3KM5A

Crystal structure analysis of the k2 cleaved adhesin domain of lys-gingipain (kgp)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
179
structure length
179
Chain Sequence
b'GSADFTETFESSTHGEAPAEWTTIDADGDGQGWLCLSSGQLDWLTAHGGSNVVSSFSWNGMALNPDNYLISKDVTGATKVKYYYAVNDGFPGDHYAVMISKTGTNAGDFTVVFEETPNGINKGGARFGLSTEANGAKPQSVWIERTVDLPAGTKYVAFRHYNCSDLNYILLDDIQFTMG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Lysine specific cysteine protease
publication title Structure determination and analysis of a haemolytic gingipain adhesin domain from Porphyromonas gingivalis
pubmed doi rcsb
source organism Porphyromonas gingivalis
molecule tags Cell invasion
total genus 48
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07675 Cleaved_Adhesin Cleaved Adhesin Domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3km5A00
3V64A 3D6EA 1GANA 1RITA 1ULCA 1PZ9A 1V6KA 4FPOB 1FX5A 1LGNA 1ULEA 4BLIA 4PBPA 4P14A 4LBNA 2CL2A 2DVDA 1BXHA 5HCFA 1AXZA 1BZWA 2EAKA 3WV6A 2DU1A 2D6LX 3BTAA 2D43A 1C1FA 1OQ1A 2DTYA 4AWDA 3R4UA 2E51A 4KBBA 4RA0A 4XYXA 1FNYA 3OBTA 1CESA 3A4UA 3ZXEA 1WLDA 1WW4A 4YW1A 5AVAA 1W0OA 1JYIA 3WG2A 5HCBA 1CIWA 3KQRA 4RL7A 2P3JA 3M3CA 3VKOA 3VUOA 3WHTA 2ZGUA 5F9TA 3MEPA 3WCRA 4P9WA 3A0NA 1LOEA 1UMZA 1CJPA 2NZ9A 4YW3A 3WVJA 5GLVA 4FPJA 1A8DA 5DZEA 2GDFA 5CB7A 4YGCA 4YM3A 4LBQA 4UW4A 4FQZA 2B7YA 4Y1VA 2VUAA 1UKGA 2PELA 4TYSA 3ZSLA 5IT6A 3VKNA 1GZWA 3FLTA 1Z0HA 3ZPYA 1LGCA 3N7LA 1KDMA 1LENA 4WV8A 2XG3A 1SCSA 3ZSKA 4XJWA 4WVWA 3R4SA 1G9FA 1O4YA 3HR9A 1KJLA 1RIRA 2WT0A 2YMZA 3ILFA 5GLZA 1J1TA 5DZGA 2DVGA 3N7MA 3AYAA 1IS4A 2TEPA 3O0VA 3BOPA 3AP6A 1W6NB 3V0AB 4HL0A 2AENA 2VU9A 4UW5A 3T1MA 5L73A 5GALA 3WUDA 1Q8OA 4YGBA 3WDTA 1V00A 4GALA 4ASMB 2CYFA 2PHWA 5DUWA 3CNAA 4K21A 2H0BA 2P2KA 5EYYA 4ISQA 4TZDA 2JKBA 2CNAA 1WBLA 2FHRA 3NWKA 5GZFA 5DUXA 3AXEA 4YM0A 4GKXA 5T5OA 3W59A 1W6PB 2ES3A 1QNWA 2VW0A 4XJ9A 3WLUA 3AZZA 4AGGA 2A5ZA 2VW1A 2WQZC 4YZ5A 2ZGNA 1FYUA 5T5JA 4XXPA 4AVTA 1VLNA 1DFQA 2WSVA 2D6MA 3QLQA 1CVNA 2AGSA 1A3KA 1UPSA 2FMDA 5GZCA 2C9AA 1AXKA 1QGLA 3AZVA 1GSLA 1MZ5A 4OZXA 2DTWA 3KM5A 4BMEA 2ZABA 4Y1ZA 1GZCA 3NV2A 3USUB 2AUYA 1AJKA 4NO4A 1ENSA 2Z42A 1LESA 3AXDA 4ATEA 4AYUA 2EALA 1AX2A 4Q1RA 4FOQA 4L8QA 4Q26A 1S1AA 4R9AA 3M1HA 1V6NA 5DUUA 3ZXLA 1S0CA 2ZGRA 2JJ6A 2E53A 4JRAA 3ZYRA 1SLIA 3DUIA 2R0FA 2DVBA 3ZXKA 4CTEA 2ZGPA 1F5FA 3IPVB 3AP5A 2GALA 1W6MB 1UX6A 1FV3A 2I2SA 2ZGKA 2R0HA 2DUOA 3B9CA 3ZVXA 2ZMLA 4YM1A 4YG6A 5JVVA 3ILNA 2A3YA 3NV4A 3Q9OA 3HN1A 3IN9A 2DWRA 4PBOA 4YFWA 2GNMA 5EYXA 2EIGA 1BYHA 3AYEA 4YZ3A 2ZHMA 4FPCA 1ENRA 1F9KA 1LOFA 2NM1A 3ASIA 4FVVA 3WDWA 4K1YA 2CWMA 1DLLA 2ZHKA 1DQ5A 4Q8KA 5GZDA 1N1TA 2WT1A 4XHBA 3A0KA 5H9QA 3TB0A 3NV3A 2UWCA 2PHTA 3MPPG 1N1VA 1SLTA 5JDBA 1LU1A 4Q2FA 1QF3A 5H9SA 3VV1A 3OBRA 5FREA 5KXDA 4YGEA 1LTEA 2WLQA 1ULFA 3AJZA 3POWA 3B01A 1DQ1A 3AYCA 1UAIA 1OFSA 2V73A 1QOTA 3OJBA 1LOAA 4JC1A 1S0BA 3WG1A 5CBLA 3GALA 2VY0A 4P9YA 4Y20A 2ZZJA 1V6LA 4XBQA 4U2AA 4DRVA 2D6KA 4ZXKA 5DUVA 1WCSA 2DURA 2GNBA 4M3CF 3OY8A 1ULGA 2AH2A 1DYPA 3LSDA 5DXDA 3AP7A 1GZWB 3ILRA 3WDXA 4DRRA 2YV8A 3GNEA 3V65A 1G9AA 5FRAA 2UURA 4FOYA 2YROA 1LOFC 3RQ0A 2A7AA 3WUCA 1I3HA 1PZ7A 1ULDA 3FUOA 3IM0A 1IKPA 4GKYA 1SLLA 4XMAA 2P34A 1HQWA 2WNEA 1WLWA 4YW4A 1U0AA 2NYYA 3UJQA 1G8WA 4H55A 3FLRA 1SLAA 2V5YA 1SLCA 3RRDA 4GWMA 1DQ6A 2P3KA 4BLJA 5KXEA 3AYDA 2R16A 3POSA 2ZGMA 4Q27A 3WCSA 2RHPA 2PHUA 4M3CB 5T50A 2VXRA 1LHUA 1YO8A 3IKWA 3WHUA 3AX4A 1NXD1 4M00A 1IOAA 1C4RA 1DHKB 2ZGSA 2Q5TA 1LHVA 1S0EA 2G4IA 4XZPA 2GMPA 2NN8A 5GLWA 3RSJA 2PHRA 2ZKNA 3N3HA 3PMEA 1GKBA 3MW2A 3VKMA 1D2SA 3DGTA 4Z8BA 5CAZA 1QOSA 1PZ8A 4XJUA 4XTMA 1MZ6A 1JN2P 1IS5A 2WT2A 1ENQA 4C1XA 2JDZA 2LALA 3WG4A 1MR5A 4R9CA 3UJOA 3IMNA 1QKQA 3SISA 1JW6A 2A75A 3OPZA 1LGBA 2W39A 2CWSA 5E8AA 1N3QA 4ITCA 2UWBA 2DV9A 4Y22A 1KDKA 5JOXA 4AVSA 4Y1UA 1H9PA 1URXA 4Y24A 1GLHA 1LOBA 1V6MA 1S0FA 1QOOA 2D6OX 4FOVA 2A70A 1KITA 1WD3A 3H0OA 3V0BA 1ZM1A 1S0GA 3LSEA 1W6QB 2GMMA 1JHNA 1ONAA 1W6OA 2GNTA 2D3RA 4XDQA 4Y26A 4CZSA 1Y7BA 1BJQA 3N35A 4FPHA 4Q1PA 1UZYA 3RG0A 1GYKA 2NMOA 4F83A 2A3XA 2DUQA 3JU9A 3T1LA 3SLIA 1DGLA 5GZEA 3M2MA 1AXYA 1SLBA 1VIWB 1CPMA 2ARBA 3BODA 3LCPA 4LBMA 1AJOA 1D0HA 4YG3A 5CA6A 1VAMA 5GLTA 4NOTA 5T5PA 1H30A 1W6NA 3AP4A 4P9XA 3SH4A 3V0AA 4ATFA 4AGVA 3W58A 1LU2A 3AZXA 4UW3A 1DYKA 1DBNA 1GNZA 1HDKA 4M01A 1N3OA 2SLIA 5DG1A 1MS8A 1LEMA 2OUJA 4XJ8A 4YG0A 4BPZA 2E7QA 1DZQA 4FPLA 4XILA 3AFKA 2ZGLA 3ZSMA 1GBGA 2YZ4A 5IUQA 4ZKTB 4U36A 1WLCA 3BIWE 1IS6A 1W6PA 2JD4A 4WVVA 2JECA 3WDVA 3ZXFA 2JE9A 2ZAAA 1GICA 2AREA 2W08A 1CR7A 3SH5A 1CPNA 4I30A 2D7FA 1UZZA 2GMEA 4DQAA 4Y20B 1V6OA 3M3OA 1HKDA 3PVEA 1EPWA 1SBEA 1UL9A 5H9RA 3FUQA 5CNAA 1DQ2A 3OY8B 3B00A 1RINA 1I1EA 4XBNA 2ZGTA 4FP3A 2CTVA 1Q8VA 4K20A 4YW5A 1NLSA 2CY6A 1HQLA 2ZHLA 1DQ0A 1S0DA 2WKKA 2ZGOA 1LULA 1S0JA 4YZ2A 1AX0A 5EXOA 2GNDA 3UL2A 1LODA 4XOGA 2D6NA 4LBQD 1N3PA 3M3EA 4GA9A 3PVNA 1LEDA 1ZA4A 2YXSA 2EXKA 1N1YA 1G86A 3N7JA 1N1SA 4HANA 3APBA 1LCLA 3AK0A 1FATA 1GV9A 1Q56A 3M3QA 4YZ4A 3WG3A 2VW2A 4LBQB 2DU0A 5SV8A 5EWSA 3RMYA 