A 3AKQA 1OF4A 4Q26A 4XZPA 3IT8A 2J1EA 1IQAA 2DUPA 4Z2WA 5F32A 1FNZA 5CVRA 5FPAA 4FPHA 4QD2A 3USSA 1ASJ2 1LHVA 1RMU2 5C8WA 4FOYA 4D0QA 3T2TA 2ZHNA 1X8MA 2JG8A 2R071 5EJ1B 1BEV3 3KV9A 3OPZA 5FP9A 5FY1A 5JZGA 5K8SA 5A3OA 3PHMA 1WW7A 1KD7A 1OI6A 1VBB1 2A1XA 4PF1A 3OGRA 1VBD3 2O1QA 4XIKA 3WNXA 4JGZA 5JPMB 4YW7A 3O1MA 1Z0HA 2Y8KA 5C5TA 4OCTA 2DCZA 2VOVA 5L9BA 2EIGA 4CDQC 1ZZ9A 2D3SA 1JHJA 1ULEA 1W28A 2QZ2A 4JDNA 1JHNA 4CUAA 2ZGSA 4K3UA 3E5QA 4Q4X2 1AVBA 4WVWA 1SHWB 5JMCA 1BBT2 2B9VA 2GH2A 3H9AA 1NYWA 4Y1ZA 5K7PA 3B9CA 3GGLA 3WG4A 2P3IA 4XTPA 1O4ZA 4M0HA 5FYIA 5L36A 1AUYA 1SDWA 2CHHA 2QFEA 1MQTA 5DAPA 3SISA 4QPIA 2G19A 4CEWB 4DRVA 4XJWA 2DCJA 3LGRA 1NE4A 4COUA 5KWRA 5LW9A 1S55A 2ZMLA 3L2HA 4EJRA 1FOD1 5K0UA 4D6RA 3FMGA 5JXJA 2RS52 3IIAA 2DDUA 2QNKA 1F8VA 2WQZC 1AR81 3RI8A 5DAXA 2B39A 2GSYA 2OZJA 3LIGA 4KWKA 4XF4A 4XBLA 5J96B 3JD71 1EAH3 4QT6A 4DOUA 1KRIA 5HCAA 2X10A 3DGTA 3RZGA 1JOJA 2IXJA 5FUIA 5GLUA 3O1UA 3FZ3A 4UBHA 4YVWB 1L3JA 1WMXA 4FPCA 5GLZA 4CUBA 4W8JA 1PZ7A 2SBAA 2VU9A 4Q4W3 3KCCA 1R1A3 3DL3A 4K1YA 3KQ4B 4C0HA 4RSUA 1JBCA 1WCDJ 3C3VA 4ZS3A 5T5PA 2UY8A 1OOPB 4LLFA 5IJRA 3ATGA 3H3ZA 4QPWA 5I0UA 1DFQA 4B7KA 5FPXA 3I2KA 1RUG3 3R0RA 1BYHA 4CPBA 5T5LA 2J42A 3R4DB 5EWSA 4FPKA 1RITA 1D7PM 2VUJA 4LQRA 1CQ9A 2DCTA 4FTEA 2Y6LA 3WR0A 1V6OA 3N9OA 5LY1A 2WYSA 4BHPA 1E5SA 4RD7A 4D94A 2W47A 1QWRA 4XCAA 5BNPB 2BDRA 1LOFA 4IGOA 3I2DA 2JIJA 1WGPA 4IGQA 2QTWB 3DPRB 3IM0A 3Q8BA 4IE0A 2AGSA 2QQUA 3OGGA 1N47A 4BQ3A 2WFPA 4QDQA 1DQ5A 1SCRA 2VGDA 3GXUA 5D1IA 2X05A 1UF2C 5FTTC 5A6QA 4HETA 4WVMA 1PO11 3AXEA 3WP4A 1IOAA 2XJPA 3CJIA 2X5IB 1O91A 5K4LA 4HG6B 3WW3A 4P02B 4LO8A 4IESA 2DVBA 2QQIA 2WL1A 5L19A 1O5LA 4L9BA 1JYWA 1ND2B 1TME3 4DY3A 4GIQA 1LEMA 1XYPA 5JXGA 5FY4A 1NCRC 3OD4A 1C5IA 1CZVA 3EB7A 2TNFA 4MO3M 1UZ0A 1REEA 1SBFA 1XYNA 1JI6A 1QJX2 3NNMA 3BPSA 4GWMA 4WVVA 3NWKA 5E16A 5ACA2 3U14A 3WZ1A 3H8XA 5BNOA 2XJUA 2FDIA 2VG9A 1BHGA 2ET7A 3AVSA 1FV3A 4OMCA 3ZSEA 4K20A 4O7XA 1JZ5A 2P17A 1VAKA 1GNHA 1W06A 5FWEA 1D4M1 3MLLA 5BXXA 5FZGA 1OA3A 5KHGA 1HB4A 3WVJA 3ZPOA 1PO23 1ZRIA 4PLOA 3USUA 1P8JA 1IZ3A 1FV2A 4S2HA 2WO1A 2BGOA 3OF1A 3ELNA 3BALA 1H8TA 1J3PA 1NXD1 1NCQA 1QJU2 2CWMA 4FPEA 5FZIA 4U2AA 3ZFFB 2G9ZA 2ZGOA 1W6NB 5EIYB 3QOPA 4NWWA 3WF4A 2HYXA 4P9LA 4GB31 4BMEA 4YWAA 4E2GA 5FYTA 2P5BA 2ZHLA 1CESA 5FYVA 3NJZA 3I59B 2AACA 1AR62 3I3QA 4AHWA 5F5QA 3NNGA 1UPSA 2Z79A 2E53A 5A32A 3O1PA 1GZCA 5FYSA 2VBDA 4EN0A 3KT4A 4LORA 1UPIA 4UFIA 1H1AA 5DUWA 1QJX1 1J58A 3PUSA 5IVBA 3C7EA 1V00A 2DYCA 2J1SA 4L97A 4URTA 4ATEA 4AQ6A 1H1MA 1WCSA 1XRUA 1MS3A 2WA3A 4GAZA 4CDWA 1LHOA 4AI9A 3POGA 1NA1B 2ZMNA 5IK8A 2WWJA 1XOYA 5JZGC 1XB9A 5DAVA 2PHUA 5CYYA 1A8MA 1PK6C 1I5PA 5E89A 3UV9A 2CL2A 4W6WA 1RMU1 5L7OB 4NAMA 1PMHX 3WSOA 1XSRA 1MEC3 5LY2A 4CVUA 1HW5A 5A3TA 4BQ2A 4AQ2A 5KR7A 1K12A 3PVEA 2WFF3 4GULA 4ES9A 2LALA 5T55A 1W8FA 5C71A 1RUE2 3H42B 3LDRA 2D6OX 2OX0A 2A73B 2BBAA 4YW2A 3UK9A 3N9QA 1WWYA 2Q1ZB 1WD3A 3T30A 2Y6JA 3K2OA 1S1AA 4HSJA 3EXUA 3W21A 1JOPA 4E8DA 1SFNA 4AXOA 5LEJA 1W8TA 2D5FA 3ZO0B 4AFMA 1BEV1 1HQWA 4IERA 4EZHA 5A1FA 2PYTA 3HBZA 3IDBB 2BERA 4RS5C 1R083 2VTFA 2Z5WA 3B5LB 4YM0A 5FMOL 2VZTA 4BQWA 2B7YA 3I2JA 5DN2A 1K5MB 1W6PB 5I0RA 1ZRCA 1TQ5A 4YG3A 2AUYA 3K48A 1N1SA 1COV1 4AVSA 3BPZA 4FBFA 5FY0A 1EY2A 2WNUB 1MZ5A 3LDBA 3C7OA 3QH6A 4BK5A 1YQ6A 4BXFA 5FWJA 1LHNA 3JBG2 3I2GA 5HCFA 2Y60A 4MH0E 4BQXA 4S2DA 4IUGA 5DMYA 5GZGA 1XNAA 3NJYA 2GALA 4XBNA 1RIRA 2FDJA 1MS1A 2YC0A 2RS33 2Q8EA 3VZMA 1JODA 4Q0UA 5L7OA 3AKSA 3AMPA 4DUWA 3NNJA 5LBBA 4Q27A 1RUJ2 3HNBM 1JYNA 4TZDA 1QU0A 3AZXA 1UMIA 3IB3A 4Q4Y2 5DUVA 3VD3A 1IPJA 3ZMNA 2W0XA 4RQPC 1ZA4A 2R043 4NOTA 2PHDA 3PLQA 5IK4A 4FQZA 3RFRA 4CRQA 4OI1A 4LULA 3VN4A 1W6QA 3DXUA 2VH9A 1YFXA 5IYYA 1CAWA 1LU1A 1NG0A 4PQQA 3ZM8A 1DP0A 1C4RA 2VM9A 4FPYA 2FDKA 3WNMA 3U1XA 1X82A 2UWBA 4BIOA 2QBXA 1JOBA 2D3PA 3DV8A 4FOWA 4LPLA 4LT5A 2WZPP 5LA0A 3EYPA 5FYZA 1WA6X 3VZOA 4BISA 5F6KA 4BZ4A 4AI0A 4C8DA 2RS13 5FZ0A 1JYTA 2D40A 2BFUL 1SPPA 2JG9B 2ZMKA 4PBOA 4XE9A 2NQYA 4YGCA 4KBZA 5BY5A 4HVQA 4QWNA 2VZSA 3WDUA 1ULDA 4FVVA 3JUUA 2GC2A 3IAQA 1KJRA 1VIWB 4AZZA 2VQ0A 3NW4A 1PNFA 2WLQA 3J7NA 4KQ7A 1W9TA 2EXIA 2ZKNA 3SLIA 1VRH1 2R042 4R4XA 3T4HB 3OUHA 1XJAA 4IL7A 1WD4A 3H1YA 3BTXA 5FZOA 3A22A 1AX0A 2JJ6A 1DBNA 2IXKA 4AEKA 2IXIA 2YYOA 2C26A 4MHRA 4XF3A 2G1MA 3ZYFA 5K0UB 1CD3G 5DABA 1AL22 2D43A 5HCHA 5GALA 3AFKA 3ALQA 5JZGB 1W6QB 1OLRA 5FP4A 1RHI3 4NHXA 4Q4V3 4IE7A 3E6BA 2X8KA 5D8AC 4CDUC 1URXA 2WS92 2GC3A 3E5XA 4A7ZA 4URAA 3FJSA 4LBQA 4QQ2A 5LK7B 2C0ZA 5IVYA 5IK7A 5F39A 5JVVA 3OUJA 2JIGA 1OVSA 2FZ1A 1OBNA 2MEV3 2LM3A 3MFAA 5DDJ1 2BGPA 4BPZA 1TME2 1U5ZA 1Y4WA 2DVFA 1YQ8A 5H9QA 2KA3A 1MS5A 2WYFA 2VPVA 2Y34A 3AZWA 4GZ9A 1ND2C 4KBBA 1AR93 4FI9A 3AK0A 1TEIA 4XETA 5FZOB 1R082 1WZXA 3ZXKA 4C90A 5ABJA 3UNPA 2LW8A 2JECA 1PGW2 5D2AA 3ZYHA 2VXJA 1PO13 1X7NA 4H55A 4L92A 4LIUA 1YHFA 4Y5Z0 1KGYA 2JG8B 4FSJA 3WG3A 3ZFFC 2YB7A 3TN92 5IVFA 5J36A 1O8PA 1TZOA 3WG2A 5F5AA 4RR3C 1LB2A 2IZWA 1LTEA 1SQ4A 4M3CF 1IG3A 3S6PA 2ZCWA 1HRI2 2HWF3 2VZ3A 3NO8A 2HYKA 1CONA 3QLQA 2XJRA 2HH9A 4BH9A 5I0TA 4JKKA 2D44A 4KNCA 2YY1A 4XJUA 2RMU3 2K2SA 2YBKA 3AL5A 4YM3A 2XGXA 2GMMA 4DY5A 3LWCA 4Y5SA 4OHYA 5APAA 4CDQB 3ZMOA 1WCUA 5LBEA 3ACIA 1W2UA 3VKLA 3C8XA 3GCWA 5HPOA 2ZGRA 4A2UA 1QHDA 2BFUS 2D98A 4XJ9A 1OFNA 4I01A 4ASLA 2QJVA 5CFCC 4QU1A 4UT5A 1G9FA 3KZ4C 3RSJA 2A71A 5JAXA 3TWIA 1B09A 2GP3A 2JD4A 1X50A 1UYXA 2ZHMA 1HRI3 5FPBA 1WBLA 1Z7S1 4ZONA 3KCXA 1S2BA 3UKNA 3I7DA 1AR91 1XNTA 1PK6B 2VC9A 3WEZA 4TYSA 3DCQA 4KWLA 5IT6A 4QKDA 3RRDA 1RXGA 3B94A 1MEC1 2VMEA 1LESA 1UIKA 1YWKA 5FOJB 3OYWB 5G05L 3ST7A 1QQP3 1W8UA 1AXKA 5FMBA 1GWMA 2J1UA 4MHUA 3BUCA 2O8OA 3ETQA 5CZKA 1HJGA 1W9FA 2XB6C 3VZNA 2NMNA 1W6OA 3H50A 2A3YA 3CBNA 1AR82 2VZPA 3AZYA 3SC7X 4D6SA 4XW3A 4LK6A 2BUKA 4Y20A 4YM2A 4CCCA 2R061 5IVVA 3ZR6A 5FY7A 5GZDA 5C9AB 3VBOC 1J83A 1IS4A 2DBIA 1DG6A 1J1LA 3KSCA 5FYYA 4YZ2A 2VCBA 2WS93 3M3CA 2F4LA 1HRV1 1ZA7A 2CAVA 4UFLA 2R49A 3BYWA 2W68A 3V65A 1RVF2 1SEFA 3AYDA 1OOPC 1WMFA 3I3BA 5EPAA 5I0SA 1JN2P 4CDQA 1HRI1 4Y1YA 2ZABA 1WLWA 1CPNA 1ND3A 1QOTA 1LRHA 1W6NA 5DZFA 2OUHA 3DYOA 4WZCA 5SV8A 3VKNA 3SH3A 4CCEA 5FKBA 1HQLA 5FQ0B 2WO2A 4NR1A 5FMDA 3SH5A 2VCMA 4YW3A 3USUB 2WIIB 1D2QA 3AP4A 2P4EA 2SLIA 3P3PA 2RR13 1R1ZA 3N36A 5FYMA 1IS3A 3UGGA 2I45A 1RC6A 4OI2A 4Y1VA 3FLPA 2YGLA 1XQNA 3WDYA 4ISQA 1UO9A 3LFMA 1K5MC 1ST8A 3WQ7A 4AOCA 1C8M2 4QAWA 5EXOA 3AM2A 1HV0A 4NVPA 2A75A 2RJ2A 4QKFA 1CJPA 4XMAA 5F6LB 5CBLA 4IE5A 4JQTA 1VR3A 4MXVA 1H8TC 4D6QA 2ZPXA 4BQ5A 1ND3C 1C8NA 3VD5A 3VZKA 1VBE2 3OGJA 4F3JA 2ZACA 1JYXA 1PVC2 4LBLA 4XF1A 5FZEA 4OI0A 4OQ9A 5EP9A 1F2NA 1G9AA 3GHNA 2ZAHA 1W05A 2BNOA 2E7QA 3J26N 3ROUA 1FX5A 1U12A 5LA9A 5IHRA 3VDAA 3WG1A 3DPRA 2YPJA 4XFIA 3SEEA 4CDXB 2VZUA 2P2KA 2ZS6B 4IEOA 2H6BA 1OURA 2QCSB 1PIV3 2NYYA 2XJSA 2EAAA 3OG2A 4RHV1 3VV1A 2ZGLA 2W95A 1DGRN 2ZX0A 3K3OA 2R073 3N35A 2ZGTA 2QQPA 4NIAA 1OQEA 3CQOA 4Q8LA 4XHBA 4YM1A 3MUY1 1OXCA 2D97A 3AMHA 4N43C 3CIHA 1VBD1 1J3QA 4QB1A 4IQPA 1TG7A 2W2IA 2VVDA 1OC1A 1R64A 3RJRA 5JWPA 4YG6A 3T3YA 1BK0A 4RGAA 3WDVA 2W46A 2BRTA 5F3EA 1RUC2 1NCRA 3AKRA 1ULFA 5FDBA 4M01A 5CKMA 2BWCA 1W2NA 1OMIA 3N3HA 4BOWA 1DGRA 1RUNA 2R1BA 1W6MA 3IWZA 2V4AA 5FZBA 1RUF3 2ID4A 3VBFC 1WLCA 3WNKA 1D4M3 2WZR2 5A3WA 4JQRA 5D21A 4OQ8A 4UFHA 1OD3A 1PX4A 1OT5A 2FBEA 4Y24A 5A7NA 2E7AA 2V72A 4W6YA 2DFCA 3LKJA 4Q8KA 2HBUA 4PHZA 4LE3A 1YQ5A 4QQLA 1CJDA 2PLV3 2ZEZA 1NY72 3CU7A 4HT1T 4IV1C 4CUCA 1S0CA 3U75A 3PUQA 3RZMA 3VBRA 3Q8FA 1QDCA 4HONA 5ISLA 3W20A 4NIDA 1VBA1 4RYDA 1YLLA 4XXPA 1AX1A 4R52A 4JGYC 4Y33A 4YVSA 3AP7A 2OT7A 1X9PA 5B4XA 3H8RA 3OD0A 2JXAA 4XDQA 4ZHNA 3FBYA 3IIIA 1NE6A 1V6JA 4JAAA 3ME2A 3E1F1 4OHVA 1AX2A 4QPGA 1JZ7A 1AR73 5FP7A 2XVLA 5I93A 1N1TA 3CEWA 4COZA 3JQWA 2WNVC 5E88A 2BQPA 4JRLA 2RM21 1SLAA 4LMFA 2XJQA 3Q8AA 1R1A2 1S0FA 5AVAA 2HWC2 1PMIA 1YNAA 1MACA 3GYDA 3UKTA 5LA2A 4MZUA 1ODMA 2RDNA 3ZN6A 1BJQA 3WF2A 2R1DA 2X29A 2O0OA 3MGUA 4FPJA 2A6XA 4A4AA 2YC2A 4B29A 3ETPA 2DCYA 4OVEA 1NT0A 2HWD3 1ACCA 2IXHA 3VBRC 1YEWA 3GCXA 3U4XA 3VBUB 5F3CA 1IQDC 1MQTC 3JU9A 1UYYA 4P08A 3M1HA 2B42B 4NHLA 1D0GA 4N53B 2VE1A 5D8AA 3T1LA 3NMBA 4AVCA 1WW4A 2DFBA 4Y4RA 1YUDA 5LB6A 2ES3A 3VL9A 1NZIA 2FDHA 2QQLA 1ZZ8A 3KQRA 4WZFA 4ASKA 1HB3A 2RV9A 4CEYB 4IV3A 1DQ1A 1RUH3 1UW8A 4Q0VA 4PBPA 5J09A 3WNLA 3IPVA 3ZN5A 1VBA2 5KHJA 1U0AA 3E97A 1W9YA 3VD9A 2FDFA 3FFZA 1NLRA 4V2WA 4UFJA 5EJZB 3THDA 4J6GA 1UOFA 4Q1PA 1NY71 4ONUA 3WW2A 3MF6A 4HN1A 1HJFA 3ZFEA 3VL8A 4LBQD 5LK5A 5HV4A 2I74A 4COYA 4IE6A 3B01A 3ZFGA 1LEDA 3FFQA 2B5HA 4YPJA 5IK5A 1YO8A 2KM2A 4B7EA 4EQVA 1S0EA 3KV5A 3UKVA 4HANA 2XVKA 2JG9A 3GBFA 1K45A 2GN3A 4K1ZA 1U5XA 5CEHA 5KC6A 3TYJA 3GBGA 4GKYA 5IFTA 3LD8A 4LKEA 4GJZA 1JZ2A 1ZYBA 3WHUA 1QY4A 5FXWA 2WS91 2RMU2 4AQSA 4JDOA 4N90A 1LGNA 4NJ4A 2HEYF 1DZRA 2C4XA 2HWE1 4HZFA 1RUI1 2VUDA 1RUH1 3JZVA 2HEWF 3RMYA 3VDBA 2ADEA 2XHNA 4I09A 4QX2A 5FZFA 3NKTA 4CEWC 1N3OA 4N43B 3S30A 1IS5A 2JENA 4QB2A 4XPVA 5FP3A 4GB33 2WZEA 5EV7A 4L11A 3DYPA 4FCAA 5GM0A 1UU4A 3CO2A 2WZ8A 5KHHA 5LBCA 1STMA 3LCPA 4IEVA 1UIJA 2RS51 2PMWB 3I3EA 3NAPB 4HVRA 3VKMA 1SFPA 4M4PA 2PHFA 3F2ZA 3HT2A 3JB4C 3O1TA 2XDVA 2YROA 4CU6A 1UOJA 3SQOA 3FHQA 4AVTA 4I0AA 2VAUA 3JBG1 3TEZA 2RE9A 2BEOA 4QXKA 2B4KA 3IMMA 2RR12 1C1FA 1G8WA 4J25A 3OEAA 4NROA 3LB9A 4UI9L 1UL9A 3QD6A 1TMF3 1GZWB 4QMAA 3ZDSA 3EHKA 4LOTA 4UBGA 4XF9A 4DO0A 1F15A 3H3UA 4TWTA 4HMZA 3HN1A 2ZHKA 4Q4W2 3V64A 1ULPA 1W3XA 2KXLA 4LITA 3WNNA 1AYN1 3CHXA 2CU5A 4E27A 1RUC1 5A7SA 2XWJB 5A33A 3VHPA 2HWB1 3HNMA 1FPN1 3DEMA 1GP5A 1ND2A 4XFBA 1UY3A 2MHFA 3PUAA 