2HWC1

A comparison of the anti-rhinoviral drug binding pocket in hrv14 and hrv1a
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
273
structure length
273
Chain Sequence
TVASISSGPKHTQKVPILTANETGATMPVLPSDSIETRTTYMHFNGSETDVECFLGRAACVHVTEIQNKDATGIDNHREAKLFNDWKINLSSLVQLRKKLELFTYVRFDSEYTILATASQPDSANYSSNLVVQAMYVPPGAPNPKEWDDYTWQSASNPSVFFKVGDTSRFSVPYVGLASAYNCFYDGYSHDDAETQYGITVLNHMGSMAFRIVNEHDEHKTLVKIRVYHRAKHVEAWIPRAPRALPYTSIGRTNYPKNTEPVIKKRKGDIKSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A comparison of the anti-rhinoviral drug binding pocket in HRV14 and HRV1A.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
total genus 41
structure length 273
sequence length 273
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1994-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2hwc100
1BMV2 4CDXA 1RUD1 5C4WB 1VRH2 5C9AB 1AL22 2RS13 5ACA3 5BNOC 5L7OB 3VBRC 1RHI2 1BEV3 5A32B 2X5IA 1GFF2 3VBOB 1Z7S1 5LK7B 3ZFGC 1AYM3 2FZ2A 1EV12 1WCDJ 4QPIC 4Q4Y3 5J98B 3JBG3 1ND3A 1POV0 4NWWA 1R1A1 5ACA1 2GH8A 4GMP1 1RUI1 1VRH1 1ZBA1 3HAGA 3JBG1 1QJZA 2IZWA 3M8LA 5K0UB 2HWC3 1RVF1 1AYM1 1SMVA 5C9AA 4N53A 1VB4A 1VRH3 2ZAHA 1Z7S2 1NA1A 1FPN2 5C4WA 4CDUC 3TN91 1QQP1 1FPN3 4IV3A 1ZBE3 1VBC1 1CD3G 1RUI3 4GMP3 5CFCC 5L7OA 2HWB2 4CDQA 1TMF2 5ABJC 1X36A 1V9U1 2RR12 4FSJA 1RUH2 1VBC3 4BCUA 4FTBA 5D8AC 2HWB3 1POV3 4N53C 2WS92 1PGW1 2HWE2 1PIV1 2RS53 1MQTA 2HWD1 4YVSA 4GMP0 2BFUS 3FBMA 5D8AB 1AR83 4RQPA 1OOPA 2R041 1W39A 4WM7B 1OOPB 1R1A3 1AR61 1BBT2 1QJX2 3CJIB 5BNPC 4AEDB 1RUH1 3VBSA 4RS5B 2X5IC 2R043 1IHMA 2HWF1 1RHI1 1ND2C 1AR73 2WS91 5BNOA 4Q4Y2 2QQPA 1OOPC 5J96B 1H8TA 5BNPB 1R091 1COV1 1HRI3 1C8M1 4Q4X2 3VDDC 4PDWB 1RVF2 3VBOC 3ZFGB 2R071 4CDWC 4RS5A 4CDQC 1POV1 1TME1 1QJY3 3JD71 4Q4W1 2XBO1 1NY72 1VBB2 2RMU3 1QQP2 2WZR3 3J8F1 1HRV3 2MEV2 5GKAC 4PDWC 3VBUA 1NA1C 3JD73 4Q4W3 5C8CA 4CDWB 5C9AC 1MEC3 5A33A 1Z7S3 1X33A 4NWVA 2TBVA 1RUJ3 2RS33 1PVC1 5FMOL 4JGZA 1D4M3 1PO11 1NA1B 1AR82 1FOD3 2BFUL 1NCQC 4GH4B 4QPIB 2HWD2 1M06G 1RUD2 1RUG2 4QPIA 1HQNA 1VBA3 5ABJB 1PGL2 1FOD2 1EV13 3ZFGA 2FZ1A 1VB2A 1C8M3 4RHV2 1K5MC 1AR62 1PO22 1QJU1 3VBSB 3VBRA 1NCQB 5DDJ2 1NCRB 1F8VA 1TMF3 2ZTNA 2WFF2 4CDXC 4CEWA 1QQP3 1NCRC 4N43A 5JZGB 1ZBA3 5AC91 3JBG2 1CJDA 4IV1B 4RHV1 1RVF3 2RM22 5DDJ1 1AYM2 5BNNB 3CJIA 1AR91 1VBD3 1ND2B 4Q4V1 4JGYC 4YVWC 2GSYA 4RR3A 1HXS3 1PO13 5AC93 2RS31 4IV1C 1B35B 2WLPA 4QPGC 4SBVA 5BNNC 1MQTB 2RS11 3JB8A 4Y4YA 2R063 1RMU3 2RR11 1RHI3 4WM7C 5DDJ3 5A33B 4WM7A 1AYN2 4WM8A 3S6PA 1AR92 4Q4V2 4QPGB 4AEDA 5BNNA 1QJX3 1QJU3 1BBT3 4QPGA 1RUG3 1PO12 3ZFEA 4CEYA 4RR3C 3JB4C 1PVC3 4JGYA 4YVWA 2RS52 3IDEA 1VBE2 1RUF1 3DPRA 1BBT1 1ZBA2 1RUC1 3VBFA 3TN93 1ASJ1 1RB8G 1NCRA 4N43C 1BEV1 3VDDB 1ZBE2 1V9U3 1VBA1 1A6CA 4YVSB 4CEWC 3TN92 5K0UC 1FMD1 2WFF1 1R092 5JZGA 3NAPC 3VBHA 1COV2 3ZFEB 4N43B 2RS51 1RUC3 4Z92B 1RUF2 1K5MB 1AL21 5A32A 1RUE1 2WZR2 4Q4X1 3VBFB 2HWD3 4CEYC 1VBD2 3ZFEC 1OPOA 2Y26A 5FOJB 1PIV2 4Q4X3 1VBB1 1FMD2 1DDLA 2RS32 1NG0A 1RUE3 4GH4C 4JGZC 3ZXAC 2R042 5ACA2 2XBO3 3LOBA 1RUE2 2WZR1 1AR71 1AYN1 1MEC1 4JGZB 3VBHB 1QJY2 2BUKA 1PO23 3ZFFA 1R093 5FMOS 1PIV3 2VQ0A 1B35C 5CFDB 4RS5C 2HWE3 3VBUB 1HRI1 2R073 2WFF3 1FOD1 3VBHC 1H8TB 1R083 4EJRA 5JZGC 1VBE1 2PLV1 5K0UA 1EAH3 1RUC2 1D4M2 1AL0G 4RFT0 2HWF3 1QJY1 1ZBE1 1H8TC 1EAH1 1PGW2 2HWE1 3JD72 4Q4W2 2PLV3 1NY71 1RUD3 1R081 2MEV1 1K5MA 1B35A 1VBE3 3ZFFC 1R1A2 4CDQB 2HWC2 1RUI2 2PLV2 1QJX1 5BNOB 1D4M1 3VBRB 1AR63 1NCQA 5C8CB 1PVC2 1HXS1 2HWF2 4YVSC 4CEWB 1AR81 4Q4Y1 4WM8C 1EAH2 1FPN1 2WS93 3NAPB 1HRV2 2MEV3 4GH4A 1R082 1RUH3 1VBC2 4IV3B 5C8CC 1HX6A 1RMU1 2RR13 5D8AA 1TMF1 4PDWA 4WM8B 2HWC1 1VBB3 2RMU2 5ABJA 4GB31 1AR72 4CEYB 1MEC2 5CFCA 5L7OC 1HXS2 2DF7A 4IV3C 4CDUB 2R072 4CDUA 2BBVA 2XBO2 3NAPA 1AUYA 1HRI2 1ND3B 3DPRB 1RMU2 2RM23 4GB33 4CDXB 2RMU1 2BPA2 3VBFC 1VBA2 1ND3C 3DPRC 3J8F3 2XPJA 4RQPB 1RUJ1 1ND2A 2WWSA 2R061 1FMD3 1NOVA 4Y5Z0 3VBSC 1RUG1 5BNPA 4FTEA 2RS12 5CFCB 1OHFA 1COV3 1AL23 1PGL1 4RQPC 2ZZQA 1C8M2 4RHV3 1E57A 4AEDC 1PO21 1QJU2 1TME3 1MQTC 1AR93 1VBD1 4Q4V3 1RUF3 4N53B 1C8NA 1RUJ2 2R062 4LLFA 1TME2 5CFDC 1HRV1 1VAKA 1BMV1 1F2NA 1ASJ3 2HWB1 4IV1A 3J8F2 3VBUC 4FTSA 3ZFFB 4JGYB 4YVWB 1V9U2 5AC92 3CJIC 4RR3B 4CDWA 1ASJ2 2RM21 4GB32 1BEV2 2X5IB 3VBOA 5C4WC 3VDDA 5CFDA 1AYN3 1EV11
chains in the Genus database with same CATH superfamily
