2HWC1

A comparison of the anti-rhinoviral drug binding pocket in hrv14 and hrv1a
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
273
structure length
273
Chain Sequence
TVASISSGPKHTQKVPILTANETGATMPVLPSDSIETRTTYMHFNGSETDVECFLGRAACVHVTEIQNKDATGIDNHREAKLFNDWKINLSSLVQLRKKLELFTYVRFDSEYTILATASQPDSANYSSNLVVQAMYVPPGAPNPKEWDDYTWQSASNPSVFFKVGDTSRFSVPYVGLASAYNCFYDGYSHDDAETQYGITVLNHMGSMAFRIVNEHDEHKTLVKIRVYHRAKHVEAWIPRAPRALPYTSIGRTNYPKNTEPVIKKRKGDIKSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title A comparison of the anti-rhinoviral drug binding pocket in HRV14 and HRV1A.
pubmed doi rcsb
source organism Human rhinovirus 14
total genus 41
structure length 273
sequence length 273
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1994-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2hwc100
1PO13 4Q4Y3 2QQPA 1GFF2 1VBB1 3TN92 4Q4X2 3ZFGA 1VBC1 1H8TB 1FOD1 1RUI1 1FPN1 1H8TA 2ZZQA 2R061 4FTBA 1RUJ2 1ZBE1 1AR63 1AYN1 1MQTC 1VBA1 1X33A 4RHV1 1F2NA 4IV3C 1HXS1 1VBB2 1AYM2 1MEC3 4JGZB 4PDWC 5CFDA 3DPRB 1VBC2 2R043 1NOVA 4QPIA 1RUI2 4WM8A 1FPN2 3VBHB 2R062 1ZBE2 3VBHA 1ZBA3 1C8NA 1VBA2 4RHV2 3S6PA 2WS91 1FMD1 4RQPC 1RHI1 1AR72 4CEWC 1AL21 4IV1C 5LK7B 4CDQC 1PO21 1QJU1 1R093 4JGYC 1WCDJ 4CDXB 1NCRC 5C9AB 3VDDB 4N53C 3VBFC 2XBO3 1D4M3 5C9AA 3VDDA 5ABJA 1HRV1 1RMU1 5C8CB 2WS92 1VB4A 1OOPC 2RS33 5C8CA 1RHI2 2PLV1 4N43C 1TMF1 1R082 1AL22 1PO22 1QJU2 1PVC2 2RMU3 1ND3A 3M8LA 1RUG1 5L7OB 3VBOA 2HWC1 1POV3 1RUE2 1RMU2 4GMP0 5DDJ3 4YVSB 1E57A 4GB31 2PLV2 1H8TC 1X36A 5D8AB 1TMF2 4YVSA 4FTSA 5D8AA 1PIV1 3HAGA 1BEV1 4CDUB 1RUG2 5CFCB 2HWC2 1VBD3 4CDUA 5CFCA 1Z7S1 2MEV2 2X5IB 2ZTNA 4JGZC 2HWE1 2HWB1 3DPRC 1RUD3 1HRI1 1RVF3 1C8M3 2RS53 4Q4W2 2WFF3 3VBHC 1PIV2 1BEV2 4GMP3 1QQP3 4CEYB 1QJX2 2HWD3 4IV1A 4CEYA 1EV13 1Z7S2 4RFT0 2HWB2 2HWE2 1C8M2 3VBFA 5FMOS 1HRI2 4Q4V3 2RM23 1AR81 1RUH1 1NCQA 4CDXC 5C9AC 3VDDC 3TN93 4Q4X3 3ZFEB 4FTEA 1R1A1 5C8CC 2GSYA 3ZFEA 2BFUL 1RUJ3 3VBOC 1NG0A 1VAKA 1AR82 1RUH2 1NY71 2XPJA 1VBB3 1AYM3 1VBC3 3VBRB 1RUI3 1FPN3 3VBRA 1VBE2 2Y26A 4YVSC 1RUC1 2R063 1ZBE3 3JB8A 5D8AC 1VBA3 2BPA2 4RHV3 1NY72 4CDUC 1FOD2 5CFCC 4JGZA 5AC91 3DPRA 1AR73 4YVWB 2RS11 5BNPB 4YVWA 1TME1 1AYN2 1RUC2 5BNPA 1VRH1 3ZXAC 4RR3B 1HXS2 2WS93 4RR3A 1POV0 5A32B 1FMD3 1BBT1 5AC92 1RHI3 4CEYC 1R083 2RS12 3CJIB 1AL23 1PO23 1QJU3 1PVC3 5J96B 1TME2 2WZR1 4CDXA 3CJIA 3JBG1 4CDWB 1NCQC 1DDLA 1VRH2 1RUE3 1FMD2 1RMU3 2WWSA 1V9U1 1BBT2 3ZFEC 2BBVA 5JZGB 2PLV3 1QJY1 1A6CA 1TMF3 5K0UB 1F8VA 2XBO1 1M06G 2WZR2 1RUG3 5L7OA 1HRV2 1BMV1 2HWC3 1RUF1 5A33B 5BNNB 3VBUB 1V9U2 2MEV3 1AR91 5C4WB 3VBUA 3VBRC 2RMU1 1QJY2 2DF7A 2FZ2A 5C4WA 4Q4W3 1PIV3 1BEV3 1ND2B 1COV1 2IZWA 5ACA1 2TBVA 1QJX3 1RUF2 4GB32 3ZFFB 1Z7S3 1K5MB 2X5IA 1AR92 2HWE3 2HWB3 3ZFFA 4YVWC 1HRI3 5BNPC 1HQNA 4RR3C 1COV2 5ACA2 3J8F1 1PGW1 2WLPA 1ASJ1 3CJIC 1PGL1 3IDEA 1AR83 1CJDA 1RUH3 4Y4YA 2RR11 2HWF1 4NWVA 1EAH1 4FSJA 1EV11 1NA1B 1VBE3 3J8F2 1PGW2 4Q4V1 1NA1A 5K0UC 5L7OC 2BFUS 2R071 1R1A2 2RR12 1FOD3 2HWF2 3JD71 1EAH2 1AL0G 5BNNC 3VBUC 1RUJ1 5BNOB 1PO11 4Q4Y1 1AYN3 5C4WC 1RUC3 5BNOA 3ZFGB 3LOBA 1HXS3 1AYM1 4GH4B 4AEDB 2R072 4GH4A 1ND2C 4AEDA 5AC93 1AR61 3JD72 3NAPB 2X5IC 2RS13 3ZFFC 3NAPA 1PO12 1K5MC 1TME3 3JB4C 4Q4Y2 1MEC1 5CFDB 1VRH3 2R041 4QPIB 4WM8B 1AR71 4WM7B 5A32A 1BBT3 1AR62 4WM7A 1HX6A 4Z92B 1ZBA1 1CD3G 1OPOA 2WZR3 3JBG3 1MEC2 3VBSB 1HRV3 4CDWA 1IHMA 2R042 4RS5B 3VBSA 1W39A 4RS5A 1R091 1V9U3 4QPGB 1R081 1B35B 5JZGA 2BUKA 1PVC1 1QJY3 4QPGA 1D4M1 1ZBA2 5K0UA 3JBG2 5ABJB 1B35A 1NA1C 1VB2A 1RUE1 2RS31 4BCUA 1RUF3 5A33A 5BNNA 1AUYA 4GB33 1R092 1ND3B 1AR93 3VBOB 2XBO2 1POV1 1D4M2 5BNOC 5FOJB 5GKAC 1BMV2 4EJRA 2RS32 2FZ1A 3ZFGC 1ND2A 5DDJ1 2ZAHA 1COV3 5ACA3 4GH4C 2MEV1 4AEDC 1MQTB 1RB8G 2RMU2 4IV3B 1K5MA 1MQTA 3NAPC 4Q4W1 4PDWB 4IV3A 1VBD1 1SMVA 4SBVA 4PDWA 1OHFA 1QJX1 5CFDC 5DDJ2 1RUD1 5J98B 4LLFA 4QPIC 1RVF1 4WM8C 1C8M1 2RS51 4WM7C 2WFF1 3J8F3 4GMP1 1QQP1 1ASJ3 4RQPB 1VBD2 4CEWB 4CDWC 5FMOL 2HWD1 4RQPA 4IV1B 1R1A3 2RR13 4CDQB 4CEWA 2HWF3 4JGYB 3VBSC 1NCRB 2VQ0A 1RUD2 4RS5C 1EAH3 4N53B 3VBFB 4CDQA 4JGYA 1RVF2 1NCRA 5JZGC 2RM21 2GH8A 2RS52 1NCQB 2WFF2 1ASJ2 4N53A 4QPGC 1PGL2 3FBMA 1B35C 1OOPB 3TN91 4Q4X1 1QQP2 4N43B 5ABJC 1OOPA 4NWWA 2HWD2 2R073 1EV12 4N43A 3JD73 1VBE1 4Y5Z0 1QJZA 4Q4V2 2RM22 1ND3C
chains in the Genus database with same CATH superfamily
