4GXLA

The crystal structure of galectin-8 c-crd in complex with ndp52
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
143
structure length
143
Chain Sequence
SSGENLYFQHMPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLNIKAFVRNSFLQESWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGDIHLLEVRSW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Galectin-8
publication title Sterical hindrance promotes selectivity of the autophagy cargo receptor NDP52 for the danger receptor galectin-8 in antibacterial autophagy
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2012-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4gxlA00
2A6ZA 1DQ2A 1LHOA 1ULCA 2R0HA 5IK7A 2JKBA 4FOYA 1BZWA 1W6OB 3D5OA 4AVVA 2VW0A 5GLUA 1W6QB 1DQ0A 4XJAA 1N47A 1YRZA 3V0BA 4Q8LA 2UWAA 3ZXEA 1YO8A 2LALA 3FLPA 3POSA 2UU8A 5H9SA 3V64A 2ZGMA 1F5FA 1S0JA 1SLBA 1W6OA 5GZCA 3POWA 1WW5A 3ZXFA 2VUAA 1W6QA 2A6YA 3B3QE 1CJPA 3PVNA 4LBOA 1WBLA 3AJZA 3BIWE 1O4ZA 4Q8KA 4YM0A 5BYNA 5T52A 4XILA 4I30A 3IPVB 4XHXA 1QNYA 2EALA 2DU1A 4CRQA 2PHUA 2JE9A 2V73A 2DVFA 2E6VA 1Q8OA 2W08A 2A6XA 3RS6A 1V6LA 3O5SA 3IPVA 5E8AA 5CB7A 4Y24A 4RA0A 1H9PA 3DGTA 1GSLA 2B7YA 1G9CA 3AP6A 3SH5A 1URXA 2SBAA 5GZGA 3V0BB 1NXD1 2D6LX 1ENSA 1UZZA 1IS5A 1WW7A 4UW5A 1H30A 3AYEA 1W6NB 3OYWB 4FOQA 3AZVA 5CA6A 1WCSA 1MS1A 3SNMA 2R0FA 2W52A 3ILFA 4FQZA 5GLTA 1W6NA 1LGBA 4KBBA 1MVQA 2CNAA 3OYWA 5JOZA 4ZXKA 3W58A 4Q1RA 4OZXA 1OFSA 3IMNA 2ZHMA 2ARBA 2PHTA 4YZ1A 2PHXA 2P2KA 3HMYA 4XYXA 2CWSA 4XJ9A 4AGRA 3N7MA 2W68A 3KQRA 4RL7A 4AGVA 2E7TA 4DS0A 2PELA 1AVBA 2OUHA 1MR5A 3M3CA 4JRAA 4XZPA 4YLZA 4DPNA 3AZYA 5DG1A 1UKGA 3ZSLA 1YYNA 3R4UA 3VKLA 5IK5A 5KXDA 4M3CF 4YZ4A 1SLAA 1BXHA 4Q26A 1QNWA 4R9CA 4YW1A 4YFZA 2JDZA 4ISQA 5T5PA 2YV8A 4XOGA 1G7YA 1UMZA 4FPEA 2DUQA 2D6MA 1VAVA 3WZ1A 1S0BA 4Y1ZA 4WZFA 2ZACA 5FRAA 2R49A 4MYEA 1V6IA 1ZA4A 1V6NA 2JECA 2JJ6A 4LBKA 4Y1VA 4YGCA 4YW5A 2OUJA 3MW4A 2JE7A 4JC1A 3PVOA 1DQ5A 1NLSA 1LHNA 1G9AA 2ZGRA 1F31A 2A3XA 4Y22B 3WDTA 3O12A 3PVEA 2D43A 3WDXA 1IS4A 3LCPA 2UWBA 3OY8B 1SACA 1VIWB 3VV1A 1CPNA 3AXEA 4Y22A 3FUQA 3IM0A 3ZYRA 2VU9A 4Y1YA 4Z8BA 4ZKTB 1SBDA 2I2SA 2WSVA 3O0VA 4YGEA 1LOFC 3OBTA 4UW3A 5GZDA 3OY8A 1BYHA 1ULFA 4Y26A 2A75A 1AF9A 3WLUA 4BLIA 1IKPA 3V0AB 1QDCA 2P37A 3AK0A 4BMBA 1ENRA 2ZGUA 3ZSMA 1BQPA 1DYKA 4Y1XA 4C1XA 4XTMA 1VLNA 1MS4A 1UAIA 2DURA 4IQPA 3V0AA 1LOEA 5T5OA 1WLWA 2G4IA 5T5JA 1ENQA 1SLIA 3ZSKA 1C1FA 2EAKA 2NMNA 1UN1A 4UW6A 1O4YA 2VW1A 3A0NA 4XBNA 1MS0A 2GMEA 3AP4A 5EYXA 2PHRA 3Q9OA 3D6EA 1JYCA 3UK9A 1AJKA 4WVVA 2ZGSA 3JU9A 4W65A 2JD4A 5T55A 1MZ5A 2GNMA 3SISA 4YM3A 3I8TA 2DTYA 2P3JA 4R9BA 2ZGNA 1S0CA 2BQPA 1X50A 3TAYA 2YY1A 1AX2A 2A5ZA 2WT2A 2GDFA 2ZGQA 2C9AA 2FMDA 4Q2FA 5DZFA 4XJUA 5CBLA 1Q8PA 1LHUA 2A3WA 3AP5A 1D2SA 5GLZA 2PHWA 3LSEA 2OVUA 5DUVA 2DVBA 4PCRA 2ZGKA 4FP2A 1LOFA 2D44A 3L2YA 4M3CE 1DHKB 5AVAA 4GKYA 5JLVA 2AGSA 5T5LA 3AXDA 1CR7A 1XQNA 1S1AA 4P9YA 1VALA 2VY0A 3SH3A 1N3PA 1DFQA 5F9TA 1MS3A 1HQWA 2A70A 3OJBA 4FP3A 3ZSJA 1WW4A 2XG3A 4GALA 4FPJA 5GLWA 1S0FA 4YM1A 2GNDA 1ULDA 3TB0A 1GICA 5KXCA 3RRDA 5HCAA 1FAYA 1FYUA 1LULA 1LHWA 4U2AA 2VW2A 1SLLA 4ISRA 4FPLA 5FREA 3AZWA 2H0BA 3POYA 3WG1A 2DVAA 3WDUA 1QOSA 3N36A 3BODA 3V65A 1GKBA 4HL0A 2E51A 1FX5A 3NWKA 4PBOA 1SCSA 5SV8A 1UZYA 3INAA 5GZEA 1HLCA 4DQAA 1KITA 1UL9A 2ZHLA 2WNEA 4XBQA 4BMEA 2ZGOA 1Y7BA 1Z78A 3T2TA 3B00A 4K20A 3WHTA 5CAZA 1JHNA 1OQ1A 3ASIA 1WW6A 4XHBA 5JVVA 3T1LA 1FV2A 2NN8A 4FPCA 4Y20B 1JYIA 3FLTA 2DTWA 3AP9A 5JOYA 4BOWA 3ZPYA 3M1HA 1W0PA 3ZXJA 3SH4A 3MEPA 5EWSA 4Y20A 1V6MA 4M01A 1V00A 2YZ4A 1AXZA 1DIWA 1N3OA 1KJLA 1YXWA 1IS3A 2UURA 1RITA 2CYFA 1LHVA 1KDMA 2WLQA 5CNAA 1W6PB 5H9QA 2KM2A 2A3YA 2HYKA 1AX1A 2AENA 4XJ8A 4XIOA 1LECA 1IKQA 2A71A 1QU0A 1W6PA 2Q5TA 4XXAA 1A3KA 3N7KA 3SITA 4PBPA 4GA9A 2NYYA 3B69A 4TYSA 4YM2A 2A6WA 1S0EA 1IOAA 3ATGA 1WBFA 2E7QA 3LSDA 3AX4A 1PZ9A 3B01A 4TZDA 1C4RA 1CPMA 1LU2A 2AH2A 4YG3A 1AXKA 4FPYA 1S0DA 1D0HA 2DYCA 2VXRA 1BKZA 1QGLA 1C57A 1V6OA 4AWDA 1ULGA 1SFYA 1Q8VA 3ILNA 4K1YA 4LBMA 1FNZA 4P14A 5DUXA 5HCFA 4C1WA 2R16A 3WUDA 4XJWA 5T54A 1LTEA 1LOBA 2D6OX 2D6KA 2FHRA 4BLJA 3AZXA 1C1LA 3I4IA 1W0OA 1QMJA 2P34A 3WG3A 2NMOA 2C5DA 4R9AA 2CTVA 3ZXLA 2ERFA 2Z42A 2GN3A 3NV4A 4P9WA 2PHFA 4R9DA 4YZ2A 1DQ6A 4AVSA 4YZ5A 4YFWA 2WQZC 3WCSA 3O0XA 1SBFA 2AUYA 3RG0A 4GKXA 4K1ZA 2ZAAA 5DUWA 3AFKA 1Q8SA 1GANA 5JDBA 1GBGA 2ZABA 2E53A 2AR6A 1G86A 5IT6A 4FPFA 4LBNA 1LJ7A 3AYDA 3W59A 4BQ1A 1JBCA 1GZCA 2LTNA 3M3OA 2DV9A 4CTEA 2NP0A 2D3RA 4DFSA 3M3QA 2EXKA 3FFZA 3QCWA 3WHUA 4DRRA 5DXDA 2YXSA 5GLVA 5JOXA 2EF6A 1KJRA 1OKQA 4XDQA 5DZEA 3VKOA 2EXIA 3WDYA 1TEIA 2EXJA 2WKKA 3RQ0A 2AREA 4AYUA 4XTPA 3C2UA 3FBYA 2ZMKA 1HKDA 1U0AA 2WT0A 1MACA 2RHPA 5EXOA 3RSJA 2ENRA 4JCKA 3O0WA 1APNA 4F83A 4WVWA 2GN7A 3AZZA 3WNXA 1S0GA 2D7FA 3WG2A 3RMYA 3M2MA 2CL2A 2ZMNA 1JW6A 5E89A 4FVVA 1LESA 3OGGA 1WLCA 2ZGLA 4LBQD 4ITCA 1DYPA 1GNHA 2ARXA 4PQ9A 4DRVA 4YG6A 2VH9A 1JOJA 2NM1A 3N3HA 1MZ6A 1AXYA 2ZA9A 1CQ9A 1N1VA 5H9PA 5GJ6A 2V5YA 1PZ7A 5GZFA 2UWCA 3AYAA 4NOTA 3WUCA 4YW3A 3ZVXA 4WV8A 5LK5A 1DZQA 4NO4A 4FPKA 1JUIA 2EXHA 3PJQA 2ES3A 2EIGA 2WJSA 