2E6VA 4HG6B 2DCYA 4QPYA 5CZKA 1S0CA 2K46A 5LK5A 1VE0A 2J1AA 3IIIA 3OG2A 3ZXFA 1GP4A 1SQ4A 3SEPA 1LU2A 1CESA 2BV4A 3O5SA 2AACA 4PF5A 1P8JA 4C0BA 4YG3A 2RVAA 1UU5A 4BOWA 4P5HA 2O0OA 4GKYA 4M00A 4K21A 2ZAAA 4YRDA 3VBRC 4LBQD 3OOXA 3VZKA 1XNCA 1RXGA 2FQPA 2VECA 1GFF2 4LHLA 3A7QA 5CB7A 3ZFGC 5LK7B 1Y7BA 4QPWA 3J7HA 4LHKA 1YI7A 3ZVXA 1EV12 4QPIC 3WNXA 1ULFA 4JCKA 2RDRA 3JBG3 4ZPIA 3BCWA 2CYFA 3NWKA 3O1UA 4MGKE 1AX0A 3MZHA 1Q56A 3RJ2X 1DQ1A 2A7AA 3VGIA 1R1A1 5ACA1 3NJXA 4KBBA 4LBKA 4NHYA 4AAXA 4RGGA 2WL1A 4N9IA 3JBG1 5AVPA 4OVEA 1DQ5A 5K0UB 1H30A 1IG3A 5EQUA 5FYYA 3POIA 3ZN4A 1LJ7A 1YFYA 3ZN6A 2ZAHA 3ZLIA 1T6BX 2A5ZA 1C5HA 4BQWA 1GWLA 1NA1A 2CGOA 1F35A 3RGBA 4SLIA 3WDWA 4IW3A 4WZFA 3TN91 1SACA 1QQP1 2WLQA 4TZDA 1OLRA 2VE1A 4ZS3A 1ZBE3 1BHGA 1W8OA 2ADDA 5FYSA 1VBC1 1CD3G 1SFNA 3ZYRA 1RUI3 3AKRA 3M4FA 4GMP3 4LBLA 1WZXA 3I2HA 4M3CF 4CDUA 3S57A 3LGRA 2D6OX 3IDAA 1L7LA 5HBAA 1X36A 2E33A 2TUNA 2V09A 4YGDA 2GMEA 2XLAA 1RUH2 3K46A 1YI9A 3WNPA 4FTBA 2PHUA 1J59A 1H4GA 4J25A 1QF3A 3T08A 4N53C 3UETA 1JOBA 1D0HA 4TN7A 3WF4A 5C3OA 3MPBA 4B4QA 4LIUA 3SXWA 1FX5A 1PIV1 2RS53 3GBFA 2ZGMA 1OVSA 5JXGA 3AP6A 5FYCA 2BFUS 2YFUA 3FBMA 4JRAA 2G9GA 4GIQA 3MI8A 4UF0B 4ORFA 1UNBA 3WHTA 2W95A 1JS9A 5LBBA 5HCHA 4EROA 4Z8BA 1AR61 3OUIA 1BBT2 4EV0A 1GZTA 3CJIB 2CAUA 3Q8CA 2X8KA 4QHZA 5FXXA 1RUH1 4AEDB 3KCXA 4RS5B 1LKNA 1OF4A 3AYAA 2X5IC 4S2FA 3DN7A 4KG0A 4UFHA 2VM9A 5JMOA 2R043 4QDRA 1ND2C 5FOBB 1AR73 4B3NA 4DRRA 2VBBA 4JVAA 1PMHX 2BGCA 4Q4Y2 3GZAA 2W08A 3UK9A 2ZMKA 2DCJA 2VMGA 1H8TA 5BNPB 4XBLA 1R091 5KHJA 4RL7A 5JXIA 2YBKA 4QD2A 1CAUA 1O6UA 2LS6A 2DUPA 1OT5A 3CO2A 1ZYBA 1C57A 2XWBB 4XF9A 1WLWA 2UWAA 4MGZE 1MS1A 3I2IA 3WLUA 3JZVA 4PDWB 1RVF2 2PMWB 5A3PA 1ZA7A 2NZ9A 2VL4A 3ZFGB 3THTA 3MF9A 3AMNA 4QX1A 2J1RA 3UJQA 3P1IA 5A7SA 4NPLA 2CHHA 1DYOA 1GOFA 1POV1 2OIIA 3HPNA 3GGLA 5C6CA 4Q4W1 1OC1A 2P3YA 1NY72 1VBB2 1YO8A 2RMU3 4XEZA 1SEFA 4Y5TA 5FLHA 5EFUA 1JZ3A 3N4MA 1HRV3 5IHRA 4P08A 5EPAA 3VBUA 3E97A 1NA1C 2JDKA 4X8PA 4FPFA 4Y33A 4Q4W3 4MSVA 3MW3A 4XABA 2JIGA 3T2TA 5LA0A 2V4AA 2WC2A 3WG2A 5JIUA 1YQ2A 1LOGA 1RUJ3 1XRUA 4L2NA 3IMMA 2RS33 1PVC1 3HJRA 4PBOA 2RDQA 1MPXA 2J1SA 4A3XA 4CUCA 1UW8A 4NROA 3POWA 1J3QA 2QQIA 4O61A 5FYBA 1FV2A 3TAYA 1UXXX 4GH4B 4UFMA 3O1PA 4EZ4A 1M06G 3E5XA 1W06A 2WFPA 1GU3A 4QPIA 3GJBA 1W3VA 4BJ0A 3GBGA 5LA1A 4B7EA 1IS6A 4KWUA 1PGL2 1FOD2 3ZFGA 2BWAA 3WINE 2FZ1A 1VB2A 4CU7A 1RXFA 3LDKA 4PCRA 4AEMA 1EPZA 1PO22 1PM7A 1QJU1 3VBSB 3VBRA 3MBWA 2IXIA 1UOJA 3MIDA 3H50A 1NAEA 4YZ3A 5JIAA 3NMBA 2IXCA 2OUHA 4FPHA 3ZDVA 4AQ2A 2OQ6A 3VD4A 1F8VA 4B4PA 1ZRDA 2ZX4A 3T3YA 4QMAA 2ZTNA 5EHDA 2WUHA 4QWNA 2IVJA 4XUPA 2CY6A 3WT3A 1G9CA 3U4XA 4CEWA 1J1LA 1YQ6A 3WNNA 3H7YA 4ZXKA 3WNKA 4OI4A 3SKJE 1Q8SA 2VZPA 1CVNA 2WRAA 5JZGB 3SITA 4OHWA 2B9VA 2WNVA 3PUHA 1S0JA 4ET7A 1CJDA 4IV1B 2VUAA 1LGBA 3MW2A 4MGQA 4BWOA 1WLCA 2ZEXA 3OPTA 5FYVA 1VALA 1VBD3 3CJIA 1ND2B 1F4AA 5GJ6A 4BQ4A 3HQXA 1UZ0A 2GSYA 4Y5SA 3ZXKA 4QQOA 1S2EA 2ATFA 4LQRA 2IXKA 1YJKA 1W3XA 4HOOA 2RS31 1WD3A 2JG9A 3HOBA 1UO9A 4NVPA 1JHJA 1RITA 3HVDA 3LKJA 1U0AA 4JDOA 5FY9A 2XJUA 1SLIA 5A7NA 4DIQA 5JOXA 2R063 1W6PA 2SBAA 4LE3A 2DUQA 1XNKA 3AM2A 5A33B 2E32A 2CDPA 2FCUA 2VCCA 4MXWB 2JEMA 2WZ8A 4XTPA 1XNTA 1KEXA 2CGNA 2ETEA 3AVSA 4QXCA 1CX4A 1L7RA 5FXWA 4QPGB 2CDOA 4XJWA 4EZHA 4YW1A 1QJX3 1QJU3 1TNFA 4FPKA 5A1FA 3V0BA 1PO12 5HXMA 3ZFEA 3DCQA 4ZU7A 1DYKA 5I8YA 1GANA 1E5IA 4FP2A 3K75B 3T0DA 3ZXJA 1GOGA 2PXJA 2XLGA 2XVKA 1K12A 4P9YA 1CZSA 2ZGOA 4UW3A 5FZCA 3ZXLA 1BXHA 1MZFA 5G04L 3U78A 4EWAA 4D6RA 2A3XA 4K1ZA 4JHTA 2NPIA 5IVEA 3THDA 3WUDA 4AHZA 1RUF1 3DPRA 1BBT1 4AI9A 1ZBA2 2V4VA 1SCRA 4PT6A 3QCWA 3INAA 4JHZA 3VN4A 2WNVC 4NHXA 5T54A 3TBDA 2WWUA 4D8MA 1ZRIA 3MUZ1 1OA3A 1FATA 5CU1A 1W8UA 5IK4A 4OUMA 4QHOA 3ILRA 3J26N 4LNVA 3OPWA 2BW8A 1A6CA 2O1QA 3FLTA 4Q26A 4QU1A 4CEWC 4TLFA 5DUUA 4MGSA 3ZSJA 5I0SA 5CG8A 2W2IA 1HV0A 5FZLA 3GXUA 2YU1A 4R8HA 4MZUA 1QNYA 1RUC3 5FK7A 4Z92B 4Y1XA 1ENXA 1RUF2 2A70A 4K20A 3BN6A 5LEKA 4NHKA 1RUE1 5F2SA 2ZS6B 3ZM8A 1HJGA 2Q1ZB 5I93A 4XF0A 2AUYA 3IDCB 4URTA 4CEYC 1OUSA 4XFHA 2WO1A 3CHXA 2VUDA 4Q5OA 1OPOA 2Y26A 4XQ4A 4YG0A 3WEZA 1VBB1 1MZ6A 3AX4A 3WW3A 1WUVA 3CIHA 3CU7A 3N7KA 4Y24A 3ZXAC 4RSUA 1BLZA 2R042 3C7GA 3AYEA 4LBMA 5ACA2 2VOTA 4X8NA 2XBO3 3GCWA 4GULA 3LOBA 1CPNA 2VBPA 4DEQA 1NUKA 1AR71 1LENA 1MEC1 1R1ZA 2D6PA 1Q8QA 4M01A 4A3ZA 2B46X 2VY0A 3LEIA 5FUNA 1QJY2 1E5SA 5IK7A 4HLTA 2Z79A 3BALA 1R093 3LSDA 5FMOS 1O91A 1PK6C 4O9GA 5CFDB 5JPNB 2L9LA 4Y3OA 1HRI1 1JYWA 2GZWA 2R073 4XBQA 2AEYA 3ZMOA 1DCSA 3S7IA 4HKLA 3VBHC 1R083 1ODNA 5DQ0A 4XXAA 1VBE1 3ELNA 2LM3A 3PVEA 5FY1A 1EAH3 4QM8A 4AFDA 4CVUA 3AK0A 1CIWA 4CUGA 1DQ0A 3SLIA 4RFT0 2ZJCA 4QB2A 2HWF3 3HQUA 1QJY1 2OT7A 2VOKA 3TRSB 3ILNA 3IMNA 1H8TC 1RTVA 3ZSEA 2XHKA 5LBCA 3I97A 3U11A 1IS5A 2BVVA 3VKLA 3WP5A 1CAXB 4XFAA 1VPHA 1AXZA 5IYYA 3NV1A 3ZO0B 1PVXA 2ORXA 5LATA 1B35A 4F8AA 3GJAA 4ZHNA 4LPLA 1OMIA 1S0IA 4P00B 3LAGA 2Y38A 4Q0PA 3ZIWA 5T5PA 3D82A 3MO4A 4YW7A 5BNOB 4QDSA 3SCGA 4YGEA 3S7EA 5C8CB 5CVRA 2Y0OA 2GC1A 1XQNA 4R9DA 2WZEA 4CEWB 1AR81 2HLEA 1IS3A 2PHFA 3QOPA 4P9JA 1HW5A 1Y4WA 4CSWA 3RZLA 2G9FA 4KU7A 1WWYA 1GNYA 4LO6B 3MHZA 4GD4A 4OCTA 2NN8A 2CSGA 1VBC2 4IE0A 4QGMA 4CU6A 4LMFA 3H7JA 3BPZA 3RPQA 3AZVA 2ES3A 4PQQA 1X7NA 4OHYA 2WO2A 1JOPA 3MIGA 3UYJA 1W05A 2J1TA 3N36A 3P3PA 4GB31 2QDRA 3OUJA 4Y1ZA 4CEYB 3NW4A 3W5MA 3T0BA 1SLLA 5FXVA 2CAVA 2P1BA 2XOMA 4GA9A 3ITQA 5FP9A 5EJ3A 4CDUB 4P9IA 4K8RB 1ULGA 1H2NA 2E51A 3RG0A 4C0HA 1LOFA 1W0PA 2FDIA 5DUWA 2A6VA 2VTXJ 4YM0A 3VKMA 4K3UA 3WDXA 1H2MA 1PMIA 5FQ0A 1REDA 5GLVA 1TQ5A 5A3TA 2GP5A 3VDAA 3C2UA 4CDXB 4TWTA 2YUEA 2XJTA 1YLLA 3DKQA 2CGPA 1GZ9A 3FMGA 1GMMA 3VBFC 1TEIA 3HN1A 1QH6A 2GNBA 2XPJA 2VBDA 1QU0A 2WWSA 3R4UA 3BPSA 4QT6A 5EP9A 1S4CA 1PX3A 4LO5B 1DZQA 4I0AA 3URFA 3VBSC 3I3BA 3UKVA 5JSOA 1JZ8A 4FTEA 2JDNA 3ACFA 5CFCB 2D5HA 1COV3 4AI1A 4D6SA 5FP7A 