3KM5A

Crystal structure analysis of the k2 cleaved adhesin domain of lys-gingipain (kgp)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
179
structure length
179
Chain Sequence
GSADFTETFESSTHGEAPAEWTTIDADGDGQGWLCLSSGQLDWLTAHGGSNVVSSFSWNGMALNPDNYLISKDVTGATKVKYYYAVNDGFPGDHYAVMISKTGTNAGDFTVVFEETPNGINKGGARFGLSTEANGAKPQSVWIERTVDLPAGTKYVAFRHYNCSDLNYILLDDIQFTMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Lysine specific cysteine protease
publication title Structure determination and analysis of a haemolytic gingipain adhesin domain from Porphyromonas gingivalis
pubmed doi rcsb
source organism Porphyromonas gingivalis
molecule tags Cell invasion
total genus 48
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07675 Cleaved_Adhesin Cleaved Adhesin Domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3km5A00
2W08A 1BZWA 2D6PA 3RG0A 2WSUA 1YI7A 2UWBA 4Y1VA 1KDMA 4XJWA 5DG2A 1ZA4A 5FREA 5JOYA 3M3OA 3UJQA 2WQZC 3IPVA 1LECA 3RS6A 3IPVB 2GMPA 2I2SA 4XJZA 2ARBA 1GNHA 1N47A 2R0FA 3AYDA 2W52A 3RMXA 5T54A 2DURA 3FLTA 4YLZA 1W0PA 1QOSA 1U0AA 3JUUA 3V0BB 4UW6A 3KM5A 2NMNA 4RA0A 4DQAA 1LU2A 4GALA 5T52A 1DQ4A 1YRZA 3ZSLA 5SV8A 1AF9A 2WKKA 1W6NA 1JYCA 2DU1A 2ZGTA 1JN2P 1W6NB 2CWSA 5GM0A 1UMZA 3IMNA 1N3OA 2PHUA 1MS8A 1N1TA 2RHPA 1LJ7A 1WD3A 1DQ1A 1LGBA 4WZFA 3HN1A 2BQPA 4XMIA 4FQZA 1DQ5A 2WT2A 1S0JA 3ZSKA 1G86A 2GNBA 2JKBA 3N7MA 2A70A 3O12A 3WHTA 4XIOA 3AJZA 5IK8A 2JE9A 2C9AA 3D5OA 4JC1A 1FV3A 3B9CA 4FPCA 5DXDA 4PBOA 1LGNA 2A71A 4U2AA 1UAIA 1LESA 2GMMA 4YZ3A 1JBCA 2DYCA 1LOFA 2D43A 2E6VA 1IOAA 5LK5A 5H9SA 2YXSA 3AZWA 3OPZA 3A0NA 3B69A 4JRAA 1I3HA 4FP2A 2UWCA 2NYYA 5IK5A 2NN8A 5EYXA 3WLUA 3U4XA 4AYUA 5H9RA 1GICA 1CVNA 3V0AA 1AZDA 3L2YA 1GANA 5HCAA 1JXNA 3V0AB 4YW2A 1DGLA 1APNA 2JE7A 3D4KA 2NM1A 4PQ9A 4Y1ZA 4GKXA 1DQ2A 1WBFA 1S0IA 4WV8A 2GNTA 1ENQA 2ZGUA 4DPNA 1G9AA 3ASIA 3NV4A 1DQ6A 1LTEA 1YIFA 3BODA 1MS4A 1GZCA 1QDCA 1O4YA 2ZBJA 4KBBA 4GXLA 1S0EA 5IK4A 4Q1RA 2PHFA 3ENRA 4XXAA 1Q8VA 4AGGA 4TZDA 1SFYA 2CWMA 1LCLA 1MR5A 4YZ4A 1QMJA 1C1FA 1KQRA 3AP6A 3BTAA 5DG1A 4BLIA 5JOZA 4AVVA 4D69A 2WSVA 5KXBA 1LOCA 2EIGA 4ITCA 5BYNA 2D6LX 2GMEA 3AYCA 1VIWB 3SITA 2AREA 3VKLA 1IS6A 1CONA 1IS3A 1A8DA 5JLVA 1V6JA 3D6EA 1MZ6A 1LHWA 1AJKA 4Q8LA 4YFZA 1EPWA 5HCBA 1AX1A 5DUWA 5L73A 1Q8OA 2W68A 1ULCA 1Y7BA 2DUQA 3B01A 4LBJA 5E8AA 3WHUA 3N7JA 2P3IA 2A5ZA 5GZGA 2A3YA 3PVOA 4XJUA 5GLZA 4HL0A 3Q9OA 1AXYA 2E7QA 1S0FA 5CNAA 2R1BA 4XXPA 1S0CA 3UL2A 3HR9A 2GDFA 4R9AA 5CB7A 4YG3A 1CIWA 3I4IA 2ZGOA 1WLDA 2Z42A 5H9PA 3WG2A 3NWKA 5GLWA 3O0XA 2ZMLA 5T5LA 3VKOA 1QF3A 1WW7A 2JJ6A 4AGRA 3WDUA 1LU1A 5DZGA 1LOAA 1ULDA 2D3SA 4M3CA 1NXD1 2DVGA 3PVNA 1GKBA 4M3CB 5CA6A 1LENA 1W6MA 2AENA 2YMZA 5GZFA 1SCRA 1SACA 1W6MB 5DZFA 2JDZA 1ULEA 3M3EA 3ZXFA 2PHTA 3MW4A 4XOGA 5DUUA 1AXZA 3USUA 1FV2A 5GLVA 2H0BA 1Z78A 3USUB 3V64A 3WUDA 3ZXKA 1LGCA 3N35A 3N3HA 4K21A 1LODA 2DTWA 3M3CA 2ZHMA 4P9WA 4R9DA 1HQWA 3POSA 1Q8QA 3A0KA 2VU9A 3AP4A 3W58A 3LSDA 1S1AA 4FOWA 3ZVXA 5DZEA 1AX0A 3T2TA 1G9BA 1HLCA 1QNWA 2WLQA 5GZEA 2SLIA 1LOEA 3V0BA 1JYIA 2OUJA 4BQ1A 3AYAA 1RINA 2NZ9A 4GKYA 2FHRA 1RITA 2ZGMA 1HQLA 3ILFA 1TEIA 2WT1A 2ZMNA 3O0VA 4BPZA 2P3KA 2CL2A 4Q27A 2A6VA 4BLJA 4Q8KA 2P34A 2VY0A 4YW1A 1GZWA 5E88A 3VKFC 1GZWB 2ZGKA 1LOFC 2W39A 3C2UA 1UX6A 4HANA 1GSLA 4YW4A 1DQ0A 3AP7A 4YM3A 1WBLA 5KXCA 3VUOA 1KITA 2A6ZA 2EXIA 3APBA 1MS9A 4FPKA 1C1LA 1SLTA 4H55A 1URXA 3TB0A 3V65A 1AJOA 2P3JA 4Z8BA 4YM2A 2PELA 1QNYA 4TYSA 2D3RA 2G4IA 1DZQA 4M01A 4FPFA 3SLIA 1QDOA 4CZSA 3FFZA 5F9TA 1GYKA 3QLQA 1DYKA 4FPJA 1ULFA 1WLWA 4XILA 1FYUA 1O4ZA 1V6OA 2NMOA 2EALA 3A4UA 1DLLA 1KJLA 2ZGLA 4BMEA 1ZM1A 1VAMA 3T1MA 4YZ5A 3BOPA 4LBKA 4UW4A 4XHBA 1KRIA 5AVAA 1LOGA 2R0HA 4XE9A 4YGCA 1G7YA 3WCRA 1V6IA 4AGVA 1N3PA 2E7TA 4XZPA 2OVUA 2ZMKA 3SNMA 1V6KA 4XMAA 3SH3A 1Z0HA 2Q5TA 1LHOA 5GJ6A 1OFSA 2PHWA 3ZYRA 1LHUA 1YO8A 2A75A 2CYFA 3OGGA 4M3CE 5T5OA 2EXKA 2SBAA 4FPYA 1KDKA 2A3XA 2CNAA 3O5SA 3R05A 3DGTA 4FPHA 3M3QA 1JHNA 3UK9A 1SLAA 3WG1A 5GLTA 4CRQA 2ZGQA 1D0HA 1UPSA 3M1HA 3ZYPA 1N1VA 3ZXLA 3RRDA 4DRRA 1MS0A 4OZXA 4YM0A 4XYXA 3VKMA 3OY8A 1FNZA 1JW6A 4FPOB 3OY8B 1GBGA 2D3PA 3INAA 3N7KA 1QKQA 2VW0A 1FNYA 4XJ8A 2DVFA 3DUIA 1UN1A 4DFSA 1G8WA 1BKZA 3ZSJA 4K1ZA 2A3WA 3IN9A 1ENRA 1S0GA 2A6WA 3AFKA 5EXOA 4NOTA 5IK7A 2GNMA 2WT0A 1LHVA 2XB6C 1LEDA 1NLSA 1Q8PA 4LBQA 2TEPA 1VLNA 1LHNA 4LBQB 5EWSA 4BMBA 4Y26A 1UZZA 1F9KA 4WVWA 3RSJA 2A6XA 1SBEA 5T50A 1Q8SA 2R16A 2ZHLA 5H9QA 1ONAA 1MVQA 1YXWA 5KXDA 1QOOA 4LBOA 3JU9A 3WOGA 1GZ9A 3QCWA 2GN7A 4SLIA 1BQPA 4PCRA 3WG4A 1GV9A 3I8TA 3NV2A 1WW4A 1PZ7A 2EAKA 4P9XA 2DUPA 4RL7A 4XTPA 3UJOA 4GWNA 4YGBA 3ILNA 3SH5A 5GALA 1CJPA 1D2SA 2GN3A 4XTMA 2VH9A 1CESA 2OUHA 5GZCA 4LBMA 4XIKA 3ZPYA 3W59A 3SISA 3ZSMA 1F31A 1H9PA 2ARXA 2ZABA 1MS1A 3OYWA 5T5JA 1Q56A 3WCSA 3OYWB 1W6OA 1W6PA 3ZXEA 4I30A 1W6OB 1W6PB 4U36A 3OBRA 1DIWA 4FOYA 1HKDA 2KM2A 4YFWA 5IUQA 4YG0A 3WUCA 3MW3A 5KXEA 3FUOA 3VKNA 4XBNA 1QOTA 2ZZJA 1AVBA 1IS4A 4IQPA 5F5QA 3WZ1A 4Y24A 4DRVA 1CN1A 2V73A 3NV1A 4BOWA 3T1LA 2GNDA 3AYEA 2VUAA 3ATGA 3AZYA 1SLIA 2UWAA 3FUQA 1A3KA 2DV9A 2DWRA 4AWDA 3R4SA 1MZ5A 3FLPA 1LULA 3OJBA 