3KM5A

Crystal structure analysis of the k2 cleaved adhesin domain of lys-gingipain (kgp)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
179
structure length
179
Chain Sequence
GSADFTETFESSTHGEAPAEWTTIDADGDGQGWLCLSSGQLDWLTAHGGSNVVSSFSWNGMALNPDNYLISKDVTGATKVKYYYAVNDGFPGDHYAVMISKTGTNAGDFTVVFEETPNGINKGGARFGLSTEANGAKPQSVWIERTVDLPAGTKYVAFRHYNCSDLNYILLDDIQFTMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Lysine specific cysteine protease
publication title Structure determination and analysis of a haemolytic gingipain adhesin domain from Porphyromonas gingivalis
pubmed doi rcsb
source organism Porphyromonas gingivalis
molecule tags Cell invasion
total genus 48
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07675 Cleaved_Adhesin Cleaved Adhesin Domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3km5A00
2P3IA 2A6VA 1KJRA 1V6KA 4FQ4A 1KDKA 2WSUA 1QF3A 1W0OA 2A6XA 3ILFA 3HMYA 1S0IA 2DYCA 2A3WA 3RS6A 1LGNA 3JU9A 1IS3A 1KDMA 4L8QA 4Q8KA 4OZXA 3FLTA 1AX0A 2A6WA 4GALA 5F9TA 4FOVA 1GICA 1CR7A 1ULGA 2AUYA 3WDXA 3WV6A 1YYNA 3DGTA 3WOGA 5KXCA 3R05A 3TAYA 1G9BA 5H9SA 2ZMLA 4XHBA 1QOTA 3WDWA 1GZ9A 1N1SA 2D6LX 1GV9A 3NV2A 3WUDA 1Q8PA 4K1YA 2GNMA 5IUQA 3OPZA 1WLWA 2CNAA 1QDCA 5GLTA 3PJQA 5GLVA 4GWMA 2D3SA 2I2SA 4C1WA 2VU9A 2A7AA 2ZAAA 5GZCA 3BIWE 2W68A 1I1EA 1Y7BA 1Z0HA 3ZSJA 5GM0A 2UWAA 2E53A 4XYXA 1BXHA 3ZYRA 3SISA 2ZA9A 1LHVA 4YGBA 1N3PA 2ZGKA 3AZZA 4Q1RA 1AJOA 4XJ8A 2D43A 4MYEA 1DQ6A 2DVDA 1MR5A 3N7JA 2CWSA 3PVNA 4WZFA 3O12A 4BMEA 4XXAA 2GNDA 4GKXA 4XBNA 2ZGLA 4YG3A 2OW4A 1A3KA 4Y1YA 5GZDA 5T5JA 1QGLA 4Y1VA 4BOWA 2YV8A 4RL7A 2R1BA 3AJZA 3T2TA 1W6PA 1BQPA 1LHNA 1LU1A 1Q8QA 3FUQA 1BYHA 3RRDA 3I4IA 4RA0A 3ILNA 4AGRA 4LBLA 2ZGRA 5IT6A 4XILA 3BODA 2YXSA 5H9PA 1IS6A 2ZHLA 2ZKNA 3INAA 3RSJA 3FFZA 5DG2A 4XBLA 3N7MA 5GLZA 1G9AA 3ZXEA 2A3XA 1KRIA 4AVTA 1O4YA 1GZWB 1QOSA 3AP9A 3WDTA 2DU1A 1H9PA 1JYCA 3SH4A 1KQRA 1LULA 1NLSA 4PBOA 5IK4A 1CESA 2A75A 3LSDA 2DVFA 4YM2A 1JW6A 4AGVA 1O4ZA 1MS8A 3BOPA 4ISQA 3POSA 3M3CA 3A0KA 1LTEA 4GWNA 2KM2A 4UW3A 1AZDA 3MPPG 1W6QA 1ULCA 1DYPA 1MACA 4XZPA 2ARXA 2PHFA 3WDUA 1N47A 1S0JA 4FP2A 4Y1XA 4YZ4A 1H9WA 2A71A 2E7TA 3T1MA 2ZHNA 5GZEA 4XIKA 1DBNA 2DWRA 2ARBA 3N3HA 3USUB 3H0OA 1JUIA 1LU2A 3OY8A 4R9BA 5GLWA 4Y24A 4YW5A 4YM0A 1CVNA 1RIRA 1S1AA 2V5YA 2CY6A 5BYNA 4R9AA 2AREA 3I8TA 2VXRA 2JECA 4H55A 1N1TA 4CTEA 5KXEA 1AXKA 2WQZC 2AGSA 1SBFA 1SLBA 2P3JA 2D6KA 4LBQA 3ZXJA 3OJBA 1UPSA 4FQZA 2ES3A 5DUVA 4Y22A 3ASIA 1DHKB 3AJYA 3ZXFA 3AZWA 3RQ0A 1D0HA 4YW2A 5HCFA 1LCLA 3RMYA 1HQLA 5DZEA 3WG2A 4R9CA 2AYHA 3GALA 2RHPA 4ASMB 1AX1A 1CIWA 4UW5A 3MEPA 2JE7A 4UW4A 3D5OA 1BKZA 5DUUA 4ZKTB 3ZSLA 1FAYA 3R4UA 1FX5A 2GNTA 1DQ0A 1LOGA 1MVQA 1N1VA 4F83A 1W6NB 2A6YA 3AP4A 2R49A 4FOYA 1V00A 3IMNA 1S0EA 5KXDA 2GMMA 1FNYA 2GMPA 1V6IA 1AXZA 3SH3A 1W6OB 3IPVA 3POWA 2VW0A 3WNXA 3AYEA 1FV3A 3WG4A 5IK8A 3AYCA 4JC1A 1JXNA 2ZGOA 3R4SA 1DFQA 2A6ZA 1G86A 2SBAA 1V6NA 3OYWB 4YW3A 1FNZA 1ENSA 4LBQD 4XMAA 3ZYPA 1ZA4A 1JOJA 4YGCA 4DQAA 3FUOA 2PHRA 3NWKA 4JRAA 4U36A 4XDQA 4BPZA 3B01A 1F31A 3ZSMA 2OUHA 2P3KA 1AX2A 3AK0A 4Y20B 2W52A 3WVJA 2AR6A 2R1DA 5T55A 2OVUA 3O5SA 1S0CA 5DZGA 3W58A 3A4UA 4SLIA 1DIWA 5JOWA 2ZGTA 1HKDA 4M00A 1C4RA 2D6NA 1IOAA 2E51A 1Q8SA 2DUPA 1MS5A 3B9CA 3POYA 1N3QA 1YXWA 2WSVA 2GN7A 4NOTA 4PQ9A 2WJSA 4XIOA 1DYKA 1MVEA 4M01A 2A3YA 2P2KA 1SCRA 2E7QA 4ISRA 2CWMA 3WCSA 4P14A 1C1FA 3RG0A 5T54A 2NYYA 2VH9A 1YRZA 1CQ9A 4I30A 1W0PA 4AVVA 2GN3A 1AF9A 1F5FA 5DZFA 1CPNA 1W6MB 1URXA 1IS5A 1MZ5A 2EXHA 4DPNA 5CAZA 1KJLA 1SLCA 4PBPA 2D3RA 4NO4A 4M3CB 1Q8VA 1DGLA 3NV3A 2Z42A 3O0XA 5EYXA 2JKBA 3GNEA 3Q9OA 5IK7A 2DTWA 1NXD1 4IQPA 1HLCA 1HDKA 1QNWA 1SLIA 1AJKA 1S0FA 2EALA 2PHXA 1PZ8A 3D6EA 4GXLA 4KBBA 4FPGA 5CA6A 5IK5A 3FBYA 2ZABA 1ENQA 3WDYA 2GMEA 2A70A 2DVBA 1MS4A 2VW1A 3LSEA 4ZXKA 1A8DA 4YM3A 4K21A 3WZ1A 1MS9A 2B7YA 4XOGA 5EXOA 4FOWA 1B09A 4WV8A 1ULFA 1YI7A 1WW4A 5JVVA 4AGGA 2LALA 4FPYA 5CNAA 4FPOB 2UURA 2D6OX 5EWSA 3UJOA 3ZXKA 3PMEA 3AFKA 2EAKA 3V0BA 1GLHA 3V0AA 2R0FA 3AZYA 4FOQA 5GZGA 5H9QA 4YZ2A 2A5ZA 1A78A 4PCRA 4YLZA 1KITA 4YZ5A 1GZCA 3ZSKA 1FATA 1LECA 1CN1A 1OKQA 1GBGA 2G4IA 3NV1A 5H9RA 2PHUA 3NV4A 4YW4A 3T1LA 2GDFA 1XQNA 4XHXA 4DFSA 1GKBA 1ULDA 1GSLA 1ONAA 2JDZA 2GNBA 4FVVA 3W59A 4AYUA 1N3OA 1Q56A 3ZVXA 5CB7A 4LBOA 5JOZA 4YW1A 3OBTA 5GLUA 4GA9A 3WCRA 1QKQA 4ITCA 2ZZJA 1SLTA 5HCBA 1V6LA 1W6PB 1WD4A 2DURA 3SH5A 2GALA 4BMBA 4XJUA 2NP0A 1G7YA 4CRQA 1LOFA 1SLLA 2JJ6A 2LTNA 4D69A 2YZ4A 1SFYA 2C5DA 2XG3A 4TZDA 1DQ5A 3AZVA 4K20A 2ZHKA 5L73A 3V64A 4W65A 5DUWA 5DG1A 1SCSA 3KQRA 3IKWA 4JCKA 2FMDA 3QCWA 4M3CE 4FPJA 1LEDA 4Y26A 1GNHA 4P9WA 5AVAA 1QMJA 1WLDA 1CPMA 3O0VA 5FRAA 1S0DA 4PF5A 2AENA 1W6QB 1DQ2A 2TEPA 4Y1ZA 5E89A 3ZXLA 3M2MA 1QOOA 3VKLA 1WW7A 3MW4A 4XE9A 3HR9A 2ZGSA 4WVWA 1V6MA 3ZPYA 1PZ9A 2NMOA 1MZ6A 3SITA 3N7KA 4FPHA 2WT0A 4YGDA 4YM1A 2YROA 4XTPA 1SBDA 1QNYA 1OFSA 2DVGA 2W39A 2E6VA 2OUJA 4XTMA 2R16A 3OY8B 2CL2A 2DUQA 4Z8BA 1I3HA 1S0GA 2PHWA 4LBNA 4XBQA 1LGBA 5GALA 3KM5A 3C2UA 4YZ1A 5T5OA 3V65A 3DUIA 1BZWA 2D6MA 4YG0A 1BJQA 3VKFC 3M1HA 4LBQB 4AVSA 1JBCA 1LOCA 2PHTA 4M3CA 1UL9A 3B69A 4Y22B 