4DO0A 4LO7A 5A3MA 1QNWA 4RQPC 2ZZQA 4RHV3 4IGQA 2QJVA 3JCIA 1O4YA 2HYKA 4YG6A 1Q5OA 1TME3 2NMNA 4XOGA 5BV6A 4Q4V3 2W3JA 4Y22B 2PAMA 2OUJA 1TE1B 2UWBA 1JTZX 3OSDA 3NNLA 3ORJA 1FXZA 3OPZA 1AJKA 3B7MA 4N90A 3KHCA 1FAYA 1RUJ2 4LLOA 4NAOA 3HD8B 4PI0A 5FLJA 1GP5A 4UI9L 4FQZA 1TME2 5FZEA 5KC5A 1HRV1 4LHSA 1VAKA 1UMIA 1X9PA 1F2NA 1ASJ3 1URXA 2BEOA 3IB3A 2ZX2A 2PQSA 2Y6KA 1Q8PA 4YZ1A 5F32A 5JMCA 1K45A 3H3LA 4ZZ5A 2WKKA 1ZZ6A 3E5QA 4K8FA 3PHMA 4QKNA 1LEDA 4AHWA 4UYBA 5A6ZA 2DVAA 4Q1PA 2PQQA 4XUOA 4IERA 3POGA 3OJBA 4QKBA 2RM21 5T5JA 3H0OA 4JX0A 1N3QA 2ARBA 2BERA 2FMYA 4XYXA 4PLNA 4XDOA 3ZXEA 2JJ6A 3GYDA 3U1XA 2VC9A 1GQPA 4Q0UA 1LRHA 2P17A 5KHGA 4RGKA 2WJSA 3WQBA 3ZX7A 3AKSA 1V00A 1LHVA 4E2GA 2F17A 4F7ZA 3WCSA 3EBRA 3K2OA 3Q8BA 2VZVA 2D6NA 1N1YA 3O1TA 1LGCA 5ACA3 2VMIA 3D4KA 4FOWA 3D3AA 2Z69A 2D97A 3KM5A 1BEV3 4BHPA 2JB8A 2VUCA 3VBOB 1PNFA 2FDGA 1H6YA 2C1FA 1AYM3 1LHNA 3KQRA 2OYZA 2FZ2A 4LBQA 4NIDA 1H0BA 1FI2A 5J98B 2QQOA 4OHZA 1ZZ8A 2R1DA 2VMEA 3U0ZA 2P6HA 2A75A 5IT6A 4Z2WA 2FBEA 4AI3A 1GQGA 5HI0A 2XJQA 4LO8A 4CCCA 2GH8A 1RUI1 1S0EA 3HT1A 2A6YA 4GMP1 4XMAA 3BTAA 3U14A 1NXD1 1W9TA 1YFUA 4FT8A 2HWC3 3OYWA 4OUEA 2B45X 2DTYA 2ZABA 3BTZA 3U10A 5C9AA 1IS4A 4M0HA 3BU0A 4CA9A 2WIIB 1Z7S2 1I3HA 4ITCA 4FAHA 3MV01 1OD3A 1JZ7A 1XE0A 1OPMA 3HQRA 4KG8A 3WV6A 1FPN3 1A8MA 4OFGA 3SISA 1H4HA 5KR7A 1MS8A 2D3RA 1YEWA 4IEQA 5CFCC 4CDQA 2QZ2A 3AMPA 4H3WA 2JDYA 4MHUA 1KFXL 2PHXA 4FPOB 2Q5TA 1DZTA 1APNA 2RR12 2W46A 5D8AC 2C4XA 4R52A 1O8PA 5FLIA 4AI8A 3C7HA 1J1TA 2ZEZA 3B3QE 5FZGA 5C33A 2VJXA 2YDEA 1PGW1 1MZ5A 2QQVA 4I01A 2QDNA 2WO3A 4DFSA 3OD0A 4FOVA 3HBZA 3ZKUA 2OW4A 3LFIA 3BODA 4YNIA 4RQPA 1DBNA 3MV11 3AMQA 4IGOA 1I5ZA 3H8OA 3UV9A 2ZX0A 4U36A 5BPXA 1UPIA 1OSGA 1PK6B 3T30A 1W8NA 4YW5A 5L9BA 1O5UA 3USSA 3VBSA 5FJKA 4LKDA 1S0DA 3MUY1 1CZVA 3UL2A 1SCSA 4DXRA 1AZDA 1H2KA 1QHDA 4X6QB 4Z82A 5C5TA 5BNOA 2VAUA 2W9XA 1QXRA 3ZXGA 4UOJA 5DG2A 4MV2A 5DZFA 1OOPC 2JD4A 5JWPA 1ULOA 3AP9A 1X82A 3RZGA 2P6CA 2CL2A 2JDAA 5JVVA 1X8EA 4E4SA 3LQCA 1A8DA 5IJRA 4Y20A 1N47A 2VZQA 4LBOA 4IUGA 3A0KA 2ET1A 2JE9A 5T55A 1RL3A 4OI0A 5FZ4A 3C7EA 5HCBA 5DXDA 3IAQA 4QX5A 5DG1A 1FT9A 4V2WA 3UGGA 4NR1A 5D1IA 1LOFC 4I3PA 4QXBA 3VDDC 4JTOA 4LKFA 4MGIE 2WSUA 3K51A 3VBOC 2VW1A 2Q8CA 3IDBB 4CDWC 5JXHA 4RS5A 3TB0A 2GNMA 2YU2A 5EIYB 2ZGSA 1TME1 1C3HA 1QQP2 2MEV2 1LOAA 4BIOA 2W94A 4MUVA 4LIVA 1JXNA 2WQ4A 3JD73 2I2SA 1SBDA 2OS2A 2EIEA 3D0SA 3R05A 4EN8B 3K3NA 2WBKA 1Z7S3 1VLNA 3AZYA 3FJSA 1GKBA 2XGXA 4AHXA 4NWVA 3QLQA 4LOSA 4UW4A 3BUCA 3V65A 1OKOA 4JGZA 1D4M3 2QZ3A 1KDMA 4QX3A 5D2AA 3TNQA 4CXYA 1UY3A 2FHRA 4OHVA 2BFUL 2R16A 1FNZA 2C26A 5F8PA 4HK9A 3CL1A 1CX1A 1W2NA 2BQPA 4QPIB 1DHKB 1GR3A 1ULPA 2PHRA 1N3PA 1RUD2 1CR7A 1LU1A 2J7MA 1DFQA 2H6CA 4R9AA 5KXCA 3GZTB 2JKBA 1HQNA 1UQXA 1W90A 1VBA3 2ENRA 2KM2A 2RE9A 3HIFA 1GWMA 2XKPA 2XQRA 5FYZA 3D6EA 5I0DA 4FPCA 5FYTA 4RHV2 2HBUA 4AEJA 2WQ8A 3A23A 4CCEA 1AR62 2HH9A 3LA3A 2W5FA 1NCQB 1QXJA 2XXZA 5BY5A 5DUVA 1V6MA 4BZ4A 4D7SA 5A1LA 3NSTA 4BDVB 1UOGA 4LBQB 1O3TA 2R30A 5HCFA 3B5LB 3N9NA 1BZWA 2P3IA 2WFF2 3EMRA 4IEVA 4RGAA 3T4VA 4CDXC 4R9BA 1V0AA 1W2UA 3BOPA 4PQ9A 4KQ7A 4RD7A 1NCRC 1YFWA 3N7MA 4N43A 4XF3A 5I0UA 4CE8A 1PGSA 4CZSA 1U5YA 1W99A 4AQSA 4LUKA 4RHV1 1CQ9A 2FMDA 3B94A 3NVCA 3PNAA 4R4XA 5FYHA 5BNNB 4YVWC 1PK6A 2ZHMA 1SDDB 2XHNA 3SMHA 3VD7A 4L0PA 4HETA 5A6XA 3RYKA 3FL7A 1FNYA 1HXS3 2DCKA 2C5DA 3PJQA 4YM3A 2ARXA 4K7JA 4ASKA 2GH2A 1UKRA 1SLCA 1OLQA 4A45A 5LRRA 1YQ8A 2AGSA 2V5DA 4QKDA 2GNTA 4TSVA 2P3KA 3KQ4B 4JTNA 5CKMA 5GM0A 5IAXA 2EALA 1OLME 5L36A 2RS11 4CP2A 1PM4A 5LA2A 4AVTA 2RR11 2ADEA 2EAAA 5DDJ3 5DAWA 3ACHA 2RDSA 3EHKA 3OD4A 4JDNA 1VMFA 4M4PA 4WM7A 3TOJA 1IPSA 2H0VA 3KV4A 4DXZA 2IC1A 4KH9A 3HNMA 3S6PA 3USUA 4Q4V2 4BQYA 4AEDA 5BNNA 2WT1A 4UBGA 2D6MA 4ES8A 3O1SA 1O3SA 1LTEA 1W2AX 4LKSA 4MYEA 2PAEA 2WA4A 5I0TA 4CEYA 3KV6A 2WR9A 3MYXA 3WW2A 4JZRA 3AKPA 4MGTA 1DF0A 4J6GA 1IKQA 3AP7A 3KGZA 4FXGB 1EYBA 1UYZA 3IDEA 1XYPA 3ETPA 5CYYA 1WGPA 5FZFA 5LB6A 1OFNA 1YCIA 4ASLA 5C5UA 5J09A 1E5HA 2OPWA 3WDVA 4CUAA 3TN93 1J3PA 4M3CE 1YUDA 3AMMA 2W87A 3OYWB 4HZFA 1RB8G 5FPXA 4IEWA 4BA6A 1ZBE2 2VQTA 4AVAA 3ZR6A 2W39A 2WYSA 4BQ1A 4AEKA 2ET7A 1WCUA 1Q43A 5JUVA 1FMD1 1H2LA 4XE9A 2AEZA 3RVHA 3UKTA 5ISLA 1XPWA 2PN5A 3NAPC 4IE6A 4AL9A 5JZGA 3F2ZA 4N43B 1Q8VA 5CNAA 2VO5A 2YC4A 1RJ7A 2A6ZA 2AENA 4DEVA 2D3SA 2R49A 4NRQA 2YXSA 3LEMA 3OY8A 5E16A 1SPPB 2QQJA 1DIWA 1GNHA 2XONA 4Q4X1 4AQ6A 2W1QA 3IZOA 5L73A 4CP1A 2VZ1A 4BLIA 5FCCA 3ZFEC 1A34A 1PX4A 4PF1A 1W9SA 4AOCA 3RDIA 1L3JA 5FOJB 3WG4A 2VG9A 1YXWA 1F15A 4XPVA 5JOYA 1FMD2 1DDLA 1G9FA 1RUE3 1POQA 2F4PA 1DGWA 4GH4C 2VCBA 3KS7A 3NNMA 3P5BA 2XJSA 2VOXA 5C71A 3NO8A 4JRLA 5E8AA 3VZNA 1UZVA 4E4DX 3LIGA 4YLZA 3E6BA 2OZJA 4H55A 2Y8KA 1XNDA 2E31A 3KCCA 3PUSA 4ISRA 2WZR1 4NPMA 4E2SA 1YHFA 2PHWA 4HVOA 1AYN1 3UGHA 4D69A 3NRUA 4NPRA 4RN5A 3A4UA 2GC0A 4JGZB 4PHZA 4QGNA 3VUOA 3BIEA 4FXKB 3PVOA 3GHNA 2QQLA 3A22A 4YM1A 5DZGA 3KVBA 2HKXA 2ZGKA 1C28A 1GNZA 1KS5A 2VQ0A 3BTYA 3WF0A 2DVGA 3ECQA 4NIGA 4UT5A 2HWE3 3C7OA 3VBUB 1I1EA 2UURA 4G9SB 1QKQA 4AAPA 1CONA 4BXSV 4CPBD 2WFF3 2YBPA 2VZ3A 4A7KA 1CAVB 