3GZTB 1YXWA 1EAH2 3C7GA 1POV1 3OBTA 4QGMA 3AKTA 4KI5M 4UF0B 5JR7B 4LHNA 3TNPB 4RN5A 4YW6A 3VHRA 1V6NA 2P6CA 5GLWA 4AHYA 1W8HA 3IKWA 4AEDA 5C4WC 4GA9A 3SH4A 4CXYA 1O3RA 3POIA 2K46A 4TXWA 3LOBA 5BNNA 5C70A 5LEKA 2VVFA 2O14A 3GM8A 4BQ1A 5F2SA 3FWEA 3UT0A 2A5ZA 4QM9A 1OQ1A 3V0BA 4Q5OA 3Q9OA 2CAUA 2EF6A 3WY6A 1CAVB 4FOVA 4LR4A 5GZCA 2ZEWA 2E32A 2V5YA 3WF1A 3O1SA 2W3JA 1MR5A 5FZ6A 4JGYA 4YVSC 3PJQA 4HBNA 5HBAA 4AHXA 1LOAA 2CGNA 1UZZA 2CWSA 2K9ZA 3MV01 3VHNA 3WW1A 1QJY2 5FY5A 3TB0A 4OUSA 4FP3A 2V5DA 2XLAA 1KEXA 4AAPA 4N8MA 4WBBA 4AK3A 2C9AA 4GQ7A 1GMMA 4WVMB 4LBKA 3WNOA 4LBJA 1ENQA 1LULA 3M3OA 3MV11 4N9HA 5I8SA 5DG1A 1F4HA 2Y33A 1US3A 3MUZ1 4GJYA 1PK6A 3IDAA 4Y3OA 5I8TA 3I2OA 2WFF2 4Y4YA 3JD73 5DUXA 1APNA 4NIIA 4IW3A 4Q4Y3 1QOOA 4QQOA 3OJBA 3GDBA 2RDQA 2HWF1 2VNRA 1N1VA 4LO4B 2CGOA 2XQXA 3D82A 5F2WA 4K9SA 3S5QA 4IEWA 1AYN2 3WDXA 1VMJA 2JDKA 1CIWA 4ITCA 5J1XA 3PTRB 3WDTA 5LCWL 3R4SA 3OY8A 4LTAA 4AEDB 3DKWA 1IKQA 1VB2A 5HXVA 5A3MA 2UY9A 1CPMA 5AC93 4OLLA 1G9CA 5GKAC 4YZ4A 3ZXGA 2ZEXA 1FNYA 4FP2A 1MVQA 5C3QA 1US2A 4AFDA 3U07A 4MGYE 2DCKA 4OUMA 4CCKA 3ZXDA 2VD7A 2JKBA 1AR92 2OPKA 2WT0A 3O0WA 4E9KA 2QQVA 1UMZA 1Y9GA 2XR4A 3AFGA 1F5JA 1Q8QA 2DBNA 3B7MA 4BWOA 5I0DA 4B1LA 1EUTA 4I3GA 4IEXA 2BWAA 1L7LA 1NCQC 3ACGA 3HQXA 1XYOA 4ZKTB 3HD8B 1G9DA 3FL7A 3I8TA 4WM8C 1GZ9A 2PLV1 2UYAA 3ZDVA 4INDA 1R091 4N7IA 4AI3A 1AR72 1POQA 1LOBA 1VP6A 4ISRA 4MGIE 1OA4A 1XSQA 3HEIA 5BPXA 4AFCA 2CY6A 2VJXA 4GH4C 5A6XA 3AP5A 1AYM1 3T2QA 4D7SA 4Y1UA 2XONA 1VE0A 1QJY3 1RGSA 3D8CA 3R05A 2E7TA 1I9RA 1W6OB 2C6SA 3PU3A 1G6NA 4I0WB 1LHWA 2YFZA 5FZHA 1O4TA 3H0OA 1S2KA 2QQMA 3THCA 1V6LA 4Y22B 1A34A 3T2OA 2GNDA 5JXIA 5A3UA 2VOXA 2C24A 1GYKA 2C1FA 2PELA 4XFGA 2HWC3 3RG0A 3VBHA 4H2AA 2DURA 1AR63 3SNMA 4Z82A 1J1TA 1H30A 4CCOA 5FAXA 1UU6A 3H7JA 3J7LA 1W2OA 2VQUA 3A0KA 5H9SA 1S0IA 5T5OA 3SXWA 4C0BA 3KV6A 1CAXA 1W0PA 3OGSA 2NPIA 2Q4SA 2E63A 1I3HA 4UW4A 1ZX5A 1PO21 1CR7A 2YHJA 2ZKLA 4RGKA 4S2GA 4E4ZA 4LK7A 1NQDA 3C2UA 1IPKA 4TN7A 3FC0A 1GFF2 4XDPA 1M4WA 2HWD2 1UOBA 5CISA 2RS12 1F35A 3MIBA 3ZSLA 2XLGA 1L7QA 4DEVA 1JU4A 2WNUC 1GV9A 1DYPA 4PIZA 4R9BA 4WM8A 4BE3A 1KS4A 3OEBA 3HQUA 1AYM3 1H2LA 2WDBA 5F3GA 2FDGA 2NN8A 2YBPA 3EJKA 2JB4A 2W5FA 1MZEA 4E4DX 5B4NA 2D6LX 1RYYA 5AFEA 1UWWA 1JXNA 5KXCA 4YFWA 1WCQA 4JTOA 4JZRA 3HT1A 3ZIXA 1RJ7A 2JDYA 2OIIA 4NN0A 3OY8B 2ZZQA 4XFAA 3G7DA 4P9GA 5JCTA 1C5HA 3DXTA 5FZCA 2BVBA 3AMMA 3FLRA 3RYPA 2RMU1 2ATFA 4OYUA 4EN9B 3GZEA 2J1VA 1XC6A 4ZZ8A 1Q8PA 2Y6KA 3BOPA 4AWDA 3A21A 3FLTA 1C8M1 1X8EA 2VO5A 1W6MB 3PVBB 4PCRA 4V2VA 4BDVB 3CLPA 2D6MA 2IFRA 5C3PA 2XL9A 2AENA 3KHBA 4LHKA 2WFF1 4YW1A 3WHTA 3HPNA 3DN7A 5J3UA 5FFOC 5T5JA 4Z2AA 1SLCA 1HB1A 3W59A 2Z42A 2G9GA 4Q2FA 2WNEA 3M8LA 3POBA 2ZX3A 4CYDA 1O3QA 1S0JA 4IEZA 2WT1A 3BVCA 2JDNA 5FZDA 1Y9QA 2BV4A 3VUOA 2ZX4A 1PVC1 4CDWB 5F8PA 4GH4A 4AVAA 4MOAA 4PI2A 4M4RA 1B35B 4XQDA 1GWKA 1RUD3 2HKXA 4BMBA 4IXLA 3H3LA 3OBAA 4YW4A 1RUC3 3W9AA 1HKDA 2ZA9A 2R7EB 3FN9A 4UW3A 4AEMA 3VB9A 4CU7A 5C9AA 4FTSA 4WM7B 3N7MA 3ZXEA 2Z69A 3K4AA 4XJ8A 2V09A 3VBFB 2ARCA 2EXKA 4BK4A 1FMD1 5FKCA 2OQ6A 2JEMA 2JDHA 3HBKA 2OPWA 2JKXA 4WM7C 5FR3A 2YMZA 4BLJA 1GQHA 1TE1B 3ECQA 4QQHA 1DZQA 3GHMA 1RXFA 4FPFA 3M3QA 1YI9A 3UJQA 1H2KA 3ZSMA 2OVUA 1VB4A 1C8M3 1RINA 1PX3A 3JBG3 4Y22A 2W92A 3QH7A 3SHRA 3WP6A 1H8TB 3WW4A 3WCRA 3LA2A 3TN91 1SLBA 3VBHC 5C8CC 5M0TA 3S57A 1DYOA 3V0AB 1MZ6A 3U4SA 4MVTA 3ZFEB 3AVRA 3MFCA 2LRPA 1UX6A 4MSVA 2FMDA 1F9KA 1GBGA 1PVC3 2VW2A 2EXJA 3BB6A 4IDZA 5FIXA 4LIVA 1XU2A 4K8FA 1SCSA 2YU2A 2WWUA 5DPNA 4X8PA 4HXCA 3ZFEC 4HPKA 5CAZA 1HLCA 4TSVA 4LA2A 5LRRA 4MLOA 2AEZA 3V0AA 4BLIA 1VLNA 1V70A 4D8MA 4CU9A 5A7OA 1XPWA 5KXDA 4R9CA 2A3XA 1O5UA 3LPFA 2D6NA 4KWUA 4XQWA 4A44A 1XNDA 4BYYA 3LF7A 4FFGA 1UYPA 5CKNA 2OA2A 1AF9A 2WINB 2WNVA 2YBSA 2F17A 2ZXQA 3IDEA 1UX7A 4A7YA 2Q1FA 3EBRA 1V9U1 2NM1A 2RDRA 3ILFA 3FUQA 4PLNA 1QJU1 4XC9A 5GZEA 2VTXA 4PF5A 1W2AX 1DLLA 5GLVA 3ZXFA 3WXPA 4DUXA 2ZGNA 4CP9B 3RZJA 4HSLA 5LBFA 4AEDC 4ZU5A 2OKXA 5FZMA 1JW6A 3ZX7A 4FPOB 3ZYBA 5A7QA 3I2HA 2VR4A 4FPGA 4QX0A 4BIFA 1RVF3 2G9FA 3KD4A 3KCYA 5FY9A 4QGLA 2BVVA 2HWF2 4HOOA 4C91A 4META 4R9DA 3WV6A 4FOQA 5L73A 4B3NA 2QQNA 3ACHA 4JCKA 3JQXA 5CB7A 1VBD2 4LHLA 4NRMA 5A7PA 2ZGPA 4S2FA 2D93A 3TBDA 1Z7S2 2WKKA 2UURA 4Q4Y1 3RI9A 2DU1A 4JGYB 3HR9A 5FY8A 3I49A 4W6XA 4IGPA 4Z1VA 4L0PA 4K7JA 4YVWA 1EAH1 1ASJ3 4XAAA 3BGAA 4MGSA 4LA3A 1KQRA 4FXGB 1RUG1 1ZBA3 4W50A 3URFA 1JYIA 4H14A 2F6BA 4YG0A 5FXVA 2ZGUA 4D7YA 4ZS2A 1ULGA 4EN8B 4YZ5A 1U5IA 4QX3A 2J1TA 5AC92 5JI9A 5C8CA 5F7UA 1KFUL 1LOFC 5CKQA 5F9TA 3PIJA 4Q4V1 2VZQA 1IKPA 2IFWA 2XJTA 3AZZA 3IPVB 4DMIA 1WMEA 2PA7A 2EIDA 2EIBA 1QNYA 2D5HA 2WABA 2YFUA 4LBNA 3NRUA 3NL1A 2GMEA 3IN9A 4YSFA 2BPA2 2RJKA 4I3PA 2VQTA 1W03A 1BVVA 5C33A 4GMP3 5AVPA 1NA1A 2MNGA 5T3NA 2X5IA 3X29B 4CCNA 4DIQA 4YNIA 2DWRA 1GOGA 1JUHA 3MIGA 1AR61 1AZDA 3Q8EA 2OZ6A 3AYAA 5A3NA 5FLIA 4DUVA 1K3IA 2GNMA 2Q5TA 2VMFA 2VBPA 3TEWA 4LBOA 1QXRA 3S7IA 3ZN6B 1YIPA 3O0XA 4KMQA 3O5SA 1JZ4A 3DUIA 3VD7A 1VBC3 3FHAA 1O6UA 3K75B 2Q1MA 3KVAA 3NJVA 2CSGA 3PVOA 4Q29A 5C4WA 1JZ3A 2YPDA 3BTZA 2PHXA 4D69A 4Q0SA 3P6BA 2Y0OA 2ZOEB 4OHXA 2EA7A 2FCTA 1MS9A 4QGNA 4XAEA 2JDAA 3AYCA 4FT8A 1SDDB 3B69A 3VBHB 4F7ZA 5ACA3 1E57A 5CFDB 3AP6A 3AYEA 1OOPA 3I54A 4B1MA 4BB3A 4QKBA 5FYUA 1SZBA 3NAPA 1CX4A 3BU0A 2PAEA 3MPBA 5FP8A 4AI2A 2ORXA 4ZXEA 1Q8SA 2P34A 3D4KA 3IAPA 1HIXA 1LKNA 1Q8VA 2YXSA 4QHZA 3ZFGB 4A45A 3W5MA 1GP4A 3HVDA 2ENRA 1OUXA 3AXDA 1UCXA 4XMIA 4COVA 1CN1A 2EVXA 1HDKA 1TME1 3K46A 3UYJA 4XUPA 5FXZA 1DU3D 1F31A 4E4HA 2XOMA 5JOXA 4Q4V2 5FJHA 3POWA 4B4RA 2A6ZA 1ODNA 4W65A 1PGW1 4NWVA 1AJKA 3DYMA 4NHMA 2XVGA 1OVPA 5FZ7A 1PIV2 1SBEA 2ERFA 1M06G 3RWKX 3WLUA 2IVIB 3KT7A 4UF0A 3GBWA 2KD7A 3MO4A 4EYUA 5C3RA 4QPIB 2IC1A 1N1YA 1QH7A 3OUIA 1HXS3 4Q1RA 5CNAA 5E1RA 2VL4A 2WAAA 5FREA 2XBO1 4UXAA 4EWEA 4LE4A 5KXBA 2FZ2A 2VCAA 2VOTA 1PGSA 2VW0A 3LIHA 4MADA 1SACA 4NRQA 2AEYA 1AXYA 2LTNA 1OKOA 3E6DA 4R9AA 2XXZA 1NZCA 2YUEA 4TLFA 3PUHA 1ENSA 3MZHA 3P1IA 1V6IA 2Y38A 3POFA 4MV2A 3T4VA 5ABJB 2ZJCA 4PIXA 3DKQA 3BTYA 2AREA 4N43A 3KMHA 4BQYA 3N9NA 5F5IA 1E5HA 2H6CA 2VZRA 2W39A 2PTMA 4XTMA 1PMJX 3D5OA 3LSEA 4Y20B 3RGBA 1W04A 4BXSV 2WO7A 5LASA 3AL6A 1W8ZA 3CF6E 4PT6A 4YZ1A 1UKGA 3WP5A 1UNBA 4QPGB 4BCUA 1QIQA 1YRZA 2WSUA 4YZ3A 4CXWA 1NCQB 2QKDA 3WOGA 3ZFFA 5CG8A 3BODA 1EPWA 4N53A 3B93A 1TNFA 4CCLA 4MGKE 3U10A 2PHWA 1PHMA 1E5IA 1RTVA 2DTWA 2QUOA 1VPHA 4IV1B 5DUUA 1O3SA 1W8OA 2VCCA 3O1VA 4DQAA 2ETEA 3S7EA 1RUE3 2PQQA 2VZVA 2I2SA 1O3TA 3O1RA 1DF0A 3O12A 1RMU3 2JICA 1RUI3 4P14A 2BNMA 2PXJA 2QQOA 3VZJA 4LO5B 5JMOA 3VD4A 1YQ2A 3KVBA 3POEA 4C1WA 3ACLA 3M3EA 1H8VA 3T1MA 1EV11 5BNNB 2A6VA 3N7KA 3PMEA 2JDMA 2OS2A 2A6YA 1F5FA 4IV3B 5FV3A 5F1RA 1FOD3 1A8DA 2ET1A 3D3AA 3PMSA 4NE9A 5CG9A 1CAUB 4RHV3 3RZZA 2XBO3 1W90A 3WD5A 1MQTB 2JB8A 1AR83 5FCCA 2J1RA 3PJYA 3O1OA 1N3QA 5DDJ2 3IBMA 1WCKA 4AVVA 5FZAA 3LA7A 5C3SA 2K0GA 1Y9MA 4I02A 4P00B 1RB8G 3GJBA 2J22A 3Q8CA 1KS5A 3ES1A 5JOWA 1S0BA 4JHZA 3C7FA 1W99A 2JDZA 3A23A 1MPXA 1I1EA 4AHZA 5A80A 2BJSA 1WW6A 5IVCA 5KXEA 2GNBA 4CP1A 3J8F3 1ZZ6A 3DPRC 3UETA 1J84A 1A6CA 1JH5A 2JWPA 1KJLA 2DVGA 1PGL2 5T50A 1H6YA 1ENXA 1KITA 4N7UA 2EAKA 4A6OA 4AR2A 1RHI2 4E4SA 1QXPA 5IVJA 2P3JA 2VUAA 1C1LA 3VBSC 2XWBB 3ABZA 1BCXA 2WZR1 3TEXA 2RVAA 3VDDC 3O0VA 1V9U3 1QF3A 3NNFA 4KG0A 2XMLA 4W4ZA 1GOFA 5FMCA 1C28A 1EUUA 1WKYA 2R32A 3C7HA 4IETA 3MF9A 3AZVA 1J3RA 2BW8A 3SCGA 3PTYA 4MGQA 1O7FA 2NZ9A 4NHYA 2HJIA 1QXJA 3T0AA 4PQ9A 1RVF1 1YIFA 4ZXKA 3QACA 1ZBE1 3LEKA 5FJKA 2W08A 1UY1A 3IMNA 5FZ4A 1RUOA 1GNYA 2BZDA 4EROA 1IG0A 2EALA 2L9LA 4FFIA 4HKLA 4QHBA 3W58A 3VZLA 4JGZC 4ZU7A 5FLJA 1K5MA 2ARBA 2ZAAA 1XU1A 2WAOA 3MI8A 1JUIA 1Q8OA 2RM23 3LE0A 5B2GB 2VOWA 3THPA 3ZXJA 1SMVA 1UY0A 4LNVA 4ES8A 5FZKA 2UWAA 4XUOA 5F5CA 4AFAA 2VTXJ 4FFHA 4YYOA 4DXSA 3A4UA 1JTZX 3NAPC 1ASJ1 2D6PA 3M7AA 4GB32 4P9YA 2F4PA 5CA6A 4KGGA 5ANNA 1VRH3 2W9XA 3OGVA 4XFFA 5A7WA 2W1WA 2WLPA 1LAJA 1LNSA 2ZGMA 1DQ6A 4NO4A 3ZYIB 2Y6FA 3LSDA 3VDDA 1E5RA 5IAXA 1ZRRA 4DFSA 2GH8A 1B35C 2A7AA 3RQ0A 1H0BA 3ZXLA 4A7KA 1RHI1 2HWD1 4XVHA 2WUHA 3ILRA 4AFBA 5CADA 3ZXAC 4FPLA 4B4PA 4XFCA 1CAXB 3VKFC 1LU2A 1VBC1 1F4AA 5FK8A 2RS32 1OLMA 4OULA 3ITQA 4TTGA 3HWJA 1TNRA 1CVNA 4MGTA 5EHDA 3OTFA 2OUJA 3L2YA 1COV2 2WNVB 4A41A 1OA2A 1KDKA 4LKDA 1UY4A 3WDWA 3VBUA 4OMDA 2A3WA 3MICA 3FE5A 4JTNA 3ZYRA 3ACFA 4DRRA 3BTAA 1VAVA 4NPRA 1GU3A 1Z78A 1I6XA 1VALA 1H4HA 4Z8BA 3D0SA 3HMYA 1FI2A 1PIV1 1R1A1 3WCSA 5CFCA 3POYA 4Q4X1 1TVGA 1UY2A 2R16A 3T2PA 4YARA 3NQHA 4FQ4A 1HN1A 2TEPA 4QX5A 1RUF1 5FO7B 2XBO2 3WP3A 2VZ1A 5LWBA 2PHTA 1Q43A 1H6XA 4XURA 1DDLA 1VBB2 3P3NA 3UJOA 3OYWA 2N7GA 2ZGKA 3N9LA 4YVSB 4GKXA 2Y6GA 4XILA 1ALYA 2ILMA 2AC1A 5J98B 3LA3A 1GICA 1EP0A 3ZYPA 2E31A 1H4GA 3AB0A 4RR3B 5DAQA 1O59A 1DQ2A 4JKLA 3VBRB 4NHKA 1PGL1 2J7MA 1AJOA 1GOHA 1SPPB 1Y3TA 2BOIA 2JDUA 3CL1A 3JD72 1AXZA 4CP2A 2HWE2 4Q0QA 2XJVA 5A33B 1QOSA 4K8RB 4X6QB 3U0ZA 4NIHA 1BBT1 4CDUA 3HAGA 3MW3A 1UZYA 4OFGA 4RHV2 2Q8CA 1D2SA 1FOD2 2NMOA 4FXKB 2GC1A 3MBWA 3AKPA 4XUNA 1GP6A 1UXZA 5FO8B 2XPJA 2IVJA 3WUDA 4P9IA 5EYXA 3N7JA 5FUPA 5CFCB 1IGOA 2OW4A 4Q4X3 3CZUA 4GD4A 1L7RA 5FXXA 3VLBB 1OSGA 2JE7A 3MW2A 1JZ8A 3RPQA 2HEVF 2DV9A 2UWCA 2XHKA 1PO12 1O4YA 4ASMB 4YGEA 4GALA 2XKOA 4ZPIA 5GLTA 4XABA 3PU8A 5EFUA 4ARXA 5JR2A 2ZZJA 4MUVA 3J4UH 2PHRA 4AG4A 3HN3A 1NAEA 4CSWA 1C3HA 5EYYA 2BU9A 4Y1XA 5A3PA 1N3PA 4A6SA 2FMYA 3H8OA 2Y26A 4XACA 3ZN4A 1S4CA 2GDFA 2X53S 1QQP1 1OHFA 2MEV2 5IUQA 1ENRA 4GWNA 4MGZE 4PLMA 2Q8DA 3RNSA 1RUE1 2XG3A 2E9QA 2VNVA 3K4DA 4EN6B 2R0HA 2IUWA 4WM7A 1LODA 2VVEA 4FFFA 4JGZB 1ONAA 