4FOWA 2ZBJA 3A4UA 1N3QA 5IK4A 3WG4A 5HCBA 1DQ4A 2OW4A 3UJQA 1FNYA 1LGCA 1N1SA 2D3PA 1LENA 3MW3A 4ATFA 4CZSA 1VAMA 3BTAA 3MW2A 1G9DA 2A6VA 1LOAA 5EYYA 1LODA 5JMCA 3PMEA 4SLIA 1LU1A 1AZDA 1GZWB 1LGNA 1R1ZA 4AVTA 3U4XA 4XMIA 4Y1UA 1CVNA 3HR9A 4AGGA 2ZKNA 4GXLA 3USUB 1MS9A 4ATEA 4LBQB 3SLIA 4GWNA 1GZWA 3N7LA 1AJOA 1W6MB 1G8WA 1WLDA 5L73A 4BPZA 1QF3A 2YROA 4P9XA 2DVDA 1A8DA 3NV1A 1DLLA 4LBJA 3USUA 3ZXKA 4M00A 4LBQA 4U36A 5DZGA 2R1BA 3KM5A 2TEPA 2D6NA 5JOWA 1JN2P 1W6MA 2R1DA 2W39A 5IK8A 2AYHA 3M3EA 1PZ8A 1MS5A 1HDKA 3WV6A 1QOOA 2D3SA 2ZHKA 4FPHA 1G9FA 3APBA 1V6KA 3D4KA 4FPOB 2YMZA 1WUVA 3OPZA 1AX0A 1JXNA 3FLRA 3UL2A 1CIWA 3NV2A 4XXPA 2WSUA 1KQRA 3AYCA 3N7JA 3R05A 1F9KA 5KXEA 3R4SA 3GNEA 4H55A 4PF5A 3QLQA 2DUOA 5F5QA 3WVJA 1UX6A 3NV3A 4FQ4A 4K21A 1ULEA 2SLIA 3CNAA 4XIKA 1S0IA 3VKNA 5KXBA 1YI7A 1KRIA 3A0KA 5DUUA 1DBNA 3N35A 1LOCA 2DWRA 1GV9A 1LEDA 1LCLA 4L8QA 2GMMA 1CESA 3VKMA 3BOPA 1GLHA 2CWMA 1Z0HA 1DQ1A 1RINA 2NZ9A 1SBEA 1CN1A 4UW4A 3WDVA 1ZM1A 4XMAA 1FV3A 1WD4A 3H0OA 2ZZJA 1G9BA 3ILRA 3FUOA 2XB6C 5GM0A 4XJZA 2DVGA 3T1MA 3ENRA 1SCRA 4HANA 1IS6A 1ONAA 1QOTA 1Q56A 4Q1PA 2P3IA 1GZ9A 2GNBA 3IN9A 4FPGA 4Q27A 1MS8A 3JUUA 4FOVA 3UJOA 1RIRA 3WCRA 3WOGA 1UPSA 3HN1A 1BJQA 2A7AA 3VUOA 1B09A 1GNZA 4BM8A 1A78A 5IUQA 1LOGA 2ZHNA 4ASMB 1J1TA 5DG2A 2DU0A 3ZYPA 4D69A 1N1YA 4YGBA 3VKFC 3DUIA 2ZGPA 4LBLA 4XBLA 2DUPA 1V6JA 5T50A 1SLCA 3IKWA 4M3CB 3WDWA 1N1TA 2GMPA 2GNTA 1MVEA 1Q8QA 1I3HA 3OBRA 4YW2A 3RMXA 1I1EA 4YZ3A 1QDOA 1HQLA 3AJYA 2GALA 3B9CA 1FATA 2ZGTA 3AP7A 4YG0A 2D6PA 4GWMA 2ZMLA 4M3CA 3GALA 3MPPG 2WT1A 5GALA 1WD3A 2P3KA 1KDKA 1DGLA 4YGDA 5E88A 1CONA 1QKQA 4XE9A 2CY6A 4YW4A 1YIFA 1LEMA 1H9WA 5H9RA 1EPWA 1GYKA 1SLTA
chains in the Genus database with same CATH superfamily
5A33B 4LO5B 3T2OA 3U14A 3HQRA 2E32A 3EMRA 5I0UA 4I01A 1J83A 2JKBA 1H6XA 1W6OB 3NNGA 2NLRA 3D5OA 4FOYA 5L7OB 1FI2A 2VW0A 1W6QB 1DQ0A 5GLUA 1N47A 1QJFA 3KF5A 1H1AA 2UWAA 2IC1A 2IWGB 4BXSV 2UU8A 4LULA 1W8WA 1S0JA 2ZEXA 2A6YA 4V2VA 2RS12 4LUKA 4CP2A 5FAXA 5ABJB 3AJZA 3BIWE 1OLMA 4BCUA 4OMDA 5FK8A 3WT3A 3W5NA 1NCRC 4E8CA 1VMFA 1AHSA 5BYNA 1BEV2 2FQPA 1WZXA 3UV9A 1YEWA 4JGZB 4B3NA 1TE1B 1QNYA 1S2EA 4CRQA 5DPNA 1RUJ3 3J7MA 2E6VA 3QOPA 4W50A 3IPVA 1UXZA 4Y24A 3HT2A 3ZM8A 4GULA 5L19A 5J3UA 5CG9A 3AP6A 1ZBE3 1URXA 2SBAA 1FPN2 4IGQA 3WF3A 5FWEA 3CBNA 1UZZA 4HKLA 4UW5A 1WW7A 3PHMA 4XF1A 3ST7A 2VUDA 1R082 3RGBA 2XVKA 4D6RA 5BNPB 2X53S 5FOJB 3PJYA 1OLME 3AZVA 1RGSA 2VOKA 1WCSA 2ET1A 1MS1A 3PTRB 1US3A 2VMIA 1R1A3 5GLTA 4QPGC 4QXHA 5F8PA 3OYWA 4Q4V1 4HFSA 3P6BA 4G9SB 4Q1RA 2WIIB 1SDWA 4RN5A 3IMNA 5I0TA 1JTZX 3WP3A 1O8SA 3D3AA 2ARBA 4AOCA 3POFA 4COUA 1B35A 1EAH3 4K8FA 3ZR5A 4CVUA 2PHXA 4Y4YA 1BBT2 2Y6HA 4QX0A 1NCQA 4XJ9A 5FYUA 3HWJA 5CFDA 3BYWA 4HK9A 2XDVA 1XXNA 4EN6B 2OUHA 3OUIA 1MR5A 3NNJA 2B39A 1DGWX 1K5MC 1ZZCA 2QCSB 4GD4A 4AW7A 1QQP1 4RQPA 5FZBA 3R4UA 5LBBA 3ZSLA 4RR3B 1SZBA 4DEVA 1NOVA 5FY1A 4A7ZA 3JD73 1V0AA 3ZOIA 4YFZA 2R6QA 1ZVFA 2OX0A 3ES1A 4QKFA 5DAQA 5G05L 2QTWB 4FPEA 3NRUA 3FMGA 1KXGA 1UY0A 3KS7A 1S0BA 2XR4A 4BWOA 3MDPA 4Y1VA 4AXOA 1ZA4A 2JECA 1SQ4A 1M06G 3AC0A 1NG0A 4JC1A 3ACGA 1DQ5A 1LHNA 2VNOA 2WBKA 2RS13 4Y22B 4MGZE 1SPPB 2D43A 1ST8A 4QKNA 2WNOA 4A7YA 1YFWA 4CU9A 2YDEA 5FFOC 3M7AA 4OQ8A 2UWBA 4RHV1 2VQAA 1CD3G 2FZ2A 3DKWA 4MGSA 1R091 2J1UA 4NE9A 4Y1YA 3KHCA 4Z8BA 1OF4A 4XACA 1SBDA 3O0VA 2JB8A 4DINB 3OBTA 1XE0A 1RHI2 2JB4A 1BYHA 2JXAA 2Y6LA 1AF9A 4HLTA 3NVCA 5C71A 3GYDA 2YBPA 3H9AA 4QX5A 2JD9A 1YHFA 5FPVA 4OULA 5A7QA 1DYKA 4XTMA 1HRI1 2WR9A 2QFEA 2BNMA 2VZSA 5T5OA 5LEKA 2G4IA 1R083 3AMPA 1ENQA 3RJRA 1PVC2 1J58A 4D6QA 2KXLA 3A0NA 2G9ZA 4XBNA 5DN2A 2GMEA 1ZZ8A 5EYXA 1J59A 2QQNA 5FMOS 2K46A 3Q9OA 5LEJA 2WS92 4SBVA 5C4WB 1W05A 1AJKA 3JU9A 3D0JA 2JD4A 3SISA 1MZ5A 2OPWA 3CJIA 4YM3A 3I8TA 2EICA 5FZAA 2ZGNA 3VBOA 5BNNB 5I93A 4XDOA 2HWB1 2BBVA 3RS6A 1ZYBA 1BBT3 1HB4A 2GDFA 2FMDA 2WT2A 4CDWC 4J6GA 2RR13 3HVDA 4XJUA 1Q8PA 1HRV2 4E4HA 1LHUA 1JS9A 2VVDA 2QE3A 4Y5TA 4Z82A 1D2SA 1L3JA 1HQNA 3K3NA 4YWAA 3LSEA 4EN0A 3AKSA 2Q8OA 4YYOA 2DVBA 4AEKA 3IAQA 4NPLA 4XFIA 2D44A 1F4AA 4M3CE 1DHKB 4V1PA 5LK7B 1QJU2 1B35C 3U07A 5T5LA 4BXFA 2FCVA 3AXDA 5A1AA 1S1AA 1UF2C 4BYYA 1NCQC 3SH3A 3RZGA 3NNLA 5K4LA 3NL1A 2ZXQA 5F9TA 2EIEA 1OOPA 2ZTNA 5AC91 1IZ3A 5GLWA 4X6RB 4ZY9A 1S2BA 3I3DA 4PDWA 1BCXA 2RS53 3AKRA 3EBRA 3OUJA 1SLLA 4ISRA 4FPLA 1NLRA 5LBFA 3POYA 2DVAA 1HXS1 1ASJ2 3V65A 2FMYA 5I8TA 4HL0A 4JVAA 4PBOA 3NWKA 1RTVA 1S2KA 5B4NA 4Y5SA 4HT1T 1H0BA 1UL9A 2XQXA 5JMOA 3PMSA 4XBQA 1RHI3 1Y7BA 4ZU7A 5IK7A 4YVWA 1AR82 3QD6A 4JTOA 5F2SA 3LA3A 3WP6A 4CEYB 2VOWA 4GH4A 3RJ2X 4FPCA 3AB0A 4Z07A 4A44A 2XPJA 1YQ2A 3GGLA 4QX2A 1GQHA 2IXHA 3C7GA 5BNPA 5JOYA 3ZPYA 4Q0PA 2RDQA 2LROA 3VD4A 1Q3EA 3MEPA 1V6MA 2YBKA 4NR1A 4M01A 2B5HA 1AXZA 2IXKA 5A3OA 4BH9A 1SMVA 1N3OA 3E5UA 2HWD2 3JBG1 4XCAA 1KDMA 4UBHA 1OPMA 5B2GB 2ZEWA 3KF3A 1W6PB 4OZOA 4NIGA 2XH6A 2BNOA 2A3YA 1XB9A 1TG7A 2HYKA 2X5IA 4O65A 2VCCA 3JQXA 5A7WA 2RVAA 5T3NA 1LECA 3WW1A 4AR2A 1QU0A 4LHKA 2Q5TA 2R062 1HRV3 4I0WB 1PK6B 5FBJA 1YQCA 4IEPA 2QQKA 4CUBA 4MGQA 1RUD2 2VG9A 5FWJA 4RR3A 3SITA 4H7LA 3THDA 3ATGA 