3KM5A

Crystal structure analysis of the k2 cleaved adhesin domain of lys-gingipain (kgp)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
179
structure length
179
Chain Sequence
GSADFTETFESSTHGEAPAEWTTIDADGDGQGWLCLSSGQLDWLTAHGGSNVVSSFSWNGMALNPDNYLISKDVTGATKVKYYYAVNDGFPGDHYAVMISKTGTNAGDFTVVFEETPNGINKGGARFGLSTEANGAKPQSVWIERTVDLPAGTKYVAFRHYNCSDLNYILLDDIQFTMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure determination and analysis of a haemolytic gingipain adhesin domain from Porphyromonas gingivalis
pubmed doi rcsb
source organism Porphyromonas gingivalis
molecule tags Cell invasion
molecule keywords Lysine specific cysteine protease
total genus 48
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07675 Cleaved_Adhesin Cleaved Adhesin Domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3km5A00
2ZGPA 4XDQA 2DVGA 4P9XA 4CRQA 5GM0A 1W6MB 3FLRA 2FMDA 1QOTA 5KXDA 1BJQA 1LECA 3U4XA 4YW5A 1VAVA 5KXEA 1JN2P 1DYPA 1SBFA 3APBA 1G86A 4XJ8A 2D6LX 4Y1VA 1GNHA 1UKGA 4YZ3A 3ASIA 1WLDA 1XQNA 1JW6A 4Y20A 2NP0A 1G9BA 3WDUA 5T50A 1R1ZA 4PQ9A 3NV3A 1QOSA 5T54A 3WUCA 2A6WA 5T52A 3ZVXA 1G9CA 4K1ZA 4XJ9A 2XG3A 1BZWA 1FV2A 2ZACA 2D7FA 1W6MA 3V65A 1Q8PA 3OBRA 5T5LA 2ZGRA 1CONA 2DUOA 5T5JA 3W59A 1Q8SA 2DTWA 1FNZA 3O0VA 3RQ0A 1LGNA 1MR5A 4FPYA 4CZSA 4WVWA 2D6PA 1OQ1A 1JUIA 3AXDA 3ILRA 3RS6A 3OBTA 5GZEA 3WNXA 4DS0A 1A78A 2Q5TA 5CBLA 2ZGTA 2W68A 5EXOA 3ZXEA 2WSVA 4Y1XA 4UW4A 4AGRA 4Q8KA 1IS4A 2D6NA 1LOBA 2D44A 3POSA 4C1WA 1GLHA 2UWBA 1RIRA 2VU9A 3WG4A 3JUUA 1N1TA 1KDMA 5FREA 4ZKTB 1ZA4A 4GXLA 1SCRA 3N3HA 1GKBA 4Y1UA 3LCPA 5AVAA 1AXZA 3ZXJA 1CESA 2PHTA 2RHPA 5JOWA 1QGLA 1N1SA 1YI7A 3D6EA 3JU9A 4YW1A 2ZHNA 1UL9A 1Z0HA 2AUYA 4YGDA 2ZMLA 1LGBA 1LHNA 4YZ2A 3PVOA 4JCKA 4FP3A 4K20A 4YG0A 3SH5A 3WDWA 4YM2A 2JD4A 1ZM1A 4FQZA 1PZ7A 5H9RA 2CNAA 4BMEA 3TB0A 1V6NA 3T1MA 1UX6A 2BQPA 2DVFA 4LBKA 2ZHMA 3GALA 4YM0A 5IK5A 4XHBA 2DVDA 1KJLA 2ZKNA 5F9TA 2NMOA 1GZ9A 2A75A 2R0HA 4GWNA 2PHXA 5GZFA 4YZ1A 1G9DA 3IPVB 1C4RA 3B69A 4YW4A 2SBAA 4GALA 2R1BA 3SISA 3V0AA 1DZQA 2AR6A 3WHUA 2ENRA 4YG3A 3USUB 1W6NB 4R9CA 2AGSA 2DVAA 3NWKA 2DU1A 3MW3A 5T5OA 1FNYA 2R16A 3MW4A 3OGGA 2W08A 4FPJA 1EPWA 2WSUA 3AK0A 4XILA 1N3OA 1MZ6A 2YV8A 2CWSA 1MS0A 4FPOB 1PZ8A 4Y1YA 1Q8OA 3D5OA 1URXA 1S0DA 1GYKA 3OJBA 1W6QA 2ZGKA 4Y26A 2GNDA 3HMYA 2R1DA 1WW5A 1SBDA 3ILFA 3WDVA 1UPSA 3LSEA 2D3SA 1BQPA 1LOGA 2WKKA 2NN8A 4XXAA 2ARXA 1S1AA 3OYWB 3UJQA 2W39A 2WT0A 1V00A 2ZGLA 4ISQA 3WDYA 1DYKA 1DBNA 2DV9A 1AX1A 2DUQA 4XBQA 5CB7A 2YROA 1LEMA 1U0AA 2A3YA 5BYNA 2CYFA 3UJOA 1QDCA 1LTEA 1MACA 4MYEA 3VKOA 1KITA 4GKXA 4H55A 1WW7A 5E8AA 4K21A 1A3KA 2D6KA 5CNAA 1UAIA 4UW6A 4OZXA 1BKZA 2AH2A 1LHUA 3ILNA 1S0BA 4LBLA 3I8TA 3FBYA 5GLTA 3WOGA 4M3CA 2CWMA 2D3PA 5IT6A 3ZXFA 3T1LA 3USUA 4ZXKA 1LULA 3N35A 2JKBA 1SFYA 4AGVA 1Y7BA 1LOFC 4LBQA 1DQ0A 3SNMA 2ZMKA 2ZAAA 5DG2A 1S0EA 2ZGQA 4KBBA 5L73A 1MS4A 3BIWE 4FVVA 2D6OX 4JC1A 1MS9A 1BYHA 1WD4A 4XYXA 3WUDA 2GNTA 2ZZJA 3AFKA 4YLZA 1SLLA 1WLWA 1LCLA 1VALA 3OY8B 2DURA 3AP6A 2ZABA 3CNAA 5DZEA 2AYHA 1ULCA 2OVUA 5F5QA 3OYWA 3AP4A 1UZYA 1QNYA 4Q26A 5SV8A 3FLPA 4P14A 3AZXA 1ENRA 5DZGA 3WG3A 1ENSA 1DQ6A 1H9PA 2R0FA 1A8DA 4PCRA 3O12A 1D2SA 1KQRA 1VLNA 2GNMA 3M3OA 5T5PA 2UU8A 2JECA 2AENA 1DGLA 2E6VA 2P2KA 3AP9A 1CVNA 4LBMA 1QMJA 3WVJA 1QF3A 2A6ZA 4Q1PA 3QLQA 1DLLA 2E51A 1F9KA 1DQ2A 2GN7A 5KXBA 4Q2FA 1LODA 2P37A 3BTAA 2UURA 2NM1A 2DTYA 2C9AA 1D0HA 4DFSA 1LU2A 3O5SA 4Y1ZA 5H9SA 1OFSA 2P34A 3PMEA 2E7TA 3M2MA 1AJKA 1LESA 5IK8A 2ZGSA 4LBQB 4Y22A 2D6MA 2ZGNA 3AYDA 3AJYA 4AWDA 1VAMA 3VKNA 3ZSJA 1ONAA 5E88A 1IOAA 3OY8A 3WDTA 3I4IA 4L8QA 5FRAA 3C2UA 4R9DA 2P3KA 5E89A 4FPHA 3IMNA 4AYUA 1GZWA 4P9WA 3AYEA 5LK5A 1H30A 1V6IA 1IKQA 1LHVA 1AXKA 4BOWA 1IS6A 4YM3A 4D69A 3N36A 1NLSA 1S0FA 2LTNA 4YW3A 1LEDA 3AXEA 4P9YA 4XOGA 1WW6A 5JOZA 1FX5A 3OPZA 2DU0A 3WV6A 2PHWA 1C1LA 3IKWA 3ATGA 2UWAA 4FOWA 1W6NA 1CJPA 1JOJA 1KDKA 4XBNA 3V0AB 1Q8VA 2EXHA 1S0GA 2WQZC 1Q56A 4NOTA 2GN3A 1J1TA 1G7YA 1CPMA 4LBJA 4LBNA 4RL7A 1N1VA 3NV4A 1ULEA 4WVVA 2A71A 1V6JA 1ULFA 3UL2A 4YGCA 3FFZA 4TZDA 1LJ7A 2P3IA 4NO4A 4FPEA 3R4SA 5GLVA 3POYA 4Y22B 1IKPA 3ZPYA 1LHOA 1WLCA 3BODA 3N7JA 3VKLA 4FOVA 4AGGA 1WW4A 2A7AA 1G8WA 5DUUA 1SLBA 1VIWB 3AYAA 4R9AA 3RG0A 1QNWA 5DXDA 1C1FA 1LOFA 3B3QE 1DFQA 2D3RA 3HN1A 1W6QB 3AJZA 5JLVA 3O0WA 3A0NA 4YGBA 3VKMA 2WT1A 2C5DA 1JHNA 5JVVA 4U2AA 1N47A 2A6XA 3MW2A 1DHKB 1G9FA 4M3CB 3RRDA 1KRIA 5GLZA 3SLIA 1SACA 4XXPA 5IK4A 4LBOA 4WZFA 2ZHLA 2XB6C 2WT2A 1I3HA 3INAA 2WNEA 3Q9OA 4Q8LA 1FATA 3IN9A 4BMBA 5EWSA 4JRAA 4HL0A 2DYCA 2GMPA 4HANA 4RA0A 4M01A 1AX0A 2Z42A 3WHTA 5GLWA 2EIGA 1GSLA 5EYXA 4M3CF 2EALA 4YFZA 4LBQD 1S0CA 2EXJA 3A4UA 2CTVA 1CQ9A 2ERFA 2JE7A 2PELA 1GZCA 4DRVA 1W6PB 1CIWA 2OW4A 3O0XA 3R05A 4YFWA 1SLCA 4PBOA 1LU1A 2W52A 1ENQA 2YMZA 4F83A 2CY6A 3A0KA 3VV1A 4SLIA 1F31A 1GANA 2E53A 2GMEA 3T2TA 4Q1RA 4XMIA 3BOPA 2UWCA 1HLCA 1W6OB 2YXSA 5HCAA 2A3WA 1DQ4A 3ZSKA 2SLIA 4BLJA 4Z8BA 3AZWA 1YYNA 1O4ZA 3WDXA 1APNA 1FAYA 2A70A 3LSDA 1BXHA 4AVVA 5H9QA 3RMXA 2A6YA 3WLUA 4XZPA 1H9WA 3IPVA 1HDKA 5GZDA 3H0OA 1MS5A 3W58A 1AVBA 3KQRA 3N7KA 1S0JA 5JMCA 4PBPA 2VXRA 