1V6IA 1W6MA 5GM0A 3O0WA 1OKQA 1QDCA 1Q8QA 1WBFA 2P3IA 2P37A 3SITA 5T55A 5JMCA 1AZDA 2NP0A 5GLUA 4LBLA 3OYWA 1Q8PA 3FBYA 4LBOA 3POYA 5DG2A 1MS3A 1LHNA 2A6YA 3JUUA 4XIOA 4BQ1A 3WDYA 4XBLA 3RS6A 3PJQA 4YGDA 4JCKA 4AVVA 4BOWA 1YIFA 4XHXA 2PHXA 2EXHA 2W68A 2PHFA 3ZXJA 1MS1A 4PF5A 2ZBJA 2EXJA 1R1ZA 3QCWA 1AVBA 5KXCA 2UWAA 4LBKA 3D4KA 5IK8A 1QMJA 1MS9A 4FPFA 1G9CA 3C2UA 2HYKA 1KRIA 3ATGA 4YZ1A 1Q8SA 2R1DA 2ZA9A 3AZWA 1SACA 3VKFC 4IQPA 4Y22B 1SCRA 1KJRA 3N7KA 4FPEA 4C1WA 3TAYA 5GJ6A 3AZYA 1SBDA 2KM2A 4XTPA 2EF6A 4BM8A 2R49A 3V0BB 1F31A 1S0IA 1KQRA 4PCRA 4YFZA 4FP2A 1G9DA 1SBFA 5F5QA 1JBCA 1W6OB 2R1BA 3UK9A 4AGRA 3I4IA 1Z78A 2OVUA 4GXLA 1AF9A 4WZFA 3B3QE 3WOGA 2A71A 1TEIA 1WUVA 1JOJA 2D44A 1HLCA 1WW6A 1CONA 1QU0A 1DQ4A 4MYEA 1GNHA 3ENRA 5IK4A 2BQPA 2E7TA 2E6VA 1QNYA 2A6ZA 3O5SA 2GN7A 2ZHNA 2ENRA 2D3PA 1WD4A 1LOGA 2ZACA 1LJ7A 4SLIA 5T54A 1YRZA 2D6PA 1MS5A 1DIWA 4Y1YA 1O4ZA 4UW6A 2C5DA 4FPKA 4M3CA 1LHWA 4CRQA 2NMNA 3AJYA 1JYCA 1MVEA 5JLVA 5E88A 2VH9A 1W0PA 3ZYPA 5DZFA 2ZGQA 2ZMNA 3SNMA 3O0XA 2A3WA 2XB6C 3AP9A 3RMXA 4XXAA 4YLZA 4PQ9A 4FPYA 1FAYA 3I8TA 1A78A 3WNXA 2D3SA 1XQNA 1WW7A 4FPGA 1H9WA 5E89A 4D69A 1MS4A 3N36A 1N47A 4DS0A 5JOWA 1IS3A 2W52A 2DUPA 4FQ4A 3PVOA 3MW4A 4DPNA 3FLPA 4DFSA 4XE9A 2DVFA 3WZ1A 1CQ9A 1APNA 2DYCA 2OUHA 4GWNA 4W65A 1G7YA 5H9PA 1WW5A 2A6VA 1JXNA 5IK5A 1QDOA 3B69A 3D5OA 4YM2A 4Q8LA 1LOCA 3VKLA 2LTNA 5HCAA 5JOYA 5GZGA 3O12A 2YY1A 1C57A 3INAA 1W6QA 1AX1A 1V6JA 1GZ9A 1FV2A 2GN3A 1VALA 2WSUA 4XJAA 3U4XA 1FNZA 4R9BA 3ZSJA 1B09A 5T52A 3OGGA 3MW3A 1MVQA 3USUA 2AYHA 4LBJA 4M3CE 3WDUA 1CN1A 4XJZA 1SFYA 2AR6A 1YXWA 4K1ZA 2ERFA 1X50A 1MS0A 4ISRA 1MACA 1YYNA 4XIKA 3OYWB 1G9BA 1LHOA 2A6WA 3FFZA 3T2TA 5T5LA 4BMBA 1BQPA 2UU8A 2WJSA 1BKZA 4YW2A 4FOWA 3SH3A 2SBAA 1VAVA 2DVAA 2ZMKA 3R05A 4R9DA 3NV1A 4XMIA 1C1LA 4Y1XA 2ARXA 5KXBA 3IPVA 1JUIA 3HMYA 1LECA 2EXIA 1IKQA 1UN1A 2A6XA 1YI7A 5LK5A 2JE7A 3L2YA 2OW4A 5IK7A 5JOZA 5BYNA
chains in the Genus database with same CATH superfamily
4ZONA 3AVSA 5C3PA 3D6EA 1GANA 4LLFA 4QDRA 3K3OA 4CUCA 4BXSV 4EN7B 1MQTC 2D5FA 4IGPA 4D6SA 1UW8A 4BLIA 1XBFA 1VBD2 3IIAA 1POV3 1DGRA 3LIHA 4Q4V2 2R7EB 4NIAA 2YGMA 4QQLA 4ET7A 1HRV3 1COV1 1F8VA 3R6SA 1VMHA 2DU1A 3WV6A 5FPXA 3SCFA 2D6LX 1UXXX 4JKLA 5FLJA 1AL21 4I09A 1VAKA 4AWDA 2E51A 1IG3A 2ZX4A 1GP6A 1Y9MA 4KBBA 3UGGA 4ARXA 2DCTA 2B39A 4XUQA 3U1XA 5FYCA 1EAH1 1YNAA 4YW1A 1PMHX 1XOYA 1GZTA 2BVVA 3LFMA 4JZRA 5CZKA 1X8EA 1ULPA 2C24A 4F3JA 4L11A 5J1XA 2P3JA 4QB2A 4EN0A 5F9TA 4OUMA 2VAUA 4OMDA 3A0NA 1UYZA 4XF0A 2KR2A 1AR83 4YW3A 1FOD3 4EWAA 4CDXC 1A8DA 1R093 1OKOA 2VQUA 3J8F1 5DZEA 5B4NA 3H8UA 4MGYE 4AI0A 1UKGA 4TYSA 3ZSLA 2VZRA 3VDBA 3FLTA 3ZPYA 1Z0HA 4EJRA 4LK7A 3N7LA 3B94A 3GJAA 2XG3A 1SMVA 3RI9A 1SCSA 5E6HA 5A80A 1EV12 1ZRIA 3W5NA 3WT3A 3MUZ1 3OOXA 2IXKA 4QXCA 3O14A 5FYBA 3SEEA 3HR9A 1KJLA 1POV1 2DF7A 4KU7A 2YU2A 4LO5B 2YMZA 1EYBA 1F15A 3ILFA 2ZTNA 4B4QA 1J1TA 1RHI3 1UXZA 2CDOA 1XE7A 2XOMA 4PDWB 1GQPA 2DVGA 2TEPA 2QE3A 1PGW1 4AG4A 1PVC2 3AP6A 5FAXA 4CCMA 5FKBA 3VBHB 1PGL1 1ASJ2 2WAAA 5FWEA 1K5JA 4UBHA 1C28A 3VBOA 3IIIA 4K21A 3KWVA 3VBUB 3ZN4A 3HNMA 4P02B 4H14A 1WBLA 3X29B 2JG9A 2W1WA 2WO3A 1WMDA 2D5HA 3AXEA 2WO2A 1AR81 5T5OA 1FOD1 2ES3A 1R091 3AZZA 4AGGA 2J7MA 2ZEWA 3LA7A 2OXBA 2WQZC 3LDRA 3N9NA 1JTZX 1FYUA 3VZMA 4AVTA 5JXGA 4Q4X3 4AI3A 4N53A 2WSVA 3QLQA 2XKPA 4F7ZA 2KA3A 2AGSA 1A3KA 4QDQA 5HXMA 1BEV2 2ZXQA 4CU7A 4X6RB 1BK0A 2ZABA 4Y1ZA 3ZYHA 1CGPA 2QQUA 1L7RA 1X9TA 1RHI1 2YYOA 4BYYA 5C3SA 2AUYA 3E5UA 2Z42A 2WWSA 1UY1A 3THCA 1AX2A 1OH4A 2J1VA 1GWMA 4QX2A 3JB8A 4FOQA 2WQ4A 4Q0QA 4Q26A 1NZCA 4KGQA 4B7EA 5FZ4A 1S0CA 2B42B 3ZFFB 4JTNA 1WMXA 4JGZB 4LO6B 4RQPB 1AHSA 1NE6A 4MH0E 1O3RA 1SDDB 2VVEA 2WIIB 2JG9C 5FZHA 2GALA 5G04L 2RMU3 4XFHA 4B29A 5FPVA 3D8CA 5FOJB 3Q9OA 4Q4X1 3TEZA 2DWRA 4YFWA 4J25A 2EIGA 3AKQA 3FHAA 3J7HA 4YZ3A 2ZHMA 4FPCA 4J1WA 3ROUA 1F9KA 1LOFA 2WDBA 3ACGA 3T3YA 1CIYA 3I3DA 4BXFA 5FZIA 1DLLA 2ZHKA 1DQ5A 5BNOB 2JB8A 4DY3A 3H8OA 3FE5A 4LO8A 5DAVA 1J84A 5JDBA 1DP0A 4PT6A 1JUHA 1SZBA 2IXIA 5FREA 2Y0OA 2VMEA 1X36A 1CAUB 1ULFA 5K8SA 3H1MA 3ZN5A 2F17A 2FCVA 3I3QA 3NMBA 4XQ4A 5FR3A 2LM3A 3I54A 3BPZA 5CFDB 3VL8A 3VZNA 4CEWB 5C4WB 4P9YA 5C7GA 3MO4A 4N7IA 2QQVA 3W9AA 5JZGA 1V6LA 3L2HA 4HK9A 4DRVA 4XEZA 1PM7A 1QJU3 2F6BA 5LRSA 1WCSA 1LB2A 2VULA 2RMU1 1IPKA 5A7PA 3NSTA 4LORA 1J1LA 3LEMA 1R083 5CEHA 1GZWB 2IXJA 4IV3A 2YV8A 2D93A 2UURA 4JV4A 2YROA 1LOFC 1UNBA 2CHHA 3ON7A 5EHDA 1J59A 3NNLA 4HPKB 2F4PA 3FZ3A 2VZUA 5IVFA 4NHMA 1QY4A 2YDEA 4LJHA 1IZ3A 3MLLA 5FZEA 1SLLA 2R073 5J96B 2E31A 2HKXA 4KU8A 4GMP3 3OBZA 4H55A 1GQHA 2ZEXA 3FLRA 4RS5A 3BCWA 4ORFA 2V5YA 5FO7B 3RRDA 2XKOA 4AQ6A 1TMF2 1AR92 3QH6A 3DPRB 1ZBE2 2RR13 4MX3A 5FZOA 3JZVA 3VBFB 2G1MA 1UOFA 4N90A 2R16A 3POSA 4PI2A 4CDWB 2ZGMA 4ZU4A 3WCSA 3WHUA 1LHUA 1YO8A 3IKWA 3QACA 5JZGC 4M00A 1C4RA 2Z4FA 1LHVA 1S0EA 1QJU1 1REFA 4CYDA 1XNCA 1IGOA 2GMPA 5GLWA 5FZ7A 3RSJA 1VR3A 1GP4A 1PX3A 5A7QA 3W20A 1W2AX 1XNKA 4Z8BA 2P6HA 4CDUC 2C1FA 1IS5A 1R081 2Q30A 1AYN1 2WT2A 2V4AA 3DYMA 3JQXA 2B9UA 4IV3C 5F5IA 4RYDA 2R061 3N9PA 2W1QA 