2VMCA 5JZGC 1REFA 5CISA 2NP0A 4WVWA 4WVZA 4DMIA 3OTFA 1UY1A 3AJYA 1M4WA 4N9HA 4M4RA 1CAWB 1RIRA 1RUC2 1D4M2 1GOHA 3IPVA 1PZ7A 2R1BA 1JU3A 4NIHA 4K40A 4MH0E 4HL0A 1GUIA 1JW6A 4UAPA 2R0FA 1PGW2 5GZGA 3ACLA 3JD72 2PLV3 4MHRA 1RUD3 1ACCA 3WG1A 4CRQA 4AFAA 5FPUA 4E27A 4H7LA 3ROUA 1ST8A 3B9IA 5J37A 2VZUA 4CP9B 4E8CA 2OZ6A 3ZFFC 2WN3A 2VD7A 2PTMA 2VULA 1W8TA 1RUI2 3CZUA 2PLV2 2UYAA 4AXOA 3BOWA 4D0QA 4CYDA 4JC1A 4QM9A 5JI7A 4AGVA 1NLSA 1D4M1 2XJVA 2VPVA 1VMJA 2P34A 1W6QB 2IXLA 5DAXA 2E7QA 3S30A 3LF7A 1ALYA 1DGWX 4Q4Y1 5IATA 4KBZA 3N9QA 4A44A 5E6HA 3T2QA 5FQ0B 3TYJA 4WV8A 3NAPB 2MEV3 1LGNA 3C3VA 1DZRA 2EVXA 4DY5A 4Q29A 3LEGA 3WHUA 2RR13 4L9BA 1TMF1 2DDUA 2QE3A 1MVEA 5FXZA 4WM8B 1MS0A 2XQXA 3PIGA 3ZYPA 2WWJA 4HFSA 1VAMA 1O59A 3LB9A 1MEC2 1VJ2A 4LJHA 4B29A 1JZ4A 5L7OC 1GZWB 3N9OA 4O9EA 3NQHA 3V0BB 2DF7A 3IKWA 4IV3C 1NZCA 2BVBA 3ACGA 3LPFA 1OA4A 4XHXA 3OBTA 3U07A 1JYVA 1W0NA 2BBVA 2DTWA 4G3YC 1LODA 3DXUA 3Q8FA 1AUYA 1AX2A 1G7YA 1HRI2 5FY4A 2WT2A 3DPRB 3VKFC 5LWBA 4GWIA 5FV3A 3VHNA 3VL8A 1JYXA 3MEPA 3OBRA 4GB33 5LBEA 1HKDA 5JXJA 2F6BA 3DL3A 4Y26A 3WX5A 1REEA 4LORA 1MS9A 3POJA 4B4RA 1O4TA 3FZ3A 1FV3A 4E9KA 3MDPA 1H1MA 5GALA 3RI8A 1CWPA 3HNBM 4QXKA 4QXHA 1ND3C 2Z5WA 1LOBA 4GALA 3J8F3 2XUEA 3GCXA 1RUJ1 2ZHLA 1ND2A 2CTVA 1S55A 2R061 5ANQA 3UT0A 4OULA 2GN7A 4AVBA 4MOAA 3FHQA 3LWCA 4IXLA 2VZOA 4Y5Z0 5KXDA 4LKEA 4Z07A 3ABZA 2JICA 1QDOA 2P5BA 2YPDA 5FPAA 3VL9A 3ZPOA 2JG8B 2KA3A 3LDBA 4HKOA 2WA3A 2YMZA 3ZYGA 1PGL1 3AZXA 3RZHA 1JYTA 4Z2AA 4N8MA 5A3WA 2VQUA 4COVA 2B7YA 3F95A 1PO21 1QJU2 3H8UA 1W2TA 3I2GA 4M3CA 1O5LA 5LY1A 2FCVA 2ERFA 4UFIA 1C8NA 4P9XA 2DV9A 3QH7A 1OF3A 4XQDA 5FZ8A 3VZOA 5A7WA 2LUWA 4UFJA 2UY9A 4G4FA 3MLLA 2R062 1CZTA 3IBMA 5FO8B 3BVCA 4ASMB 5CFDC 3DV8A 3OUHA 2AC1A 1DLLA 3THPA 1BMV1 2HWB1 4IV1A 5EYYA 1T2XA 4DOUA 3CKHA 2XWJB 4LR4A 3KB5A 4YVWB 3ZFFB 2DBNA 1V9U2 1V6KA 4MG2A 4IEPA 1L7QA 3RZJA 2DFBA 3ES4A 3TEWA 4E4HA 3BI3A 4XF1A 4RR3B 4CDWA 1ASJ2 4QB1A 2P4EA 1BEV2 3VBOA 1AVBA 5G05L 5F7UA 2JG9B 3PVBB 5FZ9A 3VDDA 4A4AA 4KU8A 5H9PA 5T52A 1AXYA 3C7FA 2GNDA 5FWJA 2K9ZA 3IAPA 3M3QA 4FFFA 1HLCA 5FZ1A 2E9QA 1F5JA 3I8TA 2OVUA 4YGBA 3WP3A 1YYNA 5H9QA 1BMV2 3O1RA 1RUD1 3UESA 3I2OA 2E53A 5IUQA 5LCWL 1JUHA 2Q8EA 5IW0A 5C4WB 5EWSA 3GALA 5C9AB 3G7DA 5GZFA 5EYXA 1RINA 3PUQA 2RJ2A 2QVSB 4QQPA 4KI5M 1S1AA 5FZ6A 1PHMA 4EN0A 5IVVA 5BNOC 5FTTC 5L7OB 3AKQA 1RHI2 2RV9A 3AZZA 2VNVA 2RDNA 2A1XA 5GZCA 2E7TA 2ZKLA 1Z7S1 1W8WA 2YG0A 4JQTA 3WW1A 1S2BA 3W9AA 1GZWA 3AKTA 1TG7A 1WA4A 2GALA 5K7PA 4Q4Y3 1SHWB 1C4RA 1LEMA 2KD7A 1XXNA 4BLJA 3PURA 5BUVA 2R0HA 1XNAA 3B9CA 1T6GC 2XUMA 1BVP1 3PTRB 4FQ4A 4HONA 5GZEA 1CAUB 3E5UA 4YZ2A 2XKOA 1XE8A 4L8QA 4A7YA 1VRH1 3RZZA 3IPVB 5IVFA 1ZBA1 2XDVA 3HAGA 1QJZA 3OF1A 3PLQA 5F5AA 1EP0A 3M8LA 5FKCA 2BP6A 1LECA 3I3DA 1TNRA 1X50A 3HT2A 1AYM1 1SMVA 5FBJA 2DYCA 3SH4A 1VB4A 1VRH3 4MX3A 3SC7X 5JI9A 1I9RA 2H6BA 2Y6GA 4YM2A 4IGPA 4W8JA 5FZOA 5C4WA 4CDUC 5LW9A 3RZKA 1CJPA 3W20A 3OGGA 4YFZA 3MIBA 1QDCA 4BQ5A 1UMHA 2ZGLA 1IQAA 1SLBA 2JG8C 1D4VB 4LBNA 4CP0A 4YW6A 1TMF2 1UIJA 5ABJC 1ZZ7A 2EAKA 3AP4A 1V6LA 4ZONA 1WLDA 4HBNA 1VBC3 1DGLA 5FP8A 4D94A 4BCUA 1LNSA 3I2JA 3UGFA 2BRTA 1JODA 3RSJA 4MXWA 1POV3 3DYMA 4IQPA 4C90A 1LAJA 1OURA 4GWMA 4EWDA 1BK0A 1UKGA 4AFMA 3VD9A 1H9PA 3AMHA 2EA7A 2R7EB 2HWD1 4YVSA 2LRPA 4BK5A 4J1WA 3C8XA 2E7AA 5K4LA 2DVFA 1AR83 1IQDC 2FDJA 1Q3EA 3I54A 2R041 4WM7B 4YARA 2NQYA 3SNMA 4XBNA 2N7GA 3LE0A 2OKXA 5GLUA 2XJRA 3CBNA 1S2KA 5BNPC 2JDMA 2UWCA 4KMQA 3BYWA 3I7DA 4FP3A 4WVMB 3V64A 1IOAA 1PMJX 4W6XA 1IHMA 2HWF1 1NX9A 2WS91 2WNOA 1UOFA 3N35A 3MLKA 4RYDA 5FMCA 2VNOA 4I09A 3PIJA 2QQPA 4XZPA 1BJQA 3HBKA 3LZZA 4LO4B 1GBGA 1W03A 3VD5A 5FZIA 4YZ5A 4NHMA 1W04A 4B1MA 3B02A 2LTNA 3W59A 1NQJA 1V70A 4MO3M 1HRI3 1GICA 1W6NA 3NNJA 1C8M1 1NT0A 2DU1A 2NMOA 3FX3A 1JHNA 5F5QA 4HVQA 1W6MB 1LESA 1OQ1A 1ZZBA 5KWRA 5F2WA 1QEXA 2VU9A 1H6XA 2TEPA 1S0FA 4ZXEA 4Q4X2 2DU0A 1YNAA 1W8ZA 3T09A 4DPNA 5F6LB 4DUWA 4HANA 2RJLA 2YY1A 3IT8A 1ULDA 4QB6A 3ZYIB 3WVJA 1QJY3 1JYIA 2XBO1 1KJLA 3WNOA 4EN9B 3RMXA 4CU9A 2ZGTA 5GKAC 4LULA 5ANNA 3U75A 3VDCA 4PDWC 3SEEA 2XL7A 1QGLA 2ILMA 4GJYA 5CBLA 3ZMNA 4QGLA 4COUA 4UW6A 5FUPA 1JN2P 3ZSLA 1STMA 4BK4A 2ZPXA 4K9SA 5FMOL 3OBZA 2Y6LA 1ULCA 2XG3A 4BPZA 2BNOA 1AF9A 2PHLA 3WQ0A 1NA1B 1G9DA 1AR82 1HB3A 3ZSMA 4OI2A 4QU2A 2G19A 4AG4A 3LEKA 4U2AA 5AFEA 4PIZA 2D5FA 1RUG2 4BH9A 2PELA 5F3CA 3WOGA 3KF5A 3KV5A 5DMYA 2OX0A 2D7FA 5ABJB 5CG9A 1NLQA 2JE7A 4XC9A 1EV13 1ZVFA 2JX9A 2PHDA 2NLRA 1ZRFA 2VVEA 3VV1A 4L97A 2BBAA 4W6YA 1PZ8A 1N3OA 3H9AA 2QKDA 5BXXA 2B9UA 1QOSA 4XW3A 2D93A 2V5YA 4MXVA 4W50A 4HSLA 2VMDA 1MVQA 3EB7A 4DZGA 3WY6A 1TMF3 4UBHA 2P3JA 1R64A 4DINB 3KT7A 3NNGA 3JU9A 2DVBA 5A70A 1WBFA 3KT1A 4QQ2A 4TYSA 4X6RB 3ACIA 1EUTA 3NV3A 3H8RA 1QQP3 5B4XA 1RJ8A 1ZBA3 2DVDA 2Y6HA 1D2SA 3O7OA 3LD8A 4IE7A 2OA2A 3N9PA 3S5AA 3WR0A 2CV6A 2FCTA 2ZOEB 5IVCA 5FZOB 5DDJ1 1AYM2 3I3MA 1V6IA 4Q4V1 2Q0AA 4GJZA 1DQ2A 1OA2A 3JXSA 4JGYC 4CXXA 3J4UH 4RR3A 5C8WA 1PO13 2QFEA 5C3SA 5T5OA 5AC93 2D6KA 2C6SA 4IV1C 5JOWA 4XJ8A 1Y9MA 4FCAA 3RI9A 1KITA 4WVVA 4QPGC 5DAPA 1HN1A 1UOBA 2XB6C 4R9CA 4SBVA 5LASA 3VLBB 1W8HA 