1MACA 1SCSA 5JVVA 2ENRA 3IKWA 3AX4A 3WVJA 3ZXJA 3M2MA 4P9YA 4Q1PA 1XQNA 5GZDA 4ZXKA 2DVBA 1WLCA 2A7AA 2ZAAA 3PVEA 1V6NA 4GWMA 4Y22A 4FOQA 1AX2A 1SLCA 4Y22B 4BM8A 1CPMA 2P2KA 4ISRA 4R9CA 5JDBA 1BXHA 3LCPA 2GALA 3WDWA 1J1TA 4YW3A 1CPNA 1FAYA 2D6NA 2DUOA 1F5FA 4W65A 3IM0A 4YM1A 3MW2A 3MPPG 1B09A 3PJQA 4CTEA 5JOXA 2ZHKA 4R9BA 3AXDA 5EYYA 4FPLA 3B00A 2P37A 1VAVA 4AVSA 3GNEA 4DS0A 4ATFA 1SBDA 2ERFA 3WDXA 4F83A 1PZ9A 4Q2FA 4NO4A 4YZ2A 2AYHA 4WVVA 1OQ1A 4YZ1A 1I1EA 2D6OX 2DVAA 4XJ9A 1DHKB 3CNAA 4ASMB 2ZGRA 2ZKNA 2JD4A 1V6LA 1JOJA 1A78A 4XDQA 1MVEA 1RIRA 1W6QA 4GA9A 5HCFA 3AP5A 1W6QB 3WDTA 1SBFA 3AXEA 4MYEA 1S0BA 5CBLA 1C57A 4YGEA 5JMCA 1FATA 2YROA 1W0OA 3AZXA 2DVDA 2NP0A 2AH2A 1N3QA 2LTNA 1KJRA 2D7FA 2YZ4A 1X50A 4Y20A 2XG3A 5DUVA 5FRAA 4Y20B 1GNZA 2V5YA 3HMYA 3RMYA 1N1SA 1IS5A 3VV1A 4P14A 3BIWE 1CR7A 4YGDA 4M3CF 1OKQA 1WUVA 4FP3A 1AXKA 5JOWA 1HDKA 3TAYA 3WG3A 1UZYA 2ES3A 3MEPA 4PBPA 5CAZA 4M00A 1UKGA 1LEMA 3N36A 1BYHA 2UURA 2VXRA 2CY6A 2EF6A 1QGLA 2C5DA 2E51A 2WJSA 2ZGSA 3AK0A 4JCKA 4Q26A 4XHXA 2CTVA 2ZACA 4UW5A 1MS3A 4YW5A 2D6MA 4AVTA 4FVVA 2R49A 1PZ8A 2E53A 4ATEA 2AR6A 1GLHA 2ZHNA 4K20A 1WW6A 2EXJA 2ZGNA 1LOBA 2JECA 4PF5A 2D6KA 3WV6A 2YV8A 1G9DA 3WDYA 2D44A 4C1XA 3O0WA 1WCSA 4L8QA 1YYNA 3WNXA 3H0OA 2VW2A 3PMEA 1R1ZA 3ILRA 2UU8A 5T5PA 1UL9A 1IKQA 1G9FA 1DFQA 1MS5A 5IT6A 1C4RA 1WW5A 2HYKA 2ZGPA 3RQ0A 3OBTA 2B7YA 1FX5A 4LBLA 2PHXA 2YY1A 3N7LA 4FPGA 3LSEA 4FOVA 1H9WA 3AZVA 2DTYA 3POWA 3SH4A 2R1DA 1H30A 2PHRA 2FMDA 3AZZA 4K1YA 4FPEA 1ENSA 1BJQA 1ULGA 4FQ4A 1JUIA 1CQ9A 1G9CA 1WD4A 4YG6A 3AJYA 3B3QE 4Y1YA 3GALA 4Y1UA 1S0DA 4ISQA 2EXHA 4XBLA 5GLUA 2AGSA 4UW3A 3R4UA 4XBQA 4LBQD 2AUYA 2A6YA 3FBYA 1VALA 5T55A 3WDVA 4ZKTB 3KQRA 2VW1A 1DYPA 1IKPA 1N1YA 4C1WA 1QU0A 2LALA 1V6MA 3FLRA 1SLBA 4XJAA 4LBNA 1DBNA 2DU0A 3AP9A 2WNEA 2ZA9A 3POYA 5E89A 1V00A 5DUXA 2OW4A 4Y1XA 3NV3A 1SLLA
chains in the Genus database with same CATH superfamily
2D6PA 1RMU3 2V4AA 4CDUC 3WY6A 1WMFA 4E4SA 4YWAA 1YI7A 3TN92 4CP9A 5JOYA 4HBNA 2VQUA 1R093 3NNMA 3M3OA 1DGRA 3NAPB 3OGJA 4A41A 4QDQA 2WQZC 5JAXA 3GHNA 3IPVB 2GMPA 2I2SA 4XJZA 2ARBA 2XL7A 3AYDA 2W52A 1E5RA 2DURA 5FPXA 4LA3A 4ZY9A 4EN0A 4JKMA 1RJ7A 3VBFC 4LO7A 1YFYA 1SHWB 4RA0A 1PO12 4GALA 5T52A 5IVEA 2IXJA 2WKKA 1JYCA 4CDXC 3GBFA 4DUVA 1JN2P 1W6NB 2RS32 5A3OA 1UMZA 1MS8A 1IG3A 1O7FA 1QJEA 3MGUA 4IETA 1FT9A 2ZJCA 3AMNA 3VZKA 4WM7B 4N43A 3HOBA 1DQ5A 2J22A 3U10A 2JDAA 3KF3A 1BK1A 3TEWA 1G86A 3D3AA 3E97A 4FCAA 1XOYA 4ZU5A 3WHTA 2JDHA 3AJZA 1QJX1 5IK8A 4QB1A 2C9AA 2YC2A 5LEKA 1UYXA 3D5OA 4JC1A 1HB1A 1QJY1 1YQ8A 3OD4A 5DXDA 2JG9B 1JZ5A 4PBOA 4JZRA 1UWWA 1UOJA 1ND2B 1YCIA 2GMMA 1YIPA 2Y64A 1PGW1 2YU1A 4X8PA 1UNBA 2XBO1 2E6VA 2Y26A 3OGRA 1IOAA 3KZ4C 4ZONA 5H9SA 2D93A 4IGQA 2BJSA 1BHGA 1POQA 3OPZA 3GCWA 4I09A 3KV4A 2NN8A 3OBZA 5EYXA 1RHI1 5H9RA 3V0AA 4MGQA 2YFUA 3L2YA 1JXNA 3FJSA 1D2QA 1DGLA 1ULPA 2FDGA 3E5XA 1ZRRA 4Q4Y2 5C9AA 2FDHA 4N90A 2RR13 1DQ2A 3T08A 4MUVA 2RM22 4WV8A 4DPNA 2ET1A 3NV4A 2W1WA 4BQ5A 1ASJ1 3FL7A 4GH4A 4GXLA 1RUI2 4KBBA 3T2PA 5L7OB 1OLRA 5LA1A 1OOPB 4ZS2A 1KS5A 1Q8VA 1SFYA 1IQAA 2CWMA 1RVF2 2WFF3 4YSFA 1MR5A 2GZWA 3HIFA 5FYBA 4Z92B 4XAAA 4CE8A 2QDNA 5FMCA 2FMYA 4H3WA 4BLIA 3BYWA 2IXLA 4D69A 5KXBA 1LOCA 1O8PA 4HVOA 5AC92 2Y6KA 1OBNA 5BYNA 3SXWA 2BTVC 3VKLA 1IS6A 1WCKA 1GZTA 5JI7A 1IS3A 1FOD1 2VQTA 2YHJA 5DDJ3 2N7GA 1XC6A 3DXTA 4Q8LA 2AEZA 4CPBD 1XYPA 4RHV3 4CEWA 1EPWA 3EJKA 4Z07A 3WP3A 1Q8OA 2JDMA 1W2OA 1CX4A 5LEJA 3WHUA 1ZZ7A 2P3IA 3GZUC 2DFCA 1JOBA 4OHVA 4HL0A 2VZ1A 5FY1A 1AXYA 5BNNA 1UYPA 2E7QA 3VBOB 5IVFA 4NPLA 5L36A 1HXS2 5FZ3A 5FKCA 4W8JA 2R1BA 5LY1A 1C8M3 4L9BA 3A22A 3HR9A 3ZOIA 1J59A 4D94A 5CFDB 1WA6X 1XB9A 3JB8A 3VBHB 5H9PA 3GZTB 5GLWA 2WAOA 2XL9A 3C8XA 3R6SA 4Y5SA 3SQOA 2VCCA 2ZMLA 5T5LA 1BEV1 2AACA 1WW7A 2JJ6A 2R062 5FLHA 3ZM8A 4AGRA 1AR93 1ZZ6A 2K0GA 4M3CA 4WM8B 1NXD1 3RNSA 1GKBA 1NCRA 1REDA 2RS52 4MVTA 1W6MA 5GZFA 1AYM1 1SCRA 1TE1B 3VDAA 4UFIA 3M3EA 1RUC2 5F39A 3WNNA 1E5SA 3OD0A 3VD5A 4XOGA 2VXJA 5LBEA 2IWGB 3IDAA 3USUA 3DECA 2EAAA 3KWVA 2PLV2 2VZQA 4KWUA 4GIQA 4DXSA 1E57A 3NNGA 1PGSA 4W6WA 3M3CA 3M4FA 3I3QA 4LHSA 3E5UA 4XUOA 3W58A 4XC9A 3VZNA 5BNQA 1XNAA 3F2ZA 2WO3A 3LAGA 4FFHA 4N43C 3UKVA 3ZVXA 4D8MA 4EV0A 4XUPA 1HX6A 4CCCA 2V72A 1AR82 3C7FA 1VBC1 1PX3A 3P6BA 4HKOA 1F5JA 4JVAA 2NZ9A 3ZYIB 1RITA 5BPXA 4IE0A 1YQ5A 3J8F1 3KV5A 3I97A 4EZHA 4A7KA 1UZVA 3LA3A 2VY0A 4NHKA 4LIUA 4XUNA 1DGRN 1GQPA 1UOGA 1GZWB 2ZGKA 3MO4A 4QQ2A 1UX6A 5FXXA 4UFMA 1HN1A 2YPJA 1DQ0A 1STMA 2XHNA 5CYYA 4LK6A 5EJ1B 4FXKB 3ME2A 2MEV1 4QPIA 2A6ZA 2EXIA 4FPKA 4QM9A 5FZDA 1C1LA 1HRI2 3J7NA 2ILMA 3V65A 3FMGA 1RC6A 5C9AC 4R4XA 2VNOA 4YM2A 2G9ZA 4IDZA 3T0AA 4FPFA 2W1QA 4ES8A 3I54A 1J3QA 2VOTA 4Q4X3 5C4WB 4K6BA 4LJHA 4CU7A 4WVMA 3ZKUA 4HVQA 1DYKA 1AR73 5LRRA 2WWUA 5A7QA 4GH4C 2EIBA 1NAEA 1T6GC 2ZGLA 1ZM1A 1YJKA 4JKLA 1OD3A 4YNIA 3BOPA 4COVA 3I2GA 4YARA 5ABJB 3ZN6B 1DCSA 2ZZQA 4OHWA 1V9U2 4AGVA 2E7TA 5C6CA 2I74A 1QJZA 1IPJA 1UY1A 1V6KA 4Q4W2 4XMAA 3SH3A 1Z0HA 2Q5TA 3RGBA 2BERA 5FZHA 2PHWA 3ZIWA 1YO8A 2G19A 2YU2A 2A75A 3H1MA 5EFUA 3I2OA 4E2GA 5FV3A 4CEWC 3UNPA 3HQXA 3KT7A 5JCTA 1CAXA 3WQ7A 2OIIA 