5LK5A 1LODA 2WNEA 2ZGMA 5E8AA 5T50A 1APNA 3APBA 1QDOA 2C9AA 4BM8A 1JHNA 3JUUA 1LENA 2XB6C 3AYDA 4CZSA 3AP7A 3QLQA 1F9KA 1C57A 4M3CF 4XJWA 1RITA 2EXJA 2WT1A 2VW2A 4U2AA 1LOEA 1VIWB 2JE9A 2UWCA 1QU0A 4GKYA 3IM0A 1TEIA 1LOFC 2DTYA 1SACA 3IN9A 1LESA 3M3OA 1Q8OA 3M3EA 5T52A 4ATEA 1SBEA 1WCSA 1MS3A 3SLIA 1DQ4A 1CONA 1GZWA 3AZXA 5F5QA 1H30A 2EXIA 4HANA 5GZFA 5CBLA 1LJ7A 1GYKA 1AVBA 1C1LA 1DZQA 1UZZA 2NZ9A 2SLIA 2DU0A 3AX4A 2ERFA 2NM1A 1WW5A 2UWBA 3IPVB 3ILRA 2DVAA 5JLVA 2VUAA 4XJZA 4P9YA 1LEMA 1IS4A 2FHRA 4FPCA 3VKMA 2JD4A 1WBLA 1WLCA 4Y1UA 1UKGA 3WUCA 1YIFA 1UZYA 1VAMA 2H0BA 3B00A 5E88A 5FREA 1LOAA 1FYUA 4AWDA 3A0NA 3USUA 2EXKA 4FPKA 1JYIA 4XJ9A 3WDVA 3VV1A 4Q8LA 1AXYA 3L2YA 1G9DA 1GNZA 4Q26A 2ZMKA 3WG3A 4FP3A 2ZGNA 1Z78A 2WKKA 3MW3A 3N7LA 2D7FA 4TYSA 3D4KA 4YGEA 4YFZA 5DUXA 3AP5A 4LBJA 3WLUA 1X50A 3AP6A 3WHTA 1FV2A 1IKQA 1N1YA 1V6OA 1OQ1A 3UK9A 2ZMNA 1UN1A 4WVVA 2ZGUA 3AXEA 3FLPA 1U0AA 1UX6A 3SNMA 3PVOA 2EIGA 1UAIA 1WW6A 4FPFA 5KXBA 1ENRA 2AH2A 5DXDA 1HQWA 1SLAA 3WG1A 2ZBJA 1G9CA 2ENRA 3UJQA 4Q2FA 4DRRA 1WBFA 4XJAA 4DS0A 3FLRA 3N36A 1ZM1A 4XXPA 1GANA 3UL2A 1LOBA 2YMZA 1W6NA 4YZ3A 4Q27A 1YO8A 2ZGPA 3PVEA 1LGCA 2WT2A 1MS1A 3VUOA 4UW6A 5JOXA 4C1XA 4XMIA 4HL0A 2W08A 1VLNA 1W6OA 2EF6A 1IKPA 3O0WA 4K1ZA 5T5PA 3BTAA 4BLJA 5JDBA 1R1ZA 4LBKA 2CTVA 5JMCA 1D2SA 1WD3A 3AXDA 4DRVA 2DUOA 5SV8A 2D44A 2Q5TA 4R9DA 3OYWA 1ULEA 3VKNA 2R0HA 2BQPA 3OGGA 1VALA 3CNAA 2V73A 4Q1PA 4YG6A 2UU8A 4YFWA 3N35A 2CYFA 2PELA 1WUVA 1UMZA 2YY1A 2ZGQA 4Y20A 5JOYA 3V0BB 4BLIA 1G9FA 1JN2P 3V0AB 3TB0A 1RINA 1CJPA 3AYAA 5GJ6A 2DV9A 4P9XA 3U4XA 3M3QA 4LBMA 1PZ7A 2P37A 1LHOA 3RMXA 1J1TA 1MS0A 1S0BA 2NMNA 2D3PA 4FPEA 4FPLA 3B3QE 5T5LA 1LHUA 3WHUA 3ENRA 1G8WA 1EPWA 5EYYA 3VKOA 3OBRA 4BQ1A 1DQ1A 2NN8A 1V6JA 1LHWA 2ZACA 3MW2A 3LCPA 1DLLA 2VY0A 2WLQA 2ZHMA 2HYKA 3ATGA 5HCAA 1W6MA 1VAVA 4ATFA 2D6PA 2P34A 3HN1A
chains in the Genus database with same CATH superfamily
1COV3 3VBHB 1OOPC 4FQ4A 5EJZB 1KDKA 4FTEA 4K6BA 1QJX3 1QF3A 3F2ZA 1UOGA 3ILFA 4HSLA 1RUJ3 2DYCA 2A3WA 2VCMA 1KDMA 4AEJA 4D6SA 4Q8KA 4Y5SA 5FY9A 2ILMA 4CCMA 2Y0OA 3R0RA 5DAVA 4FOVA 1REEA 5F9TA 1W04A 4LLOA 4Q4W2 1BMV1 2RR12 1ULGA 1VB2A 3ZPOA 1NYWA 1BBT2 3MIEA 4JDOA 1NZCA 3WOGA 4JTOA 1G9BA 1GMMA 5FMCA 3NAPC 3WDWA 1P8JA 5B4NA 1GZ9A 3IDBB 1K5MA 1GV9A 3WUDA 1Q8PA 3WP6A 3RPQA 2VOXA 4W50A 4ARYA 1RL3A 3LB9A 4N53B 4BB3A 1X8EA 4QPYA 1QDCA 3OUJA 4GWMA 2HKXA 1V0AA 2A7AA 1W8WA 5ACA3 3BIWE 2VQUA 1W8OA 3VGIA 3S0MA 5FPAA 4AAPA 3AKTA 2UWAA 3GF6A 1BXHA 4UFLA 2QUOA 5CISA 1AYN1 2VBDA 2PYTA 1O59A 3AL5A 4DUVA 1Q43A 1XU1A 2RDQA 4YGBA 1T6GC 1YCIA 2QE3A 4AE2A 5KC6A 4Q1RA 2C0ZA 5IAVA 5BNOA 1BVVA 1DQ6A 2DVDA 2XLAA 1WA4A 4K8FA 5JXJA 1OUSA 2ZGLA 4YWAA 2VC9A 4YG3A 4LHLA 3PUSA 4QX3A 5KHGA 2Y26A 3OGJA 5DABA 4CUCA 3S30A 1LRHA 2VMHA 1AYN2 1LHNA 1RVF3 5FWJA 1ND3B 4LKEA 3RRDA 3BU7A 2J42A 3OEAA 2VQAA 4LBLA 1UY2A 4NE9A 4XILA 3BODA 5I0UA 5FZ1A 1H4GA 1H6XA 4QQHA 3KVBA 4J6GA 2VNRA 4A42A 4OUEA 3INAA 3RSJA 1OT5A 4WM7B 1W8NA 5J1XA 1CAWB 1POV3 1YFWA 1FOD3 2A3XA 2OA2A 3WP3A 1GZWB 3ITQA 2DU1A 5IW0A 1JYCA 2LM3A 1MZFA 2BV4A 1LULA 4XEZA 5LRSA 4DXRA 5I8TA 1BEV1 3LSDA 4YM2A 5IAXA 4MG2A 1O4ZA 2WO7A 1MS8A 3BOPA 2Q1MA 3EQEA 4ISQA 2ZX0A 3A0KA 2KM2A 4IEZA 4UW3A 1AZDA 3MBWA 2X29A 1K5MC 4W4ZA 5LZ6A 4XZPA 2PHFA 2ZTNA 3WDUA 4BQXA 5D1IA 3GGLA 4FP2A 4YZ4A 4DXZA 1H9WA 2E7TA 2JD9A 2QQIA 2L9LA 2ZX2A 5GZEA 1W99A 1DBNA 1RUF1 2DWRA 2XWJB 1OBNA 3N3HA 1BEV2 3GYDA 5J7MA 3DYOA 3CEWA 2WNOA 1EY2A 4YW5A 2YGLA 3HD8B 4IEVA 3WF3A 1S1AA 2BPA2 4AFBA 2CY6A 2GH2A 2HWC2 4AHXA 2AREA 4CTEA 3HVDA 4BIFA 2AGSA 4LBQA 4XFCA 1PX3A 2D6KA 2VOKA 3BN6A 4QGMA 3ZXJA 4BQ4A 3ME2A 5A1FA 2WZR1 5FY7A 5BNOC 1DHKB 3ZXFA 2Q8OA 1UXZA 3AZWA 1UYPA 5C3PA 3UGFA 2DFBA 2YFZA 3KSCA 5HCFA 3LQCA 1HQLA 2YDEA 5DZEA 5FLIA 2AYHA 5FYZA 1RUC1 2RHPA 3GZAA 3LEIA 1AX1A 2ZEZA 1RGSA 2HWD1 2R071 1GWMA 2JE7A 1RUH3 1TMF3 4UW4A 3O1MA 5B4XA 3O1TA 3D5OA 3WP5A 5EZWA 5DUUA 4OI4A 4ZKTB 2P1BA 3AMQA 3ST7A 1PMJX 2R063 3MIHA 1ASJ3 1LOGA 4F83A 1W6NB 2GAUA 4LK7A 5JR7B 1YUDA 1DZTA 1RUC2 2XGXA 4HPKA 5JMOA 2GMMA 1RUE3 3SH3A 1V6IA 4QDRA 1W6OB 2EICA 1DYOA 1I9RA 3MIBA 3O1SA 2Y60A 1AYM3 3DYMA 3AYCA 2XLFA 3S7IA 4LE3A 4AK3A 2JDYA 1RYYA 1DFQA 1JUHA 4K3UA 1G86A 2ET1A 5LBEA 3TNQA 3I49A 1FNZA 1ENSA 1R081 2Z5WA 4P9GA 4HKWA 3BKZA 1BLZA 3MDPA 1YI9A 1YQ6A 3DXTA 3VZJA 1R64A 1F31A 3OGSA 3WVJA 4LLFA 2Y6LA 1HW5A 1QJEA 2R1DA 2QVSB 2VTXA 1QQP1 3DV8A 3S7EA 4A41A 2XWBB 1QJZA 1FMD3 1S0CA 2QQVA 1IPSA 4OHZA 4JGYB 1C4RA 2VBPA 1R082 4C90A 1IOAA 2QQUA 2VVDA 2VJXA 1MS5A 3JZVA 4QXKA 3B9CA 3VHNA 5FZHA 4HKOA 1HB3A 4XUTA 4EZHA 2E26A 1XRUA 2GN7A 2WSVA 2XQXA 2MPFA 4NOTA 4AHYA 4D8MA 3MI8A 4AI3A 2E9QA 4M01A 2A3YA 3PURA 2E7QA 1D2QA 4JVAA 4XURA 2KXLA 1O3TA 3RG0A 1AR71 5T54A 3PIGA 3WW2A 1L7QA 3K4DA 1AR81 1CAWA 1QJU2 1NAEA 5DZFA 4AI0A 4QHBA 4RYDA 4J1XA 1XOYA 4CDQB 5IWFA 2VZ1A 2LW8A 1IS5A 5FYSA 5AC92 5FDBA 5CAZA 1SLCA 4PBPA 1WGPA 4QX0A 3WX5A 4BJ0A 5FR3A 1H8TB 3VBRB 1SDDB 5CEHA 3NV3A 3O0XA 3TOJA 3JB8A 5EYXA 2FDFA 1NOVA 4R8HA 3LOIA 1AR72 4HVRA 1HDKA 2EALA 1SLIA 3KT4A 2PHXA 4GXLA 4UI9L 2W2IA 3IB3A 2HWE1 2RDRA 4FPGA 5M0TA 5DPNA 1VBC3 5FZCA 4CCDA 5LATA 2W92A 3LSEA 