5HCBA 3AP7A 2ZGUA 2TEPA 4BM8A 2B7YA 2ZHKA 2OUJA 4K1YA 4FPCA 4FPGA 1I1EA 1LHWA 4WV8A 4ATEA 4C1XA 1IS3A 4XJZA 1MVQA 5IUQA 4FOYA 2EF6A 3AP5A 1WD3A 3B00A 4FQ4A 3WZ1A 2FHRA 1V6MA 3DGTA 1AX2A 3PVNA 4XJAA 4BPZA 5JOXA 1X50A 1C57A 1N1YA 1W0OA 1W6PA 1AXYA 2VW1A 1CPNA 1W0PA 4IQPA 4ITCA 2P3JA 3AX4A 3M3CA 3ZYPA 2OUHA 3ZXKA 4BLIA 1V6OA 1N3QA 2CL2A 3FUOA 3AZZA 4ATFA 2ZGMA 4XHXA 3AZVA 3AZYA 2GALA 4XJWA 2A5ZA 4R9BA 1AJOA 1WBFA 2LALA 4GWMA 5CAZA 4XJUA 5DUWA 1LENA 2JDZA 3ENRA 2V5YA 3WCSA 1DQ5A 5IK7A 2KM2A 5T55A 2A6VA 4FOQA 4CTEA 4DPNA 4BQ1A 1TEIA 1N3PA 1CN1A 1JYIA 1YXWA 1LOEA 3L2YA 2I2SA 3N7MA 3M3QA 1GICA 5GJ6A 1GNZA 3NV2A 3VUOA 1RINA 3AYCA 1QDOA 4XBLA 3ZYRA 4GKYA 1GV9A 4PF5A 1LGCA 1LOCA 2ZMNA 3MEPA 5DUVA 2NYYA 1NXD1 1V6KA 5JDBA 2EXIA 3D4KA 1LOAA 2NMNA 2ZBJA 2G4IA 1FV3A 2JJ6A 2VH9A 2V73A 4GA9A 1YRZA 5GLUA 3SITA 3VKFC 5GZCA 1MVEA 1QKQA 4FPKA 5H9PA 4AVTA 1CR7A 2PHFA 1YO8A 2AREA 3KM5A 4TYSA 4FPFA 2YZ4A 1G9AA 3V0BA 1SBEA 1JYCA 4M3CE 4YZ5A 3HR9A 1FYUA 4W65A 2DUPA 3WG2A 1QOOA 3FLTA 3DUIA 4XIKA 4Y24A 1UZZA 4AVSA 3B9CA 1Q8QA 3SH4A 4YM1A 4UW5A 4ASMB 2DWRA 3WG1A 2VW2A 2WJSA 1IS5A 3NV1A 3GNEA 2R49A 2GMMA 1YIFA 1WBLA 1HKDA 3PVEA 2GNBA 3IM0A 1PZ9A 2ES3A 2YY1A 4YZ4A 5GZGA 2GDFA 5DZFA 2VUAA 1WUVA 1AF9A 4U36A 4XE9A 1QU0A 4FPLA 3M3EA 1GZWB 1OKQA 4XTMA 1HQLA 4YGEA 4YW2A 2PHUA 3QCWA 4DQAA 4DRRA 1MS1A 2WLQA 1SLAA 1RITA 3RMYA 1MS8A 5GALA 1MS3A 5KXCA 1ULGA 2D43A 4XTPA 1W6OA 4ISRA 1HQWA 1UN1A 3FUQA 5CA6A 2EXKA 2JE9A 2E7QA 2PHRA 3UK9A 3N7LA 3WCRA 2VY0A 1MZ5A 4FP2A 1WCSA 4XIOA 5EYYA 4YG6A 1S0IA 3V64A 2H0BA 3ZSMA 3R4UA 1GBGA 1AZDA 3SH3A 1SLIA 1DQ1A 3RSJA 5JOYA 1F5FA 1SCSA 1JXNA 2DVBA 3V0BB 1DIWA 4UW3A 2ZA9A 2VW0A 2HYKA 5DUXA 2EAKA 1Z78A 3M1HA 4I30A 3TAYA 3POWA 4Y20B 1ULDA 2ARBA 4M00A 1KJRA 2NZ9A 3ZXLA 4Q27A 2ZGOA 3ZSLA 1UMZA 1O4YA 3MPPG 3B01A 1B09A 1SLTA 4XMAA 1JBCA 1V6LA 5DG1A 3PJQA 2A3XA 5HCFA
chains in the Genus database with same CATH superfamily
1ZRIA 3R6SA 2ZGPA 2GH2A 3FN9A 4PLNA 3VDCA 2FMDA 4FFIA 3RI8A 5DDJ1 5C3SA 1LECA 4V1PA 4W6YA 2WNUA 3U4XA 4J1XA 3O1TA 2C4XA 1ZRCA 1AR83 1DYPA 2JG8B 1UYYA 3M4FA 1GNHA 2E31A 1E5HA 3ZKYA 4GZ9A 2VZVA 1JYWA 1VBB3 4NIAA 2KR2A 1G9BA 1NT0A 1VMFA 1DYOA 2JDUA 3WDUA 4AXOA 3DV8A 2CU5A 5T54A 3NMBA 2CAVA 3RYKA 1UZ0A 4I02A 3KHBA 4XF0A 4K9SA 4R8HA 5C8WA 2MNGA 2ZACA 5D8AA 2D7FA 1NKGA 1QJZA 4RGAA 3ZR6A 3O1SA 4Z82A 5JIAA 1CX1A 1NCRC 2RMU3 3MGUA 5T5LA 3IT8A 4QB1A 2HWB2 4NAOA 4Q0UA 3HBZA 5T5JA 2B9UA 3O0VA 1FNZA 4OHXA 1NA1C 1MR5A 4D7TA 4CZSA 4O9EA 1W9SA 4LOSA 4Z92B 3GZEA 5CBLA 4JKMA 2IXLA 3I7DA 2XHNA 2VR4A 1W39A 4KL1A 2WSVA 5FPZA 4UW4A 3ZXEA 1K12A 1OLRA 4AEJA 4AGRA 4Q8KA 5D21A 4K6BA 1LOBA 2D44A 2PFWA 1UY3A 4IEXA 3DEMA 3CJIB 3UESA 1H4GA 1B35C 1PX4A 4YVSC 2Q8DA 2IXHA 1RVF1 4IL7A 4MGTA 1GKBA 4Y1UA 2QZ3A 1OUXA 2Y6HA 3ZXJA 5FPVA 5C4WA 5C71A 3SEPA 1QGLA 2JG9A 1YI7A 3JU9A 1XNDA 1UL9A 2ZMLA 5F8PA 4N43A 2P3YA 4COUA 5L36A 4YZ2A 3PVOA 3ZR5A 4JCKA 4K20A 3SH5A 5FZ9A 5ACA1 1OURA 2HBUA 3NJZA 4MGKE 5D8AB 3VBHB 3OD0A 1BEV3 4LJHA 3JXSA 1PZ7A 5H9RA 3GJBA 3JB8A 3C7OA 1GZTA 2LM3A 3ITQA 4CU9A 1UX6A 1IPJA 1CWPA 2ZHMA 5A3OA 2DBNA 5IK5A 5FXZA 1KJLA 4DUWA 2YGLA 2R32A 3LIHA 3VZJA 1NG0A 2A75A 2WDBA 3R0RA 5GZFA 1Q43A 4YZ1A 1WA6X 1AR91 1XYNA 1NA1B 1QH6A 2VOKA 4YW4A 2R1BA 5FZOA 3V0AA 2AR6A 1OMIA 5CVRA 1NXMA 4AEDA 4XCAA 4A3XA 2VZUA 1W9FA 4QPIB 3PU3A 3GJAA 3NWKA 1RVF3 2XR4A 1J84A 1ND2C 2ZEZA 5FZLA 4QX8A 5FO9B 5JZGC 3HNBM 1FNYA 3EMRA 1RUJ1 2DDUA 2R041 4JDMA 4XPVA 4AFBA 3AK0A 5C6CA 1N3OA 2WL1A 2YV8A 4NE9A 1IQAA 1RGSA 1Q8OA 2WO3A 5ABJB 2J1VA 4GULA 1TVGA 3POIA 1GYKA 4BA6A 3RDIA 2ZGKA 2XL7A 2QDRA 1MZEA 1QJFA 3T3YA 3ILFA 2QQJA 3WDVA 1YJKA 2NN8A 3GXUA 2QQVA 1S1AA 3OYWB 4GMP3 4ZU4A 4ISQA 1V00A 5C9AC 3M8LA 4IDZA 5C33A 2DV9A 3BB6A 4XBQA 2YROA 4OZOA 4MGSA 4C90A 2Y33A 4IGPA 1BBT1 3ZFEB 3K51A 2ET1A 1REFA 3P3NA 4OUMA 3VKOA 1KITA 2HWD3 4H55A 4LOTA 4K21A 3VBRC 5FZKA 5CNAA 1GP5A 2WS92 1IPKA 5F5IA 5FYCA 2BGCA 4KWKA 2AH2A 4NRQA 1OD3A 3P6BA 1W8FA 3RGBA 1STMA 2PQSA 4M3CA 2D3PA 1VBE3 4QU2A 1VBD3 1DGWA 5KHGA 3E6DA 1OH4A 3T1LA 1HN0A 3J7LA 3PMSA 4QU1A 4IXLA 1LULA 3TRSB 4R4XA 5LEKA 1RMU1 2YC2A 3NJYA 2YBPA 4M4PA 2FDGA 5FXWA 3ZFGB 4BDVB 4GD4A 4QX3A 2J1UA 4RQPC 5F6LB 3BIWE 4FVVA 2WNUB 4UXAA 2QTWB 2XGXA 4BU2A 3CLPA 4QDSA 2GNTA 3AL6A 1EPZA 1AYN1 1LCLA 1VALA 2WINB 3MV11 4NPLA 5CA6A 5DMYA 3ZDVA 5BNOA 1ULCA 1RUC3 2X09A 1PVC2 5IVJA 3U07A 2WNVA 4P14A 4B8EA 1PK6B 1H2MA 5DZGA 3WG3A 3BU0A 1ENSA 3JBG2 1H9PA 2R0FA 2B46X 3POEA 1A8DA 1ODNA 3NJVA 4QQOA 2XJSA 3BIEA 4TN7A 1VLNA 3M3OA 1D0GA 2JECA 3AP9A 4QM9A 1H4HA 3WSOA 2ZAHA 2ZX1A 1F15A 1YNAA 3T0DA 2J1SA 1WGPA 3O1PA 4PHZA 2OX0A 4PIXA 4Q2FA 1LODA 4ORFA 4GJZA 4QHBA 4XUOA 1RUG3 2PAMA 3O5SA 5LBBA 1OFSA 2O1QA 2QKDA 1AJKA 4Q4Y2 3VBFA 1DGRA 3A7QA 1I5ZA 3AFGA 3J8F3 3JD72 1HW5A 1Z7S2 2ZGNA 1PNGA 1UZVA 2YBKA 5A3NA 1HX6A 4MO3M 4LXLA 1ONAA 1RUF2 3VKNA 2VQTA 3WDTA 1O8SA 4L8QA 1HRV2 3C2UA 1W99A 5JSOA 1B35B 3G6JB 1VBE1 3KF5A 3MIFA 4P9WA 4QD2A 5KR7A 4Q0PA 2CAUA 3NQHA 1IKQA 1YI9A 1K45A 4UT5A 4Z2AA 1ST8A 5FYSA 3OGRA 2RS33 5FPAA 3KMHA 2WO1A 3VZNA 3N36A 4UWDA 3VBSC 4FFHA 4QT6A 4B1MA 4LO6B 5BNNB 1JZ4A 4SBVA 1NYWA 4XC9A 4XOGA 1H6YA 1VR3A 1FX5A 2HWF2 