1S0EA 1IOAA 1WBFA 2CU5A 3LSDA 1PZ9A 2W1WA 5DDJ2 4YG3A 1AXKA 2YUEA 4Q4V3 3P1IA 5FZCA 4CXXA 5KHIA 1QJU3 4AQSA 2DYCA 3VBOC 4UFMA 4FSJA 1HJFA 2VXRA 1C57A 3ROUA 1SFYA 3I2DA 3F2ZA 3CDZB 1ZA7A 1NE4A 2P6CA 4GB31 1F4HA 2R16A 5CFCA 2WYFA 2NPIA 2B9UA 3C7FA 4LHSA 1LOBA 1XE7A 2W94A 1XC6A 3CMGA 3T08A 4AEDA 4IW3A 1VBD1 3WD5A 1QQP3 3LOBA 3WG3A 1JMUB 3F95A 3KGZA 3BALA 5FXWA 5A70A 3RNSA 2GN3A 2DCTA 4KBZA 1W3VA 2PHFA 4YZ2A 4YZ5A 2DBIA 2D93A 3WCSA 5DAVA 3P5BA 2Q0AA 2VTFA 2AUYA 3O0XA 3W5MA 3JB8A 4GKXA 3THPA 4K1ZA 2W46A 5DUWA 1ENXA 1GBGA 5BXXA 1AR83 4WVMB 3W59A 4PDWC 4IEXA 4BQ1A 4E8DA 3KV5A 5JXIA 1JBCA 4IE6A 1VBC1 1W03A 2YPDA 5CADA 3PUHA 4QHOA 4CTEA 2D3RA 4DFSA 1A6CA 3DPRC 2EXKA 3M3QA 4K3UA 3J8F1 3A7QA 4DRRA 4IEWA 1WMDA 3CZUA 5GLVA 3U75A 5JOXA 1AR62 1U5IA 4COVA 1KJRA 3VDDA 1OKQA 5DZEA 3J7HA 3SCHA 4MXVA 4QXBA 1TEIA 1R093 2EXJA 4QM8A 2WKKA 2ZAHA 3RQ0A 2HWD3 4P5YA 4YNIA 2Q1MA 4IEQA 3K2OA 3C2UA 4HPKB 5FO7B 1C5IA 1YI9A 1YWKA 3LE0A 5C7GA 4S2FA 3MV01 1AR71 5A7NA 2RHPA 2JE8A 5EXOA 5B4XA 3RSJA 4ZXEA 4HSJA 4F83A 2AZ5A 1REEA 2ZOEB 4Q0UA 2GN7A 2QZ2A 2R063 2ZX2A 2ZX3A 3WG2A 3RZMA 1MZEA 1UW8A 2ZMNA 3AMMA 1DF0A 4NJ4A 3TOJA 3WP5A 1TMF2 3ZFFC 1JYWA 5FZGA 5A3WA 5A6XA 2WO3A 3OUHA 4LE4A 4ITCA 2CDPA 2ARXA 4PQ9A 2VVFA 4YG6A 5FJHA 4EN8B 4P08A 2X5IC 3FHAA 3N3HA 4FT8A 1W39A 1KS5A 3AL5A 2ZEYA 1CQ9A 5H9PA 1ALYA 3I2JA 3I3EA 2PXJA 3NJYA 4N9IA 4CCEA 2DCZA 2UWCA 1UX7A 2FCUA 4NOTA 4YW3A 1DZQA 2R041 4NO4A 1AL0G 2WQ4A 2EIGA 2ZBJA 3A4UA 5FY4A 5HCBA 4Q4Y2 5LCWL 2OW4A 4R4ZA 1IQDC 1PO21 2W5FA 4KU7A 5D8AB 2DCYA 1N1SA 4IE5A 3D8CA 3ZN4A 1VRH2 1VAMA 3BTAA 1EV12 4Q29A 1G9DA 3TEXA 3OBZA 3BU0A 4ZPIA 3CO2A 4O9GA 4E4SA 5EYYA 1UXXX 3ZFGB 5JMCA 1R1ZA 3U4XA 4IL7A 1O5UA 2QQMA 3K4DA 4OUMA 1CVNA 2HWF1 3HR9A 4XUQA 3UETA 4AGGA 5AC93 4AVCA 1W3XA 4QAWA 4AEDC 3H1WA 2VZPA 4EZHA 1MS9A 4HVOA 5F3CA 1C8M1 4LBQB 3SLIA 3TRSB 4E27A 4CUCA 3K75B 1W6MB 3HD8B 4XABA 1XU1A 3LWCA 1HXS3 3O1MA 1AYM1 1OHFA 2K9ZA 2D5FA 1RUE2 2W2IA 5CKQA 4HKWA 2TEPA 4FI9A 5LZ6A 1VBA2 4AI3A 3IMMA 1NCRB 3VBSB 3MBWA 4QD2A 3D4KA 3L2HA 4MGKE 3ZN5A 2Q4SA 4AF9A 4CU7A 4XXPA 3ZX7A 3VDDC 3WNKA 1F9KA 3O1SA 5E1RA 4H55A 2N7GA 1TMF3 2DUOA 4N43C 2W1SA 3POJA 2VGDA 3AKQA 4EV0A 3NV3A 4XAEA 2XONA 4FFGA 3AKPA 5FY9A 3ACLA 3JBG3 4IERA 1S0IA 3I2IA 1F15A 3U0ZA 3T4VA 1RUOA 1KD7A 3AM2A 2DWRA 3POIA 3HQXA 1GLHA 1QWRA 4JDMA 1MEC2 3BUCA 1JYVA 1ZM1A 2XJVA 3O14A 4ZS2A 1WD4A 3ILRA 1WMXA 3FUOA 2OZ6A 4CCKA 4QX8A 1AL21 2XB6C 4IETA 1KFXL 2OT7A 4HANA 3KVAA 5I0SA 1ONAA 1QOTA 5KHKA 3H8UA 1Q56A 1IG3A 2EIBA 2JG8A 2P3IA 3IN9A 5A7PA 4FPGA 5SV5A 4F8AA 3JUUA 4QX3A 3TN91 3BN6A 1IPJA 3G7DA 2A7AA 4IEOA 1A78A 4AI8A 5IUQA 4GZ9A 3RZLA 2QQOA 1J1TA 3OSDA 2DU0A 1GWMA 2VBPA 2W1QA 1L7RA 2ZX0A 4MV2A 2WZR2 4N53B 4QKDA 3ZYPA 3NAPA 4MH0E 3VKFC 4AAXA 3MF9A 4XBLA 4ZU5A 5J09A 2FZ1A 3Q8AA 5A3TA 1JUHA 1H4GA 3ZYHA 4L99A 1VBD3 2GMPA 1FXZA 1RC6A 3T0DA 3KLSA 3U10A 1LB2A 2OA2A 5BY5A 4H2AA 1I1EA 3KV6A 1HQLA 3B9CA 2ZGTA 5KC6A 1C3HA 1RUE3 2IXIA 2JDKA 2ET7A 4HG6B 5F39A 4PLNA 2JWPA 3MPPG 1XRUA 5EJ1B 2WZPP 1W2OA 1W9YA 2W87A 2ZX1A 3THCA 2QQPA 1CONA 4YW4A 2VZVA 1YIFA 2PAEA 2VNGA 1H9WA 4B29A 2Z69A 2I74A 1DQ2A 3OB8A 2XOMA 3VZLA 3J8F3 3ZSEA 1QJZA 4AVVA 2F4PA 5JXGA 3HPNA 2KA3A 4MGYE 1OFNA 4O7XA 3K4ZA 3SEPA 3MLJA 1ND3A 3I2OA 3ZXEA 1HB2A 1YO8A 3FLPA 3POSA 2RJKA 2Y60A 1AYN1 2ZGMA 1F5FA 4E2QA 5GZCA 1R1A1 3ZLIA 1WBLA 1OI6A 2PTMA 3MUZ1 2VZ3A 4MVTA 1AR73 1OLQA 1D2QA 1OC1A 4AL9A 1H1MA 4LKEA 1MEC3 2BFUL 5J96B 5T52A 2QNKA 4CCOA 3MPBA 4IUGA 4XILA 1EAH1 1NX9A 2ZKLA 3IPVB 4OLLA 4XHXA 5FLJA 3ZYIB 4UFHA 3HOBA 4IEVA 5APAA 5IFPA 2WQ8A 5LWBA 4BDVB 1NQJA 5FYMA 1SHWB 5LW9A 1PM7A 1V6LA 5E8AA 4OCTA 3DXUA 4AFDA 4XETA 1QY4A 3UGGA 1GSLA 3SH5A 2R072 4OHYA 1RUG2 3WNOA 1ENSA 4MO3M 3AYEA 4NIDA 3FC0A 5L9RA 4LORA 4LITA 4PIZA 4Q4X2 5FKBA 3GJAA 3PURA 3OYWB 4LOTA 4S2GA 5CA6A 1WCQA 1HB1A 2VMEA 2WZR3 1ULOA 4AHYA 4C90A 1P8JA 2R043 4FQZA 3DN7A 1B35B 1OXCA 1W6NA 3NKGA 5FPXA 4KBBA 1MVQA 1I5PA 1MQTC 2KD7A 1NCQB 2QJVA 2P5BA 2Y34A 2RS11 4XCBA 5CFDB 2PHTA 1PO23 5JIAA 3RI9A 1XE8A 4WM8A 1L7LA 1COV2 2P2KA 4K40A 1G6NA 4AGRA 3RZKA 1RVF3 1A34A 1BEV1 2D97A 2W68A 4DZGA 4FAGA 4B4QA 3HIFA 3KQRA 3WNNA 1H8TA 1UIKA 2VC9A 1DU3D 5C8CA 1GOFA 3VHRA 5K8SA 4META 3L9JT 1KS4A 3O1RA 5FYYA 4UWDA 3GZEA 5KXDA 5FZFA 2C1FA 1C8M3 1SLAA 4JGYA 1QNWA 4Q26A 4YW1A 3NNMA 1W8NA 4FFFA 2JDMA 4FTBA 5T5PA 2YV8A 4XOGA 4MXWA 1J3RA 1NY72 3SKVA 1JZ7A 1UMZA 4CUAA 4X8PA 2QBXA 2D6MA 4AHZA 1AYM3 1R081 1VMHA 4K9SA 3RZZA 2ZACA 1XNKA 3CIHA 3HN3A 3KCYA 4LUMA 4OI4A 1UQXA 1V6NA 4JQTA 1X9TA 3CZJA 3MW4A 1UMIA 3PVOA 1NLSA 1W2UA 2XJRA 2ZGRA 2CV6A 4JKLA 3IDCB 2JDAA 4QDRA 3WDXA 1DP0A 1IS4A 1D4M2 1VBB2 1QJY2 4HMZA 4DO0A 4QPGA 4TTGA 3IIAA 3VBFC 4TSVA 1YQ8A 2RDNA 3J7LA 1JOBA 1VIWB 1UY4A 1CPNA 3AXEA 5F3GA 1ZREA 1CX1A 1BBT1 3RYRA 1ND3C 1PGSA 1VAKA 2OPKA 2VU9A 2VL4A 2Z4FA 2WSVA 2VMCA 3N9OA 3OY8A 1ULFA 1X8EA 4Y26A 1PGW1 4NPRA 3EQEA 3ACHA 5LY2A 3MF6A 4KL1A 3RVHA 5D2AA 4KI5M 4CA9A 4A4AA 3AKTA 4Z1VA 1K5MA 1UOFA 3HNYM 1UAIA 3WQ1A 4IQPA 4QHBA 3LB9A 3V0AA 1F5JA 1PX3A 3MFAA 1WLWA 3ZSKA 1DZRA 2EAKA 4K7JA 1JZ6A 2VVEA 1E57A 5FDBA 4YVSA 3CJIB 5KHJA 2CDOA 3RWNA 1NYWA 1DGRA 