4O7XA 2JDZA 4QM9A 4C1XA 5LA1A 3WG4A 3MF9A 3P5BA 1MR5A 4JGYC 1V70A 4DUXA 3CLPA 1NLRA 3I3EA 2R071 2CWSA 4QQOA 1NCRC 4LQRA 3KV4A 2DV9A 3POFA 4AHWA 5A32A 5DPNA 3BTYA 2WA3A 1PIV2 3M7AA 2RR11 3ZFGC 3ZDSA 2FDHA 1S0FA 2D6OX 2J1RA 4N43A 2A70A 1UU5A 1WD3A 2VOXA 3H0OA 5C8CA 2HJIA 4NVPA 2Z79A 5FBZA 3IDAA 4QPIB 1ZREA 1PK6C 3POJA 5FV3A 5LWBA 2GNTA 1Y7BA 1YCIA 4QPGB 3DXUA 1O91A 3FHQA 2R043 2E33A 2NMOA 4YYOA 3RG0A 2A3XA 2DUQA 4E27A 5BUVA 2XONA 2A73B 1HRI3 3SLIA 2OZ6A 1W05A 3M2MA 2W5FA 1CPMA 2YHJA 2RJLA 3BODA 4LBMA 4A42A 1D0HA 2KXLA 2OQ7A 4YG3A 2IUWA 5CA6A 5GLTA 5T5PA 3ZFEB 4NJ4A 1H30A 1WCUA 3SH4A 4CUAA 1CWPA 4NRMA 3VBHA 4ATFA 4D6RA 2YFZA 3W58A 1LU2A 3OUJA 5FY4A 4BJ0A 1GNZA 1OPMA 2IXHA 3FFQA 5APAA 2OUJA 4YG0A 3QH7A 4BPZA 2EIEA 4FCAA 4FPLA 4QGLA 3AFKA 2V5DA 1NCQB 1VB4A 2VTXJ 3ZSMA 2PQSA 4PLNA 5IFTA 1H4HA 4A44A 4ZZ8A 2BW8A 3EYPA 4XVHA 5JPNB 2JE9A 2AREA 2W08A 2XJVA 4X6QB 3SH5A 3C7OA 5JMCA 5L36A 3TN92 1FMD2 2D7FA 3AVRA 4PI0A 5C8CC 2GMEA 2P6CA 1MZFA 3GGLA 1V6OA 3C3VA 5IATA 1HKDA 4NRPA 5C9AA 3JBG3 2BVBA 3VLBB 1EPWA 1SBEA 1UL9A 1GWKA 1VBE3 2R041 3FUQA 4WM7A 2Q8EA 1RUNA 3GF6A 1GNYA 1ZZ6A 4AAPA 2QCSB 3VZLA 3IMMA 1TE1B 4FP3A 5JI9A 1RGSA 1Q8VA 2DBIA 4YW5A 4KI5M 4PDWC 1QXJA 3FC0A 1W8UA 4EE2A 1D4M2 1NUKA 1YWKA 2ZHLA 3O7OA 4LNVA 4OQ9A 2YPDA 4O61A 3URFA 4A41A 2WKKA 3LEGA 3CZUA 3LD8A 3VBHC 1S0JA 3BALA 3OCPA 4AOCA 5L9RA 1LODA 4XOGA 5A7SA 5FYUA 3ZFFA 5CFCB 2BWAA 1RXGA 4RQPA 4GB33 3N7JA 2EXKA 4MGIE 1N1SA 1FATA 1GV9A 4CP9B 1JHJA 3U75A 3R4DB 4LBQB 2DU0A 5SV8A 5EWSA 4OQ8A 1OH3A 4NHLA 5DDJ3 5FZ0A 5KBFA 1YFUA 2W1UA 1QDCA 2WL1A 2W87A 3LOIA 4S2HA 5FP8A 2P37A 1H6YA 3PL0A 3HVDA 4Y5SA 3SITA 3JBG1 1UY2A 4LBLA 5GLUA 3OYWA 1Q8PA 3FBYA 1JYVA 1RUOA 5DG2A 1MS3A 1VBE1 4WM7C 3ZR6A 1RUF3 3JUUA 2QQLA 5BNOA 2XJQA 5J36A 1Q3EA 3DKQA 2YC4A 1HN1A 1FPN2 1REDA 1Y43B 2JB4A 1HW5A 2XQXA 4XHXA 2W68A 5FCCA 3ZIWA 4CPBA 4AI1A 2VOTA 5KC6A 4PF5A 2ZBJA 3UT0A 3KT7A 1B35B 2EXJA 3PNAA 1CAUA 1J58A 2RG4A 1QMJA 3C2UA 1KRIA 4G9SB 3ATGA 3AMQA 1Q8SA 3I2JA 3ZFFC 4JGZC 4CEWA 4GB31 1RUI3 2GC0A 3AKRA 4RQPC 2W1SA 4WM8B 5EPAA 1SCRA 2HWD1 5LBFA 3N7KA 3DN7A 4L99A 4BDVB 1GQGA 1NY71 4JHTA 2BBAA 5IHRA 3GBWA 1XSQA 3IWZA 5GJ6A 5DDJ1 4IGQA 4CEYA 1J3RA 5LY2A 3I2FA 4AAXA 1ZRCA 4IESA 2GH8A 4Q4V3 1BVP1 4MHUA 4QXBA 4YFZA 1KQRA 5LEJA 1C8NA 3HOBA 4FP2A 1G9DA 4QB6A 3OGJA 3LB9A 1JBCA 3A7QA 1JYWA 4Q0UA 3VDDA 4HPKA 5BNOC 3WOGA 3WW3A 3CF6E 2ADDA 2BDRA 2A71A 3VHPA 1JOJA 2VMCA 1HLCA 1CONA 1QU0A 3M4FA 2YB7A 1GNHA 3ENRA 5IK4A 1R64A 3I59B 3QBQA 4BA6A 1NLQA 5LW9A 2FCUA 3CBNA 2ENRA 2C6SA 2D98A 5EJ3A 1OLRA 4L9BA 4M0NA 1K45A 5AC92 3DPRA 4CCKA 3VBFA 4GQ7A 4C91A 1O4ZA 5CFDC 1RUI1 2W9XA 4FPKA 5C4WC 4CEWC 3KLSA 4IEUA 2W0XA 4Z1VA 3U0ZA 3CEWA 2NMNA 5C70A 1JYCA 1UYYA 2XL9A 4NR1A 5FYSA 4O9EA 3TEYA 5DZFA 2ZGQA 5JSPA 4TTGA 4CEYC 4RR3B 5KHIA 4YLZA 3CMGA 2ZCWA 1QQP2 4Q4V1 4C0HA 1AR72 1P8JA 4ONUA 3SCHA 1XYOA 3I2IA 3H8XA 3WNXA 1XQNA 1WW7A 1TVGA 1W06A 3J26N 4HN0A 1ULOA 2CGNA 2EAAA 4AF9A 3N36A 4AQ2A 4AK3A 1CJDA 1ASJ3 5A7WA 2X09A 1POV0 4S2DA 2W91A 1IS3A 1CX4A 2W52A 4SBVA 4TN7A 1W9YA 2DUPA 4FQ4A 3ZX7A 5EFUA 4WVMB 4DPNA 3FLPA 1XNTA 1ZX5A 2TNFA 4XE9A 5FZFA 3BGAA 3OD4A 1APNA 2DYCA 2Z5WA 4DZGA 3BB6A 1G7YA 5H9PA 5HCAA 3D5OA 1YJKA 3DPRC 4HLTA 1SDWA 5A7NA 4YVSB 2FZ1A 3VBFC 1H2NA 2Y33A 4R52A 4D6QA 5E1RA 4CDWC 4NIHA 3O12A 5FJKA 1C57A 5IW0A 2RS12 1VB2A 3CU7A 3H1WA 4DXZA 4MG2A 1BEV3 1FNZA 3ZSJA 3EMRA 1XRUA 3L9JT 5I0UA 4LBJA 4M3CE 3WDUA 1PNGA 2PHLA 5LATA 5J7MA 3N4MA 2A1XA 4FBFA 4YARA 3Q8BA 4CUGA 2PN5A 1ZRDA 1OC1A 4D3WA 3NL1A 5FLHA 1YQ6A 3H3UA 3MV11 2XLFA 4RD7A 1ALYA 4XIKA 4YW7A 1G9BA 3RZJA 5EZWA 4NUBA 1C8M2 4FOWA 5FZAA 3ZXGA 1ASJ1 1YI9A 2DVAA 2WQ8A 4S2FA 2JDNA 3IAPA 4B4PA 2FDKA 4LE3A 4Y1XA 2QZ2A 2HWE3 5FZGA 3MICA 4BCUA 1J3QA 2Q1ZB 3MHZA 2BOJA 5AVPA 1YQ2A 2JE7A 3OGRA 5HV4A 4D0QA 2VZSA 3D0JA 2BWCA 1XYNA 5IK7A 1IHMA 2RS32 1PO22 5ANQA 1RITA 1ULCA 1PZ9A 4FPOB 4QPIC 2OIIA 1ULEA 4PBPA 2D40A 3O1OA 4LBNA 1BEV1 4QPGC 2DVDA 5HCFA 1BXHA 4H3WA 3FX3A 4COZA 2FDGA 2Y6FA 2XVGA 3ZPOA 1BBT3 3BTAA 2XHKA 3I2KA 3N9MA 4XF3A 2ET1A 3DL3A 3R4UA 1UIJA 3F2ZA 2DDUA 3LWCA 1BVVA 2JDKA 3A4UA 3K3NA 3OBTA 4IEPA 4D8MA 1VRBA 2AZ5A 5AVAA 1W0OA 3RNSA 2W95A 3VZOA 3WP5A 3ZFEC 4B8EA 3WG2A 3KQRA 4RL7A 5ABJB 3WCRA 2XBO3 3AM2A 4Z2WA 5CFCA 2W94A 1RL3A 1LOEA 1UMZA 1CJPA 1XE8A 2B9VA 2HWE1 3ELNA 3RGBA 3WVJA 1CX1A 2Q8DA 4FPJA 2NPIA 3BU7A 2GDFA 3AB0A 1A6CA 1ZA7A 4LBQA 3NO8A 1I5ZA 2B7YA 4FQZA 4Y1VA 2RS52 1LGCA 1WKYA 1OLQA 3VDCA 3K48A 3WY6A 1LENA 3O1UA 4QQHA 4WV8A 1W9TA 2GC2A 4A6SA 2QKDA 1Q5OA 2QDRA 3KV6A 4IV1B 1E5IA 4XCAA 4NIDA 4XUPA 4E4DX 3BKZA 4HONA 4QHOA 5FPZA 2WT0A 5IYYA 3M8LA 3HD8B 2P5BA 2ORZA 5A3UA 1PO12 3N7MA 1IS4A 3FWEA 4OULA 1BBT1 2OKXA 2XVKA 3BOPA 1UY4A 5L9BA 3H3LA 4HL0A 1QJFA 2VCMA 4QX1A 3V0AB 4UW5A 5L73A 1Q8OA 4YVWA 4YGBA 4FO9A 3CIHA 1V00A 5F3GA 4ASMB 3CO2A 1TMF3 1AR93 2YBSA 2H0BA 1ZBE3 4FXKB 4EWEA 2VZVA 1EUUA 2XBO1 5IWFA 2Q8OA 1E5RA 3E5QA 5DUXA 1MEC1 4D7YA 5CFCC 4WM8A 1W6PB 4XJ9A 1HIXA 1QNWA 2BFUL 1O6UA 5FYHA 1GOFA 3D82A 4M4RA 2YGLA 1HXS2 2A5ZA 2VW1A 4BQ4A 1ODNA 1UOJA 1K5MB 4LO7A 5FY1A 3Q8CA 1W9FA 