2DU0A 3OPZA 1YCIA 4LUKA 5FY0A 5JXJA 5K9YA 3LPGA 4CP9A 5KHIA 2PHWA 1TZOA 3IKWA 5FMDA 3ATGA 5AC93 5FLIA 4NPRA 2ARCA 1H6XA 4FOWA 3DYOA 1JOJA 2HWC2 1ZNPA 1RUC1 3HNYM 4XBNA 1Q8VA 1S0GA 3ZN5A 2WQZC 3M7AA 4DINB 4AQSA 1W2NA 1RJ7A 2Y6KA 3IAPA 2VNRA 1CPMA 3D0SA 5FIXA 5FYYA 1AR72 2BVBA 5FO8B 1RUF1 2L9LA 3HNMA 3I3EA 3SKVA 3UL2A 3POGA 2D97A 2WFPA 1R1A3 5FCCA 3PTYA 2MEV2 3CQOA 4PIYA 4AGGA 3N7JA 4CXXA 5FOJB 2WRAA 3FMGA 2YC4A 4FOVA 1X36A 1AR61 4IEWA 4RR3C 3EXUA 3AYAA 4XCBA 5KHKA 3QH7A 3UT0A 5FBZA 5EJ3A 1DFQA 3SCFA 4AHYA 1VRH1 1TME1 3OBZA 4C0BA 3MUY1 2TNFA 1R082 4S2FA 2WT1A 1N47A 2J1AA 3MW2A 5FZMA 1A6CA 1UOJA 4ONUA 3CKHA 3NNMA 2CV6A 4XUQA 5FZFA 5IK4A 4MXWB 4QPIA 4WZFA 1HRI2 2XB6C 2ZHLA 4N53B 1OC1A 4Q8LA 3VBRA 4CEWC 1UX7A 2Q0AA 3IN9A 1TMF1 5EIYB 5F3CA 2ET7A 1XNKA 3D3AA 3A21A 2ZS6B 4RGKA 4X8PA 3WF3A 3LIGA 2EIGA 3KSCA 5C9AA 2BBAA 3DPRC 2WAOA 3FHIB 2EALA 3H1YA 2JENA 2VD7A 1Y3TA 4UFMA 3OUJA 2JE7A 4Y4YA 3ZSEA 1GZCA 4YFWA 1E5RA 4H7MA 4CDXB 1SLCA 4GQ7A 1XB9A 4PBOA 2RM21 4P9LA 2W94A 5DAQA 5FYMA 4NIGA 3MF6A 2W52A 3PVBB 3OEAA 3LFIA 4GWJA 4MHRA 1RC6A 3B7MA 1RMU2 4AZZA 1GANA 3KV6A 1DF0A 1MEC3 2GMEA 5A1FA 1YQ8A 2BGOA 2X29A 3AKRA 3IDAA 4XMIA 2UWCA 2YYOA 5C7GA 2JDAA 4ZS2A 1IZ3A 2VNVA 3IDEA 1KS4A 1UIKA 3JD73 1DQ4A 2B8MA 2KD7A 2Y6LA 2GP5A 3NNGA 2SLIA 1ASJ1 1UD1A 1YYNA 4OI0A 1RUI1 4QX1A 3NRUA 3FWEA 4DUVA 5LW9A 4X6RB 1BXHA 3BUCA 5FYIA 1YFWA 3VZMA 1VAKA 3WLUA 4BIFA 3IPVA 1K42A 5L7OC 5GZDA 2OIIA 5FFOC 2R7EB 3W58A 4QGNA 2I74A 1BVP1 1CAUA 3B5LB 3GF6A 3TN92 4COZA 2DCZA 2Q8OA 1BBT3 5C9AB 5IVFA 5HCBA 4DXTA 5IWFA 5JSPA 1I1EA 4HN1A 2CGNA 2P17A 3ST7A 1LHWA 5CFDC 4ATEA 2GC3A 5IHRA 3C3VA 3IIAA 5IUQA 2Z2SB 4FOYA 4BYYA 1AR82 1F4HA 3H1MA 4JGYB 5F6KA 4INDA 2EF6A 2B39A 2W9XA 5ABJC 2EIDA 5LASA 1EV12 1V6MA 1AX2A 3PVNA 2WNVB 1UY1A 1W04A 3AVRA 1SQ4A 3I59B 4K8FA 4PI2A 2I45A 3BI3A 2OUHA 2VTFA 3ZXKA 4BLIA 3EYPA 4LNVA 1N3QA 3FUOA 2BEOA 3AZZA 2VUCA 3MFCA 5FZ0A 4ATFA 3AZYA 2A5ZA 3FX3A 4JKKA 1RUJ2 1OBNA 1RUD1 2LALA 4LHNA 1XPWA 4KU8A 2ZX2A 1RYYA 5IJRA 3WCSA 3MIGA 2RJLA 1UW8A 4QB2A 5T55A 2BP6A 3RZJA 3DN7A 2QQIA 1GP4A 1L7LA 2WQ8A 4FXGB 4BQ1A 1SFNA 1S55A 2BVVA 2ZCWA 5A32A 2VXJA 4CUAA 3AYCA 2RDRA 3ZYRA 2CGPA 1LOCA 5DUVA 3ZN6A 4DEQA 4QWNA 4CXYA 2XXZA 2VMCA 4IE7A 5EQUA 5C3OA 4IE5A 3D4KA 4BHPA 3K4AA 1H8TB 1T6GC 2VH9A 2XH6A 2IVJA 3CO2A 3I59A 4EYUA 4IEVA 3PIGA 1O7FA 5LBEA 3ZYHA 1QKQA 4TYSA 1V9U1 1SEFA 1HN1A 2WS91 3TEXA 3V0BA 1G6NA 4BZ4A 2AZ5A 4RS5A 2BBVA 2X5IB 1JYCA 3MICA 4YZ5A 2WN3A 3OPTA 5A7WA 5LWBA 5LA1A 3GHNA 1LB2A 4NMIA 3FLTA 3B94A 1YQ2A 2G19A 3DUIA 1M06G 1Q8QA 5JAXA 1PO21 2Y34A 4YM1A 3WF2A 3RJ2X 1PGSA 3M3IA 3WG1A 4ASMB 5HPOA 3C7EA 3U10A 1RUH1 2H6BA 1GWLA 3KB5A 4AK3A 1PZ9A 3MLKA 4CU8A 2XUMA 5GZGA 2VUAA 5AC91 3H8RA 2GH8A 2MHFA 1GZWB 5FR3A 2ZTNA 1GOFA 2YU1A 5DQ0A 3QCWA 4DQAA 5JPMB 1QJX1 4CCDA 3AVSA 2WR9A 2QQUA 3FHAA 1PVC3 5LZ6A 4XTPA 3JBG1 4WM7B 1VMJA 5F1RA 1UXZA 1ZZ7A 5G04L 1HQWA 1UN1A 5FYVA 2JE9A 2EXKA 1J58A 4QXHA 2HWD1 3OCPA 3WCRA 3N7LA 4QPGA 4XIOA 4KQ7A 1RXGA 1S0IA 5LRSA 3V64A 3ZSMA 1JMUB 1QWRA 5FZEA 1ZZ9A 3SH3A 3RSJA 2XL9A 1F5FA 1SCSA 5FQ0B 5C8CC 2DVBA 2VOVA 1DIWA 5JOYA 2JDMA 4UW3A 4IESA 4PF1A 2GC0A 2DCJA 2VM9A 3EQEA 1Z7S3 5FMBA 4W8JA 3W20A 4BIOA 2BNMA 3LZZA 2JEMA 5C3RA 1JZ2A 1KEXA 3LEIA 3ME2A 4BQ5A 5CFDA 4GH4B 5FXXA 5HCHA 2ARBA 5A6ZA 2F17A 1PX3A 1O4YA 4B4RA 2RS53 1ZRDA 5HV0A 5JSRA 3ZYBA 2OT7A 4LMFA 1AL23 2WABA 1YJLA 2A3XA 4IEQA 3B02A 5A3WA 4P9XA 2TBVA 1DZTA 3OF1A 4LPLA 4BQXA 5KXDA 1BJQA 1C8M2 3ZFEA 4DB5A 4RQPB 2RMU2 4MHUA 1EV13 4FO9A 1F35A 1NE6A 1OI6A 5LB6A 3HPNA 4HLTA 3GCWA 3AC0A 2HWE2 3CZJA 3PUSA 1PGL1 2BERA 4YZ3A 4PJYA 1COV1 3LPFA 1JW6A 3ZFFB 5A6XA 2J1TA 1YQ6A 3WD5A 5HXVA 2JDYA 2ZOEB 4OI1A 3WUCA 2A6WA 3BPZA 1I9RA 4LIVA 3ZVXA 3ZIWA 5C3QA 4O61A 3KV9A 2WZR1 4XJ9A 4QGLA 3ES4A 2XG3A 1BZWA 3AB0A 1W6MA 2J1RA 3J8F1 2XKOA 1UPIA 4DY5A 2ZGRA 5CU1A 2QQKA 3T4VA 4COYA 2IFWA 1Q8SA 4CEYA 3JQXA 1NAEA 5BXXA 2RR13 5I0RA 2LS6A 4EN7B 4HONA 3THPA 4OI2A 1REEA 2D6PA 2Y64A 5FZOB 3OBTA 5GZEA 3KGLA 2VOWA 1R081 4DNYA 1A78A 4J25A 4DS0A 2ZGTA 2XVKA 1NX9A 2VNGA 1O5LA 4G9SB 4Y1XA 4JV4A 4MGQA 3U1XA 4WBBA 2YGMA 1IS4A 4QPGB 2D6NA 1QH7A 2PAEA 1CGPA 4LUMA 1WLTA 4C1WA 2VU9A 1JZ7A 2BV4A 3I2FA 1N1TA 2RJKA 5J96B 1KDMA 1US3A 4ZKTB 1TNRA 1GOHA 3NAPB 4GXLA 4FTSA 1V0AA 3KWVA 4L9BA 1W9YA 5FZCA 2HH9A 5FAXA 4GMP0 4H14A 5FZAA 5JOWA 2VCAA 5F2WA 5FO7B 3KT1A 3OSDA 1N1SA 4ARXA 4UFLA 2ZHNA 4TWTA 5EP9A 4YGDA 2HEVF 1H8TC 1D2QA 1LGBA 4E4ZA 1FOD2 3K2OA 3WDWA 3GZUC 4YM2A 1ZM1A 5J37A 2PXJA 1HRI3 1QY4A 1PO11 2WBKA 3MUZ1 2BWCA 4XVHA 3VBHC 3OTFA 1J1LA 2OPWA 1R083 5LY1A 3BTZA 3NSTA 1EP0A 1GZ9A 4Z2WA 1S2BA 1PK6A 1WMXA 4YARA 1JZ6A 4Q4X1 5ANQA 4QAWA 3NJXA 3E5UA 3TNPB 5I0TA 5LBCA 4KI5M 3USUB 2AGSA 1ZBE3 5LCWL 2DVAA 4TXWA 3MW3A 3WR0A 5DAXA 2XLFA 1R1A2 3OGGA 2VUDA 1OXCA 1VB2A 3MW4A 5LY2A 5T5OA 1AYM2 2EVXA 4FPJA 3ZX7A 5FYHA 2X10A 4IGOA 4AI9A 4WVMB 3HT1A 1MS0A 4I0BA 3NNJA 3J9SA 4FPOB 3LOBA 3D5OA 4MH0E 2Z5WA 3OJBA 1VRBA 1W6QA 2QQMA 3ZFGC 4AEDC 3HMYA 4E8CA 1WW5A 1SBDA 3ZYGA 3PUQA 1S2EA 2JB8A 2D3SA 1LOGA 1RJ8A 2OPKA 3RYRA 4AVCA 3CL1A 4XXAA 1NZCA 2ARXA 3UJQA 3RZLA 2FCTA 2YUEA 3HVDA 5B4NA 3LDKA 4A6OA 1JOBA 2OS2A 2VCBA 