2SBAA 5I91A 4FPYA 4KGGA 4CCOA 3WQ1A 4LT5A 1FMD1 3U11A 5A32A 2YDEA 1H0BA 3AKRA 1JYWA 4QMAA 4EWDA 5BNNC 3WSOA 3HVDA 4CPBA 4JHZA 3KD4A 1N1VA 1VBB2 3ZXLA 2C0ZA 3SCHA 4UFHA 5DPNA 1I5ZA 3ELNA 3O1OA 4XYXA 5FDBA 1FNZA 4GB33 1OA4A 1W9YA 3N9NA 2D3PA 3INAA 5EV7A 2JKXA 1J58A 2VW0A 3HNBM 5ANNA 4DY3A 4OVEA 1QEXA 2RG4A 5FZLA 1PVC1 3FE5A 3HN3A 2C24A 3P3NA 4DUXA 1EAH3 3J7HA 1NCRC 5J36A 4NAOA 4DXZA 2J1AA 1QH6A 4A2UA 5C5TA 1LEDA 2YYOA 1B35B 2CAVA 2TEPA 1VLNA 2QFEA 3OOXA 4G9SB 3VL8A 2BGPA 4DRVA 4PLOA 1A34A 4Y26A 4WVWA 4FFFA 4OMDA 3RSJA 4WBBA 4LUKA 4Z1VA 5FFOC 1VPHA 2MHFA 1BLZA 2WUHA 2HWB3 1GWMA 4CUBA 1ND3B 2UYBA 2VMEA 3WNLA 1QOOA 3THPA 1GZ9A 2GN7A 3KB5A 5I8SA 1U5IA 1WCDJ 2E33A 4SLIA 3OBAA 5BNPB 3WG4A 1RUJ2 3I8TA 2GC3A 2XJPA 2YUEA 5EZWA 1W8TA 2DUPA 2GAUA 4RL7A 1JZ3A 2HWD3 3LZZA 1UKRA 3UJOA 1VRH1 5GALA 5BXXA 1D2SA 4IEOA 4XTMA 3W20A 4BJ0A 1W9SA 3ON7A 4FAHA 4HZFA 5F6KA 1PM4A 4QDRA 4FBFA 1M4WA 1F31A 1QJU1 1YFWA 1BVP1 1SPPB 4NIHA 3OYWA 3BTYA 1RUH1 1W6PA 3ZR5A 5FQ0A 1UZWA 3UGGA 2BNOA 4FOYA 2OPKA 4YFWA 5IUQA 4COUA 4QKDA 2Y0IA 3FUOA 3VKNA 1UIJA 4RFT0 2GP3A 4QPIC 4OI0A 3DKQA 1JYTA 1AVBA 1GFF2 4IQPA 1RUE2 4Y24A 4QPGB 3RJRA 2V73A 5IYYA 2BWCA 2GNDA 1TMF2 2PFWA 3AZYA 3FUQA 4IGOA 2DV9A 4AWDA 3MIHA 1MZ5A 4I0WB 5LA2A 1RYYA 1O6UA 4NAMA 2ZPXA 4AHWA 3RZJA 4NUBA 3M2MA 1ZRCA 3HJRA 5F5IA 1DDLA 3E1F1 2R7EB 3C7HA 2VUJA 1Y9GA 2DVBA 3CKHA 2ZAAA 3PVEA 5FYHA 3O1MA 4P5HA 4G3YC 4Y22A 3R4DB 4BIFA 2IXCA 1AR61 3ZDSA 4BM8A 5A33A 4C91A 2P2KA 2FZ1A 2D98A 2GC1A 2YBPA 5C3OA 5JDBA 2WZR1 3LCPA 4Q4V1 2VBPA 4B29A 4RYDA 2D6NA 4AEJA 3VBRA 4W65A 5A7OA 4XURA 2C6SA 4XZUG 5CFCB 3JZVA 1WMDA 4Y4RA 4RR3A 4AI2A 4BHPA 4CP2A 4QGNA 2WWSA 2QQLA 4OULA 4Q5OA 4CDUB 5JOXA 5LASA 4R9BA 3MIDA 3X29B 3TEYA 5FCCA 5EYYA 3MICA 2P37A 1QQP2 3Q8AA 5B4NA 1SBDA 2GP5A 2UY9A 4CSWA 1OC1A 1GNYA 4GMP0 1PZ9A 4UBHA 4WVVA 4TSVA 1OQ1A 1I1EA 3KLSA 4XACA 2D6OX 5DMYA 1NLRA 3HEIA 2Q1ZB 4XJ9A 1O5UA 3CNAA 5FMOL 4BISA 3VBFB 2QKDA 4XW3A 4CCEA 4TTGA 1QJX2 3ES1A 1W8HA 2JD4A 4CEYA 4CXXA 2QZ3A 1QJY2 4MH0E 2J1VA 1RIRA 4BDVB 4CDXB 1W6QA 2JB8A 2XOMA 1OPOA 1YFUA 3AP5A 3MIGA 2IVIB 4GA9A 4P9LA 1PGW2 2IXKA 4MYEA 3AB0A 3H8XA 1W3XA 1X7NA 1ODMA 3CF6E 4PIZA 1R083 1Z7S3 5JMCA 4PIYA 5A70A 3ROUA 2DVDA 1COV3 4META 3VDCA 2P1BA 2XVKA 1N3QA 1RHI2 1YWKA 2D7FA 2B39A 2YZ4A 2XMLA 5FRAA 5M0TA 1GNZA 1IG0A 1O8SA 4YGDA 4M3CF 1OKQA 1WUVA 5L9BA 4FP3A 2G1MA 3J9SA 3RWNA 1OHFA 3NVCA 1R1A3 2B8MA 1L3JA 2XWBB 1UKGA 4HK9A 2Q1MA 5CG8A 3PIJA 2UURA 3O1SA 4Q26A 2WJSA 3RWKX 1VBE3 5CFDC 1ASJ2 4UW5A 1SG3A 1JUHA 4YW5A 2D6MA 2JD9A 3WW2A 1AL0G 4ATEA 2R043 4LTAA 1PX4A 2YGLA 3G6JB 4OUSA 3VB9A 2HKXA 4LHNA 3O7OA 4QU1A 3AVSA 2V5DA 2W5FA 3U37A 1G9DA 4JQRA 3I2JA 4C1XA 3THTA 4JTNA 1WCSA 2FD8A 1LR5A 1PMHX 2A73B 1YYNA 2Y6LA 2QQPA 3RZGA 2VW2A 1W28A 4PI0A 1BMV2 4J1XA 1W99A 1NZIA 2ARAA 1UL9A 2O1QA 1G9FA 1O59A 1W90A 1CJDA 4IEQA 3ZYFA 3ZPOA 2WBKA 3OBTA 3MIEA 4W4ZA 2RVAA 4XF0A 1EV11 4KG0A 2HEYF 1XNTA 1F2NA 1R091 2QUOA 4UF0A 5I0UA 2FMDA 2F6BA 3WF4A 2CGNA 3A7QA 4NROA 1ULGA 2G9FA 3M8LA 4HSJA 2FCVA 4EN6B 1CQ9A 2WN2A 5ACA2 2FDFA 4Y1YA 1DZTA 5LK7B 2VCMA 4IE7A 3IIAA 4XBQA 3R4UA 4LBQD 1VALA 3POFA 2HEWF 5JIUA 1BEV2 1TVGA 1QU0A 5LBCA 2C4XA 1SLBA 4AVBA 3U07A 2BEOA 1DBNA 3BUCA 3AP9A 1NX9A 1AYM2 3TNQA 2VULA 5EPAA 1V00A 2BRTA 2JIJA 4QQPA 3VBRC 3ZN4A 3NV3A 2E9QA 2BWAA 2VECA 4EN8B 4MGIE 4CU6A 4KNCA 4RR3C 5FZ4A 2WSUA 2UWBA 4Y1VA 1UO9A 1HIXA 3SEEA 4CP9B 1CAVA 1LECA 1RXGA 2X09A 3UJQA 4YM3A 5JSOA 3NJYA 1MZFA 3K2OA 4IEPA 2PAMA 4YLZA 3T09A 2XWJB 3WP4A 4E4DX 3I2HA 4B4RA 3JUUA 1VBC2 2YBSA 3LEKA 3KM5A 5FYTA 4WZCA 5FBJA 2NMNA 1TNFA 5D21A 4AEMA 1RUNA 3PIGA 1LU2A 4BZ4A 1YRZA 5FO8B 1AF9A 2HWE3 3J8F2 2DU1A 1RUF3 2ZGTA 2CWSA 4AAXA 1N3OA 4UBGA 3RZLA 1N1TA 3KT4A 4GZ9A 2O8QA 2QNKA 4LITA 4LOSA 4D6RA 3QH6A 1DQ1A 2JG8A 4WZFA 2BQPA 4RD7A 2RR11 3C7EA 4N43B 2RV9A 1BVVA 1S0JA 1MPXA 3ZSKA 2MEV2 4OMCA 3N7MA 1SEFA 3FHAA 2A70A 4QX0A 3PNAA 3O12A 3VHNA 5A3MA 2BDRA 1U12A 3VBSA 1SDWA 2A71A 4B1MA 1UAIA 4BK4A 3LKJA 4O9GA 1W8FA 2WFF1 1JBCA 1K12A 1LOFA 5LK5A 1A6CA 1PO13 3RYPA 1PO22 4DO0A 3B69A 3W5MA 3U1XA 2NYYA 2RS33 1YEWA 1GP5A 1CVNA 2JENA 1GANA 3V0AB 4A6SA 4YW2A 2L9LA 3WNKA 5F5AA 3AC0A 4RHV1 3D4KA 5C9AB 2ZX3A 1GP6A 1YQCA 2XHKA 5BY5A 4ET7A 4PJYA 1WBFA 2DFBA 2VE1A 2GU9A 3CEWA 1GU3A 1HQNA 2B46X 5FZGA 5FOJB 3ASIA 2VUDA 1LTEA 3ZN5A 1O3TA 3PJYA 4XQ4A 2ZBJA 4ORFA 5FZ6A 2JDNA 4P00B 3K4ZA 4GH4B 1NQDA 1C8M1 1J1LA 1W06A 4M0HA 4Q1RA 4XXAA 4AGGA 4DNYA 1ACCA 5IVCA 4QM8A 1LCLA 3C3VA 5FY4A 1FMD2 1RJ8A 5A6QA 2QQIA 1C1FA 2LW8A 2Y0OA 4LLOA 4PI2A 3AP6A 4MGKE 2E63A 5DG1A 4AVVA 3VD3A 5IATA 2W3JA 4ITCA 3SITA 1AR91 3ZYBA 4AF9A 1VB4A 2OKXA 1OPMA 4XQWA 1V6JA 3D6EA 1LHWA 1QH7A 5FZOA 5FPZA 4CEWB 3JD71 3KCCA 4NPRA 5L73A 1JU4A 4A42A 1W9WA 1ULCA 1Y7BA 2W68A 3ALQA 3B01A 1PHMA 2RM23 3N7JA 1SZBA 2A5ZA 3CJIA 1W04A 2A3YA 4Q0UA 1XYNA 5EQUA 5IJRA 2H6BA 5KHHA 2BPA2 5CG9A 5BNNB 3MLKA 4TLGA 4MGYE 5CNAA 1RUI3 2O0OA 3P1IA 1HJGA 3WW1A 1S0CA 2LROA 4HK8A 5K4LA 1QWRA 1RVF3 4O7XA 4YG3A 3O1RA 3I4IA 3S30A 2Z42A 3NWKA 3ST7A 3A21A 2QQOA 3O0XA 1VR3A 4DXRA 3RYKA 4BQWA 2IXHA 4AR2A 1REFA 3GZAA 2W92A 3VLBB 4RQPA 3ZLIA 1OH4A 3LPGA 4E8CA 1LOAA 2D3SA 3BCWA 