1ENXA 2D6MA 3C8XA 4KWLA 3BIEA 1CVNA 2VMGA 3LEIA 2IVJA 1AYM3 1JYTA 2YU1A 1GSLA 4A3XA 2C4XA 4P08A 4BMEA 4CA9A 1V9U1 5FY0A 3USUB 2W2IA 1QJY3 3CJIB 2XJUA 4K7JA 3AXDA 1LESA 4AYUA 2I74A 3WF3A 3ZYGA 4XFIA 5JWPA 5F2SA 3LGRA 1V6NA 2Y6JA 1B35C 3OB8A 4C0BA 5LCWL 2ZGRA 1WWYA 4E4SA 5FDBA 5DAXA 3ZYRA 4BB3A 5F5AA 1CAVA 1TMF1 2HBTA 2VZOA 1ZBE1 2GU9A 2IXCA 3ZXDA 1MQTA 3MV01 1LNSA 3WX5A 3UYJA 4XW3A 4WM8C 2I2SA 3PLQA 4IDZA 4TLGA 3ZVXA 5F2WA 1OD3A 4YM1A 4QU1A 2NQYA 3ZO0B 2VC9A 5JVVA 3O1TA 1U12A 1KS4A 4RR3A 5JMOA 4OVEA 2W3JA 3AYEA 3WP6A 1YIPA 4FVVA 2NM1A 3ASIA 1AYM1 5FPLA 1PVXA 4C90A 4Q8KA 5LA2A 4CXXA 1N1TA 4XHBA 2PHTA 1TME2 1W8FA 2WBKA 1QJY1 1SLTA 4UFIA 1LU1A 3VV1A 4V2VA 4PHZA 3E6CC 1YUDA 3HPNA 3PIGA 4XURA 3AJZA 1DQ1A 3AYCA 1UAIA 1OPOA 2H6CA 1U5IA 4JC1A 5FYMA 1LAJA 3RYKA 1QXRA 4HOOA 3ZIXA 4XUOA 4Y20A 2HWC2 5FP3A 3S5AA 2RM22 4U2AA 1OXCA 2RJKA 5J09A 4GJZA 4QHZA 2FBEA 2GNBA 2LROA 3OY8A 4E4HA 2Y8KA 4FI9A 3VD7A 5A6XA 4GJYA 1X8MA 3LSDA 4P5HA 2QQJA 3RZLA 2HYXA 3WDXA 2V72A 4RR3C 4Y4YA 5I0SA 1G9AA 1CAWA 5CIRA 5FRAA 3BU0A 3G6JB 1C5HA 2PHDA 4MHRA 3RQ0A 2O1QA 2BBVA 2A7AA 3HBZA 3WUCA 2TUNA 5JXHA 4LKSA 3FUOA 1D4M3 5DAQA 1UO9A 1X9PA 4C8DA 1HQWA 2JKXA 2BJSA 2HWF2 2NYYA 4GD4A 2PAKA 1G8WA 1SLAA 3NQHA 1DQ6A 3VBSB 4Y33A 4RHV3 2P3KA 4ARYA 2J1AA 2FMYA 4BLJA 4COYA 3IT8A 1D7PM 4Q27A 1UKRA 4RGKA 3ZXLA 3MFCA 3KGZA 2ZJCA 3AX4A 4I2OA 2VBBA 2RV9A 4YVSC 5FFOC 4BQ3A 5JPMB 5L19A 3FBMA 4W6YA 1T2XA 2ETEA 1LR5A 2J42A 2PHRA 1GKBA 1HRV1 3VKMA 4X8NA 3DGTA 5LBEA 5CAZA 1PZ8A 5LZ6A 5DQ0A 5FXWA 1W8NA 4Q29A 1K12A 3ITQA 2WZ8A 4RGAA 2LALA 1FPN3 5K7PA 4MGSA 3U07A 4R9CA 3UJOA 3T2QA 2XLAA 3IMNA 5FMBA 4ASKA 3GDBA 1D4M1 1JW6A 3THDA 4LITA 1LGBA 3MBWA 3PDQA 4GZ9A 5D21A 5E8AA 5LBBA 4WBBA 4Y22A 1O4TA 4AHZA 5FO9B 4Q4W2 4Y1UA 3RJRA 4LLOA 3NJVA 4RHV1 1JYNA 3VDAA 1V6MA 4NMIA 2JX9A 4UFJA 1QOOA 3WP4A 1YHFA 4FOVA 5FMDA 1KITA 3I2HA 3V0BA 4ES8A 1S0GA 5K0UB 1O3QA 4JDMA 1OURA 2Y26A 1CAXB 2WZR3 3T4HB 1JHNA 4BE3A 1ONAA 1RUE3 1WA4A 4XDQA 4YNIA 5D1IA 1O5UA 3WP3A 3ZMNA 4FPHA 3ABZA 1UZYA 2H6BA 1GYKA 4IV1A 4F83A 2B8MA 5FPUA 1DG6A 1L7QA 3JU9A 5DAPA 3IZOA 1DGLA 5GZEA 3NNGA 5A3WA 1AXYA 1VIWB 2WNOA 4IE4A 3LCPA 1AJOA 3IAQA 1LRHA 2W92A 5BY5A 3TYJA 1UYXA 1FPN1 3AP4A 4P9XA 2V09A 3V0AA 5JSRA 2K9ZA 4XC9A 4UW3A 1DYKA 2J1TA 1HDKA 3GBGA 5DG1A 1N3OA 4CCLA 1MS8A 1LEMA 1T6GC 2E7QA 3ACFA 5ABJC 2G19A 3LOBA 1DU3D 4LK6A 1OOPB 2Y34A 4ZZ5A 2ZGLA 2YZ4A 5IUQA 4QQ2A 4U36A 1NG0A 1WLCA 3BIWE 1W6PA 2JD4A 4WVVA 2JECA 1NQJA 3WDVA 3R0RA 2QVSB 3TEXA 2ZAAA 5A3NA 1GICA 2G9GA 4XAAA 2ZX2A 4BHPA 4GH4B 1JZ7A 3M3OA 2WZR1 4Q0PA 1H0BA 5F1RA 1RUE1 2EVXA 1QQP3 1ND2B 1OA3A 3KHBA 2VCCA 2HEWF 4JX0A 5JUVA 5CG8A 4GIQA 5A33B 5KHGA 4K8RB 4IV1C 2P3YA 1V0AA 5FKCA 3HEIA 3DECA 1RINA 1OUXA 2BTVC 3T0AA 2CTVA 3PU3A 4JTOA 5T3NA 1KFUL 4OI1A 3ZN6B 3AMPA 4LIVA 1K42A 4KGGA 4I3PA 1VMJA 1ZZ7A 1ZBA2 1HQLA 4MXWA 1DQ0A 1UWWA 1S0DA 2MEV2 3OGVA 2JIJA 1LULA 4B1MA 2RVAA 1AX0A 5EXOA 3U11A 1F2NA 5A70A 2VUJA 4JKKA 1N3PA 5CKQA 3HIFA 5LBCA 1XC6A 2QQOA 1LEDA 3AMMA 2JDAA 4AEKA 5LEKA 1ZA4A 3NJYA 4AQSA 4G3YC 2XXZA 3M3QA 3AK0A 4Y4RA 5A7OA 3SKVA 5FMCA 1DCSA 4YZ4A 1RUG2 3WG3A 4CDUA 4HKLA 4XFAA 3UETA 3KCCA 1O7FA 2XJTA 3H7YA 1OKQA 1WBFA 1Q8QA 4LT5A 1K5MC 3ZMOA 3LZZA 4PIXA 5BXXA 4PIZA 2P3IA 4MV2A 3VD5A 3AMNA 2WFF3 4XACA 4JGYA 5T55A 1QQP1 4CE8A 2NP0A 3VD4A 3POYA 2VOVA 5F32A 4I3GA 5C5UA 4LKEA 1KS5A 1NCRA 3N9LA 1BMV1 3RS6A 4QKNA 2PLV2 1GR3A 1UX7A 4AVVA 1RUJ2 1YJLA 3ALQA 4BOWA 1XU2A 2EXHA 2E9QA 3CJIC 4YRDA 5DABA 1MPXA 3FMGA 1QJX3 3QCWA 1AVBA 3ORJA 5KXCA 3K51A 5IVCA 1MS9A 5FZDA 1G9CA 1PK6A 5EV7A 2XR4A 2HWB2 1HB2A 4LO4B 2WS92 1KJRA 3C7GA 1S2BA 2RS33 5IJRA 4FPEA 3LAGA 2BFUS 1PO23 1NZIA 3DV8A 1JU3A 1RUD3 3F95A 3B02A 5I8YA 4AVCA 1SBDA 2VUCA 3BVCA 3KD4A 4XPVA 4CDQB 3WNLA 2EF6A 2CU5A 2YUEA 3VHRA 1S0IA 4EV0A 4D94A 3C7HA 1IG0A 3ST7A 2WFF1 4PLOA 1XNBA 2R1BA 1W6OB 4LE4A 5F5QA 5FZ1A 1JOBA 3I4IA 2PQQA 4HBNA 4NPLA 4NPRA 4AGRA 4MLOA 2BZDA 1OI6A 3USSA 1RUH2 1VRH2 4GMP1 2OYZA 2Y38A 5A1LA 1TEIA 1VMFA 3DYOA 4I0BA 5FYIA 1WW6A 4IUGA 1UU6A 4RFT0 2E7TA 4I02A 3MFAA 5FMOS 2GN7A 1QJX1 3W5MA 2D3PA 4DINB 3J7MA 5T54A 3VBSA 5IVEA 4JQTA 4AHXA 4META 1RYYA 2VNVA 2D6PA 4N9HA 1MS5A 1EUTA 3CJXA 3SMHA 3M3IA 4UW6A 2XDVA 1DYOA 1OQEA 5DN2A 2RS53 4TWTA 4CRQA 2RS31 4I01A 5E88A 1RUD1 1W0PA 4LEJA 4Y5TA 2ZMNA 3O0XA 3AP9A 2XB6C 4PDWA 3ES4A 4PJYA 2RDRA 1JZ3A 2RE9A 3EBRA 4KWJA 3I8TA 4A7KA 1PO13 4LUKA 2D3SA 1S2KA 2FZ2A 2Y6GA 1H9WA 4AFDA 5CADA 5LK7B 1MS4A 4CSWA 3VBUA 4OUSA 5JOWA 4XUTA 2JEMA 2IXLA 4XABA 5JSOA 4EZ4A 1AL22 3PVOA 2WO1A 1A8MA 4DIQA 2QTWB 4IEWA 2OUHA 1VBB2 1FI2A 1Y9QA 2XH6A 4GWNA 4H2AA 3S5QA 2A6VA 3VBSC 2BYVE 4XFBA 1QDOA 4Z07A 4YM2A 4Q8LA 3KF5A 3VKLA 5JOYA 3U78A 4FTSA 5I0RA 3K4ZA 3ZYJB 2G9ZA 3IDCB 2X5IB 3A21A 1U5YA 2RS51 4K8FA 4J6GA 2TBVA 2PA7A 3WQ1A 2I45A 3KF3A 1HRI1 3J8F2 1WGPA 5FZ8A 2Q1FA 4XJAA 2YBPA 1B09A 1SPPB 2G9FA 2WZEA 3MW3A 4LTAA 1JOPA 5T52A 3VD3A 1JU4A 1RVF3 1CN1A 3OBAA 4XJZA 2WLPA 3TRSB 1PO11 3E97A 2YC2A 5ACA3 1W8OA 2CDPA 1R1A3 3NVCA 4BMBA 3LF7A 3T2TA 1BQPA 2Y6KA 2ARAA 4YW2A 4R8HA 4JGZA 2E26A 3U14A 2MHFA 1OMIA 3VBUC 1QWRA 3R05A 