4BM8A 5LZ6A 4A3XA 5AFBA 1Q5OA 3GJAA 3I59A 3M3IA 5J48A 1K42A 1X9TA 1RJ8A 3GZAA 1BVP1 3J7HA 5JSRA 4J1XA 5JDBA 1ZZ7A 1OUSA 4XQ4A 5C9AC 1PO22 5FPLA 4CCMA 3A0NA 1YJKA 4KWJA 3HNYM 1EV13 1AL23 1OQDA 2QVSB 2VECA 4DXZA 4RQPA 5LA1A 1VBE1 4OZOA 4XBQA 2PFWA 3PVNA 1OFSA 1UZVA 2VUCA 4LBQB 4LKFA 4MXWA 2VY0A 4NAOA 3CNAA 4GXLA 3J7MA 1LCLA 4YVWC 4L2NA 3CKHA 2ZX1A 2Q30A 3GF6A 3J8F1 4X6RB 3INAA 2WN2A 4UOJA 2FQPA 2W1QA 5H9RA 1ZREA 2AZ5A 4P5YA 2GAUA 4Y26A 4CEYC 5F3IA 3OBZA 2WNOA 2WQ8A 1UAIA 5BNPC 2EIEA 2CGPA 5C7GA 2GNTA 1XE7A 3WX5A 4LOSA 3RVHA 1PM7A 2BNNA 1GSLA 5CFDC 4H7LA 2RHPA 1XE0A 3WF0A 2V4VA 1CAWB 3FHIB 2HLEA 2PLV2 3AP9A 5BNOC 1W0NA 3LPGA 1V6KA 2IWGB 4XZUG 4CU8A 4RS5A 3N4MA 1ZRDA 1NCRB 1X33A 3RDIA 1ULOA 1HX6A 4LO7A 3U11A 5DXDA 1D4M2 2WZR3 5DZEA 5FBJA 1AL21 4KL1A 5FO9B 2R072 3RJ2X 4EWAA 4LUMA 1NXMA 1RUF2 1BZWA 1BMV2 4JV4A 3S0MA 2V73A 3KGZA 4RFT0 1DYKA 4UFMA 5FYCA 1RUG2 3VBFA 3ZSKA 4RGGA 1QMJA 4LXLA 5FPVA 1PVXA 2ZBJA 3POSA 4CXXA 1SFYA 3LAGA 4CPBD 3T0DA 1COV3 4AE2A 5FRAA 2AR6A 4LHSA 2BYVE 2WNUA 3AJYA 1NOVA 1QGLA 4C1XA 3AMNA 1FYUA 2WT2A 3KGLA 3PL0A 4RL7A 4UW5A 5ERLA 3ZYJB 1TMF1 2P3YA 3UESA 1FATA 3LQCA 4X8NA 2MPFA 1R081 4LBMA 4UFKA 2A70A 5A3LA 2RS31 1MS0A 3KHCA 3KLSA 1DGWX 1TMF2 5EJ3A 2ORZA 3LEIA 3WQ1A 2YDEA 3FX3A 2WN3A 4F83A 4Y5TA 3VKOA 3RZLA 3B9IA 1VRBA 3BN6A 4M3CE 3KS7A 3K77A 4AGRA 2YV8A 3B3QE 3M2MA 4AAXA 4IEPA 4CE8A 4ZZ5A 1DIWA 1LENA 1ZBE2 4PIYA 5ABJC 1VRH2 2PAKA 2R041 3H8UA 4CDWC 2HWC1 1R093 3GNEA 1UMHA 3CJXA 3MHZA 2CYFA 2YC4A 4EN7B 1H9WA 4G4FA 3V0BB 1WLTA 3AX4A 1AYM2 4HL0A 2GN7A 1HXS1 2XLFA 5FYHA 2CNAA 3MYXA 5FPZA 1PNGA 2LROA 2WQ4A 2WA4A 5G04L 4PJYA 1W6PA 1Q3EA 1YJLA 5FZ1A 4AF9A 5EQUA 1ZBA1 1FPN3 2ARXA 1H1IA 3H1MA 5FBZA 1NA1C 2WWSA 4FO9A 3LEMA 3SITA 4XUTA 4CUGA 2I07B 1ZBA2 5T54A 4M0NA 1EYBA 4I2OA 3P5BA 5GJ6A 3MLKA 1BQPA 4I0BA 4Z92B 4SLIA 2Q0AA 5FZ3A 5CIRA 3U78A 1SBDA 2VNGA 3ORJA 4KU7A 1FMD2 1BKZA 1J59A 2Y0IA 1VBA3 1GUIA 2Z2SB 3JB8A 4BU2A 4XF0A 3MDPA 5KBFA 1Z7S3 2BP6A 1ULCA 3FUOA 5JPNB 4TLGA 3I2FA 1D4VB 2XUMA 3T08A 3ZFGC 4CTEA 1UN1A 4GMP1 1NLQA 2Q8OA 4Z07A 4QX8A 3VHOA 2QQJA 4L8QA 3TRSB 4XXAA 1EV12 2RS11 3ZKYA 2IXCA 3TEYA 5FZ8A 1VMHA 2H0BA 3N9MA 1MZFA 3M70A 4CDXA 1GR3A 3I2IA 4CP9A 2JD9A 3MW4A 3AJZA 2PHLA 1UZWA 1AHSA 1QJEA 1VBB3 5KHIA 1POV0 4DS0A 2BBVA 1FAYA 5CU1A 1MVEA 4EE2A 2C9KA 1H2NA 3ILNA 2WJSA 4HLTA 1G86A 2EICA 3JXSA 1YFUA 2D6KA 1VJ2A 4QHOA 4UAPA 3ZIWA 3BIWE 2PN5A 4XHXA 4QXCA 5FUNA 5ACA1 4M3CB 3PURA 5IVEA 1W8NA 2MEV1 1QQP2 5J7MA 4K40A 4ORFA 5DZGA 1BBT3 2ZTNA 4CCDA 2Z4FA 4XFHA 5HI0A 5BNOB 4SBVA 3T0BA 3VDDB 1BMV1 3ZSJA 4XDOA 2HBTA 2XUEA 4A42A 4QM8A 3SCHA 3ASIA 4IEUA 1LGCA 1W8WA 4IEQA 4NUBA 4DXRA 3OBRA 4RR3A 3SEPA 2CV6A 3LDKA 1SG3A 5I8YA 3NV3A 3WT3A 1DHKB 5FQ0A 2BTVC 1GKBA 5SV5A 1CZSA 2QE3A 3GALA 3OB8A 4NRPA 4CDXC 1FMD3 3WQBA 2HWE3 1OLME 1R092 3KT1A 1QJFA 3VDCA 5JSPA 2BGCA 4HK9A 3ZVXA 3EO6A 4HVOA 1LECA 4QXBA 2VW1A 5JIAA 2VMGA 1HN0A 3KWVA 1JS9A 1QNWA 2XH6A 4P5HA 4RFRB 1WUVA 1HB2A 3KF5A 4V1PA 1OF3A 1KFXL 3N9PA 1LR5A 3TN93 4K21A 5A70A 1CWPA 2WSVA 4N9IA 1UKRA 4O65A 5FYBA 1HQNA 2LUWA 2B9UA 2VMDA 1B35A 3CZJA 2ZEYA 3HOBA 3L9JT 1FXZA 3O14A 4QDSA 4QPIC 5BNNC 1AYN3 4HK8A 4MG2A 2DVAA 2O8QA 4AGGA 4GWIA 4HKOA 4E2QA 1HV1A 1UQXA 3DECA 1U5YA 4LJHA 5LATA 5CFDA 1VAMA 1ZBE3 2R0FA 4GWJA 3MIHA 3BIEA 5IAVA 3H7YA 1UYZA 2W87A 4NIGA 4RS5B 1GNZA 4XYXA 1CX1A 2Y6HA 3OOXA 5HXMA 1XNBA 5A32B 1DQ4A 1DGLA 5TSWA 2W1SA 3R4UA 4YGBA 5A6ZA 1SLIA 4E2SA 2G4IA 3MEPA 2HWB3 3D6EA 3LOIA 3LZZA 3MIDA 3MIFA 5IW0A 3WUCA 1PM4A 4CA9A 1H9PA 2ARAA 2A6WA 4GMP0 4JDMA 3ZLIA 2ZGQA 4QXHA 4H7MA 5J37A 3NKGA 3OPTA 3POJA 4XOGA 2W1UA 1JZ6A 1OLQA 2R062 3KM5A 4CEWA 3H1WA 3OPWA 2FHRA 4XEZA 4ET7A 1HRV2 1LHUA 5IFPA 1IHMA 1UOGA 5D8AB 5T52A 1FT9A 4RQPB 1AR71 2WBKA 2B45X 1W9WA 1LOEA 2RR11 2JG8C
chains in the Genus database with same CATH topology
4JX0A 3C7OA 4BK5A 3UETA 1J84A 3I2GA 2ZEWA 2E32A 3WF1A 4LKSA 4IUGA 5DMYA 1H6YA 1XNAA 2W3JA 4A6OA 3MV01 4DUWA 4QX1A 3ABZA 2RVAA 5DQ0A 3HNBM 1JYNA 2V5DA 1KEXA 1UMIA 3IB3A 3VD3A 4W4ZA 3WNOA 1GMMA 1GOFA 2YG0A 3MV11 1EUUA 1WKYA 1F4HA 3C7HA 1US3A 3MUZ1 2W91A 4DEQA 4E8CA 4MGQA 3IDAA 5IYYA 3T0AA 3ZM8A 4PQQA 1DP0A 2VM9A 3SKVA 3GDBA 3I3DA 3LEKA 2XQXA 3WNMA 3K4ZA 1UY1A 1GNYA 2BZDA 2QBXA 2L9LA 1CIYA 5J1XA 5LCWL 4LPLA 5LA0A 3EYPA 5JUVA 2WAOA 3I97A 3LE0A 1UY0A 1NKGA 4XUOA 5JXHA 2ZEXA 4DXSA 1US2A 2DCKA 3T09A 2VZSA 1UXXX 2W9XA 3OGVA 5I0DA 3IAQA 3HJRA 1EUTA 2W1WA 3ACGA 1LNSA 4ARYA 1W9TA 3FL7A 3CDZB 3A22A 4XVHA 2WUHA 1W9SA 3HEIA 2C26A 2VJXA 3T2QA 2XONA 1F4AA 4TTGA 2YFZA 3WF3A 2QQMA 4XUQA 3THCA 4A41A 1JU3A 4JKMA 1GQPA 3T2OA 5JXIA 1UY4A 4OMDA 3ACFA 2BGPA 1GU3A 2VQUA 3NJXA 2CDPA 3OGSA 4GZ9A 2LS6A 4FI9A 1TVGA 3UNPA 3VDBA 1UY2A 3T2PA 3NQHA 2LW8A 5A1AA 1HN1A 2VZ1A 1KGYA 3AC0A 3CMGA 4DEVA 2YB7A 1L7QA 2W94A 1O8PA 1JU4A 1H6XA 4XURA 2VMCA 3OEBA 2VZ3A 2Y6GA 2WDBA 1O8SA 2E31A 2W5FA 4JKKA 5B4NA 4BJ0A 1RYYA 2QQKA 1O59A 1UWWA 4JKLA 1WCQA 2J7MA 1GOHA 2VZOA 5HPOA 3ACIA 3C8XA 2CDOA 2J1AA 4OYUA 3A7QA 3MBWA 1UYXA 2J1VA 1XC6A 1UXZA 4XUNA 4ZZ8A 2Y6KA 3A21A 3U37A 3CZUA 2VO5A 1L7RA 1XNTA 1JZ8A 4BDVB 2VC9A 3WEZA 3HPNA 4A3ZA 4Z2AA 3WNPA 2VMEA 4ARXA 5JR2A 4QDRA 5G05L 2JE8A 4AG4A 2J1UA 2E33A 3HN3A 1NAEA 5CZKA 4MOAA 4M4RA 2VZPA 4DXTA 4ZY9A 3OBAA 3SKJE 3K4DA 4CU7A 2R7EB 3FN9A 1J83A 3K4AA 2VCBA 1DLCA 1K42A 4BK4A 3J7HA 1JYVA 2X09A 2JKXA 3W5NA 3I3BA 3ECQA 3HNYM 5LA1A 4OZOA 1NUKA 1PX3A 3DYOA 2W92A 3LEGA 4QB6A 2WO3A 4OUEA 2WO2A 3PUIA 3CKHA 1DYOA 2E26A 4UOJA 2WN2A 2W1QA 4P5YA 1CZTA 1OH4A 2WQ8A 2EIEA 5C7GA 2PQSA 5DPNA 2Y64A 4QAWA 1NX9A 3WF0A 2RJ2A 2V4VA 2HLEA 1W0NA 4D8MA 4CU9A 3LPGA 1XPWA 4XZUG 4CU8A 4A44A 3LPFA 4KWUA 1T2XA 3VD5A 1ULOA 1OF4A 2J1EA 1JYXA 2ZXQA 4D0QA 1UX7A 5IHRA 3VDAA 4DUXA 3SEEA 2VZUA 4PF1A 3OGRA 3OG2A 2OKXA 3T0DA 2W95A 2Y8KA 4LHSA 3I2HA 2VR4A 4QX0A 1JHJA 3CQOA 3MUY1 4CUAA 3UESA 3CIHA 3LQCA 4QB1A 1SHWB 2B9VA 1TG7A 2QQNA 1R64A 3ACHA 3GGLA 2W46A 2ORZA 3LEIA 2WN3A 3BN6A 3K77A 2DCJA 4AAXA 4ZZ5A 4L0PA 2ID4A 5JXJA 2DDUA 3BGAA 3WNKA 4MGSA 1UMHA 4W50A 2YC4A 1OD3A 1PX4A 1OT5A 2V72A 4QX3A 2J1TA 2X10A 5F7UA 2ZEZA 5G04L 2VZQA 4CUCA 5FUIA 2EIDA 4CUBA 2EIBA 2WABA 2YFUA 4XUTA 4W8JA 3NRUA 4RYDA 2VQTA 5B4XA 3IIIA 1GOGA 1JZ7A 3E1F1 5IJRA 4QPWA 1GUIA 3I2KA 3I2FA 3T08A 1D7PM 4LQRA 4DUVA 1K3IA 2VMFA 2Y6LA 5LA2A 2WYSA 2QQJA 4KMQA 3WF2A 2W47A 1JZ4A 3VD7A 3FHAA 3NJVA 3K75B 2YC2A 4A4AA 1JZ3A 3ETPA 3I2IA 2JD9A 3P6BA 4QDQA 2X05A 3GXUA 1IQDC 2JDAA 1SDDB 1UYYA 4P08A 4HG6B 2C9KA 4P02B 2QQIA 2QQLA 2EICA 2ORXA 3JXSA 4ZXEA 2RV9A 1JYWA 3IAPA 4UAPA 3W5MA 5JXGA 4A45A 3WNLA 1CZVA 3EB7A 4MO3M 1UZ0A 1W8NA 1JI6A 3VD9A 3K46A 4XUPA 5EJZB 3THDA 2Z4FA 2XOMA 3T0BA 1BHGA 4OMCA 4A42A 1JZ5A 3DYMA 4DXRA 3SEPA 4YPJA 1SG3A 1P8JA 2KD7A 3MO4A 2WO1A 2BGOA 1K45A 2VL4A 1CZSA 2WAAA 3OB8A 5IFTA 3WQBA 5EIYB 1JZ2A 2VCAA 2VOTA 3WF4A 2HYXA 4MADA 3VDCA 3PUHA 3P1IA 2C4XA 1OF3A 2XHNA 4QX2A 4QB2A 2VZRA 3NNGA 1PMJX 2WZEA 3DYPA 4BXSV 2WZ8A 3HOBA 2VMDA 3CZJA 3C7EA 2J1SA 2ZEYA 4PT6A 4QDSA 3I3EA 4M4PA 4GWIA 3DECA 3F2ZA 4GWJA 4CU6A 5CYYA 1I5PA 1W8OA 3FHQA 2VCCA 1UYZA 2W87A 3WSOA 1PMHX 1CX1A 2Y6HA 4CVUA 5HXMA 2VZVA 2B4KA 1K12A 5EJ1B 3OEAA 4UI9L 5C71A 2W1SA 2QQOA 2BBAA 5JMOA 3VD4A 1YQ2A 1ULPA 2Y6JA 3WNNA 4E8DA 3HNMA 2W1UA 1JZ6A 1UY3A 3D3AA 3C7GA 2BERA 4KI5M 4ET7A 4RN5A 2J1RA 2VTFA 5IFPA 2VZTA 3I2JA 4P00B 5DN2A 2J22A 2WBKA 4TXWA 4JHZA 1W9WA 3C7FA 1W99A 5C70A 3A23A 1MPXA 3GM8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JX0 A;  3C7O A;  4BK5 A;  3UET A;  1J84 A;  3I2G A;  2ZEW A;  2E32 A;  3WF1 A;  4LKS A;  4IUG A;  5DMY A;  1H6Y A;  1XNA A;  2W3J A;  4A6O A;  3MV0 1;  4DUW A;  4QX1 A;  3ABZ A;  2RVA A;  5DQ0 A;  3HNB M;  1JYN A;  2V5D A;  1KEX A;  1UMI A;  3IB3 A;  3VD3 A;  4W4Z A;  3WNO A;  1GMM A;  1GOF A;  2YG0 A;  3MV1 1;  1EUU A;  1WKY A;  1F4H A;  3C7H A;  1US3 A;  3MUZ 1;  2W91 A;  4DEQ A;  4E8C A;  4MGQ A;  3IDA A;  5IYY A;  3T0A A;  3ZM8 A;  4PQQ A;  1DP0 A;  2VM9 A;  3SKV A;  3GDB A;  3I3D A;  3LEK A;  2XQX A;  3WNM A;  3K4Z A;  1UY1 A;  1GNY A;  2BZD A;  2QBX A;  2L9L A;  1CIY A;  5J1X A;  5LCW L;  4LPL A;  5LA0 A;  3EYP A;  5JUV A;  2WAO A;  3I97 A;  3LE0 A;  1UY0 A;  1NKG A;  4XUO A;  5JXH A;  2ZEX A;  4DXS A;  1US2 A;  2DCK A;  3T09 A;  2VZS A;  1UXX X;  2W9X A;  3OGV A;  5I0D A;  3IAQ A;  3HJR A;  1EUT A;  2W1W A;  3ACG A;  1LNS A;  4ARY A;  1W9T A;  3FL7 A;  3CDZ B;  3A22 A;  4XVH A;  2WUH A;  1W9S A;  3HEI A;  2C26 A;  2VJX A;  3T2Q A;  2XON A;  1F4A A;  4TTG A;  2YFZ A;  3WF3 A;  2QQM A;  4XUQ A;  3THC A;  4A41 A;  1JU3 A;  4JKM A;  1GQP A;  3T2O A;  5JXI A;  1UY4 A;  4OMD A;  3ACF A;  2BGP A;  1GU3 A;  2VQU A;  3NJX A;  2CDP A;  3OGS A;  4GZ9 A;  2LS6 A;  4FI9 A;  1TVG A;  3UNP A;  3VDB A;  1UY2 A;  3T2P A;  3NQH A;  2LW8 A;  5A1A A;  1HN1 A;  2VZ1 A;  1KGY A;  3AC0 A;  3CMG A;  4DEV A;  2YB7 A;  1L7Q A;  2W94 A;  1O8P A;  1JU4 A;  1H6X A;  4XUR A;  2VMC A;  3OEB A;  2VZ3 A;  2Y6G A;  2WDB A;  1O8S A;  2E31 A;  2W5F A;  4JKK A;  5B4N A;  4BJ0 A;  1RYY A;  2QQK A;  1O59 A;  1UWW A;  4JKL A;  1WCQ A;  2J7M A;  1GOH A;  2VZO A;  5HPO A;  3ACI A;  3C8X A;  2CDO A;  2J1A A;  4OYU A;  3A7Q A;  3MBW A;  1UYX A;  2J1V A;  1XC6 A;  1UXZ A;  4XUN A;  4ZZ8 A;  2Y6K A;  3A21 A;  3U37 A;  3CZU A;  2VO5 A;  1L7R A;  1XNT A;  1JZ8 A;  4BDV B;  2VC9 A;  3WEZ A;  3HPN A;  4A3Z A;  4Z2A A;  3WNP A;  2VME A;  4ARX A;  5JR2 A;  4QDR A;  5G05 L;  2JE8 A;  4AG4 A;  2J1U A;  2E33 A;  3HN3 A;  1NAE A;  5CZK A;  4MOA A;  4M4R A;  2VZP A;  4DXT A;  4ZY9 A;  3OBA A;  3SKJ E;  3K4D A;  4CU7 A;  2R7E B;  3FN9 A;  1J83 A;  3K4A A;  2VCB A;  1DLC