3LEMA 1AX1A 2DUQA 2LUWA 3BCWA 3MYXA 5C5UA 4TLFA 2A3YA 4FFFA 2CYFA 2J7MA 3ALQA 2YFZA 2HJIA 3FL7A 4MYEA 3JZVA 2RE9A 1SG3A 3KS7A 3D8CA 4GKXA 1RUE1 1PM7A 1NE4A 2D6KA 2XQXA 4WVMA 4EN0A 1AL0G 4Q4V1 4UW6A 1BEV1 1UY4A 4IUGA 4OZXA 4X8NA 5FZHA 3ON7A 4LA3A 4OCTA 1C5IA 3VD3A 3PIJA 3RPQA 2HBTA 2YPJA 3UGFA 4OHWA 1VP6A 2HWB3 3USUA 1EUTA 4QXKA 1NY72 4OULA 2JKBA 4ZZ8A 3I2OA 1LOFC 4W6WA 3H3ZA 3SNMA 2ZMKA 3LQCA 4K7JA 1PGL2 2XOMA 3LFMA 4KBBA 2C0ZA 3MF9A 1R093 1BYHA 4XYXA 3WUDA 2ZZJA 3KT4A 2Q8CA 1ZZBA 1WLWA 2UYBA 3VBUA 1U5XA 2DURA 2IXJA 3AP6A 1LKNA 2AYHA 1RUOA 2G1MA 5F5QA 2QJVA 3OYWA 2RDQA 3THTA 4YVWB 5CIRA 3OUHA 1W28A 1OSGA 3FLPA 3WY6A 4MX3A 1NA1A 3J26N 3TN91 1CZVA 3I2IA 2B45X 3GBGA 4D94A 3O12A 2WFF1 1KQRA 2GNMA 4M0HA 5T5PA 1O8PA 2UU8A 2BOIA 2AENA 4GB31 1RTVA 3L2HA 1QIQA 3H1WA 3U14A 3WVJA 4M4RA 2YFUA 2A6ZA 5APAA 4Q1PA 1X82A 1DLLA 2E51A 3QLQA 3RZMA 4JQRA 1F9KA 1AR92 1RUD3 2FMYA 3D82A 3ZLIA 5KXBA 1R64A 3BTAA 4CP0A 2YDEA 2NM1A 4UAPA 2C9AA 1E5SA 5FTTC 1ZRRA 1J3QA 4J1WA 1KFUL 4Y1ZA 5H9SA 4FXKB 3PMEA 4BQ3A 1JS9A 4XUNA 4CDUA 3LA2A 4Y22A 4LBQB 1DP0A 1GR3A 4XF9A 5IVBA 4AEKA 1OVPA 2R073 1RUNA 2D6MA 3AYDA 5A6QA 1H8VA 2BTVC 4WM7C 3VDDB 1ZZ6A 1IOAA 2ZJCA 3HJRA 5LBFA 4ZPIA 3N9NA 3AKQA 5FRAA 4LKDA 1CJDA 1PK6C 2P1BA 5J7MA 4FPHA 1QEXA 4HG6B 3FFQA 1ZREA 5EZWA 1H30A 1V6IA 2JWPA 4YVSB 5M0TA 1LAJA 1LHVA 5A33B 1W8OA 3VBHA 1S2KA 1IS6A 4BOWA 4H7LA 1KS5A 4D69A 1DGRN 4QDQA 1S0FA 4YW3A 4N7IA 3ETPA 4BMBA 1WW6A 4MXWA 1OOPC 3WV6A 3H50A 1TG7A 3LDRA 4QKDA 1UYXA 4AHZA 4M0NA 1Y9QA 2AACA 1W6NA 4R4ZA 3P3PA 1HB2A 4RYDA 1KDKA 1XE8A 5FZ4A 2EXHA 4Y5SA 1W8UA 4XF1A 4COVA 4IW3A 4NOTA 4RL7A 4LBJA 3NV4A 4YW7A 1VBC1 4CCKA 5FP7A 2EIBA 4YGCA 5F7UA 4XFBA 3WNMA 3RZKA 2R071 3C7GA 3T4HB 2DCKA 2K0GA 4IEZA 4Y22B 4Y5Z0 3BODA 4CDWA 3VGIA 3WW1A 5F5CA 5DUUA 3RG0A 5KHJA 1QNWA 3BU7A 1KXGA 1W8HA 4C91A 4AFCA 2O8OA 1JU3A 1E57A 1W6QB 1YHFA 3AJZA 3O0WA 4QX7A 4FT8A 4YGBA 1H0BA 5FUIA 3N4MA 4OLLA 3ZFFC 4WZCA 2WO7A 1B35A 1JHNA 3GBWA 2A6XA 4NN0A 1DHKB 5KC6A 4YPJA 3MIBA 1SACA 4XXPA 3CZUA 5L9RA 5T52A 2WT2A 5FP4A 3UETA 3T0BA 4BQWA 3I2DA 3K75B 3MDPA 4IETA 3DKQA 4O9GA 3KQ4B 3PTRB 5GLWA 3BTYA 5EYXA 4HPKA 1ZBA1 4LK6A 5A1LA 1S0CA 3A4UA 1CQ9A 1XC6A 2PLV2 4LITA 4P5YA 2PELA 5DAWA 4FSJA 3R05A 4L2NA 5TSWA 3ACGA 3N9QA 1UO9A 4HSLA 4D6RA 1LU1A 5C8CB 5CEHA 2YMZA 2CY6A 2FDKA 2V09A 3VV1A 1H2LA 4MGZE 5CG9A 4MZUA 3WQ1A 1JYTA 3I3BA 1AYN2 3R4DB 2F6BA 4RFRB 3B9IA 1W6OB 5HCAA 1ZX5A 2WZR3 3IAQA 3LF7A 2WLPA 5J36A 3ZSKA 2JDKA 1RUE3 3H3LA 4IV3A 1O4ZA 5FZ3A 3CIHA 3WDXA 1GWKA 2UYAA 3E5XA 3LSDA 3ABZA 3CMGA 5H9QA 1UF2C 3RMXA 1HB4A 2A6YA 3ZFEC 5A3UA 4AFMA 4BXSV 3BYWA 1HDKA 4E4DX 3PL0A 3ZXGA 4E9KA 2NQYA 1MS5A 4EQVA 3SCHA 5JR2A 3KQRA 1UMIA 1S0JA 2XHKA 2FCVA 3VZOA 5A6YA 2LRPA 2ZGUA 1NLRA 1HV0A 3MFAA 4UBHA 2B7YA 3ZN4A 4K1YA 4FPCA 4CDQB 1CAXB 2GC2A 1PVXA 4PT6A 3KCCA 4DO0A 3C7FA 1UXXX 2R061 4QKNA 4XJZA 1Y43B 4HMZA 4OHVA 5FXVA 4OMDA 1PIV2 4FQ4A 5FK7A 1VBD1 3DXTA 1JZ8A 2IZWA 1X50A 1YFXA 2MEV1 4AF9A 1W6PA 1HRV1 1AXYA 1CPNA 2HEWF 1IG0A 4HOOA 4I01A 4ITCA 4MUVA 3M3CA 4DXZA 4NWWA 2RM23 4LT5A 1OA4A 4XHXA 3RVHA 3AZVA 2HWF3 1V70A 5LRRA 3I97A 3MHZA 5LATA 1OA2A 3NAPC 3WQ0A 2RDNA 5CAZA 4CDUB 1K5MA 1LENA 2RS32 1MEC1 2JDZA 4LTAA 3ENRA 4WM8C 4OUSA 2VZPA 4D7YA 2V5YA 3CDZB 5FKCA 5FMOL 2KM2A 3AL5A 1TMF2 2VZSA 1RUH3 4FOQA 4D6QA 5DN2A 1RUH2 1YXWA 1LOEA 2W87A 2ADEA 3LGRA 3N7MA 1GICA 1SHWB 4P02B 3DCQA 4FBFA 4Y4RA 1QDOA 2QDNA 4XBLA 2IC1A 1CAWA 1LGCA 2W1QA 2NYYA 3PNAA 1GP6A 1V6KA 2QQNA 4P9IA 5A33A 2UY9A 1LOAA 2DF7A 4Q4W2 2Q1MA 4KG0A 2RM22 3VKFC 2V73A 1YRZA 5GLUA 5A3TA 3DPRB 4G4FA 3TOJA 4Q4X3 4XQDA 4RS5C 2E7AA 2D93A 2PHFA 2AREA 3KM5A 1SDDB 4MGYE 1G9AA 5LK7B 3T08A 1SBEA 5LA0A 4L92A 2DUPA 4IV1C 2EAAA 4ASLA 2HWE3 3BKZA 4FCAA 4XFAA 2VUJA 4RGGA 5SV5A 3S5AA 2WJSA 3NV1A 5DDJ3 2GMMA 2BGPA 5FYTA 3KV4A 4QHOA 1WBLA 4CDQC 1HKDA 2OZJA 3PVEA 5CFDB 1O3QA 4YW6A 3EBRA 2ES3A 4RFT0 3SHRA 5IFPA 1WUVA 5JXHA 2JE8A 1QU0A 3VDAA 1FT9A 1ZYBA 3F2ZA 3IB3A 4YW2A 3ZYFA 5JI7A 5A7NA 1POV1 3Q8EA 1MS1A 1QQP3 4QM8A 4UYBA 2C9KA 4XUTA 5GKAC 2PLV1 2RS52 1PHMA 1QJU1 2RV9A 3P5BA 3RMYA 4GAZA 5KXCA 1OD5A 1ND3C 1RMU3 4PIZA 2QNKA 1HJGA 4ISRA 3H3UA 3FUQA 4XFHA 3RWNA 4MOAA 4B7EA 1QHDA 3QACA 4L99A 2D5HA 3AKPA 4NAMA 2XKPA 4L97A 3UK9A 2VY0A 4FP2A 1NCQA 2CDOA 4KNCA 1AYN3 1PMIA 3R4UA 5JCTA 1GBGA 1AZDA 2PA7A 2VVEA 2XJQA 3EJKA 2RR11 4CP2A 5AC92 2ZXQA 4E27A 1JXNA 2GAUA 2VOXA 2VOTA 3V0BB 1UZWA 1VRH3 3IWZA 1JODA 5T3NA 5ABJA 4ZHNA 2D5FA 1HJFA 5F39A 4FTEA 5FWJA 1Z78A 4JHTA 3POWA 1WCQA 1OHFA 4HN0A 4QHZA 1VRH2 1O91A 4W50A 3ES1A 1QJY2 3ZSLA 4AG4A 3MPPG 4EN9B 1B09A 3WNOA 1SLTA 1JBCA 1V6LA 1I6XA 1L3JA 5DG1A 2OKXA 4UI9L 4CDQA 5J3UA 5D1IA 4CP9B 5FY7A 5D2AA 4CRQA 3JB4C 2DVGA 4XDQA 5L9BA 4YVWC 5GM0A 5L7OA 2QQOA 1KFXL 5CG8A 3RNSA 5KBFA 1C8NA 1WCDJ 2VNOA 2ORXA 1VAVA 4YW5A 5JR7B 1SMVA 5KXEA 3JD71 3AM2A 4LLFA 2VMFA 1JN2P 2D40A 2ZX3A 5AVPA 1G86A 1UU6A 4XJ8A 1DU3D 4Y1VA 1SPPB 4K3UA 4AAXA 5E6HA 1DG6A 1WLDA 1XQNA 2ILMA 2WNOA 2NP0A 4BK5A 4RHV3 3ZKUA 2XJRA 2ADDA 2BYVE 1R1ZA 4PLOA 3NV3A 4PQ9A 3MLLA 5BNNC 5A32B 4AI0A 3UGHA 1G9CA 1OLQA 3OUIA 4ZZ5A 3LWCA 3UGGA 1CAWB 1JH5A 1VBA3 4IGQA 4UF0B 4CEWA 2KA3A 2VJXA 