4IGQA 1ULPA 4ZXKA 4YM3A 4B29A 3WZ1A 4XOGA 4TTGA 5EXOA 4TN7A 4FOWA 1UPIA 5KHJA 4IV3A 3RWNA 4CU8A 1OUXA 1YI7A 4OMDA 1QJY3 4WV8A 5BV6A 1R093 4FPYA 3UJOA 3VDDA 4OUMA 3OGVA 4AR2A 3WNMA 1PIV3 3OUIA 1LR5A 3AZYA 5CFCA 2H6BA 3L2HA 1W05A 1J3QA 2XUEA 1VMHA 2A5ZA 5A32B 1MEC3 1KITA 3ZSKA 3VD4A 3AFGA 1RHI3 1B35A 1CN1A 1OVSA 2GSYA 1OKQA 2ZOEB 5H9RA 4CXWA 3SHRA 3NNLA 5J3UA 4XHXA 5B2GB 2E63A 1GSLA 4LR4A 4FVVA 1CAUB 4IE7A 4AYUA 4QWNA 4J1WA 4HFSA 4MXWB 1XNCA 1RMU1 1SFPA 3H3UA 4ZY9A 2ZX3A 1U5ZA 3DN7A 3OBTA 2WN3A 4GA9A 2RDNA 4Q5OA 4KG8A 3ZYBA 4CCEA 2P17A 3FHAA 1W6PB 4CXXA 4JRLA 3ACIA 4CVUA 1W2UA 2RS11 2NP0A 5BPXA 4XUPA 3ORJA 1LOFA 1JYNA 5C5UA 5LBCA 1GNYA 1SFYA 2G9GA 4FFFA 4EN0A 1X9PA 1IHMA 1AL21 1RMU2 2BERA 3AZVA 3VN4A 2WS91 2B4KA 3PTRB 4OHYA 5LA2A 3DCQA 3HQXA 3JBG2 1SPPA 2CDOA 4JCKA 3OTFA 4BE3A 2K2SA 5E6HA 5I0RA 3TEZA 1PO11 4IEYA 5CADA 2RS12 4P9WA 1OH4A 1RUI2 4Y5TA 2AEZA 3X29B 1WLDA 2VZSA 5KBFA 2XHNA 3KV9A 2FBEA 5FRAA 4JGYA 2AENA 1AL22 1NE6A 3B7MA 4IV3C 5F39A 5F8PA 4Y1ZA 2CAVA 2Y6HA 2WS92 4A44A 1QOOA 3VKLA 3VDDC 1ZBE2 2ZGSA 4Q4W3 3ZPYA 2RR13 3N7KA 2VCCA 1BBT3 2YROA 4E4SA 4I02A 3RFRA 1OFSA 2DVGA 2OQ6A 2E6VA 3DECA 4XAAA 3ES1A 2BFUS 5EJ3A 2PHWA 4ES9A 3PIJA 1LGBA 1B35C 3KM5A 3U75A 5L7OB 4I2OA 3BOWA 3KS7A 4AFMA 2VULA 4WVMA 4YG0A 5FZDA 4EYUA 3IDAA 1RUD1 1J58A 3MICA 5FQ0B 3GCWA 1JBCA 3VBFB 4OHXA 2FD8A 1LOCA 2R32A 1L7LA 4JDNA 4Y22B 2BUKA 5HCHA 3TN91 2WNEA 2ZGMA 4LOSA 5E8AA 5T50A 5A70A 3FMGA 3GHMA 4FBFA 2AEYA 1JHNA 4HXCA 3CLPA 1UF2C 1YJKA 3QLQA 1F9KA 4DXTA 1W8FA 4JTNA 4XJWA 1PGL2 4W6WA 3NNJA 2LUWA 4LT5A 1VIWB 1RUD2 4HONA 4CA9A 4PLMA 1OSGA 1OA3A 1HJFA 2IXKA 1TEIA 1LOFC 1OHFA 5A7WB 5F6LB 1Q8OA 3D0SA 4Q0SA 4ATEA 1X82A 3C7EA 1DCSA 1CONA 3AZXA 3W5NA 4HANA 1HN1A 1AVBA 1C1LA 1UZZA 1W2OA 1EV13 1TME1 2DU0A 2UWBA 1WW5A 5ABJA 4R4XA 3ILRA 2DVAA 3KF3A 2VUAA 5FZKA 3THPA 4E8CA 1WZXA 5JIAA 3AMPA 4XUOA 2FHRA 4Y4YA 3VL8A 4FPCA 4LXLA 3VKMA 1WBLA 5IVVA 2VO5A 1SDWA 2EIDA 5C8WA 1UZVA 3ZFEA 4CP9A 3SCHA 2IVJA 4JGYC 1YIFA 2ATFA 1UZYA 1VAMA 4ZU5A 3B9IA 1LOAA 4V1PA 1FYUA 1EAH1 3ZMOA 1KGYA 1VRH1 4QXCA 3WXPA 2EIBA 2JDPA 4AWDA 4UT5A 3DPRA 3USUA 1TME2 5KHIA 1PVC1 1UW8A 4A7YA 3C7GA 5JCTA 1CAUA 1G9DA 3UKTA 4AHWA 3WG3A 1IG3A 2W91A 2XBO1 3WEZA 5F5CA 4TYSA 3BALA 2YC2A 2ZX1A 1CZTA 5DUXA 4DINB 3AP6A 5E1RA 3ZIXA 1IKQA 4AVBA 1N1YA 3HBKA 5CG8A 3GDBA 4B3NA 1EAH2 4AOCA 1VRH2 2V72A 2GC0A 3SMHA 1JOPA 1NCQC 3I2OA 4UFMA 5C3QA 1UY0A 2D93A 4PI2A 3DEMA 1W9SA 2ZCWA 1JYWA 2YGMA 4QGNA 3SNMA 1V9U2 3ZN4A 2EIGA 3PNAA 1ENRA 1OF4A 4RN5A 2R30A 1ZNPA 1SLAA 3ZR6A 1OPOA 4PLNA 1NQJA 1UOFA 2HWC3 3R6SA 4XJAA 1CJDA 2BP6A 2CV6A 1XBFA 2CSGA 3UL2A 4CCKA 1LOBA 1YO8A 1ZRDA 5L9BA 1IPKA 5FKBA 4X8PA 2RV9A 4UW6A 4BXSV 2Y0IA 4HL0A 1JYXA 2CDPA 1VBB3 2W08A 2EF6A 1IKPA 3WNKA 5K7PA 1H6YA 1BCXA 3UV9A 4LBKA 2CTVA 5C4WA 1UY4A 5HI0A 1D2SA 3H1YA 5CFCB 5A6XA 2DUOA 2UYBA 3POBA 5SV8A 3WR0A 4IESA 2VZ3A 3OYWA 5ABJC 1WWYA 4WZCA 1VALA 2E33A 2VVFA 2XVKA 4KGQA 4XFGA 5HV0A 1OKOA 1UYYA 1ZZCA 5FY1A 4YFWA 3T4HB 3DF0A 3CU7A 3VBSB 3ZFEC 4DO0A 2JICA 5I8YA 3CJIA 5IFTA 4S2GA 4NVPA 4BLIA 1G9FA 1JN2P 1A34A 4B4PA 4GB32 1JU3A 3DPRC 5GJ6A 4P9XA 2PAEA 4Q0QA 5HBAA 2P37A 1F5JA 1J1TA 2NMNA 2A1XA 4F8AA 4COUA 4FPEA 1IG0A 2WL1A 2BGOA 3B3QE 1LHUA 2QQWA 3J4UH 2W47A 1PK6A 1F15A 3E97A 5FZ6A 1PNFA 2VZOA 2B9UA 1CD3G 3VKOA 5C70A 5HPOA 3T0AA 1X9TA 1Q5OA 2RS52 4HN0A 4QKFA 4PDWC 4LTAA 3MIGA 1LHWA 4F7ZA 4K7JA 1SQ4A 1WMFA 2OT7A 3LCPA 2WLQA 3H7YA 2HYKA 5FJKA 2UY8A 2RM22 3FE5A 1JZ7A 3I59B 1OA2A 2VD7A 2P3IA 4EN7B 3G7DA 2Q1FA 1R083 4GMP0 2RS31 4IEWA 1V6KA 2CGPA 2JB8A 4PJYA 4I3GA 3HMYA 1S0IA 4CDUB 3RS6A 1ZBA2 3ACGA 1XSQA 3ZN6B 5A7SA 4UWDA 3J8F2 3J7HA 1ZREA 2ARCA 1GOFA 1CX1A 1OLMA 1XE8A 4PT6A 3EBRA 1QJU3 1YYNA 1F8VA 3DGTA 3VZOA 2RS32 4EN6B 4JGZB 1AR61 4XF3A 5C4WC 3O7OA 4XHBA 3RZKA 5A3NA 1NUKA 5AC93 2OX0A 5FYTA 3WF2A 3NV2A 2GNMA 2IXIA 3OPZA 3OCPA 4YVWB 4A6OA 4Q4X1 1W3XA 2X5IB 3JXSA 1STMA 2WDBA 5GLVA 2I2SA 3NKGA 5FJHA 4C1WA 3VDBA 5FZGA 3CJIC 2VGDA 4P08A 5FK7A 3JD71 3BB6A 5L19A 1AR62 5DAWA 5GM0A 4COYA 1HIXA 1AR92 4I0BA 2E53A 3NKTA 3ZYRA 3SISA 2ZA9A 4CUGA 1H2LA 1XJAA 3ALQA 2OXBA 2HWF1 3Q8BA 2BGPA 2JDAA 2EA7A 2IZWA 3SEEA 2QQPA 4XJ8A 4KH9A 3N7JA 3KQ4B 3WF1A 1PK6C 2CWSA 1QH7A 3NRUA 3BIEA 1GP4A 4XBNA 3LFMA 3VD7A 2QQMA 4QX1A 2OW4A 1A3KA 5GZDA 5T5JA 4Y1VA 3QH6A 4AG4A 3VZKA 3AM2A 2H0VA 2X05A 5LB6A 4RL7A 2R1BA 3AJZA 4YSFA 1BQPA 1LU1A 3EJKA 4JV4A 3FUQA 1BYHA 3WT3A 3I4IA 4RA0A 3KHBA 1H4HA 4Y4RA 3L9JT 4I0WB 4XQ4A 4Z2WA 3LE0A 1WMEA 2QQKA 2WAAA 5H9PA 1IS6A 2YG0A 2WFF1 4JKLA 1G6NA 5A80A 2IFRA 3FFZA 1GU3A 2YFUA 3GJAA 4UFJA 4IEPA 5DG2A 1GOGA 1MQTB 5C6CA 4BA6A 1XB9A 3NVCA 4AVTA 4KWUA 4YVSA 1QOSA 1YQ5A 3MO4A 2ADEA 4MGIE 5IJRA 1CAVB 1XE7A 3OF1A 3AKQA 4QPIC 1KQRA 4PBOA 5IK4A 2VZQA 3PMSA 2NLRA 2XL9A 2QKDA 3ZYGA 4NPLA 5CG9A 3JQXA 3I3MA 4N43A 2WFF2 1WMDA 3MPPG 1ULCA 2ZEYA 1MACA 4FXGB 5FK8A 4GIQA 2Y34A 1N47A 2KD7A 1VBD2 3VBUA 2A71A 5JPMB 1RMU3 1LB2A 3MUY1 2ZHNA 3ZFFA 1H2MA 2OPWA 1W0NA 1J59A 2BWCA 2W46A 1IQAA 2QNKA 2ARBA 3JBG3 3N9MA 5LCWL 4XUQA 1LU2A 1W03A 4X8NA 5GLWA 3FJSA 3DYPA 1RIRA 1R1A2 1EYBA 1RUI3 3H8UA 4FXKB 4MUVA 4H55A 4CUAA 1HXS1 4SBVA 5FPBA 4L0PA 5BUVA 