3R6SA 1BKZA 3X29B 4XHBA 4CCLA 1XSQA 4NO4A 1G9BA 3JB8A 4Y4YA 1RHI3 4P02B 4Y1VA 4IEOA 2A6WA 5LEJA 1XB9A 5C7GA 5C70A 2X10A 4XXPA 2AYHA 2VTFA 5I8TA 1AR92 2EICA 4EWEA 1SZBA 4KWLA 2J22A 4QPGA 1JOJA 1DQ6A 1YFXA 1RUG3 3EYPA 2C9AA 2Y6FA 3WXPA 4AQTA 3FBYA 1SDWA 2WNVB 1VP6A 1GLHA 1SBFA 1W2OA 4NMIA 4RR3C 2AR6A 3JB4C 2EIDA 1XYOA 1Z78A 4JGYA 2NM1A 4PIYA 3B01A 2BDRA 1XU2A 1VBE2 3PJYA 5IVJA 3H1WA 2QUOA 2VCAA 3ASIA 3KF3A 4BXFA 2W1WA 1ENSA 4AW7A 5TSWA 2A73B 4HMZA 4A41A 4Y22A 2Q8DA 3VDDB 2O8QA 1V9U3 1VBA1 5IWFA 1F31A 2ZA9A 2JE8A 1MZEA 1UYXA 4YVSB 3O0VA 3TN92 3ATGA 4ZZ8A 2Y33A 3VBHA 1COV2 1VMHA 2X09A 2WT0A 3K48A 2Q1FA 2DFCA 1XYNA 2OQ7A 1H1AA 3KV9A 3NJYA 3BB6A 4XDQA 4XUQA 4XFBA 1KQRA 3E6DA 3LSEA 2WZR2 1OI6A 3CMGA 2JDZA 3N9MA 1OBNA 4N7UA 2W1SA 4D7TA 4AI2A 1VBD2 2C0ZA 3ZKYA 4AWDA 4FO9A 5LY2A 1ODMA 1KRIA 1N1TA 1BK1A 1PIV2 2PA7A 3AZWA 3OGJA 4JDMA 2RS32 4XFFA 1NG0A 4ZS2A 1UXZA 3POSA 3MFCA 1WW7A 3N7JA 5GLWA 3O0XA 4OUSA 3G6JB 4PI2A 3FE5A 5C3PA 5DN2A 1JZ5A 4IDZA 1RUOA 2QBXA 3ALQA 3ZDSA 1QXPA 1F9KA 4CCKA 1K5JA 4O65A 3H1MA 2IFRA 1NE6A 4Y1UA 1X8MA 3KWVA 4NIAA 2QQNA 4LOTA 4A7ZA 3R4SA 3KD4A 1WW5A 3LPGA 3VBHB 5FYMA 4AF9A 2GC2A 2ZZJA 4META 5KBFA 1H1IA 1HQWA 1PO23 2Q1MA 3ZFFA 2WNUB 4AK3A 3AYCA 3CF6E 5C3RA 3J7NA 2P37A 3RQ0A 4LE4A 3APBA 3VZMA 3FFZA 3MIFA 2WINB 3NV2A 4LA2A 4LEJA 5JCTA 1GSLA 2VW2A 4COYA 1H8TB 1SLAA 4AE2A 4EJRA 1ZM1A 5M0TA 2XMLA 2PLV1 3KVAA 1N1VA 1NYWA 1QJEA 1KD7A 2Y0IA 3K77A 4HKWA 5I8SA 1O3QA 1DYPA 5FY7A 4OLLA 3USUB 1JYNA 1Y43B 3ILFA 4COWA 3QACA 4URAA 4AGGA 5A7OA 2YB7A 3HWJA 4BU2A 1EY2A 1ZBE1 3VHOA 2VVDA 1HB1A 1YJLA 1WCSA 3O14A 1H9WA 1EAH1 1NZIA 2Q4SA 4XVHA 1EUUA 2IUWA 3IN9A 5H9RA 4Q4W2 5SV8A 5F5IA 3LA2A 4Q0SA 1F5FA 5JOZA 5K9YA 5IK8A 3FHIB 1JI6A 1KJRA 3KZ4C 2TNFA 2G1MA 3FC0A 1K5MA 1UZWA 3RFRA 5CADA 4FPLA 4S2HA 5FO9B 1VBE3 2W47A 4ZY9A 2FDKA 3CJXA 3RZMA 1C1LA 2VGDA 5L19A 4CDQB 5JSPA 1BQPA 3AP5A 3V0AB 1UY4A 2IWGB 3K3OA 3VBRB 1MS3A 4XJZA 3WF3A 4A6SA 2ZHKA 1NCQA 1W9WA 1DQ4A 1W6QA 1PVC2 4CCNA 1WW6A 3WW4A 2HWF2 4TXWA 4UFKA 4FPEA 1G86A 5FDBA 4K6BA 5E89A 2AZ5A 4YVSC 1IPKA 4YW4A 1EAH2 4QX7A 5HV0A 1HRV2 2X53S 3K4DA 4GH4A 5DAVA 2VNRA 4OZOA 4XZUG 1R082 4BQXA 2DBIA 3NV4A 1RUH3 5DUXA 5C8CC 1HX6A 2QQKA 2VH9A 4FPGA 4H7MA 4Q2FA 3AFKA 3OEAA 4S2DA 1WMEA 2HWC1 3ES1A 3RWNA 5ABJA 3MIEA 3ZN6B 4EN6B 1AR72 2D43A 4XETA 5HPOA 2JG8A 2ZGPA 3TEYA 1UYPA 3OB8A 2W1UA 3WZ1A 4ARYA 2EIBA 3SHRA 2BWCA 1UZYA 3PTYA 4PLOA 3EXUA 1NXMA 1XBFA 2BOIA 4LITA 5IAVA 4W4ZA 5F3IA 5LBFA 2V73A 2XBO2 5F5CA 5FZ7A 1OFSA 3NAPA 4AVSA 1CAVA 1H8VA 3TNPB 5J48A 4HN0A 1RUNA 1S0BA 2ZGUA 1O7FA 3H3ZA 3NKGA 4XCAA 1RMU2 2RM23 4ATFA 2LROA 2IFWA 5EZWA 3WNLA 2Y60A 2RMU1 5HXVA 2BPA2 1GWKA 3T4HB 1VAVA 1DLCA 4EYUA 5HV4A 2ZGQA 3VKOA 1VBA2 5FAXA 1Q8OA 2WNEA 4QQHA 5FP3A 1KDKA 3ZR5A 5FBZA 2WNUC 2XJPA 3WD5A 4RQPB 4YZ4A 1N1SA 2WYFA 2WAOA 4P5YA 3P6BA 1FMD3 3ZSKA 3RMYA 2O14A 5A3NA 1V6OA 5FZMA 1FYUA 2O8OA 3PU3A 1C8M2 1W6OB 3IM0A 5EJZB 1W6NB 1HJFA 4XIOA 4AEDC 2JB4A 3PVNA 1MQTC 2B39A 1ZZ9A 2DURA 1VBD1 4HK8A 4FAGA 3CQOA 5ERLA 5GLTA 1DU3D 1UD1A 2YHJA 2ZEWA 4LTAA 2YFZA 4AVCA 5CKNA 2EXIA 2VCMA 1QOTA 4LLFA 1QY4A 5J3UA 2YYOA 1NLRA 4NN0A 1UZZA 3RRDA 3VBUC 4FTSA 2VTXA 3J8F2 3Q8AA 4I0BA 5FZ3A 3DUIA 4JGYB 1ZRCA 3PMEA 1UL9A 3O12A 4GKXA 4ZU5A 3FHAA 1LHUA 5AVAA 3JQWA 5EV7A 3OEBA 4XMIA 4Y4RA 2WAAA 2XL9A 5FWEA 4D7YA 4EE2A 1O4ZA 1LHOA 1MS4A 4GB32 5JPMB 1UU6A 4NAMA 1RC6A 3CDZB 4XQWA 5FMBA 5CFDA 1O3RA 1JH5A 4AI0A 3POFA 3GM8A 4DB5A 5CAZA 1KS4A 3NJVA 4DXTA 2ZX3A 4XFCA 2RG4A 3DYOA 4CDXA 4OHXA 1BCXA 2JIJA 2ZCWA 2WDBA 5L9RA 4DS0A 2PAKA 2YPJA 1DP0A 3O0WA 5J36A 1VRH2 1SBEA 4XFIA 1AL22 1CAWA 2XH6A 4PBPA 2HEYF 4BMBA 2RS13 4MADA 1X9TA 4S2GA 2Y34A 1WCKA 3MPPG 1UWWA 2BNNA 4DY3A 4HXCA 3WDUA 5A32B 1ZREA 2X5IA 1A78A 4I0WB 2Q30A 2VMHA 5A6YA 5F9TA 3WP6A 2BZDA 4DQAA 3NKTA 4XAEA 1WCDJ 5KHIA 1WBLA 2B4KA 2EIGA 2ZEYA 4K1YA 1W9YA 2VZSA 3EJKA 4D6QA 1ND3A 5FY0A 2AREA 1POV0 4GWNA 2MPFA 4NRMA 2VQAA 2ZGNA 4NWWA 4FOYA 4BM8A 1WMDA 1EPWA 2YBSA 2IZWA 4IE5A 1C1FA 5B2GB 4DXSA 4A42A 4V1PA 3FLRA 1MS5A 3A21A 2YGMA 5IFTA 1RVF1 5IK5A 1IZ3A 4TTGA 1U5ZA 4N53A 3VD3A 4OQ9A 4AYUA 1A3KA 1JYCA 1JZ6A 4HN1A 4OZXA 2R6QA 4Q8LA 5L9VA 1FPN2 4MGYE 4FI9A 5FREA 1VRBA 1UYYA 4IV3A 3NNFA 5F37A 5L7OA 2HWB2 1WW4A 5AFBA 3VZLA 4Q8KA 1V9U1 3E1F1 3AJZA 1SPPA 3M7AA 2BGOA 2BTVC 4FSJA 1Y9GA 3THCA 3A0NA 1OXCA 2JD9A 2ZMNA 3DECA 4BISA 2B5HA 3KLSA 4IEUA 2HWB3 4IL7A 2VOWA 4COZA 4H2AA 3LCPA 5A3LA 1I6XA 1UU4A 2WS92 5KXEA 2XVGA 2KR2A 1UY0A 5IVBA 4NIIA 1V6JA 1W28A 2G4IA 4FPJA 4GWJA 4OMCA 1UIKA 2HWE2 1D7PM 3OGVA 1ONAA 3FN9A 1MQTA 3GZUC 3VHRA 4GMP0 5DPNA 2IXJA 2WSVA 4Y20B 4BQ2A 3Q9OA 5D8AB 3M2MA 3AC0A 4GZ9A 4WZCA 1OOPA 4FFIA 2GDFA 2ZBJA 1W39A 1W0OA 1OOPB 1R1A3 1WMXA 2DCTA 2YV8A 3DEMA 2UY8A 1QJX2 4LUMA 3FUOA 1QOOA 3S5QA 2HEWF 2VOVA 4HPKA 2WZPP 2ZACA 2D44A 3QBQA 4BYYA 1Y3TA 1RHI1 4YFWA 1YC61 4E2QA 2WABA 3T1MA 1D2QA 2WNUA 2W52A 2QQMA 1JMUB 3GZEA 4IETA 4YSFA 3O1MA 4PLMA 4HT1T 5J96B 2QNKA 2XLFA 3KHBA 4KWJA 2IVIB 3WF1A 3SH3A 1AXKA 3MF6A 3SCHA 2E63A 1JZ2A 4HVRA 1COV1 3RWKX 4NJ4A 3POYA 4QQLA 1GYKA 4BMEA 1NKGA 3ZYHA 1UX6A 3I59B 1LR5A 5FPZA 4ATEA 4DUXA 4UFLA 3WQ1A 5DABA 5BNQA 