5FYZA 1PGW2 4DEVA 2HEVF 1L3JA 3LA2A 3NV1A 4N9IA 1C1LA 2BOIA 3KT1A 3MDPA 3PTRB 4R9DA 4UF0B 4DY5A 4HK8A 3RYRA 1UN1A 1PGL2 1OOPA 2MNGA 3HQXA 2C26A 1J3PA 5B4XA 5BNPB 3JB4C 4DEQA 4URAA 3S57A 1XNAA 4QX5A 4XAEA 2OW4A 3Q8EA 3OTFA 3V64A 2GC3A 3GZTB 1OUSA 5K0UC 2Z69A 3CHXA 2XJRA 1AR82 1FX5A 2JDHA 1FOD2 4M4PA 5FZ6A 4NROA 1ND2A 5FZKA 4UFKA 2CL2A 4UFHA 1TG7A 2WABA 3P3PA 1BZWA 1RVF1 2Y64A 2Q0AA 1OF3A 2D43A 1OQ1A 2DTYA 1WA6X 3TEWA 3ZN6A 4XYXA 3ZXEA 5ACA1 2WWJA 1FNYA 3NNFA 1CESA 3HNBM 4KNCA 1RUC2 1R1A1 4IXLA 1NA1B 4NAOA 3S7EA 1JYIA 4QMAA 4FXGB 1KD7A 1RHI2 5HCBA 5CFDA 2VTXA 3POGA 5C4WA 4CXWA 2ZGUA 2J22A 3VBRB 3W21A 3MEPA 4P9WA 4EROA 3T2OA 1MZEA 2NZ9A 2WO7A 1HV1A 2CAUA 2RM23 1OOPC 5BNQA 4YGCA 1VBD3 4JRLA 2PELA 1I5PA 3RFRA 1GZWA 4CU6A 4UOJA 5LRRA 3BTXA 4I0WB 1KDMA 4AEMA 2BPA2 5FZ3A 2HBUA 3GBFA 4GH4C 5GKAC 4RFRB 1RUF1 2NLRA 2OQ6A 3GZUC 4XJWA 3ZYIB 3R4SA 1G9FA 1ND2C 1O4YA 2QQIA 5A3PA 3WSOA 3HN3A 5A32B 3I3MA 4HVOA 1E5SA 1F35A 4HG6B 3O0VA 3A22A 2WNUB 5I93A 1OBNA 3O1PA 5IAXA 4KMQA 5FIXA 2VU9A 2JWPA 3WUDA 1W3VA 3B7MA 4TLFA 3UNPA 3WDTA 3KVAA 4CCEA 4EZHA 4HZFA 4CDWA 2PHWA 4UI9L 5EYYA 1UY0A 2JKBA 2CNAA 3BPSA 1S55A 2VCBA 3PUIA 1YFYA 2VMHA 3NWKA 1W8WA 4MO3M 3BOWA 1EV13 3PUQA 4GKXA 4OHXA 3EQEA 4OI2A 2RM21 3FL7A 5BNNB 1VBD1 3B93A 2ZGNA 5I0DA 5T5JA 1RTVA 4XXPA 1VLNA 3U37A 5A1AA 4CDQA 1AR62 3J4UH 2FMDA 1PVC3 4OZXA 1AXKA 1QGLA 3AZVA 4PIYA 1MZ5A 4COWA 2VMFA 2DTWA 4V2WA 5D2AA 2ZEYA 5A6ZA 3T30A 1GZCA 4NWVA 3N9OA 1W03A 1AJKA 4NO4A 1J83A 4JHZA 4KH9A 2PYTA 2OZJA 4ATEA 4PF1A 4XCBA 1UZWA 3Q8FA 2JDMA 3VGIA 4LA2A 4R9AA 3ZOIA 2WFPA 3POBA 3I97A 2ADEA 1HB1A 2PFWA 2W46A 2WN3A 3E5XA 4Q4W3 2JJ6A 2E53A 3LPGA 4JRAA 5F5CA 4FAHA 2CGPA 4UFMA 4COVA 4QPIA 3WF4A 2R0FA 4CTEA 3ZXKA 1F5JA 1F5FA 4QPGA 1EV11 3ACHA 3AP5A 3IPVB 1OA2A 1UX6A 4XFFA 4W8JA 4CDXB 3UESA 4CCCA 2R0HA 3B9CA 1ZZBA 4YG6A 2J1SA 2A3YA 3NV4A 3HN1A 3IN9A 4PBOA 2VM9A 5EYXA 4R4XA 5I8TA 2WWUA 4CDQC 1JS9A 3ZFEA 1PVC1 3WDWA 1W8ZA 3K46A 5TSWA 4CPBD 4K1YA 2GP5A 2CWMA 3BUCA 4DXTA 5FO8B 2BNMA 2VBDA 5H9QA 2XQRA 4HKOA 3NV3A 3MPPG 1AYN2 3VZKA 2GH2A 1H8VA 2R062 4MGZE 2VZ1A 3DEMA 4ZY9A 3OBRA 4CP2A 1NCQA 3GZAA 2WLQA 1WCKA 4QPWA 2XWBB 3B01A 3O1RA 2WZPP 1OFSA 2V73A 1QOTA 3OJBA 3P3NA 3PVBB 1LOAA 3U4SA 3E1F1 4FT8A 1OF4A 2R072 5D8AB 1NX9A 3JD72 4Q4Y2 3WG1A 3GJBA 3GALA 5CBLA 2ZZJA 1PX4A 3ME2A 2IVIB 4ZXKA 2X5IA 1EY2A 1W8HA 4CU9A 5DUVA 1DZRA 1TNFA 5FJHA 2AH2A 4JQRA 4G4FA 5L9VA 3NRUA 3AP7A 1SPPA 3ILRA 4K9SA 4XF1A 5DXDA 3O1SA 3GNEA 4XFGA 2IC1A 2DCKA 2Y6HA 3AMHA 1E57A 1CZTA 4NHYA 2UY8A 4FOYA 4AI2A 1OLME 4LKDA 4KWUA 3WW2A 1UYPA 5IVVA 3MYXA 4A7YA 5A6QA 3WXPA 3IM0A 3D3AA 4RGGA 3OPWA 1IKPA 4GKYA 1H1IA 2B46X 2MEV3 2P34A 2VTFA 1RJ7A 1UZVA 1WLWA 2WNEA 4ZS3A 4YW4A 3AKPA 1UQXA 4IERA 1KFXL 2UYAA 4CP9A 1NCQC 1SLCA 3KSCA 4UF0A 4GWMA 3SHRA 3CKHA 3GCXA 2UYBA 4QB1A 2AC1A 5JR2A 5BNPA 5A3TA 5C33A 1DLCA 5SV5A 3VBOB 3IBMA 1EPZA 5FK8A 5T50A 4QX3A 2E63A 2X53S 2GSYA 3MPBA 2ZGSA 1DHKB 4BK4A 2Q5TA 2JG9B 2X5IC 1QJZA 2XUEA 3LPFA 2ZKNA 3IDBB 3M70A 1D2SA 3UKVA 4Q5OA 1O59A 4YPJA 1VJ2A 1BHGA 4N53B 5ANNA 3K2OA 1ENQA 3KQ4B 4LMFA 4MGKE 4XETA 3RI8A 4OHYA 1B35A 2RJ2A 4KG8A 3HNYM 2RDSA 4W50A 5FZMA 5LY1A 5J37A 4LXLA 1NA1A 3O1VA 2LRPA 2DCZA 4PLMA 1LKNA 2W39A 2MEV1 1N3QA 4BH9A 3VHNA 5FWJA 2I07B 4QGNA 3BTZA 1JZ8A 1KDKA 4XUNA 2JXAA 3WQ7A 1URXA 4Y24A 2WS93 1GLHA 1LOBA 2DBNA 2XVLA 5ISLA 2XWJB 5BNPC 4A4AA 1CZVA 1W2TA 1YQ8A 1SEFA 5G05L 4OI0A 1OD5A 4P00B 1U5ZA 5CG9A 2BRTA 2VQ0A 4Y26A 1I6XA 4XDOA 3EXUA 1BJQA 1WCDJ 2BP6A 3N35A 4AFAA 2VZTA 4NE9A 3SQOA 4A45A 4AEDB 4ZU7A 3T2PA 1NOVA 5LB6A 1BLZA 1HN0A 1RUH3 1BCXA 3AL6A 2ARBA 4IEQA 4LKFA 4X8PA 2JE8A 3ZKYA 1VRH3 3I59A 4B1LA 2WINB 3JBG2 4NOTA 2RDNA 1HV0A 4EWDA 2EIBA 3ZR5A 2QQWA 4L92A 1W2OA 2ZX1A 3ACIA 3WF1A 4AGVA 1AR91 1PIV3 3AZXA 5B2GB 1NA1C 2ZOEB 3HBKA 4M01A 4XJ8A 3NW4A 1ZYBA 1DZQA 4XILA 2QQNA 4GMP0 3MIBA 2RDQA 3AKSA 4CP0A 1GBGA 4QDSA 4ZKTB 4AW7A 3GM8A 2WS91 3E6DA 3HJRA 5KHKA 5BNNA 3DF0A 3OEBA 1CR7A 1W9WA 4I30A 4E8DA 1UZZA 4DQAA 3H9AA 4B3NA 5FK7A 2HWD2 4GWJA 3OD0A 4CCOA 4OUEA 1NY72 2ZAHA 3PVEA 4A3ZA 1X33A 3RZMA 4IE6A 1HQNA 5H9RA 2O8QA 2GAUA 1DGWA 5DDJ2 4DB5A 4E2QA 1DQ2A 3B00A 4Q0VA 1X7NA 2ZGTA 2O8OA 4UYBA 4K20A 5LA9A 1W90A 4WVMA 1ZZCA 5K4LA 2L9LA 3WF0A 2WNUC 3FHIB 3THTA 1UOGA 4OHZA 2HLEA 2JIGA 2ZGOA 4IEOA 4QD2A 3OGSA 4P9JA 3PUAA 1PIV1 2GNDA 2FDIA 1VBB3 1US3A 3IDEA 4YVSA 3RVHA 3ZXAC 4LBQD 2BERA 5HV0A 1A34A 3PVNA 4OI4A 3TN93 1FMD3 2E32A 3HQUA 3RJ2X 3WW4A 4EN8B 2Z2SB 3GHNA 1G86A 3S7IA 1X82A 3JQWA 1LCLA 2VNOA 4IGOA 4LPLA 3NNJA 4RS5B 5AFEA 5A3OA 3WW1A 5C8WA 1V6IA 5FZOB 3T09A 4P9LA 5GM0A 3OSDA 3O0WA 4NAMA 5BNNC 4FSJA 4FTBA 4BU2A 3OUIA 1RUI2 2Y60A 1HJGA 4JDOA 2JG8B 2AEYA 2ZX3A 4UXAA 2BV4A 1D4VB 4LBOA 4I0AA 1DDLA 1LHNA 2A6YA 4XIOA 1I9RA 4BQ1A 3WDYA 4AVBA 4XBLA 3PJQA 5L7OB 1WZXA 5C6CA 1RXFA 5CYYA 1XXNA 4K3UA 2YG0A 2J1EA 2PHXA 3MLJA 1MS1A 2BGOA 4JAAA 2OPKA 4XQDA 1VBA2 3NKTA 4CCJA 4CXYA 4AEJA 3D4KA 5FP4A 5K9YA 4W4ZA 1VBB1 2XGXA 4FPFA 3DCQA 3CZJA 5D8AA 3ZYBA 4YZ1A 1QXPA 3TN91 1FMD1 3I2OA 2R1DA 2VO5A 2ZA9A 3AZWA 2Q4SA 3OPTA 4IQPA 1KXGA 5F39A 1M06G 4IEZA 4BQ2A 