3VBOB 4Q0SA 3UK9A 2YC2A 3VBRC 4I09A 3WQ0A 5T55A 4MHUA 5FZEA 2W3JA 5KWRA 2DTYA 2HYXA 2RM22 2FDJA 2JX9A 3IBMA 1S0CA 2BQPA 2HEWF 1AX2A 1V70A 2A5ZA 4Q2FA 3AFGA 2WUHA 5JWPA 2VUCA 4YPJA 4AE2A 1K12A 1XYPA 3OPWA 2PHWA 1V9U2 3E6BA 4YRDA 4JHTA 3OD4A 2G9GA 1RHI1 2R30A 3IZOA 4PCRA 2ZGKA 5FLIA 5C9AA 5DAWA 3PDQA 3L2YA 5AVAA 1OOPB 2AGSA 4LKSA 4A7KA 1W9TA 4WM8C 3QBQA 5FXZA 1XQNA 4UOJA 4NN0A 4XFHA 2PQSA 1RJ8A 4COWA 1UOGA 2Y6KA 4ZZ5A 4PDWB 1HQWA 2A70A 1PVC1 1H8TC 3OJBA 4IV3C 5CIRA 5C8CC 4W6WA 4GALA 3P3PA 4OFGA 3IWZA 3JZVA 4FPJA 4KWJA 1S0FA 2AEZA 4HKOA 2BVBA 1JYXA 5EFUA 1GICA 3PVBB 3CKHA 1FYUA 1LHWA 2E33A 3KWVA 4JGYC 2WS91 1FT9A 2XBO2 4PIXA 4XQDA 1D4M3 3RI8A 1ZRCA 1QJY3 1GR3A 3AZWA 3J4UH 3WY6A 2BOIA 1UOBA 3O1PA 1CAVA 4YVWB 3GM8A 1OUSA 1ZZ6A 4L2NA 1PO12 1O7FA 4INDA 4DQAA 4GH4B 5FV3A 4I02A 1HRV1 4IV1A 4AI9A 5FMDA 4CDWA 1PIV2 1WA4A 3SEEA 2IFRA 3B00A 1PMIA 1AYN3 2F4LA 3ASIA 4NHMA 2FD8A 2WC2A 2NN8A 4MHRA 4AG4A 5E6HA 4HN0A 1QJU1 3VLBB 2W0XA 1CAXA 3ZXJA 1CAUA 2F6BA 2BPA2 3SH4A 4UFLA 1W9SA 2C4XA 3IDBB 4JQRA 1YFYA 4PLMA 2X5IB 1KJLA 1ZX5A 1HN0A 2LW8A 5A7WB 5EIYB 2UURA 3T2PA 3O1UA 4NIHA 5FZ6A 2E26A 5H9QA 2KM2A 3IIIA 4BQ5A 2PMWB 1LNSA 5LRSA 2ZJCA 2XVGA 4XJ8A 5FYCA 2WNVA 4XIOA 4HVQA 3R0RA 5DMYA 1ASJ1 1CAWA 2I07B 4L11A 1W06A 5FPZA 1A3KA 4LLOA 1NAEA 4YVSC 2Y0OA 2VE1A 3B69A 4GA9A 3VDCA 4TYSA 4YM2A 2A6WA 2VZTA 4C0BA 3AX4A 3B01A 4L9BA 4QHZA 1CPMA 1AR81 4TZDA 3VZKA 2RS32 1OH3A 4EE2A 3P3NA 3ZYBA 1H8VA 2ZS6B 5CFCB 1WA6X 1QGLA 1C28A 1X82A 3Q8CA 1V6OA 3QH7A 3ABZA 4QDSA 5FYVA 4K1YA 3GF6A 1FNZA 4AEDB 4C1WA 4C91A 2PYTA 1BEV3 3LA7A 3WUDA 4XJWA 3ACFA 2D6OX 2FHRA 2D6KA 2XKPA 4LHLA 3I59A 4BLJA 1NZCA 2HWD1 1C1LA 1W0OA 1QMJA 5C9AC 4KG0A 4QGNA 5F5IA 3OPTA 4O9EA 4Z2WA 2RMU2 5IJRA 3WR0A 4DXZA 2R7EB 5L9BA 4P9WA 3WW4A 4NUBA 1S4CA 4AVSA 4BB3A 1FPN3 1YJLA 5F5AA 3LFMA 4LJHA 2R061 1O3RA 5F32A 2PAKA 2ZAAA 5JDBA 1PIV3 1Q8SA 2DCJA 1RUD1 2VULA 2ZABA 5HV4A 2YGLA 4YSFA 3GZUC 4LT5A 1OVPA 2W92A 3AYDA 3ZN6A 4KGGA 4ZS3A 1OF3A 1GZCA 5DDJ1 3VDDB 2DV9A 2NP0A 4BQXA 3U37A 5I0DA 4F3JA 1YQ5A 3FFZA 4R8HA 2PHDA 1RYYA 4S2HA 5DXDA 2YXSA 4C8DA 3ZFEC 4O61A 2ADEA 5IVVA 2OXBA 1QXPA 2ZCWA 3VKOA 2VCBA 1UYPA 2VQTA 3IDEA 3MLLA 4IV1C 4XDQA 3WDYA 2XGXA 4GMP0 3POBA 2C9KA 1ODNA 3FBYA 2ZMKA 1HKDA 2WT0A 4QQHA 4QU1A 2GU9A 2VMDA 3GJBA 3T0BA 2ENRA 3UT0A 3O0WA 4URTA 4ET7A 1PVXA 2D7FA 2B45X 1VR3A 3GHNA 1XYOA 1ZBA2 3NKTA 1JW6A 4CCCA 5FBZA 2JIGA 4I2OA 4XZUG 2QQJA 2BYVE 3FN9A 1FMD2 4MGTA 5FPAA 3VZMA 1GNHA 4DRVA 2VH9A 4R52A 2K0GA 5CVRA 3VZJA 2EAAA 2WNVC 1N1VA 1VPHA 2J1SA 2V5DA 4DOUA 4CDUA 4MG2A 4COZA 1PNFA 1F2NA 1HN1A 4JDOA 1RUH2 4MOAA 3DPRA 1AR61 2OKXA 3ZVXA 4WV8A 4D7TA 2B9VA 3ELNA 3U78A 4CU6A 4FFIA 1UPIA 4GWJA 4FXKB 5EV7A 1W8FA 1UZWA 3SKJE 2JG9A 3EHKA 3PIJA 3VGIA 3ZMOA 4XUOA 3PNAA 4OMCA 5JI9A 5IK4A 2WL1A 3ES4A 2X05A 3MIBA 1U12A 1FNYA 1LGCA 1Y9QA 1CZSA 4M0NA 4CZSA 1ACCA 1K45A 3FJSA 1F8VA 2XLGA 4IE4A 1L7QA 2E9QA 4RD7A 3T2QA 1U5XA 4SLIA 1LU1A 1AZDA 1LGNA 3LOIA 2GC3A 4MSVA 1PVC3 3LZZA 1TMF1 5LASA 1OMIA 1UY2A 3OBAA 4QXCA 4ATEA 3VL9A 4E2SA 1S55A 3ZFFA 2VQUA 4ZHNA 1AJOA 2O0OA 1WLDA 4OQ9A 2WS93 5JXHA 1QF3A 1W90A 2XJTA 2DVDA 1DLLA 3MICA 1EPZA 3USUA 5BNOA 2IXJA 5C3QA 2W39A 5IK8A 2VZUA 3M3EA 5A7SA 3C7HA 4AEJA 1MS5A 1OD5A 1BHGA 3M70A 4QKBA 4UFJA 3WV6A 2ZHKA 4FPHA 4E2GA 1YJKA 4JKKA 4NHXA 2BRTA 4LIUA 5C70A 1H2LA 1X9PA 4FPOB 4Q4Y1 5F3IA 2YMZA 3OPZA 1AX0A 1JXNA 2WN2A 1UYYA 2WFF2 1VRH1 5FP9A 1KQRA 1EV11 1RUI2 3N7JA 1W28A 2I45A 4OYUA 1ZBA3 3GNEA 4PF5A 4CEWC 4LLFA 5F5QA 1HRI2 4K21A 1ULEA 2SLIA 4XIKA 4LE3A 4UF0A 2GC1A 4XFAA 4P9JA 1LCLA 1JU4A 2OS2A 3BOPA 5FZOA 1NT0A 1RINA 3ZKYA 2NZ9A 3WDVA 3LIGA 5FYHA 5FQ0A 1ASJ3 2A1XA 2YU1A 4XMAA 1J1LA 1RUE1 1FV3A 2OQ6A 4FO9A 1XNTA 2JG8B 4NAOA 5GM0A 3I54A 4B8EA 2R32A 3ENRA 1DYOA 2VD7A 1VBA1 2J1RA 5C5TA 4HVRA 1XPWA 1J84A 4Q1PA 2VMHA 2Y26A 4OHXA 3RYKA 3VDBA 1MS8A 2D98A 4CDUC 2GH2A 5FZKA 4HZFA 1UPSA 3BPSA 3NAPB 1BJQA 3NO8A 3T4HB 5C3RA 3ZYGA 1KFUL 5LA2A 3WQBA 4FFHA 2VXJA 1LOGA 4HXCA 4ASMB 5DG2A 1K42A 1UU5A 2DCKA 4LO6B 2JG9C 3H7JA 4YGBA 1JHJA 3DUIA 2ZGPA 2RDSA 2DUPA 1V6JA 2XVLA 5F3EA 5T50A 1EUTA 3H8RA 1RXGA 4N43A 4QB2A 2E7AA 1UMHA 3MO4A 1N1TA 3WDWA 4IEYA 1Q8QA 1I3HA 4YW2A 3RMXA 4YZ3A 3AJYA 1E5RA 3AP7A 2D6PA 2ZMLA 3NW4A 1MEC1 2QQUA 1IG0A 5IVYA 3N9LA 4JGZC 4URAA 2WT1A 3OG2A 3N4MA 2YHJA 2NQYA 4RFRB 3SMHA 2P3KA 1DGLA 3VBFB 1RUD3 1YUDA 2ETEA 2C6SA 1QKQA 4QPIA 4BZ4A 2CY6A 3A23A 3TWIA 2HBTA 1LEMA 4W6XA 4WM7C 1SFNA 3X29B 4R9CA 2ID4A 1GYKA 1SLTA 1ND3B 2CAUA 3KT7A 1STMA 1VP6A 2VZOA 2A6ZA 4IESA 4PQQA 4RGKA 5DDJ3 5BNOC 1LHOA 2CGPA 2YFZA 2E31A 3H42B 1RUI3 4AAPA 1UU4A 2Q1FA 1YRZA 1HV1A 3J7NA 4PT6A 4Q8LA 4LKDA 3V0BA 2LALA 4YW7A 4BE3A 1VMJA 2WNUA 4JHZA 4BU2A 5IVJA 2WZR1 1REFA 1WW5A 3POWA 4MUVA 1CJPA 2BWCA 2JKXA 2IUWA 1VBE2 4TLFA 1OUXA 4Q8KA 3U11A 5JSOA 4JV4A 2ZZQA 3BPZA 4I30A 5F6LB 2RE9A 3MI8A 3VD7A 4AFCA 2VTXA 1RVF1 2EALA 3FFQA 3WQ7A 2DU1A 4AEMA 2PHUA 5A3MA 2DVFA 2HWC2 2JDNA 1JZ4A 3O5SA 2VOVA 1I5ZA 3CU7A 4RA0A 2W47A 1G9CA 3DGTA 1DDLA 1H4HA 2PQQA 2IFWA 1VB2A 4HSLA 1NXD1 4X8NA 3M8LA 2EVXA 1H30A 1I9RA 3WX5A 1W6NB 3BU7A 3B9IA 3AL6A 5FYZA 5FR3A 2F17A 1TME2 1POV3 4FOQA 