4P9IA 4Z07A 1HW5A 1PO13 2W87A 2ZEZA 2BNMA 4NVPA 4PIYA 2WZPP 4JHZA 3RPQA 4AI3A 1LHUA 4Q4X2 1MS8A 3NSTA 4KL1A 5FWEA 3SCHA 1C1LA 1ULDA 1FYUA 4L99A 4WVMB 2JDUA 1HV1A 1RUI1 3SCFA 1ZA4A 1W6QA 5I0DA 3NRUA 4Y33A 4ISQA 4XF0A 1ZBE1 4DY5A 5C33A 5G04L 1Q8VA 1MQTC 1YI7A 3OY8A 3PDQA 4HPKB 4FOQA 5F37A 3I49A 2UWCA 3LCPA 3LA7A 3KQRA 3PL0A 4BE3A 2W39A 2WNVA 5FUNA 3VDAA 3BN6A 1D2SA 1NOVA 2ARXA 4NIHA 1TG7A 1ZZBA 1SG3A 2OZJA 5FPBA 2RVAA 4OZXA 1O8PA 5FXZA 3LDBA 2ZABA 3OJBA 1CZTA 1FPN2 3IDAA 4C8DA 2RHPA 1LOBA 2RV9A 3ZSKA 2R062 2W52A 3C8XA 5IUQA 1W04A 2VZ3A 2BNNA 2XVKA 4UBGA 1VBA2 2YU1A 2WT1A 1DHKB 4R4XA 3ZMOA 5DN2A 2GC2A 3POBA 1GWKA 1W2AX 5F32A 1QDOA 2CAVA 3LDRA 2J1UA 4RGGA 1CN1A 3UGGA 2A6YA 3WCRA 1S2EA 3BTAA 3MPBA 3O1PA 4RGAA 1QJU1 1HIXA 1R093 2XUMA 3BYWA 4HN0A 4QX8A 3MV01 5EYYA 4OZOA 3VBFC 4EN7B 2WO1A 2ZACA 3NJZA 2W2IA 1W6OA 2QZ3A 2R1DA 2Y6FA 5JR2A 4HMZA 3VDDA 4LK6A 1HRV1 2GMMA 4IERA 4XBNA 2D3RA 5ABJA 4KWLA 3SKJE 3I4IA 3FHIB 1RHI2 3FE5A 3FX3A 2JG9C 3ECQA 3MIEA 3GJBA 4EV0A 5JCTA 1PO22 1Z78A 1ND3A 2JG8A 5DAQA 3M8LA 5H9SA 2J1RA 2VECA 5CU1A 4BIFA 1V70A 2WSUA 3CJXA 4P02B 2HWC1 3VBOA 3ZSEA 2CWMA 1UZVA 4D94A 2YC2A 1RC6A 4MZUA 3AZVA 1XB9A 2W46A 4M01A 2VULA 2D98A 1F5JA 5DDJ3 1YYNA 3C7EA 1YJLA 4IEOA 2JKXA 4Q0PA 2PLV2 4GJYA 2XMLA 1XNBA 1WCKA 4YVSA 2WDBA 3SH5A 1QOTA 5B2GB 1PIV1 3HAGA 2OUJA 4RD7A 2O8QA 3HN1A 1BEV1 3E5XA 4XIKA 2F6BA 4K1ZA 4XYXA 5F3IA 4QPYA 3CF6E 4BQ5A 5CEHA 4HVQA 4R9CA 4XZUG 1HKDA 2ADDA 4FBFA 3I7DA 5CFCA 1GZWA 2ZGQA 2YB7A 2MEV2 2ZTNA 4JGZC 4OQ8A 2HWE1 2J1SA 1RUD3 3HT2A 3ZX7A 1PM7A 2JX9A 1RVF3 1W90A 4OYUA 1C8M3 2YGLA 4YZ3A 3VBHC 1ULEA 4FT8A 3I2HA 4Q26A 1UU4A 2LTNA 5A7OA 1U12A 3HQRA 4AQSA 5BNQA 5C3SA 1UY0A 2GNMA 1SACA 3WNKA 5EZWA 1SQ4A 3LGRA 2E51A 1KJLA 5IK5A 1IPKA 2HLEA 4PBPA 3TWIA 5KC5A 1CPNA 3ENRA 2HWB2 3RZGA 1C8M2 4TN7A 3VBFA 5FLIA 4JRLA 4IETA 1US3A 4YM1A 3WF2A 2DBNA 1F15A 3OSDA 1QY4A 1Y3TA 1IZ3A 1SLTA 5FYCA 4EN9B 2FDFA 2MPFA 4LBMA 4FP2A 1SFYA 4AHXA 3RGBA 2DV9A 1VMJA 5C9AC 2P3JA 4QM8A 2YC4A 3TN93 4J1XA 3ZFEB 4DUXA 5FBJA 1ZRFA 5C8CC 4FPFA 4O65A 1W0OA 2WRAA 3DV8A 4XJ8A 5GALA 2V5YA 1L7LA 3HMYA 1QOSA 3ZYJB 1KFXL 2BFUL 1O5UA 1RUJ3 2BVVA 4GWIA 4C1WA 3OYWB 3Q8BA 5JSPA 4NMIA 3CZJA 1FNYA 1E5SA 1CPMA 4WVVA 5DABA 3UKTA 4XUOA 5EFUA 1DG6A 3I2GA 3HVDA 3HN3A 3J7MA 4J25A 1OQ1A 3IPVA 1VPHA 3GGLA 4YG3A 2QNKA 3V64A 1RUI3 1JW6A 1GP5A 3M3OA 4S2DA 2IXJA 4HBNA 3VBRA 4HKLA 2DVBA 3INAA 5FO7B 1ZBE3 4X6QB 2V5DA 2VZVA 1J84A 4XHXA 4F7ZA 4KG8A 2VY0A 4FQZA 1W6PA 4YGDA 3P3PA 2WT2A 2XVGA 3U14A 1NY72 4ES8A 3AP7A 1PNGA 5CZKA 2WNOA 4CDUC 2WO7A 5E8AA 3ETPA 4JGZA 3WG2A 5AC91 1KDMA 4Z8BA 1IPJA 3MF9A 1J1LA 5C8WA 2E7TA 1IKPA 2GC0A 2RS11 4MGYE 4K7JA 4LBQB 3T2TA 1PX3A 1RUNA 3N4MA 4Q2FA 5A1LA 5F2WA 3UGHA 3K4ZA 5BNPA 1LGCA 3MZHA 1MVQA 2A6ZA 1OKQA 1ENQA 4BQYA 4R9DA 2XDVA 3TOJA 1SBDA 2VW2A 1POV0 3HBKA 3APBA 1LOFA 1BBT1 1WUVA 4EE2A 2K0GA 2YHJA 2XUEA 2GC3A 1XPWA 5GLTA 4G9SB 5FY7A 3AKSA 1G9FA 4AAPA 1QJU3 4B4QA 1PVC3 1JU4A 1TME2 2WZR1 2E63A 3CJIA 3ES1A 4FCAA 4S2HA 4UAPA 5FZ4A 1NCQC 1AXYA 1DFQA 2VMHA 4A2UA 1RUE3 5JXGA 1RUOA 4QHBA 3B94A 1GNYA 2WWSA 5JOXA 4BMEA 1KFUL 3KSCA 1N1YA 5JZGB 1PZ7A 5FZLA 1QJY1 3NWKA 3RRDA 4P00B 4UFJA 4NUBA 1OBNA 1ZZ9A 4NIDA 1M06G 2RG4A 3UV9A 2B39A 4PLNA 5L7OA 1HRV2 1XNCA 2XB6C 4AVVA 2HWC3 4OHZA 4CP9A 4BOWA 1CX1A 3O1MA 1PZ9A 1RUF1 2WN3A 4FI9A 3K46A 1V9U2 1YRZA 3TEWA 3VZLA 5C4WB 4QB2A 1IG3A 3I54A 5DZGA 5FZMA 5F9TA 2RMU1 1AHSA 1F9KA 4LJHA 2CV6A 5F5QA 2FZ2A 2UY8A 1JOJA 1NXMA 1MACA 1F4HA 2LS6A 1PIV3 1WBFA 1BEV3 3ZN6A 3KT1A 2XHNA 3WY6A 3R4DB 1COV1 2IZWA 4UFIA 1UAIA 2BVBA 2E7AA 4QGNA 3NKTA 2NZ9A 3ZFFB 4GJZA 1HN0A 3AM2A 3KZ4C 4XJWA 3I3DA 5FLHA 4PLMA 1AR92 2HWE3 4UF0B 5D2AA 3ZYHA 1NZIA 2J22A 4LIVA 4YVWC 1OXCA 3UK9A 4XE9A 4XJZA 4P9LA 3VD7A 4COYA 1LJ7A 1OLME 2W95A 4D3WA 1DP0A 1GV9A 3AYAA 1JTZX 1OF3A 3ITQA 3NO8A 5E89A 5FO8B 5CNAA 1O3TA 2VTXA 2JDKA 5LRSA 1ULOA 1OF4A 3ACIA 3N7LA 3ZR6A 3LE0A 4Z2WA 5IK7A 2C0ZA 4COUA 2H0BA 4L2NA 2VCBA 2J1EA 1H1MA 2ZHKA 3I3QA 4XFGA 4KBBA 1I6XA 3PU8A 5H9PA 3RWKX 3N9NA 3NV2A 4QXKA 2Q8DA 3SCGA 4KU7A 1NE4A 1YQ6A 1GP4A 3KM5A 1B09A 4V1PA 1QXJA 2YMZA 1O4YA 2WFPA 5LRRA 1TE1B 4B4PA 4COVA 4CA9A 3ILNA 4LT5A 2QKDA 4JDOA 3N35A 3THDA 4F3JA 4JQRA 1HV0A 3MIFA 1VBE3 3R4SA 4MV2A 1UOBA 4Q4V1 2C5DA 2JDHA 3NV4A 1NA1A 1XNKA 2D3PA 2LUWA 1W9SA 1V6KA 1G7YA 2VW0A 1W3VA 3MIBA 3NVCA 1CIYA 2AREA 2R071 5FKCA 4IGQA 1MZ5A 2RR12 4QQLA 3VHNA 2HWF2 1Y43B 1YWKA 2G1MA 1VMHA 3NQHA 4BYYA 1YIPA 2Q30A 4OLLA 4BMBA 1J59A 1OQDA 3DF0A 1ULGA 1GUIA 3UJQA 1AYN3 1FATA 4E4HA 4JTNA 2EF6A 1YEWA 3JZVA 1UY3A 5DAXA 3ZFGB 3O1TA 3KHCA 1AZDA 3LOBA 4MGSA 3J26N 2Y6GA 1UKRA 4DFSA 3WG1A 5FDBA 3USUA 4OHXA 3MW2A 5FOBB 4AEDA 3EYPA 4HKOA 5AC93 1AR61 4GWNA 2CWSA 2X5IC 2RS13 1ENSA 4EN6B 3B00A 1O4ZA 3H50A 4C0BA 1WLDA 4XFAA 4D7YA 2VMFA 1E5RA 2Z4FA 3NNLA 3WDXA 1TNFA 4ATEA 1R1ZA 1U5IA 1I1EA 3I2IA 3NKGA 3BIEA 4QPIB 4UFLA 2PHTA 1AR71 4M3CE 3AX4A 1BBT3 2XJTA 3I8TA 3ASIA 4BK5A 5IATA 2NP0A 1DF0A 5B4NA 1FV2A 2W68A 4WM7A 2VTFA 2GN3A 1Q43A 1YNAA 1ZBA1 4YNIA 1OA3A 5EPAA 5C7GA 4YM2A 4CUGA 2VNGA 2WAOA 4XF9A 5IVVA 1OPOA 2WZR3 3PU3A 4XXAA 3VBSB 4CDWA 5F3EA 1IHMA 2IXIA 4P5HA 1NQDA 4MX3A 4ZZ8A 3VD9A 4IE6A 2PXJA 1VAVA 1DYPA 3UNPA 1TEIA 4RS5A 1OFNA 1WW7A 4C90A 1QJY3 4QPGA 5E1RA 5FUPA 1ODMA 1UZ0A 1VB2A 3OGJA 4KG0A 2PHWA 4JVAA 1TVGA 2QZ2A 3B01A 1CAWA 3PTRB 2PHUA 4GA9A 2FDGA 1GZ9A 5EJ1B 4A6SA 1RUF3 4WZFA 1DBNA 4DINB 4YGBA 3E5UA 2R1BA 3KQ4B 2JDNA 1K12A 4FO9A 4HN1A 5DXDA 3AZYA 2ARBA 1POV1 4EZ4A 1Q8SA 2EIBA 2VZOA 1DQ4A 5FOJB 3IZOA 1WLWA 4CP2A 2VNRA 2BJSA 2ZGTA 1JUHA 4AVBA 4A6OA 3RZLA 2RS32 4I0WB 1BKZA 1BHGA 1XNTA 4P5YA 4GKYA 4EYUA 1W06A 1COV3 4KMQA 1XYPA 3WDTA 3A0NA 5IT6A 1RB8G 1XBFA 1UYZA 2RMU2 1LOGA 4AE2A 1SCRA 1CAXB 1W6MB 5EYXA 4QX3A 4S2GA 4V2WA 3RNSA 4ZPIA 4PDWB 5A3NA 4HETA 4M4RA 2YUEA 1VBD1 4KGQA 2VR4A 3CLPA 4SBVA 3B3QE 4Q8LA 5LBBA 2QBXA 3POYA 2Q5TA 3MIDA 3WNLA 4QHZA 1DQ6A 