3BTXA 2XR4A 3K4ZA 3UJOA 3SH5A 3WDYA 4Y1YA 1I5PA 3K4AA 3IIAA 4QX0A 1J84A 2YROA 4CTEA 4LBJA 3SKVA 2R071 3OGRA 3BIWE 4O7XA 4CDQC 3LOIA 3I2KA 4INDA 1XSRA 3QD6A 3JD71 2VW0A 4L99A 1BYHA 2DCZA 1G9AA 1SG3A 2WZR3 3J8F1 4IE4A 5JR2A 2CU5A 1LHWA 1VR3A 2JDHA 4MLOA 3LA7A 4NHLA 4NRPA 1U5IA 5C8CA 2VMFA 4CDWB 1HN0A 5C9AC 1MEC3 3L2HA 5A33A 1W6OA 5FY8A 5KXBA 5GZDA 1W6MA 1W6PB 1X33A 3MFAA 2TBVA 3RS6A 4UXAA 5FZKA 4CPBA 2K2SA 1PO11 1O8SA 4KGGA 1DG6A 1FOD3 4C1XA 3LDRA 3SCFA 1OH3A 1NCQC 4C8DA 4YPJA 2HWD2 2HBTA 3H42B 3H1YA 3HNYM 1NQDA 3B69A 1XOYA 4JQRA 3MGUA 4JV4A 4W65A 3OY8B 5FO7B 1ULEA 4CCDA 1WKYA 4TLGA 4XTMA 1UPSA 5T5LA 4YYOA 1C8M3 1YQCA 5FRAA 5LRSA 1K5MC 1D0GA 2RJKA 1G6NA 4ARXA 1HDKA 4WVMA 2JWPA 3ZYJB 5DDJ2 5FPVA 2J1VA 4NOTA 1NCRB 1BVVA 4JKLA 4AHYA 2WO7A 3KMHA 3MW4A 1DGRA 4QKFA 3CEWA 1UCXA 2V72A 3J7MA 4LXLA 3ETQA 1PNGA 3N3HA 3N7LA 4UWDA 1OKQA 1UAIA 2AH2A 4XJ9A 1HB4A 2JECA 3UNPA 3VDBA 2ZMLA 4FVVA 3LIHA 4QX8A 4J1XA 5E88A 2PFWA 4E4ZA 1CAXA 1UY2A 5CKQA 5CEHA 2BYVE 3T0AA 4QAWA 5F3GA 4I3GA 2NYYA 5JR7B 3JBG2 5AC91 4CU8A 4BE3A 2VVFA 1ENRA 1SFPA 3FLPA 2J1EA 1RVF3 5D21A 2RM22 2ZGRA 3GHMA 1DGRN 3BU7A 2BNMA 1JBCA 2YZ4A 4HPKB 1AR91 4ONUA 2W0XA 3T2OA 1ZA4A 2UYBA 4ZU4A 3VHPA 3WNMA 4B8EA 1OD5A 2C24A 2GC3A 2SLIA 2X29A 3I2DA 5KHHA 4FPYA 3OBAA 1B35B 2BU9A 2WLPA 3D8CA 2I74A 3KSCA 5JAXA 2OPKA 4FFHA 5BNNC 1MQTB 2GMPA 4JAAA 1ZX5A 5APAA 1GV9A 4CCJA 3AFGA 2CWSA 1Z0HA 3KGLA 1LCLA 1RMU3 4WM7C 5FY5A 5FZBA 5I91A 1WD4A 3LFMA 4GQ7A 5B4NA 4FBFA 1AYN2 1OLMA 3I59A 3PUAA 4WM8A 4XAAA 3AL5A 3L9JT 4UF0A 5H9SA 3W5NA 5T50A 3FWEA 2X05A 5A6QA 3ON7A 1MACA 1BBT3 2QQWA 1PZ9A 1B09A 2J1UA 2ARCA 4ISQA 1XC6A 4LK6A 2FDHA 4JKKA 2W92A 2H0BA 1HB2A 1W8FA 2A71A 3I3EA 3I3QA 3R0RA 1XU1A 3TEXA 3GBWA 1PVC3 1JU4A 3POBA 4YVWA 3ZYFA 2UU8A 2Q8OA 2GU9A 4ES9A 2RS52 4OQ8A 4YWAA 3O1OA 5A80A 1NE4A 1GP6A 5SV5A 3EQEA 1XE7A 1RUC1 1OVPA 3RNSA 3VBFA 4WBBA 1ASJ1 1LB2A 5CIRA 1NCRA 4N43C 4CXWA 2Z4FA 1BEV1 2GP3A 5F6KA 1OH4A 2PHTA 3M70A 3PDQA 3POEA 1U5XA 3HEIA 4A6OA 2FD8A 5K0UC 1J83A 1YRZA 2VXRA 2WFF1 1K3IA 2YGLA 1R092 3NJZA 5FZDA 5FIXA 2FDFA 1IKPA 4NUBA 2W91A 3ZFEB 3W58A 3AL6A 2RS51 4XJUA 4EQVA 2F4LA 2KXLA 1K5MB 2LW8A 5FJHA 1AL21 1YWKA 2WN2A 2J42A 2QTWB 1UN1A 4YW2A 4BIFA 5A32A 3BGAA 2GN3A 5FFOC 3VBFB 3AVRA 2JDUA 2HWD3 5DAQA 5FZAA 2QQUA 4P9GA 5K8SA 3AYDA 3MIHA 3KT4A 3ME2A 3CZJA 1KXGA 2JENA 5F39A 1JUIA 3H8XA 3OGSA 4XIKA 3W21A 4AGRA 2G9ZA 4DNYA 3PMSA 2ORZA 1QWRA 4Q4X3 4XILA 4IESA 4BQ3A 1IPJA 4JGZC 5GLZA 4F83A 5FK8A 4Q0VA 4C1WA 3ZOIA 3VB9A 1UF2C 4KNCA 3VZJA 3E6CC 3JQXA 1GZCA 4M3CB 4AFCA 1RUE2 5KHKA 3HMYA 3MLJA 4Q1RA 2ID4A 3WQ7A 3L2YA 1QJFA 2D3PA 2BUKA 3U4SA 5EXOA 3DKWA 1IG0A 2P2KA 2JKXA 3AXEA 3CNAA 3Q8EA 2DUOA 1PIV3 1WMFA 1B35C 2CWMA 4RS5C 2PYTA 4XURA 3IWZA 2VUJA 4CUBA 2ZHNA 1AJOA 1ENQA 3DGTA 1YIFA 3FUQA 4H14A 4LA3A 1QIQA 3V0AA 1FOD1 3M1HA 3QH6A 1WA6X 3O1VA 3SQOA 1OUXA 4I02A 2B8MA 3ZN5A 5JDBA 5A7PA 4LHNA 1OQEA 1IGOA 5K0UA 4RFRB 5A7QA 4B7KA 4CCMA 2B42B 1RGSA 3PUIA 1AL0G 1TVGA 5FR3A 4EN7B 1AX1A 1QH7A 2VNGA 4D3WA 4XUNA 4UW5A 3NL1A 1J3RA 3JUUA 3I2FA 1YIPA 2EXJA 2HWE1 3AXDA 4M0NA 2EXKA 1SFYA 4QHBA 2A6XA 1NY71 5JSRA 4PIXA 1US3A 1Y9QA 1SLTA 5T3NA 3T1LA 3DF0A 4CCOA 1R081 1WCQA 4P14A 2MEV1 4XF4A 4YGCA 5FYIA 3AB0A 4CP9A 1HV1A 1UMZA 2VR4A 1KFUL 1VIWB 2QCSB 4QX2A 2WQZC 1R1A2 2A3YA 4FFGA 5FZHA 2HWC2 5FP4A 4OMDA 5CA6A 2YC0A 1QJX1 3ENRA 3GDBA 2VZTA 3T2PA 1XJAA 1QMJA 3DXTA 3ZPYA 2A3WA 4AVVA 1AR63 1CPMA 3RJRA 4LK7A 3WUCA 2ARAA 1HXS1 2D40A 3M3EA 3D5OA 1E5RA 4F3JA 4W6WA 5LA9A 2CNAA 1OQDA 3GNEA 4WM8C 3V56A 3WG3A 4AFBA 1FPN1 2WS93 3WF2A 2E26A 2Y64A 3M3CA 3EO6A 1LOEA 1V6NA 4IEZA 4IV3B 1W9FA 3RYRA 3ZXDA 4KGQA 1RMU1 1MR5A 5D8AA 1WLTA 4JKMA 2BOJA 2LALA 1TZOA 4PDWA 1VBB3 2RMU2 2ZX1A 4OYUA 4DRVA 4BB3A 4XCBA 4E8DA 2D6LX 5CFCA 1HXS2 4XACA 5FPLA 1HIXA 5HCAA 1XNBA 5FZ0A 4PJYA 2R072 4DUVA 5IFPA 5F3EA 3HN3A 5A1AA 2OXBA 3ZYBA 4B1LA 1F4HA 2IXHA 4P9WA 5BYNA 4AZZA 3D0JA 5E1RA 2DWRA 2Z2SB 1ND3B 1RYYA 3UKNA 3CLPA 2C9KA 5DZEA 3ST7A 3WDTA 5J7MA 1S0GA 3S0MA 3H3UA 4NE9A 4N7IA 4XJAA 4GAZA 2EXHA 5FMDA 1K42A 2Y6JA 5I0RA 3MICA 3BKZA 2JXAA 3I4IA 5LZ6A 4I30A 4V2VA 3TEZA 3B00A 2R32A 3DPRC 5EJ1B 2W68A 2I07B 3PU8A 4MVTA 4AR2A 2D98A 1US2A 2GMMA 2MNGA 4C91A 2BGPA 3VKNA 3RYPA 1C5IA 2GAUA 1AHSA 4LT5A 1NOVA 1CGPA 1LULA 3M3OA 2RHPA 1HQLA 2VZRA 1RUG1 3GF6A 3P3NA 3R4DB 5BNPA 1G8WA 2YC2A 3WP4A 2RS12 5FKBA 1J58A 1OHFA 4HSJA 1AL23 3J7LA 5J1XA 4KL1A 4XDPA 5IVYA 1E57A 2K0GA 4YW3A 3PL0A 4IEYA 4QDQA 1U12A 1ZNPA 2BJSA 5FPBA 1AR93 1LOCA 1ZZCA 1RUF3 4GXLA 5FYUA 5A3OA 5F1RA 1YQ5A 2Z42A 4N53B 4XFGA 4RA0A 2ZKNA 5A7WB 3KCYA 5C3QA 2VXJA 4Q27A 3U37A 2HEVF 4Q0QA 4OI1A 2HYXA 4XUTA 5JLVA 5FUIA 2XVLA 3M3IA 3I49A 4FOQA 2JG9C 4KWKA 1UX7A 1GQHA 1CN1A 3B93A 2ZXQA 2MHFA 3N9LA 3OCPA 4L11A 5AC92 4I2OA 2I45A 3TWIA 3CJIC 3DYPA 4ZKTB 2HJIA 5A3UA 4R4ZA 2JDPA 3WCRA 3HR9A 1CIYA 2X5IB 3FFQA 4L92A 4P9LA 3ZIXA 4Z1VA 5C4WC 5KC6A 4A2UA 2EF6A 3J9SA 3WSOA 4IEXA 1ZRRA 1AYN3 1EV11 1KGYA
chains in the Genus database with same CATH topology