4LTAA 2RG4A 4QPYA 5LA9A 2GP3A 1AR63 3SNMA 1EUUA 3LDRA 2R0FA 5C3PA 4GJYA 1RUC2 3DEMA 2V4VA 4WM8B 5FK7A 4UFIA 5FPBA 3VBHC 1I6XA 2CNAA 2RV9A 2VMGA 2XJSA 3I2KA 3LQCA 3KV9A 4MZUA 5JOZA 2FBEA 1OFSA 3WNLA 4D7SA 2ZHMA 4GB32 1H8TB 4IV3B 5LY1A 1T6BX 5C8CB 1FOD2 3OD0A 2VBBA 2WA3A 3HMYA 4XUNA 4XYXA 3KQ4B 1Y9GA 1VRBA 4LO7A 4DUVA 5EJ3A 4RL7A 4WZCA 4JGYB 3NJZA 3MLKA 2PELA 1AVBA 1K3IA 5FUNA 4XZPA 3KD4A 1WCDJ 5DG1A 1UKGA 2WYSA 4MXWB 1YYNA 4WBBA 4CE8A 1VJ2A 3VKLA 5IK5A 1W99A 2WABA 4YZ4A 2WO1A 2PA7A 3S30A 4ES8A 1E5IA 4XEZA 4ISQA 1ZRFA 4DXTA 1OH4A 4IGPA 1C8NA 1IQAA 1G7YA 1W8UA 2J22A 2VPVA 2DUQA 3ZKUA 1ZRRA 1VAVA 4JDNA 4GQ7A 4WZFA 4Q4X1 5FRAA 3UGFA 4MYEA 1V6IA 4YW5A 3CHXA 2LS6A 3W21A 4LBKA 4CXWA 4DIQA 4QPGB 1QJX2 4IDZA 1H1IA 2JE7A 4H14A 4LPLA 4QPIC 2CHHA 1G9AA 1OLRA 2A3XA 5IVBA 3PVEA 2HJIA 3LCPA 4Q4Y3 1MQTA 2C0ZA 1TVGA 3OY8B 5KR7A 3VV1A 3WNMA 1COV1 3DF0A 4B7EA 4CYDA 1VRH3 3FUQA 5HXVA 3ZPOA 1EV13 1RUF2 4QQLA 1LR5A 4YGEA 1K5MB 1DGWA 1LOFC 4B4RA 2WNUC 3HAGA 3WLUA 4C0HA 1JU3A 2CSGA 4BLIA 1OT5A 2GH8A 2PHLA 1IKPA 3MIGA 3V0AB 1BK1A 3GBWA 1QDCA 4CP9A 4E4ZA 2VJXA 4DY3A 2P37A 3AK0A 1ZRIA 2ZGUA 3ZSMA 1BQPA 4Y1XA 2H6CA 4QGLA 4QWNA 5FP7A 3RZHA 2DURA 4OVEA 1OKOA 3LDBA 4NPMA 4Y33A 4YVSB 4BQYA 5KBFA 1ZZBA 3OEBA 1WCUA 2NMNA 1NY71 1RMU2 1UN1A 4P02B 4UW6A 1JH5A 1O4YA 2BWAA 1DG6A 1MS0A 3AP4A 1O3QA 3HT1A 4TXWA 2LM3A 3D6EA 1JYCA 1JYNA 3I49A 4EZ4A 3VD3A 2FDFA 4WVVA 5FKCA 1VBA3 1JZ5A 2BW8A 4ASLA 5LRRA 3AMHA 3ZIXA 1VBB1 1D4M1 2GZWA 1QJY1 5AFEA 1FOD3 1X50A 3TAYA 2ZGQA 4D8MA 5ACA2 2PLV2 5DZFA 5FP4A 2BOJA 1H6YA 1NA1A 3I3BA 4M4PA 3VBFA 5C9AB 4QQOA 1NQDA 3C7EA 4Q5OA 3EO6A 2BU9A 3DYOA 4BIFA 1DZTA 2WN3A 3VL8A 2O8OA 5DUVA 4L92A 4UYBA 5GKAC 5IAVA 4FP2A 5A32A 4HETA 3OGSA 4EWAA 4COYA 1UZVA 4GKYA 5JLVA 2XUEA 5JUVA 4LA3A 1H2KA 1CR7A 4LA2A 2Q8CA 5C6CA 4R4XA 1VALA 5IVCA 1DFQA 4OHZA 2ILMA 1MS3A 4FP3A 5FZ7A 3ZSJA 5F1RA 1EY2A 1MZFA 5DAPA 1QJX3 4YM1A 2GNDA 1ULDA 2D5HA 1OD3A 3TB0A 1CAVB 2H0VA 5HCAA 1FAYA 4U2AA 1LULA 4NWWA 4JKMA 2VBDA 5FREA 2H0BA 4IV1B 3FBMA 4UI9L 3N36A 2Y38A 4CDWB 1GKBA 3VBRA 2RM21 4IEZA 4OI0A 2E51A 1W9WA 4CCDA 5A3UA 2UYAA 1SCSA 1CZTA 1UZYA 4IGOA 3O1OA 1HLCA 1RUF3 1UCXA 2WO2A 4KWLA 1D0GA 1KITA 3LGRA 2ZHLA 4P9LA 2WNEA 5HXMA 3HJRA 1Z78A 2YC0A 5JAXA 2E63A 1V9U1 3PUIA 2O1QA 1JHNA 1OQ1A 3I3QA 1CAXB 5F2WA 1CAUB 1W8ZA 4XHBA 5FUIA 3VBUA 1FV2A 5FPUA 1JYIA 2XJPA 5FYBA 3PU3A 2B46X 1U5YA 4BOWA 1T2XA 3M1HA 5FZIA 4E9KA 1W0PA 5CEHA 1REDA 5EZWA 4Y20A 3VZNA 2RJLA 2G1MA 5HCHA 2WNVB 2WAOA 1LHVA 2WLQA 4IV3A 5CNAA 1CAWB 2Y0IA 5EPAA 1OA2A 1UZ0A 3MIDA 2PFWA 1LKNA 2XQRA 5FZ1A 5AFBA 5C33A 1CX4A 1GOHA 3VHPA 1AX1A 2QQLA 2XBO1 4QMAA 2WZEA 4QQ2A 1IKQA 1AL22 5A6ZA 2A71A 3BVCA 3LIHA 1O6UA 4XXAA 3ACIA 1FPN1 1AR92 3N7KA 2XJUA 4XF4A 1KGYA 2BGPA 2NYYA 4ZONA 4HK8A 5CISA 4UAPA 4EROA 2E7QA 1PIV1 1C4RA 3BTZA 1LU2A 2ADDA 2BERA 4BISA 1BMV2 4FPYA 1PHMA 2ZEZA 2XJQA 1W8HA 4KH9A 3THTA 2ORXA 3PTYA 3S5AA 5JZGA 5FJKA 2BTVC 4B1MA 4AWDA 1ULGA 1NA1C 1Q8VA 2XUMA 1GWKA 1UU6A 3AMQA 3I59B 2JDPA 3ILNA 4LBMA 4P14A 5DUXA 5HCFA 1OA3A 4NVPA 5T54A 5ERLA 4AVTA 5JXJA 2IVJA 1YLLA 2W95A 2B4KA 3AZXA 3RZJA 2P34A 4LKFA 3N9MA 4D7YA 3LKJA 2CTVA 1JODA 2P4EA 2Z42A 5A6QA 4XF9A 4R9DA 4BHPA 1DQ6A 2R073 1RUJ2 1RUG3 4QM9A 4DY5A 2QQWA 3ZN6B 3CJXA 3LD8A 2LUWA 2VAUA 4Q4X3 1E5HA 1Y4WA 4AQ6A 2E53A 2AR6A 3E1F1 4KU8A 5IT6A 4LBNA 4CDQA 1LJ7A 3DCQA 1ZBE2 3C3VA 3WXPA 3M4FA 3E6CC 2VUJA 1GP6A 2VECA 2LTNA 2LRPA 1IPKA 1R64A 2RS31 2GSYA 2HWE2 3LF7A 5CKMA 1PNGA 3T3YA 2FDIA 2EF6A 5KHGA 5IWFA 1ZNPA 3JCIA 2WFPA 1COV3 2EXIA 4ORFA 4Q4W2 5FIXA 3TBDA 2AREA 4NHKA 4XTPA 4QGMA 4H7MA 2Q8DA 3WW3A 4AYUA 5FMBA 1US2A 3VBUC 4QU2A 2Q30A 4HN1A 2IZWA 4YARA 2L9LA 3WP4A 2RMU1 1APNA 3FX3A 4WVWA 1JOPA 2QDNA 3AZZA 3WNXA 1S0GA 5JR7B 3RMYA 2V09A 3M2MA 3ZFGC 4FVVA 2XLFA 4QB1A 2ARAA 1PGL1 1WLCA 2ZGLA 4LBQD 2WLPA 2QQVA 3WF4A 4CDUB 3JD72 1DYPA 4Q0VA 2YYOA 5CAZA 2XWBB 2VZQA 5FYTA 4AQTA 3DPRB 1SG3A 3SXWA 4CDXA 3VB9A 3UKNA 2BDRA 3D0SA 3VD9A 1VBB3 2JG9B 1PZ7A 5GZFA 2GC2A 1W2NA 1ND2A 4EWEA 1Z7S2 3AVRA 5LK5A 5K9YA 4FPKA 1JUIA 5LBCA 3ZFEA 3Q8BA 2WWSA 1NUKA 2QQIA 5FZ9A 3VBSC 4AFBA 5LB6A 1HV0A 3UJQA 4CPBD 2TNFA 3E5QA 2AC1A 1T6GC 5K0UA 2D3PA 5JZGC 5KC5A 4ATFA 3H8XA 4W8JA 2H6BA 2V4AA 3HBKA 3MW2A 3UYJA 1M4WA 2XKOA 3MIHA 1LOAA 1LODA 3C8XA 3PMEA 3ZFFB 3ZDSA 2X8KA 4WM7B 4XF0A 4N9HA 4Y4RA 3KV4A 1JZ8A 2YU2A 4Y1UA 1ZBA1 2MEV2 2ZKNA 3UGHA 4ES9A 4GXLA 4RS5A 3USUB 5BNOB 2BJSA 2X10A 1FMD1 3W20A 4AHXA 2YPJA 4PF1A 4FTEA 1GZWA 4NIIA 4D94A 2XHKA 3N7LA 3BOWA 5L73A 1G8WA 5IVEA 5CG8A 3NNFA 2YROA 1UD1A 4HONA 2HWE3 4LBJA 3TEZA 4M00A 4U36A 2R1BA 2RM23 3ZDVA 2D6NA 1JN2P 4G4FA 3B94A 4WVZA 1RUH1 4J25A 2AYHA 4Q4W3 1YFUA 1PMHX 4XPVA 1HDKA 4CDQC 5IFTA 1Y43B 5ANNA 3G6JB 1V9U3 3APBA 4XAAA 4XFCA 3KCCA 3KT1A 3RPQA 1QXJA 2O14A 2J1AA 4DXRA 2RR12 1ULPA 2Z5WA 4QXKA 3SCFA 3FLRA 1CIWA 3NV2A 5D21A 5FO8B 2WSUA 1W9FA 1PGW2 3AYCA 2VOXA 3A22A 2VCAA 2ZPXA 3LDKA 3R05A 1X7NA 2ORZA 3HNBM 3ZYFA 5KXEA 3H1MA 4UF0B 5J1XA 3EJKA 3CQOA 1UX6A 4KGQA 4FQ4A 5FZOB 4F7ZA 2CGNA 2WRAA 1XNDA 3EB7A 3CNAA 3PL0A 4N53C 3VKNA 4GAZA 1YI7A 3A0KA 3B7MA 5DUUA 5FQ0B 5JCTA 3BKZA 1RJ7A 5J7MA 3N35A 4DUXA 4ZU4A 