4CUBA 2BEOA 4IEYA 4URTA 3HWJA 4EN6B 2QZ3A 3K4DA 4ASLA 3UGFA 4BQWA 3AZYA 4RN5A 5LA0A 5FLIA 4N43B 2W47A 4QKFA 2WR9A 2R49A 5C8CB 3KVBA 1PM4A 4BWOA 4OZOA 5IVYA 3TOJA 3WD5A 1SBFA 4LOTA 2OA2A 2EA7A 3MGUA 5ERLA 2OVUA 4GXLA 1JMUB 4CCNA 2VMDA 3B3QE 1G6NA 1RUC3 5ABJA 2XMLA 3Q8AA 1RC6A 1TQ5A 1WUVA 4H7LA 2D44A 4YWAA 3RWKX 1O3SA 1W8TA 2VUDA 1DQ4A 4MYEA 4QX8A 3LKJA 2E6VA 4COUA 2CSGA 1UPIA 5BPXA 4INDA 2GP3A 2ZACA 4FFGA 4SLIA 5KR7A 4OHWA 4QHBA 4Y3OA 1W3XA 1VE0A 2BGPA 2VOKA 5M0TA 5D8AC 2K0GA 1OHFA 3PTYA 2C5DA 4N8MA 5FY7A 5HXVA 5FXVA 4HFSA 4NN0A 3AJYA 1T6BX 1MVEA 3HT1A 3RYPA 3RZHA 4NIIA 2H0VA 4AHYA 4AZZA 3RMXA 4PQ9A 3ETQA 1RB8G 1H1MA 4QX0A 2Y6LA 4FPYA 2VECA 1A78A 4DMIA 4QXHA 5C9AB 3J7NA 4GAZA 1VBC2 5FZLA 4OLLA 3I3BA 1HX6A 2WC2A 4WM7B 3RWNA 3ES1A 5FYTA 1FT9A 5EP9A 4D69A 1RUC1 1N47A 3POEA 5AC93 1GFF2 4CU8A 5FP9A 1YQCA 2R32A 3LDBA 1SFPA 1ODMA 3MW4A 3GHMA 4DFSA 1RMU2 1ZZ9A 2DVFA 2YC0A 3WZ1A 2WUHA 1PNFA 2ZPXA 3O1MA 1WW5A 1K5MA 1JXNA 5IK5A 1OT5A 1LOCA 2LTNA 3VHOA 4D7SA 2VJXA 2ZS6B 3VBOC 4ZHNA 1H2KA 2PXJA 2HWE2 3AC0A 1WLTA 1AR73 2VL4A 1V6JA 1AR63 1GZ9A 3J7LA 4R4ZA 2LS6A 5FZ9A 4HT1T 2IFWA 2VZQA 2WNVB 3JCIA 3OGGA 1MVQA 4KL1A 3USUA 3CJIA 1DGRN 4AEDA 3U10A 4OHVA 1POQA 1XSRA 1SFYA 2AR6A 4O9GA 1YXWA 2R30A 4K1ZA 4N53C 4QKDA 2DCYA 1X50A 1MS0A 1MACA 4ISRA 2VGDA 3OYWB 1H2MA 2A6WA 2WJSA 1BKZA 4YW6A 3PMSA 5AC91 3T0DA 1BBT2 2XL7A 3T0BA 3K4AA 4A7ZA 1ND3B 1JUIA 1YQ5A 1LECA 2EXIA 2RS13 3H3ZA 5JAXA 2VBPA 5IVBA 3T08A 2JDPA 5LK5A 2OPWA 2XJPA 1YFXA 3TWIA 5FYYA 4ZS2A 4EN9B 2K46A 1W0NA 4TXWA 3RZKA 3L2YA 2GZWA 4MADA 1TZOA 4IE5A 4FFIA 2XBO2 4LA3A 4XF4A 5BYNA 5JOZA 2PAMA 1Y9GA 5CVRA 1MEC2 1NE4A 1V6KA 3B9IA 1AR71 3HAGA 2QFEA 1LGNA 1QIQA 1AR61 3ZLIA 4CP1A 4DUWA 4P14A 1TNRA 2ATFA 3AL5A 5JR7B 1M4WA 1C8M3 4CEYB 2X8KA 2P1BA 1AXZA 2EAKA 1W99A 2IZWA 3RZZA 4AEDC 3J9SA 1C1FA 1AYN3 1QH7A 4RA0A 3KT4A 2N7GA 1PMJX 2R063 1WLDA 1WW4A 4KQ7A 4MXVA 4BZ4A 2FD8A 4QU2A 2JDUA 3VDDB 1CZSA 1V9U2 3NKGA 1CIWA 3SKJE 2R6QA 3M3CA 4XDPA 3VKOA 3VUOA 3WHTA 1XE0A 4UWDA 5F6LB 1OVSA 3JD73 4Q4Y3 2E7AA 4Y5Z0 4AI9A 2XHNA 3EHKA 4W6WA 2RS11 3PU8A 5FXZA 5GLVA 3WNKA 1JODA 1DF0A 5CB7A 4DXSA 4YM3A 3V56A 4UW4A 1PGSA 2VUAA 2ID4A 2VZ3A 3ZSEA 5IT6A 1UD1A 2O0OA 3VKNA 1NAEA 3NAPB 3ZDVA 4UT5A 1ZNPA 4EYUA 3WNMA 2JG8A 3BN6A 4OYUA 5FPAA 3ZSKA 2CV6A 4WVWA 3D0SA 4AE2A 1RIRA 1OVPA 2DCJA 1C8M1 3GXUA 3KZ4C 3MLKA 5GLZA 4QGMA 4AL9A 5DZGA 4AXOA 1JYXA 4LHLA 3AYAA 4P9GA 5L7OA 3WNOA 1AYM2 1W6NB 5F3IA 3ZFGA 2AENA 3T1MA 1REEA 5GALA 2VE1A 2CAVA 2JDYA 5FBJA 3PIJA 4Q0SA 1D0GA 4GALA 2CYFA 4OFGA 1QJY2 3CNAA 5DUWA 1Z7S2 2P2KA 4TZDA 2BNNA 4ISQA 4PQQA 5A7WB 2ZX0A 3VL9A 2FHRA 4FFFA 5GZFA 3JD71 1PO21 4Q4Y1 5HPOA 1EP0A 5KC5A 4YM0A 1PHMA 4CZSA 3W59A 2VW0A 2IFRA 3WLUA 4IEXA 4RS5C 4IE7A 5I8SA 5C3QA 4YZ5A 3THPA 2JENA 1DFQA 5CISA 3SCGA 5F3CA 3H7JA 4RSUA 1RJ8A 2PAEA 2V4VA 1H8TB 2XJSA 1UPSA 5GZCA 2C9AA 5FQ0B 3KMHA 2DFBA 2JG8C 5FZBA 4FFHA 2XUMA 3KM5A 1COV2 4QAWA 4AFMA 1Y4WA 1NXMA 1FXZA 3NV2A 4QXKA 4Z82A 2AEZA 4XZUG 1ENSA 1WMEA 4F8AA 2EALA 5L7OC 4Q1RA 1EAH2 3MIFA 5FPBA 2ZZQA 4L8QA 4MVTA 4O65A 4GWIA 1F4AA 2QDNA 1S1AA 4J1XA 3PUSA 3M1HA 5DUUA 1HXS3 5K0UA 1SLIA 3DUIA 4NIGA 2WAOA 1HB3A 1CAXA 2DVBA 5FY9A 2ZGPA 3RZGA 1ZZ8A 1ZRFA 1SFNA 1UU4A 1IQDC 1SHWB 3CDZB 2VXJA 4LIUA 4HSLA 2OX0A 1W6MB 1FV3A 2ZGKA 4KG0A 2DUOA 3DXTA 5F37A 2ZMLA 3ILNA 5LASA 3K77A 3S6PA 3AFGA 1L7LA 2GNMA 3I2DA 4K6BA 4N43C 1BYHA 5E16A 2WYFA 4K40A 1ENRA 5CKMA 3KB5A 4QQPA 1QH6A 1HRV2 3T4VA 5GZDA 2WT1A 3TB0A 5FUIA 3A0KA 5A3MA 3FN9A 3CQOA 4LHSA 2VQTA 1PMIA 2UWCA 4CCDA 3S0MA 1N1VA 4Q2FA 1AL0G 1QF3A 3PURA 5H9SA 1UMHA 2QQKA 5KXDA 4YGEA 1LTEA 4QWNA 3POWA 3H1YA 4HKWA 4NHKA 1HXS1 4NRQA 2FQPA 1CD3G 4MGQA 1O3TA 1S0BA 1WMFA 4A6OA 4AI8A 4DO0A 2VY0A 4GH4A 3TNPB 5HCHA 4XBQA 1R092 2C0ZA 2D6KA 3B5LB 4MSVA 3WR0A 2P4EA 3ZYFA 4DUVA 5HI0A 5A33A 4E4ZA 3ZKUA 4CVUA 4RHV2 2HWD3 2DURA 3MIEA 3PUHA 4M3CF 5IVJA 1ULGA 1DYPA 1GWLA 5JXIA 2WNVA 4L0PA 1TME3 4DRRA 3V65A 3OUHA 5C71A 4IL7A 5A3LA 2LUWA 2QJVA 5F8PA 5FXXA 4BISA 2VR4A 3UKTA 1JI6A 1I3HA 1PZ7A 5C9AC 1ULDA 5HBAA 2ILMA 3MF6A 4XMAA 3ZM8A 1GP5A 1ZVFA 3KV5A 5FZCA 4MZUA 3VD9A 5EJ1B 1U0AA 3UJQA 2HWC3 3KGLA 4KBZA 1IPJA 4BK5A 1WCQA 1ND3A 4L2NA 3MIGA 4YVWB 5KWRA 5KXEA 3AYDA 1W28A 1DZTA 3P6BA 5FYVA 2RHPA 2PHUA 4M3CB 2VXRA 2DFCA 1NXD1 1GU3A 1IOAA 4NPMA 4NWWA 5DAWA 1Y3TA 2G4IA 1GMMA 2ZKLA 4XZPA 4AVAA 5IFPA 2HH9A 2NN8A 1NT0A 2K2SA 3N3HA 4Q4X2 5I91A 3PMEA 5IAVA 3MW2A 1NYWA 3LFIA 1K3IA 1QOSA 4XJUA 1UOBA 1YFWA 4XTMA 1MZ6A 1JN2P 4BIOA 1TME1 2WNVC 2WN2A 2WZR2 2HWF3 3G7DA 4V1PA 1ZRRA 1RUE2 3E6BA 1Q43A 3H8RA 4FAGA 3TBDA 2F4LA 1UIKA 1YC61 2VPVA 4E9KA 2B5HA 3EB7A 3JXSA 3VZJA 1QKQA 2AACA 2BUKA 3SISA 2A75A 1H4GA 1GOGA 1VBA3 3ECQA 3OPZA 5I0TA 1H6XA 4QPYA 5FP7A 2P17A 2VOWA 4ITCA 2UWBA 4QKBA 1IQAA 2HWC1 5C3RA 5JOXA 4AVSA 2VNGA 5F7UA 1H9PA 4OMCA 1XJAA 1ND3C 2LW8A 3PHMA 3POIA 1ZM1A 1CAVB 2EICA 3LSEA 5C5TA 2X29A 1MQTB 1W6QB 3OEAA 3NAPA 2GMMA 1O8PA 3QOPA 4ZU5A 3MI8A 1W6OA 2RMU2 2D3RA 3OG2A 1UZ0A 4Q1PA 2BNOA 3BI3A 2Q1MA 5AFBA 3KV9A 1KGYA 4DOUA 3LQCA 3T1LA 1XNDA 3NJXA 1SLBA 2J1UA 4N7UA 5JI7A 1XPWA 2HWF1 5F6KA 