5CFDC 2DU0A 4XZPA 2FQPA 4NJ4A 5J98B 3K3NA 4DO0A 3V0AB 2WFF1 4NIIA 3A4UA 2RJLA 2J1AA 3AZXA 4GMP1 3BALA 4PF5A 1AXKA 4E4SA 1UOFA 1QQP1 2GALA 3AMQA 4W6XA 4RQPB 2WBKA 1YUDA 2VJXA 2YU2A 3T2PA 1ZX5A 4CEWB 1UMIA 4A7ZA 4CPBA 4CXXA 4JCKA 3CO2A 2HWD1 5JOWA 4ASMB 2PHXA 1JYTA 1RGSA 4JGYB 4AFMA 4ASLA 2P1BA 2C4XA 3O1OA 4CDQA 3BI3A 1H2LA 1VAMA 1NCRA 2WA3A 5DZEA 1AF9A 1NCQB 2NMOA 1NYWA 3FBMA 1B35C 5GLVA 5IVJA 4Q4X1 3Q8FA 2VZ1A 4MXWA 2BGOA 2AACA 2JDAA 2QVSB 4WVZA 4Q0UA 1OOPA 4NAOA 1H9PA 1RXFA 2R073 1JZ3A 2WWJA 4CP0A 3B93A 1JBCA 4LA3A 5FY8A 1Q56A 1V6IA 1H2KA 3FWEA 1PMIA 2V73A 1XSQA 2RM22 4Q4V2 5FTTC 1MS3A 3LAGA 4DXSA 1G8WA 3DGTA 4UFMA 1H8TB 3HQXA 4L11A 1IKQA 1HB4A 4XJAA 1C57A 4OMCA 1FPN1 3PNAA 2OIIA 5C70A 1CAVB 2E32A 2R061 2EA7A 2ZOEB 4WVMA 3KV4A 1AR63 1L3JA 2HKXA 4DXTA 1WBLA 2B42B 1KRIA 4ORFA 5GZEA 1VBA1 1WMEA 4NE9A 1F2NA 4IV3C 5EIYB 5FY0A 4CZSA 2ES3A 1HXS1 3MLKA 4GWJA 4HPKA 3S57A 1UMHA 1O59A 5CFDA 3DPRB 4I0AA 1OA2A 4CTEA 1JZ4A 5FP3A 1X7NA 1W3XA 4OUMA 2YPDA 3J4UH 2XQRA 4MADA 1O8SA 3I3BA 4Q5OA 3VV1A 2OPKA 4XQ4A 2Y60A 1ZBA3 4PJYA 1C8NA 2YFUA 3AYCA 1NZCA 4A3XA 4YW6A 4CCOA 4XDOA 1FMD1 2Y38A 5F3CA 3OBZA 1LODA 5FZCA 1RHI1 3LDKA 1AR72 2Z2SB 1GQPA 4OVEA 5FP9A 1PO21 3VD4A 2VW1A 2ZHMA 1WCDJ 4QMAA 4CSWA 3GALA 1SLBA 4QQ2A 2D40A 4N53C 2XBO3 2Z79A 3HJRA 4QDRA 2C26A 3AP6A 1VP6A 4H7LA 5KHIA 4Y4RA 4BM8A 4NHMA 3GZUC 4LXLA 4L8QA 4YPJA 1BJQA 2JICA 4P9JA 1N3PA 2YBPA 4EZHA 2VVDA 1IG0A 4I01A 5IYYA 2PLV1 4N43C 1FX5A 3MUY1 3VL8A 1UYYA 1NLRA 2C9AA 2ZAAA 4ZKTB 3CL1A 3EHKA 4JAAA 1GQGA 2JD4A 4PIXA 2PN5A 5CYYA 2X10A 1POV3 2C9KA 4NR1A 2ZKNA 3RVHA 1UZWA 3WDYA 1RMU2 5GLZA 1S1AA 1JODA 4IESA 1JH5A 5FZOB 4AVAA 4FOYA 2BYVE 3WUCA 1QJFA 5D8AB 1TMF2 2D6MA 1CAUB 2PELA 5KHKA 1WLCA 1AJOA 3TEXA 5L9BA 5IAXA 4QKFA 4QAWA 2V4AA 3WCSA 4BQWA 4IGOA 3TB0A 1VBD3 2WNVC 4PBOA 2VZQA 2CGOA 4Q1PA 3M3QA 3FLPA 2D97A 4Y22B 4J1WA 2PHDA 2X5IB 5I0UA 4LLOA 2HWB1 4FQ4A 5AVAA 3FBYA 1XE7A 5I8SA 3QOPA 1UPIA 3KCYA 5FYBA 1NUKA 2WFF3 4PQQA 1P8JA 3LA2A 1LENA 4HOOA 1WD3A 4GMP3 1HB3A 3OCPA 5G05L 4FFIA 4QWNA 1QQP3 4TWTA 3W21A 2FD8A 4TXWA 4CEYB 3H8RA 3ACLA 2HWD3 1NLQA 1GKBA 1EV13 1Z7S2 2A71A 4RFT0 4KNCA 4XBQA 3I2OA 5FMOS 3UETA 3IN9A 5A3OA 3VN4A 2WL1A 4AI0A 1ZM1A 3R6SA 4KGGA 3WF1A 4CDXC 3T4VA 3ACHA 3IMMA 3VDDC 2XL7A 4JQTA 4Q4X3 4QDSA 2R0HA 3B69A 3EMRA 3FJSA 1R1A1 3H7YA 1SLLA 4HKWA 4JDMA 4E9KA 3ZIXA 3LF7A 4UI9L 3ZFEA 4XF1A 1STMA 4GKXA 3AKRA 3I2KA 3OPTA 2QQWA 3OD0A 4WBBA 2CNAA 2JG8C 4X8NA 4Y5TA 3POWA 2ZGPA 4QX1A 1VAKA 3OYWA 3VBOC 4LK7A 4ZU4A 1NY71 4Z82A 2XPJA 1UCXA 2J1VA 1QXPA 4DQAA 4AEMA 1W9FA 4XJ9A 3DUIA 4BLIA 1Y9MA 4CU8A 5CADA 2PA7A 2GZWA 1FPN3 4LHNA 4K9SA 4BU2A 4QGMA 2BBAA 4YVSC 3ILRA 2R063 4MGQA 4HONA 3RYRA 3JB8A 1WW5A 4FPGA 1C3HA 4M3CB 2CL2A 2EXKA 3OGGA 4QT6A 2VZPA 3C7GA 2RE9A 1VBA3 2D6OX 2P37A 1ACCA 3LB9A 3WW3A 2YYOA 3C3VA 3MIHA 4P9YA 3LZZA 2ZKLA 5CFCC 3J7LA 1NQJA 1WMDA 3VHPA 5I0RA 3RZKA 1QH7A 1WA6X 1EY2A 2VZSA 5JVVA 4COZA 2BQPA 2ZX2A 4LULA 3ILFA 2EICA 2DU1A 2BWCA 1SHWB 3H9AA 3RQ0A 5J7MA 3V0BB 1TME1 2A3XA 2EIGA 4ZU5A 4BH9A 2DTYA 2R0FA 2CU5A 4PQ9A 4LBQA 4A7KA 1C5HA 2DFCA 4RR3B 3MDPA 2GU9A 2JB8A 1HXS2 1FI2A 1MZFA 2D93A 3D0JA 5L73A 2V72A 5M0TA 3H8XA 1WWYA 1J3RA 2Q1ZB 4AVCA 2WNUA 5A32B 3ZOIA 4FPYA 1FMD3 4COWA 4DY3A 4HXCA 5GLUA 3SC7X 4XMAA 4IEXA 1RHI3 2CYFA 2ORXA 3ALQA 5FZ1A 4CU6A 4FOVA 1QMJA 4N7UA 1GR3A 4RYDA 5DG2A 4AQ6A 3T0DA 2O8OA 1PO23 5J96B 2GMEA 3JU9A 3BKZA 4CDXA 3JBG1 3WQ0A 2ZGUA 5FUIA 3ZXLA 2HJIA 3F95A 1FMD2 3OUIA 3I2FA 1ODNA 1GNHA 4AQTA 2H0VA 2OT7A 1V9U1 3VUOA 3IM0A 2PLV3 3ZR5A 5JUVA 5JWPA 3WG4A 5K0UB 1UW8A 2E6VA 3RJRA 2DCJA 4QXBA 4C91A 2C24A 4XDPA 1UYPA 1REDA 3WQ7A 1NLSA 3LEMA 3WD5A 4QQOA 4I2OA 4QKNA 2O0OA 4BQ4A 2Y6KA 2X53S 1U0AA 4XABA 4DOUA 1IPSA 3KT7A 1ULCA 1YQ5A 3M4FA 1BZWA 3VBUB 3C7OA 2YBSA 1KXGA 3QLQA 4I3PA 3FLRA 2MEV3 3BPZA 5FZIA 3NNGA 1AR91 5GZFA 3WNOA 1TZOA 2P3YA 3VBRC 3CNAA 2DF7A 2I45A 3HNBM 5C4WA 4AFDA 1K45A 2VTXJ 4AI8A 3TEYA 1RJ7A 4KWJA 5K4LA 2IWGB 5FP8A 1RL3A 3U1XA 4DUVA 4YGCA 5C3OA 5CBLA 4HANA 5CA6A 1OT5A 5CVRA 4YFZA 3ZYBA 2TBVA 3NNFA 3BTYA 5FZBA 4AF9A 4CP1A 2AEYA 3VB9A 3RMYA 1VJ2A 1ZYBA 1SDWA 2HWB3 2Y6HA 1DZRA 4MOAA 3ZFFA 1JYVA 2PFWA 4PI2A 5DG1A 4EWAA 4E27A 4UF0A 2E7QA 2R30A 5BNPC 3W5MA 4YGEA 4GULA 1HQNA 1UL9A 1UN1A 5LCWL 4BXFA 5F5CA 5ACA2 1Z0HA 1LOFC 2G9ZA 1GYKA 1WKYA 4YM3A 4M4PA 4HL0A 2D3SA 1XNAA 2YFZA 4YWAA 1ASJ1 2XQXA 2VQUA 1WGPA 4XJUA 3CJIC 4XUPA 1PMJX 3HOBA 5AVPA 1CJDA 4H14A 4BISA 3EQEA 2RR11 4AVSA 2HWF1 2PMWB 3AB0A 3ME2A 4LA2A 4L92A 3RDIA 4YW2A 2ZGRA 4XURA 5FMBA 2HBTA 4OUEA 3WDWA 2DFBA 2EAAA 4IE0A 4Y1XA 3AJYA 5JI9A 1RITA 4FXKB 1Y7BA 2WWUA 3J8F2 1PGW2 4B3NA 4ZU7A 4NHKA 3NV1A 4XXPA 1F35A 3MFAA 3FUQA 2VMGA 2W08A 2XJRA 4LBLA 5LBFA 5L7OC 5FXWA 2P3KA 5IFTA 4GXLA 1KS4A 1EPZA 1JI6A 3K48A 1R1A2 3V65A 3PVNA 4W8JA 2EXIA 2QJVA 2D6PA 5FK8A 3H7JA 4UW5A 3DYPA 1UKGA 3O14A 5BNNC 2FDIA 2AR6A 4MXVA 1CJPA 4ASKA 1QH6A 2A3YA 5AFBA 5BNOB 1JS9A 1S55A 4PIZA 4CPBD 5BUVA 3N9OA 5FMCA 2OQ6A 3IAQA 1HJGA 3AVSA 5JMOA 1AYM1 4GH4B 4KU8A 4ET7A 4KWKA 2XGXA 5A3LA 1F4AA 3QH6A 1X8MA 3BU0A 1W6QB 2NQYA 2ZZJA 1ND2C 5E88A 5T5OA 3KHBA 3KWVA 2VC9A 3JD72 1HDKA 3H1WA 3NAPB 