A;  1K42 A;  4BK4 A;  3J7H A;  1JYV A;  2X09 A;  2JKX A;  3W5N A;  3I3B A;  3ECQ A;  3HNY M;  5LA1 A;  4OZO A;  1NUK A;  1PX3 A;  3DYO A;  2W92 A;  3LEG A;  4QB6 A;  2WO3 A;  4OUE A;  2WO2 A;  3PUI A;  3CKH A;  1DYO A;  2E26 A;  4UOJ A;  2WN2 A;  2W1Q A;  4P5Y A;  1CZT A;  1OH4 A;  2WQ8 A;  2EIE A;  5C7G A;  2PQS A;  5DPN A;  2Y64 A;  4QAW A;  1NX9 A;  3WF0 A;  2RJ2 A;  2V4V A;  2HLE A;  1W0N A;  4D8M A;  4CU9 A;  3LPG A;  1XPW A;  4XZU G;  4CU8 A;  4A44 A;  3LPF A;  4KWU A;  1T2X A;  3VD5 A;  1ULO A;  1OF4 A;  2J1E A;  1JYX A;  2ZXQ A;  4D0Q A;  1UX7 A;  5IHR A;  3VDA A;  4DUX A;  3SEE A;  2VZU A;  4PF1 A;  3OGR A;  3OG2 A;  2OKX A;  3T0D A;  2W95 A;  2Y8K A;  4LHS A;  3I2H A;  2VR4 A;  4QX0 A;  1JHJ A;  3CQO A;  3MUY 1;  4CUA A;  3UES A;  3CIH A;  3LQC A;  4QB1 A;  1SHW B;  2B9V A;  1TG7 A;  2QQN A;  1R64 A;  3ACH A;  3GGL A;  2W46 A;  2ORZ A;  3LEI A;  2WN3 A;  3BN6 A;  3K77 A;  2DCJ A;  4AAX A;  4ZZ5 A;  4L0P A;  2ID4 A;  5JXJ A;  2DDU A;  3BGA A;  3WNK A;  4MGS A;  1UMH A;  4W50 A;  2YC4 A;  1OD3 A;  1PX4 A;  1OT5 A;  2V72 A;  4QX3 A;  2J1T A;  2X10 A;  5F7U A;  2ZEZ A;  5G04 L;  2VZQ A;  4CUC A;  5FUI A;  2EID A;  4CUB A;  2EIB A;  2WAB A;  2YFU A;  4XUT A;  4W8J A;  3NRU A;  4RYD A;  2VQT A;  5B4X A;  3III A;  1GOG A;  1JZ7 A;  3E1F 1;  5IJR A;  4QPW A;  1GUI A;  3I2K A;  3I2F A;  3T08 A;  1D7P M;  4LQR A;  4DUV A;  1K3I A;  2VMF A;  2Y6L A;  5LA2 A;  2WYS A;  2QQJ A;  4KMQ A;  3WF2 A;  2W47 A;  1JZ4 A;  3VD7 A;  3FHA A;  3NJV A;  3K75 B;  2YC2 A;  4A4A A;  1JZ3 A;  3ETP A;  3I2I A;  2JD9 A;  3P6B A;  4QDQ A;  2X05 A;  3GXU A;  1IQD C;  2JDA A;  1SDD B;  1UYY A;  4P08 A;  4HG6 B;  2C9K A;  4P02 B;  2QQI A;  2QQL A;  2EIC A;  2ORX A;  3JXS A;  4ZXE A;  2RV9 A;  1JYW A;  3IAP A;  4UAP A;  3W5M A;  5JXG A;  4A45 A;  3WNL A;  1CZV A;  3EB7 A;  4MO3 M;  1UZ0 A;  1W8N A;  1JI6 A;  3VD9 A;  3K46 A;  4XUP A;  5EJZ B;  3THD A;  2Z4F A;  2XOM A;  3T0B A;  1BHG A;  4OMC A;  4A42 A;  1JZ5 A;  3DYM A;  4DXR A;  3SEP A;  4YPJ A;  1SG3 A;  1P8J A;  2KD7 A;  3MO4 A;  2WO1 A;  2BGO A;  1K45 A;  2VL4 A;  1CZS A;  2WAA A;  3OB8 A;  5IFT A;  3WQB A;  5EIY B;  1JZ2 A;  2VCA A;  2VOT A;  3WF4 A;  2HYX A;  4MAD A;  3VDC A;  3PUH A;  3P1I A;  2C4X A;  1OF3 A;  2XHN A;  4QX2 A;  4QB2 A;  2VZR A;  3NNG A;  1PMJ X;  2WZE A;  3DYP A;  4BXS V;  2WZ8 A;  3HOB A;  2VMD A;  3CZJ A;  3C7E A;  2J1S A;  2ZEY A;  4PT6 A;  4QDS A;  3I3E A;  4M4P A;  4GWI A;  3DEC A;  3F2Z A;  4GWJ A;  4CU6 A;  5CYY A;  1I5P A;  1W8O A;  3FHQ A;  2VCC A;  1UYZ A;  2W87 A;  3WSO A;  1PMH X;  1CX1 A;  2Y6H A;  4CVU A;  5HXM A;  2VZV A;  2B4K A;  1K12 A;  5EJ1 B;  3OEA A;  4UI9 L;  5C71 A;  2W1S A;  2QQO A;  2BBA A;  5JMO A;  3VD4 A;  1YQ2 A;  1ULP A;  2Y6J A;  3WNN A;  4E8D A;  3HNM A;  2W1U A;  1JZ6 A;  1UY3 A;  3D3A A;  3C7G A;  2BER A;  4KI5 M;  4ET7 A;  4RN5 A;  2J1R A;  2VTF A;  5IFP A;  2VZT A;  3I2J A;  4P00 B;  5DN2 A;  2J22 A;  2WBK A;  4TXW A;  4JHZ A;  1W9W A;  3C7F A;  1W99 A;  5C70 A;  3A23 A;  1MPX A;  3GM8 A; 
#chains in the Genus database with same CATH topology
 3SMH A;  5E8A A;  2KR2 A;  5HCB A;  3PIG A;  5BNP A;  5C4W B;  1PZ9 A;  1XNC A;  2VNO A;  4JX0 A;  4KG8 A;  4PDW B;  1GZW A;  3NV2 A;  3VBS A;  1LJ7 A;  1QDO A;  1S2E A;  3MPP G;  4LKS A;  3TNQ A;  1VMF A;  4DNY A;  1RUJ 3;  3MIE A;  4PDW C;  2D7F A;  3IZO A;  2NP0 A;  1BK1 A;  3UGH A;  4XJZ A;  5K9Y A;  1POV 3;  2HWB 2;  2DUO A;  4QX1 A;  3SCF A;  5KC5 A;  1A3K A;  2JE9 A;  5DQ0 A;  4DZG A;  2P3K A;  4COW A;  1UD1 A;  1G7Y A;  3ZPY A;  1OH3 A;  1S0G A;  3FBM A;  3RYR A;  2JG9 C;  4MX3 A;  1GWL A;  1NQJ A;  2YG0 A;  3ZOI A;  3DF0 A;  1YFY A;  1X36 A;  3G6J B;  4QPY A;  3BCW A;  3LFI A;  4P9X A;  4JHT A;  2ADD A;  1YC6 1;  3CJI C;  3BI3 A;  3N7L A;  5BV6 A;  2XQR A;  4JVA A;  4E8C A;  2W91 A;  4DEQ A;  1BEV 2;  5EZW A;  2C5D A;  1W0O A;  5ANQ A;  1REF A;  1YQC A;  5FOB B;  1CAV A;  3I3M A;  2WR9 A;  3SKV A;  3I3D A;  1K5J A;  4U36 A;  4HPK B;  4AW7 A;  1MS4 A;  1AL0 G;  3APB A;  2R30 A;  3K4Z A;  1GQG A;  1T6B X;  1UU5 A;  2AYH A;  4UYB A;  4QPG C;  3ZKU A;  1CIY A;  1V6M A;  5JOZ A;  4YW5 A;  4CP0 A;  3I4I A;  1RL3 A;  5FK7 A;  1DGW A;  3VBO A;  1C57 A;  5JUV A;  3I97 A;  3EMR A;  1V0A A;  1NKG A;  2XKP A;  3NNL A;  5C5U A;  1Y7B A;  5JXH A;  2UYB A;  3ZR5 A;  1CAU A;  2GU9 A;  1QH6 A;  4D7T A;  4B8E A;  4UW6 A;  3TAY A;  3BU7 A;  4HFS A;  1ZNP A;  4MXW B;  3F95 A;  4OI4 A;  3T09 A;  2B8M A;  1Y43 B;  1UXX X;  3HIF A;  3M4F A;  4Q4W 1;  4DB5 A;  1CGP A;  5DDJ 3;  1RUI 2;  3HJR A;  3J9S A;  4ARY A;  3VBO B;  5HV0 A;  1PZ8 A;  2ZX2 A;  1NLS A;  1XXN A;  1DQ0 A;  2OYZ A;  4EZ4 A;  3CDZ B;  5L7O C;  3NV4 A;  4FAG A;  3ZYG A;  1QJU 3;  4IV3 C;  4UWD A;  1W9S A;  1HXS 2;  3RYK A;  5F37 A;  1T6G C;  2YU1 A;  5AC9 1;  2VQA A;  4CEY A;  5IWF A;  4H3W A;  1YI7 A;  2WRA A;  4GH4 B;  1YFW A;  3KV4 A;  4XJA A;  1FPN 2;  4AYU A;  4WVZ A;  3WF3 A;  4KGQ A;  4QX7 A;  4XUQ A;  1JU3 A;  4JKM A;  5L9R A;  1JMU B;  1GQP A;  4CCJ A;  4L99 A;  4Q0P A;  4YRD A;  1GZT A;  1ZVF A;  2PAM A;  3RWN A;  4FTB A;  2QQW A;  4OZX A;  1RUD 2;  3WIN E;  4R8H A;  4DPN A;  5A1L A;  3B02 A;  4QU2 A;  3NJX A;  2JDP A;  1OPO A;  2IXL A;  3PNA A;  4JC1 A;  2CDP A;  2GZW A;  2R6Q A;  4CZS A;  2LS6 A;  1XBF A;  2QDN A;  4M00 A;  3UL2 A;  5K0U C;  3VBS B;  3B00 A;  3ENR A;  1D0H A;  4EWD A;  5A1A A;  4LLO A;  5FPU A;  3GZU C;  2QDR A;  2UU8 A;  3S5A A;  3NST A;  4YGD A;  5FMO S;  3HQR A;  4CDU B;  3AC0 A;  3CMG A;  1XNK A;  2GC0 A;  4RA0 A;  5FZ9 A;  3PDQ A;  4FAH A;  2W94 A;  5FZL A;  5BUV A;  2DVD A;  5C3O A;  2VMC A;  4WV8 A;  2BOJ A;  4OHZ A;  1WLD A;  1O8S A;  3NVC A;  3MLJ A;  1IS6 A;  4BJ0 A;  2QQK A;  3R6S A;  2RJL A;  1G9B A;  3NV1 A;  1W39 A;  1ND3 B;  4IE4 A;  2RDS A;  1OPM A;  3IDC B;  4AI1 A;  3K3N A;  3OCP A;  1QKQ A;  4O9G A;  2VZO A;  2X5I C;  2CTV A;  1LOG A;  2CDO A;  2J1A A;  4LO6 B;  2H0V A;  4ATF A;  2R06 3;  5C6C A;  4AGV A;  5E6H A;  3UGF A;  5FLH A;  4LUK A;  3D0J A;  2XL7 A;  3A7Q A;  2DU0 A;  1RED A;  4PI0 A;  4OHW A;  4BQ4 A;  1V9U 2;  3KF3 A;  4D3W A;  2VMH A;  3O7O A;  3U37 A;  4M3C A;  3RZK A;  4AEJ A;  3VGI A;  4KU8 A;  3TOJ A;  4ZU4 A;  1GAN A;  1KDM A;  4BA6 A;  2GMP A;  3E6C C;  1DCS A;  1H2M A;  2P1B A;  2WC2 A;  4YFZ A;  2RG4 A;  2VUL A;  5JIU A;  5JLV A;  4G3Y C;  4A3Z A;  1LGB A;  3WNP A;  5IAT A;  2VXR A;  3CJI B;  3KB5 A;  4LEJ A;  4IV1 A;  1VBC 2;  3ON7 A;  4IEY A;  1QJX 3;  4QDR A;  2JE8 A;  5GZF A;  1RUD 1;  2VMI A;  3J8F 2;  1QEX A;  2E33 A;  4O61 A;  2FCV A;  4K6B A;  4AVB A;  5LRS A;  1WMD A;  1HRV 3;  1W3V A;  1S0D A;  4P9W A;  4KH9 A;  2JX9 A;  3QCW A;  4DXT A;  1I5Z A;  1DZT A;  4ZY9 A;  2GP5 A;  1JYC A;  3BKZ A;  3SKJ E;  1QJZ A;  4NPL A;  4YLZ A;  2D3R A;  2DUQ A;  2RM2 2;  1ZRF A;  4J1W A;  5BNQ A;  4PDW A;  2W52 A;  3E5U A;  4JRA A;  2OQ7 A;  2AH2 A;  1BXH A;  1DLC A;  3OSD A;  2P37 A;  1Q56 A;  1JYV A;  2X09 A;  5JI7 A;  1SLT A;  3W5N A;  3JCI A;  5A7W B;  2VOK A;  4F8A A;  3AMQ A;  4B4Q A;  3EQE A;  4HKW A;  5JSO A;  4QKN A;  1NUK A;  4AQT A;  1LOC A;  4EV0 A;  4P9J A;  3LEG A;  4NMI A;  5A6Y A;  1A78 A;  4QB6 A;  2WO3 A;  4OUE A;  3PUI A;  5L9V A;  5KHK A;  1ZZC A;  2E6V A;  2VBB A;  5H9P A;  1OD5 A;  2E26 A;  1GLH A;  5JOY A;  1ZM1 A;  2B46 X;  2FCU A;  1IPS A;  4WM8 B;  3RS6 A;  1EPZ A;  2YZ4 A;  3BOW A;  3ES4 A;  2TBV A;  1OKQ A;  4HN0 A;  4O9E A;  3THT A;  5I91 A;  1KXG A;  1MEC 2;  1SLL A;  1YCI A;  2DTY A;  2DF7 A;  2RS5 3;  4DIN B;  5C8C B;  1CZT A;  4G9S B;  3K51 A;  3V56 A;  1RUH 2;  3RMX A;  2OXB A;  5DG2 A;  1OH4 A;  4AL9 A;  1ZZB A;  2YGM A;  5BYN A;  2E51 A;  2EXH A;  2FD8 A;  4I30 A;  2PQS A;  1VBE 3;  2TUN A;  2Y64 A;  4R4Z A;  4N53 C;  5DAW A;  1WW5 A;  4NPM A;  4QQP A;  1BLZ A;  1NX9 A;  4MYE A;  3VBU C;  1WA4 A;  4XCB A;  1YYN A;  3RZH A;  1WBF A;  1MS8 A;  1QJY 1;  4AI8 A;  1XE8 A;  1RUJ 1;  2P6H A;  2QZ3 A;  3QBQ A;  4XIO A;  1T2X A;  1W2T A;  2NLR A;  3WQ0 A;  3AKQ A;  1OF4 A;  4Q26 A;  4XZP A;  3IT8 A;  2J1E A;  1IQA A;  2DUP A;  4Z2W A;  5F32 A;  1FNZ A;  5CVR A;  5FPA A;  4FPH A;  4QD2 A;  3USS A;  1ASJ 2;  1LHV A;  1RMU 2;  5C8W A;  4FOY A;  4D0Q A;  3T2T A;  2ZHN A;  1X8M A;  2JG8 A;  2R07 1;  5EJ1 B;  1BEV 3;  3KV9 A;  3OPZ A;  5FP9 A;  5FY1 A;  5JZG A;  5K8S A;  5A3O A;  3PHM A;  1WW7 A;  1KD7 A;  1OI6 A;  1VBB 1;  2A1X A;  4PF1 A;  3OGR A;  1VBD 3;  2O1Q A;  4XIK A;  3WNX A;  4JGZ A;  5JPM B;  4YW7 A;  3O1M A;  1Z0H A;  2Y8K A;  5C5T A;  4OCT A;  2DCZ A;  2VOV A;  5L9B A;  2EIG A;  4CDQ C;  1ZZ9 A;  2D3S A;  1JHJ A;  1ULE A;  1W28 A;  2QZ2 A;  4JDN A;  1JHN A;  4CUA A;  2ZGS A;  4K3U A;  3E5Q A;  4Q4X 2;  1AVB A;  4WVW A;  1SHW B;  5JMC A;  1BBT 2;  2B9V A;  2GH2 A;  3H9A A;  1NYW A;  4Y1Z A;  5K7P A;  3B9C A;  3GGL A;  3WG4 A;  2P3I A;  4XTP A;  1O4Z A;  4M0H A;  5FYI A;  5L36 A;  1AUY A;  1SDW A;  2CHH A;  2QFE A;  1MQT A;  5DAP A;  3SIS A;  4QPI A;  2G19 A;  4CEW B;  4DRV A;  4XJW A;  2DCJ A;  3LGR A;  1NE4 A;  4COU A;  5KWR A;  5LW9 A;  1S55 A;  2ZML A;  3L2H A;  4EJR A;  1FOD 1;  5K0U A;  4D6R A;  3FMG A;  5JXJ A;  2RS5 2;  3IIA A;  2DDU A;  2QNK A;  1F8V A;  2WQZ C;  1AR8 1;  3RI8 A;  5DAX A;  2B39 A;  2GSY A;  2OZJ A;  3LIG A;  4KWK A;  4XF4 A;  4XBL A;  5J96 B;  3JD7 1;  1EAH 3;  4QT6 A;  4DOU A;  1KRI A;  5HCA A;  2X10 A;  3DGT A;  3RZG A;  1JOJ A;  2IXJ A;  5FUI A;  5GLU A;  3O1U A;  3FZ3 A;  4UBH A;  4YVW B;  