3UGHA 4ZXEA 1VAMA 2ET7A 2VNRA 4HN1A 4LUMA 3NNMA 1W6NA 3KS7A 3SXWA 2FDJA 3S30A 4BIFA 1OSGA 3EJKA 2QUOA 1BMV2 1VBA1 4IETA 5DMYA 1DBNA 4DXRA 2SLIA 3VDDC 4P5YA 4D7TA 3HT2A 2BU9A 3I49A 4FTEA 1IS6A 2B45X 3ZXFA 1F4HA 2X05A 1XU1A 1XB9A 4OCTA 4IE0A 1CPNA 1QJU2 2X10A 3LA3A 4LOSA 3ETPA 3GZEA 4Y20B 5A1FA 3NAPC 1UMIA 1H8TA 1HB4A 2FDFA 5FQ0A 1R082 5CNAA 3OY8B 3UKNA 2YFUA 4ES9A 1I1EA 1VBC3 4XBNA 4JVAA 3SEPA 5C3OA 2XPJA 5EIYB 5JCTA 4UFLA 1NLSA 4MUVA 1CAWB 2WFF2 2D97A 2CY6A 1OFNA 4AFBA 2B4KA 1OQDA 4Q4W1 4XF9A 1D2QA 1RMU3 4YZ2A 3UL2A 2D6NA 2WA4A 4QM8A 4GA9A 3M3EA 2YXSA 1JZ4A 1N1YA 3LDKA 4WZCA 3TNQA 4HANA 2RR12 3APBA 1QJX2 1Q56A 2VD7A 4LULA 2VW2A 2PMWB 3RMYA 1IPSA 1W6MA 1W2NA 2BGCA 3WF2A 4A2UA 4AQTA 1BK1A 4BQYA 5FOBB 5J3UA 2ARCA 3GYDA 2JD9A 2OT7A 1AZDA 4BQ5A 1XYPA 1C3HA 1UF2C 2PTMA 1ZBA3 1H8TC 3ACLA 5J98B 1RUD2 3RDIA 4IW3A 2CGOA 3C7EA 3PJYA 5FUNA 4E8CA 4MGTA 3LIGA 5JXJA 4YGDA 1VBC1 4JCKA 1YIFA 4B4RA 4L97A 4HVQA 2PHFA 3ZXJA 4LR4A 1C5IA 3SC7X 2C9KA 2VZPA 1R1ZA 3MZHA 1AUYA 1RUG3 2UWAA 2O14A 2OS2A 4LBKA 3DKWA 4TSVA 5IK8A 1RMU1 1ST8A 3OF1A 1H1AA 2HYKA 1JZ6A 2QNKA 2ZEZA 3K75B 1SACA 5FTTC 3VKFC 2WYSA 4Y22B 4XFCA 3MIHA 2VG9A 4S2GA 4C1WA 3TAYA 1MEC3 2EIDA 4MOAA 1UY3A 2XLGA 5A6YA 2KM2A 3I7DA 1JZ5A 4XTPA 3QD6A 1JH5A 2PLV3 4BM8A 3V0BB 1RUJ3 4YSFA 1F31A 4PCRA 4HETA 1NQDA 2R042 3A23A 1S2EA 5CU1A 2Y0IA 5F3EA 3UK9A 3WNPA 1ZBA1 1HRI2 1JZ2A 3KHCA 1GUIA 1Z78A 1AF9A 4WZFA 3BYWA 4NHXA 4UBGA 4HVRA 1GOHA 1YEWA 1SQ4A 1O5LA 1QEXA 1W9SA 2WRAA 1STMA 3DYPA 3VBRA 2HWB3 1V9U3 2BQPA 1QHDA 1QNYA 2A6ZA 3O5SA 2ZHNA 3KCXA 1W04A 1RUG1 3AKTA 1WD4A 5EQUA 2Q8CA 1LOGA 4WVZA 1LJ7A 4EQVA 2VVFA 5J48A 1YRZA 3C7FA 1ACCA 3EO6A 2QBXA 4Y1YA 1DIWA 4M0HA 2ORXA 1US2A 1E5HA 4M3CA 5FY8A 1LHWA 2HEYF 4H7MA 5JLVA 2VCAA 2VH9A 3ZYPA 4HMZA 1VPHA 2IWGB 2A3WA 1SG3A 3IB3A 3SNMA 4XXAA 2PLV1 2QQPA 1RUJ1 2WNUA 5CKNA 3WQ0A 3N9QA 1VBE2 1FAYA 4DNYA 5BV6A 4FPGA 4KWKA 4QX7A 5E89A 1QJEA 3LEKA 3I2GA 4P9IA 3H42B 1RVF2 3VN4A 4DS0A 2KD7A 3RPQA 3VBRC 2HWB1 1UCXA 1HJFA 1Z7S3 5ACA2 4Z92B 4AFCA 1R1A2 1CQ9A 1O8SA 1NKGA 4MXWB 4E2SA 4W65A 4GULA 4HXCA 5FMOL 2VQAA 2YBKA 3B69A 4GB32 4E2GA 4XQWA 3FJSA 4QT6A 4YVWC 3WEZA 5JZGB 1W2UA 3WQBA 1YLLA 5GZGA 3WNNA 4HSJA 2GC1A 2YY1A 3INAA 5KHJA 1W6QA 1H2LA 1AX1A 1VP6A 1FV2A 2GN3A 5FY5A 1VALA 2WSUA 5KHHA 4CDUB 3U4XA 4Z2AA 2UY9A 4R9BA 1RUH1 5JIUA 4IEVA 4ZPIA 1OLMA 4IV3B 3UV9A 2AYHA 1COV3 1VRH1 4JDNA 3WINE 1AL23 1RUF2 4AR2A 4BQXA 2ERFA 4JGYB 1YYNA 2MPFA 1LHOA 1EAH3 3FFZA 1U5XA 2VVDA 3P1IA 4JKMA 2UU8A 5T5LA 3CL1A 1NCRB 1S4CA 2QQMA 2SBAA 3LE0A 1VAVA 4LHKA 3SH3A 3VB9A 1DGWX 3NJZA 5JIAA 2ZMKA 3GCWA 3MUY1 2VMIA 4XMIA 4W6XA 1KEXA 2ARXA 1Z7S1 2FCTA 3IPVA 5KXBA 3HMYA 3ZFGB 4B7KA 1IKQA 4CDXA 4LHNA 2A6XA 3KCYA 1YI7A 3J8F3 1OA4A 4UAPA 5EJZB 2JICA 3MIDA 5FUPA 1W39A 2YPJA 3H50A 1PK6B 3HQRA
chains in the Genus database with same CATH topology
3D6EA 1GANA 4LLFA 4EN7B 1MQTC 2D5FA 1UW8A 4BLIA 1VBD2 3IIAA 1POV3 1DGRA 4Q4V2 2YGMA 4QQLA 1HRV3 1COV1 1F8VA 3R6SA 3WV6A 2DU1A 5FPXA 3SCFA 2D6LX 5FLJA 1AL21 4I09A 1VAKA 4AWDA 2E51A 2ZX4A 4KBBA 2DCTA 2B39A 1EAH1 1YNAA 4YW1A 2BVVA 4F3JA 1X8EA 4L11A 2P3JA 4EN0A 5F9TA 4OUMA 3A0NA 4XF0A 1AR83 4YW3A 1FOD3 4EWAA 4CDXC 1A8DA 1R093 5DZEA 3J8F1 3H8UA 4MGYE 4AI0A 1UKGA 4TYSA 3ZSLA 3FLTA 3ZPYA 1Z0HA 4EJRA 3N7LA 3B94A 5J09A 2XG3A 1SMVA 3RI9A 1SCSA 1EV12 3WT3A 2IXKA 3O14A 3HR9A 1KJLA 1POV1 2DF7A 4KU7A 4LO5B 4B4QA 2YMZA 1EYBA 3ILFA 2ZTNA 1J1TA 1RHI3 1XE7A 4PDWB 2DVGA 2TEPA 2QE3A 1PGW1 4AG4A 1PVC2 3AP6A 5FAXA 3VBHB 1PGL1 1ASJ2 4UBHA 1C28A 3VBOA 4K21A 3VBUB 3ZN4A 4H14A 1WBLA 3X29B 2JG9A 1WMDA 2D5HA 3AXEA 1AR81 5T5OA 1FOD1 2ES3A 1R091 3AZZA 4AGGA 3LA7A 2WQZC 1JTZX 1FYUA 3VZMA 4AVTA 4Q4X3 4AI3A 4N53A 2WSVA 3QLQA 2XKPA 4F7ZA 2KA3A 2AGSA 1A3KA 1BEV2 4X6RB 2ZABA 4Y1ZA 1RHI1 2YYOA 4BYYA 2AUYA 3E5UA 2Z42A 2WWSA 1AX2A 3JB8A 4FOQA 2WQ4A 4Q0QA 4Q26A 1NZCA 4KGQA 4B7EA 1S0CA 2B42B 3ZFFB 4JTNA 4JGZB 4LO6B 4RQPB 1AHSA 1NE6A 4MH0E 1O3RA 2VVEA 2WIIB 2JG9C 2GALA 2RMU3 4XFHA 4B29A 3D8CA 5FOJB 3Q9OA 4Q4X1 2DWRA 4YFWA 2EIGA 3AKQA 4YZ3A 2ZHMA 4FPCA 4J1WA 3ROUA 1F9KA 1LOFA 5BNOB 1DLLA 2ZHKA 1DQ5A 4DY3A 3FE5A 4LO8A 5JDBA 1JUHA 2IXIA 5FREA 2Y0OA 1X36A 1CAUB 1ULFA 5K8SA 3H1MA 3ZN5A 4XQ4A 2LM3A 3I54A 3BPZA 5CFDB 3VL8A 3VZNA 4CEWB 5C4WB 4P9YA 4N7IA 5JZGA 3W9AA 1V6LA 3L2HA 4HK9A 4DRVA 4XEZA 1PM7A 1QJU3 2F6BA 5LRSA 1WCSA 1LB2A 2VULA 2RMU1 1IPKA 3NSTA 1J1LA 1R083 1GZWB 2IXJA 4IV3A 2YV8A 2D93A 2UURA 4JV4A 2YROA 1LOFC 1J59A 4HPKB 2F4PA 3FZ3A 4NHMA 1QY4A 2YDEA 1IZ3A 3MLLA 1SLLA 2R073 5J96B 2HKXA 4KU8A 4GMP3 4H55A 1GQHA 3FLRA 4RS5A 5FO7B 3BCWA 4ORFA 2V5YA 3RRDA 2XKOA 4AQ6A 1TMF2 1AR92 3QH6A 3DPRB 1ZBE2 2RR13 4MX3A 3ZFGA 3JZVA 3VBFB 4N90A 2R16A 3POSA 4CDWB 2ZGMA 4ZU4A 3WCSA 3WHUA 1LHUA 1YO8A 3IKWA 3QACA 5JZGC 4M00A 1C4RA 1LHVA 1S0EA 1QJU1 1REFA 4CYDA 1XNCA 1IGOA 2GMPA 5GLWA 3RSJA 1VR3A 1XNKA 4Z8BA 4CDUC 2C1FA 1IS5A 1R081 2Q30A 1AYN1 2WT2A 3JQXA 2B9UA 4IV3C 2R061 4QM9A 4C1XA 2JDZA 3WG4A 3MF9A 1MR5A 4JGYC 1V70A 3CLPA 1NLRA 2R071 2CWSA 4QQOA 1NCRC 2DV9A 4AHWA 2WA3A 1PIV2 3M7AA 2RR11 3ZFGC 3ZDSA 1S0FA 2D6OX 4N43A 2A70A 