5FAXA 4AOCA 4DB5A 1UZYA 1CZVA 3OY8B 1H0BA 1FV3A 3T3YA 5KXDA 3ZMNA 4Q0VA 3WX5A 5KXEA 1K5MC 1TME3 3JB4C 4Q4Y2 4UWDA 2VMCA 1OURA 1SBEA 4W6WA 5C3PA 1JYWA 4R9AA 2WYFA 2Z5WA 3KCCA 2BZDA 3Q9OA 2ZA9A 1OH3A 3O0WA 4A41A 1LOAA 5IVCA 1GQHA 1UX6A 1HX6A 1S0GA 3GBGA 3ZSMA 4YZ1A 4I0BA 2ORZA 4I30A 4XAAA 1HB2A 1KEXA 2KM2A 3KLSA 1H4HA 2TUNA 3JBG3 2F17A 4UXAA 1MEC2 2DCZA 1HRV3 2VMIA 3KGZA 1OUSA 3POGA 2OZ6A 2R042 4OI4A 3PJQA 3ZN4A 5FMDA 4NROA 2Y6JA 3VDBA 1W8UA 1GU3A 5A3WA 2PAEA 4Y3OA 3RI8A 3VBSA 4CCKA 3BUCA 1V9U3 4XILA 1R081 2A73B 5FCCA 5T5LA 1RXGA 3FFZA 2VH9A 5CKMA 1BVVA 2R6QA 5FPXA 2JE9A 1MPXA 2ENRA 3JBG2 5ABJB 1NA1C 4PCRA 1ENXA 2WLQA 3BU7A 3KV9A 3O0XA 1VIWB 4GIQA 1QF3A 1PK6B 1VLNA 2PHRA 2RS31 3C2UA 2VBPA 4XBLA 4BA6A 3Q8CA 2V4VA 1H8VA 4IE7A 4A44A 3UT0A 1DQ5A 3P1IA 3A0KA 5A33A 3ZYIB 4U36A 5BNNA 1MZ6A 4DXZA 1SLCA 5A7PA 5FZAA 2VO5A 1ND3B 1OD5A 2JG8B 1UY1A 3KVAA 1H30A 1OFSA 1AR93 3NL1A 3P5BA 1W8HA 3VBOB 1GP6A 1UNBA 3MW4A 1WW6A 2P34A 4MGZE 1RJ8A 1D4M2 1V6JA 4O9EA 5DPNA 2RJ2A 3ON7A 3GZEA 3WP3A 2DBIA 2WT0A 5H9RA 2B9VA 1ND2A 5F1RA 4XQDA 2ZAHA 5L9RA 1SPPA 3K3OA 1DLCA 4AEDC 1MQTB 2WZEA 2HEYF 4IGPA 4URAA 1IGOA 2Y0OA 3LWCA 1RTVA 1W9TA 2AGSA 2XHKA 3OEBA 4Y1ZA 1K5MA 4LO8A 2YROA 1S0JA 4Q4W1 3ZVXA 5T52A 4UW6A 1CAXA 4Y20B 3GYDA 4LE3A 3WQ1A 2XJPA 3DCQA 1ZRIA 4Y5SA 1NAEA 2DWRA 4PDWA 1OHFA 1VRBA 4ZXKA 1QJX1 5C5TA 2QDNA 2VG9A 4HT1T 3TAYA 2VPVA 2HYKA 4AFAA 3HWJA 3H8UA 4WM8C 1CWPA 2V09A 4WM7C 4FXGB 4XTPA 3V0AA 2VUAA 4P08A 5FP7A 1OLRA 3VKMA 5IWFA 2CGPA 4QX2A 1ZRRA 3IMNA 1ASJ3 5FZ3A 2AUYA 1PM4A 1V6OA 2GC1A 4AVTA 4CDWC 4FPHA 3WW4A 5JXIA 4RQPA 3DKWA 4JKKA 3VDCA 5KC6A 1V6LA 2RR13 4CEWA 2HWF3 1OVSA 4NPRA 3BODA 4LE4A 4ONUA 4RS5C 5FKBA 4FPKA 1BK0A 3VBFB 4TLGA 3W5NA 3N9PA 4JGYA 3V56A 3TYJA 2LRPA 2RM21 2GH8A 2RS52 4QPGC 5A1FA 1ASJ2 1ZRDA 4R8HA 3MLLA 4OHVA 5HI0A 3DYMA 3E6CC 2L9LA 4CVUA 5FO9B 3VKLA 5JI7A 1DZQA 1S0IA 3O0VA 3WNPA 1WA4A 2JG9B 4GALA 4NWWA 2TNFA 3D3AA 4UW3A 2ZEWA 5LWBA 3OG2A 4EN0A 3LEKA 1I5PA 1PHMA 3GZTB 4XW3A 5IW0A 3Q8EA 3ZSLA 5FZEA 5ERLA 1MS1A 3ZKUA 1QJZA 1MR5A 4LO6B 1FNZA 1C1FA 3E6BA 2B5HA 2QQPA 1GFF2 4PT6A 4AXOA 4YM0A 4Z2AA 3IBMA 5T5JA 2CHHA 1FOD1 2GAUA 2VL4A 2J42A 3I97A 3TEZA 2JD9A 3FZ3A 3PUQA 1H8TA 3VZMA 2AEZA 1HLCA 4QU1A 4H2AA 2WJSA 4XF4A 1YFXA 2OS2A 5FIXA 1BLZA 1JOBA 1X33A 1LHWA 5C3RA 2ET7A 2LROA 5FPAA 1IQDC 1UXXX 3N9QA 3POIA 1VBB2 1V6MA 1AYM2 1VALA 2B46X 3RFRA 4JGZB 1XXNA 1W9WA 2VVEA 1VBC2 4W65A 3SISA 1DCSA 4LUMA 3LIGA 4NO4A 2QTWB 1XQNA 5FY9A 1O4TA 1ULPA 4JZRA 4WM8A 1Y4WA 2DDUA 3VBHB 4PHZA 4XAEA 1E5IA 5SV8A 1GWLA 3MPPG 3OEAA 4RSUA 3FL7A 2IXKA 4AI2A 1DLLA 3ATGA 3X29B 3DXTA 3OGVA 3WNNA 2WNEA 2XWJB 4RHV2 3S6PA 1YCIA 1LULA 2W1UA 1GMMA 2ID4A 3D0SA 3LPGA 3RJ2X 2UU8A 1JZ7A 2ZBJA 5FR3A 5I0TA 1S4CA 4HVRA 3VZKA 1YLLA 1W8WA 3KD4A 3DYOA 4IV1C 1S0BA 1XYNA 2BERA 4AHWA 3POFA 4CDQC 4W4ZA 5GZGA 2Q1FA 3AMMA 1NCRC 1JYXA 2PTMA 5C9AB 2XG3A 3RYKA 2Y33A 3HNMA 1ULFA 4DIQA 2GNTA 5A7WB 4IEYA 4YZ4A 1RMU1 5C8CB 3PVEA 3PLQA 2WS92 3ZXJA 1OOPC 2GDFA 3QCWA 2RS33 4D69A 2SBAA 1U5XA 2WSVA 4FFHA 5C71A 1XRUA 4UBHA 1I5ZA 1PGSA 1W6NB 2CDOA 2JIGA 1TMF1 4CU9A 4CXYA 1R082 1SLIA 4MGTA 1AL22 1S0DA 4XFHA 5I8TA 2Q0AA 2IXHA 5GZCA 2P2KA 4U2AA 3AVRA 2RMU3 4LBQD 4CYDA 3VL9A 1S0CA 2D5HA 2QQOA 4BXSV 4K1YA 5L7OB 5I0SA 1DZTA 5LEKA 3WV6A 4PI0A 1LU2A 4A7YA 3K2OA 2UWBA 4HZFA 4DXRA 2VM9A 3SNMA 2RDNA 3ETQA 3H1MA 3GBWA 1JZ2A 4GB31 5FQ0B 3VKNA 1NT0A 2VAUA 2D6KA 4ITCA 2EXJA 4QPWA 1UY2A 4FTSA 2XH6A 4V2VA 5D8AA 1JZ5A 4EWDA 5FZ8A 4K8FA 3CDZB 5D21A 4CDUB 1RUG2 3JUUA 5EXOA 1OPMA 3PUSA 4YG6A 1V6NA 2ZJCA 2ATFA 5BYNA 4XACA 2DUQA 4CCLA 3K4AA 4LTAA 4M00A 3KGLA 1Z7S1 3PHMA 4CCDA 4URTA 5FYUA 4QKBA 5FPVA 4N9HA 1TNRA 2I2SA 2QQNA 2WKKA 1S2KA 3B5LB 1UPSA 4OUSA 4Q4W2 3LOIA 5CISA 2DVAA 3HQUA 3O1VA 4WVWA 3BCWA 4QXHA 2NM1A 1OKOA 1QJX2 3JQWA 4AK3A 2FDKA 2W94A 3SEEA 4NAMA 4IV1A 3ELNA 4BIOA 4CEYA 2VUJA 2DVGA 1UF2C 5F7UA 3HBZA 4HFSA 1REFA 1HRI2 5KHHA 4Q4V3 2K9ZA 2RM23 3ZXKA 3O1SA 1MZEA 3ACFA 5T5PA 2Y0IA 5FYIA 2UY9A 3KCXA 4PLOA 2R32A 4NHXA 1GICA 3VKFC 2BEOA 2VQAA 4M3CF 4X6RB 4IUGA 3L9JT 5LB6A 1ZZ7A 2GSYA 2YPJA 1DGWX 2A6VA 1Y9QA 3CEWA 3CZUA 3ORJA 2TEPA 5A3UA 4IEUA 2RDQA 3HR9A 2VGDA 3G7DA 4JHTA 2VZRA 1MS9A 3PUHA 2CGNA 1AR82 1RUH2 3O12A 1DGWA 2FMYA 3ZLIA 4K21A 3ZXEA 2DVFA 3VD5A 4NOTA 1Q8QA 4AL9A 4E2SA 5FLJA 2AZ5A 2A6XA 4JDNA 4FAHA 1AJKA 4EROA 1LU1A 2ZMKA 3OPZA 5BV6A 5JSOA 5T3NA 2Y26A 1URXA 1EPWA 3GHNA 4MG2A 4MUVA 3ZXDA 3ABZA 5SV5A 1W2NA 4NPLA 2XXZA 4M0HA 4RFRB 3SHRA 3TRSB 2VE1A 4QDQA 4LKSA 3WF0A 4LIUA 1FOD2 3USUB 5FXVA 2YZ4A 4BQ2A 1WLTA 5FY1A 5TSWA 1EUUA 1AR73 2HYXA 3MUZ1 3KF5A 3WF3A 4CCNA 4YVWB 4AI9A 3T4HB 3SH3A 1RIRA 2H6CA 3JCIA 4IE4A 2VU9A 1RUC2 3MGUA 3WXPA 4XOGA 5JMCA 3ZXAC 4AZZA 3V0BA 1ZNPA 4GQ7A 3E5QA 1YIFA 5GJ6A 4EQVA 3ZN5A 1WW4A 2VOKA 3LEIA 4RR3A 4IEZA 5CIRA 1DIWA 3RS6A 3U4SA 1LHVA 5A1AA 5FYTA 1N1SA 5EJ3A 2IXLA 2OUHA 4CUCA 1JU3A 5HCHA 2OA2A 2NMNA 4S2FA 4AEJA 2DCYA 1Q5OA 1XU2A 4YW4A 4AI1A 3PTYA 5ANNA 2WABA 3R0RA 4CDWB 1WCQA 3LSEA 2ZGNA 4DRVA 1DDLA 1VRH2 4OULA 2Y8KA 1Q8OA 1LHNA 1RMU3 2K46A 3DN7A 4M0NA 3S5QA 3WR0A 2R49A 3IDCB 2XKOA 5FREA 3W59A 1O91A 3THPA 3ZFEC 4R52A 1YFYA 4OI2A 2BBVA 