1AXKA 1SLBA 4JZRA 1RUG3 3PUQA 3OJBA 4K8RB 4FQZA 3POJA 1J83A 4IETA 5FY0A 1ZBE3 2X53S 4PHZA 3RQ0A 1CWPA 3M70A 3RMYA 4Q0PA 1OFNA 1S55A 4QX8A 4XFIA 5F3EA 1CIWA 1MZEA 4UW5A 2Q8DA 1J1LA 3MEPA 5AFEA 1NQDA 2FDJA 2ZPXA 4GJYA 1HXS2 3TRSB 1UY1A 4QDSA 1BKZA 5FZOB 2DCJA 3ZSLA 4CEWB 4D6QA 4HOOA 1FX5A 1DQ0A 3I7DA 2JDHA 2PHDA 4CDQA 2K46A 2A6YA 2B45X 4BZ4A 4ZZ8A 3OBZA 4FOYA 2X5IA 1V00A 4UOJA 3ZN5A 5KXDA 2PHLA 3POFA 4INDA 3IPVA 2Z79A 3AVSA 4YVSC 3KV4A 1FV3A 1DF0A 2W9XA 4QM9A 1TQ5A 3B5LB 5FIXA 4QPGB 4CCLA 2ZGOA 1H2KA 1VE0A 4A7KA 3RYRA 5CVRA 4YW3A 2AC1A 2YBKA 4M0NA 5CFDB 3N4MA 2BVVA 1W8HA 4LO4B 5DAPA 4N43C 4PIXA 4E2GA 4M4RA 2WNVA 2VR4A 3OEBA 3VD5A 3C3VA 4U36A 2PHRA 2WWSA 3EB7A 1DDLA 4XDQA 4BK4A 3B01A 4EWDA 3VBUC 1LKNA 2YU1A 3AK0A 4Y20B 3THTA 4ES8A 1GQHA 1QEXA 2J1VA 3ZFFC 3AKRA 4L2NA 3USSA 3O5SA 4NJ4A 5DZGA 1PO21 2QQNA 1DIWA 5JOWA 2ZGTA 3OUHA 5TSWA 1YQ2A 1HKDA 4M00A 1W9FA 1SFNA 3AMNA 2O14A 1O8SA 3FFQA 3NNGA 5FP8A 3ZM8A 1BMV2 1Q8SA 4NAOA 3MZHA 4K40A 1S2EA 2PMWB 3POYA 4IV1B 4R52A 2BBVA 1IQDC 4CCOA 2ZZQA 4B7KA 5FXWA 2WJSA 1POV0 4KU8A 3NJYA 3QH7A 1MVEA 2JG8B 1SCRA 3WCSA 4G3YC 1FPN3 1C1FA 1PO22 2K9ZA 2NYYA 2BDRA 1YRZA 1QWRA 3A22A 1TZOA 1W0PA 4AVVA 3AVRA 4LNVA 3T0BA 5JZGB 5J48A 1XSRA 1MZ5A 1I5PA 2MEV3 3PJYA 4COWA 4HT1T 4YRDA 4UYBA 1Q8VA 2GU9A 3HOBA 2Z42A 1EAH3 1VRH3 3MUZ1 3ZYHA 4H7LA 5IK7A 4CDQC 4XFBA 4AXOA 2HYXA 4JDMA 1S0FA 4AEKA 5I0DA 5JXGA 2B8MA 1V9U3 2ZABA 4PIYA 5LY1A 3F95A 1ENQA 3PUAA 4XVHA 2GMEA 2A70A 1MS4A 3C8XA 1QXPA 1ACCA 1RXFA 3EYPA 1FT9A 2OPKA 2DCYA 3WW1A 1B09A 5LBBA 5DQ0A 5I93A 4WM8A 5JVVA 5JXHA 5EWSA 2UURA 3PMEA 2Y64A 2EAKA 1HQNA 4ZS2A 3V0BA 4COZA 2R0FA 2WNVC 4PLOA 2BVBA 4FOQA 4C8DA 3NSTA 5H9QA 4AEDA 4HK8A 3GZTB 4YZ2A 4E4HA 2RVAA 3KCCA 1HB1A 4BWOA 4YZ5A 5A7OA 1GZCA 2PQQA 4DMIA 3RWKX 4MO3M 2Y38A 5FMDA 5A6YA 4OULA 3NV1A 5C3OA 1HV0A 2PHUA 2W94A 3IT8A 4RQPB 3T1LA 3GZUC 4CDXB 1PMHX 1ONAA 2FZ2A 1REDA 5JOZA 5FLJA 3ZFGB 3E5UA 3NMBA 4LOTA 4YW1A 2WLPA 4GB33 4XABA 1UWWA 2XJPA 5FYCA 5GLUA 3FN9A 1T6BX 2ZZJA 5HCBA 3PHMA 4JAAA 1WD4A 3VBHA 2DURA 4AI2A 3SH5A 1JZ4A 2GALA 4XJUA 1RUF2 5EFUA 1SLLA 2D98A 2LTNA 4DOUA 1RJ7A 4HK9A 3PUHA 3TYJA 3FHQA 5FAXA 4QX2A 4TZDA 1UNBA 1DQ5A 2RS53 4QXBA 1OVPA 1W8TA 2ZHKA 2WWUA 3V64A 4W65A 4KL1A 1XYOA 2F4LA 3IKWA 4RHV1 2FMDA 2WZR2 2HH9A 1F2NA 2P3YA 2RM23 3IIIA 4Y26A 1GNHA 5C3RA 4AQ2A 4ZHNA 4N53A 5A6QA 4OFGA 3H8RA 1ZBA3 2HWD2 2R072 1W6QB 3N9LA 5E89A 4E2QA 4WM8C 1WW7A 2FCUA 2Z69A 4HN1A 3IAPA 3J8F3 3KVAA 1CAXB 4ASKA 3SITA 2Z2SB 3ZKUA 3DKWA 1JZ3A 4LO7A 4YGDA 4AEDC 2RJKA 1NCRB 1UZ0A 5A7PA 1RUNA 2WO3A 4XTMA 1F4AA 3OY8B 2CL2A 2VPVA 4KU7A 3WD5A 4KNCA 1S0GA 5GALA 4XBQA 2BNOA 3C2UA 4QPWA 5FBJA 3GJBA 2D6MA 4JKKA 1YNAA 4CUBA 1BJQA 3M1HA 5FMOL 1O91A 4LA2A 4AVSA 1O3SA 3CHXA 5FZ8A 1LODA 1AHSA 2R041 3W9AA 2OZ6A 3FHIB 1W3VA 1DGRA 1QDOA 2BNMA 4BM8A 5F3CA 3JUUA 2XB6C 1ND3A 1AR93 2JG9B 4E4ZA 4AI9A 4XACA 2VCBA 4GQ7A 1RITA 2EXJA 2WT1A 4BQ5A 3VBHC 1NT0A 1LOEA 1DGWX 3FZ3A 3I54A 4U2AA 3T2QA 2UWCA 5FO8B 1QQP2 2VMIA 2VZRA 3I2GA 4B8EA 1QU0A 4GKYA 5IVYA 4N7UA 3IM0A 1TVGA 1HX6A 4WM7A 1SACA 3IN9A 2R042 3M3EA 1OI6A 3LDRA 1MS3A 1GZWA 1PVXA 2PA7A 5F5QA 3RJRA 1SEFA 2EXIA 2B39A 1XXNA 2VTXJ 4DEVA 1RJ8A 3KCXA 4P02B 3THDA 1VMFA 3AX4A 4OUSA 2NM1A 3OB8A 1I6XA 1PGSA 5K9YA 4NWVA 2FDKA 3J9SA 1K5JA 2XMLA 2GH8A 1WLCA 4Y1UA 1AR82 3BPSA 4N53C 2I45A 4LULA 5FREA 2O1QA 4MHRA 1O4TA 1M06G 3P1IA 1VP6A 2EXKA 4FPKA 5A3MA 4NAMA 4XDOA 3BGAA 3VV1A 1AXYA 3L2YA 4GMP1 1GNZA 4NHKA 5A3WA 4AVAA 3WNPA 2FCVA 3ZFGA 1XE0A 2FZ1A 2VM9A 2WKKA 1ND2B 4QHOA 4YGEA 4QHZA 2JKXA 2ZX4A 1SG3A 3IMMA 4YFZA 2HWE2 4LBJA 1VBE3 1X50A 3WLUA 2C6SA 2WFF3 2PLV1 1HRV1 2JDMA 1NE4A 1Q3EA 1V6OA 4ZXEA 3U10A 3RZMA 4BK5A 3IDCB 1UN1A 1VBD3 3T09A 4AL9A 2OKXA 4HSJA 4COVA 3LA2A 3K3NA 3AXEA 4AFAA 2VMGA 4XQDA 1U0AA 1UX6A 1XNAA 4MH0E 1UU4A 3BYWA 3ZYIB 3AKSA 2AH2A 1JI6A 3KCYA 2F6BA 5DXDA 1ND3C 4FAHA 1R1A3 4Q2FA 1WBFA 4DS0A 4CCNA 3FLRA 1ZM1A 3RZGA 3IBMA 4BISA 1GANA 4BIOA 4MLOA 2YMZA 2ZKLA 1W6NA 1ZYBA 4YZ3A 4AI1A 4HLTA 5FTTC 4IERA 3POIA 1LGCA 4WM7C 3VUOA 5FZ4A 1ZA7A 4C1XA 5JOXA 3HQUA 5IATA 1D4M1 1W6OA 1Z7S1 3BTAA 4OQ8A 3T3YA 3RVHA 5FZEA 2G19A 4NHLA 4DRVA 1UXXX 2D44A 3GXUA 4HG6B 4R9DA 1HXS3 4HZFA 3KHCA 1ULEA 2XKPA 3ABZA 5BXXA 4QKDA 1OLRA 3VKNA 3OGGA 2HWB1 4O7XA 1HB4A 4O65A 2P6CA 3CNAA 2V73A 3GZEA 4YG6A 3W20A 2KR2A 4RS5B 2W1QA 1H0BA 2PELA 5FZMA 1V70A 3LD8A 1D4M2 4H2AA 2VCAA 1HN0A 4EN8B 4FT8A 3U07A 3V0AB 1RINA 1CJPA 3GBWA 2IVIB 5J98B 1X36A 4ZPIA 2GP3A 5C8CB 4R4ZA 2HWB2 1JOBA 2VNGA 4AAXA 5F7UA 1MS0A 4NIDA 2QZ2A 4IDZA 2JG9A 3K46A 2D3PA 4FPLA 3Q8FA 5T5LA 2WC2A 3ENRA 1PO12 5EYYA 5CFCC 3H9AA 3OBRA 5D8AB 4AFCA 2XQRA 4RGAA 2VZVA 1JU4A 4QU2A 1UOBA 5FZLA 1RC6A 3Q8AA 1CGPA 4HVQA 1C8M1 2XXZA 1DLLA 1O5LA 2ZHMA 4HKLA 3B02A 1VAVA 4ATFA 2D6PA 1GFF2 3HN1A 4Q4V1 4Q0UA 5LASA 2A6VA 2JDUA 5I0SA 2G9FA 1H8TA 3VBRA 1W0OA 3O1PA 2C26A 5F3GA 5A33B 2RMU1 3JQWA 5FZ9A 1LGNA 3FLTA 1AX0A 3T2OA 4BQ3A 1HRI1 1O6UA 3I97A 1GICA 1W9TA 4UAPA 5AVPA 1F4HA 2HEVF 3H8OA 1GP6A 1QJX1 1M4WA 3WV6A 5FY5A 3MHZA 1RUJ1 4M4PA 3TAYA 4ET7A 3IWZA 3IDEA 1XNTA 2O8OA 1VJ2A 1OA4A 3KV5A 4MZUA 1N1SA 2D6LX 2LS6A 2RMU2 4NR1A 5D21A 1JZ5A 4XCBA 5IUQA 3WSOA 