5A1LA 3BB6A 1UXXX 4M3CB 1LENA 1NCRB 1H1AA 4S2FA 3JBG3 3S7EA 1W6MB 1XNCA 4L92A 2JDZA 2WZPP 1EYBA 1OSGA 1VRH2 4UWDA 3VZJA 3JQXA 1AXZA 3W9AA 4GD4A 1FV2A 4D7YA 2Z69A 3WW3A 3USUB 4TLFA 1VMHA 3V64A 1NE4A 4ZS3A 3ABZA 3N35A 3POIA 4B1LA 1LODA 5A3TA 3LB9A 1RUH2 1Q8QA 4KG8A 4OI2A 2JG8C 2DCKA 1FI2A 3LSDA 5DZEA 3T2TA 4K8RB 1S2KA 1HV1A 1YQ2A 1HLCA 1NA1A 1QNWA 2IC1A 2OPWA 1BCXA 5GZEA 2Q8EA 4Q4X1 4NRQA 1RUG3 1UZ0A 3I3EA 4OHXA 1JMUB 2Y6FA 1AR71 1RINA 3VD4A 4GKYA 2FHRA 5JZGA 3VBSC 3JCIA 1SFNA 1TEIA 5I8TA 4MGTA 4JX0A 4KMQA 4Q27A 4LNVA 5KHIA 2RS53 4P9JA 4COWA 3PTRB 1D4VB 3ZX7A 4N8MA 1IQDC 1LOFC 4OZOA 3TYJA 3C2UA 1RUC3 3RVHA 2RMU2 1GSLA 1RUD3 5K9YA 1WZXA 1V0AA 4UAPA 2VD7A 4QPIB 2Q0AA 4HN0A 2E7AA 4NPMA 1AR62 1W2NA 1AJOA 2P3JA 2WZR2 3PUSA 4KBZA 4X6RB 4TYSA 5D2AA 1PGL1 2D3RA 2G4IA 2F4PA 1H6XA 4LKFA 2Y6GA 3PUAA 3SLIA 1K5JA 1QDOA 4CZSA 1UX7A 3WF3A 3WF1A 1E5IA 3QLQA 4WVMB 4BQ4A 2XLFA 4AI8A 3DN7A 3WQBA 1H4HA 2NMOA 3A4UA 5FY0A 2LRPA 4LE4A 3AFGA 4YZ5A 4UW4A 3PUQA 4GB31 1LOGA 1G7YA 1T6BX 1V6IA 1XPWA 2ARCA 3P3PA 1N3PA 4N9IA 3J4UH 3WW4A 4MSVA 1W2UA 2ZMKA 2W95A 3I3MA 1IZ3A 1OQEA 5EHDA 4XF3A 5GJ6A 1T2XA 5AFEA 1LHUA 2IUWA 3MLLA 3GBGA 2ZEYA 4AHXA 4A3XA 4W6YA 4FTBA 1LAJA 3POBA 2Q8OA 1CAXB 2Q1FA 2ZCWA 4LXLA 4ZHNA 2X53S 3MI8A 2A3XA 3O5SA 3R05A 3CJIC 1U5XA 2HWF3 3DGTA 4FPHA 1RUOA 2BYVE 3M3QA 5A32B 1IPSA 3UK9A 5JR2A 4JGYA 2GC0A 3PTYA 4L99A 4XF9A 2CGPA 1UPSA 3M1HA 5C71A 3RRDA 4DRRA 4XF4A 4OZXA 3ZR6A 2Q8DA 1DZRA 1Y4WA 3VKMA 2I45A 2BP6A 2VCAA 2PXJA 1I9RA 3O1PA 1O3SA 2FCTA 2BUKA 4HVRA 4XJ8A 1JZ4A 2DVFA 4RQPC 1X9PA 4DFSA 3Q8EA 3ZSJA 2A3WA 2O14A 3H3UA 4RGKA 3IN9A 2BFUS 5EXOA 2RJ2A 4NOTA 3AKQA 2GNMA 4C8DA 4AVAA 3H3LA 3DXUA 4NRPA 4AZZA 1UZZA 5JMOA 1NY71 2A6XA 3LFMA 4H7LA 1SBEA 2WAAA 2D5FA 2EIDA 4GAZA 4NIGA 5A1AA 2W46A 5FIXA 3ZFGA 5FLJA 1MVQA 5KXDA 1VBB3 1C5HA 3WOGA 5FK7A 2YBKA 4K9SA 1NA1C 4YVSA 1BQPA 4NVPA 3VDBA 3ZIXA 1WW4A 1V70A 4V1PA 1LRHA 3OUHA 1SQ4A 1D4M1 2VTXA 1EV12 2ET7A 3WF2A 2DDUA 1R092 5JZGC 2VGDA 5AFBA 4Q0QA 2VH9A 1CESA 2XJQA 4AFBA 4QB2A 5LBBA 4ZZ5A 2QQUA 3W59A 3SISA 2DCZA 4IEUA 1H9PA 3LQCA 2ZABA 1ZREA 3FFQA 4CDQA 1Q56A 1POV1 3NL1A 1W6OA 3OYWB 4OFGA 3I59A 1W6PB 1LB2A 5FQ0B 3H9AA 1DIWA 5JPMB 3WUCA 3HT2A 2OQ6A 5JXIA 2ZZJA 3VZOA 2V09A 1IS4A 3H42B 4MGSA 3WF0A 4GWJA 1G6NA 4BOWA 5FMBA 3AYEA 2VUAA 5FP4A 4OQ8A 3ATGA 4HN1A 3KGZA 2DWRA 3TBDA 3R4SA 3SCGA 1RUJ3 3IIIA 2W94A 4L97A 2AEYA 4EJRA 4E8DA 2UY8A 1EUUA 3MUZ1 1SCSA 5JVVA 1Y9MA 3AX4A 3WVJA 3ZXJA 3OF1A 2K2SA 5HCHA 1VBD3 1NCQA 1XQNA 1QXRA 4PIXA 4ZXKA 1W9TA 1WLCA 3PUHA 1V6NA 5FUIA 4HPKA 1AX2A 4Y22B 4LO4B 1OLMA 1GOFA 2IXIA 4ISRA 1H1MA 1REEA 2QQKA 5EJZB 5A33B 1BXHA 2C26A 3TEXA 4CA9A 2VTXJ 3WDWA 4LKDA 4YW3A 3RZZA 2NQYA 1MZEA 4S2DA 3VBRB 2RS13 1MQTA 4IV1B 1S55A 3RI9A 1B09A 1RUE3 2H0VA 4RGGA 2VZRA 5C3SA 1CGPA 2VOXA 4RR3B 1GQGA 2ZHKA 2VTFA 1UIKA 5CISA 3KHCA 3MLJA 2Q8CA 2E31A 2Y33A 3B00A 4FPLA 5I0SA 3E6CC 1XSQA 4UYBA 4AVSA 5A3PA 5KHGA 4B4QA 1RXFA 2PAKA 2ERFA 2RR12 2WS91 4E9KA 4Q2FA 4YZ2A 3HBKA 3BTZA 2CU5A 4BQ2A 3E6DA 5FYUA 4NJ4A 2ZGRA 2ZKNA 2XUMA 1V6LA 4CEYB 3NQHA 1AYN2 2QBXA 1MVEA 3H1YA 3CU7A 2R041 4UFKA 3KCXA 1W6QB 2J1UA 1SBFA 1NT0A 3AXEA 3PLQA 5CU1A 3WDTA 4Y3OA 5FZIA 3ES4A 2VQ0A 2UYAA 1GWLA 3H8RA 2W1UA 3ETQA 1OI6A 4JKKA 4QPYA 2NP0A 1UY2A 1US3A 3SMHA 2LTNA 1CAUA 4AHYA 1NQJA 1UY4A 2OZJA 1UQXA 1X50A 4N7UA 4YPJA 1QQP3 3AKPA 4KWJA 1VBA1 3VV1A 5APAA 1IS5A 5JI9A 1W8NA 4RHV2 1CR7A 1ZA7A 4KU7A 4DZGA 4PLMA 1BBT1 5FYZA 1HDKA 5F6LB 3I3DA 5FPLA 3WG3A 1UZYA 2ES3A 2VMGA 4PBPA 5CAZA 3LWCA 3ZFGC 3N36A 2VUCA 2G9GA 2ZGSA 4X8NA 5CKQA 3AK0A 5K7PA 3OCPA 4MHUA 5IVYA 4FT8A 2AC1A 4YVSC 1C8M2 3AMHA 1TG7A 3H8OA 2R49A 4AFMA 1YQ6A 2E53A 2WQ4A 3DPRA 2AR6A 2ZHNA 3OTFA 4JDMA 1OH3A 1Q3EA 2QDRA 3RI8A 3MPBA 1ZNPA 4PF5A 1JODA 2FDKA 2YV8A 3MBWA 2VZPA 3WDYA 4D7SA 4BA6A 1RHI3 4CDQC 1D0GA 1JTZX 1R1ZA 3ILRA 1DFQA 3LDBA 5FZCA 1PIV1 1VJ2A 1OD5A 1FX5A 2B7YA 1LKNA 2QQVA 2F4LA 3JD72 4LBLA 1W39A 2ID4A 2VJXA 1W2AX 4FPGA 4CXWA 4FOVA 1IPKA 2PQQA 2DTYA 3OSDA 2WNUB 4NWVA 3WX5A 4MO3M 1H30A 2PHRA 1ASJ3 4UF0B 1UYZA 4QXKA 1OT5A 1ST8A 4FQ4A 2VL4A 2VZSA 4GMP1 1JUIA 1GOGA 4XF1A 4YG6A 3AJYA 4QGLA 2BGCA 3PU8A 4Y1UA 3AMMA 1FPN3 2AGSA 4IERA 4MOAA 4EN7B 5CFCA 2AUYA 1NCQC 2W87A 5T55A 4AFDA 1YI9A 4LHKA 4OI1A 2X05A 2QE3A 2HWE1 4HKWA 1V6MA 4BWOA 3R0RA 2XUEA 4QQHA 4QX8A 4LBNA 5D8AA 5DN2A 3ZKYA 2WNOA 4XCBA 5FUPA 3U0ZA 4FO9A 5A7PA 4XFIA 1KS4A 2WNEA 3K48A 5E89A 4LE3A 5DUXA 2XJUA 5FR3A 1K5MA 1GP4A 1NOVA 1X82A 1BZWA 1MQTC 3NMBA 4QHZA 3N4MA 1O91A 4JDNA 1ZA4A 2XJRA 5A80A 1W8ZA 1CAVB 1OUSA 5FY7A 5ACA3 1GNHA 2R0FA 5T54A 1OA3A 2RJKA 4G4FA 4EQVA 4Q4X2 1QOSA 3LD8A 2HH9A 1UOFA 3V0BB 1QIQA 1AR72 1PO11 4CVUA 1AUYA 2JIGA 4DQAA 1NZCA 3PURA 3U78A 5J3UA 1DQ4A 3ZSLA 2PN5A 4IV1A 3Q8BA 4J6GA 5SV8A 2ZOEB 5GM0A 4AL9A 2WNVA 2OQ7A 1AYM3 1NG0A 4XFFA 2RHPA 3I3BA 4URAA 3QBQA 4R52A 4HKLA 3WNPA 4DINB 1LJ7A 2C1FA 2ZX4A 4AEKA 3FHQA 2W1SA 2JG8B 3BVCA 3HN1A 4XMIA 1E5HA 3GYDA 2FQPA 4JQTA 4DUWA 3CHXA 1YJLA 2GNBA 2VAUA 3I2KA 1XYOA 1HB4A 1ZBA1 1NE6A 3GXUA 4R8HA 2VMIA 1L7LA 5KHJA 1ZZ9A 1UU4A 2WC2A 3T2QA 4AK3A 1H2LA 4L0PA 3VBSB 1PGL2 3EYPA 1FV3A 5C70A 5FZ7A 5A7NA 1LESA 1S4CA 4YZ3A 2PYTA 2DYCA 