3AC0A 3T30A 1A6CA 1TMF3 2ZX1A 1YC61 3AL5A 2DYCA 2QQKA 1SLAA 1LEDA 3GJAA 5LASA 3C7FA 4QGLA 4H7MA 2G4IA 4JX0A 2PQQA 1YQCA 3SXWA 1CAWB 4TLFA 4D0QA 4C1XA 1RYYA 5IK8A 2NPIA 5I93A 4E4DX 3ZXGA 4CCCA 3S5AA 2CSGA 1GWMA 2X09A 3G6JB 4IXLA 3IKWA 2WO3A 3ZKYA 4B29A 2YXSA 5LEJA 4QX5A 1WD4A 3PUIA 3VBUA 1LAJA 1GLHA 3NNJA 4XHBA 1LKNA 2R7EB 2XJVA 5F3GA 4AGGA 3T1MA 2EIDA 1XYOA 4META 5GLWA 5A3PA 5I8YA 1REEA 4AR2A 1JHNA 4LKFA 3KB5A 4AW7A 4BQXA 4CCMA 3M1HA 5ACA1 4XFFA 1GANA 2CDPA 3ZYGA 4GB32 1F5FA 3ZYRA 1Z7S3 1J3PA 1J1TA 1C5IA 3MICA 2R16A 3IAPA 1W2TA 2C1FA 4TYSA 1NXD1 3O1UA 4IEWA 4QB1A 5FYHA 3B9CA 4UFKA 2C6SA 4XDQA 3NJXA 2YDEA 2ZGSA 1ZZ6A 2MNGA 4AGRA 4AEKA 3M3IA 3VHOA 5KXBA 2WNUC 1G9AA 1S0EA 3GM8A 3O1RA 4N90A 2P4EA 5IVYA 4ARXA 5CKNA 3LQCA 5T50A 1N1TA 1DQ0A 2BOJA 3I3EA 1W28A 3AP9A 4CU7A 4HLTA 1UZZA 4XUNA 1U5ZA 2RJKA 1PGW1 1QXRA 1Y9GA 2VOWA 2WLPA 3J8F1 4QU2A 2ZS6B 4LO5B 4DPNA 3IDEA 4Y4YA 2O1QA 2E53A 3OF1A 3ST7A 3MYXA 4LQRA 4LBJA 3KMHA 4HSJA 4BQ1A 4NHLA 3WOGA 2ILMA 5JIAA 5JSRA 5FYYA 4D8MA 1O3QA 5KR7A 1N3QA 1T2XA 5LA0A 2DUOA 4WZCA 3K77A 4L97A 3UGFA 4NRMA 2JKBA 1JYNA 1W8TA 5CG9A 2HEVF 4BB3A 4YW7A 3WW2A 5FPLA 2XR4A 3TNPB 4LHSA 1K3IA 3MHZA 3OB8A 3U75A 3IIAA 3BPSA 1JXNA 3AZZA 1LOEA 2ZX0A 2BFUS 3K4DA 5IAVA 1ZZ8A 3TBDA 2IVIB 4IL7A 4JV4A 1UQXA 1O3RA 4O7XA 3JD71 4AGVA 1EAH2 5C5UA 1AL0G 2WQ4A 3H42B 3BTXA 4NPMA 1RUJ1 1WCSA 1JUIA 3AYDA 2UYAA 3VD3A 1CONA 1JN2P 4Q4Y1 3AK0A 4Q8KA 5C4WC 3BIWE 1KQRA 5BNOA 5J37A 1YFWA 2AC1A 3E97A 3ACGA 5KWRA 4K20A 1CGPA 3AFKA 1HXS3 3AMHA 3J7NA 5DAWA 4BLJA 3IT8A 4GH4A 2XLFA 1M4WA 4YRDA 2ZEXA 3KS7A 4LR4A 1H2MA 4UYBA 1UIJA 5JR7B 5CKQA 3EBRA 2XLGA 1O6UA 2GNDA 3MFCA 4J6GA 2QFEA 3ZFFC 3NAPA 5FYVA 1PO12 2ARAA 4KQ7A 1OUXA 2ZGMA 2Q8CA 1MEC1 3NJYA 4Q1RA 5CFDB 2I74A 1US2A 3JXSA 2YV8A 2R041 2GH2A 1QKQA 4FFGA 3D4KA 3T0AA 5FV3A 1Q8PA 4LITA 1V00A 3B02A 3BOWA 2VOVA 5FRAA 5EJZB 4GWMA 5FZHA 1XU1A 4IDZA 5GZDA 4YZ2A 2BNOA 1ZZCA 5DZFA 2D44A 4XFCA 1ZRCA 3NW4A 2NLRA 2ZGOA 1JZ6A 1CD3G 1G9DA 4N7IA 5J09A 1YXWA 1W05A 4OHYA 2N7GA 4F83A 4BK4A 5FZ6A 3T09A 3FFQA 1G9BA 2GP5A 5JLVA 4GD4A 1UO9A 1B35B 2JJ6A 3MI8A 5JZGA 1PVC1 1D4M1 3FUOA 5B4XA 2Z42A 2JIJA 2UURA 1RUE1 1UU6A 4JKLA 5FZFA 1MVEA 2G9FA 4HK9A 1LESA 3W58A 1D4VB 1PK6A 1IS3A 1MS5A 3GCWA 3OBTA 4FP3A 1R092 2YC0A 3AKPA 2A70A 5DAPA 3PVOA 4Q0QA 1YJKA 3DEMA 4L9BA 2AENA 3QD6A 2QQLA 3FMGA 2W1WA 1YFUA 4ATFA 2VMDA 1H1IA 3B9IA 3KVBA 4CUAA 4XC9A 1IS4A 2FZ1A 3ZFGC 4LBNA 5CAZA 3H1YA 5K7PA 5ACA3 3BGAA 2OKXA 2O14A 4QHOA 4I3GA 2X05A 3WP5A 2XOMA 3ZDSA 4IV3B 1OLQA 2WO2A 3VGIA 5HXVA 1IOAA 3A7QA 1MQTA 3UYJA 2LALA 2UYBA 3H0OA 1HB1A 1CIWA 1YQ2A 4CUBA 5DUXA 2A5ZA 3FHAA 1SMVA 3U0ZA 4LKEA 1KITA 4XEZA 3KT4A 1QNWA 4Y20A 3Q8AA 2BW8A 4LORA 4XCAA 5DDJ2 3W20A 3RZMA 1JOPA 2CY6A 3LIHA 5AFEA 4LLFA 4QPIC 5E16A 2RS51 3L2HA 3J8F3 3VLBB 4B1LA 2BTVC 3OOXA 5EWSA 3HD8B 5LATA 5LA1A 5FMOL 1HQLA 1KDKA 1R1A3 3LSDA 4A3ZA 3VBSC 1QDCA 2E9QA 4DNYA 2YY1A 1RUD2 1X9PA 4IEQA 4N53B 5FYMA 1AVBA 2W1QA 1RVF2 3I59B 5LY2A 2ERFA 2PHFA 2Q8OA 2XJUA 1G86A 1QGLA 1OMIA 2W0XA 3U11A 4N43B 4XUTA 2F4PA 4IW3A 4NRPA 3M70A 1WMFA 4Y26A 1A8DA 2DUPA 3CBNA 5A6QA 1LGNA 2JG9A 4MVTA 1J83A 3JD73 2WYSA 2FDJA 4XMIA 1W2UA 3RMXA 3ZSJA 1VBE1 5FJKA 2OPWA 4D7TA 3OGRA 4ZZ5A 2KXLA 5C6CA 4RA0A 5T55A 4Q4Y3 2OQ7A 3S7EA 1VBB1 3SQOA 2WZ8A 3TN92 4KBZA 3BVCA 3POSA 3ZFGA 1VBC1 3SLIA 1JHJA 3WG3A 2FCTA 2WA4A 3GF6A 3P6BA 1X50A 4FPEA 3LKJA 3T08A 1ZA7A 4LNVA 2ZZQA 1QNYA 1GZTA 1KS5A 2CAUA 2VMEA 1OC1A 1RUJ2 3AP5A 4FTBA 1W8ZA 4DZGA 1RINA 2J1TA 3DXUA 3K51A 3U37A 1AYN1 4XPVA 4AHYA 2WNVB 1GOGA 4RHV1 4W50A 1WCUA 4N8MA 1GZCA 3WP4A 3SKVA 1VR3A 1MEC3 3D5OA 1OI6A 4MO3M 3AMPA 4PDWC 1KJRA 2BU9A 2J7MA 1NE6A 2R043 3O7OA 4BZ4A 5BXXA 4QPIA 1RUI2 5FZ0A 1JZ8A 4YW5A 4XFIA 5JAXA 3A22A 5JDBA 2QQVA 3DKQA 3WNMA 1ZBE2 1CR7A 4LKDA 3VBHA 3DECA 3ZM8A 3BOPA 3M3EA 2WNUB 2WS91 5DQ0A 1T6GC 2IFWA 4H55A 1JMUB 4MHUA 4RQPC 2ZGKA 2Y64A 2OVUA 4MYEA 4LEJA 4CEWC 4Y1YA 5DMYA 3MW3A 1AL21 4BJ0A 5LK7B 3USSA 2PYTA 3CQOA 5ANQA 1W6OB 4JGYC 4CDXB 3VDDB 3LFMA 4NIGA 1A34A 3IB3A 4AQ2A 1D4M3 2WAAA 5A7QA 1O3SA 5JOZA 5C9AA 5ISLA 5EQUA 4BDVB 2JE7A 1VB4A 3UL2A 5A7WA 3SEPA 5C8CA 3HEIA 4IEPA 4DEQA 2BGPA 1GSLA 2OX0A 5FK7A 3PURA 4YLZA 4HVOA 1CX4A 5D1IA 1U5YA 3E6DA 3ES4A 3OUHA 4XVHA 2WINB 1W6NA 1QJU2 2A1XA 1PVC2 4D6SA 3PIGA 4FVVA 2JXAA 1RUG1 2JDMA 5IJRA 4YSFA 2BGCA 2VBDA 1RUE2 2B45X 3T0BA 4DEVA 3OGSA 4ARYA 4I02A 3EB7A 4GMP0 1J3QA 4YVSB 1E57A 3E1F1 3N9MA 4TSVA 2WR9A 2FDHA 1H8TC 1X36A 1WZXA 1UX7A 1YHFA 2DCTA 1T6BX 2JECA 2VNVA 3GBFA 4GZ9A 4P14A 5FQ0A 2ARCA 4UT5A 3EO6A 2YG0A 2VZTA 3D6EA 5K8SA 1W6MA 3WEZA 5DAVA 3R05A 1GZWB 5CFCB 1FAYA 2HWC2 3PMEA 4FPCA 4N9IA 4NHYA 3NMBA 4UOJA 1IS5A 4CDUA 2Y34A 3GXUA 4Y1VA 4QX7A 4UFHA 5FBZA 4BWOA 1GNZA 3DPRC 5FZ7A 4IQPA 3F2ZA 4G4FA 1HRI1 4LHLA 5HCBA 2RS53 2P3IA 2KD7A 1ZVFA 1PIV2 4ZY9A 1BEV2 1YI9A 3AKQA 1GOHA 5IK4A 3WLUA 3WF4A 3U10A 3AP4A 2VQTA 3LD8A 1DYOA 4HSLA 1GOFA 2VVFA 3EJKA 4LBKA 3RG0A 1VMFA 4IEVA 3H3LA 2ZMLA 2HWE2 3OUJA 5FZGA 1LCLA 2HEWF 4BQ3A 2SLIA 3MEPA 4C0HA 1POQA 1QEXA 1D2QA 2F4LA 1MS0A 4LOTA 1AR81 1RUH1 1NCQA 2BV4A 4Z1VA 3AXEA 5FP4A 2ZCWA 1K5JA 4LOSA 2ADEA 4B1MA 2E26A 5F8PA 