3VBOB 5LRRA 1WLWA 2CNAA 3LZZA 2OS2A 3TN92 4A3ZA 4L9BA 5GLTA 1ULOA 3G6JB 2VU9A 4FTBA 2WWJA 1AYN3 5IHRA 1ZRFA 5GZCA 2IFWA 1RUJ2 2W68A 1K12A 1I1EA 5A32A 1Y7BA 1Z0HA 4O9EA 1H1IA 3NJXA 4ORFA 4NHXA 4URAA 4Z07A 4YPJA 3E5QA 3UT0A 4ZZ5A 3HJRA 3D8CA 4FSJA 3PTYA 4P9LA 5K8SA 4CEYB 3WF0A 5ACA1 3NNFA 1LHVA 4LJHA 1J3RA 4XFAA 1N3PA 2JG9C 3HNBM 2ZGKA 3AZZA 1JTZX 2D43A 4MYEA 4NWWA 4LA3A 5C7GA 1MR5A 2CU5A 2WR9A 3PVNA 4WZFA 3O12A 2VMFA 4XXAA 1OH3A 4LE4A 1I5ZA 3HT2A 4MXWA 3C7OA 5HXVA 4Y1YA 1OMIA 2GC3A 4CP2A 3ZXAC 1W6PA 3VDCA 3FX3A 5EQUA 3UNPA 1POQA 3NNMA 3ILNA 4AGRA 4S2DA 4TLGA 1PVC2 3RZHA 3PL0A 3U0ZA 1H8TC 3N9OA 3P3PA 4URTA 3VBRC 1ZZ7A 2XBO2 1BEV3 2JEMA 2ZKNA 4RR3B 5F2SA 4E9KA 1KFXL 1RVF1 5C3SA 1W06A 4XBLA 2FDIA 5FKCA 3ZXEA 5BNNB 4CSWA 4OVEA 1YFUA 1O4YA 1OXCA 3WDTA 1ODNA 1H9PA 3SH4A 2BW8A 1NLSA 2J1EA 1CESA 2A75A 3LA7A 1DG6A 3TBDA 4QU1A 2DVFA 5EP9A 4AGVA 4XETA 1VMJA 5ANQA 1BK1A 1XYPA 1POV1 1LTEA 1RUF3 3M3CA 3PLQA 1FOD1 2CAUA 5C8CA 5K0UB 2B9VA 1DYPA 2GP5A 2A73B 2O8QA 2ARXA 2XHKA 3MFCA 1S0JA 4Y1XA 5A3TA 2WIIB 3POGA 4EJRA 3HAGA 3T1MA 5FLHA 2XVGA 2H6CA 1WCKA 3TEXA 5A3OA 3H0OA 1JUIA 4CDWB 2WZR3 5FP9A 4R9BA 3NL1A 2X09A 4Y24A 3ZR5A 4YM0A 1CVNA 5L7OA 1LAJA 4KBZA 3OPWA 5KXEA 4R9AA 3I8TA 2VXRA 2JECA 1RUC3 2DF7A 2XOMA 2WQZC 5FQ0A 2P3JA 2HWD3 2R073 4LO8A 4DUXA 3VBFA 4ONUA 5FUNA 3SEPA 1J84A 4Y22A 3ASIA 2WFPA 3ZLIA 1TNRA 4FFGA 4RGKA 3SCFA 2PQSA 1D0HA 1ZZ8A 4YW2A 4E2SA 4LUKA 2WINB 4NN0A 3WG2A 5AFBA 1T2XA 2JWPA 3AC0A 3GALA 4R9CA 4ASMB 2ADDA 2WO1A 4EN9B 4EWEA 1OOPB 2E32A 2JXAA 2OYZA 2V4VA 4O9GA 5FY8A 3E6BA 1FAYA 5C5TA 2R6QA 3NO8A 3R4UA 3K4ZA 4LQRA 5A7WA 4LKDA 4KMQA 1MVQA 4KWKA 5A3UA 4P9JA 2P6HA 3MIDA 1UD1A 4ZU4A 2JENA 1RUH1 1TMF1 1W9YA 3VBOA 1OQDA 3IMNA 1S0EA 1TNFA 1MPXA 1K3IA 2GMPA 1AXZA 3OD0A 2VW0A 4W8JA 3WNXA 5FMBA 1C3HA 1S2KA 2R061 4XUNA 1ZRCA 3WG4A 2XJSA 3NAPB 4JC1A 3R4SA 4B1MA 3KV6A 3M3IA 1U5XA 5FUIA 1QQP3 5CIRA 2VZTA 3MLKA 1L3JA 1OURA 1RUE1 1WKYA 3OD4A 3NW4A 4CEYA 5C8CC 3A23A 1TMF2 1ZA4A 4YGCA 1AYM1 3ETQA 3FUOA 3NWKA 4JRAA 4YW6A 4Q29A 4GZ9A 1NKGA 2QJVA 5FMOS 3ZSMA 4IEUA 2P3KA 1AX2A 2W52A 2JE8A 2R062 3RDIA 2X10A 3ROUA 2FDGA 4MGTA 4HBNA 3RYKA 3W58A 4SLIA 3D0JA 2ZS6B 4LIVA 1UU6A 3WNLA 2W5FA 4W6YA 1AR73 5EV7A 5L7OC 2ARAA 2FDHA 1AR83 4UF0B 3AL6A 3CBNA 1AYM2 1YXWA 4P5HA 3FWEA 2WZ8A 4N9HA 4PQ9A 4XIOA 1DYKA 1UQXA 2Y8KA 4QDQA 4YNIA 3VBFC 2CWMA 4P9IA 4E4DX 5IVCA 3H1WA 4XC9A 4AQ6A 2QTWB 4Q4X2 1CQ9A 1ZZ9A 1NX9A 1FXZA 2GN3A 1AF9A 1F5FA 4MGKE 2RE9A 4BXFA 5JXIA 1W6MB 1ENXA 1URXA 2BNNA 2VQ0A 3JD72 4O61A 1KJLA 2HWE3 4JQRA 2D3RA 3LGRA 5JAXA 5JI9A 4IE6A 5FPZA 2DCZA 4CPBD 4AQTA 2W95A 1NXD1 2XJVA 4IQPA 2BZDA 2HWF2 1AJKA 1YWKA 4KBBA 5FPVA 1PZ8A 3D6EA 3VBOC 5CA6A 4NIGA 2DCKA 2XJRA 2FCTA 2C9KA 4MX3A 4TLFA 2GC2A 3WDYA 4EWAA 1RXGA 3S6PA 4LORA 4N7IA 5IVJA 1UX7A 1VR3A 2DVBA 5DAQA 4XQWA 2ORXA 4K21A 1MS9A 2B7YA 2IXLA 3AB0A 4CP1A 2WYSA 1K5MB 4AFDA 4FFIA 2VL4A 3VBSA 2LALA 4FPOB 1VBC1 2D6OX 4CEYC 3AFKA 1GWLA 2PAMA 5EJ1B 4GH4B 3KD4A 4J25A 3BTXA 3GM8A 2IXHA 3VDAA 2VMEA 4NRQA 4RFRB 1VB4A 3U11A 3LDBA 1QJY1 1A78A 1R091 3MGUA 4PCRA 3A7QA 4YLZA 3MV01 4QX7A 1FATA 4BMEA 1XU2A 4C91A 1PX4A 3RZZA 1GBGA 1OQEA 2ID4A 1VBC2 3LPGA 1OF3A 1ZZBA 3NV4A 4TWTA 4MOAA 4YW4A 2GDFA 2WRAA 1XYNA 5A1AA 1MEC1 4LHKA 2B5HA 4DFSA 2JDZA 4CE8A 5BNOB 1DP0A 3ZDSA 4L99A 3W59A 1N3OA 2RS13 3ZVXA 1RHI1 3D3AA 5CB7A 4H14A 5IYYA 3H3LA 4I0AA 1UO9A 3D82A 2C4XA 1W2NA 2OIIA 1Y4WA 4OLLA 2I74A 3I59A 4ITCA 1AL23 1C5IA 4KI5M 1K42A 2HWB3 1V6LA 1UMHA 1RB8G 2WS93 2BEOA 4KQ7A 1US3A 2JDKA 4UFHA 4CDUA 4CRQA 1W2AX 2YZ4A 2WQ8A 1PO13 3NQHA 3ZN6A 2BRTA 2C5DA 2B46X 4FI9A 2YBSA 3ETPA 1OLQA 4K20A 1JYTA 2F17A 4I3PA 3R4DB 1SCSA 5FXZA 3KQRA 4PIZA 3WQ7A 5CKNA 4MADA 4JGZA 1D7PM 4QQOA 1LEDA 5FP3A 2CHHA 4QM8A 5SV5A 3RI9A 1ZZ6A 3OG2A 1QMJA 3HNMA 1W2TA 4QB6A 4YVWA 3U1XA 4DXSA 3O0VA 1TG7A 1F35A 2QDRA 1KS5A 3M4FA 4A4AA 3VZMA 2DDUA 4LEJA 4HETA 4XE9A 3VBSC 5FZIA 4D7SA 3HR9A 1NZIA 4YARA 4P5YA 4WVWA 3VHPA 1V6MA 2Q0AA 3WNNA 2XKOA 1MZ6A 4CCCA 4FPHA 4TXWA 1W8ZA 2WT0A 4IE4A 4ZS3A 2XH6A 1RUD3 3WP4A 3QACA 1QNYA 2W39A 4A2UA 3LKJA 3U78A 3BPZA 3RNSA 3TN93 2WA3A 4Q4W1 3RZLA 2RR11 1ZVFA 2VOVA 2XVLA 3J26N 3HNYM 3V65A 1BZWA 2CGOA 4DEQA 1BBT1 2WQ4A 3LF7A 4LBQB 3UETA 5F5IA 2PHTA 4V2WA 1UL9A 3B69A 5LK5A 4XCAA 1GOHA 4QKBA 1H8VA 3KF5A 4L92A 5FZBA 5LA9A 2C9AA 4XZUG 3AYDA 1UOJA 5D2AA 4CZSA 3H50A 1VBA1 2Q4SA 3PU8A 5JWPA 2F4PA 3IZOA 5FXVA 3K4AA 2VW2A 5IVBA 1XNDA 4AVCA 2ZJCA 5FOJB 2GZWA 3CIHA 3N9QA 4NIIA 3H3ZA 1TME3 4CDUC 1MQTA 1SBEA 2XL7A 4Q4Y1 3P3NA 3MF6A 1CAVA 5LY2A 1VRBA 1H1MA 1VBA2 4HPKB 1X8MA 2BYVE 2NZ9A 3T0DA 4UBHA 2SLIA 4L11A 1C8NA 3CO2A 4GH4A 5F5AA 3RJ2X 3THCA 4JGZC 5JLVA 4XJZA 1Y43B 4P9YA 1ZRRA 3UKVA 1IS4A 4Y33A 1PVC3 2JD4A 5J96B 1NLRA 2XUMA 3PU3A 3HPNA 4YVWC 4KG0A 2XBO3 3ELNA 2X5IC 2XLGA 1EV11 1O7FA 4GAZA 2H0BA 4L97A 3B00A 4NPRA 2LRPA 3T08A 5A3LA 3MIFA 2D5FA 4DZGA 4LIUA 1BHGA 1C28A 2VOWA 3SC7X 4XJ9A 1KFUL 2D5HA 2RJ2A 2QQOA 4XAEA 4RFT0 2ET7A 1TE1B 4QT6A 5L9VA 4E27A 4IGOA 3MW3A 1XNBA 1HJGA 1UZWA 4IUGA 1GWKA 2HBTA 4NRMA 4QB1A 5KC5A 1EV12 5F32A 1FV2A 3WHTA 3O1VA 4NMIA 3GBFA 2XJUA 3VHOA 5JSPA 5JSRA 1GUIA 3UK9A 3VD9A 3W5MA 2ZMNA 3GHNA 