5IVVA 3V65A 4QPIC 2RS11 4JRLA 4AVBA 1ZBE1 4XAEA 2DUOA 5IVYA 3W59A 3I54A 1C8M3 3RQ0A 5F3IA 3BGAA 3H7YA 2Q1ZB 5CYYA 3T0AA 4B1LA 3IIIA 5ANNA 5FDBA 1OQ1A 1JUIA 3ILRA 3WNXA 4OFGA 4WM8A 5ERLA 2JG8C 2Q5TA 1K5MC 2YG0A 4QQHA 3T2OA 1WA4A 3HQXA 1UIJA 2GP3A 2PYTA 3MI8A 1W06A 3POSA 4CDWC 1GLHA 2BJSA 1RIRA 2UWBA 3JUUA 3J8F2 1QXPA 2BW8A 4OYUA 5FREA 4Q4Y3 4N9HA 2VC9A 4Q4W1 3N3HA 5IAXA 5AVAA 3LCPA 2VZTA 3OOXA 5FY9A 4C0HA 3HQRA 4PDWA 2PQQA 4F3JA 2HWD2 3ACLA 4OMCA 2RHPA 1QQP2 2PTMA 2VECA 1T6BX 3BPSA 1OVSA 4NIDA 3KF3A 3D6EA 4URAA 5I8SA 4RR3A 3WF4A 2XVLA 5EPAA 4E2GA 1XYPA 1FPN3 1JOPA 1LHNA 2WWJA 3ZDSA 4XQWA 4YG0A 4CEWB 1GQPA 5IAVA 1W9WA 4A45A 1OOPA 1PMJX 5A80A 2B5HA 4CE8A 1AR71 4LBKA 1Y9GA 3ZOIA 4YM0A 3I49A 1JHJA 2VZOA 2GZWA 2DVDA 5F9TA 1U5IA 3TEYA 4GWNA 1G9DA 2WYFA 4HK8A 4DXRA 2VMGA 5FLHA 4CU7A 1C4RA 3B69A 5IW0A 2SBAA 1RB8G 4XFIA 3SISA 5IFTA 5FPBA 1IG3A 1MPXA 2RVAA 3GBFA 3WF1A 3OD4A 4B29A 1W6NB 4R9CA 3U37A 2XONA 2WFF2 2NLRA 4S2GA 1UY0A 3VBSA 4CDUC 3IMMA 3ZXDA 1DLCA 1TNFA 1W2OA 1XSQA 2R16A 4KWUA 5ISLA 1MZ6A 4JKLA 4E2QA 5K0UA 3THCA 1XU2A 2IXCA 4I0AA 3CBNA 3O1OA 2VCMA 4IEOA 1IPSA 1PZ8A 4ASKA 4JTOA 2PMWB 1S0DA 2N7GA 4QX5A 2GU9A 2GNDA 5LEJA 1RUI3 3VBFC 3U78A 1UPSA 2LW8A 2X05A 4N7UA 1ZRFA 4O7XA 2ZX4A 3K46A 1AR73 3PHMA 1W3VA 1ENXA 1C5HA 1WCUA 2R30A 1W9TA 2WT0A 2ZGLA 3MPBA 3WDYA 4ZS3A 3OB8A 4AOCA 1DYKA 4AR2A 4LHLA 4N53A 4NHKA 5CB7A 3VBRB 5F2SA 1LEMA 2WWUA 2XJPA 5FZGA 4A3ZA 3QOPA 2VBDA 3UJOA 2FDJA 1LTEA 1MACA 3GZAA 1YQCA 4ZXEA 1X9TA 3VBUC 3U0ZA 1OPMA 3PU8A 5FZIA 3ZPOA 1UAIA 1W3XA 2QE3A 3SMHA 4XF4A 5JZGB 3K77A 5FY1A 1LHUA 3ILNA 4RQPA 3I8TA 3FBYA 3WOGA 1XSRA 5IT6A 2WNVC 3ZXFA 1POV3 4F7ZA 2VQ0A 4PQQA 2PLV3 4ZXKA 3N35A 3GM8A 3QH6A 3PDQA 1SFYA 3RWKX 4QDRA 3AMQA 4AEDB 4AGVA 5FP3A 4LBQA 3ACFA 3W21A 5DG2A 2VQUA 2ZGQA 4BISA 4JC1A 4PLMA 2FDHA 1WD4A 3J7NA 3AFKA 3OPWA 1SLLA 2XQRA 3H42B 5FZ7A 2LROA 5FY4A 3VL8A 1WWYA 1NOVA 4Y33A 4LE4A 1ND2B 1LNSA 3EO6A 2W1WA 5DZEA 2OQ6A 2OVUA 4JGZA 2RJ2A 4NPMA 4JVAA 1JI6A 2VCCA 1FOD1 1QNYA 4Q26A 5CKNA 2XMLA 4IERA 3E6CC 3H8XA 2MEV3 2ZEWA 1W2UA 1ENRA 3AZXA 4BXFA 4RSUA 1DQ6A 2IWGB 3HQUA 4PCRA 3E6BA 1D2SA 1A34A 3WINE 3RZHA 2O14A 2P2KA 1C28A 1CVNA 1L7RA 4XEZA 5E1RA 5C4WB 1JUHA 2C1FA 4ZU7A 3FC0A 4KH9A 5JMOA 3VHOA 4GMP1 3AMNA 1JU4A 2GN7A 2JICA 2P37A 3NW4A 2UURA 2HWB1 3TNQA 2FDFA 4BK4A 4DFSA 1D0HA 3MO4A 1LU2A 1OPOA 1OF4A 3P1IA 4W4ZA 1PGW1 3IDBB 1LESA 4BJ0A 2ZEXA 3OGVA 3AMHA 2ZGSA 5IK8A 2Y6GA 1NQJA 3K3OA 1R1A1 4AWDA 2FCUA 1ND3B 2W3JA 1FPN2 4CCMA 3POJA 3I4IA 4DOUA 2C24A 4R9DA 4XABA 4QXCA 5BNPA 3AYEA 5LK5A 1QJU2 1GMMA 2Z79A 3UYJA 1PM4A 2FZ1A 4LORA 1YQ5A 4LO8A 4HVQA 5BPXA 1LEDA 4AI3A 1CZTA 5JOZA 1IQDC 4B4PA 2WS93 3VDBA 4AQ2A 1XOYA 4HZFA 4NVPA 1RUG2 1RUI2 5I0UA 4BCUA 1C3HA 1CJPA 1XNAA 2WC2A 5DAPA 5ACA2 2FD8A 4HSJA 4UFJA 5CKQA 2EIEA 2J22A 5F5AA 3CU7A 5C4WC 1WMDA 2QVSB 3J7MA 1J1TA 1G7YA 4A4AA 4LBNA 3NL1A 1N1VA 4WVVA 1ULEA 1X33A 4JGZC 2A71A 1V6JA 4Y5TA 4MVTA 1PIV3 2P3IA 2WFF3 1QJY1 2XBO1 2ZPXA 3POYA 4TLGA 1VBA2 5EJZB 4AW7A 4ZONA 1NZIA 4CA9A 1LHOA 4CPBD 4D0QA 4QX2A 4N43C 1JZ3A 2A7AA 1HRI1 2YB7A 3THDA 1RUC2 4R9AA 1LOFA 2G9GA 4AHXA 3EB7A 3HN1A 2D3RA 5FOBB 1X9PA 4LA2A 3KD4A 4NWVA 3TEZA 1OLME 4CCOA 1O3TA 1F4AA 3Q8AA 3VKMA 1KGYA 2C5DA 3J4UH 4U2AA 1G9FA 2Y8KA 3VB9A 4IV3B 5GLZA 3LEKA 3SLIA 4I3GA 5C70A 4LBOA 1YFYA 2BRTA 1AR62 3INAA 2HKXA 1I3HA 1RXFA 1ZA7A 2WNEA 3FHQA 1FATA 3KGZA 3Q9OA 1UU4A 4LO7A 4XFGA 3TYJA 2JDPA 4MV2A 2HLEA 4NUBA 1HV1A 2GMPA 4HANA 1RUE2 4RA0A 4OUEA 3SXWA 4M3CF 3WT3A 4YFZA 4LO5B 4KGQA 3MIDA 1VJ2A 1YEWA 4AI2A 4KU7A 1QJY3 2D98A 4NROA 4IEUA 4A2UA 1W6PB 2RS12 3O0XA 4RD7A 5FUPA 3ZFGA 2W47A 2Y38A 2JX9A 1EYBA 4LR4A 3VBOC 5FKBA 2Y26A 3RZZA 4F83A 1RHI1 2B42B 1BMV2 1F31A 2ZX0A 3T2TA 4QX0A 5K0UC 4Q1RA 3PUHA 3JCIA 1HLCA 4LHKA 3ECQA 5FUNA 1RUF3 3W5MA 1MQTB 1ZBA2 2NPIA 1U5YA 4Z8BA 2RS13 1LRHA 1M4WA 5FJHA 4MADA 5CZKA 1APNA 1FAYA 2A70A 2E26A 3PJYA 1D7PM 1VE0A 2HWF1 4AVVA 1GQGA 1LR5A 4XZPA 3U75A 5K7PA 4GB32 1RVF2 3VBUB 3WNKA 3W5NA 2QFEA 2Y60A 4HVRA 4Q29A 3H0OA 3GGLA 5JIUA 3MV01 2FBEA 3HWJA 5A7OA 5FV3A 3ACIA 1AVBA 2HWC1 4EJRA 3N7KA 4JDOA 5CFCC 4PBPA 3I3QA 1UYZA 2VXRA 2TEPA 3N9LA 4JGYC 1RHI2 2ID4A 1BMV1 2ZHKA 3OGJA 2JG9B 3V56A 4FPGA 4EWEA 4H3WA 1HXS1 1R092 1OH3A 2Q1FA 4S2HA 4WV8A 3VHRA 1FXZA 5FPUA 2JDNA 1IS3A 2VULA 1YLLA 5DDJ2 2Y0IA 3AP5A 3CF6E 1WD3A 5J09A 4META 2BZDA 2W5FA 4AHWA 4EWAA 3DGTA 1BEV2 3VHPA 5JOXA 1UOFA 2WZ8A 1C57A 3KHCA 2W46A 3VBOB 1ZBA3 1OT5A 1FPN1 5FYZA 4IQPA 4LK7A 2AC1A 3AX4A 1YC61 1EUUA 1V6OA 2B4KA 4GJYA 4LIUA 2VZ3A 3LA3A 2CL2A 4RS5B 5HV4A 3ZYJB 1A8MA 4UFHA 2PAKA 2GALA 4Q4W3 4XJWA 5J48A 1AJOA 1WBFA 2QQLA 3MBWA 4CCLA 5FYBA 5DUWA 2JG8A 1E5IA 1QJX3 4LULA 1FOD3 2XVGA 1PVC1 2BNNA 2VZQA 3PLQA 3HT2A 1UOBA 4XW3A 1TEIA 1N3PA 1CN1A 4FI9A 2VZ1A 3U4SA 1JYIA 1CAXA 1V9U2 4BQYA 5GJ6A 2P4EA 1GNZA 3ZXAC 3BOWA 2OQ7A 1OOPB 1RINA 1UOGA 1UKRA 3NV2A 4W6XA 3TWIA 1L7QA 3WNNA 3VUOA 1GV9A 1PO13 2R072 3HAGA 3Q8CA 4PF5A 4AQ6A 4EE2A 1RUJ3 5B2GB 5JDBA 1QQP1 1UYPA 1AYM3 1QJU3 5BY5A 2RS31 3SITA 4ARYA 2JJ6A 1EAH1 1XNCA 4GA9A 3VBOA 2VAUA 3D0JA 4HETA 3CJIA 3M70A 3T2PA 1XBFA 2Y6JA 4FPKA 5I91A 1REDA 2Y6FA 2YZ4A 4IEPA 4JQTA 3AKSA 