4IE5A 1SFPA 4FTEA 4FPOB 2QUOA 1OVPA 3D82A 1IS6A 3GDBA 3ZPYA 5I91A 5JPMB 2PAMA 3M7AA 3N7MA 4LUKA 1EUTA 4XUQA 3FC0A 3T2QA 5CB7A 2VBBA 2XKPA 3A23A 3DL3A 2BDRA 1VE0A 2LM3A 1PNFA 2PHLA 3AKTA 3H3UA 4HG6B 4KH9A 2FBEA 1QU0A 3AZWA 5KHJA 2X8KA 1NG0A 1H9WA 2FCVA 3FN9A 4HK8A 3RSJA 3IPVB 1LHOA 1VBB3 1AYM3 1N1VA 4ZS3A 3FHQA 5HCAA 5HV0A 1VBC3 1ONAA 1D0GA 2DCKA 2P17A 4XETA 3VBRB 2RDSA 5E6HA 3RZZA 3BTZA 3UKNA 3N36A 1KGYA 1Q3EA 3BB6A 4JRAA 1UMZA 2NN8A 1NX9A 2QE3A 2W5FA 5FZKA 1VBE2 1CAVA 1RUC1 4LO4B 1W6PB 5D8AC 1XSRA 2JDYA 1XC6A 2QQIA 4AAXA 2XVLA 5HV4A 1MS4A 3I2JA 2BPA2 2PQSA 5HPOA 4RHV3 5JOYA 2ET1A 3N7KA 3ROUA 3ZO0B 2IVJA 2JEMA 3DPRA 4G3YC 5J3UA 2A75A 1YO8A 1DYKA 4XCBA 5A6YA 3N7JA 5JPNB 5BNPB 2CTVA 4YVWA 1AYN2 3C7HA 4JTOA 4XF3A 1N47A 2EIEA 1VRH1 3MLJA 3WUDA 4X8PA 5FXXA 3AMNA 4OHWA 3CMGA 3KF3A 3WVJA 3UKVA 1O7FA 2G19A 2WS93 4NRQA 4YW1A 4WV8A 1OH4A 1EP0A 2P6CA 5DUVA 5AC92 4CEYC 1ENRA 2VOXA 1R083 2RS12 3CJIB 1AL23 3K75B 1KD7A 5FYZA 3WP6A 5LY1A 3LA3A 2K2SA 3T1LA 1UYXA 2E33A 3PUAA 4MLOA 4Y1UA 5IVBA 4O61A 4P9GA 4UW4A 3RZHA 2P6HA 3IWZA 4YYOA 3FLTA 3MBWA 2GMPA 4DRRA 3J9SA 4I09A 2W91A 3S7IA 3QBQA 3NV3A 1BBT2 3THCA 1LTEA 4CXWA 2E31A 4R4ZA 1LEMA 2RDRA 5GM0A 2Z69A 1LB2A 4RN5A 4D6QA 5LW9A 4AYUA 1F8VA 2XBO1 1DGRA 4Q29A 4CP9B 4MH0E 2WZR2 1RUG3 4EWEA 1BCXA 1BMV1 4AFCA 1W8NA 1GBGA 5K9YA 2WUHA 2DURA 5A33B 5BNNB 5APAA 2PAKA 1SBFA 3J7HA 3OTFA 5FZOA 4OMDA 2Q8EA 3RI9A 1OLMA 4E4ZA 1AX2A 1QJY2 2KR2A 2X29A 5DUWA 3ZN6B 5BY5A 4RGKA 4D6RA 5L36A 1CAUA 5LBEA 4E8DA 1K42A 4O9GA 4Q4W3 1OD3A 4OFGA 4P9XA 4H3WA 5A7NA 2B8MA 4DUWA 2WQ8A 5HXMA 1ND2B 1SCSA 5IHRA 5HCFA 1SPPB 1QJX3 3EXUA 1RUF2 5KXCA 3KV6A 3WSOA 3AL6A 1TQ5A 4CCJA 4Y22A 3LEGA 1K5MB 2I07B 2X5IA 3VZOA 2Y6LA 4EN8B 1DGRN 4Q27A 2EALA 3R4UA 1APNA 1UOJA 2UWAA 5FPZA 1HRI3 2W1SA 2ZGLA 1UIKA 2OXBA 4MSVA 4CE8A 2JENA 3H3ZA 1WMXA 2YGMA 1YQ8A 2D5FA 3AFGA 1I9RA 2OW4A 3PMSA 4ZS2A 5CG8A 2WQZC 4AFBA 5BPXA 1FXZA 4RR3C 5JXHA 1COV2 4F8AA 1DQ2A 4QQHA 1CZSA 4R9BA 5LA2A 2YBKA 3RWNA 3OBRA 2IUWA 3SMHA 3WW1A 1HN1A 2JDZA 3L2YA 5H9QA 2OYZA 5FPUA 3UESA 1D0HA 5LA9A 1PGL1 2FHRA 1F31A 2IFRA 1AR83 1RUH3 1AX1A 3PVBB 1W8OA 4PF1A 4YARA 2H6BA 4TZDA 3WHTA 5J1XA 3RZJA 2GNBA 4NWVA 1ALYA 1EAH1 1DU3D 1EV11 4FSJA 1PZ8A 2XWBB 4KWUA 4QM9A 5A70A 1NA1B 1X82A 2AYHA 1BVP1 4YFWA 5KHGA 1XE0A 1H1AA 1BQPA 3AYEA 2GN7A 3PJYA 1A78A 1E5HA 1ST8A 5K0UC 3S0MA 1EYBA 2B4KA 1UD1A 2A7AA 5FY4A 3VZNA 1L7QA 5L19A 2VXRA 5EP9A 3CIHA 1FOD3 4TTGA 1G6NA 2ZEYA 1S2BA 1HQWA 2ZMNA 3VBUC 4A45A 1SZBA 4YG0A 1PO11 5F2SA 2Q1MA 1RUC3 3MIGA 4L0PA 3U07A 4AWDA 1PVXA 3SITA 2G9GA 3GZAA 4M3CA 4CRQA 1LR5A 5J36A 3VZJA 1W03A 2VUDA 2B9UA 2FCUA 5EV7A 4DS0A 1A3KA 4AEDB 4A4AA 2R072 4B7KA 4D7SA 1W0NA 4XIOA 2ZHLA 2VZUA 2VNOA 4A42A 3I2DA 4K6BA 4K3UA 1SEFA 4QD2A 3OD4A 1NKGA 1XE8A 4NN0A 2D43A 1W2OA 3SH4A 4QXCA 3CHXA 3NNMA 1W99A 1J58A 3POJA 2VCMA 3POEA 4GAZA 4B4RA 5C3QA 3I3MA 2LW8A 5A3TA 2ZX3A 4YW3A 2WN2A 1CVNA 1C4RA 3CKHA 3LPFA 4ZXEA 5HBAA 1VRH3 5JIUA 3P3NA 2ZXQA 1DGLA 3GHMA 4MGKE 1LECA 3GNEA 4KI5M 3LFIA 4WM8B 4WM7B 5LK5A 4YZ5A 5A32A 5L9VA 4QKDA 2VXJA 1H6YA 4E2QA 2MHFA 1AR62 2XLAA 4MGIE 4K8RB 1OSGA 1PMHX 2VOTA 3D8CA 4B7EA 4Z92B 2JE8A 2FMDA 1AXZA 1BYHA 2ZHNA 3H8OA 5FFOC 2P5BA 3NJVA 1HJFA 4BPZA 4BHPA 1QJEA 5F6LB 2IC1A 5A7SA 1W8FA 2VUCA 4RS5B 1XNDA 3MV11 3URFA 2B7YA 3WINE 3WNXA 4QX0A 1W39A 2BRTA 1R091 3GCXA 4QPGB 4Y24A 5KBFA 1A8MA 5IVEA 2NYYA 2BUKA 4E2GA 1ZREA 1OQEA 5K0UA 1ZBA2 1W0PA 1UOGA 4XTMA 2VCCA 4K40A 5A80A 1B35A 4INDA 3THTA 3IIIA 4E8CA 5J48A 3VKOA 1CQ9A 2IXCA 4QQPA 4OQ9A 5FZ9A 3IDBB 1X8EA 1X9TA 2ETEA 3A21A 4BCUA 5A3MA 2HBUA 4LMFA 1AUYA 2BOIA 2W47A 2WIIB 4GB33 5FY5A 1XJAA 2XONA 3S30A 1UU5A 3WZ1A 1H6XA 4LO7A 4XFBA 2QDRA 2QQUA 2XBO2 1SFNA 3WDUA 4CCEA 1XOYA 1SDDB 1QHDA 5BNOC 4LPLA 5FZDA 5DUUA 2EAKA 2EVXA 3M3CA 2QCSB 1UWWA 3AJZA 4OCTA 5GKAC 4EJRA 5F5AA 3N9LA 1BMV2 3HT1A 3MO4A 2KA3A 1LRHA 1V0AA 3PIJA 5DDJ1 2QQJA 2D6NA 4RL7A 4JC1A 3VHRA 3T2OA 3ZIWA 4GH4C 2MEV1 5FYSA 1AX0A 4FPLA 4NIAA 1LGBA 3ZDVA 2XJQA 2A3WA 5T54A 3MF6A 1I3HA 4XQWA 2WC2A 4JKMA 3NAPC 4B8EA 3QACA 3M2MA 4IV3A 2XJSA 1LOCA 1QIQA 1OA4A 1H2NA 4FPJA 3WQBA 2QQMA 2W9XA 2JWPA 3TNQA 5FWJA 3O5SA 1BXHA 1O5LA 3WDVA 3ZYPA 2VD7A 2EXHA 1UY4A 3B7MA 4OI0A 2DTWA 3U4XA 1RUD1 1BK1A 3HIFA 2D7FA 1IQAA 2DVDA 1RVF1 3U78A 2ZX4A 5IFPA 4ES9A 1C8M1 1S0FA 4W6YA 5F5IA 3QH7A 1QWRA 4QB6A 5IVFA 1FT9A 2XL9A 1LNSA 3HNYM 5JXJA 5F6KA 3ZYFA 1C28A 1UXZA 1VBD2 3HPNA 3KV5A 3CU7A 3OPWA 4DMIA 5A6XA 1QOOA 3N3HA 2ZPXA 4FOWA 2D6LX 4IV1B 2BP6A 4FAGA 1JYIA 3JQXA 4CDQB 4ZHNA 4ISRA 5LBCA 3AXDA 4P9WA 1NCRB 2VQ0A 1JYCA 3UJOA 1EAH3 4AG4A 1N3OA 1W9YA 2VCAA 3WHUA 2GP3A 5JZGC 1R64A 2WFF2 4MXWB 2Q4SA 4N53A 1D7PM 1CESA 1PGL2 3ZXFA 1OOPB 3I59A 4ZONA 4OI1A 3TN91 4AHZA 1QQP2 2W3JA 4MHRA 3RYPA 3ZPOA 4SLIA 2BWAA 5ABJC 1G9CA 2JDPA 1DQ1A 2AH2A 4LHKA 4Q0SA 5EHDA 2JB4A 2HWD2 2W92A 3WT3A 3OBAA 1PK6C 1EV12 2HH9A 4N43A 5FJHA 5LZ6A 4LBOA 1H4GA 1L7RA 2A6WA 5F39A 4Y5Z0 1PX4A 3W9AA 5A6ZA 4FFFA 1ND3C
chains in the Genus database with same CATH topology