1L3J A;  1WMX A;  4FPC A;  5GLZ A;  4CUB A;  4W8J A;  1PZ7 A;  2SBA A;  2VU9 A;  4Q4W 3;  3KCC A;  1R1A 3;  3DL3 A;  4K1Y A;  3KQ4 B;  4C0H A;  4RSU A;  1JBC A;  1WCD J;  3C3V A;  4ZS3 A;  5T5P A;  2UY8 A;  1OOP B;  4LLF A;  5IJR A;  3ATG A;  3H3Z A;  4QPW A;  5I0U A;  1DFQ A;  4B7K A;  5FPX A;  3I2K A;  1RUG 3;  3R0R A;  1BYH A;  4CPB A;  5T5L A;  2J42 A;  3R4D B;  5EWS A;  4FPK A;  1RIT A;  1D7P M;  2VUJ A;  4LQR A;  1CQ9 A;  2DCT A;  4FTE A;  2Y6L A;  3WR0 A;  1V6O A;  3N9O A;  5LY1 A;  2WYS A;  4BHP A;  1E5S A;  4RD7 A;  4D94 A;  2W47 A;  1QWR A;  4XCA A;  5BNP B;  2BDR A;  1LOF A;  4IGO A;  3I2D A;  2JIJ A;  1WGP A;  4IGQ A;  2QTW B;  3DPR B;  3IM0 A;  3Q8B A;  4IE0 A;  2AGS A;  2QQU A;  3OGG A;  1N47 A;  4BQ3 A;  2WFP A;  4QDQ A;  1DQ5 A;  1SCR A;  2VGD A;  3GXU A;  5D1I A;  2X05 A;  1UF2 C;  5FTT C;  5A6Q A;  4HET A;  4WVM A;  1PO1 1;  3AXE A;  3WP4 A;  1IOA A;  2XJP A;  3CJI A;  2X5I B;  1O91 A;  5K4L A;  4HG6 B;  3WW3 A;  4P02 B;  4LO8 A;  4IES A;  2DVB A;  2QQI A;  2WL1 A;  5L19 A;  1O5L A;  4L9B A;  1JYW A;  1ND2 B;  1TME 3;  4DY3 A;  4GIQ A;  1LEM A;  1XYP A;  5JXG A;  5FY4 A;  1NCR C;  3OD4 A;  1C5I A;  1CZV A;  3EB7 A;  2TNF A;  4MO3 M;  1UZ0 A;  1REE A;  1SBF A;  1XYN A;  1JI6 A;  1QJX 2;  3NNM A;  3BPS A;  4GWM A;  4WVV A;  3NWK A;  5E16 A;  5ACA 2;  3U14 A;  3WZ1 A;  3H8X A;  5BNO A;  2XJU A;  2FDI A;  2VG9 A;  1BHG A;  2ET7 A;  3AVS A;  1FV3 A;  4OMC A;  3ZSE A;  4K20 A;  4O7X A;  1JZ5 A;  2P17 A;  1VAK A;  1GNH A;  1W06 A;  5FWE A;  1D4M 1;  3MLL A;  5BXX A;  5FZG A;  1OA3 A;  5KHG A;  1HB4 A;  3WVJ A;  3ZPO A;  1PO2 3;  1ZRI A;  4PLO A;  3USU A;  1P8J A;  1IZ3 A;  1FV2 A;  4S2H A;  2WO1 A;  2BGO A;  3OF1 A;  3ELN A;  3BAL A;  1H8T A;  1J3P A;  1NXD 1;  1NCQ A;  1QJU 2;  2CWM A;  4FPE A;  5FZI A;  4U2A A;  3ZFF B;  2G9Z A;  2ZGO A;  1W6N B;  5EIY B;  3QOP A;  4NWW A;  3WF4 A;  2HYX A;  4P9L A;  4GB3 1;  4BME A;  4YWA A;  4E2G A;  5FYT A;  2P5B A;  2ZHL A;  1CES A;  5FYV A;  3NJZ A;  3I59 B;  2AAC A;  1AR6 2;  3I3Q A;  4AHW A;  5F5Q A;  3NNG A;  1UPS A;  2Z79 A;  2E53 A;  5A32 A;  3O1P A;  1GZC A;  5FYS A;  2VBD A;  4EN0 A;  3KT4 A;  4LOR A;  1UPI A;  4UFI A;  1H1A A;  5DUW A;  1QJX 1;  1J58 A;  3PUS A;  5IVB A;  3C7E A;  1V00 A;  2DYC A;  2J1S A;  4L97 A;  4URT A;  4ATE A;  4AQ6 A;  1H1M A;  1WCS A;  1XRU A;  1MS3 A;  2WA3 A;  4GAZ A;  4CDW A;  1LHO A;  4AI9 A;  3POG A;  1NA1 B;  2ZMN A;  5IK8 A;  2WWJ A;  1XOY A;  5JZG C;  1XB9 A;  5DAV A;  2PHU A;  5CYY A;  1A8M A;  1PK6 C;  1I5P A;  5E89 A;  3UV9 A;  2CL2 A;  4W6W A;  1RMU 1;  5L7O B;  4NAM A;  1PMH X;  3WSO A;  1XSR A;  1MEC 3;  5LY2 A;  4CVU A;  1HW5 A;  5A3T A;  4BQ2 A;  4AQ2 A;  5KR7 A;  1K12 A;  3PVE A;  2WFF 3;  4GUL A;  4ES9 A;  2LAL A;  5T55 A;  1W8F A;  5C71 A;  1RUE 2;  3H42 B;  3LDR A;  2D6O X;  2OX0 A;  2A73 B;  2BBA A;  4YW2 A;  3UK9 A;  3N9Q A;  1WWY A;  2Q1Z B;  1WD3 A;  3T30 A;  2Y6J A;  3K2O A;  1S1A A;  4HSJ A;  3EXU A;  3W21 A;  1JOP A;  4E8D A;  1SFN A;  4AXO A;  5LEJ A;  1W8T A;  2D5F A;  3ZO0 B;  4AFM A;  1BEV 1;  1HQW A;  4IER A;  4EZH A;  5A1F A;  2PYT A;  3HBZ A;  3IDB B;  2BER A;  4RS5 C;  1R08 3;  2VTF A;  2Z5W A;  3B5L B;  4YM0 A;  5FMO L;  2VZT A;  4BQW A;  2B7Y A;  3I2J A;  5DN2 A;  1K5M B;  1W6P B;  5I0R A;  1ZRC A;  1TQ5 A;  4YG3 A;  2AUY A;  3K48 A;  1N1S A;  1COV 1;  4AVS A;  3BPZ A;  4FBF A;  5FY0 A;  1EY2 A;  2WNU B;  1MZ5 A;  3LDB A;  3C7O A;  3QH6 A;  4BK5 A;  1YQ6 A;  4BXF A;  5FWJ A;  1LHN A;  3JBG 2;  3I2G A;  5HCF A;  2Y60 A;  4MH0 E;  4BQX A;  4S2D A;  4IUG A;  5DMY A;  5GZG A;  1XNA A;  3NJY A;  2GAL A;  4XBN A;  1RIR A;  2FDJ A;  1MS1 A;  2YC0 A;  2RS3 3;  2Q8E A;  3VZM A;  1JOD A;  4Q0U A;  5L7O A;  3AKS A;  3AMP A;  4DUW A;  3NNJ A;  5LBB A;  4Q27 A;  1RUJ 2;  3HNB M;  1JYN A;  4TZD A;  1QU0 A;  3AZX A;  1UMI A;  3IB3 A;  4Q4Y 2;  5DUV A;  3VD3 A;  1IPJ A;  3ZMN A;  2W0X A;  4RQP C;  1ZA4 A;  2R04 3;  4NOT A;  2PHD A;  3PLQ A;  5IK4 A;  4FQZ A;  3RFR A;  4CRQ A;  4OI1 A;  4LUL A;  3VN4 A;  1W6Q A;  3DXU A;  2VH9 A;  1YFX A;  5IYY A;  1CAW A;  1LU1 A;  1NG0 A;  4PQQ A;  3ZM8 A;  1DP0 A;  1C4R A;  2VM9 A;  4FPY A;  2FDK A;  3WNM A;  3U1X A;  1X82 A;  2UWB A;  4BIO A;  2QBX A;  1JOB A;  2D3P A;  3DV8 A;  4FOW A;  4LPL A;  4LT5 A;  2WZP P;  5LA0 A;  3EYP A;  5FYZ A;  1WA6 X;  3VZO A;  4BIS A;  5F6K A;  4BZ4 A;  4AI0 A;  4C8D A;  2RS1 3;  5FZ0 A;  1JYT A;  2D40 A;  2BFU L;  1SPP A;  2JG9 B;  2ZMK A;  4PBO A;  4XE9 A;  2NQY A;  4YGC A;  4KBZ A;  5BY5 A;  4HVQ A;  4QWN A;  2VZS A;  3WDU A;  1ULD A;  4FVV A;  3JUU A;  2GC2 A;  3IAQ A;  1KJR A;  1VIW B;  4AZZ A;  2VQ0 A;  3NW4 A;  1PNF A;  2WLQ A;  3J7N A;  4KQ7 A;  1W9T A;  2EXI A;  2ZKN A;  3SLI A;  1VRH 1;  2R04 2;  4R4X A;  3T4H B;  3OUH A;  1XJA A;  4IL7 A;  1WD4 A;  3H1Y A;  3BTX A;  5FZO A;  3A22 A;  1AX0 A;  2JJ6 A;  1DBN A;  2IXK A;  4AEK A;  2IXI A;  2YYO A;  2C26 A;  4MHR A;  4XF3 A;  2G1M A;  3ZYF A;  5K0U B;  1CD3 G;  5DAB A;  1AL2 2;  2D43 A;  5HCH A;  5GAL A;  3AFK A;  3ALQ A;  5JZG B;  1W6Q B;  1OLR A;  5FP4 A;  1RHI 3;  4NHX A;  4Q4V 3;  4IE7 A;  3E6B A;  2X8K A;  5D8A C;  4CDU C;  1URX A;  2WS9 2;  2GC3 A;  3E5X A;  4A7Z A;  4URA A;  3FJS A;  4LBQ A;  4QQ2 A;  5LK7 B;  2C0Z A;  5IVY A;  5IK7 A;  5F39 A;  5JVV A;  3OUJ A;  2JIG A;  1OVS A;  2FZ1 A;  1OBN A;  2MEV 3;  2LM3 A;  3MFA A;  5DDJ 1;  2BGP A;  4BPZ A;  1TME 2;  1U5Z A;  1Y4W A;  2DVF A;  1YQ8 A;  5H9Q A;  2KA3 A;  1MS5 A;  2WYF A;  2VPV A;  2Y34 A;  3AZW A;  4GZ9 A;  1ND2 C;  4KBB A;  1AR9 3;  4FI9 A;  3AK0 A;  1TEI A;  4XET A;  5FZO B;  1R08 2;  1WZX A;  3ZXK A;  4C90 A;  5ABJ A;  3UNP A;  2LW8 A;  2JEC A;  1PGW 2;  5D2A A;  3ZYH A;  2VXJ A;  1PO1 3;  1X7N A;  4H55 A;  4L92 A;  4LIU A;  1YHF A;  4Y5Z 0;  1KGY A;  2JG8 B;  4FSJ A;  3WG3 A;  3ZFF C;  2YB7 A;  3TN9 2;  5IVF A;  5J36 A;  1O8P A;  1TZO A;  3WG2 A;  5F5A A;  4RR3 C;  1LB2 A;  2IZW A;  1LTE A;  1SQ4 A;  4M3C F;  1IG3 A;  3S6P A;  2ZCW A;  1HRI 2;  2HWF 3;  2VZ3 A;  3NO8 A;  2HYK A;  1CON A;  3QLQ A;  2XJR A;  2HH9 A;  4BH9 A;  5I0T A;  4JKK A;  2D44 A;  4KNC A;  2YY1 A;  4XJU A;  2RMU 3;  2K2S A;  2YBK A;  3AL5 A;  4YM3 A;  2XGX A;  2GMM A;  4DY5 A;  3LWC A;  4Y5S A;  4OHY A;  5APA A;  4CDQ B;  3ZMO A;  1WCU A;  5LBE A;  3ACI A;  1W2U A;  3VKL A;  3C8X A;  3GCW A;  5HPO A;  2ZGR A;  4A2U A;  1QHD A;  2BFU S;  2D98 A;  4XJ9 A;  1OFN A;  4I01 A;  4ASL A;  2QJV A;  5CFC C;  4QU1 A;  4UT5 A;  1G9F A;  3KZ4 C;  3RSJ A;  2A71 A;  5JAX A;  3TWI A;  1B09 A;  2GP3 A;  2JD4 A;  1X50 A;  1UYX A;  2ZHM A;  1HRI 3;  5FPB A;  1WBL A;  1Z7S 1;  4ZON A;  3KCX A;  1S2B A;  3UKN A;  3I7D A;  1AR9 1;  1XNT A;  1PK6 B;  2VC9 A;  3WEZ A;  4TYS A;  3DCQ A;  4KWL A;  5IT6 A;  4QKD A;  3RRD A;  1RXG A;  3B94 A;  1MEC 1;  2VME A;  1LES A;  1UIK A;  1YWK A;  5FOJ B;  3OYW B;  5G05 L;  3ST7 A;  1QQP 3;  1W8U A;  1AXK A;  5FMB A;  1GWM A;  2J1U A;  4MHU A;  3BUC A;  2O8O A;  3ETQ A;  5CZK A;  1HJG A;  1W9F A;  2XB6 C;  3VZN A;  2NMN A;  1W6O A;  3H50 A;  2A3Y A;  3CBN A;  1AR8 2;  2VZP A;  3AZY A;  3SC7 X;  4D6S A;  4XW3 A;  4LK6 A;  2BUK A;  4Y20 A;  4YM2 A;  4CCC A;  2R06 1;  5IVV A;  3ZR6 A;  5FY7 A;  5GZD A;  5C9A B;  3VBO C;  1J83 A;  1IS4 A;  2DBI A;  1DG6 A;  1J1L A;  3KSC A;  5FYY A;  4YZ2 A;  2VCB A;  2WS9 3;  3M3C A;  2F4L A;  1HRV 1;  1ZA7 A;  2CAV A;  4UFL A;  2R49 A;  3BYW A;  2W68 A;  3V65 A;  1RVF 2;  1SEF A;  3AYD A;  1OOP C;  1WMF A;  3I3B A;  5EPA A;  5I0S A;  1JN2 P;  4CDQ A;  1HRI 1;  4Y1Y A;  2ZAB A;  1WLW A;  1CPN A;  1ND3 A;  1QOT A;  1LRH A;  1W6N A;  5DZF A;  2OUH A;  3DYO A;  4WZC A;  5SV8 A;  3VKN A;  3SH3 A;  4CCE A;  5FKB A;  1HQL A;  5FQ0 B;  2WO2 A;  4NR1 A;  5FMD A;  3SH5 A;  2VCM A;  4YW3 A;  3USU B;  2WII B;  1D2Q A;  3AP4 A;  2P4E A;  2SLI A;  3P3P A;  2RR1 3;  1R1Z A;  3N36 A;  5FYM A;  1IS3 A;  3UGG A;  2I45 A;  1RC6 A;  4OI2 A;  4Y1V A;  3FLP A;  2YGL A;  1XQN A;  3WDY A;  4ISQ A;  1UO9 A;  3LFM A;  1K5M C;  1ST8 A;  3WQ7 A;  4AOC A;  1C8M 2;  4QAW A;  5EXO A;  3AM2 A;  1HV0 A;  4NVP A;  2A75 A;  2RJ2 A;  4QKF A;  1CJP A;  4XMA A;  5F6L B;  5CBL A;  4IE5 A;  4JQT A;  1VR3 A;  4MXV A;  1H8T C;  4D6Q A;  2ZPX A;  4BQ5 A;  1ND3 C;  1C8N A;  3VD5 A;  3VZK A;  1VBE 2;  3OGJ A;  4F3J A;  2ZAC A;  1JYX A;  1PVC 2;  4LBL A;  4XF1 A;  5FZE A;  4OI0 A;  4OQ9 A;  5EP9 A;  1F2N A;  1G9A A;  3GHN A;  2ZAH A;  1W05 A;  2BNO A;  2E7Q A;  3J26 N;  3ROU A;  1FX5 A;  1U12 A;  5LA9 A;  5IHR A;  3VDA A;  3WG1 A;  3DPR A;  2YPJ A;  4XFI A;  3SEE A;  4CDX B;  2VZU A;  2P2K A;  2ZS6 B;  4IEO A;  2H6B A;  1OUR A;  2QCS B;  1PIV 3;  2NYY A;  2XJS A;  2EAA A;  3OG2 A;  4RHV 1;  3VV1 A;  2ZGL A;  2W95 A;  1DGR N;  2ZX0 A;  3K3O A;  2R07 3;  3N35 A;  2ZGT A;  2QQP A;  4NIA A;  1OQE A;  3CQO A;  4Q8L A;  4XHB A;  4YM1 A;  3MUY 1;  1OXC A;  2D97 A;  3AMH A;  4N43 C;  3CIH A;  1VBD 1;  1J3Q A;  4QB1 A;  4IQP A;  1TG7 A;  2W2I A;  2VVD A;  1OC1 A;  1R64 A;  3RJR A;  5JWP A;  4YG6 A;  3T3Y A;  1BK0 A;  4RGA A;  3WDV A;  2W46 A;  2BRT A;  5F3E A;  1RUC 2;  1NCR A;  3AKR A;  1ULF A;  5FDB A;  4M01 A;  5CKM A;  2BWC A;  1W2N A;  1OMI A;  3N3H A;  4BOW A;  1DGR A;  1RUN A;  2R1B A;  1W6M A;  3IWZ A;  2V4A A;  5FZB A;  1RUF 3;  2ID4 A;  3VBF C;  1WLC A;  3WNK A;  1D4M 3;  2WZR 2;  5A3W A;  4JQR A;  5D21 A;  4OQ8 A;  4UFH A;  1OD3 A;  1PX4 A;  1OT5 A;  2FBE A;  4Y24 A;  5A7N A;  2E7A A;  2V72 A;  4W6Y A;  2DFC A;  3LKJ A;  4Q8K A;  2HBU A;  4PHZ A;  4LE3 A;  1YQ5 A;  4QQL A;  1CJD A;  2PLV 3;  2ZEZ A;  1NY7 2;  3CU7 A;  4HT1 T;  4IV1 C;  4CUC A;  1S0C A;  3U75 A;  3PUQ A;  3RZM A;  3VBR A;  3Q8F A;  1QDC A;  4HON A;  5ISL A;  3W20 A;  4NID A;  1VBA 1;  4RYD A;  1YLL A;  4XXP A;  1AX1 A;  4R52 A;  4JGY C;  4Y33 A;  4YVS A;  3AP7 A;  2OT7 A;  1X9P A;  5B4X A;  3H8R A;  3OD0 A;  2JXA A;  4XDQ A;  4ZHN A;  3FBY A;  3III A;  1NE6 A;  1V6J A;  4JAA A;  3ME2 A;  3E1F 1;  4OHV A;  1AX2 A;  4QPG A;  1JZ7 A;  1AR7 3;  5FP7 A;  2XVL A;  5I93 A;  1N1T A;  3CEW A;  4COZ A;  3JQW A;  2WNV C;  5E88 A;  2BQP A;  4JRL A;  2RM2 1;  1SLA A;  4LMF A;  2XJQ A;  3Q8A A;  1R1A 2;  1S0F A;  5AVA A;  2HWC 2;  1PMI A;  1YNA A;  1MAC A;  3GYD A;  3UKT A;  5LA2 A;  4MZU A;  1ODM A;  2RDN A;  3ZN6 A;  1BJQ A;  3WF2 A;  2R1D A;  2X29 A;  2O0O A;  3MGU A;  4FPJ A;  2A6X A;  4A4A A;  2YC2 A;  4B29 A;  3ETP A;  2DCY A;  4OVE A;  1NT0 A;  2HWD 3;  1ACC A;  2IXH A;  3VBR C;  1YEW A;  3GCX A;  3U4X A;  3VBU B;  5F3C A;  1IQD C;  1MQT C;  3JU9 A;  1UYY A;  4P08 A;  3M1H A;  2B42 B;  4NHL A;  1D0G A;  4N53 B;  2VE1 A;  5D8A A;  3T1L A;  3NMB A;  4AVC A;  1WW4 A;  2DFB A;  4Y4R A;  1YUD A;  5LB6 A;  2ES3 A;  3VL9 A;  1NZI A;  2FDH A;  2QQL A;  1ZZ8 A;  3KQR A;  4WZF A;  4ASK A;  1HB3 A;  2RV9 A;  4CEY B;  4IV3 A;  1DQ1 A;  1RUH 3;  1UW8 A;  4Q0V A;  4PBP A;  5J09 A;  3WNL A;  3IPV A;  3ZN5 A;  1VBA 2;  5KHJ A;  1U0A A;  3E97 A;  1W9Y A;  3VD9 A;  2FDF A;  3FFZ A;  1NLR A;  4V2W A;  4UFJ A;  5EJZ B;  3THD A;  4J6G A;  1UOF A;  4Q1P A;  1NY7 1;  4ONU A;  3WW2 A;  3MF6 A;  4HN1 A;  1HJF A;  3ZFE A;  3VL8 A;  4LBQ D;  5LK5 A;  5HV4 A;  2I74 A;  4COY A;  4IE6 A;  3B01 A;  3ZFG A;  1LED A;  3FFQ A;  2B5H A;  4YPJ A;  5IK5 A;  1YO8 A;  2KM2 A;  4B7E A;  4EQV A;  1S0E A;  3KV5 A;  3UKV A;  4HAN A;  2XVK A;  2JG9 A;  3GBF A;  1K45 A;  2GN3 A;  4K1Z A;  1U5X A;  5CEH A;  5KC6 A;  3TYJ A;  3GBG A;  4GKY A;  5IFT A;  3LD8 A;  4LKE A;  4GJZ A;  1JZ2 A;  1ZYB A;  3WHU A;  1QY4 A;  5FXW A;  2WS9 1;  2RMU 2;  4AQS A;  4JDO A;  4N90 A;  1LGN A;  4NJ4 A;  2HEY F;  1DZR A;  2C4X A;  2HWE 1;  4HZF A;  1RUI 1;  2VUD A;  1RUH 1;  3JZV A;  2HEW F;  3RMY A;  3VDB A;  2ADE A;  2XHN A;  4I09 A;  4QX2 A;  5FZF A;  3NKT A;  4CEW C;  1N3O A;  4N43 B;  3S30 A;  1IS5 A;  2JEN A;  4QB2 A;  4XPV A;  5FP3 A;  4GB3 3;  2WZE A;  5EV7 A;  4L11 A;  3DYP A;  4FCA A;  5GM0 A;  1UU4 A;  3CO2 A;  2WZ8 A;  5KHH A;  5LBC A;  1STM A;  3LCP A;  4IEV A;  1UIJ A;  2RS5 1;  2PMW B;  3I3E A;  3NAP B;  4HVR A;  3VKM A;  1SFP A;  4M4P A;  2PHF A;  3F2Z A;  3HT2 A;  3JB4 C;  3O1T A;  2XDV A;  2YRO A;  4CU6 A;  1UOJ A;  3SQO A;  3FHQ A;  4AVT A;  4I0A A;  2VAU A;  3JBG 1;  3TEZ A;  2RE9 A;  2BEO A;  4QXK A;  2B4K A;  3IMM A;  2RR1 2;  1C1F A;  1G8W A;  4J25 A;  3OEA A;  4NRO A;  3LB9 A;  4UI9 L;  1UL9 A;  3QD6 A;  1TMF 3;  1GZW B;  4QMA A;  3ZDS A;  3EHK A;  4LOT A;  4UBG A;  4XF9 A;  4DO0 A;  1F15 A;  3H3U A;  4TWT A;  4HMZ A;  3HN1 A;  2ZHK A;  4Q4W 2;  3V64 A;  1ULP A;  1W3X A;  2KXL A;  4LIT A;  3WNN A;  1AYN 1;  3CHX A;  2CU5 A;  4E27 A;  1RUC 1;  5A7S A;  2XWJ B;  5A33 A;  3VHP A;  2HWB 1;  3HNM A;  1FPN 1;  3DEM A;  1GP5 A;  1ND2 A;  4XFB A;  1UY3 A;  2MHF A;  3PUA A;  3GZT B;  1YXW A;  1EAH 2;  3C7G A;  1POV 1;  3OBT A;  4QGM A;  3AKT A;  4KI5 M;  4UF0 B;  5JR7 B;  4LHN A;  3TNP B;  4RN5 A;  4YW6 A;  3VHR A;  1V6N A;  2P6C A;  5GLW A;  4AHY A;  1W8H A;  3IKW A;  4AED A;  5C4W C;  4GA9 A;  3SH4 A;  4CXY A;  1O3R A;  3POI A;  2K46 A;  4TXW A;  3LOB A;  5BNN A;  5C70 A;  5LEK A;  2VVF A;  2O14 A;  3GM8 A;  4BQ1 A;  5F2S A;  3FWE A;  3UT0 A;  2A5Z A;  4QM9 A;  1OQ1 A;  3V0B A;  4Q5O A;  3Q9O A;  2CAU A;  2EF6 A;  3WY6 A;  1CAV B;  4FOV A;  4LR4 A;  5GZC A;  2ZEW A;  2E32 A;  2V5Y A;  3WF1 A;  3O1S A;  2W3J A;  1MR5 A;  5FZ6 A;  4JGY A;  4YVS C;  3PJQ A;  4HBN A;  5HBA A;  4AHX A;  1LOA A;  2CGN A;  1UZZ A;  2CWS A;  2K9Z A;  3MV0 1;  3VHN A;  3WW1 A;  1QJY 2;  5FY5 A;  3TB0 A;  4OUS A;  4FP3 A;  2V5D A;  2XLA A;  1KEX A;  4AAP A;  4N8M A;  4WBB A;  4AK3 A;  2C9A A;  4GQ7 A;  1GMM A;  4WVM B;  4LBK A;  3WNO A;  4LBJ A;  1ENQ A;  1LUL A;  3M3O A;  3MV1 1;  4N9H A;  5I8S A;  5DG1 A;  1F4H A;  2Y33 A;  1US3 A;  3MUZ 1;  4GJY A;  1PK6 A;  3IDA A;  4Y3O A;  5I8T A;  3I2O A;  2WFF 2;  4Y4Y A;  3JD7 3;  5DUX A;  1APN A;  4NII A;  4IW3 A;  4Q4Y 3;  1QOO A;  4QQO A;  3OJB A;  3GDB A;  2RDQ A;  2HWF 1;  2VNR A;  1N1V A;  4LO4 B;  2CGO A;  2XQX A;  3D82 A;  5F2W A;  4K9S A;  3S5Q A;  4IEW A;  1AYN 2;  3WDX A;  1VMJ A;  2JDK A;  1CIW A;  4ITC A;  5J1X A;  3PTR B;  3WDT A;  5LCW L;  3R4S A;  3OY8 A;  4LTA A;  4AED B;  3DKW A;  1IKQ A;  1VB2 A;  5HXV A;  5A3M A;  2UY9 A;  1CPM A;  5AC9 3;  4OLL A;  1G9C A;  5GKA C;  4YZ4 A;  3ZXG A;  2ZEX A;  1FNY A;  4FP2 A;  1MVQ A;  5C3Q A;  1US2 A;  4AFD A;  3U07 A;  4MGY E;  2DCK A;  4OUM A;  4CCK A;  3ZXD A;  2VD7 A;  2JKB A;  1AR9 2;  2OPK A;  2WT0 A;  3O0W A;  4E9K A;  2QQV A;  1UMZ A;  1Y9G A;  2XR4 A;  3AFG A;  1F5J A;  1Q8Q A;  2DBN A;  3B7M A;  4BWO A;  5I0D A;  4B1L A;  1EUT A;  4I3G A;  4IEX A;  2BWA A;  1L7L A;  1NCQ C;  3ACG A;  3HQX A;  1XYO A;  4ZKT B;  3HD8 B;  1G9D A;  3FL7 A;  3I8T A;  4WM8 C;  1GZ9 A;  2PLV 1;  2UYA A;  3ZDV A;  4IND A;  1R09 1;  4N7I A;  4AI3 A;  1AR7 2;  1POQ A;  1LOB A;  1VP6 A;  4ISR A;  4MGI E;  1OA4 A;  1XSQ A;  3HEI A;  5BPX A;  4AFC A;  2CY6 A;  2VJX A;  4GH4 C;  5A6X A;  3AP5 A;  1AYM 1;  3T2Q A;  4D7S A;  4Y1U A;  2XON A;  1VE0 A;  1QJY 3;  1RGS A;  3D8C A;  3R05 A;  2E7T A;  1I9R A;  1W6O B;  2C6S A;  3PU3 A;  1G6N A;  4I0W B;  1LHW A;  2YFZ A;  5FZH A;  1O4T A;  3H0O A;  1S2K A;  2QQM A;  3THC A;  1V6L A;  4Y22 B;  1A34 A;  3T2O A;  2GND A;  5JXI A;  5A3U A;  2VOX A;  2C24 A;  1GYK A;  2C1F A;  2PEL A;  4XFG A;  2HWC 3;  3RG0 A;  3VBH A;  4H2A A;  2DUR A;  1AR6 3;  3SNM A;  4Z82 A;  1J1T A;  1H30 A;  4CCO A;  5FAX A;  1UU6 A;  3H7J A;  3J7L A;  1W2O A;  2VQU A;  3A0K A;  5H9S A;  1S0I A;  5T5O A;  3SXW A;  4C0B A;  3KV6 A;  1CAX A;  1W0P A;  3OGS A;  2NPI A;  2Q4S A;  2E63 A;  1I3H A;  4UW4 A;  1ZX5 A;  1PO2 1;  1CR7 A;  2YHJ A;  2ZKL A;  4RGK A;  4S2G A;  4E4Z A;  4LK7 A;  1NQD A;  3C2U A;  1IPK A;  4TN7 A;  3FC0 A;  1GFF 2;  4XDP A;  1M4W A;  2HWD 2;  1UOB A;  5CIS A;  2RS1 2;  1F35 A;  3MIB A;  3ZSL A;  2XLG A;  1L7Q A;  4DEV A;  1JU4 A;  2WNU C;  1GV9 A;  1DYP A;  4PIZ A;  4R9B A;  4WM8 A;  4BE3 A;  1KS4 A;  3OEB A;  3HQU A;  1AYM 3;  1H2L A;  2WDB A;  5F3G A;  2FDG A;  2NN8 A;  2YBP A;  3EJK A;  2JB4 A;  2W5F A;  1MZE A;  4E4D X;  5B4N A;  2D6L X;  1RYY A;  5AFE A;  1UWW A;  1JXN A;  5KXC A;  4YFW A;  1WCQ A;  4JTO A;  4JZR A;  3HT1 A;  3ZIX A;  1RJ7 A;  2JDY A;  2OII A;  4NN0 A;  3OY8 B;  2ZZQ A;  4XFA A;  3G7D A;  4P9G A;  5JCT A;  1C5H A;  3DXT A;  5FZC A;  2BVB A;  3AMM A;  3FLR A;  3RYP A;  2RMU 1;  2ATF A;  4OYU A;  4EN9 B;  3GZE A;  2J1V A;  1XC6 A;  4ZZ8 A;  1Q8P A;  2Y6K A;  3BOP A;  4AWD A;  3A21 A;  3FLT A;  1C8M 1;  1X8E A;  2VO5 A;  1W6M B;  3PVB B;  4PCR A;  4V2V A;  4BDV B;  3CLP A;  2D6M A;  2IFR A;  5C3P A;  2XL9 A;  2AEN A;  3KHB A;  4LHK A;  2WFF 1;  4YW1 A;  3WHT A;  3HPN A;  3DN7 A;  5J3U A;  5FFO C;  5T5J A;  4Z2A A;  1SLC A;  1HB1 A;  3W59 A;  2Z42 A;  2G9G A;  4Q2F A;  2WNE A;  3M8L A;  3POB A;  2ZX3 A;  4CYD A;  1O3Q A;  1S0J A;  4IEZ A;  2WT1 A;  3BVC A;  2JDN A;  5FZD A;  1Y9Q A;  2BV4 A;  3VUO A;  2ZX4 A;  1PVC 1;  4CDW B;  5F8P A;  4GH4 A;  4AVA A;  4MOA A;  4PI2 A;  4M4R A;  1B35 B;  4XQD A;  1GWK A;  1RUD 3;  2HKX A;  4BMB A;  4IXL A;  3H3L A;  3OBA A;  4YW4 A;  1RUC 3;  3W9A A;  1HKD A;  2ZA9 A;  2R7E B;  3FN9 A;  4UW3 A;  4AEM A;  3VB9 A;  4CU7 A;  5C9A A;  4FTS A;  4WM7 B;  3N7M A;  3ZXE A;  2Z69 A;  3K4A A;  4XJ8 A;  2V09 A;  3VBF B;  2ARC A;  2EXK A;  4BK4 A;  1FMD 1;  5FKC A;  2OQ6 A;  2JEM A;  2JDH A;  3HBK A;  2OPW A;  2JKX A;  4WM7 C;  5FR3 A;  2YMZ A;  4BLJ A;  1GQH A;  1TE1 B;  3ECQ A;  4QQH A;  1DZQ A;  3GHM A;  1RXF A;  4FPF A;  3M3Q A;  1YI9 A;  3UJQ A;  1H2K A;  3ZSM A;  2OVU A;  1VB4 A;  1C8M 3;  1RIN A;  1PX3 A;  3JBG 3;  4Y22 A;  2W92 A;  3QH7 A;  3SHR A;  3WP6 A;  1H8T B;  3WW4 A;  3WCR A;  3LA2 A;  3TN9 1;  1SLB A;  3VBH C;  5C8C C;  5M0T A;  3S57 A;  1DYO A;  3V0A B;  1MZ6 A;  3U4S A;  4MVT A;  3ZFE B;  3AVR A;  3MFC A;  2LRP A;  1UX6 A;  4MSV A;  2FMD A;  1F9K A;  1GBG A;  1PVC 3;  2VW2 A;  2EXJ A;  3BB6 A;  4IDZ A;  5FIX A;  4LIV A;  1XU2 A;  4K8F A;  1SCS A;  2YU2 A;  2WWU A;  5DPN A;  4X8P A;  4HXC A;  3ZFE C;  4HPK A;  5CAZ A;  1HLC A;  4TSV A;  4LA2 A;  5LRR A;  4MLO A;  2AEZ A;  3V0A A;  4BLI A;  1VLN A;  1V70 A;  4D8M A;  4CU9 A;  5A7O A;  1XPW A;  5KXD A;  4R9C A;  2A3X A;  1O5U A;  3LPF A;  2D6N A;  4KWU A;  4XQW A;  4A44 A;  1XND A;  4BYY A;  3LF7 A;  4FFG A;  1UYP A;  5CKN A;  2OA2 A;  1AF9 A;  2WIN B;  2WNV A;  2YBS A;  2F17 A;  2ZXQ A;  3IDE A;  1UX7 A;  4A7Y A;  2Q1F A;  3EBR A;  1V9U 1;  2NM1 A;  2RDR A;  3ILF A;  3FUQ A;  4PLN A;  1QJU 1;  4XC9 A;  5GZE A;  2VTX A;  4PF5 A;  1W2A X;  1DLL A;  5GLV A;  3ZXF A;  3WXP A;  4DUX A;  2ZGN A;  4CP9 B;  3RZJ A;  4HSL A;  5LBF A;  4AED C;  4ZU5 A;  2OKX A;  5FZM A;  1JW6 A;  3ZX7 A;  4FPO B;  3ZYB A;  5A7Q A;  3I2H A;  2VR4 A;  4FPG A;  4QX0 A;  4BIF A;  1RVF 3;  2G9F A;  3KD4 A;  3KCY A;  5FY9 A;  4QGL A;  2BVV A;  2HWF 2;  4HOO A;  4C91 A;  4MET A;  4R9D A;  3WV6 A;  4FOQ A;  5L73 A;  4B3N A;  2QQN A;  