1ENXA 4XUTA 2XBO2 3VZMA 4KGQA 4AFCA 3AZWA 4GWIA 3H50A 3J8F3 4JRAA 1HB3A 2EA7A 3E6BA 2UWCA 2WO1A 3HD8B 4NHYA 3U4XA 3WLUA 2BNNA 5C5UA 4AYUA 2YC4A 4DXTA 1AZDA 3J7LA 5HCAA 5HXMA 2WA4A 2VZVA 3MIFA 3I2FA 5IVJA 1ZBE1 3EO6A 1JYVA 2JE7A 3LEIA 2NM1A 2H6CA 2Z5WA 4E2SA 2PQSA 3NJZA 4CYDA 4Y1ZA 4GKXA 5HV4A 2X10A 2J42A 4S2GA 5CEHA 2CHHA 1S0IA 3KVBA 4KI5M 4JRLA 1TQ5A 4SBVA 1G9AA 4LO5B 3THCA 5C7GA 1DQ6A 3BODA 3LF7A 1MS4A 1GZCA 1QDCA 3OPTA 4V2VA 3OB8A 4CCNA 5IK4A 2HBTA 3LGRA 3NO8A 5FLIA 3ENRA 3AVRA 3DKWA 1ULOA 3NNLA 4NRMA 3BIEA 4OUMA 2WO2A 3ZYGA 3J7MA 1C3HA 4YZ4A 4IEZA 4XFCA 1F4AA 4CU8A 3CDZB 1PO23 5JOZA 3IWZA 3K3OA 2VMFA 2WSVA 1WLTA 2D6LX 2GMEA 3AYCA 2QTWB 2AREA 3BGAA 1HRV1 4URTA 3THDA 5FYVA 1CONA 2HWC3 2R6QA 3ORJA 1A8DA 2I07B 4B8EA 1FOD2 3JBG1 3TWIA 5CFCC 1AJKA 3VDDA 4YVWB 1OLME 3CMGA 1AX1A 2DCJA 2Q4SA 5FZOB 5DUWA 5HCBA 3WEZA 1WA4A 2DUQA 3EHKA 3JXSA 5KWRA 4P5YA 1RMU1 4AAPA 5D8AC 2WNUA 3CJIB 3PVOA 4L2NA 3POJA 4XJUA 4YRDA 2YGMA 3Q9OA 4PF1A 2W47A 2D5HA 1S0FA 4MXWA 4XXPA 1K5MC 3UL2A 4QKBA 1UMIA 2GDFA 1FMD3 4JGZA 1CIWA 1NY72 4I02A 1WLDA 1RUG1 1XNKA 4OLLA 3HAGA 4IE4A 1DG6A 2X5IA 3VKOA 1TME3 4CCMA 1QF3A 5F32A 1LU1A 3KVAA 4UI9L 3MIBA 4RQPB 1ULDA 5DZGA 1CAWA 5J1XA 5JUVA 3VL9A 2NPIA 2DVGA 2R073 3PVNA 3HNYM 3UGFA 4BXSV 5LWBA 3HPNA 2AENA 2YMZA 4D6QA 4TXWA 1UF2C 1D4M2 3T0BA 1OURA 2J1SA 3T4VA 3ZXFA 2PHTA 1RUD1 5FZ8A 4QDSA 5DUUA 4IV1C 5K0UA 1MEC3 2XQRA 5GLVA 2H0BA 2TNFA 1YFXA 4KH9A 2WNVC 4QU2A 4YW6A 2V4VA 4Y5Z0 3WUDA 3MYXA 4P9WA 1K3IA 3POSA 1AL23 5F5CA 2VU9A 3AP4A 3LPFA 1S1AA 2J1RA 2LS6A 5DAWA 1AX0A 5SV5A 4AQ2A 3AL6A 1G9BA 3VZLA 1YUDA 1EUTA 1NA1B 2WLQA 4FTSA 2SLIA 1LOEA 3V0BA 2OUJA 4BQ1A 4COYA 1X36A 2VNGA 1H4GA 3Q8FA 1HQLA 5JZGB 3ILFA 2WT1A 2XJTA 2ZMNA 2PHLA 4BPZA 4CEYC 2P3KA 4Q8KA 2P34A 2J1EA 3H3ZA 2Y8KA 4YW1A 5E88A 2FZ2A 4HG6B 1H2NA 1ODNA 3EMRA 5L9RA 3S7IA 4XAEA 3URFA 3NJVA 4UFLA 4O9EA 4I3PA 4GJYA 2B9VA 1WBLA 2J1TA 4XDPA 4QGMA 5KXCA 1KITA 3TN93 1YNAA 3APBA 5C8CB 1W8UA 4INDA 3N9LA 4UT5A 3TB0A 4Z2WA 3VHOA 2MPFA 3E5QA 4A6OA 3CO2A 3WR0A 2CSGA 2OX0A 4IEWA 4XDOA 1QHDA 5IFTA 1CZVA 2HWF1 4NN0A 3L2HA 4A44A 2VOWA 2WYFA 3FFZA 5F9TA 4PDWB 1GUIA 4FPJA 4HOOA 1ULFA 4LK7A 4D0QA 1O4TA 4RN5A 2VO5A 2JDUA 4XFAA 2WQ8A 4L11A 4NIAA 1DLLA 4FXGB 4LMFA 1VAMA 4LBKA 2WS92 1KRIA 3IDCB 2R0HA 4MGZE 4XE9A 5DDJ1 2RMU3 5FO7B 3O1UA 2BBVA 1CZSA 4GJZA 3ZFFA 3POGA 3WXPA 5KC6A 3PDQA 5C33A 4AW7A 2OVUA 2QQMA 3MDPA 1NUKA 1PK6A 2OZ6A 3IBMA 3CLPA 3SC7X 3AKSA 3VD7A 4Z82A 1AR63 5E6HA 3ZYRA 2JDYA 2YPDA 3VDDC 2R042 3WD5A 4LA2A 5T5OA 5F3GA 4CUAA 3HQRA 2EXKA 4QKFA 1KDKA 5ISLA 4FSJA 4CDWA 3DV8A 2WNUC 4K8FA 4BIOA 1JHNA 3PHMA 4LO8A 5FZ9A 1SLAA 4JGYB 3WG1A 4BH9A 4ZU4A 3NNFA 1D0HA 2BOJA 4HLTA 2PTMA 4AOCA 1VBA2 1AHSA 3RJ2X 5JXGA 1MS0A 2R32A 4OHYA 1BBT2 4JGZC 4YM0A 2DCYA 3GBWA 3OY8A 4AVCA 1W9FA 4FPOB 2B45X 1GBGA 2X5IC 2VCBA 4Q4Y3 3MUY1 4LULA 3PMSA 4Y4YA 1QKQA 4Q0SA 2XLAA 5HV0A 3DUIA 1C28A 3K75B 4EROA 1BKZA 1OFNA 3BU7A 4K1ZA 1XE8A 1PVC2 5FMOS 4QXCA 2ZX0A 3TNPB 3AFKA 4D6SA 1H8TA 5IK7A 2WT0A 4QX7A 2IZWA 2ZX2A 3K51A 1NLSA 1Q8PA 4LBQA 5A3LA 3B7MA 1LHNA 2XQXA 4KWKA 5E1RA 5EWSA 5FYMA 4OUEA 3UESA 4BMBA 1W0NA 3LEMA 5K0UC 3W5NA 1F9KA 1ZZCA 3I2DA 4DY5A 4IEXA 3FWEA 3WINE 1ZZ8A 2RE9A 2OYZA 2R16A 3OEBA 1W2TA 3U14A 1DP0A 5H9QA 4A7ZA 4C0BA 4CUGA 1ONAA 3ZFGB 3JU9A 2VZOA 3QCWA 2ETEA 5AC93 2C9KA 1PIV2 3KQ4B 4CCDA 1XE0A 1PNFA 1H2KA 4YVSB 1BK0A 2EAKA 1L7RA 3FZ3A 4XTPA 1CX1A 2Y6JA 4YGBA 3ILNA 1CJPA 4W50A 4XETA 2EVXA 2GN3A 1VBD1 1J3PA 3K46A 4XFHA 1XRUA 4LBMA 3ZPYA 2VMHA 4HONA 3C7OA 3ZSMA 1H2MA 4OCTA 1QJU2 5FJKA 1MS1A 3TOJA 3WCSA 4CDQB 1HXS3 3ZXEA 4I30A 1W6OB 3I59B 2JX9A 2W9XA 1WMEA 2KM2A 4IXLA 4B4PA 4YG0A 3MW3A 2ZEWA 5FJHA 2RS11 1KD7A 2IVJA 5T3NA 1RUE1 5ANQA 2HWE2 2VNRA 3WZ1A 1CN1A 3T1LA 3EQEA 2VG9A 2VR4A 5DABA 2R063 4KL1A 1SLIA 3O1VA 1A3KA 2CDPA 2P6HA 1UW8A 1GR3A 1OVPA 3AL5A 2HLEA 1MACA 3KF5A 4IV3A 1EV13 1H8VA 2ENRA 4QX3A 4O61A 3SKVA 4P9YA 4F8AA 5IVVA 4IESA 4JHTA 5JXHA 2K9ZA 2JICA 3KSCA 1NCQB 4P08A 1UD1A 3VHRA 1W03A 2PLV3 2QQJA 5C8CA 1JS9A 5FXWA 1SLCA 4HPKB 2XONA 4P9GA 3KS7A 3SHRA 3ZFFC 2VVEA 2GALA 4E4ZA 1CPNA 2E26A 4Q4V2 1F5FA 2XDVA 3ZFEA 1PK6C 3IM0A 3MPPG 2BNMA 3PJQA 1AR83 1MQTB 3U75A 4DOUA 4CTEA 2ADEA 5BNOA 3IZOA 3FC0A 4PDWA 5FPAA 1PMJX 3AXDA 1QQP1 3B5LB 4JAAA 1VAVA 1SDDB 2Y60A 4FI9A 3GNEA 3MV11 5BUVA 4ATFA 4HFSA 4CDWC 5JSRA 4XFGA 5FYYA 2BU9A 2BVBA 4YZ1A 1CWPA 5A3NA 2F17A 1ZBA2 2ZXQA 4YW7A 4OHZA 4W6XA 1W8WA 4QB6A 5A7WA 4PHZA 3LDKA 2XVGA 1DF0A 3BN6A 5IAVA 4XDQA 1EAH1 1HRI3 5FZEA 1OLQA 5HCFA 3NKGA 4IEYA 4XUQA 3ITQA 2WZ8A 3QOPA 5CBLA 1S0BA 1XE7A 1Y3TA 3I2IA 3VD9A 3N9MA 1XSRA 5FP7A 1C57A 4AEDA 1FATA 4AQTA 2HJIA 4FAGA 4BQXA 1ZRIA 1H8TC 1TZOA 1KJRA 1GMMA 3H1WA 3H7YA 1VB2A 3HT1A 3C7GA 1CAUB 5EP9A 5F3EA 2HWB1 4MV2A 4Y20A 5DUVA 1W3VA 2V5YA 5CADA 1ZBE2 3HMYA 1N1SA 5FP9A 3RMYA 4P14A 3BIWE 5J37A 1XXNA 5EJ3A 5LATA 3LA7A 5JOWA 3TAYA 2QCSB 3SKJE 3MEPA 3CL1A 4UFJA 4M00A 1V9U3 1LEMA 2HWD1 4BE3A 1BYHA 4EN9B 4JCKA 2EF6A 1L7QA 1QGLA 2E51A 4M4PA 4XHXA 5FZKA 4CCJA 4Q4W3 2CTVA 4IE5A 5FTTC 1MS3A 1AYN3 3O1TA 4TWTA 4AVTA 2XVLA 1UMHA 2BV4A 4FVVA 1PZ8A 3GM8A 3NKTA 2W91A 4JV4A 4KWLA 2OA2A 3DPRB 4EWAA 4K20A 