3O1UA 3POEA 1W8UA 2ZGUA 3J7NA 3RYPA 2O0OA 2UY9A 3LPFA 3ACFA 2W1UA 5FYMA 1J3PA 3ES4A 5BNPB 2DCTA 3M8LA 3PVOA 1JODA 1WW6A 2X8KA 2BGCA 3KGZA 5KXBA 3VB9A 1HQWA 5HV4A 1Y9GA 3WG1A 2ZBJA 1G9CA 5CU1A 2ENRA 5FZOA 4QB2A 5DN2A 4JHZA 4CEWA 3K77A 3ECQA 5LW9A 1EPZA 2YUEA 4XXPA 3ZYFA 4CCJA 3PVBB 3ZO0B 2ZGPA 3PVEA 4ZONA 1MS1A 3ZXGA 2I07B 1MQTC 4XMIA 3BUCA 2HWC1 5T5PA 3O0WA 4EQVA 4NROA 4LHNA 1QHDA 3VL9A 5JR2A 3ON7A 3T2PA 3M7AA 4QPGA 3DKQA 1H1AA 3OPTA 3H1MA 5CFDA 4GH4C 1IPJA 5LEKA 1IZ3A 4Z92B 4QX5A 2R0HA 2BQPA 1VBB1 1E5IA 4IV3B 4D0QA 5T3NA 4BH9A 3N35A 2VUJA 2VTFA 2DFCA 4Y5Z0 1CZVA 3VDDB 2YY1A 3WY6A 2PAKA 2ZGQA 4BQYA 4Y20A 5FPUA 3KZ4C 3I3EA 1PNGA 2V4AA 4XF9A 3URFA 2WNUB 4C0HA 2BBAA 2YB7A 3AYAA 2VAUA 3ZKYA 2WYFA 3U4XA 2QDNA 3I2JA 3M3QA 1PZ7A 3WW4A 3KWVA 1CX4A 1LHOA 1VBB2 2HLEA 2UYAA 4FFHA 3SQOA 1B35B 1BK0A 2XDVA 4IV1A 2DBNA 2K0GA 4RHV2 2VE1A 2YC0A 3WHUA 1EPWA 2JG8A 3BCWA 4BQ1A 3ACLA 3I2IA 3SXWA 4CU7A 2RS33 2NN8A 2W1WA 3VZNA 4XFHA 5KWRA 3T4VA 3MYXA 3BTYA 2VY0A 1ST8A 4G4FA 5HCAA 4MHUA 5JZGA 1QH6A 2P34A 3P5BA 3CJXA 3ZOIA 1KJRA 2XONA 1EUUA 2WSUA 5FBZA 2A6XA 3CMGA 4CEWC 3KT1A 2BWAA 3TEYA 1E57A 3JU9A 4KWLA 1IS3A 3LEGA 1AR63 4L8QA 2W0XA 4OZXA 1GP5A 2WA4A 2A6WA 4GALA 5G05L 3HIFA 3U37A 3HQRA 1QIQA 1CR7A 2AUYA 1PMIA 3WDXA 2D40A 4Q4X3 1CZSA 5FZ7A 1SPPB 4AHZA 5KXCA 1U5YA 3R05A 3ZDVA 5H9SA 3OSDA 2ZMLA 4W6XA 2QQLA 1QOTA 4X6QB 4QPGC 1Y3TA 5ANNA 1DGRN 3JD73 5CFDC 4K1YA 4ASLA 1XPWA 2VUDA 3H7JA 1QJU1 2P5BA 1ALYA 3PJQA 2D3SA 4I09A 2QCSB 3JB4C 5BNQA 2ZAAA 1KS4A 3E6DA 4CYDA 2BJSA 2HWF3 2G1MA 5AC91 1VAKA 4V2VA 3ZSJA 3TEWA 2QQJA 4CU9A 4XYXA 5BNPA 5C33A 1UY3A 2TNFA 5I91A 4LUMA 4RQPA 4BQWA 2XR4A 4IV1C 1RUOA 4CDXA 1AJOA 4HMZA 4DY5A 4WVMB 1NCQB 2JG8C 4AQSA 2GNDA 1XC6A 3E5XA 3KLSA 2HEWF 4GKXA 4UBGA 5J09A 3LDKA 5L36A 5CKQA 1ZX5A 1QGLA 4QAWA 5HXMA 2YU2A 4UXAA 1K45A 5FYIA 2YV8A 4BOWA 5A1LA 4H7MA 3T2TA 1Q8QA 1US2A 4MSVA 5FP7A 2V09A 5JZGC 2ZGRA 5IT6A 4AW7A 4QQLA 3B94A 3N9PA 2YXSA 1KXGA 4D7YA 3SKVA 4FTSA 2J7MA 2ZHLA 4MGQA 4H3WA 4QGLA 4AZZA 3N7MA 5GLZA 1G9AA 1KRIA 3H42B 1QJFA 4PF1A 4LK6A 1YC61 4FO9A 2PLV2 4A7ZA 1HRV2 3AP9A 4DNYA 2KA3A 5ERLA 5JIUA 2JX9A 1YQ8A 2G9ZA 2WNUA 5ABJB 1JW6A 3KMHA 3BTZA 1WA6X 3POSA 4GWNA 2WUHA 4MGSA 4D3WA 1W6QA 1PM4A 4KGGA 1WLTA 3I3DA 3CZJA 3OBAA 3ZFEB 4CP9B 4MGYE 4QD2A 1CAXA 1Y9QA 4RGGA 3EO6A 4PQQA 4XIKA 4N9IA 3H8XA 1VPHA 1NCRA 4OYUA 3DPRB 3FBMA 3USUB 1JZ6A 4TSVA 5CZKA 4FCAA 1GQPA 3OY8A 1PHMA 3ZXDA 2VUCA 2V5YA 4IEQA 1O5UA 5BNPC 4ZU7A 5BYNA 2Y6FA 1Z7S2 1N1TA 5A7QA 3KT7A 3EMRA 3JBG1 1SBFA 3K48A 1YLLA 1GR3A 4LO6B 4RD7A 4RQPC 1UPSA 2YC4A 2ES3A 5F2WA 5DUVA 4CDXC 3LA3A 3AJYA 2VNOA 4BQ2A 4PDWB 4CXYA 1JZ8A 1RUI1 5J36A 1LCLA 3ZFGC 3HEIA 1UYXA 5FPXA 1HB2A 1RUG1 2PTMA 3UKNA 2VZPA 5DDJ1 1ZBE1 2QZ3A 4XF0A 4AEMA 4B1LA 2GNTA 3LEMA 1N1VA 3OOXA 2WN2A 3WQBA 5EIYB 3AP4A 2HEYF 2R49A 5LEJA 1YIPA 1KD7A 2EIEA 1A8MA 1RUG2 4P00B 1FNYA 2IXCA 1DGWA 5GKAC 1WMXA 3POWA 5FZ0A 4LPLA 4FAGA 3AYEA 5DDJ2 4I01A 5IK8A 1W9WA 4IGPA 2BU9A 5C4WB 1JXNA 4Q0VA 2A6ZA 2WNUC 2SBAA 4EE2A 1V6NA 3OYWB 2BOIA 1C8M2 3SKJE 4IE5A 1COV1 5FCCA 4BCUA 4LMFA 3V56A 1O3RA 1ODMA 1PO23 4LBQD 1NY71 4XMAA 5FPLA 3ZYPA 4CPBA 4QKNA 1JOJA 5F6KA 2VMCA 4Q4V2 1AUYA 4DQAA 4BPZA 3GBGA 1PGL1 2OUHA 1REFA 3CJIB 5FYUA 1NCQA 2J1AA 3CL1A 2AR6A 1QXJA 1VBA3 2YYOA 1CIYA 2MHFA 2OVUA 2LROA 2Q1ZB 5T55A 3U4SA 5F37A 1NCRC 3A4UA 1ND2A 1JZ2A 2WZPP 1HRI2 1COV2 4QQ2A 2D6NA 2E51A 4QQPA 2DUPA 1UU5A 1NY72 2GC1A 4D6RA 1QJX2 5LWBA 1N3QA 4RSUA 3CF6E 2QFEA 5A3PA 2TBVA 4Q4Y3 4JQTA 2V5DA 2VNVA 1PK6B 2P2KA 1YQCA 1H2NA 4ISRA 3AMMA 3LWCA 2W87A 4P14A 1DLCA 5KHHA 2Y6JA 5EPAA 5FZFA 2AZ5A 4ARXA 2VH9A 2PFWA 4I30A 4NHYA 3I2HA 1CPNA 3Q8EA 5KR7A 2ETEA 3S57A 5FY4A 2N7GA 4AF9A 5J37A 3PUIA 2EXHA 4DPNA 4IE0A 1FPN1 4NO4A 4M3CB 1ZRIA 1DGLA 3MF9A 4BU2A 1UCXA 4B4RA 2JKBA 4UFIA 3A21A 2NQYA 3GNEA 3Q9OA 3I2DA 3AKPA 4EZ4A 2DTWA 3NJVA 3MFAA 4OZOA 1O3QA 4IW3A 5FXXA 5ACA2 1HLCA 1QNWA 5IK5A 2MEV1 3C7FA 3FBYA 2IUWA 3P6BA 4N8MA 4QPIB 4PI0A 4OQ9A 5FZ3A 4XPVA 1DU3D 2VMDA 2C24A 3MV11 2VW1A 1OD3A 1FPN2 1A8DA 1S4CA 5LBFA 2D97A 4K9SA 4YW7A 5JI7A 5I0TA 4RS5A 1ULFA 2J22A 1WW4A 1V9U1 4MGZE 3OGRA 4AGGA 4XDPA 3ACHA 5CNAA 5FYBA 3ZXKA 3WQ1A 5KHKA 2MEV2 1GLHA 3V0AA 3ZMNA 1W39A 5GZGA 3RZJA 4NIAA 4DY3A 3BVCA 4PDWA 5LA0A 3TNPB 1JS9A 1NLQA 1RVF2 1WCQA 1UIKA 4DUWA 5JUVA 1LECA 4LITA 1ND2C 5FV3A 3WW3A 3RI8A 3UGGA 1A6CA 2FMYA 3UGHA 2G4IA 5D8AA 2ORZA 1AL0G 2JIGA 2EVXA 1XQNA 2NPIA 5FO9B 5IVFA 3K3OA 1SZBA 1DZRA 1GKBA 1ULDA 2HJIA 2GNBA 1Q56A 2TUNA 4LBOA 3HN3A 1FOD2 2YHJA 3U14A 5JPNB 3S5AA 5JSOA 3I2KA 2PN5A 4X6RB 3WCRA 1QKQA 1SLTA 4WVZA 2B42B 4NIHA 4QXHA 3LAGA 3W21A 3VLBB 3DXUA 4XF1A 5F1RA 2AACA 4BMBA 2J1TA 3O1OA 3LOBA 1G7YA 5A33A 2J1RA 5FUPA 1YFXA 2JJ6A 4RHV3 4GB31 4D69A 4DB5A 2YPJA 1NA1B 5EHDA 2XG3A 5IFPA 2ZXQA 3HT1A 4GJZA 4UFKA 5C9AB 1NG0A 3HWJA 4DIQA 4B4QA 4CU6A 5L73A 1O8PA 4Z1VA 5DUWA 5DG1A 1E5RA 2EAAA 4N90A 4YVSB 2IWGB 3QCWA 3WNOA 4M3CE 4FPJA 4EV0A 5AVAA 2RS51 4LHSA 3WQ0A 5ISLA 2Q8EA 1E5HA 4LKSA 1CPMA 2ZAHA 3JCIA 1S0DA 4GD4A 4PF5A 5G04L 4N43B 3J7MA 1DQ2A 2TEPA 4RS5C 3ZXLA 1GQGA 3M2MA 4BDVB 4Z2AA 4M0HA 3I3QA 1OLME 3MW4A 2RM21 1W28A 1ASJ1 1D4VB 3VBUB 4MVTA 2BTVC 