3ACH A;  4JCK A;  3JQX A;  5CB7 A;  1VBD 2;  4LHL A;  4NRM A;  5A7P A;  2ZGP A;  4S2F A;  2D93 A;  3TBD A;  1Z7S 2;  2WKK A;  2UUR A;  4Q4Y 1;  3RI9 A;  2DU1 A;  4JGY B;  3HR9 A;  5FY8 A;  3I49 A;  4W6X A;  4IGP A;  4Z1V A;  4L0P A;  4K7J A;  4YVW A;  1EAH 1;  1ASJ 3;  4XAA A;  3BGA A;  4MGS A;  4LA3 A;  1KQR A;  4FXG B;  1RUG 1;  1ZBA 3;  4W50 A;  3URF A;  1JYI A;  4H14 A;  2F6B A;  4YG0 A;  5FXV A;  2ZGU A;  4D7Y A;  4ZS2 A;  1ULG A;  4EN8 B;  4YZ5 A;  1U5I A;  4QX3 A;  2J1T A;  5AC9 2;  5JI9 A;  5C8C A;  5F7U A;  1KFU L;  1LOF C;  5CKQ A;  5F9T A;  3PIJ A;  4Q4V 1;  2VZQ A;  1IKP A;  2IFW A;  2XJT A;  3AZZ A;  3IPV B;  4DMI A;  1WME A;  2PA7 A;  2EID A;  2EIB A;  1QNY A;  2D5H A;  2WAB A;  2YFU A;  4LBN A;  3NRU A;  3NL1 A;  2GME A;  3IN9 A;  4YSF A;  2BPA 2;  2RJK A;  4I3P A;  2VQT A;  1W03 A;  1BVV A;  5C33 A;  4GMP 3;  5AVP A;  1NA1 A;  2MNG A;  5T3N A;  2X5I A;  3X29 B;  4CCN A;  4DIQ A;  4YNI A;  2DWR A;  1GOG A;  1JUH A;  3MIG A;  1AR6 1;  1AZD A;  3Q8E A;  2OZ6 A;  3AYA A;  5A3N A;  5FLI A;  4DUV A;  1K3I A;  2GNM A;  2Q5T A;  2VMF A;  2VBP A;  3TEW A;  4LBO A;  1QXR A;  3S7I A;  3ZN6 B;  1YIP A;  3O0X A;  4KMQ A;  3O5S A;  1JZ4 A;  3DUI A;  3VD7 A;  1VBC 3;  3FHA A;  1O6U A;  3K75 B;  2Q1M A;  3KVA A;  3NJV A;  2CSG A;  3PVO A;  4Q29 A;  5C4W A;  1JZ3 A;  2YPD A;  3BTZ A;  2PHX A;  4D69 A;  4Q0S A;  3P6B A;  2Y0O A;  2ZOE B;  4OHX A;  2EA7 A;  2FCT A;  1MS9 A;  4QGN A;  4XAE A;  2JDA A;  3AYC A;  4FT8 A;  1SDD B;  3B69 A;  3VBH B;  4F7Z A;  5ACA 3;  1E57 A;  5CFD B;  3AP6 A;  3AYE A;  1OOP A;  3I54 A;  4B1M A;  4BB3 A;  4QKB A;  5FYU A;  1SZB A;  3NAP A;  1CX4 A;  3BU0 A;  2PAE A;  3MPB A;  5FP8 A;  4AI2 A;  2ORX A;  4ZXE A;  1Q8S A;  2P34 A;  3D4K A;  3IAP A;  1HIX A;  1LKN A;  1Q8V A;  2YXS A;  4QHZ A;  3ZFG B;  4A45 A;  3W5M A;  1GP4 A;  3HVD A;  2ENR A;  1OUX A;  3AXD A;  1UCX A;  4XMI A;  4COV A;  1CN1 A;  2EVX A;  1HDK A;  1TME 1;  3K46 A;  3UYJ A;  4XUP A;  5FXZ A;  1DU3 D;  1F31 A;  4E4H A;  2XOM A;  5JOX A;  4Q4V 2;  5FJH A;  3POW A;  4B4R A;  2A6Z A;  1ODN A;  4W65 A;  1PGW 1;  4NWV A;  1AJK A;  3DYM A;  4NHM A;  2XVG A;  1OVP A;  5FZ7 A;  1PIV 2;  1SBE A;  2ERF A;  1M06 G;  3RWK X;  3WLU A;  2IVI B;  3KT7 A;  4UF0 A;  3GBW A;  2KD7 A;  3MO4 A;  4EYU A;  5C3R A;  4QPI B;  2IC1 A;  1N1Y A;  1QH7 A;  3OUI A;  1HXS 3;  4Q1R A;  5CNA A;  5E1R A;  2VL4 A;  2WAA A;  5FRE A;  2XBO 1;  4UXA A;  4EWE A;  4LE4 A;  5KXB A;  2FZ2 A;  2VCA A;  2VOT A;  1PGS A;  2VW0 A;  3LIH A;  4MAD A;  1SAC A;  4NRQ A;  2AEY A;  1AXY A;  2LTN A;  1OKO A;  3E6D A;  4R9A A;  2XXZ A;  1NZC A;  2YUE A;  4TLF A;  3PUH A;  1ENS A;  3MZH A;  3P1I A;  1V6I A;  2Y38 A;  3POF A;  4MV2 A;  3T4V A;  5ABJ B;  2ZJC A;  4PIX A;  3DKQ A;  3BTY A;  2ARE A;  4N43 A;  3KMH A;  4BQY A;  3N9N A;  5F5I A;  1E5H A;  2H6C A;  2VZR A;  2W39 A;  2PTM A;  4XTM A;  1PMJ X;  3D5O A;  3LSE A;  4Y20 B;  3RGB A;  1W04 A;  4BXS V;  2WO7 A;  5LAS A;  3AL6 A;  1W8Z A;  3CF6 E;  4PT6 A;  4YZ1 A;  1UKG A;  3WP5 A;  1UNB A;  4QPG B;  4BCU A;  1QIQ A;  1YRZ A;  2WSU A;  4YZ3 A;  4CXW A;  1NCQ B;  2QKD A;  3WOG A;  3ZFF A;  5CG8 A;  3BOD A;  1EPW A;  4N53 A;  3B93 A;  1TNF A;  4CCL A;  4MGK E;  3U10 A;  2PHW A;  1PHM A;  1E5I A;  1RTV A;  2DTW A;  2QUO A;  1VPH A;  4IV1 B;  5DUU A;  1O3S A;  1W8O A;  2VCC A;  3O1V A;  4DQA A;  2ETE A;  3S7E A;  1RUE 3;  2PQQ A;  2VZV A;  2I2S A;  1O3T A;  3O1R A;  1DF0 A;  3O12 A;  1RMU 3;  2JIC A;  1RUI 3;  4P14 A;  2BNM A;  2PXJ A;  2QQO A;  3VZJ A;  4LO5 B;  5JMO A;  3VD4 A;  1YQ2 A;  3KVB A;  3POE A;  4C1W A;  3ACL A;  3M3E A;  1H8V A;  3T1M A;  1EV1 1;  5BNN B;  2A6V A;  3N7K A;  3PME A;  2JDM A;  2OS2 A;  2A6Y A;  1F5F A;  4IV3 B;  5FV3 A;  5F1R A;  1FOD 3;  1A8D A;  2ET1 A;  3D3A A;  3PMS A;  4NE9 A;  5CG9 A;  1CAU B;  4RHV 3;  3RZZ A;  2XBO 3;  1W90 A;  3WD5 A;  1MQT B;  2JB8 A;  1AR8 3;  5FCC A;  2J1R A;  3PJY A;  3O1O A;  1N3Q A;  5DDJ 2;  3IBM A;  1WCK A;  4AVV A;  5FZA A;  3LA7 A;  5C3S A;  2K0G A;  1Y9M A;  4I02 A;  4P00 B;  1RB8 G;  3GJB A;  2J22 A;  3Q8C A;  1KS5 A;  3ES1 A;  5JOW A;  1S0B A;  4JHZ A;  3C7F A;  1W99 A;  2JDZ A;  3A23 A;  1MPX A;  1I1E A;  4AHZ A;  5A80 A;  2BJS A;  1WW6 A;  5IVC A;  5KXE A;  2GNB A;  4CP1 A;  3J8F 3;  1ZZ6 A;  3DPR C;  3UET A;  1J84 A;  1A6C A;  1JH5 A;  2JWP A;  1KJL A;  2DVG A;  1PGL 2;  5T50 A;  1H6Y A;  1ENX A;  1KIT A;  4N7U A;  2EAK A;  4A6O A;  4AR2 A;  1RHI 2;  4E4S A;  1QXP A;  5IVJ A;  2P3J A;  2VUA A;  1C1L A;  3VBS C;  2XWB B;  3ABZ A;  1BCX A;  2WZR 1;  3TEX A;  2RVA A;  3VDD C;  3O0V A;  1V9U 3;  1QF3 A;  3NNF A;  4KG0 A;  2XML A;  4W4Z A;  1GOF A;  5FMC A;  1C28 A;  1EUU A;  1WKY A;  2R32 A;  3C7H A;  4IET A;  3MF9 A;  3AZV A;  1J3R A;  2BW8 A;  3SCG A;  3PTY A;  4MGQ A;  1O7F A;  2NZ9 A;  4NHY A;  2HJI A;  1QXJ A;  3T0A A;  4PQ9 A;  1RVF 1;  1YIF A;  4ZXK A;  3QAC A;  1ZBE 1;  3LEK A;  5FJK A;  2W08 A;  1UY1 A;  3IMN A;  5FZ4 A;  1RUO A;  1GNY A;  2BZD A;  4ERO A;  1IG0 A;  2EAL A;  2L9L A;  4FFI A;  4HKL A;  4QHB A;  3W58 A;  3VZL A;  4JGZ C;  4ZU7 A;  5FLJ A;  1K5M A;  2ARB A;  2ZAA A;  1XU1 A;  2WAO A;  3MI8 A;  1JUI A;  1Q8O A;  2RM2 3;  3LE0 A;  5B2G B;  2VOW A;  3THP A;  3ZXJ A;  1SMV A;  1UY0 A;  4LNV A;  4ES8 A;  5FZK A;  2UWA A;  4XUO A;  5F5C A;  4AFA A;  2VTX J;  4FFH A;  4YYO A;  4DXS A;  3A4U A;  1JTZ X;  3NAP C;  1ASJ 1;  2D6P A;  3M7A A;  4GB3 2;  4P9Y A;  2F4P A;  5CA6 A;  4KGG A;  5ANN A;  1VRH 3;  2W9X A;  3OGV A;  4XFF A;  5A7W A;  2W1W A;  2WLP A;  1LAJ A;  1LNS A;  2ZGM A;  1DQ6 A;  4NO4 A;  3ZYI B;  2Y6F A;  3LSD A;  3VDD A;  1E5R A;  5IAX A;  1ZRR A;  4DFS A;  2GH8 A;  1B35 C;  2A7A A;  3RQ0 A;  1H0B A;  3ZXL A;  4A7K A;  1RHI 1;  2HWD 1;  4XVH A;  2WUH A;  3ILR A;  4AFB A;  5CAD A;  3ZXA C;  4FPL A;  4B4P A;  4XFC A;  1CAX B;  3VKF C;  1LU2 A;  1VBC 1;  1F4A A;  5FK8 A;  2RS3 2;  1OLM A;  4OUL A;  3ITQ A;  4TTG A;  3HWJ A;  1TNR A;  1CVN A;  4MGT A;  5EHD A;  3OTF A;  2OUJ A;  3L2Y A;  1COV 2;  2WNV B;  4A41 A;  1OA2 A;  1KDK A;  4LKD A;  1UY4 A;  3WDW A;  3VBU A;  4OMD A;  2A3W A;  3MIC A;  3FE5 A;  4JTN A;  3ZYR A;  3ACF A;  4DRR A;  3BTA A;  1VAV A;  4NPR A;  1GU3 A;  1Z78 A;  1I6X A;  1VAL A;  1H4H A;  4Z8B A;  3D0S A;  3HMY A;  1FI2 A;  1PIV 1;  1R1A 1;  3WCS A;  5CFC A;  3POY A;  4Q4X 1;  1TVG A;  1UY2 A;  2R16 A;  3T2P A;  4YAR A;  3NQH A;  4FQ4 A;  1HN1 A;  2TEP A;  4QX5 A;  1RUF 1;  5FO7 B;  2XBO 2;  3WP3 A;  2VZ1 A;  5LWB A;  2PHT A;  1Q43 A;  1H6X A;  4XUR A;  1DDL A;  1VBB 2;  3P3N A;  3UJO A;  3OYW A;  2N7G A;  2ZGK A;  3N9L A;  4YVS B;  4GKX A;  2Y6G A;  4XIL A;  1ALY A;  2ILM A;  2AC1 A;  5J98 B;  3LA3 A;  1GIC A;  1EP0 A;  3ZYP A;  2E31 A;  1H4G A;  3AB0 A;  4RR3 B;  5DAQ A;  1O59 A;  1DQ2 A;  4JKL A;  3VBR B;  4NHK A;  1PGL 1;  2J7M A;  1AJO A;  1GOH A;  1SPP B;  1Y3T A;  2BOI A;  2JDU A;  3CL1 A;  3JD7 2;  1AXZ A;  4CP2 A;  2HWE 2;  4Q0Q A;  2XJV A;  5A33 B;  1QOS A;  4K8R B;  4X6Q B;  3U0Z A;  4NIH A;  1BBT 1;  4CDU A;  3HAG A;  3MW3 A;  1UZY A;  4OFG A;  4RHV 2;  2Q8C A;  1D2S A;  1FOD 2;  2NMO A;  4FXK B;  2GC1 A;  3MBW A;  3AKP A;  4XUN A;  1GP6 A;  1UXZ A;  5FO8 B;  2XPJ A;  2IVJ A;  3WUD A;  4P9I A;  5EYX A;  3N7J A;  5FUP A;  5CFC B;  1IGO A;  2OW4 A;  4Q4X 3;  3CZU A;  4GD4 A;  1L7R A;  5FXX A;  3VLB B;  1OSG A;  2JE7 A;  3MW2 A;  1JZ8 A;  3RPQ A;  2HEV F;  2DV9 A;  2UWC A;  2XHK A;  1PO1 2;  1O4Y A;  4ASM B;  4YGE A;  4GAL A;  2XKO A;  4ZPI A;  5GLT A;  4XAB A;  3PU8 A;  5EFU A;  4ARX A;  5JR2 A;  2ZZJ A;  4MUV A;  3J4U H;  2PHR A;  4AG4 A;  3HN3 A;  1NAE A;  4CSW A;  1C3H A;  5EYY A;  2BU9 A;  4Y1X A;  5A3P A;  1N3P A;  4A6S A;  2FMY A;  3H8O A;  2Y26 A;  4XAC A;  3ZN4 A;  1S4C A;  2GDF A;  2X53 S;  1QQP 1;  1OHF A;  2MEV 2;  5IUQ A;  1ENR A;  4GWN A;  4MGZ E;  4PLM A;  2Q8D A;  3RNS A;  1RUE 1;  2XG3 A;  2E9Q A;  2VNV A;  3K4D A;  4EN6 B;  2R0H A;  2IUW A;  4WM7 A;  1LOD A;  2VVE A;  4FFF A;  4JGZ B;  1ONA A;  4BM8 A;  5LZ6 A;  4A3X A;  5AFB A;  1Q5O A;  3GJA A;  3I59 A;  3M3I A;  5J48 A;  1K42 A;  1X9T A;  1RJ8 A;  3GZA A;  1BVP 1;  3J7H A;  5JSR A;  4J1X A;  5JDB A;  1ZZ7 A;  1OUS A;  4XQ4 A;  5C9A C;  1PO2 2;  5FPL A;  4CCM A;  3A0N A;  1YJK A;  4KWJ A;  3HNY M;  1EV1 3;  1AL2 3;  1OQD A;  2QVS B;  2VEC A;  4DXZ A;  4RQP A;  5LA1 A;  1VBE 1;  4OZO A;  4XBQ A;  2PFW A;  3PVN A;  1OFS A;  1UZV A;  2VUC A;  4LBQ B;  4LKF A;  4MXW A;  2VY0 A;  4NAO A;  3CNA A;  4GXL A;  3J7M A;  1LCL A;  4YVW C;  4L2N A;  3CKH A;  2ZX1 A;  2Q30 A;  3GF6 A;  3J8F 1;  4X6R B;  3INA A;  2WN2 A;  4UOJ A;  2FQP A;  2W1Q A;  5H9R A;  1ZRE A;  2AZ5 A;  4P5Y A;  2GAU A;  4Y26 A;  4CEY C;  5F3I A;  3OBZ A;  2WNO A;  2WQ8 A;  1UAI A;  5BNP C;  2EIE A;  2CGP A;  5C7G A;  2GNT A;  1XE7 A;  3WX5 A;  4LOS A;  3RVH A;  1PM7 A;  2BNN A;  1GSL A;  5CFD C;  4H7L A;  2RHP A;  1XE0 A;  3WF0 A;  2V4V A;  1CAW B;  3FHI B;  2HLE A;  2PLV 2;  3AP9 A;  5BNO C;  1W0N A;  3LPG A;  1V6K A;  2IWG B;  4XZU G;  4CU8 A;  4RS5 A;  3N4M A;  1ZRD A;  1NCR B;  1X33 A;  3RDI A;  1ULO A;  1HX6 A;  4LO7 A;  3U11 A;  5DXD A;  1D4M 2;  2WZR 3;  5DZE A;  5FBJ A;  1AL2 1;  4KL1 A;  5FO9 B;  2R07 2;  3RJ2 X;  4EWA A;  4LUM A;  1NXM A;  1RUF 2;  1BZW A;  1BMV 2;  4JV4 A;  3S0M A;  2V73 A;  3KGZ A;  4RFT 0;  1DYK A;  4UFM A;  5FYC A;  1RUG 2;  3VBF A;  3ZSK A;  4RGG A;  1QMJ A;  4LXL A;  5FPV A;  1PVX A;  2ZBJ A;  3POS A;  4CXX A;  1SFY A;  3LAG