1WW6A 1WGPA 2EXJA 2ZGNA 1FPN1 4I3GA 4AG4A 1JYXA 2D6KA 4AI1A 2ADDA 4OQ9A 4QX1A 3O0WA 4NWWA 4AFAA 2XR4A 5J96B 1X8EA 5LA9A 3H0OA 1DLCA 1HRV2 1OVSA 2RDSA 5F37A 1BMV1 3PMEA 4LKSA 2R30A 3JBG2 5T5PA 1TNRA 3LE0A 1IKQA 4XFBA 5F8PA 4XQDA 5FUNA 1C4RA 1WW5A 2ZGPA 1GWKA 3RQ0A 4DIQA 2QJVA 4RS5A 3N7LA 3BU0A 1F35A 3ACFA 4N53A 3LFIA 1H9WA 1RMU2 3POWA 1CIYA 2R1DA 2CDOA 4K1YA 3AZZA 3WNOA 1ENSA 1HV0A 4K7JA 1BJQA 1YC61 1KEXA 5ACA1 2RDNA 5HBAA 2P3YA 2J7MA 3MF6A 1G9CA 2D97A 4ZXEA 2VPVA 4IV3C 3B3QE 3SCFA 4DEQA 4ISQA 1RUG2 2VC9A 4HXCA 3VBUA 5DAVA 5GLUA 2Z4FA 4QHBA 1NYWA 1R64A 1WKYA 5I0TA 2DCTA 3FBYA 3T4HB 4D3WA 3WDVA 4ZKTB 3FN9A 3KQRA 1WCUA 2VW1A 4DEVA 5F7UA 1IKPA 1N1YA 4C1WA 4ZZ8A 5C8CC 1Q43A 3FLRA 5JSPA 4XJAA 2DU0A 2VMCA 5D8AB 4XEZA 5A6ZA 5HPOA 3POYA 4YVWA 3OGVA 3JD73 3W21A 1C8NA 2OW4A 3DCQA 3ZFEC 1NXMA 1RUD2 4Z2AA 1K5MB 2W08A 3RYRA 2KXLA 1EP0A 3ZXAC 3ACGA 5BNOC 5JWPA 3RG0A 1JOPA 4PDWC 4I01A 1KDMA 4XJWA 5DG2A 5FREA 3NAPA 4LHLA 4S2HA 4O65A 3IPVA 4QPWA 3RS6A 2XLGA 2RJLA 3RMXA 4AE2A 1N47A 1J83A 3FLTA 1NLQA 2X29A 5A3WA 1UY0A 1W0PA 1ZX5A 3T30A 1YLLA 1U0AA 3JB4C 3GDBA 2EIEA 4EE2A 3LIHA 1S2EA 4UW6A 2BBAA 3F95A 1OA2A 1R081 1Z7S1 5IW0A 2O8OA 3NRUA 4IW3A 4FFIA 1COV1 1OMIA 1W6NA 1H1IA 3IMNA 1XNDA 2PHUA 3M7AA 3ZDVA 1UXZA 1TMF3 2WNVB 2WABA 4QAWA 1ZRFA 4IUGA 2B42B 2AZ5A 1WD3A 1LGBA 4Y33A 4AEDC 4MADA 5IVBA 4WM7A 2CV6A 1VMJA 4FQZA 2K46A 4QHOA 2WT2A 5D1IA 3WP5A 4F3JA 2ZKLA 4P9IA 2ATFA 1ZYBA 2XH6A 2JKBA 3DF0A 4JGYC 1R1A1 5G04L 2OS2A 3HBZA 3VN4A 2DF7A 2P17A 3PVBB 4BYYA 4XIOA 3NJXA 2JE9A 2WL1A 4RGAA 1PM7A 1VBE1 2B9UA 1UCXA 2JG9A 3B9CA 4FPCA 2PMWB 5DAQA 1LGNA 1ND2A 2A1XA 4U2AA 3LDRA 2HWF2 1VRBA 2W0XA 2WLPA 2WFF2 4C90A 1UYYA 2D43A 4HETA 4I0BA 5FYCA 1PO21 3HNMA 2VQAA 2YXSA 5FZFA 5A1FA 4I2OA 3A0NA 1X9TA 1I3HA 3KT1A 4FP2A 5FY5A 5IK5A 4YYOA 3I49A 1GICA 2HWC1 5CZKA 3Q8CA 4COZA 3B93A 4AI3A 4NE9A 5DDJ2 1POV0 1APNA 5CKNA 5IWFA 4PQ9A 4LPLA 1SFPA 4GULA 3RZMA 3ZMNA 3PL0A 1EY2A 4BB3A 2VOVA 2GNTA 3LOBA 4QWNA 5CVRA 1ENQA 2ZGUA 1OKOA 2YC0A 4QT6A 4PLNA 1YIFA 5L7OA 1QJX3 1O4YA 1OOPA 3FBMA 1S0EA 2WDBA 1QJY3 2DBIA 2PHFA 4RS5C 5EIYB 4TZDA 4N53C 3VGIA 3RFRA 5FPVA 2LM3A 2XBO3 5FZAA 3HQUA 3QACA 1QMJA 3MV01 4XPVA 1KQRA 3BTAA 1XNBA 2YFZA 1I5PA 1ALYA 1TME1 2VOKA 4NR1A 3GJAA 2EIGA 4LOTA 1X33A 1VIWB 2XJSA 4ASKA 2R071 1AR92 2HYXA 1JI6A 5JLVA 3VBUC 3N9QA 1MZ6A 2B5HA 2XKPA 3OGSA 3DYOA 3IB3A 2W2IA 3VDDB 4YFZA 4XABA 2ZS6B 2VZUA 1MEC1 2B4KA 4LBJA 5E8AA 5HXVA 4A45A 5GZGA 3LOIA 5TSWA 1O3RA 5JPNB 5GLZA 3EB7A 4MHRA 3S57A 3VBOA 4AHZA 1AL21 1OUXA 4F7ZA 4YVWC 5FWJA 4MXWB 3K77A 4ONUA 4NIIA 4LKEA 3CIHA 3KHBA 4R9AA 5CB7A 5CFDA 5FPBA 2RDRA 2VVDA 3VBHA 4QQOA 3KMHA 4JGZB 2ZGOA 3WG2A 1KGYA 3NAPC 2X5IB 3GCXA 3POEA 4XCAA 1VAKA 3WDUA 2XKOA 2CGOA 4AXOA 4WM8A 3AMPA 1UU6A 1CAWB 1RUF1 4ARXA 5CA6A 1P8JA 3OEAA 1FOD3 4A3ZA 3IAQA 2VBDA 4HT1T 1SACA 1C5IA 5DZFA 4NHXA 4ZU7A 1ULEA 5B4XA 5IAXA 3CQOA 3BKZA 3WT3A 5FP3A 3MW4A 3PU3A 1VBD2 4LEJA 4XVHA 3BPSA 5K0UB 5I93A 1Z78A 4V2WA 3T0DA 3TN91 3ZXKA 3BTXA 1LGCA 3N3HA 4K21A 2DTWA 1OXCA 3BI3A 2ZHMA 4R9DA 3V56A 1HQWA 3A0KA 3FX3A 1UPIA 3KV6A 2FDIA 4WM7C 4ARYA 4FOWA 1XBFA 1IGOA 2XJVA 5GKAC 4KQ7A 2RS12 4IE6A 4TN7A 4NMIA 4N7IA 1JYIA 3H7JA 3U4SA 3WQ0A 3AYAA 3NSTA 5KBFA 2ZGMA 4QQLA 1BEV3 3UKNA 3O14A 3WNMA 5AVPA 3S0MA 1NKGA 3O0VA 2JG9C 4OI4A 4J1WA 4AI9A 2CL2A 5FZ0A 2A6VA 4BLJA 1ND2C 2RS31 5A7SA 5LA0A 4MG2A 1GZWA 1J3RA 3VKFC 1D4M3 1GQHA 2W39A 2RMU1 4AQSA 4HANA 1CZTA 1F8VA 4YW4A 3TRSB 3AP7A 4I0AA 3VUOA 1MS9A 4B7EA 1SLTA 1POV3 1URXA 2FCUA 4H55A 4J25A 4R4ZA 5BV6A 3IAPA 2EICA 3MFAA 3M70A 2VZ3A 2VVFA 4M4RA 4Z8BA 3D0JA 3T2OA 2PELA 1QNYA 3UKTA 1ZVFA 4DB5A 4HMZA 4M01A 1DZQA 4ASLA 3AM2A 5J09A 2Z79A 3DL3A 5C4WA 3TEZA 1VBC3 3K3NA 1GYKA 3MHZA 4XILA 1WLWA 2WFPA 5L7OC 1FYUA 1O4ZA 1UOBA 1OOPC 2OXBA 1V6OA 3KV9A 2EALA 2KD7A 2Z2SB 2KA3A 5ABJA 2MNGA 1J84A 1KJLA 4BMEA 3T1MA 3K4DA 5DAPA 3ZN6A 3B02A 3DPRC 4XHBA 4FTEA 3D0SA 3CZJA 2QVSB 5AVAA 4YGCA 1PVXA 4GB32 5G05L 3WCRA 4Q4Y1 5A6XA 1QJFA 4XZPA 3KGLA 3ZFFB 3SNMA 3KCYA 4LUMA 3B9IA 3OUJA 4JDOA 2WA3A 2MEV3 1PK6B 2RM21 3D8CA 4BQYA 1LHOA 3CJXA 1EAH2 1OFSA 3HWJA 2JEMA 2CYFA 4P02B 3OGGA 4M3CE 1Y9QA 1RUI1 1RL3A 3NNJA 2WO7A 3FHIB 4NIDA 2CNAA 1RVF1 4CDWB 4AQ6A 2VNVA 3VBOC 1IHMA 5GLTA 4CRQA 1VMFA 2ZGQA 2HWB2 4RFRB 5IHRA 3RZHA 3ZYPA 2ZEXA 2XXZA 1VE0A 4A4AA 2BW8A 3MF9A 4WVZA 1UU5A 5AC91 5FMDA 5JR7B 4E2QA 1HB2A 1EPZA 1YHFA 5FZ1A 2WS93 3VBHC 4BK5A 5C3QA 1KFUL 2WR9A 4DMIA 1JW6A 1OF4A 3OY8B 3ZXDA 3ZO0B 3N7KA 5A3UA 2HWD2 3AMQA 1FNYA 2TUNA 5FBZA 1O3QA 1VP6A 4CCLA 2GH2A 3QD6A 1UN1A 5LRSA 1G8WA 4WM8C 1HJFA 1HW5A 1F15A 1ENRA 1S0GA 2A6WA 1ZZBA 5I8YA 1H8TB 1LHVA 4QKNA 5LY2A 1HXS1 2YG0A 1B35A 1DYOA 3DEMA 2XB6C 4LIVA 1ZRDA 4HSLA 2LUWA 4IGPA 1FPN2 4NHLA 1RTVA 3UGHA 4LBQB 2P5BA 2WIIB 4X6QB 5JIAA 5FXVA 2Y34A 5FPUA 1CD3G 4H14A 5T50A 1Q8SA 2ZHLA 1ND3A 1DGWA 1VBA3 2DBNA 1YXWA 4LLFA 4LBOA 1QXPA 2R061 2WZEA 1BBT3 5BNPA 2QQWA 1RGSA 4PCRA 3K4AA 4UOJA 2ORXA 1GV9A 3S5QA 4CXYA 2RS51 3NV2A 2TBVA 1PZ7A 4P9XA 1JU3A 4M0NA 2Y38A 4C0HA 4GWNA 3SH5A 1RUC1 1UY3A 3ZYJB 5LCWL 3QH7A 3CBNA 2OUHA 5GZCA 1PVC3 3GJBA 4XIKA 2BGOA 1SPPA 2QZ2A 1XU1A 2PLV1 2YB7A 5JXJA 2ARXA 1DU3D 5FOBB 