1PZ9A 2NMOA 4QMAA 5IVEA 5FYHA 3ZFFB 1JYVA 4GWJA 4OHVA 4YM1A 2W1SA 2VOTA 3KGLA 1SBDA 1ZBA1 4KWJA 4OCTA 4XTPA 3WINE 4OMCA 2OUJA 2R16A 4F3JA 1L7RA 2BOJA 1JH5A 1RUH2 3LFIA 3J7LA 3FC0A 3Q8CA 4LKFA 2DUQA 2R043 3J8F1 1I3HA 4LBNA 5CKMA 5FFOC 4Z8BA 4YZ1A 5T5OA 3DUIA 1EUTA 1OC1A 2YPDA 1ASJ2 3AMHA 3PDQA 3VKFC 3ZYJB 5D8AC 2WZEA 4A45A 4M3CA 1SHWB 4D7TA 3K2OA 1APNA 3APBA 1RUE2 4XFFA 1D0GA 4LO5B 1JMUB 2VZUA 1LENA 3AP7A 1C57A 1FMD1 4M3CF 3EHKA 3K51A 4QPIA 1WCUA 2R7EB 2JE9A 1WCDJ 3O1RA 3TWIA 3BU0A 4RR3A 4CP0A 2XJTA 3CKHA 1UIJA 4XF4A 2DTYA 1HV1A 1AR91 1LESA 1C5HA 3M3OA 4GULA 2DBIA 5T52A 1U12A 1YHFA 4META 5L9RA 1WCSA 4NHMA 3SLIA 5BNNA 2VVEA 1DQ4A 1XNKA 2QBXA 1UYZA 1H30A 2C1FA 3FL7A 4IL7A 5GZFA 4OI1A 5CBLA 1GYKA 1LJ7A 1DZQA 1FMD2 3ZSEA 2VQTA 5FWEA 3IPVB 2ERFA 5APAA 3NJZA 4YYOA 3E1F1 1LEMA 4OI2A 5K0UA 4MV2A 2Q30A 1YEWA 2WO2A 4GMP3 2WBKA 4NUBA 2Z4FA 1X7NA 4HVOA 1UKGA 3WUCA 5FYYA 3BI3A 1PM7A 2XJQA 5E88A 3S5QA 5F3IA 4OHWA 2E7AA 2WNVB 1GZTA 4Y3OA 5LA1A 3A0NA 5K4LA 3O14A 2W3JA 1JYIA 1E5SA 2PLV3 1BVP1 1HRV3 2WABA 4Q8LA 5FZAA 3WDVA 4CDWA 4Q26A 4D94A 2ZMKA 4FP3A 3VD3A 1S2BA 2ZGNA 1Z78A 2MNGA 3UESA 3VZLA 4S2FA 3N7LA 5DMYA 2D7FA 1QXRA 3D4KA 3QBQA 2JIJA 1X33A 1IGOA 2IXJA 3AP5A 1Y9MA 1EP0A 1OQ1A 4IXLA 2CGNA 1NXMA 3I2FA 4WVVA 1SMVA 2E31A 1OPMA 1U5IA 1NA1A 3FLPA 5C71A 4NRPA 3HBZA 1PIV1 2JDNA 1VBE1 2OZJA 2Y6KA 3DL3A 3LEKA 1UAIA 5FO7B 5C9AA 1OD5A 4FPFA 4BYYA 3E6CC 2VECA 4G9SB 1OOPA 1VBD1 4Q4Y2 3UJQA 1D4M3 1RTVA 4DRRA 2J1UA 1Z7S3 4IEXA 3MLLA 3N36A 3C7HA 1QJY2 3IIAA 2Q8CA 1R092 5FOBB 3MLJA 4JHTA 1QY4A 4Q27A 5CYYA 5FYVA 5FP4A 2FQPA 4RR3C 3WF4A 4BHPA 2J1SA 1LNSA 3QD6A 2WT2A 1PIV2 4MXVA 1VBE2 1R1A1 4S2HA 3LIHA 3K75B 4K1ZA 1VLNA 5BNNC 1W90A 2VG9A 2RJLA 2Y6GA 5E16A 4BLJA 5JDBA 1R1ZA 5BY5A 2VBBA 2IC1A 3KB5A 3NAPA 1MEC2 1UKRA 1WD3A 3AXDA 3SCGA 5JMCA 4JX0A 1UMIA 1PGW1 1YJLA 2Q5TA 3LIGA 1FI2A 1RHI2 4B7EA 5A6ZA 2HBUA 4GWIA 4IEOA 2RG4A 5K0UC 2ZEXA 4Q1PA 4C0BA 2UU8A 3CQOA 4WM8B 3N9NA 2CYFA 1WUVA 1UMZA 3ZX7A 2JB4A 5JOYA 3V0BB 3GCXA 3TB0A 3I3BA 2OQ7A 2WAOA 4AEDB 4EROA 1PGW2 4A3XA 4AI8A 4A6SA 2DV9A 5DDJ3 4CDWC 2RDSA 3UYJA 4LBMA 5A7NA 2ZEWA 3T30A 2VXJA 2Y33A 1YFYA 3CDZB 3RMXA 5LK7B 3RGBA 1S0BA 5DAXA 4E8DA 4UF0A 1C8M3 1G8WA 4JKMA 2YBPA 2XPJA 3VHRA 4Q4V3 1DQ1A 2P4EA 3EXUA 1KEXA 4XW3A 3ZIWA 1V6JA 4WBBA 4NPMA 3QOPA 2ZACA 1JHJA 3B93A 3MW2A 2RMU3 2PXJA 1NA1C 4Z82A 5I8SA 3ATGA 3CZUA 3MPBA 4OI0A 1W6MA 2BFUL 5C9AC 3IAQA 1HRI3
chains in the Genus database with same CATH topology
1COV3 3VBHB 1OOPC 4FQ4A 1KDKA 4FTEA 4K6BA 1QJX3 1QF3A 3ILFA 4HSLA 1RUJ3 2DYCA 2A3WA 1KDMA 4AEJA 4Q8KA 2ILMA 2Y0OA 3R0RA 5F9TA 4FOVA 1REEA 4LLOA 4Q4W2 1BMV1 2RR12 1ULGA 1VB2A 1NYWA 1BBT2 3MIEA 4JDOA 1NZCA 3WOGA 4JTOA 1G9BA 3NAPC 3WDWA 1GZ9A 3IDBB 1K5MA 1GV9A 3WUDA 1Q8PA 3WP6A 3RPQA 2VOXA 1RL3A 3LB9A 4N53B 1X8EA 4QPYA 1QDCA 4GWMA 2HKXA 2A7AA 5ACA3 3BIWE 3VGIA 3S0MA 3AKTA 2UWAA 3GF6A 1BXHA 2QUOA 1AYN1 2PYTA 1Q43A 1XU1A 4YGBA 1T6GC 1YCIA 2QE3A 4AE2A 5KC6A 4Q1RA 2C0ZA 5BNOA 1BVVA 1DQ6A 2DVDA 2XLAA 1WA4A 4K8FA 2ZGLA 4YG3A 4LHLA 5KHGA 2Y26A 3OGJA 3S30A 1LRHA 2VMHA 1AYN2 1LHNA 1RVF3 1ND3B 3RRDA 3BU7A 2VQAA 4LBLA 4XILA 3BODA 5I0UA 1H4GA 4QQHA 4J6GA 2VNRA 3INAA 3RSJA 4WM7B 1CAWB 1POV3 1YFWA 1FOD3 2A3XA 2OA2A 3WP3A 1GZWB 2DU1A 1JYCA 2LM3A 1MZFA 1LULA 4XEZA 5LRSA 5I8TA 1BEV1 3LSDA 4YM2A 1O4ZA 1MS8A 3BOPA 2Q1MA 3EQEA 4ISQA 2ZX0A 3A0KA 2KM2A 4IEZA 4UW3A 1AZDA 2X29A 1K5MC 4XZPA 2PHFA 2ZTNA 3WDUA 5D1IA 4FP2A 4YZ4A 4DXZA 1H9WA 2E7TA 2ZX2A 5GZEA 1DBNA 1RUF1 2DWRA 2XWJB 3N3HA 1BEV2 3GYDA 5J7MA 3CEWA 1EY2A 4YW5A 2YGLA 3HD8B 4IEVA 1S1AA 2BPA2 4AFBA 2CY6A 2GH2A 2HWC2 4AHXA 2AREA 4CTEA 4BIFA 2AGSA 4LBQA 4XFCA 2VOKA 2D6KA 4QGMA 3ZXJA 5CFCB 3ME2A 2WZR1 5BNOC 1DHKB 3ZXFA 2Q8OA 3AZWA 2DFBA 3KSCA 5HCFA 1HQLA 2YDEA 5DZEA 5FLIA 2AYHA 1RUC1 2RHPA 3GZAA 1AX1A 1RGSA 2HWD1 2R071 2JE7A 1RUH3 1TMF3 4UW4A 3D5OA 3WP5A 5EZWA 5DUUA 4OI4A 4ZKTB 3AMQA 3ST7A 3MIHA 2R063 1ASJ3 1LOGA 4F83A 1W6NB 2GAUA 5JR7B 1YUDA 1DZTA 1RUC2 2XGXA 4HPKA 2GMMA 1RUE3 3SH3A 1V6IA 1W6OB 3MIBA 1I9RA 1AYM3 3AYCA 2XLFA 3S7IA 4LE3A 4AK3A 1DFQA 1JUHA 4K3UA 1G86A 2ET1A 3TNQA 1FNZA 1ENSA 1R081 2Z5WA 4P9GA 4HKWA 3MDPA 1YI9A 3VZJA 1F31A 3WVJA 4LLFA 1HW5A 2R1DA 2QVSB 3DV8A 1QQP1 3S7EA 2XWBB 1QJZA 1FMD3 1S0CA 4OHZA 4JGYB 1C4RA 1R082 4C90A 1IOAA 2VVDA 1MS5A 3JZVA 4QXKA 3B9CA 3VHNA 4HKOA 1XRUA 2GN7A 2WSVA 4NOTA 2MPFA 4AHYA 3MI8A 4AI3A 2E9QA 4M01A 2A3YA 2E7QA 1D2QA 4JVAA 2KXLA 1O3TA 3RG0A 1AR71 5T54A 3WW2A 1AR81 1CAWA 1QJU2 5DZFA 4AI0A 4QHBA 4J1XA 5FDBA 1IS5A 5AC92 5CAZA 1SLCA 4PBPA 1WGPA 3WX5A 1H8TB 3VBRB 3NV3A 3O0XA 3TOJA 3JB8A 5EYXA 1NOVA 4R8HA 3LOIA 1AR72 4HVRA 1HDKA 2EALA 1SLIA 3KT4A 2PHXA 4GXLA 2HWE1 4FPGA 1VBC3 3LSEA 4ZXKA 4YM3A 4B29A 3WZ1A 4XOGA 5EXOA 5KHJA 4FOWA 1UPIA 4IV3A 3RWNA 4WV8A 1YI7A 1QJY3 5BV6A 1R093 4FPYA 3UJOA 3VDDA 4OUMA 1PIV3 1LR5A 3AZYA 5CFCA 2H6BA 3L2HA 1J3QA 2A5ZA 5A32B 1MEC3 1KITA 3ZSKA 3AFGA 1RHI3 1B35A 1CN1A 2GSYA 1OKQA 2ZOEB 5H9RA 3SHRA 5J3UA 4XHXA 5B2GB 2E63A 1GSLA 4LR4A 4FVVA 1CAUB 4AYUA 4J1WA 4HFSA 4MXWB 1XNCA 1RMU1 3H3UA 2ZX3A 1U5ZA 3DN7A 3OBTA 4GA9A 4KG8A 2P17A 1W6PB 4JRLA 1W2UA 2RS11 2NP0A 5BPXA 1LOFA 1SFYA 