3H8OA 3KVBA 4M3CE 3CJIC 3SQOA 3E5QA 3HR9A 1W2AX 1FMD3 2Q4SA 4AVSA 4XIKA 1UZZA 1XE0A 4RN5A 5FMCA 5FY8A 4QB6A 4UW5A 2DWRA 4K8RB 2VW2A 5K0UB 2W1SA 4Q5OA 3RJRA 3WNPA 4AL9A 5AFEA 4H2AA 4XURA 3I3DA 3HD8B 3PUIA 4JTNA 4AFAA 3IM0A 4Q4V2 2VL4A 4XFFA 3ZO0B 3W9AA 4YZ4A 2QCSB 2YY1A 1O3SA 2GDFA 5DZFA 2HYXA 4CCJA 4JX0A 1GNYA 4XE9A 4IE4A 2VBBA 1HIXA 4O65A 4D6SA 3M3EA 5L19A 4QGMA 1HQLA 3VD7A 4A41A 4CCEA 3O1MA 3WF0A 2WLQA 1SLAA 3ETQA 1MS8A 5GALA 3ORJA 1VMHA 2RDSA 2D43A 4K40A 3AKTA 3UKNA 5I8YA 5KC5A 1UY2A 2VGDA 5C8CA 3VZLA 5BV6A 2R062 1MQTC 1EV11 1ULOA 1D4VB 1D4M2 2QUOA 3C7HA 4N9IA 4QPYA 2QBXA 5FZBA 4V2VA 4EROA 1SDWA 1WMFA 4L11A 3LDBA 1Y9MA 1WCSA 2K2SA 5EYYA 4FAGA 4MGIE 2H0BA 5I0SA 1HB1A 3E97A 4Q0VA 5J1XA 1SLIA 3GYDA 2MPFA 4UFKA 3VN4A 1PO23 3KVAA 3T2QA 2ZA9A 2BPA2 2HYKA 3UKTA 5DUXA 2GC1A 2ETEA 2EAKA 3M1HA 1TQ5A 4F8AA 2K9ZA 3G7DA 5FK8A 4Y20B 4AVAA 1ULDA 4M00A 3ZXLA 4QMAA 3WP5A 4P00B 2P5BA 1UMZA 4JGYA 2XJVA 3B01A 5HXMA 1Q5OA 3A23A 5CFCA 1POQA 3PJQA 2J1EA 2WWSA 4IE0A 3CHXA 2DFCA 5JI9A 1VB4A 1W6MB 3FLRA 5J98B 1QXJA 1QOTA 2ORZA 2V4AA 2JB4A 3VLBB 4IV1A 3RFRA 3RZGA 3APBA 1SBFA 2VPVA 4MSVA 1GFF2 2D6LX 1NQDA 3QD6A 4NJ4A 3HIFA 3I2GA 1UKGA 3MLJA 3ASIA 4CSWA 4Y20A 5I8TA 3WW4A 2WIIB 2X53S 4YSFA 1RHI3 2XWJB 3VBSB 4Z07A 1T2XA 1O4TA 5T50A 4A6SA 1QOSA 3A22A 3WW2A 4NIIA 5FPXA 4DUXA 1VBB2 1OQEA 3FJSA 4HKLA 5CFCB 2A1XA 4K1ZA 3S7EA 1PMHX 4LLOA 1FV2A 4B4QA 1OKOA 1F5JA 2E63A 4AFDA 1ASJ3 1Q8PA 3HBKA 3OBRA 3K4DA 2C6SA 4YWAA 4EN6B 1CONA 3GZTB 4MG2A 3H7JA 2VG9A 2ZZQA 2DTWA 5DABA 4NIHA 1W05A 1XXNA 1LGNA 4FPYA 3AMPA 3CEWA 1HQNA 1UCXA 4WVWA 2R043 3AXDA 3RS6A 1S4CA 3NVCA 2AEYA 4GH4A 5IVEA 1ZZCA 3K4ZA 2JIGA 3O1RA 4YRDA 2W68A 5EXOA 4I0WB 4Z1VA 2F4LA 4J6GA 2XBO3 3WNLA 4KWJA 3WG4A 2RS51 3H8UA 5EFUA 4DXSA 1VBB1 1ZA4A 1SCRA 2DCTA 3JQWA 1EAH2 1XE7A 1P8JA 1AXZA 4LO4B 4YYOA 1CESA 2PHTA 3K3NA 2QQPA 1IHMA 1BVVA 3I2KA 4CEYB 4YW1A 1JTZX 1Z0HA 2AUYA 2E9QA 2HEYF 1PIV1 3ELNA 4XDPA 2W91A 2RR12 4FP3A 5CISA 3C8XA 3MZHA 2W95A 2JD4A 4FQZA 3O7OA 2IXKA 1AR63 2WA4A 5EJ1B 2CNAA 4CVUA 2JD9A 4BMEA 3TB0A 1V6NA 3T1MA 5BNPB 2YU2A 2BQPA 1O5UA 2DVFA 5A7WB 3GALA 4EV0A 1TME3 1RUD2 4XHBA 3FE5A 1AYM1 2ZKNA 5FJKA 3WX5A 2NMOA 4IV1B 4PI0A 1YFUA 2R0HA 2PHXA 1BK0A 4BE3A 3IPVB 4GALA 1VBA1 2B9VA 1DZQA 5LA9A 3WHUA 3IZOA 5FZ1A 2YBSA 4P08A 2ENRA 4NHLA 2RMU1 4YG3A 2YHJA 2VMEA 2CHHA 2IFRA 4Q4Y1 2DU1A 1U12A 2OYZA 3E1F1 3TBDA 4KBZA 5HI0A 1DGWX 3OEBA 2W08A 2CGOA 1CAVA 1EPWA 2WSUA 2HWE1 2V4VA 4LKFA 4XILA 4A7YA 3KCXA 4OQ8A 2CWSA 1BBT2 3LD8A 3TN93 5K4LA 4HT1T 4XETA 1ODMA 4P9GA 4NHYA 1OLMA 5F3EA 5B4XA 4Y1YA 3WXPA 4DZGA 1W0NA 1XYOA 3K48A 3Q8FA 1URXA 5FYUA 2FDIA 3NKGA 1BCXA 5ACA3 3USSA 1HXS2 1R091 1XJAA 3DECA 4Y26A 3SCGA 1BK1A 1PGW2 2R1DA 4QKFA 3ZN6B 4CDWB 3I3MA 3LSEA 4HXCA 1BQPA 2WKKA 2VQAA 4FFGA 2W1UA 4S2DA 1H1IA 1YWKA 4OVEA 1SFPA 2PN5A 1DDLA 2E32A 4EWDA 2W39A 1FMD1 3DPRA 4AI8A 4XDOA 2VVDA 1DBNA 2RG4A 4KWLA 4P5HA 4XUPA 3VHNA 5BNQA 1PO22 1U0AA 5BYNA 3VZKA 4NR1A 3FBMA 1QDCA 2ZKLA 5JPNB 2VO5A 3PURA 2IVIB 3IBMA 1WW7A 5E8AA 5L7OB 1A3KA 2QZ2A 3VDDC 1HXS3 1EY2A 2ZEYA 1BKZA 2OXBA 1K5JA 2Z69A 3O1VA 1S0BA 4LBLA 2ATFA 5GLTA 2CWMA 3ZFFA 4B3NA 2WZPP 5KWRA 4CPBA 4CU6A 4PDWC 1X7NA 3NNFA 4HFSA 2WZEA 5A3LA 1MZFA 1Y7BA 3VBFB 1DQ0A 1AR93 1SZBA 2BUKA 2ZAAA 4URTA 1S0EA 4LE3A 3URFA 5L73A 1MS4A 1OUSA 5FBJA 2D6OX 4JDNA 1MS9A 4D8MA 3VDDA 1ZZ8A 3N9MA 4YLZA 1XNBA 4LKEA 2P6CA 5FP9A 1XU1A 3OY8B 1GOGA 3CNAA 2ZABA 4LHSA 4WM8B 1J59A 2WYSA 3AP4A 3GCXA 1NY71 4XFCA 2BDRA 1UZYA 3WQBA 1O59A 1ULPA 5SV8A 2WN2A 1WZXA 2I07B 2XLGA 3KT7A 4HKWA 2WQ4A 4ZY9A 4E8DA 4L0PA 4CEYC 4AI1A 3S7IA 1W8ZA 1XRUA 3I2HA 1CZSA 3T30A 2CDPA 1DGLA 1OQDA 2E6VA 3EHKA 3OGSA 1W03A 4LBMA 1QMJA 3J7HA 5L9VA 5K8SA 1QF3A 3LB9A 2W2IA 5FMOS 4XAAA 5FQ0A 1DQ2A 1GQHA 4N53C 5BNNA 3KLSA 2DTYA 1JZ5A 1OA3A 4GWIA 3S30A 4XF3A 1WCKA 1EAH3 2H0VA 2P34A 2E7TA 5FZ6A 3M2MA 4NRPA 5JZGA 2WUHA 3DL3A 3WP6A 4GIQA 1JYVA 1VPHA 1AR81 1US2A 4CYDA 4PDWB 5C3PA 5IATA 4WM7A 3BTXA 3AJYA 2W92A 4FTBA 1XNTA 1VAMA 2XBO2 1K3IA 1W2TA 1UQXA 3ZSJA 5E88A 2DFBA 3OY8A 1YIPA 1COV3 3H9AA 2YPDA 3GHMA 4JAAA 2P3KA 2VZRA 4N43B 1BLZA 1Y4WA 1COV2 1GZWA 3IMNA 5E89A 3MIEA 4AYUA 4EN8B 4YVWA 5A70A 4OHYA 3L9JT 1AXKA 4YM3A 1QJX2 1H2KA 3DF0A 1NLSA 3ZMNA 4NHXA 2LTNA 2XWBB 3AXEA 4P9YA 2PHLA 4A42A 1O6UA 2V5DA 4E4HA 1I5PA 5FWEA 1Q3EA 1W90A 5JXGA 4MLOA 4DEVA 3LE0A 4Q0SA 4UOJA 1C1LA 2V72A 3MIHA 5JUVA 4I2OA 4LEJA 2BWAA 1K5MB 2UWAA 1TMF3 4XQ4A 2VTXA 3F95A 1W8NA 4UBGA 2VVFA 3OG2A 4I3PA 3V0AB 3DYPA 4N90A 4UF0A 1Q56A 2GN3A 2FQPA 4CCNA 5BNOC 1ULFA 1WKYA 2XJUA 4TZDA 3FFZA 3LKJA 4Q0QA 1LJ7A 1NCQC 4NO4A 4FPEA 3NO8A 3R4SA 4YVSA 5GLVA 1WMEA 3BALA 2Q30A 1ZBE2 5HBAA 1IKPA 3ZPYA 1WLCA 4QQ2A 3VKLA 2O8QA 3POFA 3WQ7A 1WW4A 2BFUS 1G8WA 2VE1A 2EA7A 1SLBA 3WP3A 4E2SA 1VIWB 5DXDA 1C1FA 3B3QE 4IEYA 1SPPA 5CADA 1X8MA 5JLVA 4GH4C 1NUKA 3A0NA 3S57A 5DPNA 5IYYA 2EICA 3JBG3 4ZU5A 2HWC3 3ACHA 5JVVA 3CJXA 4KG8A 2ARAA 3RRDA 4M3CB 3LOIA 5A7SA 1J3PA 1HB3A 1KRIA 2DCYA 1FMD2 1NCRA 4G3YC 4BH9A 5EWSA 4V2WA 5D8AC 4JRAA 4HL0A 2DYCA 3LA7A 4M01A 1AX0A 2Z42A 2BFUL 2XLAA 4UFIA 3S0MA 3WHTA 5A1AA 2BOJA 1J3RA 1GSLA 4ES8A 1AL22 2JDHA 1Z7S1 4KMQA 1DZRA 1HRV3 1QXRA 