1GV9A 1Q43A 1YQ6A 5LA0A 2RJ2A 1DQ1A 2UY8A 2XBO3 3ITQA 2BBAA 4NRQA 3ZYJB 1SBEA 1CN1A 4UW4A 5ISLA 3ETPA 1QH7A 3VBHB 1Z7S3 2JDYA 3I2GA 3IAPA 5BNQA 2Y8KA 4LK7A 2VNVA 1G9BA 1GNYA 1PO13 2RS52 3KT4A 2HLEA 3D82A 2Q1ZB 3KHBA 4PIYA 3T1MA 4B4PA 3S7EA 5EHDA 4Q27A 4CDXC 2GNBA 4PHZA 2C24A 4A42A 3ZXDA 1RIRA 3LEKA 4EYUA 2Q8EA 1TNFA 4EWDA 1GFF2 1B09A 3SCGA 1ND2C 2WFF1 1F35A 1OQEA 4K6BA 2ZHNA 5C3OA 1RUI1 5HV0A 4N43B 4KWKA 2MEV3 4CCNA 5FZDA 4Z92B 1C5HA 4CEWA 2JEMA 3IKWA 4HBNA 4RGGA 4RFT0 5EQUA 1XNCA 3B93A 5K0UC 2JICA 2GNTA 1O91A 2W1UA 3N9NA 4P00B 5FZ3A 5BV6A 3OBRA 5JSPA 3FE5A 5FY8A 4YG0A 5JPMB 4M3CA 5FXXA 5CU1A 4CCMA 4QPIB 2WWUA 3PIGA 4N7IA 5DAXA 1UIJA 1KDKA 4RS5C 1O4TA 1RUNA 2Y6GA 5E88A 2BFUS 2DFBA 1J3PA 4XE9A 5KHHA 3LEGA 4X6QB 5H9RA 1OURA 4MLOA 3S7IA 1POQA 3EYPA 4S2DA 2W91A 3V0BB 3WF0A 1ULCA 2R0HA 2RS33 3H8OA 1ZRDA 2WNUB 4ONUA 3TEWA 1BZWA 2XHNA 3MZHA 2VZRA 2QKDA 1UYXA 2P3YA 4XJAA 4KQ7A 5A33A 3PUAA 4EN9B 3FWEA 1POV1 3ZMNA 4H3WA 5A1LA 5H9SA 3R4DB 3V64A 5L7OA 3ETQA 1SLBA 4QQPA 1W6OA 5FTTC 4Q4V2 2Y64A 1X36A 2XMLA 2VUAA 1W6QA 3B3QE 3ZXFA 3S0MA 3MHZA 3PVNA 4LBOA 1XNBA 4UT5A 1IPSA 1DCSA 1LRHA 1O4ZA 3SC7X 1YFXA 4AZZA 2VMFA 4Z2AA 4YM0A 2JIJA 5AVPA 5CFDC 1WMFA 1ZZ9A 5F7UA 2HH9A 2RMU3 3HBZA 3LEIA 5JPNB 4Y3OA 3OGRA 5ABJA 3VHNA 4AFMA 3J26N 4RQPC 3MGUA 2BV4A 4CP0A 2JE9A 2V73A 4NRPA 1Q8OA 1QQP2 1W8OA 2W08A 2A6XA 3BTXA 1SEFA 3S6PA 2BGOA 5CB7A 5IATA 4JGZA 1X33A 1GMMA 1H9PA 1NKGA 2B7YA 3DYPA 4DNYA 4OI1A 5GZGA 1XNAA 2D6LX 1VB4A 1IS5A 4UW3A 4WM7A 5F37A 2RDRA 3RYPA 3LFIA 1QIQA 4JZRA 2WWJA 5JIUA 1KEXA 5FLHA 4I0BA 1W0NA 3LPGA 5G04L 2W52A 3ILFA 1CJDA 3QH6A 3H7YA 1LGBA 2JDHA 1A8MA 2EIDA 2WO7A 5FZ0A 4ZXKA 3W58A 4OZXA 3R6SA 4RHV2 4KWUA 1VBE1 4YZ1A 1TQ5A 5FP3A 1WGPA 3CEWA 3KB5A 2CWSA 1R092 3H3ZA 3N7MA 4TLGA 4XDPA 4CCLA 4MX3A 1IGOA 3GCWA 4AGVA 2E7TA 4DS0A 4LNVA 4JRAA 4YLZA 3M3CA 3W9AA 4DPNA 4PLOA 2HEYF 3H50A 4I3GA 3AZYA 3S5QA 2Y6JA 2HWC1 1OA4A 1XOYA 4JX0A 1GQPA 2VM9A 3O7OA 1CZVA 2ARCA 1FMD3 4M3CF 1BXHA 3DKQA 4D3WA 3MIFA 5J98B 3PUSA 4CSWA 1BLZA 2JDZA 5TSWA 2IXCA 2VTXJ 1NZIA 3PLQA 4MGIE 5CZKA 2BEOA 3WZ1A 4Y1ZA 4I0AA 5A3NA 1TME1 2R49A 3GCXA 3ZXGA 2JJ6A 1RUH3 2QVSB 4YGCA 2OUJA 2MPFA 4LR4A 1MQTB 3CJIC 2BVVA 1BVVA 4LXLA 3E97A 1RUC1 1F31A 3WDTA 3O12A 4UBGA 4BIOA 2VO5A 2HWB2 3VBHA 4CXYA 2J1TA 5C8WA 1SACA 3BCWA 3K77A 5FY0A 4Y22A 5FZHA 1FOD1 1SPPA 5FZ8A 5LBEA 3IM0A 4CP9B 2QZ3A 2ZX4A 5FMCA 1YC61 3ZYRA 4ZKTB 1CIYA 2I2SA 4JRLA 5GZDA 3T1LA 2GC0A 5L7OC 3OGJA 2A75A 3GHMA 4DEQA 3ZXAC 4FTSA 5JR2A 3WW2A 1XYNA 5FXVA 3RDIA 2GAUA 5I8SA 1ENRA 4BMBA 4C1XA 1VLNA 1MS4A 2UYBA 1OOPC 1LOEA 2BUKA 4RYDA 3FHQA 1WLTA 1XSQA 1SLIA 5T5JA 3WF2A 1C1FA 1Q5OA 5ABJC 4IXLA 2CGOA 5AC92 4W4ZA 4P9IA 1UOJA 2D40A 2VW1A 5F6KA 3U4SA 4CU8A 3PUQA 1PM4A 3J9SA 3HQUA 2PHRA 4LK6A 4XC9A 5FOBB 1QJX1 1W8TA 1GP5A 1NXMA 2Z2SB 1NA1B 4NWVA 2ZGSA 4W65A 1HXS2 2GNMA 1HJGA 1JZ3A 4ARXA 4RHV3 2P3JA 4QX1A 4R9BA 1EYBA 1UYZA 4FCAA 4JAAA 4XW3A 2G19A 2YY1A 5C3SA 1CWPA 5C4WA 2C9AA 3M3IA 5CBLA 4YVWC 2MHFA 5A32B 4FBFA 2A3WA 2UY9A 2WFF3 4D6SA 3AP5A 5GLZA 5BNNA 1RUF1 4GH4C 2MNGA 2Z79A 4TN7A 2OVUA 5BNPC 3Q8FA 2J1EA 1HRI3 1LOFA 1SFPA 4FXGB 4ARYA 2B42B 1O3SA 2B8MA 3ZO0B 5A6YA 3LPFA 4P9YA 1EP0A 3CF6E 2VY0A 2FCTA 2YFUA 1N3PA 4UFKA 4AVBA 3GBGA 1RMU1 3GDBA 4DMIA 1WW4A 3JBG2 4OHWA 1H2MA 2XG3A 4B1LA 3I2HA 3SQOA 4IE7A 1MPXA 5KXCA 3VBRB 3RRDA 1RXFA 2VW2A 3WG1A 2HWB3 3WDUA 4B7KA 1QOSA 3BODA 1WCKA 1GP4A 4RR3C 1FX5A 5SV8A 5ACA1 2PLV1 2W9XA 3INAA 5GZEA 1UNBA 3VBUB 4V2WA 1W04A 4LO4B 3UNPA 4BMEA 2ZGOA 2HEVF 4XFBA 3AVSA 1JI6A 4IE0A 4K20A 1O8PA 3T2TA 4A6OA 3WHTA 2AACA 2BGCA 5JSRA 1WW6A 4OUEA 5JVVA 2QDRA 3OTFA 4Y20B 3FLTA 4NAMA 1TZOA 2DTWA 2DF7A 3AP9A 2VCMA 1WKYA 4LO8A 5CFCC 4CEYA 1UO9A 4RGAA 5EWSA 2YG0A 3IB3A 4NROA 1V00A 2YZ4A 2A73B 5FP8A 1XBFA 1DIWA 1HW5A 3RFRA 1YXWA 1VE0A 3BB6A 1IS3A 1VBD2 1RITA 4XFGA 2CYFA 3OCPA 3B5LB 5HBAA 3CLPA 3I97A 2HKXA 5J48A 4NRMA 2AENA 3T0AA 1HX6A 1Y9MA 1XU2A 4GMP1 2X09A 5IHRA 1Y3TA 1OBNA 3KGLA 1DGRN 1QH6A 2IXLA 2CAVA 1W6PA 2OQ7A 2YB7A 3KMHA 3I7DA 3ME2A 4XQ4A 4ZZ8A 5FZ4A 2R071 3GZTB 3WNPA 3OGVA 1JZ2A 1RUG1 3N9PA 3MFCA 4PBPA 1D7PM 1XJAA 3IDAA 4GIQA 5E16A 5IVFA 5JZGB 4AI2A 4E4DX 4XF3A 4FAHA 2XL9A 1VBC2 3T09A 2FDKA 1PK6A 1YNAA 1NLQA 2AH2A 4XFFA 5ANQA 4NIAA 4A6SA 3J8F2 1S0DA 1D0HA 2JENA 1BKZA 3H1YA 1VBE3 1W2AX 5C4WC 4BQ3A 1JYTA 2VR4A 4LQRA 4BA6A 3WSOA 3TEYA 5BNNC 4L97A 4KNCA 4AI0A 2OZJA 3PU8A 5FZMA 1LTEA 3UKTA 5J37A 4OHVA 1AR72 3I4IA 5IW0A 4AK3A 3BI3A 5DQ0A 2HWC3 2NMOA 2C5DA 4R9AA 3ZIWA 3ZXLA 2ERFA 5EJZB 3FHIB 3NV4A 4BJ0A 4YFWA 5EP9A 2WQZC 4CDQB 1SBFA 4JTNA 3RG0A 4MADA 1BVP1 2Y6FA 3DL3A 3MIEA 4PI2A 3AFKA 1AR91 1GANA 3K4AA 1TME3 2V72A 3V56A 4IEUA 3K3OA 1G86A 4KG8A 4FPFA 4J1XA 5LATA 3H3LA 3TNPB 4OUSA 1RUC3 2FDGA 3M3OA 1ZZ7A 5I91A 3ALQA 1BMV1 3HNMA 4LMFA 3GZAA 3QCWA 3A21A 3WHUA 4WVMA 2QUOA 3DXTA 3DECA 3U1XA 4GB33 5FUPA 4AQ2A 2VOTA 2R042 1XSRA 4LHNA 1OVSA 3OEAA 5LA1A 4NMIA 4UXAA 1LAJA 2Y33A 1IHMA 2BP6A 2YGMA 2G9FA 3CL1A 1UWWA 5D1IA 4A3XA 1PO22 4RSUA 1O5LA 3LEMA 1U0AA 4ASKA 1CGPA 4AVAA 1MACA 4AI1A 1RVF2 4JCKA 2IVIB 4L0PA 4I3PA 4QX7A 4A3ZA 4CEYC 4HPKA 5A3PA 2JDUA 2O8QA 5FMOL 3ZR6A 1RUJ1 2CL2A 2HWF2 2ATFA 3K46A 3LAGA 1GWLA 5E89A 5J36A 1LESA 5JI7A 3OGGA 4CDXB 5M0TA 1C8M2 1U5ZA 1SDDB 1VBC3 4OI2A 3VZOA 4DUWA 5A1FA 1RB8G 1ZBE1 3BTYA 1JOJA 1ND2B 2NM1A 1UY1A 3I3MA 1MZ6A 1AXYA 2GP5A 2ZA9A 3ECQA 5HPOA 5GJ6A 4PI0A 1AYM2 4K8RB 3ZFEB 3DV8A 2FDHA 2V5YA 3VHOA 2HWE1 2P6HA 3VDAA 3POEA 1K5JA 3RWKX 3AYAA 5K7PA 3BIEA 3WUCA 3SHRA 3KCXA 3MV11 4XUTA 5FPLA 4CCJA 1WMEA 2EXHA 4XUPA 3PJQA 4KMQA 5K0UB 2ES3A 2TBVA 2WJSA 3C7OA 3N9QA 3NQHA 4FOWA 4Q4W1 2OIIA 1PK6C 1N3QA 3WG4A 1QJEA 1DQ4A 2WAAA 2EA7A 3JQWA 1UY3A 1OQDA 5L36A 3GXUA 2WA4A 3ORJA 4YW6A 1LENA 3MW3A 3I2FA 3B02A 2A6VA 4RS5B 3MUY1 4QB6A 5FYIA 1OPOA 1PMJX 1X8MA 5D8AA 5FY7A 1YIPA 4BQ4A 3E5XA 4QPWA 3KZ4C 1GZWB 5IYYA 1BK0A 5FY5A 2XLAA 4P9GA 4XMIA 1E5SA 1RMU3 4J1WA 2WZ8A 4Y5Z0 4DXSA 2VQ0A 4NHLA 4N8MA 3URFA 3ZFGA 1D4VB 3E6DA 3FZ3A 3JD71 4GWNA 2VZ1A 1GUIA 4BPZA 1WWYA 4PJYA 4P9XA 5FCCA 1A8DA 2AEYA 1RL3A 3NV1A 3Q8EA 3ZXKA 2XWJB 2C26A 4LBQA 5DZGA 2X29A 3KM5A 2BNNA 4AHWA 5JOWA 5BUVA 1W6MA 2R1DA 5ACA3 2PLV3 3BGAA 1HB3A 1PZ8A 1Z7S1 3H3UA 4TWTA 5IAXA 2DFCA 1O3TA 1GZTA 2JG8C 3JB4C 1PO11 1QOOA 2D3SA 1PX4A 1G9FA 1GQGA 1V6KA 3TN92 3TYJA 1YCIA 3LA2A 1UKRA 1WUVA 4RQPB 4BK5A 5L9VA 1NCRA 4P5HA 3UL2A 3VBSA 4XURA 4A2UA 3GBFA 4CUGA 4EN7B 1AUYA 4G3YC 3NMBA 3NAPC 3UESA 1O59A 5C5UA 3HEIA 3R4SA 2HWF3 3QLQA 4CPBA 2KR2A 4A41A 3VN4A 3WVJA 3WEZA 3S57A 4A45A 1POV0 2XXZA 3IT8A 3T30A 5I8YA 2DDUA 2MEV1 5DABA 4GJZA 5KXBA 1OSGA 1KRIA 1DBNA 3KSCA 1LOCA 4BQ2A 1LEDA 4L8QA 3VKMA 2GMMA 1CESA 3OOXA 3O1VA 3NSTA 2BZDA 4M0HA 2CWMA 1Z0HA 4EJRA 4XVHA 4GMP3 3USSA 2P1BA 4HOOA 1QEXA 3H0OA 3K48A 2ZZJA 3NJXA 4NHYA 3DYMA 4BQWA 4EQVA 3EXUA 4XJZA 2DVGA 3QACA 1SCRA 4LOSA 3VD5A 1IS6A 4QDQA 2XL7A 3ON7A 3KVBA 1GZ9A 4N90A 1ODMA 1W2TA 3UJOA 4FOVA 2VNRA 4LIVA 3WCRA 3WOGA 2RR11 3HN1A 4Q0QA 1DLCA 5FZLA 3VUOA 1GNZA 4BM8A 4QT6A 2J42A 5CYYA 1GU3A 2K2SA 3WF1A 5FYSA 4CEWB 2OYZA 1AYN2 4D69A 4M4RA 1NE6A 2WDBA 1N1YA 1R1A2 1J3QA 5A7OA 4LBLA 1SLCA 2TUNA 1QXRA 3NJVA 4M3CB 5A3LA 5BPXA 1QHDA 1TNRA 5CKNA 2YC4A 3POGA 3K51A 3FL7A 4BK4A 3O1TA 4N53A 1HIXA 1MVEA 1H2NA 2J1VA 5F5CA 4W6YA 4AFAA 4DB5A 2J7MA 1QDOA 1PGL2 1EAH2 2GALA 1FATA 2PAMA 3MYXA 4GWIA 2HBUA 4GWMA 3OF1A 3GALA 5HI0A 5D8AC 2PN5A 2DBNA 2WINB 4XQWA 1AL23 5GALA 1WD3A 1GOGA 4LEJA 4N7UA 3JXSA 4CP1A 3AMNA 4YGDA 1AR93 3WINE 2RS51 3TNQA 5A80A 2P17A 3UKVA 4D0QA 2YBSA 5FO9B 5I0RA 1EPWA 3TN93
chains in the Genus database with same CATH topology
5A33B 4LO5B 5I0UA 4I01A 2JKBA 4FOYA 5L7OB 1W6OB 5IK7A 2NLRA 3D5OA 1FI2A 2VW0A 1W6QB 1DQ0A 5GLUA 1N47A 1H1AA 2UWAA 2IC1A 2IWGB 2UU8A 4LULA 1S0JA 2A6YA 2RS12 4LUKA 4CP2A 5FAXA 5ABJB 3AJZA 3BIWE 4BCUA 3WT3A 1NCRC 1AHSA 5BYNA 1BEV2 2FQPA 3UV9A 4JGZB 4B3NA 1TE1B 1QNYA 4CRQA 1RUJ3 2E6VA 3QOPA 3IPVA 4Y24A 3HT2A 4GULA 5L19A 5J3UA 5CG9A 3AP6A 1ZBE3 1URXA 2SBAA 1FPN2 1UZZA 4HKLA 4UW5A 1WW7A 3PHMA 4XF1A 3ST7A 1R082 5BNPB 2XVKA 2X53S 5FOJB 3PJYA 3AZVA 1RGSA 2VOKA 1WCSA 2ET1A 1MS1A 2VMIA 1R1A3 5GLTA 4QPGC 3OYWA 4Q4V1 4HFSA 4G9SB 4Q1RA 2WIIB 1SDWA 3WP3A 3IMNA 5I0TA 1JTZX 2ARBA 4COUA 1B35A 1EAH3 4K8FA 2PHXA 4Y4YA 1BBT2 4XJ9A 1NCQA 3HWJA 5CFDA 4HK9A 1XXNA 4EN6B 2OUHA 1MR5A 2B39A 1DGWX 1K5MC 1ZZCA 2QCSB 4AW7A 1QQP1 4RQPA 3ZSLA 3R4UA 4RR3B 1NOVA 4A7ZA 3JD73 4YFZA 2R6QA 1ZVFA 3ES1A 4FPEA 3FMGA 1KXGA 3KS7A 1S0BA 4BWOA 3MDPA 4Y1VA 4AXOA 1ZA4A 2JECA 1SQ4A 1M06G 1NG0A 4JC1A 1DQ5A 1LHNA 2VNOA 2RS13 4Y22B 4MGZE 2D43A 4A7YA 1YFWA 2YDEA 5FFOC 3M7AA 2UWBA 4RHV1 2VQAA 1CD3G 2FZ2A 3DKWA 1R091 4Y1YA 4Z8BA 1SBDA 3O0VA 4DINB 3OBTA 4UW3A 1RHI2 2JXAA 1BYHA 1AF9A 4HLTA 3NVCA 3GYDA 3H9AA 4QX5A 1YHFA 4OULA 1DYKA 4XTMA 1HRI1 2QFEA 2BNMA 5T5OA 5LEKA 2G4IA 1R083 3AMPA 1ENQA 3RJRA 1PVC2 1J58A 2KXLA 3A0NA 4XBNA 2GMEA 1ZZ8A 5EYXA 1J59A 5FMOS 3Q9OA 5LEJA 2WS92 4SBVA 5C4WB 1AJKA 3JU9A 3D0JA 2JD4A 3SISA 1MZ5A 3CJIA 4YM3A 3I8TA 5BNNB 2ZGNA 3VBOA 5I93A 2HWB1 2BBVA 3RS6A 1ZYBA 1BBT3 2GDFA 2WT2A 2FMDA 4CDWC 4J6GA 2RR13 4XJUA 1Q8PA 1HRV2 1LHUA 2VVDA 2QE3A 4Z82A 1D2SA 1L3JA 1HQNA 3LSEA 4EN0A 3AKSA 2Q8OA 4YYOA 2DVBA 4AEKA 4XFIA 2D44A 4M3CE 1DHKB 4V1PA 5LK7B 1QJU2 1B35C 3U07A 5T5LA 3AXDA 1S1AA 1UF2C 4BYYA 1NCQC 3SH3A 3NL1A 5F9TA 1OOPA 2ZTNA 5AC91 1IZ3A 5GLWA 4X6RB 1S2BA 4PDWA 1BCXA 2RS53 3AKRA 3EBRA 1SLLA 4ISRA 4FPLA 1NLRA 3POYA 2DVAA 1HXS1 1ASJ2 3V65A 2FMYA 5I8TA 4HL0A 4JVAA 4PBOA 3NWKA 1RTVA 1S2KA 4HT1T 1H0BA 1UL9A 3PMSA 4XBQA 1RHI3 1Y7BA 4ZU7A 4YVWA 1AR82 3QD6A 4JTOA 3LA3A 3WP6A 4CEYB 2VOWA 4GH4A 3RJ2X 4FPCA 3AB0A 4Z07A 2XPJA 5BNPA 1GQHA 2IXHA 5JOYA 3ZPYA 4Q0PA 1Q3EA 3MEPA 1V6MA 4NR1A 4M01A 2B5HA 1AXZA 2IXKA 4BH9A 1SMVA 1N3OA 3E5UA 2HWD2 3JBG1 1KDMA 4UBHA 1OPMA 5B2GB 1W6PB 2XH6A 2BNOA 2A3YA 2HYKA 2X5IA 3JQXA 5T3NA 1LECA 3WW1A 1QU0A 4LHKA 2Q5TA 2R062 1HRV3 4I0WB 1PK6B 4IEPA 1RUD2 2VG9A 4RR3A 3SITA 4H7LA 3ATGA 1S0EA 1IOAA 1WBFA 3LSDA 1PZ9A 5DDJ2 4YG3A 1AXKA 2YUEA 4Q4V3 5KHIA 1QJU3 4AQSA 2DYCA 3VBOC 4FSJA 2VXRA 1C57A 3ROUA 1SFYA 3I2DA 1NE4A 4GB31 2R16A 5CFCA 2NPIA 2B9UA 1LOBA 1XE7A 4AEDA 1VBD1 3WD5A 1QQP3 3LOBA 3WG3A 3KGZA 3BALA 3RNSA 2GN3A 2DCTA 2PHFA 4YZ2A 4YZ5A 2D93A 3WCSA 2Q0AA 3O0XA 2AUYA 3JB8A 4GKXA 3THPA 4K1ZA 5DUWA 1ENXA 1GBGA 5BXXA 1AR83 4WVMB 3W59A 