5T5JA 1JZ6A 5C3PA 3BALA 4U36A 3BOWA 3OBRA 4N9HA 3OPWA 2JB4A 3GZEA 3ZSEA 1HKDA 2VBBA 5KXEA 3J26N 3GHMA 3EXUA 1JYNA 3RZKA 5L9VA 4XBNA 4MLOA 3LA2A 1QOTA 1AR81 2OT7A 2IFWA 1F4HA 2HEVF 4QPGA 5F5QA 5FWEA 1KFXL 3PUIA 3S6PA 1WCQA 2BZDA 2WINB 3NV1A 3UETA 5F2SA 5K8SA 5J48A 4LR4A 2BOIA 2UWAA 1PIV3 4GQ7A 3ZXGA 5L19A 2XPJA 3FLPA 5C4WC 5FK8A 1LULA 2WRAA 1WWYA 3OJBA 4FFGA 3ECQA 3RPQA 4IV3B 3IKWA 4OYUA 1PNGA 5HI0A 4QX5A 2PHDA 1VRH3 2HBUA 3IT8A 4Q1PA 4ZPIA 4EYUA 5I0DA 3ACLA 1XU2A 5FY8A 5GZDA 4GMP3 4A7YA 5ABJC 2A7AA 4Q0PA 3RDIA 1QJU3 4GWMA 3IMMA 3P5BA 4FOQA 1HRI1 1JHJA 3CZUA 1CPMA 1RUH3 4K3UA 4R9CA 4MZUA 5LB6A 4BXFA 2Y6HA 5J7MA 3D82A 4QXHA 1J1TA 1FAYA 2DUOA 5LW9A 5J98B 4CP0A 1R082 1Z7S2 4YM1A 3MW2A 4QXBA 3ZFEB 1COV2 4H7MA 4CDUA 5BNOB 2D40A 3N9PA 2VM9A 2JDKA 2NLRA 5FKBA 1M06G 1GOHA 4DS0A 5FZBA 3B94A 2VZTA 3DYMA 1DGWX 2JE8A 1KXGA 3WDXA 4ES9A 4F83A 1JZ2A 4NO4A 1Y43B 5KC5A 1OF3A 2AYHA 2WWJA 1K45A 1R1A2 1V9U1 3I7DA 2DVAA 4AI0A 1H6YA 3S5AA 1DHKB 3VBFA 5CKMA 2ZX1A 3ZYHA 4CUCA 2BFUL 1W8OA 4ASMB 3M3IA 2WN3A 4Q29A 4Q4W1 1VBE2 2ZEZA 5A7WB 5F3CA 5C3RA 2FBEA 4K40A 1AYN1 4PQQA 2P6CA 1JOJA 1A78A 3OUIA 4BCUA 4CDXA 2RDQA 3ZMOA 4UXAA 1PMIA 1W05A 3USSA 2WZR3 1I6XA 1K42A 4Q4V3 5F3IA 3SEPA 4YGEA 2FDJA 4AEDB 1Q5OA 2YROA 1W0OA 2JXAA 4Q0VA 5FAXA 3AZXA 1A8MA 4MX3A 3UYJA 4BQ3A 5C8WA 2AH2A 4LO6B 4CP1A 2ORZA 4Y5TA 2HWC2 1B35C 2XG3A 1QXJA 2WYSA 3L9JT 4Y20B 4BU2A 5FY9A 2BVVA 1VBB1 3UT0A 5IFPA 5E16A 4CU9A 3MZHA 3IDEA 1AXKA 3WP6A 1O5LA 2IFRA 3EBRA 3AKTA 3LIGA 1ZBA3 2VMDA 1ND3C 3DYPA 4QD2A 5KR7A 2VXRA 1JZ8A 2CY6A 2C5DA 4IEVA 1LNSA 2ZACA 5BNPC 1SMVA 2GH8A 2PAEA 3IDBB 3BPZA 5DQ0A 3VHPA 2Q30A 3ACIA 1U5YA 1GLHA 3MFCA 1D7PM 3GGLA 1XJAA 3GF6A 4KU8A 5DAXA 5F1RA 1LOBA 2JECA 4NHMA 1QY4A 3ACHA 3WV6A 2KR2A 2GSYA 1TME2 2D44A 2GC2A 4L8QA 3WNXA 4D7TA 2R072 4B7KA 1JZ7A 1ZBE3 5LZ6A 2UU8A 2ZTNA 4E4HA 1MS5A 5IT6A 5A6YA 2HYKA 5FXZA 2XGXA 2PHXA 1RUJ1 2YY1A 1MEC2 2ZAHA 3LSEA 3N9OA 4RS5B 4QPGC 5FYIA 3LEGA 2X8KA 4MXVA 3AZVA 4IL7A 4N53B 3SH4A 4EWEA 5FO9B 3H8UA 4JTOA 2P4EA 3JQWA 1X8MA 1JH5A 2E32A 1AL22 4FPEA 1WMXA 4RSUA 2PA7A 4LORA 3A23A 5FZMA 1WD4A 1US2A 3NW4A 2JDPA 5B2GB 1OQDA 5KHKA 3GALA 3T3YA 1S0DA 2QQNA 5I0RA 2EXHA 4XBLA 1RB8G 4UW3A 3VBUB 4EZ4A 5FYSA 5LBFA 1U5ZA 2A6YA 3OG2A 2CAUA 4B3NA 1DYPA 5F2WA 4QX2A 2LALA 4PT6A 1HRV3 1HN0A 1RUF2 3G7DA 1S2BA 1TMF1 4LQRA 5CIRA 3UV9A 2ZA9A 3ETPA 4E27A 2JWPA 1FXZA 4H2AA 4Y1XA 4CCKA 5ERLA 5FP8A 1SLLA
chains in the Genus database with same CATH topology
2D6PA 1RMU3 4CDUC 3WY6A 1WMFA 4E4SA 1YI7A 3TN92 5JOYA 4HBNA 1R093 3M3OA 1DGRA 3NAPB 3OGJA 2WQZC 5JAXA 3GHNA 3IPVB 2GMPA 2I2SA 4XJZA 2ARBA 2XL7A 3AYDA 2W52A 2DURA 5FPXA 4LA3A 4EN0A 1RJ7A 3VBFC 4LO7A 1YFYA 4RA0A 1PO12 4GALA 5T52A 2IXJA 2WKKA 1JYCA 4CDXC 3GBFA 1JN2P 1W6NB 2RS32 1UMZA 1MS8A 1O7FA 3MGUA 4IETA 1FT9A 2ZJCA 3AMNA 3VZKA 4WM7B 4N43A 1DQ5A 3U10A 1BK1A 1G86A 3E97A 4FCAA 4ZU5A 3WHTA 3AJZA 1QJX1 5IK8A 2C9AA 5LEKA 3D5OA 4JC1A 1QJY1 3OD4A 5DXDA 2JG9B 4PBOA 1ND2B 1YCIA 2GMMA 1YIPA 1PGW1 4X8PA 2XBO1 2E6VA 2Y26A 1IOAA 3KZ4C 5H9SA 2D93A 3OPZA 4I09A 2NN8A 5EYXA 1RHI1 5H9RA 3V0AA 3L2YA 1JXNA 3FJSA 1D2QA 1DGLA 3E5XA 1ZRRA 4Q4Y2 5C9AA 4N90A 2RR13 1DQ2A 4MUVA 2RM22 4WV8A 4DPNA 2ET1A 3NV4A 1ASJ1 4GH4A 4GXLA 1RUI2 4KBBA 5L7OB 1OLRA 1OOPB 1KS5A 1Q8VA 1SFYA 1IQAA 2CWMA 1RVF2 2WFF3 4YSFA 1MR5A 2GZWA 3HIFA 4Z92B 2QDNA 2FMYA 4H3WA 4BLIA 2IXLA 4D69A 5KXBA 1LOCA 4HVOA 5AC92 5BYNA 3SXWA 2BTVC 3VKLA 1IS6A 1WCKA 5JI7A 1IS3A 1FOD1 2YHJA 5DDJ3 2N7GA 4Q8LA 1XYPA 4RHV3 4CEWA 1EPWA 3EJKA 4Z07A 3WP3A 1Q8OA 5LEJA 1CX4A 3WHUA 1ZZ7A 2P3IA 3GZUC 2DFCA 4OHVA 4HL0A 1AXYA 5BNNA 2E7QA 3VBOB 5L36A 1HXS2 2R1BA 1C8M3 4L9BA 1J59A 3HR9A 4D94A 5CFDB 3JB8A 3VBHB 5H9PA 3GZTB 5GLWA 2XL9A 3R6SA 2ZMLA 5T5LA 1BEV1 1WW7A 2JJ6A 2R062 5FLHA 4AGRA 1AR93 1ZZ6A 2K0GA 4M3CA 4WM8B 1NXD1 3RNSA 1GKBA 1NCRA 1REDA 2RS52 4MVTA 1W6MA 5GZFA 1AYM1 1SCRA 1TE1B 3M3EA 1RUC2 3OD0A 4XOGA 2IWGB 3USUA 2EAAA 2PLV2 4GIQA 1E57A 4W6WA 1PGSA 3M3CA 3M4FA 3E5UA 3W58A 3VZNA 5BNQA 3UKVA 3LAGA 4N43C 3ZVXA 4EV0A 1HX6A 1AR82 1VBC1 4HKOA 1F5JA 4JVAA 2NZ9A 3ZYIB 1RITA 5BPXA 3J8F1 4A7KA 3LA3A 2VY0A 4NHKA 1DGRN 1GZWB 2ZGKA 4QQ2A 1UX6A 2YPJA 1DQ0A 4FXKB 3ME2A 2MEV1 4QPIA 2A6ZA 2EXIA 4FPKA 4QM9A 1C1LA 1HRI2 2ILMA 3V65A 3FMGA 1RC6A 5C9AC 4R4XA 2VNOA 4YM2A 4FPFA 4ES8A 3I54A 1J3QA 4Q4X3 5C4WB 4K6BA 4WVMA 4HVQA 1DYKA 1AR73 5LRRA 4GH4C 1T6GC 2ZGLA 4COVA 1ZM1A 1YJKA 5ABJB 4YARA 4YNIA 3BOPA 3ZN6B 2ZZQA 4OHWA 1V9U2 4AGVA 2E7TA 5C6CA 2I74A 1QJZA 1IPJA 1V6KA 4Q4W2 4XMAA 3SH3A 1Z0HA 2Q5TA 3ZIWA 2PHWA 1YO8A 5EFUA 2A75A 3H1MA 4E2GA 4CEWC 3HQXA 3KT7A 5JCTA 1CAXA 3WQ7A 2OIIA 2SBAA 5I91A 4FPYA 4KGGA 3WQ1A 4LT5A 1FMD1 3U11A 5A32A 2YDEA 1H0BA 3AKRA 4QMAA 4EWDA 5BNNC 3KD4A 1N1VA 1VBB2 3ZXLA 2C0ZA 3SCHA 1I5ZA 3ELNA 4XYXA 5FDBA 1FNZA 4GB33 1OA4A 2D3PA 3INAA 5EV7A 1J58A 2VW0A 4DY3A 4OVEA 1PVC1 3FE5A 3P3NA 5J36A 1EAH3 1NCRC 4DXZA 1QH6A 4A2UA 1LEDA 2YYOA 1B35B 2CAVA 2TEPA 1VLNA 2QFEA 4G9SB 3VL8A 4PLOA 4Y26A 4WVWA 3RSJA 4WBBA 4LUKA 4Z1VA 5FFOC 2MHFA 2HWB3 1ND3B 2UYBA 1QOOA 3THPA 1GZ9A 2GN7A 3KB5A 5I8SA 1U5IA 1WCDJ 4SLIA 5BNPB 3WG4A 1RUJ2 3I8TA 2GC3A 2XJPA 2YUEA 5EZWA 2DUPA 