4P9IA 4Z07A 1HW5A 1PO13 4PIYA 2WZPP 2BNMA 4NVPA 3RPQA 3S7EA 3VZLA 4AI3A 1LHUA 4Q4X2 1MS8A 3NSTA 4KL1A 3SCHA 1C1LA 1ULDA 1FYUA 4L99A 4WVMB 3SCFA 1HV1A 1RUI1 1ZA4A 1W6QA 4ISQA 4XF0A 1ZBE1 4DY5A 5C33A 1Q8VA 1MQTC 1YI7A 3OY8A 4HPKB 4FOQA 2UWCA 3LCPA 3LA7A 3KQRA 4BE3A 2W39A 2WNVA 1D2SA 1NOVA 2ARXA 1ZZBA 2OZJA 4OZXA 2ZABA 3OJBA 1FPN2 2RHPA 1LOBA 3ZSKA 2R062 2W52A 5IUQA 2BNNA 2XVKA 4UBGA 1VBA2 2WT1A 1DHKB 4R4XA 3ZMOA 2GC2A 1QDOA 2CAVA 4RGGA 1CN1A 2A6YA 3WCRA 3BTAA 3MPBA 4RGAA 1QJU1 1HIXA 1R093 2XUMA 4HN0A 5EYYA 3VBFC 4EN7B 2ZACA 3NJZA 1W6OA 2QZ3A 2R1DA 4HMZA 3VDDA 4XBNA 1HRV1 2GMMA 4IERA 5ABJA 2D3RA 4KWLA 3I4IA 3FHIB 1RHI2 3FE5A 3FX3A 2JG9C 3ECQA 3MIEA 4EV0A 5JCTA 1PO22 1Z78A 1ND3A 2JG8A 3M8LA 5H9SA 5CU1A 2VECA 4BIFA 1V70A 2WSUA 3CJXA 3VBOA 2HWC1 3ZSEA 2CWMA 4D94A 1RC6A 4MZUA 3AZVA 4M01A 2VULA 2D98A 1F5JA 5DDJ3 1YYNA 4IEOA 1YJLA 4Q0PA 2PLV2 1XNBA 1WCKA 4YVSA 3SH5A 1QOTA 5B2GB 1PIV1 3HAGA 2OUJA 4RD7A 2O8QA 3HN1A 1BEV1 3E5XA 4XIKA 2F6BA 4K1ZA 4XYXA 4QPYA 3CF6E 4HVQA 4R9CA 1HKDA 4FBFA 3I7DA 5CFCA 1GZWA 2ZGQA 2MEV2 2ZTNA 4JGZC 2HWE1 1RUD3 3HT2A 3ZX7A 1PM7A 2JX9A 1RVF3 1C8M3 2YGLA 4YZ3A 3VBHC 1ULEA 4FT8A 4Q26A 1UU4A 2LTNA 1U12A 5BNQA 4AQSA 2GNMA 1SACA 5EZWA 1SQ4A 3LGRA 2E51A 1KJLA 5IK5A 1IPKA 4PBPA 3TWIA 5KC5A 1CPNA 3ENRA 2HWB2 1C8M2 3VBFA 5FLIA 4JRLA 4IETA 4YM1A 1QY4A 1Y3TA 1IZ3A 1SLTA 4EN9B 2MPFA 4LBMA 4FP2A 1SFYA 4AHXA 2DV9A 5C9AC 2P3JA 4QM8A 3TN93 4J1XA 3ZFEB 1ZRFA 5C8CC 4FPFA 1W0OA 3DV8A 4XJ8A 5GALA 3ZYJB 2V5YA 3HMYA 1QOSA 1KFXL 2BFUL 1O5UA 1RUJ3 2BVVA 4C1WA 3OYWB 5JSPA 1FNYA 1CPMA 4WVVA 3UKTA 5EFUA 1DG6A 1OQ1A 3IPVA 4YG3A 2QNKA 3V64A 1RUI3 1JW6A 3M3OA 4S2DA 2IXJA 4HBNA 3VBRA 4HKLA 2DVBA 3INAA 5FO7B 1ZBE3 4X6QB 4F7ZA 4XHXA 4KG8A 2VY0A 4FQZA 1W6PA 4YGDA 3P3PA 2WT2A 2XVGA 1NY72 4ES8A 3AP7A 1PNGA 4CDUC 5E8AA 4JGZA 3WG2A 5AC91 1KDMA 4Z8BA 1IPJA 3MF9A 1J1LA 5C8WA 2E7TA 1IKPA 2GC0A 2RS11 4MGYE 4K7JA 4LBQB 3T2TA 1RUNA 3N4MA 4Q2FA 5BNPA 1LGCA 3MZHA 1MVQA 2A6ZA 1OKQA 1ENQA 4R9DA 3TOJA 1SBDA 2VW2A 1POV0 3APBA 1LOFA 1BBT1 1WUVA 2K0GA 2YHJA 2GC3A 5GLTA 4G9SB 3AKSA 1G9FA 1QJU3 4B4QA 1PVC3 4DXZA 1TME2 2WZR1 2E63A 3CJIA 3ES1A 4FCAA 4S2HA 1NCQC 1AXYA 1DFQA 2VMHA 4A2UA 1RUE3 1RUOA 4QHBA 3B94A 2WWSA 5JOXA 4BMEA 1KFUL 3KSCA 1N1YA 5JZGB 1PZ7A 1QJY1 3NWKA 3RRDA 1ZZ9A 1M06G 3UV9A 2B39A 4PLNA 5L7OA 1HRV2 1XNCA 2XB6C 4AVVA 2HWC3 4OHZA 4BOWA 1PZ9A 1RUF1 1V9U2 1YRZA 5C4WB 3I54A 5DZGA 5F9TA 2RMU1 1AHSA 1F9KA 2CV6A 5F5QA 2FZ2A 2UY8A 1JOJA 1NXMA 1MACA 1PIV3 1WBFA 1BEV3 3ZN6A 3KT1A 3WY6A 3R4DB 1COV1 2IZWA 1UAIA 2BVBA 2E7AA 4QGNA 3NKTA 2NZ9A 3ZFFB 3AM2A 3KZ4C 4XJWA 5FLHA 4PLMA 1AR92 2HWE3 4YVWC 3UK9A 4XE9A 4XJZA 4P9LA 4COYA 1LJ7A 4D3WA 1GV9A 3AYAA 5E89A 1JTZX 3NO8A 5FO8B 1O3TA 5CNAA 5LRSA 3N7LA 4Z2WA 5IK7A 2C0ZA 4COUA 2H0BA 4L2NA 1H1MA 2ZHKA 4XFGA 4KBBA 1I6XA 5H9PA 4QXKA 3NV2A 3SCGA 4KU7A 1NE4A 3KM5A 1B09A 4V1PA 1QXJA 2YMZA 1O4YA 2WFPA 5LRRA 1TE1B 4B4PA 4COVA 3ILNA 4LT5A 2QKDA 4JDOA 3N35A 4F3JA 4JQRA 1HV0A 3MIFA 1VBE3 3R4SA 4MV2A 4Q4V1 2C5DA 3NV4A 1NA1A 1XNKA 2D3PA 2LUWA 1V6KA 1G7YA 2VW0A 3NVCA 3MIBA 2AREA 2R071 1MZ5A 2RR12 4QQLA 3VHNA 2HWF2 1Y43B 1YWKA 4BYYA 1YIPA 2Q30A 4OLLA 4BMBA 1J59A 1OQDA 3DF0A 1ULGA 3UJQA 1AYN3 1FATA 4JTNA 2EF6A 3JZVA 3ZFGB 3LOBA 1AZDA 3J26N 1UKRA 4DFSA 3WG1A 5FDBA 3USUA 4OHXA 3MW2A 5FOBB 4AEDA 4HKOA 5AC93 1AR61 4GWNA 2CWSA 2X5IC 2RS13 1ENSA 4EN6B 3B00A 1O4ZA 3H50A 4C0BA 1WLDA 4XFAA 4D7YA 3WDXA 1TNFA 4ATEA 1R1ZA 1U5IA 1I1EA 3NKGA 4QPIB 2PHTA 1AR71 4M3CE 3AX4A 1BBT3 2XJTA 3I8TA 3ASIA 2NP0A 1DF0A 1FV2A 2W68A 4WM7A 2GN3A 1Q43A 1YNAA 1ZBA1 4YNIA 1OA3A 4YM2A 2VNGA 4XF9A 1OPOA 2WZR3 4XXAA 3VBSB 4CDWA 1IHMA 2IXIA 4P5HA 1NQDA 4MX3A 1VAVA 1DYPA 1TEIA 4RS5A 1OFNA 1WW7A 4C90A 1QJY3 4QPGA 5E1RA 1VB2A 3OGJA 4KG0A 2PHWA 4JVAA 2QZ2A 3B01A 1CAWA 2PHUA 4GA9A 1GZ9A 1RUF3 4WZFA 1DBNA 4DINB 4YGBA 3E5UA 2R1BA 4FO9A 4HN1A 5DXDA 3AZYA 2ARBA 1POV1 1Q8SA 1DQ4A 5FOJB 1WLWA 4CP2A 2VNRA 2ZGTA 4AVBA 1JUHA 2RS32 4I0WB 1BKZA 4GKYA 1COV3 3WDTA 1XYPA 3A0NA 5IT6A 1RB8G 2RMU2 1LOGA 4AE2A 1SCRA 1CAXB 1W6MB 5EYXA 4S2GA 3RNSA 4PDWB 4HETA 2YUEA 1VBD1 4KGQA 3CLPA 4SBVA 3B3QE 4Q8LA 3POYA 2Q5TA 3MIDA 1DQ6A 5CFDC 2DU0A 4XZPA 2FQPA 5J98B 3V0AB 2WFF1 3A4UA 2RJLA 3AZXA 4GMP1 3BALA 4PF5A 1AXKA 4E4SA 1QQP1 2GALA 3AMQA 4W6XA 4RQPB 1YUDA 1ZX5A 4CEWB 4A7ZA 4JCKA 3CO2A 2HWD1 5JOWA 4ASMB 2PHXA 1RGSA 4JGYB 4AFMA 4ASLA 4CDQA 1H2LA 1VAMA 1NCRA 2WA3A 5DZEA 1AF9A 1NCQB 2NMOA 1NYWA 3FBMA 1B35C 5GLVA 4Q4X1 4MXWA 2QVSB 4WVZA 4Q0UA 1OOPA 1H9PA 2R073 4CP0A 3B93A 1JBCA 4LA3A 1Q56A 1V6IA 1H2KA 3FWEA 2V73A 1PMIA 4Q4V2 2RM22 5FTTC 1MS3A 3LAGA 1G8WA 3DGTA 1H8TB 3HQXA 4L11A 1IKQA 4XJAA 1C57A 1FPN1 3PNAA 2OIIA 1CAVB 4WVMA 2R061 2EA7A 2ZOEB 1AR63 1L3JA 2HKXA 1WBLA 2B42B 1KRIA 4ORFA 5GZEA 1VBA1 1WMEA 1F2NA 4IV3C 4CZSA 2ES3A 1HXS1 3MLKA 4HPKA 5CFDA 3DPRB 4I0AA 1OA2A 4CTEA 1X7NA 4OUMA 3J4UH 3VV1A 2OPKA 4XQ4A 1ZBA3 4PJYA 1C8NA 3AYCA 1NZCA 4A3XA 1FMD1 2Y38A 1LODA 1RHI1 1AR72 2Z2SB 4OVEA 1PO21 2VW1A 2ZHMA 1WCDJ 4QMAA 3GALA 1SLBA 4QQ2A 2D40A 4N53C 2XBO3 2Z79A 3AP6A 5KHIA 1VP6A 4H7LA 4BM8A 4NHMA 3GZUC 4L8QA 1BJQA 2JICA 4P9JA 1N3PA 2VVDA 4I01A 2PLV1 4N43C 1FX5A 3VL8A 1NLRA 2C9AA 2ZAAA 4ZKTB 3CL1A 3EHKA 4JAAA 1GQGA 2JD4A 4PIXA 2PN5A 1POV3 4NR1A 2ZKNA 3WDYA 1RMU2 5GLZA 1S1AA 4AVAA 