3X29B 2CSGA 4LBQD 2EXJA 2GSYA 2CTVA 4I09A 2ERFA 5E16A 1JYNA 4DRVA 2OW4A 1CIWA 2A73B 3PUAA 1VBE2 5FPLA 1ACCA 4QQPA 5FZDA 1CIYA 2R063 1ENQA 2E33A 2WZR2 4RHV1 3A0KA 4TTGA 1O3RA 4SLIA 2AEZA 1PNFA 3HN3A 2E53A 1RL3A 5FZ8A 2G9FA 3BOPA 4NHMA 2YXSA 2JXAA 4QPWA 1W8WA 3ZM8A 2A3WA 1ND2A 1DCSA 3DKWA 4BLJA 3AZWA 1IGOA 5G05L 4A44A 3N9PA 4Q4V3 1TE1B 1X8EA 2R6QA 3T09A 1AUYA 2X5IC 3UNPA 1ALYA 1H9WA 4CUCA 3NNLA 4TSVA 3WP4A 2XUEA 4CCCA 2R042 1NCQB 1UMHA 5I0DA 5EHDA 3NAPA 4AEMA 5JMCA 4HPKB 5F3GA 3AP7A 1W8TA 1ZVFA 4RHV2 3UV9A 4BM8A 4CXWA 2OUJA 3ZYIB 1U5ZA 4AQTA 4DIQA 1VBC2 1TME2 1QJEA 3AMMA 5LA2A 2OA2A 4C1XA 1MVQA 1C8M1 1H8TA 3N9OA 1MQTA 3OBAA 5I93A 4R52A 2KXLA 4NRMA 3TEWA 2K46A 2JG9C 5FY5A 3B00A 2WO2A 4OHZA 3SKJE 3WZ1A 5EV7A 2FHRA 4XJAA 3ZIXA 4BPZA 3POBA 4N8MA 5BNPC 3SEEA 3NKTA 4X6QB 1N1YA 1W0OA 2IUWA 4BB3A 2UY8A 2VW1A 1W0PA 4JZRA 2P3JA 3IDCB 1NCRB 3DYMA 4FAHA 3ZYPA 2YC0A 1OF3A 1V9U3 4GB33 3U11A 3Q8BA 5KHHA 4HKOA 1KD7A 1H2NA 4KGGA 4E4SA 5A3PA 1D4M1 2ZGMA 1ND3A 4C8DA 5FLJA 4R9BA 5IVCA 2WAAA 4D7SA 4GWMA 2TUNA 4WVZA 4XJUA 2Q8EA 3VD9A 3O1UA 4P9JA 3BVCA 1RUG1 3O14A 4QXBA 3HEIA 3RYPA 3WEZA 1DQ5A 5IK7A 2A6VA 1AHSA 1NLQA 4CTEA 4DPNA 2J42A 3KZ4C 3B93A 4IV3C 2VTXJ 3L2YA 2I2SA 2JKXA 3M3QA 3WW3A 4CUGA 2F4PA 4LQRA 2XPJA 2VMHA 3UKVA 4GKYA 4IE6A 1OFNA 2ZMNA 3MEPA 5F37A 3BN6A 4BQ4A 1CAUB 1NXD1 5A7PA 2EXIA 1UNBA 2NMNA 2ZBJA 1ASJ2 2G4IA 1FV3A 5GZCA 4A7KA 3LEGA 2G9ZA 3VL9A 1MVEA 5H9PA 4QKBA 4AVTA 4CP1A 2IXIA 1BHGA 1CR7A 1YO8A 2VBPA 2XJTA 4FPFA 4JGZB 2QQWA 3QBQA 4XACA 4EZ4A 3SC7X 3VD4A 3GDBA 1D4M3 2Y0OA 4EZHA 3KCYA 1FYUA 4W65A 3WG2A 1F2NA 2WNUC 1QOOA 4Y24A 5C5TA 3B9CA 2W0XA 3SH4A 5BUVA 4AE2A 2BNOA 1IS5A 3GNEA 2R49A 1YIFA 1VBC3 4ES9A 4BWOA 4D3WA 5A3MA 5CKMA 2GNBA 1CD3G 2PHDA 2VMIA 1H1MA 2WA3A 2BU9A 4JHZA 4MXVA 4CDXA 1AF9A 4U36A 4FPLA 5A7QA 4RR3B 1CAVB 4B7KA 2FZ2A 1OKQA 1AL21 4XTMA 4AAPA 4YGEA 2PHUA 1UWWA 4DRRA 4Q4X2 2OZ6A 1UU5A 1RITA 4LKSA 1MS3A 1ULGA 4CUBA 3FZ3A 1W6OA 2Z4FA 1VBD2 2C26A 4BQ2A 2DBIA 3KV5A 2E7QA 2PHRA 5F32A 4OQ9A 1FI2A 4QPGC 1F8VA 1MZ5A 2XDVA 1GWMA 4YG6A 5AFBA 1POV0 4QQLA 4COWA 3RI9A 1DQ1A 4A7ZA 1H1AA 3ROUA 1MEC2 3LAGA 3S6PA 4DY3A 5FP8A 4YNIA 2VW0A 1CX4A 3S5QA 1J83A 1YUDA 2O0OA 1PO12 2X8KA 2H6CA 4HK9A 4I30A 3TAYA 1GU3A 2X5IA 3VD5A 4DMIA 4ET7A 5JWPA 4HVOA 1KJRA 2JIJA 2P6HA 2NZ9A 2VMDA 4Y3OA 3HOBA 4Q27A 5DAVA 3ZMOA 4CDXC 2ZGOA 5JXIA 4OI4A 1JYXA 3I2JA 1GUIA 4XMAA 3DXUA 4HBNA 4XZUG 5BNOB 5HCFA
chains in the Genus database with same CATH topology
3R6SA 2ZGPA 2GH2A 4PLNA 2FMDA 3RI8A 5DDJ1 1LECA 4V1PA 4W6YA 2WNUA 3U4XA 4J1XA 1AR83 1DYPA 2JG8B 3M4FA 1GNHA 1VBB3 1G9BA 3WDUA 4AXOA 3DV8A 5T54A 2CAVA 3RYKA 4I02A 4XF0A 4K9SA 4R8HA 5C8WA 2MNGA 2ZACA 5D8AA 2D7FA 1QJZA 4RGAA 4Z82A 5JIAA 1NCRC 2RMU3 3MGUA 5T5LA 3IT8A 2HWB2 4Q0UA 3HBZA 5T5JA 2B9UA 3O0VA 1FNZA 4OHXA 1NA1C 1MR5A 4D7TA 4CZSA 4O9EA 4Z92B 5CBLA 2IXLA 3I7DA 1W39A 4KL1A 2WSVA 5FPZA 4UW4A 3ZXEA 4AEJA 1OLRA 4AGRA 4Q8KA 4K6BA 1LOBA 2D44A 2PFWA 4IEXA 3CJIB 1H4GA 1B35C 4YVSC 2IXHA 1RVF1 4IL7A 1GKBA 4Y1UA 2QZ3A 3ZXJA 5C4WA 1QGLA 2JG9A 1YI7A 3JU9A 1XNDA 1UL9A 2ZMLA 4COUA 4N43A 5L36A 4YZ2A 3PVOA 4JCKA 4K20A 3SH5A 5ACA1 3NJZA 4MGKE 5D8AB 3VBHB 3OD0A 1BEV3 1PZ7A 5H9RA 3JB8A 2LM3A 1UX6A 1IPJA 2ZHMA 5IK5A 1KJLA 2YGLA 2R32A 3VZJA 1NG0A 2A75A 4YZ1A 3R0RA 5GZFA 1Q43A 5BNPC 1XYNA 1AR91 2VOKA 1NA1B 1QH6A 4YW4A 2R1BA 3V0AA 2AR6A 1OMIA 5CVRA 1NXMA 4AEDA 4A3XA 4QPIB 3NWKA 1RVF3 5FO9B 1ND2C 5JZGC 1FNYA 1RUJ1 4XPVA 2R041 4JDMA 4AFBA 3AK0A 5C6CA 1N3OA 2WL1A 2YV8A 1IQAA 1RGSA 1Q8OA 5ABJB 4GULA 1GYKA 4BA6A 3RDIA 2ZGKA 2XL7A 2QDRA 1MZEA 3WDVA 3ILFA 1YJKA 2NN8A 1S1AA 3OYWB 4GMP3 4ZU4A 4ISQA 1V00A 5C9AC 3M8LA 5C33A 2DV9A 3BB6A 4XBQA 2YROA 4C90A 1BBT1 3ZFEB 3K51A 2ET1A 1REFA 3P3NA 4OUMA 3VKOA 1KITA 2HWD3 4H55A 4K21A 3VBRC 5CNAA 2WS92 4CDUB 1IPKA 2BGCA 4KWKA 2AH2A 4M3CA 2D3PA 1VBE3 4QU2A 1VBD3 1DGWA 5KHGA 3E6DA 3T1LA 3PMSA 4IXLA 1LULA 3TRSB 4R4XA 5LEKA 1RMU1 3ZFGB 4RQPC 5F6LB 3BIWE 4FVVA 2WNUB 4UXAA 2XGXA 3CLPA 2GNTA 1EPZA 1AYN1 1LCLA 1VALA 2WINB 5BNOA 1ULCA 1RUC3 1PVC2 3U07A 2WNVA 4P14A 4B8EA 1PK6B 1H2MA 5DZGA 3WG3A 1ENSA 3JBG2 1H9PA 2R0FA 2B46X 1A8DA 4QQOA 2XJSA 1VLNA 3M3OA 1D0GA 2JECA 3AP9A 4QM9A 1H4HA 2ZAHA 2ZX1A 1YNAA 1WGPA 4PIXA 4Q2FA 1LODA 4ORFA 4QHBA 1RUG3 2PAMA 3O5SA 1OFSA 2O1QA 2QKDA 1AJKA 4Q4Y2 3VBFA 1DGRA 1I5ZA 3AFGA 3J8F3 3JD72 1HW5A 1Z7S2 2ZGNA 1PNGA 1HX6A 3VKNA 1ONAA 1RUF2 3WDTA 4L8QA 1HRV2 3C2UA 5CG9A 5JSOA 1B35B 3G6JB 1VBE1 3MIFA 4P9WA 4QD2A 4Q0PA 2CAUA 1IKQA 1YI9A 2RS33 3VZNA 3KMHA 3N36A 3VBSC 1J59A 4QT6A 4LO6B 5BNNB 4SBVA 1NYWA 4XOGA 1VR3A 1FX5A 2HWF2 2DU0A 3OPZA 1YCIA 4LUKA 5K9YA 5KHIA 2PHWA 3IKWA 3ATGA 5AC93 5FLIA 4NPRA 4FOWA 1JOJA 2HWC2 1ZNPA 1RUC1 4XBNA 1Q8VA 1S0GA 3ZN5A 2WQZC 3M7AA 4DINB 4AQSA 1RJ7A 2VNRA 1CPMA 3D0SA 1AR72 2BVBA 5FO8B 1RUF1 3UL2A 2D97A 2WFPA 1R1A3 5FCCA 3PTYA 2MEV2 4PIYA 4AGGA 3N7JA 5FOJB 3FMGA 4FOVA 1X36A 1AR61 4IEWA 4RR3C 3EXUA 3AYAA 5KHKA 3QH7A 5FBZA 5EJ3A 1DFQA 3SCFA 4AHYA 1VRH1 1TME1 4C0BA 2TNFA 1R082 4S2FA 2WT1A 1N47A 3MW2A 1A6CA 4ONUA 2CV6A 5IK4A 4MXWB 4QPIA 4WZFA 1HRI2 2XB6C 2ZHLA 4N53B 4Q8LA 3VBRA 4CEWC 2Q0AA 3IN9A 1TMF1 2ET7A 1XNKA 2ZS6B 