2E6VA 2DCYA 4QPYA 1S0CA 5LK5A 3ZXFA 1SQ4A 1LU2A 1CESA 3O5SA 4PF5A 4C0BA 4YG3A 1UU5A 4BOWA 4P5HA 2O0OA 4GKYA 4M00A 4K21A 2ZAAA 4YRDA 3VBRC 4LBQD 3VZKA 1XNCA 2FQPA 5CB7A 2VECA 1GFF2 4LHLA 5LK7B 3ZFGC 1Y7BA 4LHKA 1YI7A 3ZVXA 1EV12 4QPIC 3WNXA 1ULFA 4JCKA 3JBG3 3BCWA 2CYFA 3NWKA 4MGKE 1AX0A 3MZHA 1Q56A 3RJ2X 1DQ1A 2A7AA 3VGIA 1R1A1 5ACA1 4KBBA 4LBKA 4RGGA 2WL1A 4N9IA 3JBG1 5AVPA 4OVEA 1DQ5A 5K0UB 1H30A 3ZN4A 1LJ7A 1YFYA 3ZN6A 2ZAHA 2A5ZA 1C5HA 1NA1A 2CGOA 3WDWA 4SLIA 4WZFA 3TN91 1SACA 1QQP1 2WLQA 1OLRA 1ZBE3 3ZYRA 1VBC1 1CD3G 1SFNA 1RUI3 3AKRA 3M4FA 4GMP3 4LBLA 4M3CF 3LGRA 2D6OX 5HBAA 1X36A 2TUNA 2V09A 4YGDA 2GMEA 2XLAA 1RUH2 1YI9A 4FTBA 2PHUA 1J59A 1H4GA 1QF3A 4N53C 1D0HA 3MPBA 4B4QA 3SXWA 1FX5A 1PIV1 2RS53 3GBFA 2ZGMA 3AP6A 2BFUS 3FBMA 4JRAA 2G9GA 4GIQA 3MI8A 4ORFA 3WHTA 4EROA 4Z8BA 1AR61 4EV0A 1BBT2 3CJIB 2CAUA 2X8KA 4AEDB 1RUH1 3KCXA 4RS5B 1LKNA 3AYAA 4S2FA 2X5IC 3DN7A 4KG0A 2R043 1ND2C 5FOBB 1AR73 4B3NA 4DRRA 4JVAA 2BGCA 4Q4Y2 3GZAA 2W08A 3UK9A 2ZMKA 2DCJA 2VMGA 1H8TA 5BNPB 4XBLA 1R091 5KHJA 4RL7A 4QD2A 1CAUA 2DUPA 3CO2A 1ZYBA 1C57A 2XWBB 4XF9A 1WLWA 2UWAA 4MGZE 1MS1A 3WLUA 3JZVA 4PDWB 1RVF2 2NZ9A 3ZFGB 3THTA 3MF9A 3AMNA 3UJQA 1POV1 2OIIA 5C6CA 4Q4W1 4XEZA 5FLHA 1NY72 1VBB2 1YO8A 2RMU3 3VN4A 1SEFA 5EFUA 3N4MA 1HRV3 3VBUA 3E97A 1NA1C 4X8PA 4FPFA 4Q4W3 4MSVA 3MW3A 3T2TA 3WG2A 2WC2A 5JIUA 1LOGA 1RUJ3 1XRUA 4L2NA 4PBOA 2RS33 1PVC1 4A3XA 1UW8A 3POWA 1J3QA 1FV2A 3TAYA 4GH4B 1M06G 3E5XA 2WFPA 4QPIA 3GBGA 4B7EA 1IS6A 1PGL2 1FOD2 3ZFGA 2BWAA 3WINE 2FZ1A 1VB2A 4PCRA 4AEMA 1EPZA 1PO22 1PM7A 1QJU1 3VBSB 3VBRA 2IXIA 3MIDA 3H50A 4YZ3A 5JIAA 1F8VA 2IXCA 2OUHA 4FPHA 4AQ2A 4B4PA 1ZRDA 2ZX4A 4QMAA 2ZTNA 2CY6A 3WT3A 1G9CA 3U4XA 4CEWA 1J1LA 3H7YA 4ZXKA 4OI4A 1Q8SA 1CVNA 5JZGB 3SITA 4OHWA 2WNVA 1S0JA 1CJDA 4IV1B 2VUAA 1LGBA 3MW2A 4BWOA 1WLCA 1VALA 1VBD3 3CJIA 1ND2B 5GJ6A 3HQXA 2GSYA 3ZXKA 4QQOA 2ATFA 1YJKA 2IXKA 2RS31 1WD3A 2JG9A 4NVPA 1RITA 3LKJA 4JDOA 1U0AA 5JOXA 2XJUA 1SLIA 2R063 1W6PA 2SBAA 4LE3A 2DUQA 1XNKA 3AM2A 5A33B 4MXWB 3ZSKA 2JEMA 4XTPA 3WQ7A 2CGNA 2ETEA 1CX4A 4QPGB 4XJWA 4YW1A 1QJX3 1QJU3 1TNFA 4FPKA 3V0BA 1PO12 3ZFEA 1DYKA 5I8YA 1GANA 4FP2A 3ZXJA 4P9YA 2XVKA 2XLGA 4UW3A 2ZGOA 4EWAA 3ZXLA 1BXHA 1MZFA 2A3XA 4K1ZA 2NPIA 3WUDA 4AHZA 1RUF1 3DPRA 1BBT1 1ZBA2 1SCRA 3QCWA 3INAA 2WNVC 5T54A 3TBDA 5IK4A 1OA3A 1FATA 5CU1A 4OUMA 3ILRA 3J26N 4LNVA 2BW8A 1A6CA 2O1QA 3FLTA 4Q26A 4CEWC 4TLFA 5DUUA 3ZSJA 5I0SA 5CG8A 1HV0A 4R8HA 4MZUA 1QNYA 1RUC3 4Z92B 4Y1XA 1ENXA 1RUF2 2A70A 4K20A 5LEKA 4NHKA 1RUE1 2ZS6B 5I93A 2Q1ZB 4XF0A 2AUYA 3IDCB 4URTA 4CEYC 4XFHA 4XQ4A 1OPOA 2Y26A 4YG0A 1VBB1 1MZ6A 3AX4A 3WW3A 1WUVA 3CU7A 3N7KA 4Y24A 3ZXAC 4RSUA 2R042 3AYEA 4LBMA 5ACA2 4X8NA 2XBO3 3LOBA 4GULA 1CPNA 1AR71 1LENA 1MEC1 1R1ZA 2D6PA 1Q8QA 4M01A 2B46X 2VY0A 1QJY2 5IK7A 4HLTA 3BALA 2Z79A 1R093 3LSDA 5FMOS 1O91A 1PK6C 4O9GA 5CFDB 5JPNB 1HRI1 2GZWA 2R073 4XBQA 3ZMOA 3S7IA 4HKLA 3VBHC 1R083 4XXAA 1VBE1 3ELNA 2LM3A 3PVEA 4AFDA 1EAH3 4QM8A 3AK0A 1CIWA 1DQ0A 3SLIA 4RFT0 2ZJCA 2HWF3 1QJY1 2VOKA 3TRSB 3ILNA 3IMNA 1H8TC 1RTVA 3ZSEA 2XHKA 3U11A 1IS5A 2BVVA 3VKLA 3WP5A 1CAXB 4XFAA 1AXZA 3NV1A 3ZO0B 1PVXA 4F8AA 1B35A 1OMIA 1S0IA 3LAGA 2Y38A 4Q0PA 3ZIWA 5T5PA 3D82A 5BNOB 3SCGA 4YGEA 3S7EA 5C8CB 5CVRA 2Y0OA 2GC1A 1XQNA 4R9DA 4CEWB 4ZU7A 1AR81 2PHFA 1IS3A 3QOPA 4P9JA 1HW5A 2G9FA 4KU7A 4LO6B 2NN8A 1VBC2 4QGMA 3H7JA 3BPZA 3RPQA 3AZVA 2ES3A 1X7NA 4OHYA 3MIGA 3P3PA 3N36A 4GB31 2QDRA 4Y1ZA 4CEYB 3NW4A 1SLLA 2CAVA 4GA9A 5EJ3A 4CDUB 4P9IA 1ULGA 1H2NA 2E51A 3RG0A 4C0HA 1LOFA 1W0PA 5DUWA 2A6VA 3VKMA 4YM0A 4K3UA 3WDXA 1H2MA 1PMIA 5FQ0A 1REDA 5GLVA 1TQ5A 3C2UA 4CDXB 4TWTA 2YUEA 2XJTA 1YLLA 1GZ9A 3FMGA 3VBFC 1TEIA 3HN1A 1QH6A 2GNBA 2XPJA 1QU0A 2WWSA 3R4UA 4QT6A 4LO5B 1DZQA 4I0AA 3URFA 3VBSC 3UKVA 5JSOA 4FTEA 5CFCB 2D5HA 1COV3 4AI1A 5A3MA 4LO7A 1QNWA 4RQPC 2ZZQA 4RHV3 2QJVA 3JCIA 1O4YA 2HYKA 4YG6A 1Q5OA 1TME3 2NMNA 4XOGA 5BV6A 4Q4V3 4Y22B 2PAMA 2OUJA 1TE1B 2UWBA 1JTZX 4N90A 3OPZA 1FXZA 1AJKA 3B7MA 1FAYA 1RUJ2 4LLOA 3HD8B 5FLJA 4FQZA 1TME2 5KC5A 1HRV1 1VAKA 1F2NA 1ASJ3 1URXA 2BEOA 2ZX2A 4YZ1A 1Q8PA 5JMCA 2WKKA 1ZZ6A 3E5QA 4K8FA 3PHMA 1LEDA 4AHWA 2DVAA 4Q1PA 2PQQA 4IERA 5T5JA 3OJBA 2RM21 3H0OA 1N3QA 2ARBA 2FMYA 4XYXA 4PLNA 3ZXEA 2JJ6A 3GYDA 4Q0UA 1LRHA 2P17A 5KHGA 2WJSA 3ZX7A 3AKSA 1V00A 1LHVA 4E2GA 4F7ZA 3WCSA 3EBRA 2D6NA 1N1YA 1LGCA 5ACA3 2VMIA 3D4KA 4FOWA 2Z69A 2D97A 3KM5A 1BEV3 4BHPA 3VBOB 1PNFA 2C1FA 1AYM3 1LHNA 3KQRA 2OYZA 2FZ2A 4LBQA 1H0BA 1FI2A 5J98B 4OHZA 1ZZ8A 2R1DA 3U0ZA 5IT6A 2A75A 4Z2WA 2FBEA 4AI3A 1GQGA 5HI0A 2XJQA 4LO8A 2GH8A 1RUI1 1S0EA 3HT1A 2A6YA 4GMP1 4XMAA 3BTAA 1NXD1 1YFUA 4FT8A 2HWC3 3OYWA 2B45X 2DTYA 2ZABA 3U10A 5C9AA 1IS4A 4M0HA 2WIIB 1Z7S2 1I3HA 4ITCA 4FAHA 1OPMA 4KG8A 3WV6A 1FPN3 1A8MA 4OFGA 3SISA 1H4HA 1MS8A 2D3RA 4IEQA 5CFCC 4CDQA 2QZ2A 3AMPA 4H3WA 1KFXL 2PHXA 4FPOB 2Q5TA 1DZTA 1APNA 2RR12 5D8AC 4R52A 5FLIA 4AI8A 1J1TA 3B3QE 5C33A 2YDEA 1PGW1 1MZ5A 4I01A 2QDNA 4DFSA 3OD0A 4FOVA 3HBZA 2OW4A 3BODA 4YNIA 4RQPA 1DBNA 3AMQA 1I5ZA 3UV9A 2ZX0A 4U36A 5BPXA 1UPIA 1OSGA 1PK6B 3VBSA 4YW5A 1O5UA 3USSA 1S0DA 3UL2A 1SCSA 1AZDA 1H2KA 1QHDA 4X6QB 4Z82A 5BNOA 1QXRA 3ZXGA 5DG2A 4MV2A 5DZFA 1OOPC 2JD4A 5JWPA 3AP9A 1X82A 2CL2A 5JVVA 1X8EA 4E4SA 1A8DA 4Y20A 