4IESA 1JH5A 4FOYA 2BYVE 5D8AB 1TMF2 2D6MA 1CAUB 2PELA 5KHKA 1WLCA 1AJOA 3WCSA 3TB0A 1VBD3 2WNVC 4PBOA 2CGOA 4Q1PA 3M3QA 3FLPA 2D97A 4Y22B 4J1WA 2PHDA 2X5IB 5I0UA 4LLOA 2HWB1 4FQ4A 5AVAA 3FBYA 1XE7A 5I8SA 3QOPA 1UPIA 3KCYA 2WFF3 3LA2A 1LENA 1WD3A 4GMP3 3OCPA 4TWTA 1QQP3 4CEYB 3ACLA 2HWD3 1GKBA 1EV13 1Z7S2 2A71A 4RFT0 4KNCA 4XBQA 5FMOS 3VN4A 3IN9A 2WL1A 4AI0A 1ZM1A 3R6SA 4KGGA 4CDXC 3VDDC 2XL7A 4Q4X3 2R0HA 3B69A 3FJSA 1R1A1 3H7YA 1SLLA 4HKWA 4JDMA 4E9KA 3ZIXA 3ZFEA 4XF1A 4GKXA 3AKRA 3OD0A 4WBBA 2CNAA 2JG8C 4X8NA 3POWA 2ZGPA 3VBOC 1VAKA 3OYWA 4ZU4A 1NY71 4Z82A 2XPJA 1UCXA 1QXPA 4DQAA 4AEMA 4XJ9A 3DUIA 4BLIA 5CADA 2PA7A 2GZWA 1FPN3 4LHNA 4K9SA 4QGMA 4YVSC 3ILRA 2R063 3RYRA 3JB8A 1WW5A 4FPGA 1C3HA 4M3CB 2CL2A 2EXKA 3OGGA 4QT6A 2RE9A 1VBA3 2D6OX 2P37A 3LB9A 3WW3A 2YYOA 3C3VA 3MIHA 4P9YA 3LZZA 2ZKLA 5CFCC 1NQJA 1WMDA 3VHPA 5I0RA 1QH7A 1EY2A 5JVVA 4COZA 2BQPA 2ZX2A 4LULA 3ILFA 3RQ0A 2DU1A 2BWCA 3H9AA 5J7MA 3V0BB 1TME1 2A3XA 2EIGA 4ZU5A 4BH9A 2DTYA 2R0FA 4PQ9A 4A7KA 4LBQA 1C5HA 2DFCA 4RR3B 3MDPA 2GU9A 5L73A 1HXS2 1FI2A 1MZFA 2D93A 3D0JA 1J3RA 2Q1ZB 4AVCA 2WNUA 5A32B 4COWA 4FPYA 1FMD3 4DY3A 5GLUA 4XMAA 4IEXA 1RHI3 2CYFA 3ALQA 4FOVA 1QMJA 4N7UA 1GR3A 5DG2A 4AQ6A 2O8OA 1PO23 5J96B 2GMEA 3JU9A 4CDXA 3JBG1 3WQ0A 2ZGUA 3ZXLA 2HJIA 1FMD2 4AQTA 1GNHA 2H0VA 1V9U1 3VUOA 3IM0A 2PLV3 5JWPA 3WG4A 5K0UB 1UW8A 2E6VA 3RJRA 2DCJA 4C91A 1REDA 3WQ7A 1NLSA 3WD5A 4I2OA 4QQOA 2O0OA 2X53S 1U0AA 4DOUA 3KT7A 1ULCA 3M4FA 1BZWA 3VBUB 3QLQA 1KXGA 4I3PA 3FLRA 2MEV3 3BPZA 1AR91 5GZFA 3VBRC 3CNAA 2DF7A 2I45A 5C4WA 4AFDA 4AI8A 1RJ7A 4KWJA 2IWGB 1RL3A 4YGCA 5CBLA 4HANA 5CA6A 5CVRA 4YFZA 2TBVA 4AF9A 4CP1A 3RMYA 1VJ2A 1ZYBA 1SDWA 2HWB3 1DZRA 3ZFFA 2PFWA 5DG1A 4EWAA 4E27A 2E7QA 2R30A 5BNPC 4YGEA 4GULA 1HQNA 1UL9A 1UN1A 5ACA2 1Z0HA 1LOFC 1GYKA 4YM3A 4HL0A 2D3SA 1ASJ1 4XJUA 1WGPA 3CJIC 5AVPA 1CJDA 4H14A 3EQEA 2RR11 4AVSA 2HWF1 3AB0A 3ME2A 4LA2A 3RDIA 4L92A 4YW2A 2ZGRA 3WDWA 2DFBA 2EAAA 4Y1XA 3AJYA 5JI9A 1RITA 4FXKB 1Y7BA 3J8F2 1PGW2 4B3NA 4ZU7A 4NHKA 3NV1A 4XXPA 3MFAA 3FUQA 2VMGA 2W08A 2XJRA 4LBLA 5L7OC 2P3KA 4GXLA 1KS4A 1EPZA 3K48A 1R1A2 3V65A 3PVNA 2EXIA 2QJVA 2D6PA 3H7JA 4UW5A 1UKGA 3O14A 5BNNC 2AR6A 4MXVA 1CJPA 5BNOB 1QH6A 2A3YA 5AFBA 1S55A 4PIZA 5BUVA 1AYM1 4GH4B 4KU8A 4KWKA 2XGXA 5A3LA 3QH6A 1X8MA 1W6QB 2NQYA 2ZZJA 1ND2C 5E88A 5T5OA 3JD72 5FAXA 1HDKA 3H1WA 3NAPB 4DB5A 1UZYA 3OY8B 1H0BA 1FV3A 5KXDA 3ZMNA 4Q0VA 3WX5A 5KXEA 1K5MC 1TME3 3JB4C 4Q4Y2 4W6WA 1G9BA 1SBEA 4R9AA 2Z5WA 3KCCA 3Q9OA 2ZA9A 3O0WA 1LOAA 1GQHA 1UX6A 1HX6A 1S0GA 3GBGA 3ZSMA 4YZ1A 4I0BA 4I30A 2KM2A 3KLSA 1H4HA 2TUNA 3JBG3 4UXAA 2VMIA 1MEC2 2DCZA 1HRV3 3KGZA 2OZ6A 2R042 4OI4A 3PJQA 3ZN4A 3VBSA 3RI8A 2PAEA 1V9U3 4XILA 1R081 2A73B 5FCCA 5T5LA 3FFZA 2VH9A 1BVVA 2R6QA 5FPXA 2JE9A 2ENRA 3JBG2 5ABJB 1NA1C 4PCRA 1ENXA 2WLQA 3BU7A 3O0XA 1VIWB 4GIQA 1QF3A 1PK6B 1VLNA 2PHRA 2RS31 3C2UA 4XBLA 4BA6A 1H8VA 1DQ5A 3ZYIB 3A0KA 5A33A 4U36A 5BNNA 1MZ6A 1SLCA 3NL1A 1ND3B 1OD5A 2JG8B 1H30A 1OFSA 1AR93 3VBOB 4O9EA 3MW4A 1WW6A 2P34A 4MGZE 1RJ8A 1D4M2 1V6JA 3WP3A 2WT0A 5H9RA 1ND2A 5F1RA 4XQDA 2ZAHA 4AEDC 1MQTB 2HEYF 1IGOA 2Y0OA 3LWCA 1RTVA 2AGSA 2XHKA 4Y1ZA 1K5MA 4LO8A 2YROA 1S0JA 4Q4W1 3ZVXA 5T52A 4UW6A 1CAXA 4Y20B 3GYDA 4LE3A 3WQ1A 2XJPA 2DWRA 4PDWA 1OHFA 4ZXKA 1QJX1 2QDNA 2VG9A 4HT1T 3TAYA 2VPVA 2HYKA 4AFAA 3HWJA 3H8UA 4WM8C 2V09A 4WM7C 4FXGB 4XTPA 3V0AA 2VUAA 3VKMA 1OLRA 2CGPA 1ZRRA 3IMNA 1ASJ3 2AUYA 1V6OA 2GC1A 4AVTA 4CDWC 4FPHA 3WW4A 4RQPA 3DKWA 5KC6A 1V6LA 2RR13 4CEWA 2HWF3 4NPRA 3BODA 4LE4A 4ONUA 4RS5C 4FPKA 3VBFB 4JGYA 3V56A 3TYJA 2RM21 2GH8A 2RS52 4QPGC 1ZRDA 1ASJ2 4R8HA 3MLLA 4OHVA 5HI0A 3E6CC 5FO9B 3VKLA 5JI7A 1DZQA 1S0IA 3O0VA 1WA4A 2JG9B 4GALA 4NWWA 2TNFA 4UW3A 4EN0A 3GZTB 1PHMA 4XW3A 3ZSLA 1MS1A 1QJZA 1MR5A 4LO6B 1FNZA 1C1FA 3E6BA 2B5HA 2QQPA 1GFF2 4AXOA 4YM0A 3IBMA 5T5JA 2GAUA 1FOD1 3FZ3A 3VZMA 1H8TA 1HLCA 2WJSA 4XF4A 1YFXA 1X33A 1LHWA 2ET7A 1VBB2 1V6MA 1AYM2 1VALA 2B46X 4JGZB 1XXNA 2VVEA 1VBC2 4W65A 3SISA 4LUMA 4NO4A 1XQNA 1O4TA 4WM8A 3VBHB 5SV8A 3MPPG 4RSUA 4AI2A 2IXKA 1DLLA 3ATGA 3X29B 2WNEA 2XWJB 4RHV2 3S6PA 1YCIA 1LULA 3D0SA 3RJ2X 2UU8A 2ZBJA 5I0TA 4HVRA 3VZKA 1YLLA 3KD4A 4IV1C 1S0BA 1XYNA 4AHWA 4CDQC 5GZGA 3AMMA 1NCRC 2PTMA 5C9AB 2XG3A 3RYKA 1ULFA 2GNTA 4IEYA 4YZ4A 1RMU1 5C8CB 3PVEA 3PLQA 2WS92 3ZXJA 1OOPC 2GDFA 3QCWA 2RS33 4D69A 2SBAA 1U5XA 2WSVA 1XRUA 4UBHA 1I5ZA 1PGSA 1W6NB 1TMF1 1R082 1SLIA 1AL22 1S0DA 4XFHA 5I8TA 2Q0AA 2IXHA 5GZCA 2P2KA 4U2AA 4CYDA 2RMU3 4LBQD 3VL9A 1S0CA 2D5HA 4K1YA 5L7OB 5I0SA 1DZTA 5LEKA 3WV6A 1LU2A 4A7YA 2UWBA 4HZFA 3SNMA 3ETQA 3H1MA 3GBWA 4GB31 5FQ0B 3VKNA 2D6KA 4ITCA 2EXJA 4FTSA 2XH6A 5D8AA 4EWDA 4K8FA 4CDUB 1RUG2 3JUUA 5EXOA 1OPMA 4YG6A 1V6NA 2ZJCA 2ATFA 5BYNA 2DUQA 4LTAA 4M00A 3KGLA 1Z7S1 3PHMA 4URTA 4N9HA 1TNRA 2I2SA 2WKKA 1S2KA 3B5LB 1UPSA 4OUSA 4Q4W2 3LOIA 2DVAA 4WVWA 3BCWA 2NM1A 1QJX2 3JQWA 4AK3A 4IV1A 3ELNA 4BIOA 4CEYA 2VUJA 2DVGA 1UF2C 3HBZA 4HFSA 1REFA 1HRI2 5KHHA 4Q4V3 2K9ZA 2RM23 3ZXKA 1MZEA 5T5PA 2Y0IA 2UY9A 3KCXA 4PLOA 2R32A 1GICA 3VKFC 2BEOA 2VQAA 4M3CF 4X6RB 3L9JT 1ZZ7A 2GSYA 2YPJA 1DGWX 2A6VA 1Y9QA 3CEWA