A;  4CPB D;  3T0D A;  1COV 3;  4AE2 A;  5FRA A;  2AR6 A;  4LHS A;  2BYV E;  2WNU A;  3AJY A;  1NOV A;  1QGL A;  4C1X A;  3AMN A;  1FYU A;  2WT2 A;  3KGL A;  3PL0 A;  4RL7 A;  4UW5 A;  5ERL A;  3ZYJ B;  1TMF 1;  2P3Y A;  3UES A;  1FAT A;  3LQC A;  4X8N A;  2MPF A;  1R08 1;  4LBM A;  4UFK A;  2A70 A;  5A3L A;  2RS3 1;  1MS0 A;  3KHC A;  3KLS A;  1DGW X;  1TMF 2;  5EJ3 A;  2ORZ A;  3LEI A;  3WQ1 A;  2YDE A;  3FX3 A;  2WN3 A;  4F83 A;  4Y5T A;  3VKO A;  3RZL A;  3B9I A;  1VRB A;  3BN6 A;  4M3C E;  3KS7 A;  3K77 A;  4AGR A;  2YV8 A;  3B3Q E;  3M2M A;  4AAX A;  4IEP A;  4CE8 A;  4ZZ5 A;  1DIW A;  1LEN A;  1ZBE 2;  4PIY A;  5ABJ C;  1VRH 2;  2PAK A;  2R04 1;  3H8U A;  4CDW C;  2HWC 1;  1R09 3;  3GNE A;  1UMH A;  3CJX A;  3MHZ A;  2CYF A;  2YC4 A;  4EN7 B;  1H9W A;  4G4F A;  3V0B B;  1WLT A;  3AX4 A;  1AYM 2;  4HL0 A;  2GN7 A;  1HXS 1;  2XLF A;  5FYH A;  2CNA A;  3MYX A;  5FPZ A;  1PNG A;  2LRO A;  2WQ4 A;  2WA4 A;  5G04 L;  4PJY A;  1W6P A;  1Q3E A;  1YJL A;  5FZ1 A;  4AF9 A;  5EQU A;  1ZBA 1;  1FPN 3;  2ARX A;  1H1I A;  3H1M A;  5FBZ A;  1NA1 C;  2WWS A;  4FO9 A;  3LEM A;  3SIT A;  4XUT A;  4CUG A;  2I07 B;  1ZBA 2;  5T54 A;  4M0N A;  1EYB A;  4I2O A;  3P5B A;  5GJ6 A;  3MLK A;  1BQP A;  4I0B A;  4Z92 B;  4SLI A;  2Q0A A;  5FZ3 A;  5CIR A;  3U78 A;  1SBD A;  2VNG A;  3ORJ A;  4KU7 A;  1FMD 2;  1BKZ A;  1J59 A;  2Y0I A;  1VBA 3;  1GUI A;  2Z2S B;  3JB8 A;  4BU2 A;  4XF0 A;  3MDP A;  5KBF A;  1Z7S 3;  2BP6 A;  1ULC A;  3FUO A;  5JPN B;  4TLG A;  3I2F A;  1D4V B;  2XUM A;  3T08 A;  3ZFG C;  4CTE A;  1UN1 A;  4GMP 1;  1NLQ A;  2Q8O A;  4Z07 A;  4QX8 A;  3VHO A;  2QQJ A;  4L8Q A;  3TRS B;  4XXA A;  1EV1 2;  2RS1 1;  3ZKY A;  2IXC A;  3TEY A;  5FZ8 A;  1VMH A;  2H0B A;  3N9M A;  1MZF A;  3M70 A;  4CDX A;  1GR3 A;  3I2I A;  4CP9 A;  2JD9 A;  3MW4 A;  3AJZ A;  2PHL A;  1UZW A;  1AHS A;  1QJE A;  1VBB 3;  5KHI A;  1POV 0;  4DS0 A;  2BBV A;  1FAY A;  5CU1 A;  1MVE A;  4EE2 A;  2C9K A;  1H2N A;  3ILN A;  2WJS A;  4HLT A;  1G86 A;  2EIC A;  3JXS A;  1YFU A;  2D6K A;  1VJ2 A;  4QHO A;  4UAP A;  3ZIW A;  3BIW E;  2PN5 A;  4XHX A;  4QXC A;  5FUN A;  5ACA 1;  4M3C B;  3PUR A;  5IVE A;  1W8N A;  2MEV 1;  1QQP 2;  5J7M A;  4K40 A;  4ORF A;  5DZG A;  1BBT 3;  2ZTN A;  4CCD A;  2Z4F A;  4XFH A;  5HI0 A;  5BNO B;  4SBV A;  3T0B A;  3VDD B;  1BMV 1;  3ZSJ A;  4XDO A;  2HBT A;  2XUE A;  4A42 A;  4QM8 A;  3SCH A;  3ASI A;  4IEU A;  1LGC A;  1W8W A;  4IEQ A;  4NUB A;  4DXR A;  3OBR A;  4RR3 A;  3SEP A;  2CV6 A;  3LDK A;  1SG3 A;  5I8Y A;  3NV3 A;  3WT3 A;  1DHK B;  5FQ0 A;  2BTV C;  1GKB A;  5SV5 A;  1CZS A;  2QE3 A;  3GAL A;  3OB8 A;  4NRP A;  4CDX C;  1FMD 3;  3WQB A;  2HWE 3;  1OLM E;  1R09 2;  3KT1 A;  1QJF A;  3VDC A;  5JSP A;  2BGC A;  4HK9 A;  3ZVX A;  3EO6 A;  4HVO A;  1LEC A;  4QXB A;  2VW1 A;  5JIA A;  2VMG A;  1HN0 A;  3KWV A;  1JS9 A;  1QNW A;  2XH6 A;  4P5H A;  4RFR B;  1WUV A;  1HB2 A;  3KF5 A;  4V1P A;  1OF3 A;  1KFX L;  3N9P A;  1LR5 A;  3TN9 3;  4K21 A;  5A70 A;  1CWP A;  2WSV A;  4N9I A;  1UKR A;  4O65 A;  5FYB A;  1HQN A;  2LUW A;  2B9U A;  2VMD A;  1B35 A;  3CZJ A;  2ZEY A;  3HOB A;  3L9J T;  1FXZ A;  3O14 A;  4QDS A;  4QPI C;  5BNN C;  1AYN 3;  4HK8 A;  4MG2 A;  2DVA A;  2O8Q A;  4AGG A;  4GWI A;  4HKO A;  4E2Q A;  1HV1 A;  1UQX A;  3DEC A;  1U5Y A;  4LJH A;  5LAT A;  5CFD A;  1VAM A;  1ZBE 3;  2R0F A;  4GWJ A;  3MIH A;  3BIE A;  5IAV A;  3H7Y A;  1UYZ A;  2W87 A;  4NIG A;  4RS5 B;  1GNZ A;  4XYX A;  1CX1 A;  2Y6H A;  3OOX A;  5HXM A;  1XNB A;  5A32 B;  1DQ4 A;  1DGL A;  5TSW A;  2W1S A;  3R4U A;  4YGB A;  5A6Z A;  1SLI A;  4E2S A;  2G4I A;  3MEP A;  2HWB 3;  3D6E A;  3LOI A;  3LZZ A;  3MID A;  3MIF A;  5IW0 A;  3WUC A;  1PM4 A;  4CA9 A;  1H9P A;  2ARA A;  2A6W A;  4GMP 0;  4JDM A;  3ZLI A;  2ZGQ A;  4QXH A;  4H7M A;  5J37 A;  3NKG A;  3OPT A;  3POJ A;  4XOG A;  2W1U A;  1JZ6 A;  1OLQ A;  2R06 2;  3KM5 A;  4CEW A;  3H1W A;  3OPW A;  2FHR A;  4XEZ A;  4ET7 A;  1HRV 2;  1LHU A;  5IFP A;  1IHM A;  1UOG A;  5D8A B;  5T52 A;  1FT9 A;  4RQP B;  1AR7 1;  2WBK A;  2B45 X;  1W9W A;  1LOE A;  2RR1 1;  2JG8 C; 
#chains in the Genus database with same CATH homology
 4JX0 A;  3C7O A;  4BK5 A;  3UET A;  1J84 A;  3I2G A;  2ZEW A;  2E32 A;  3WF1 A;  4LKS A;  4IUG A;  5DMY A;  1H6Y A;  1XNA A;  2W3J A;  4A6O A;  3MV0 1;  4DUW A;  4QX1 A;  3ABZ A;  2RVA A;  5DQ0 A;  3HNB M;  1JYN A;  2V5D A;  1KEX A;  1UMI A;  3IB3 A;  3VD3 A;  4W4Z A;  3WNO A;  1GMM A;  1GOF A;  2YG0 A;  3MV1 1;  1EUU A;  1WKY A;  1F4H A;  3C7H A;  1US3 A;  3MUZ 1;  2W91 A;  4DEQ A;  4E8C A;  4MGQ A;  3IDA A;  5IYY A;  3T0A A;  3ZM8 A;  4PQQ A;  1DP0 A;  2VM9 A;  3SKV A;  3GDB A;  3I3D A;  3LEK A;  2XQX A;  3WNM A;  3K4Z A;  1UY1 A;  1GNY A;  2BZD A;  2QBX A;  2L9L A;  1CIY A;  5J1X A;  5LCW L;  4LPL A;  5LA0 A;  3EYP A;  5JUV A;  2WAO A;  3I97 A;  3LE0 A;  1UY0 A;  1NKG A;  4XUO A;  5JXH A;  2ZEX A;  4DXS A;  1US2 A;  2DCK A;  3T09 A;  2VZS A;  1UXX X;  2W9X A;  3OGV A;  5I0D A;  3IAQ A;  3HJR A;  1EUT A;  2W1W A;  3ACG A;  1LNS A;  4ARY A;  1W9T A;  3FL7 A;  3CDZ B;  3A22 A;  4XVH A;  2WUH A;  1W9S A;  3HEI A;  2C26 A;  2VJX A;  3T2Q A;  2XON A;  1F4A A;  4TTG A;  2YFZ A;  3WF3 A;  2QQM A;  4XUQ A;  3THC A;  4A41 A;  1JU3 A;  4JKM A;  1GQP A;  3T2O A;  5JXI A;  1UY4 A;  4OMD A;  3ACF A;  2BGP A;  1GU3 A;  2VQU A;  3NJX A;  2CDP A;  3OGS A;  4GZ9 A;  2LS6 A;  4FI9 A;  1TVG A;  3UNP A;  3VDB A;  1UY2 A;  3T2P A;  3NQH A;  2LW8 A;  5A1A A;  1HN1 A;  2VZ1 A;  1KGY A;  3AC0 A;  3CMG A;  4DEV A;  2YB7 A;  1L7Q A;  2W94 A;  1O8P A;  1JU4 A;  1H6X A;  4XUR A;  2VMC A;  3OEB A;  2VZ3 A;  2Y6G A;  2WDB A;  1O8S A;  2E31 A;  2W5F A;  4JKK A;  5B4N A;  4BJ0 A;  1RYY A;  2QQK A;  1O59 A;  1UWW A;  4JKL A;  1WCQ A;  2J7M A;  1GOH A;  2VZO A;  5HPO A;  3ACI A;  3C8X A;  2CDO A;  2J1A A;  4OYU A;  3A7Q A;  3MBW A;  1UYX A;  2J1V A;  1XC6 A;  1UXZ A;  4XUN A;  4ZZ8 A;  2Y6K A;  3A21 A;  3U37 A;  3CZU A;  2VO5 A;  1L7R A;  1XNT A;  1JZ8 A;  4BDV B;  2VC9 A;  3WEZ A;  3HPN A;  4A3Z A;  4Z2A A;  3WNP A;  2VME A;  4ARX A;  5JR2 A;  4QDR A;  5G05 L;  2JE8 A;  4AG4 A;  2J1U A;  2E33 A;  3HN3 A;  1NAE A;  5CZK A;  4MOA A;  4M4R A;  2VZP A;  4DXT A;  4ZY9 A;  3OBA A;  3SKJ E;  3K4D A;  4CU7 A;  2R7E B;  3FN9 A;  1J83 A;  3K4A A;  2VCB A;  1DLC A;  1K42 A;  4BK4 A;  3J7H A;  1JYV A;  2X09 A;  2JKX A;  3W5N A;  3I3B A;  3ECQ A;  3HNY M;  5LA1 A;  4OZO A;  1NUK A;  1PX3 A;  3DYO A;  2W92 A;  3LEG A;  4QB6 A;  2WO3 A;  4OUE A;  2WO2 A;  3PUI A;  3CKH A;  1DYO A;  2E26 A;  4UOJ A;  2WN2 A;  2W1Q A;  4P5Y A;  1CZT A;  1OH4 A;  2WQ8 A;  2EIE A;  5C7G A;  2PQS A;  5DPN A;  2Y64 A;  4QAW A;  1NX9 A;  3WF0 A;  2RJ2 A;  2V4V A;  2HLE A;  1W0N A;  4D8M A;  4CU9 A;  3LPG A;  1XPW A;  4XZU G;  4CU8 A;  4A44 A;  3LPF A;  4KWU A;  1T2X A;  3VD5 A;  1ULO A;  1OF4 A;  2J1E A;  1JYX A;  2ZXQ A;  4D0Q A;  1UX7 A;  5IHR A;  3VDA A;  4DUX A;  3SEE A;  2VZU A;  4PF1 A;  3OGR A;  3OG2 A;  2OKX A;  3T0D A;  2W95 A;  2Y8K A;  4LHS A;  3I2H A;  2VR4 A;  4QX0 A;  1JHJ A;  3CQO A;  3MUY 1;  4CUA A;  3UES A;  3CIH A;  3LQC A;  4QB1 A;  1SHW B;  2B9V A;  1TG7 A;  2QQN A;  1R64 A;  3ACH A;  3GGL A;  2W46 A;  2ORZ A;  3LEI A;  2WN3 A;  3BN6 A;  3K77 A;  2DCJ A;  4AAX A;  4ZZ5 A;  4L0P A;  2ID4 A;  5JXJ A;  2DDU A;  3BGA A;  3WNK A;  4MGS A;  1UMH A;  4W50 A;  2YC4 A;  1OD3 A;  1PX4 A;  1OT5 A;  2V72 A;  4QX3 A;  2J1T A;  2X10 A;  5F7U A;  2ZEZ A;  5G04 L;  2VZQ A;  4CUC A;  5FUI A;  2EID A;  4CUB A;  2EIB A;  2WAB A;  2YFU A;  4XUT A;  4W8J A;  3NRU A;  4RYD A;  2VQT A;  5B4X A;  3III A;  1GOG A;  1JZ7 A;  3E1F 1;  5IJR A;  4QPW A;  1GUI A;  3I2K A;  3I2F A;  3T08 A;  1D7P M;  4LQR A;  4DUV A;  1K3I A;  2VMF A;  2Y6L A;  5LA2 A;  2WYS A;  2QQJ A;  4KMQ A;  3WF2 A;  2W47 A;  1JZ4 A;  3VD7 A;  3FHA A;  3NJV A;  3K75 B;  2YC2 A;  4A4A A;  1JZ3 A;  3ETP A;  3I2I A;  2JD9 A;  3P6B A;  4QDQ A;  2X05 A;  3GXU A;  1IQD C;  2JDA A;  1SDD B;  1UYY A;  4P08 A;  4HG6 B;  2C9K A;  4P02 B;  2QQI A;  2QQL A;  2EIC A;  2ORX A;  3JXS A;  4ZXE A;  2RV9 A;  1JYW A;  3IAP A;  4UAP A;  3W5M A;  5JXG A;  4A45 A;  3WNL A;  1CZV A;  3EB7 A;  4MO3 M;  1UZ0 A;  1W8N A;  1JI6 A;  3VD9 A;  3K46 A;  4XUP A;  5EJZ B;  3THD A;  2Z4F A;  2XOM A;  3T0B A;  1BHG A;  4OMC A;  4A42 A;  1JZ5 A;  3DYM A;  4DXR A;  3SEP A;  4YPJ A;  1SG3 A;  1P8J A;  2KD7 A;  3MO4 A;  2WO1 A;  2BGO A;  1K45 A;  2VL4 A;  1CZS A;  2WAA A;  3OB8 A;  5IFT A;  3WQB A;  5EIY B;  1JZ2 A;  2VCA A;  2VOT A;  3WF4 A;  2HYX A;  4MAD A;  3VDC A;  3PUH A;  3P1I A;  2C4X A;  1OF3 A;  2XHN A;  4QX2 A;  4QB2 A;  2VZR A;  3NNG A;  1PMJ X;  2WZE A;  3DYP A;  4BXS V;  2WZ8 A;  3HOB A;  2VMD A;  3CZJ A;  3C7E A;  2J1S A;  2ZEY A;  4PT6 A;  4QDS A;  3I3E A;  4M4P A;  4GWI A;  3DEC A;  3F2Z A;  4GWJ A;  4CU6 A;  5CYY A;  1I5P A;  1W8O A;  3FHQ A;  2VCC A;  1UYZ A;  2W87 A;  3WSO A;  1PMH X;  1CX1 A;  2Y6H A;  4CVU A;  5HXM A;  2VZV A;  2B4K A;  1K12 A;  5EJ1 B;  3OEA A;  4UI9 L;  5C71 A;  2W1S A;  2QQO A;  2BBA A;  5JMO A;  3VD4 A;  1YQ2 A;  1ULP A;  2Y6J A;  3WNN A;  4E8D A;  3HNM A;  2W1U A;  1JZ6 A;  1UY3 A;  3D3A A;  3C7G A;  2BER A;  4KI5 M;  4ET7 A;  4RN5 A;  2J1R A;  2VTF A;  5IFP A;  2VZT A;  3I2J A;  4P00 B;  5DN2 A;  2J22 A;  2WBK A;  4TXW A;  4JHZ A;  1W9W A;  3C7F A;  1W99 A;  5C70 A;  3A23 A;  1MPX A;  3GM8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...