1N47A 4LBOA 5T55A 3A0KA 2ET1A 2JE9A 1RL3A 4OI0A 5HCBA 5DXDA 5DG1A 4QX5A 1FT9A 4NR1A 5D1IA 1LOFC 4I3PA 3VDDC 4JTOA 4MGIE 2WSUA 3K51A 3VBOC 2VW1A 3IDBB 4CDWC 4RS5A 3TB0A 2GNMA 2ZGSA 1TME1 1C3HA 1QQP2 2MEV2 1LOAA 4BIOA 4MUVA 1JXNA 2WQ4A 3JD73 2I2SA 1SBDA 3D0SA 3R05A 4EN8B 3AZYA 1Z7S3 1VLNA 3FJSA 1GKBA 2XGXA 4AHXA 4NWVA 3QLQA 4UW4A 3V65A 4JGZA 1D4M3 2QZ3A 1KDMA 3TNQA 2FHRA 4OHVA 2BFUL 2R16A 1FNZA 4HK9A 3CL1A 2BQPA 4QPIB 1DHKB 1GR3A 2CGPA 2PHRA 1N3PA 1RUD2 1CR7A 1LU1A 2H6CA 1DFQA 4R9AA 5KXCA 3GZTB 2JKBA 1HQNA 2ENRA 2KM2A 1VBA3 2RE9A 3HIFA 2XKPA 3D6EA 4FPCA 4RHV2 4AEJA 1AR62 3LA3A 1NCQB 1QXJA 5BY5A 5DUVA 1V6MA 4BZ4A 4D7SA 3NSTA 4LBQB 1O3TA 2R30A 5HCFA 3B5LB 4IEVA 1BZWA 2P3IA 2WFF2 4RGAA 4FBFA 4CDXC 4R9BA 1W2UA 3BOPA 4PQ9A 4KQ7A 4RD7A 1NCRC 1YFWA 3N7MA 4N43A 4XF3A 5I0UA 1PGSA 4CZSA 1U5YA 4AQSA 4LUKA 4RHV1 1CQ9A 2FMDA 3B94A 3NVCA 3PNAA 4R4XA 5BNNB 4YVWC 1PK6A 2ZHMA 3SMHA 4HETA 3RYKA 1FNYA 1HXS3 2DCKA 2C5DA 3PJQA 4YM3A 2ARXA 4K7JA 2GH2A 1UKRA 1SLCA 1OLQA 5LRRA 2AGSA 2GNTA 4TSVA 2P3KA 4JTNA 5GM0A 2EALA 5L36A 2RS11 4CP2A 4AVTA 2RR11 2EAAA 5DDJ3 3EHKA 3OD4A 3TOJA 4JDNA 4DXZA 4WM7A 2H0VA 2IC1A 4KH9A 3S6PA 3USUA 4Q4V2 4AEDA 5BNNA 2WT1A 4UBGA 2D6MA 4ES8A 1O3SA 1LTEA 4MYEA 2PAEA 2WA4A 5I0TA 4CEYA 3WW2A 3MYXA 3AKPA 1DF0A 4J6GA 1IKQA 3AP7A 3KGZA 4FXGB 1EYBA 3IDEA 1XYPA 1WGPA 1OFNA 1YCIA 4ASLA 5J09A 3WDVA 3TN93 1J3PA 4M3CE 1YUDA 3AMMA 4HZFA 3OYWB 1RB8G 5FPXA 4IEWA 4BA6A 1ZBE2 4AVAA 2W39A 4BQ1A 4AEKA 2ET7A 1Q43A 1FMD1 1H2LA 4XE9A 3UKTA 2PN5A 3NAPC 5JZGA 4N43B 1Q8VA 5CNAA 1RJ7A 2A6ZA 2AENA 2D3SA 2R49A 2YXSA 3OY8A 5E16A 1DIWA 1GNHA 4Q4X1 4AQ6A 5L73A 4CP1A 4BLIA 5FCCA 3ZFEC 3RDIA 1L3JA 5FOJB 3WG4A 2VG9A 1YXWA 5JOYA 4XPVA 1FMD2 1DDLA 1G9FA 1RUE3 2F4PA 1DGWA 4GH4C 3KS7A 2XJSA 2VOXA 3NO8A 4JRLA 5E8AA 3VZNA 4E4DX 4YLZA 3E6BA 2OZJA 4H55A 1XNDA 4ISRA 3KCCA 4E2SA 2WZR1 1YHFA 2PHWA 4HVOA 1AYN1 4D69A 4NPRA 3A4UA 2GC0A 4JGZB 4QGNA 3VUOA 4FXKB 3PVOA 3GHNA 4YM1A 5DZGA 2ZGKA 2HKXA 1C28A 1GNZA 1KS5A 2VQ0A 2DVGA 3ECQA 2HWE3 3VBUB 1I1EA 2UURA 4G9SB 1QKQA 1CONA 2WFF3 4A7KA 1CAVB 5JZGC 2NP0A 1REFA 4WVWA 4WVZA 4DMIA 3OTFA 3AJYA 1M4WA 4N9HA 1CAWB 1RIRA 1RUC2 1D4M2 3IPVA 1PZ7A 2R1BA 4K40A 4MH0E 4HL0A 1JW6A 2R0FA 1PGW2 5GZGA 3ACLA 3JD72 2PLV3 1RUD3 3WG1A 4CRQA 4AFAA 4E27A 4H7LA 3ROUA 3B9IA 5J37A 2OZ6A 3ZFFC 2PTMA 2VULA 1RUI2 2PLV2 2UYAA 4AXOA 3BOWA 4CYDA 4JC1A 4QM9A 5JI7A 4AGVA 1NLSA 1D4M1 2XJVA 2VPVA 2P34A 1W6QB 2IXLA 2E7QA 3S30A 1ALYA 1DGWX 4Q4Y1 3TYJA 5FQ0B 4WV8A 3NAPB 2MEV3 1LGNA 3C3VA 1DZRA 2EVXA 4DY5A 4Q29A 3WHUA 2RR13 4L9BA 1TMF1 2QE3A 1MVEA 4WM8B 1MS0A 3ZYPA 4HFSA 1VAMA 3LB9A 1MEC2 1VJ2A 4B29A 5L7OC 1GZWB 3V0BB 4O9EA 2DF7A 3IKWA 4IV3C 1NZCA 2BVBA 1OA4A 4XHXA 3OBTA 3U07A 2BBVA 2DTWA 4G3YC 1LODA 1AUYA 1AX2A 1G7YA 1HRI2 2WT2A 3DPRB 3VKFC 3VL8A 3VHNA 3MEPA 3OBRA 4GB33 1HKDA 2F6BA 3DL3A 4Y26A 3WX5A 1REEA 1MS9A 4B4RA 1O4TA 3FZ3A 4E9KA 3MDPA 1H1MA 5GALA 3RI8A 4QXKA 1ND3C 2Z5WA 1LOBA 4GALA 3J8F3 1RUJ1 2ZHLA 1ND2A 2CTVA 1S55A 2R061 4AVBA 4OULA 2GN7A 3LWCA 4IXLA 5KXDA 4Y5Z0 4Z07A 2JICA 1QDOA 3VL9A 2JG8B 2KA3A 4HKOA 2WA3A 2YMZA 3ZYGA 1PGL1 3AZXA 4COVA 2B7YA 1PO21 1QJU2 3H8UA 4M3CA 1O5LA 2ERFA 1C8NA 4P9XA 2DV9A 3QH7A 4XQDA 3VZOA 2LUWA 2UY9A 4G4FA 3MLLA 2R062 3IBMA 5FO8B 4ASMB 5CFDC 3DV8A 3THPA 1DLLA 1BMV1 2HWB1 4IV1A 5EYYA 4DOUA 3ZFFB 2XWJB 4LR4A 3KB5A 4YVWB 1V9U2 1V6KA 4IEPA 2DFBA 3ES4A 4XF1A 4RR3B 4CDWA 1ASJ2 1BEV2 3VBOA 1AVBA 2JG9B 3PVBB 3VDDA 4KU8A 5H9PA 5T52A 1AXYA 2GNDA 2K9ZA 3M3QA 1HLCA 2E9QA 1F5JA 3I8TA 2OVUA 4YGBA 3WP3A 1YYNA 5H9QA 1BMV2 1RUD1 2E53A 5IUQA 1JUHA 5C4WB 5EWSA 3GALA 5C9AB 3G7DA 5GZFA 5EYXA 1RINA 2QVSB 4QQPA 1S1AA 4EN0A 1PHMA 5BNOC 5FTTC 5L7OB 3AKQA 1RHI2 3AZZA 5GZCA 2E7TA 2ZKLA 1Z7S1 3WW1A 1S2BA 3W9AA 1GZWA 3AKTA 1WA4A 2GALA 5K7PA 4Q4Y3 1C4RA 1LEMA 1XXNA 4BLJA 5BUVA 2R0HA 3B9CA 1T6GC 2XUMA 1BVP1 4FQ4A 5GZEA 1CAUB 3E5UA 4YZ2A 2XKOA 1XE8A 4L8QA 4A7YA 1VRH1 3RZZA 3IPVB 1ZBA1 3HAGA 3OF1A 1QJZA 3PLQA 1EP0A 3M8LA 1LECA 1TNRA 1X50A 3HT2A 1AYM1 1SMVA 3SH4A 2DYCA 1VB4A 1VRH3 4MX3A 5JI9A 1I9RA 2H6BA 4YM2A 5C4WA 4CDUC 1CJPA 3OGGA 4YFZA 3MIBA 1QDCA 2ZGLA 1IQAA 1SLBA 2JG8C 1D4VB 4LBNA 4CP0A 1TMF2 1UIJA 5ABJC 1ZZ7A 2EAKA 3AP4A 1V6LA 1WLDA 4HBNA 1VBC3 1DGLA 4D94A 4BCUA 3RSJA 4MXWA 1POV3 4IQPA 4C90A 4GWMA 4EWDA 1UKGA 4AFMA 1H9PA 3AMHA 2EA7A 2HWD1 4YVSA 4J1WA 2E7AA 2DVFA 1AR83 1Q3EA 3I54A 2R041 4WM7B 4YARA 2NQYA 3SNMA 4XBNA 2N7GA 5GLUA 2XJRA 1S2KA 5BNPC 2UWCA 3I7DA 4FP3A 4WVMB 3V64A 1IOAA 4W6XA 1IHMA 2HWF1 2WS91 3N35A 3MLKA 2VNOA 4I09A 2QQPA 4XZPA 1BJQA 3LZZA 4LO4B 1GBGA 4YZ5A 4NHMA 3B02A 2LTNA 3W59A 1NQJA 1V70A 1HRI3 1GICA 1W6NA 1C8M1 2DU1A 2NMOA 3FX3A 1JHNA 5F5QA 4HVQA 1W6MB 1LESA 1OQ1A 1ZZBA 5KWRA 2VU9A 2TEPA 1S0FA 4Q4X2 2DU0A 1YNAA 4DPNA 5F6LB 4HANA 2RJLA 2YY1A 3IT8A 1ULDA 3ZYIB 3WVJA 1QJY3 1JYIA 2XBO1 1KJLA 4EN9B 3RMXA 2ZGTA 5GKAC 4LULA 4PDWC 2XL7A 1QGLA 2ILMA 5CBLA 3ZMNA 4QGLA 4COUA 4UW6A 1JN2P 3ZSLA 2ZPXA 4K9SA 5FMOL 1ULCA 2XG3A 4BPZA 2BNOA 1AF9A 2PHLA 3WQ0A 1NA1B 1G9DA 1AR82 3ZSMA 4OI2A 4QU2A 4AG4A 4U2AA 5AFEA 4PIZA 1RUG2 2D5FA 4BH9A 2PELA 3WOGA 5CG9A 5ABJB 2D7FA 1ZRFA 2JE7A 1EV13 1ZVFA 2JX9A 2PHDA 2NLRA