2G9GA 4EN0A 1IHMA 1AL21 1RMU2 3AZVA 3VN4A 2WS91 4OHYA 3HQXA 3JBG2 4JCKA 3OTFA 4BE3A 2K2SA 5I0RA 1PO11 4IEYA 5CADA 2RS12 4P9WA 1RUI2 3X29B 1WLDA 5KBFA 2FBEA 5FRAA 4JGYA 2AENA 1AL22 1NE6A 3B7MA 4IV3C 5LRRA 4Y1ZA 2CAVA 2WS92 1QOOA 3VKLA 3VDDC 1ZBE2 2ZGSA 4Q4W3 3ZPYA 2RR13 3N7KA 1BBT3 2YROA 4E4SA 4I02A 1OFSA 2DVGA 2E6VA 3ES1A 2BFUS 5EJ3A 2PHWA 4ES9A 5L7OB 1LGBA 1B35C 3KM5A 4I2OA 3BOWA 3KS7A 4AFMA 2VULA 4WVMA 4YG0A 1RUD1 1J58A 3MICA 5FQ0B 1JBCA 3VBFB 4OHXA 1LOCA 2R32A 4Y22B 4JDNA 2BUKA 3TN91 2WNEA 2ZGMA 5E8AA 5T50A 3FMGA 3GHMA 4FBFA 1JHNA 3CLPA 1UF2C 1YJKA 3QLQA 1F9KA 4JTNA 4XJWA 1PGL2 4W6WA 2LUWA 4LT5A 1VIWB 1RUD2 4PLMA 1OSGA 1OA3A 2IXKA 1TEIA 1LOFC 1OHFA 5F6LB 1Q8OA 3D0SA 4Q0SA 4ATEA 1X82A 1CONA 3AZXA 4HANA 1AVBA 1C1LA 1UZZA 1EV13 1TME1 2DU0A 2UWBA 1WW5A 5ABJA 4R4XA 3ILRA 2DVAA 2VUAA 3THPA 5JIAA 3AMPA 2FHRA 4Y4YA 3VL8A 4FPCA 3VKMA 1WBLA 1SDWA 5C8WA 3ZFEA 3SCHA 4JGYC 1YIFA 2ATFA 1UZYA 1VAMA 4ZU5A 3B9IA 1LOAA 4V1PA 1FYUA 1EAH1 3ZMOA 1VRH1 3WXPA 4AWDA 3DPRA 3USUA 1TME2 5KHIA 1PVC1 1UW8A 4A7YA 5JCTA 1G9DA 1CAUA 3UKTA 4AHWA 3WG3A 2XBO1 4TYSA 3BALA 2ZX1A 5DUXA 4DINB 3AP6A 5E1RA 3ZIXA 1IKQA 4AVBA 1N1YA 5CG8A 4B3NA 1EAH2 1VRH2 2GC0A 3SMHA 1NCQC 2D93A 2ZCWA 2YGMA 4QGNA 3SNMA 1V9U2 3ZN4A 2EIGA 3PNAA 1ENRA 2R30A 1ZNPA 1SLAA 1OPOA 4PLNA 1NQJA 2HWC3 3R6SA 4XJAA 1CJDA 2CV6A 3UL2A 1LOBA 1YO8A 1ZRDA 1IPKA 4X8PA 4UW6A 2Y0IA 4HL0A 2W08A 1VBB3 5K7PA 2EF6A 1IKPA 1BCXA 3UV9A 4LBKA 2CTVA 5C4WA 5HI0A 1D2SA 3H1YA 2DUOA 2UYBA 5SV8A 3WR0A 4IESA 3OYWA 5ABJC 4WZCA 1VALA 2VVFA 2XVKA 4KGQA 4XFGA 1ZZCA 4YFWA 3DF0A 3CU7A 3VBSB 3ZFEC 2JICA 5I8YA 3CJIA 4S2GA 4NVPA 4BLIA 1G9FA 1JN2P 4B4PA 4GB32 3DPRC 5GJ6A 4P9XA 2PAEA 4Q0QA 5HBAA 2P37A 1F5JA 1J1TA 2NMNA 4F8AA 4COUA 4FPEA 2WL1A 3B3QE 1LHUA 3J4UH 1PK6A 3E97A 1PNFA 2B9UA 1CD3G 3VKOA 1Q5OA 2RS52 4HN0A 4PDWC 4LTAA 3MIGA 1LHWA 4F7ZA 4K7JA 1SQ4A 1WMFA 3LCPA 2WLQA 3H7YA 2HYKA 2UY8A 2RM22 3FE5A 3I59B 1OA2A 2P3IA 4EN7B 3G7DA 1R083 4GMP0 2RS31 4IEWA 1V6KA 2CGPA 4PJYA 4I3GA 3HMYA 1S0IA 4CDUB 3RS6A 1ZBA2 3ZN6B 3J8F2 1ZREA 1XE8A 3EBRA 1QJU3 1YYNA 1F8VA 3DGTA 3VZOA 2RS32 4EN6B 4JGZB 1AR61 4XF3A 5C4WC 3O7OA 4XHBA 5AC93 3NV2A 2GNMA 2IXIA 3OPZA 3OCPA 4YVWB 4Q4X1 2X5IB 5GLVA 2I2SA 3NKGA 4C1WA 3CJIC 2VGDA 3JD71 3BB6A 5L19A 1AR62 5GM0A 4COYA 1HIXA 1AR92 4I0BA 2E53A 3NKTA 3ZYRA 3SISA 2ZA9A 1H2LA 3ALQA 2HWF1 2EA7A 2IZWA 2QQPA 4XJ8A 4KH9A 3N7JA 1PK6C 2CWSA 1QH7A 4XBNA 2OW4A 1A3KA 5GZDA 5T5JA 4Y1VA 3QH6A 4AG4A 3VZKA 3AM2A 2H0VA 4RL7A 2R1BA 3AJZA 4YSFA 1BQPA 1LU1A 3EJKA 4JV4A 3FUQA 1BYHA 3WT3A 3I4IA 4RA0A 1H4HA 3L9JT 4I0WB 4XQ4A 4Z2WA 1WMEA 5H9PA 1IS6A 2WFF1 1G6NA 2IFRA 3FFZA 5DG2A 4IEPA 1MQTB 5C6CA 4BA6A 3NVCA 4AVTA 4YVSA 1QOSA 4MGIE 1CAVB 1XE7A 3OF1A 3AKQA 4QPIC 1KQRA 4PBOA 5IK4A 3PMSA 2NLRA 2XL9A 2QKDA 3ZYGA 5CG9A 3JQXA 4N43A 2WFF2 1WMDA 3MPPG 1ULCA 4FXGB 1MACA 4GIQA 1N47A 1VBD2 3VBUA 2A71A 5JPMB 1RMU3 2ZHNA 3ZFFA 1H2MA 1J59A 2BWCA 1IQAA 2QNKA 2ARBA 3JBG3 1LU2A 4X8NA 5GLWA 3FJSA 1RIRA 1R1A2 1EYBA 1RUI3 3H8UA 4FXKB 4MUVA 4H55A 1HXS1 4SBVA 5BUVA 1AXKA 1SLBA 1RUG3 3OJBA 4FQZA 4IETA 1ZBE3 2X53S 3RQ0A 3M70A 3RMYA 4Q0PA 1OFNA 1S55A 4XFIA 1CIWA 1MZEA 4UW5A 1J1LA 3MEPA 5AFEA 1NQDA 2ZPXA 3TRSB 1HXS2 1BKZA 2DCJA 3ZSLA 4CEWB 1FX5A 1DQ0A 3I7DA 4CDQA 2PHDA 2A6YA 2B45X 4FOYA 2X5IA 1V00A 3ZN5A 5KXDA 2PHLA 4INDA 3IPVA 2Z79A 4YVSC 1FV3A 1DF0A 4QM9A 1TQ5A 3B5LB 4QPGB 2ZGOA 1H2KA 4A7KA 3RYRA 5CVRA 4YW3A 5CFDB 4M0NA 3N4MA 2BVVA 4LO4B 4N43C 4PIXA 4E2GA 2WNVA 3C3VA 4U36A 2PHRA 2WWSA 1DDLA 4XDQA 3B01A 4EWDA 3VBUC 1LKNA 3AK0A 4Y20B 3THTA 4ES8A 1GQHA 3ZFFC 3AKRA 4L2NA 3USSA 3O5SA 5DZGA 1PO21 1DIWA 5JOWA 2ZGTA 5TSWA 1HKDA 4M00A 1SFNA 3AMNA 3FFQA 1BMV2 1Q8SA 3MZHA 4K40A 3POYA 4IV1B 4R52A 2BBVA 2ZZQA 4B7KA 2WJSA 1POV0 4KU8A 3QH7A 1MVEA 2JG8B 1SCRA 3WCSA 4G3YC 1FPN3 1C1FA 1PO22 2K9ZA 2NYYA 1YRZA 1QWRA 1W0PA 4AVVA 4LNVA 5JZGB 5J48A 1MZ5A 2MEV3 3PJYA 4COWA 4HT1T 4YRDA 1Q8VA 2GU9A 2Z42A 1EAH3 1VRH3 4H7LA 5IK7A 4CDQC 4XFBA 4AXOA 4JDMA 1S0FA 4AEKA 2B8MA 1V9U3 2ZABA 4PIYA 1ENQA 2GMEA 2A70A 1MS4A 1QXPA 1FT9A 2OPKA 2DCYA 3WW1A 1B09A 5I93A 4WM8A 5JVVA 5EWSA 2UURA 3PMEA 2EAKA 1HQNA 3V0BA 4COZA 2R0FA 2WNVC 4PLOA 2BVBA 4FOQA 3NSTA 5H9QA 4AEDA 4HK8A 3GZTB 4YZ2A 3KCCA 4BWOA 4YZ5A 1GZCA 2PQQA 4DMIA 2Y38A 4OULA 3NV1A 1HV0A 2PHUA 3IT8A 4RQPB 3T1LA 3GZUC 4CDXB 1ONAA 2FZ2A 1REDA 5JOZA 5FLJA 3ZFGB 3E5UA 4YW1A 2WLPA 4GB33 2XJPA 5GLUA 2ZZJA 5HCBA 3PHMA 4JAAA 1WD4A 3VBHA 2DURA 4AI2A 3SH5A 2GALA 4XJUA 1RUF2 5EFUA 1SLLA 2D98A 2LTNA 4DOUA 1RJ7A 4HK9A 3TYJA 5FAXA 4TZDA 1DQ5A 2RS53 2ZHKA 3V64A 4W65A 4KL1A 1XYOA 3IKWA 4RHV1 2FMDA 2WZR2 1F2NA 2RM23 4Y26A 1GNHA 4AQ2A 4N53A 4OFGA 1ZBA3 2HWD2 2R072 1W6QB 5E89A 4E2QA 4WM8C 1WW7A 2Z69A 4HN1A 3J8F3 1CAXB 3SITA 2Z2SB 3DKWA 4LO7A 4YGDA 4AEDC 2RJKA 1NCRB 1RUNA 4XTMA 3OY8B 2CL2A 2VPVA 4KU7A 3WD5A 4KNCA 1S0GA 5GALA 4XBQA 2BNOA 3C2UA 2D6MA 1YNAA 1BJQA 3M1HA 5FMOL 1O91A 4LA2A 4AVSA 1O3SA 1LODA 1AHSA 2R041 3W9AA 2OZ6A 3FHIB 1DGRA 1QDOA 2BNMA 4BM8A 3JUUA 2XB6C 1ND3A 1AR93 2JG9B 4E4ZA 4GQ7A 1RITA 2EXJA 2WT1A 3VBHC 3I54A 1LOEA 1DGWX 3FZ3A 4U2AA 5FO8B 2UWCA 1QQP2 2VMIA 4B8EA 1QU0A 4GKYA 4N7UA 3IM0A 1HX6A 4WM7A 1SACA