2GAUA 4RL7A 2HWD3 3LZZA 1UKRA 3UJOA 1VRH1 5GALA 5BXXA 1D2SA 4IEOA 4XTMA 4FAHA 4HZFA 5F6KA 4FBFA 1M4WA 1F31A 1QJU1 1YFWA 1BVP1 3OYWA 1RUH1 1W6PA 5FQ0A 2BNOA 4FOYA 2OPKA 4YFWA 5IUQA 4COUA 2Y0IA 3FUOA 3VKNA 1UIJA 4RFT0 4QPIC 4OI0A 1AVBA 1GFF2 4IQPA 1RUE2 4Y24A 4QPGB 3RJRA 2V73A 2BWCA 2GNDA 1TMF2 2PFWA 3AZYA 3FUQA 2DV9A 4AWDA 3MIHA 1MZ5A 4I0WB 2ZPXA 4AHWA 1ZRCA 3M2MA 1DDLA 2VUJA 2DVBA 2ZAAA 3PVEA 4P5HA 4G3YC 4Y22A 3R4DB 4BIFA 2IXCA 1AR61 3ZDSA 4BM8A 5A33A 4C91A 2P2KA 2FZ1A 2D98A 2GC1A 5JDBA 2WZR1 3LCPA 4Q4V1 4B29A 2D6NA 4AEJA 3VBRA 4W65A 3JZVA 1WMDA 4RR3A 4AI2A 4BHPA 4CP2A 4QGNA 2WWSA 4OULA 4CDUB 5JOXA 4R9BA 3MIDA 3X29B 5FCCA 5EYYA 3MICA 2P37A 1QQP2 1SBDA 2UY9A 4GMP0 1PZ9A 4UBHA 4WVVA 4TSVA 1OQ1A 1I1EA 3KLSA 2D6OX 1NLRA 4XJ9A 2Q1ZB 5FMOL 1O5UA 3CNAA 3VBFB 2QKDA 4XW3A 1QJX2 3ES1A 2JD4A 4CEYA 2QZ3A 1QJY2 4MH0E 1RIRA 4CDXB 1W6QA 4GA9A 1OPOA 1YFUA 3AP5A 3MIGA 4P9LA 1PGW2 2IXKA 4MYEA 3AB0A 1X7NA 3CF6E 4PIZA 1R083 1Z7S3 5JMCA 4PIYA 3ROUA 2DVDA 1COV3 4META 2XVKA 1N3QA 1RHI2 1YWKA 2D7FA 2B39A 2YZ4A 5FRAA 1GNZA 4YGDA 4M3CF 1OKQA 1WUVA 4FP3A 3J9SA 3RWNA 1OHFA 3NVCA 1R1A3 2B8MA 1L3JA 2XWBB 1UKGA 4HK9A 2Q1MA 5CG8A 2UURA 4Q26A 2WJSA 1VBE3 1ASJ2 4UW5A 1JUHA 4YW5A 2D6MA 3WW2A 1AL0G 4ATEA 2R043 4LTAA 3G6JB 2YGLA 4OUSA 2HKXA 4LHNA 3O7OA 1G9DA 4JQRA 4C1XA 3THTA 4JTNA 1WCSA 1LR5A 2A73B 2QQPA 1YYNA 2VW2A 1BMV2 4J1XA 2O1QA 1UL9A 1G9FA 1CJDA 4IEQA 3OBTA 3MIEA 4XF0A 1EV11 4KG0A 2HEYF 1F2NA 1R091 2QUOA 5I0UA 2FMDA 2F6BA 2CGNA 1ULGA 2G9FA 3M8LA 4HSJA 4EN6B 1CQ9A 5ACA2 4Y1YA 1DZTA 5LK7B 3IIAA 4XBQA 3R4UA 4LBQD 1VALA 5JIUA 2HEWF 1BEV2 1QU0A 1SLBA 4AVBA 3U07A 2BEOA 1DBNA 3AP9A 1AYM2 3TNQA 2VULA 1V00A 4QQPA 3VBRC 3ZN4A 3NV3A 2E9QA 2BWAA 2VECA 4EN8B 4MGIE 4KNCA 4RR3C 2WSUA 2UWBA 4Y1VA 1HIXA 1CAVA 1LECA 3UJQA 4YM3A 5JSOA 1MZFA 4IEPA 2PAMA 4YLZA 2XWJB 3WP4A 4E4DX 4B4RA 3JUUA 1VBC2 3KM5A 4WZCA 2NMNA 1TNFA 4AEMA 1RUNA 4BZ4A 1LU2A 1YRZA 5FO8B 1AF9A 2HWE3 3J8F2 2DU1A 1RUF3 2ZGTA 2CWSA 1N3OA 4UBGA 1N1TA 3KT4A 2O8QA 2QNKA 3QH6A 1DQ1A 2JG8A 4WZFA 2BQPA 4RD7A 2RR11 4N43B 1BVVA 1S0JA 3ZSKA 2MEV2 3N7MA 1SEFA 2A70A 3PNAA 3O12A 3VHNA 5A3MA 1U12A 3VBSA 1SDWA 2A71A 1UAIA 3LKJA 4O9GA 2WFF1 1JBCA 1LOFA 5LK5A 1A6CA 1PO13 3RYPA 1PO22 3B69A 2NYYA 2RS33 1CVNA 2JENA 1GANA 3V0AB 4YW2A 4RHV1 3D4KA 5C9AB 2ZX3A 2XHKA 5BY5A 4PJYA 1WBFA 2DFBA 2GU9A 3CEWA 1HQNA 2B46X 5FOJB 3ASIA 1LTEA 3ZN5A 1O3TA 3PJYA 4XQ4A 2ZBJA 4ORFA 4GH4B 1NQDA 1C8M1 1J1LA 4Q1RA 4M0HA 4XXAA 4AGGA 4DNYA 4QM8A 1LCLA 3C3VA 1FMD2 1RJ8A 2Y0OA 1C1FA 4LLOA 5DG1A 3AP6A 4MGKE 2E63A 4AVVA 4ITCA 3SITA 1AR91 4AF9A 1VB4A 1OPMA 4XQWA 1V6JA 3D6EA 1LHWA 1QH7A 5FPZA 4CEWB 3JD71 3KCCA 4NPRA 5L73A 2W68A 1ULCA 1Y7BA 3ALQA 3B01A 1PHMA 2RM23 3N7JA 2A5ZA 3CJIA 4Q0UA 2A3YA 1XYNA 2H6BA 5KHHA 2BPA2 5CG9A 5BNNB 3MLKA 4MGYE 5CNAA 1RUI3 2O0OA 3WW1A 1S0CA 4HK8A 1QWRA 1RVF3 4YG3A 3I4IA 3S30A 2Z42A 3NWKA 3ST7A 3O0XA 1VR3A 3RYKA 2IXHA 1REFA 3GZAA 3VLBB 4RQPA 1LOAA 2D3SA 3BCWA 3BB6A 4M3CB 1LENA 1NCRB 1H1AA 4S2FA 3JBG3 3S7EA 1W6MB 1XNCA 4L92A 2JDZA 2WZPP 1EYBA 1OSGA 1VRH2 3VZJA 3JQXA 1AXZA 3W9AA 1FV2A 4D7YA 2Z69A 3WW3A 3USUB 4TLFA 3V64A 1NE4A 3N35A 1LODA 3LB9A 1RUH2 1Q8QA 4KG8A 4OI2A 2JG8C 2DCKA 1FI2A 3LSDA 5DZEA 3T2TA 1S2KA 1HV1A 2IC1A 1HLCA 1NA1A 1QNWA 4EWAA 4F7ZA 1BCXA 5GZEA 4Q4X1 1RUG3 4OHXA 1AR71 1RINA 4GKYA 2FHRA 5JZGA 3VBSC 3JCIA 1SFNA 1TEIA 5I8TA 4Q27A 5KHIA 4LNVA 2RS53 4P9JA 4COWA 1D4VB 3ZX7A 1LOFC 3TYJA 3C2UA 1RUC3 2RMU2 1GSLA 1RUD3 5K9YA 4QPIB 2Q0AA 4HN0A 2E7AA 1AR62 1AJOA 2P3JA 2WZR2 4X6RB 4TYSA 1PGL1 2D3RA 2G4IA 2F4PA 3SLIA 1QDOA 4CZSA 3QLQA 4WVMB 2XLFA 4AI8A 3DN7A 1H4HA 2NMOA 3A4UA 4LE4A 3AFGA 4YZ5A 4UW4A 4GB31 1LOGA 1G7YA 3P3PA 1V6IA 4N9IA 1N3PA 3J4UH 3WW4A 4MSVA 1W2UA 2ZMKA 1IZ3A 1OQEA 4XF3A 5GJ6A 5AFEA 1LHUA 3MLLA 3GBGA 4AHXA 4A3XA 4W6YA 4FTBA 2Q8OA 1CAXB 2ZCWA 2X53S 3MI8A 2A3XA 3O5SA 3R05A 3CJIC 1U5XA 2HWF3 3DGTA 4FPHA 1RUOA 2BYVE 3M3QA 5A32B 3UK9A 4JGYA 2GC0A 3PTYA 4L99A 4XF9A 2CGPA 1UPSA 3M1HA 3RRDA 4DRRA 4XF4A 4OZXA 1DZRA 3VKMA 2I45A 1I9RA 1O3SA 2BUKA 4HVRA 4XJ8A 2DVFA 4RQPC 4DFSA 3ZSJA 2A3WA 3H3UA 3IN9A 2BFUS 5EXOA 4NOTA 3AKQA 2GNMA 4AVAA 1UZZA 1NY71 2A6XA 4H7LA 1SBEA 2D5FA 3ZFGA 5FLJA 1MVQA 5KXDA 1VBB3 1C5HA 3WOGA 4K9SA 1NA1C 4YVSA 1BQPA 4NVPA 3ZIXA 1WW4A 1V70A 4V1PA 1LRHA 1SQ4A 1D4M1 1EV12 2ET7A 5JZGC 1R092 2VGDA 5AFBA 4Q0QA 2VH9A 1CESA 2XJQA 4AFBA 3W59A 3SISA 2DCZA 4IEUA 1H9PA 2ZABA 1ZREA 3FFQA 4CDQA 1Q56A 1POV1 3NL1A 1W6OA 3OYWB 4OFGA 3I59A 1W6PB 1LB2A 5FQ0B 3H9AA 1DIWA 5JPMB 3WUCA 3HT2A 2ZZJA 3VZOA 2V09A 1IS4A 1G6NA 4BOWA 3AYEA 2VUAA 3ATGA 4HN1A 3KGZA 2DWRA 3TBDA 3R4SA 3SCGA 1RUJ3 4L97A 4EJRA 2UY8A 5JVVA 1SCSA 3AX4A 3WVJA 3ZXJA 3OF1A 2K2SA 1VBD3 1NCQA 1XQNA 1QXRA 4PIXA 4ZXKA 1WLCA 1V6NA 4HPKA 1AX2A 4Y22B 4LO4B 2IXIA 4ISRA 1H1MA 1REEA 5A33B 1BXHA 3WDWA 4YW3A 3RZZA 2NQYA 1MZEA 4S2DA 3VBRB 2RS13 1MQTA 4IV1B 1S55A 3RI9A 1B09A 1RUE3 2H0VA 4RGGA 1CGPA 2VOXA 4RR3B 1GQGA 2ZHKA 1UIKA 3MLJA 4FPLA 3B00A 3E6CC 5I0SA 4AVSA 5KHGA 4B4QA 2RR12 2PAKA 2ERFA 2WS91 4E9KA 4Q2FA 4YZ2A 3E6DA 2ZGRA 2ZKNA 2XUMA 1V6LA 4CEYB 1AYN2 1MVEA 3H1YA 3CU7A 2R041 3KCXA 1W6QB 3PLQA 1SBFA 3AXEA 5CU1A 3WDTA 3ES4A 2VQ0A