4X8PA 2EIGA 3KSCA 5C9AA 3FHIB 3DPRC 2EALA 3H1YA 2JENA 1Y3TA 4Y4YA 2JE7A 3ZSEA 1GZCA 4YFWA 4H7MA 4CDXB 1SLCA 4GQ7A 4PBOA 4P9LA 2RM21 3MF6A 2W52A 3PVBB 1RC6A 3B7MA 1RMU2 1GANA 1DF0A 1MEC3 2GMEA 2X29A 3AKRA 4XMIA 2UWCA 2YYOA 1IZ3A 3IDEA 1KS4A 1UIKA 3JD73 1DQ4A 2B8MA 2SLIA 1ASJ1 1UD1A 1YYNA 4OI0A 1RUI1 3FWEA 4X6RB 1BXHA 1YFWA 3VZMA 1VAKA 3WLUA 4BIFA 3IPVA 5L7OC 5GZDA 2OIIA 5FFOC 3W58A 4QGNA 2I74A 1BVP1 1CAUA 3B5LB 3GF6A 3TN92 4COZA 2DCZA 2Q8OA 1BBT3 5C9AB 5HCBA 5JSPA 1I1EA 4HN1A 2CGNA 2P17A 3ST7A 1LHWA 5CFDC 4ATEA 2GC3A 3C3VA 3IIAA 5IUQA 2Z2SB 4FOYA 4BYYA 1AR82 3H1MA 4JGYB 5F6KA 4INDA 2EF6A 2B39A 5ABJC 1EV12 1V6MA 1AX2A 3PVNA 2WNVB 1SQ4A 3I59B 4K8FA 2I45A 2OUHA 3ZXKA 4BLIA 4LNVA 1N3QA 3FUOA 2BEOA 3AZZA 3MFCA 4ATFA 3AZYA 2A5ZA 3FX3A 4LHNA 1RUJ2 1RUD1 2LALA 4KU8A 2ZX2A 3WCSA 3MIGA 2RJLA 1UW8A 5T55A 3DN7A 4FXGB 4BQ1A 1SFNA 1S55A 2BVVA 2ZCWA 5A32A 3AYCA 3ZYRA 2CGPA 1LOCA 5DUVA 3ZN6A 3D4KA 4BHPA 2XH6A 3CO2A 1H8TB 1T6GC 2VH9A 3I59A 4IEVA 1O7FA 1QKQA 4TYSA 1V9U1 1SEFA 2WS91 3V0BA 1G6NA 4BZ4A 2AZ5A 4RS5A 2BBVA 2X5IB 1JYCA 3MICA 4YZ5A 3GHNA 1LB2A 3FLTA 3B94A 3DUIA 1M06G 1Q8QA 5JAXA 1PO21 4YM1A 4ASMB 3RJ2X 1PGSA 3M3IA 3WG1A 3U10A 1RUH1 2H6BA 3KB5A 4AK3A 1PZ9A 3MLKA 2XUMA 5GZGA 2VUAA 5AC91 2GH8A 2MHFA 1GZWB 2ZTNA 4DQAA 3QCWA 5JPMB 1QJX1 1PVC3 4XTPA 3JBG1 4WM7B 5F1RA 1ZZ7A 1HQWA 1UN1A 2EXKA 2JE9A 1J58A 2HWD1 3OCPA 3WCRA 3N7LA 4QPGA 4XIOA 4KQ7A 1S0IA 5LRSA 3V64A 3ZSMA 1QWRA 1ZZ9A 3SH3A 3RSJA 2XL9A 1F5FA 1SCSA 5FQ0B 5C8CC 2DVBA 2VOVA 1DIWA 5JOYA 4UW3A 4IESA 2GC0A 2DCJA 3EQEA 1Z7S3 4BIOA 2BNMA 3LZZA 2JEMA 3ME2A 5CFDA 4GH4B 2ARBA 1O4YA 4B4RA 2RS53 1ZRDA 5JSRA 1AL23 1YJLA 2A3XA 4IEQA 3B02A 4P9XA 2TBVA 1DZTA 3OF1A 5KXDA 1BJQA 1C8M2 3ZFEA 4DB5A 4RQPB 2RMU2 1EV13 4FO9A 1NE6A 1OI6A 4HLTA 2HWE2 1PGL1 4YZ3A 4PJYA 1COV1 1JW6A 3ZFFB 3WD5A 5HXVA 2ZOEB 4OI1A 3WUCA 2A6WA 3BPZA 1I9RA 3ZVXA 3ZIWA 2WZR1 4XJ9A 4QGLA 3ES4A 2XG3A 1BZWA 3AB0A 1W6MA 3J8F1 2XKOA 1UPIA 4DY5A 2ZGRA 5CU1A 4COYA 2IFWA 1Q8SA 4CEYA 3JQXA 5BXXA 2RR13 5I0RA 4EN7B 3THPA 4OI2A 1REEA 2D6PA 3OBTA 5GZEA 3KGLA 2VOWA 1R081 4DNYA 1A78A 4DS0A 2ZGTA 2XVKA 4G9SB 2VNGA 1O5LA 4Y1XA 4JV4A 4WBBA 2YGMA 1IS4A 4QPGB 2D6NA 1QH7A 2PAEA 1CGPA 4LUMA 1WLTA 4C1WA 2VU9A 1N1TA 2RJKA 5J96B 1KDMA 4ZKTB 1TNRA 3NAPB 4GXLA 4FTSA 4L9BA 5FAXA 4GMP0 4H14A 5JOWA 5FO7B 3KT1A 1N1SA 2ZHNA 4TWTA 4YGDA 2HEVF 1H8TC 1D2QA 1LGBA 4E4ZA 1FOD2 3WDWA 3GZUC 4YM2A 1ZM1A 5J37A 1HRI3 1QY4A 1PO11 2BWCA 3VBHC 3OTFA 1J1LA 1R083 3NSTA 1EP0A 1GZ9A 4Z2WA 1S2BA 1PK6A 4YARA 4Q4X1 3E5UA 3TNPB 5I0TA 3USUB 2AGSA 1ZBE3 2DVAA 3MW3A 3WR0A 2XLFA 1R1A2 3OGGA 5T5OA 1VB2A 3MW4A 1AYM2 2EVXA 4FPJA 3ZX7A 4WVMB 3HT1A 1MS0A 4I0BA 3J9SA 4FPOB 3LOBA 3D5OA 4MH0E 2Z5WA 3OJBA 1W6QA 3ZFGC 4AEDC 3HMYA 1WW5A 1SBDA 3ZYGA 2D3SA 1LOGA 1RJ8A 2OPKA 3RYRA 4AVCA 3CL1A 4XXAA 1NZCA 2ARXA 3UJQA 2YUEA 1AX1A 2DUQA 2LUWA 3BCWA 3MYXA 4TLFA 2A3YA 2CYFA 3ALQA 2HJIA 4MYEA 3JZVA 2RE9A 3KS7A 3D8CA 4GKXA 1RUE1 1PM7A 1NE4A 2D6KA 4WVMA 4EN0A 1AL0G 4Q4V1 4UW6A 1BEV1 4OZXA 4X8NA 4LA3A 1C5IA 3RPQA 2YPJA 4OHWA 1VP6A 2HWB3 3USUA 4QXKA 1NY72 4OULA 2JKBA 1LOFC 4W6WA 3H3ZA 3SNMA 2ZMKA 4K7JA 1PGL2 4KBBA 2C0ZA 3MF9A 1R093 1BYHA 4XYXA 3WUDA 2ZZJA 3KT4A 1ZZBA 1WLWA 2UYBA 3VBUA 1U5XA 2DURA 2IXJA 3AP6A 1LKNA 2AYHA 1RUOA 5F5QA 2QJVA 3OYWA 3THTA 4YVWB 5CIRA 1OSGA 3FLPA 3WY6A 4MX3A 1NA1A 3J26N 3TN91 2B45X 3GBGA 4D94A 3O12A 2WFF1 1KQRA 2GNMA 4M0HA 5T5PA 2UU8A 2AENA 4GB31 1RTVA 3L2HA 3H1WA 3WVJA 2A6ZA 4Q1PA 1X82A 1DLLA 2E51A 3QLQA 4JQRA 1F9KA 3D82A 1AR92 1RUD3 2FMYA 5KXBA 3BTAA 4CP0A 2YDEA 2NM1A 2C9AA 5FTTC 1ZRRA 1J3QA 4J1WA 1KFUL 4Y1ZA 5H9SA 4FXKB 3PMEA 4CDUA 3LA2A 4Y22A 4LBQB 1GR3A 4XF9A 4AEKA 2R073 1RUNA 2D6MA 3AYDA 1H8VA 2BTVC 4WM7C 3VDDB 1ZZ6A 1IOAA 2ZJCA 3AKQA 5FRAA 1CJDA 1PK6C 5J7MA 4FPHA 3FFQA 1ZREA 5EZWA 1H30A 1V6IA 4YVSB 1LHVA 5A33B 3VBHA 1S2KA 1IS6A 4BOWA 4H7LA 1KS5A 4D69A 1DGRN 1S0FA 4YW3A 4N7IA 1WW6A 4MXWA 1OOPC 3WV6A 3H50A 4AHZA 4M0NA 1Y9QA 1W6NA 4R4ZA 3P3PA 1KDKA 1XE8A 2EXHA 4XF1A 4COVA 4NOTA 4RL7A 4LBJA 3NV4A 1VBC1 4YGCA 4XFBA 2R071 2DCKA 2K0GA 4IEZA 4Y22B 4Y5Z0 3BODA 4CDWA 3VGIA 3WW1A 5DUUA 3RG0A 5KHJA 1QNWA 3BU7A 1KXGA 4C91A 4AFCA 2O8OA 1E57A 1W6QB 1YHFA 3AJZA 3O0WA 4FT8A 4YGBA 1H0BA 3N4MA 4OLLA 3ZFFC 4WZCA 1B35A 1JHNA 3GBWA 2A6XA 4NN0A 1DHKB 5KC6A 3MIBA 1SACA 4XXPA 5T52A 2WT2A 3I2DA 3MDPA 4IETA 4O9GA 5GLWA 5EYXA 4HPKA 1ZBA1 1S0CA 3A4UA 1CQ9A 2PLV2 4FSJA 2PELA 3R05A 4L2NA 5TSWA 4HSLA 5C8CB 1LU1A 2YMZA 2CY6A 2V09A 3VV1A 1H2LA 4MGZE 4MZUA 3WQ1A 1AYN2 3R4DB 2F6BA 3B9IA 1W6OB 5HCAA 1ZX5A 2WZR3 2WLPA 5J36A 3ZSKA 1RUE3 4IV3A 1O4ZA 3WDXA 2UYAA 3E5XA 3LSDA 5H9QA 1UF2C 3RMXA 3ZFEC 2A6YA 4AFMA 1HDKA 4E4DX 3ZXGA 4E9KA 2NQYA 1MS5A 3SCHA 3KQRA 1S0JA 2XHKA 3VZOA 2ZGUA 1NLRA 1HV0A 3MFAA 4UBHA 2B7YA 3ZN4A 4K1YA 4FPCA 4CDQB 1CAXB 2GC2A 1PVXA 3KCCA 2R061 4XJZA 1Y43B 4HMZA 4OHVA 1PIV2 4FQ4A 1VBD1 2IZWA 1X50A 1YFXA 2MEV1 4AF9A 1W6PA 1HRV1 1AXYA 1CPNA 2HEWF 4I01A 4ITCA 4MUVA 3M3CA 4DXZA 4NWWA 2RM23 4LT5A 1OA4A 4XHXA 3AZVA 2HWF3 1V70A 5LRRA 3WQ0A 1OA2A 3NAPC 5CAZA 1K5MA 1LENA 2RS32 1MEC1 2JDZA 4LTAA 3ENRA 4WM8C 4OUSA 4D7YA 2V5YA 5FMOL 2KM2A 1TMF2 1RUH3 4FOQA 1RUH2 1YXWA