4PDWC 4IEXA 4BQ1A 1JBCA 1VBC1 5CADA 4CTEA 2D3RA 4DFSA 1A6CA 3DPRC 2EXKA 3M3QA 4K3UA 3J8F1 4DRRA 4IEWA 1WMDA 5GLVA 5JOXA 1AR62 1U5IA 4COVA 1KJRA 3VDDA 1OKQA 5DZEA 3SCHA 4MXVA 1TEIA 1R093 2EXJA 4QM8A 2WKKA 2ZAHA 3RQ0A 2HWD3 4YNIA 2Q1MA 4IEQA 3C2UA 4HPKB 5FO7B 1C5IA 1YI9A 1YWKA 4S2FA 1AR71 2RHPA 5EXOA 3RSJA 4HSJA 4F83A 2AZ5A 1REEA 2ZOEB 4Q0UA 2GN7A 2QZ2A 2R063 2ZX2A 2ZX3A 3WG2A 1MZEA 1UW8A 2ZMNA 3AMMA 1DF0A 3TOJA 3WP5A 1TMF2 3ZFFC 4LE4A 4ITCA 2ARXA 4PQ9A 2VVFA 4YG6A 4EN8B 2X5IC 3N3HA 4FT8A 1W39A 1KS5A 1CQ9A 5H9PA 1ALYA 4N9IA 2DCZA 2UWCA 4NOTA 4YW3A 1DZQA 2R041 4NO4A 1AL0G 2WQ4A 2EIGA 2ZBJA 3A4UA 5HCBA 4Q4Y2 2OW4A 4R4ZA 1PO21 4KU7A 5D8AB 2DCYA 1N1SA 3ZN4A 3D8CA 1VRH2 1VAMA 3BTAA 1EV12 4Q29A 1G9DA 3CO2A 4O9GA 4E4SA 5EYYA 3ZFGB 5JMCA 1R1ZA 3U4XA 4IL7A 1O5UA 4OUMA 1CVNA 2HWF1 3HR9A 5AC93 4AGGA 4AVCA 4AEDC 3H1WA 1MS9A 4HVOA 1C8M1 4LBQB 3SLIA 3TRSB 4E27A 1W6MB 3HD8B 1XU1A 3LWCA 1HXS3 1AYM1 1OHFA 2K9ZA 2D5FA 1RUE2 4HKWA 2TEPA 1VBA2 4AI3A 1NCRB 3VBSB 4QD2A 3D4KA 3L2HA 4MGKE 3ZN5A 2Q4SA 4AF9A 4XXPA 3VDDC 1F9KA 5E1RA 4H55A 2N7GA 1TMF3 2DUOA 4N43C 2VGDA 3AKQA 4EV0A 3NV3A 3AKPA 3ACLA 3JBG3 4IERA 1S0IA 3U0ZA 1RUOA 1KD7A 3AM2A 2DWRA 3HQXA 1GLHA 1QWRA 4JDMA 1MEC2 1ZM1A 2XJVA 3O14A 1WD4A 3ILRA 3FUOA 2OZ6A 1AL21 2XB6C 4IETA 1KFXL 4HANA 5I0SA 5KHKA 1ONAA 1QOTA 3H8UA 1Q56A 2JG8A 2P3IA 3IN9A 5SV5A 4FPGA 4F8AA 3JUUA 3TN91 1IPJA 3G7DA 2A7AA 4IEOA 1A78A 4AI8A 5IUQA 1J1TA 2DU0A 2ZX0A 3ZYPA 3ZX7A 4MV2A 2WZR2 4N53B 3NAPA 4MH0E 3VKFC 3MF9A 4XBLA 4ZU5A 5J09A 2FZ1A 1JUHA 1H4GA 4L99A 1VBD3 2GMPA 1FXZA 1RC6A 1LB2A 3KLSA 3U10A 2OA2A 5BY5A 1I1EA 1HQLA 3B9CA 2ZGTA 5KC6A 1C3HA 1RUE3 2IXIA 2ET7A 4PLNA 3MPPG 1XRUA 2WZPP 2ZX1A 2QQPA 1CONA 4YW4A 1YIFA 2PAEA 2VNGA 1H9WA 4B29A 2Z69A 2I74A 1DQ2A 3VZLA 3J8F3 3ZSEA 1QJZA 4AVVA 2F4PA 2KA3A 4MGYE 1OFNA 3MLJA 1ND3A 3ZXEA 1YO8A 3FLPA 3POSA 2RJKA 1AYN1 2ZGMA 1F5FA 4E2QA 5GZCA 1R1A1 1WBLA 1OI6A 2PTMA 4MVTA 1AR73 1OLQA 1D2QA 1H1MA 1MEC3 2BFUL 5J96B 5T52A 2QNKA 3MPBA 4XILA 1PGL1 1EAH1 2ZKLA 4OLLA 3IPVB 4XHXA 5FLJA 3ZYIB 4IEVA 1NQJA 1PM7A 1V6LA 5E8AA 4AFDA 4XETA 1QY4A 1GSLA 3SH5A 2R072 4OHYA 1RUG2 1ENSA 3AYEA 3FC0A 4PIZA 4Q4X2 3OYWB 4S2GA 5CA6A 4C90A 2WZR3 4AHYA 2R043 4FQZA 3DN7A 1B35B 3NKGA 1W6NA 5FPXA 4KBBA 1MVQA 1MQTC 1NCQB 2QJVA 2RS11 5CFDB 2PHTA 1PO23 5JIAA 3RI9A 1XE8A 4WM8A 1COV2 2P2KA 4K40A 1G6NA 4AGRA 1RVF3 1BEV1 2D97A 2W68A 4DZGA 4FAGA 4B4QA 3HIFA 3KQRA 1H8TA 1UIKA 5C8CA 1DU3D 3VHRA 5K8SA 4META 3L9JT 1KS4A 5KXDA 2C1FA 1C8M3 1SLAA 4JGYA 1QNWA 4Q26A 4YW1A 4FTBA 5T5PA 2YV8A 4XOGA 4MXWA 1J3RA 1NY72 1UMZA 4X8PA 2D6MA 4AHZA 1AYM3 1R081 4K9SA 3RZZA 2ZACA 1XNKA 3KCYA 4LUMA 4OI4A 1V6NA 3MW4A 3PVOA 1NLSA 1W2UA 2XJRA 2ZGRA 2CV6A 3IDCB 3WDXA 1VBB2 1IS4A 1D4M2 1QJY2 4HMZA 4QPGA 3IIAA 3VBFC 4TSVA 1VIWB 1CPNA 3AXEA 1ZREA 1BBT1 3RYRA 1ND3C 1PGSA 1VAKA 2OPKA 2VU9A 2WSVA 3OY8A 1ULFA 1X8EA 4Y26A 1PGW1 4NPRA 3EQEA 3MF6A 4KL1A 4Z1VA 3AKTA 1K5MA 1UAIA 3WQ1A 4IQPA 4QHBA 3LB9A 3V0AA 1F5JA 3MFAA 1WLWA 3ZSKA 1DZRA 2EAKA 4K7JA 2VVEA 1E57A 5FDBA 4YVSA 3CJIB 5KHJA 3RWNA 1NYWA 1DGRA 3VBOB 4Q0SA 3UK9A 3VBRC 4I09A 3WQ0A 5T55A 5KWRA 2DTYA 2RM22 3IBMA 2JX9A 1S0CA 2BQPA 2HEWF 1AX2A 1V70A 2A5ZA 4Q2FA 3AFGA 5JWPA 4AE2A 1XYPA 2PHWA 1V9U2 3E6BA 4YRDA 3OD4A 2G9GA 1RHI1 2R30A 4PCRA 2ZGKA 5FLIA 5C9AA 3L2YA 5AVAA 1OOPB 2AGSA 4A7KA 4WM8C 3QBQA 1XQNA 4NN0A 4XFHA 1RJ8A 4COWA 4PDWB 1HQWA 2A70A 1PVC1 1H8TC 3OJBA 4IV3C 5CIRA 5C8CC 4W6WA 4GALA 3P3PA 4OFGA 3IWZA 3JZVA 4FPJA 4KWJA 1S0FA 4HKOA 2BVBA 5EFUA 1GICA 3PVBB 1FYUA 1LHWA 3RI8A 4JGYC 2WS91 1FT9A 2XBO2 4PIXA 4XQDA 1D4M3 1ZRCA 1QJY3 1GR3A 3AZWA 3J4UH 3WY6A 1CAVA 4YVWB 1ZZ6A 4L2NA 1PO12 1O7FA 4INDA 4DQAA 4GH4B 4I02A 1HRV1 4IV1A 4CDWA 1PIV2 1WA4A 2IFRA 3B00A 1PMIA 1AYN3 3ASIA 4NHMA 2WC2A 2NN8A 4AG4A 4HN0A 1QJU1 3VLBB 2W0XA 1CAXA 3ZXJA 1CAUA 2F6BA 2BPA2 3SH4A 3IDBB 4JQRA 1YFYA 4PLMA 2X5IB 1KJLA 1ZX5A 2UURA 5H9QA 2KM2A 5LRSA 2ZJCA 2XVGA 4XJ8A 2WNVA 4XIOA 4HVQA 3R0RA 1ASJ1 1CAWA 2I07B 4L11A 5FPZA 1A3KA 4LLOA 4YVSC 2Y0OA 4GA9A 3B69A 4TYSA 4YM2A 2A6WA 4C0BA 3AX4A 3B01A 4L9BA 4TZDA 1CPMA 1AR81 3VZKA 2RS32 3P3NA 1H8VA 2ZS6B 5CFCB 1QGLA 1C28A 1X82A 1V6OA 3QH7A 4K1YA 3GF6A 1FNZA 4AEDB 4C1WA 4C91A 2PYTA 1BEV3 3LA7A 3WUDA 4XJWA 2D6OX 2FHRA 2D6KA 2XKPA 4LHLA 3I59A 4BLJA 1NZCA 2HWD1 1C1LA 1W0OA 1QMJA 5C9AC 4KG0A 4QGNA 4Z2WA 4O9EA 2RMU2 3WR0A 4DXZA 4P9WA 3WW4A 4AVSA 1FPN3 1YJLA 2R061 1O3RA 2PAKA 2ZAAA 5JDBA 1PIV3 1Q8SA 2DCJA 1RUD1 2VULA 2ZABA 2YGLA 4YSFA 3GZUC 4LT5A 3AYDA 3ZN6A 4KGGA 1GZCA 5DDJ1 3VDDB 2DV9A 2NP0A 4F3JA 3FFZA 4R8HA 2PHDA 4S2HA 5DXDA 2YXSA 3ZFEC 2ZCWA 1QXPA 3VKOA 4XDQA 3IDEA 3MLLA 3WDYA 4IV1C 2XGXA 4GMP0 3FBYA 2ZMKA 1HKDA 2WT0A 4QQHA 2GU9A 2ENRA 3O0WA 4URTA 1PVXA 2D7FA 2B45X 1VR3A 3GHNA 1XYOA 1ZBA2 3NKTA 1JW6A 5FBZA 4I2OA 2BYVE 1FMD2 3VZMA 1GNHA 4DRVA 2VH9A 4R52A 2K0GA 5CVRA 3VZJA 2EAAA 2WNVC 1N1VA 4DOUA 4CDUA 4COZA 1PNFA 1F2NA 4JDOA 1RUH2 3DPRA 1AR61 3ZVXA 4WV8A 4D7TA 3ELNA 1UPIA 5EV7A 4FXKB 3VGIA 3ZMOA 2JG9A 3EHKA 3PNAA 5JI9A 5IK4A 2WL1A 3ES4A 3MIBA 1U12A 1FNYA 1LGCA 1Y9QA 4M0NA 4CZSA 3FJSA 1F8VA 2XLGA 2E9QA 4RD7A 1U5XA 4SLIA 1LU1A 1AZDA 1LGNA 3LOIA </