1UU5A 1WD3A 2VOXA 3H0OA 5C8CA 2HJIA 4NVPA 2Z79A 5FBZA 4QPIB 1ZREA 1PK6C 2GNTA 1Y7BA 1YCIA 4QPGB 4YYOA 1O91A 3RG0A 2R043 4E27A 2NMOA 4FBFA 2A3XA 2DUQA 5BUVA 2A73B 1HRI3 3SLIA 2OZ6A 3M2MA 1CPMA 2YHJA 2RJLA 3BODA 4LBMA 1D0HA 2KXLA 4YG3A 5CA6A 5GLTA 5T5PA 3ZFEB 1H30A 3SH4A 3VBHA 4ATFA 3W58A 1LU2A 1GNZA 1OPMA 2IXHA 3FFQA 2OUJA 4YG0A 3QH7A 4BPZA 4FCAA 4FPLA 4QGLA 3AFKA 1NCQB 1VB4A 3ZSMA 4PLNA 1H4HA 2BW8A 5JPNB 2JE9A 2AREA 2W08A 2XJVA 4X6QB 3SH5A 5L36A 3TN92 1FMD2 2D7FA 5C8CC 1CGPA 2GMEA 1MZFA 1V6OA 3C3VA 1HKDA 5C9AA 3JBG3 2BVBA 3VLBB 1EPWA 1SBEA 1UL9A 1VBE3 2R041 3FUQA 4WM7A 1RUNA 3GF6A 1ZZ6A 2QCSB 3VZLA 1TE1B 4FP3A 5JI9A 1RGSA 1Q8VA 4YW5A 4PDWC 1QXJA 3FC0A 1D4M2 2ZHLA 1YWKA 3O7OA 4LNVA 3URFA 2WKKA 3VBHC 1S0JA 3BALA 3OCPA 1LODA 4XOGA 3ZFFA 5CFCB 2BWAA 4RQPA 4GB33 3N7JA 2EXKA 4MGIE 1N1SA 1FATA 1GV9A 3R4DB 4LBQB 2DU0A 5SV8A 5EWSA 4NHLA 5DDJ3 5KBFA 1YFUA 1QDCA 2WL1A 3LOIA 4S2HA 2P37A 3SITA 3JBG1 5GLUA 4LBLA 3OYWA 1Q8PA 3FBYA 1RUOA 5DG2A 1MS3A 1VBE1 4WM7C 5BNOA 1RUF3 3JUUA 2XJQA 5J36A 1Q3EA 1FPN2 1REDA 1Y43B 5FCCA 1HW5A 4XHXA 2W68A 3ZIWA 5KC6A 4AI1A 4PF5A 2ZBJA 3KT7A 1B35B 2EXJA 3PNAA 1CAUA 1J58A 1QMJA 3C2UA 1KRIA 4G9SB 3ATGA 3AMQA 1Q8SA 3ZFFC 4JGZC 4CEWA 4GB31 1RUI3 2GC0A 3AKRA 4RQPC 4WM8B 1SCRA 2HWD1 3N7KA 3DN7A 4L99A 1GQGA 1NY71 3GBWA 3IWZA 5GJ6A 5DDJ1 4CEYA 1J3RA 1ZRCA 4IESA 2GH8A 4Q4V3 1BVP1 5LEJA 4YFZA 1KQRA 1C8NA 4FP2A 1G9DA 3OGJA 3LB9A 1JBCA 4Q0UA 3VDDA 4HPKA 5BNOC 3WOGA 3WW3A 3CF6E 2A71A 3VHPA 1JOJA 1HLCA 1CONA 1QU0A 3M4FA 1GNHA 3ENRA 5IK4A 3I59B 3QBQA 4BA6A 2ENRA 2D98A 5EJ3A 1OLRA 4L9BA 4M0NA 5AC92 3DPRA 3VBFA 4GQ7A 4C91A 1O4ZA 5CFDC 1RUI1 4FPKA 4CEWC 5C4WC 3KLSA 4IEUA 2W0XA 4Z1VA 3U0ZA 3CEWA 2NMNA 1JYCA 4NR1A 2XL9A 4O9EA 5DZFA 2ZGQA 5JSPA 4CEYC 4RR3B 5KHIA 4YLZA 2ZCWA 1QQP2 4Q4V1 4C0HA 1AR72 4ONUA 3SCHA 1XYOA 3WNXA 1XQNA 1WW7A 3J26N 4HN0A 2CGNA 2EAAA 4AF9A 3N36A 4AQ2A 4AK3A 1CJDA 1ASJ3 1POV0 4S2DA 1IS3A 1CX4A 2W52A 4SBVA 2DUPA 4FQ4A 3ZX7A 5EFUA 4WVMB 4DPNA 3FLPA 1ZX5A 2TNFA 4XE9A 3OD4A 1APNA 2DYCA 2Z5WA 4DZGA 3BB6A 1G7YA 5H9PA 5HCAA 3D5OA 1YJKA 3DPRC 4HLTA 1SDWA 3VBFC 4YVSB 2FZ1A 1H2NA 4R52A 5E1RA 4CDWC 3O12A 1C57A 2RS12 1VB2A 3CU7A 3H1WA 4DXZA 1BEV3 1FNZA 3ZSJA 1XRUA 3L9JT 5I0UA 4LBJA 4M3CE 3WDUA 1PNGA 2PHLA 5J7MA 3N4MA 4YARA 1ZRDA 2PN5A 4D3WA 3NL1A 5FLHA 1G9BA 3H3UA 4RD7A 2XLFA 1ALYA 4XIKA 5EZWA 3ZXGA 1C8M2 4FOWA 1ASJ1 1YI9A 2DVAA 4S2FA 4B4PA 4LE3A 4Y1XA 2QZ2A 2HWE3 3MICA 4BCUA 1J3QA 2Q1ZB 5AVPA 2JE7A 3D0JA 2BWCA 1XYNA 5IK7A 2RS32 1IHMA 1PO22 1RITA 1ULCA 1PZ9A 4FPOB 4QPIC 2OIIA 1ULEA 4PBPA 2D40A 4LBNA 1BEV1 4QPGC 2DVDA 5HCFA 1BXHA 4H3WA 3FX3A 4COZA 2XVGA 1BBT3 3BTAA 2XHKA 4XF3A 2ET1A 3DL3A 3R4UA 1UIJA 4J1XA 3LWCA 3OBTA 1BVVA 3A4UA 4IEPA 2AZ5A 5AVAA 3RNSA 1W0OA 3ZFEC 3VZOA 3WP5A 4B8EA 3WG2A 3KQRA 4RL7A 5ABJB 3WCRA 2XBO3 3AM2A 4Z2WA 5CFCA 1RL3A 1LOEA 1UMZA 1CJPA 1XE8A 2HWE1 3ELNA 3WVJA 4FPJA 2NPIA 3BU7A 2GDFA 3AB0A 1A6CA 4LBQA 3NO8A 1I5ZA 2B7YA 4FQZA 4Y1VA 2RS52 1LGCA 1OLQA 3K48A 3WY6A 1LENA 4QQHA 4WV8A 2GC2A 2QKDA 1Q5OA 2QDRA 4IV1B 4E4DX 5FPZA 2WT0A 3M8LA 3HD8B 1PO12 3N7MA 1IS4A 3FWEA 4OULA 1BBT1 2XVKA 3BOPA 3V0AB 4HL0A 4UW5A 5L73A 1Q8OA 4YVWA 4YGBA 4FO9A 1V00A 4ASMB 3CO2A 1TMF3 1AR93 2H0BA 1ZBE3 4FXKB 4EWEA 2XBO1 2Q8OA 3E5QA 5DUXA 5CFCC 1MEC1 4D7YA 4WM8A 1W6PB 4XJ9A 1HIXA 1QNWA 2BFUL 3D82A 2YGLA 1HXS2 2A5ZA 2VW1A 4LO7A 1K5MB 1ENXA 2D6MA 4KWLA 1CVNA 2VMGA 1AYM3 1GSLA 4A3XA 4BMEA 1V9U1 3USUB 1QJY3 3CJIB 2XJUA 4K7JA 3AXDA 1LESA 4AYUA 2I74A 3ZYGA 4XFIA 5JWPA 3LGRA 1V6NA 1B35C 4C0BA 2ZGRA 4E4SA 5FDBA 3ZYRA 1CAVA 1TMF1 3ZXDA 1ZBE1 2GU9A 2IXCA 1MQTA 3WX5A 4XW3A 4WM8C 2I2SA 3PLQA 3ZVXA 4YM1A 3ZO0B 2NQYA 5JVVA 1U12A 1KS4A 4RR3A 4OVEA 3AYEA 3WP6A 1YIPA 4FVVA 2NM1A 3ASIA 1AYM1 4C90A 1PVXA 4Q8KA 1N1TA 4XHBA 2PHTA 1TME2 1QJY1 1SLTA 1LU1A 3VV1A 3E6CC 1YUDA 3AJZA 1DQ1A 3AYCA 1UAIA 1OPOA 2H6CA 1U5IA 4JC1A 3RYKA 1QXRA 3ZIXA 4Y20A 2HWC2 2RM22 4U2AA 2RJKA 2FBEA 2GNBA 3OY8A 1X8MA 3LSDA 4P5HA 3WDXA 5I0SA 4RR3C 4Y4YA 1G9AA 1CAWA 5CIRA 5FRAA 3G6JB 1C5HA 2PHDA 3RQ0A 2O1QA 2BBVA 2A7AA 3HBZA 3WUCA 2TUNA 3FUOA 1D4M3 1HQWA 2HWF2 2NYYA 2PAKA 1G8WA 1SLAA 1DQ6A 3VBSB 4RHV3 2P3KA 2FMYA 4BLJA 4COYA 3IT8A 4Q27A 1UKRA 3ZXLA 3MFCA 3KGZA 2ZJCA 3AX4A 4I2OA 4YVSC 5FFOC 5JPMB 5L19A 3FBMA 4W6YA 3VKMA 2ETEA 1LR5A 2PHRA 1GKBA 1HRV1 4X8NA 3DGTA 5CAZA 1PZ8A 4Q29A 4RGAA 2LALA 1FPN3 5K7PA 3U07A 4R9CA 3UJOA 2XLAA 3IMNA 1D4M1 1JW6A 1LGBA 5E8AA 4WBBA 4Y22A 1O4TA 4AHZA 5FO9B 4Q4W2 4Y1UA 3RJRA 4LLOA 4RHV1 1V6MA 2JX9A 1QOOA 3WP4A 1YHFA 4FOVA 1KITA 3V0BA 4ES8A 1S0GA 5K0UB 1O3QA 4JDMA 2Y26A 1CAXB 2WZR3 1JHNA 4BE3A 1ONAA 1RUE3 1WA4A 4XDQA 4YNIA 5D1IA 1O5UA 3WP3A 3ZMNA 4FPHA 1UZYA 2H6BA 1GYKA 4IV1A 4F83A 2B8MA 1DG6A 3JU9A 1DGLA 5GZEA 1AXYA 1VIWB 3LCPA 1AJOA 1LRHA 5BY5A 3TYJA 1FPN1 3AP4A 4P9XA 2V09A 3V0AA 5JSRA 2K9ZA 4UW3A 1DYKA 1HDKA 3GBGA 5DG1A 1N3OA 1MS8A 1LEMA 1T6GC 2E7QA 5ABJC 3LOBA 1DU3D 1OOPB 2ZGLA 2YZ4A 5IUQA 4QQ2A 4U36A 1NG0A 1WLCA 3BIWE 1W6PA 2JD4A 4WVVA 2JECA 1NQJA 3WDVA 3R0RA 2QVSB 2ZAAA 1GICA 2G9GA 2ZX2A 4BHPA 4GH4B 3M3OA 2WZR1 4Q0PA 1H0BA 5F1RA 1RUE1 2EVXA 1QQP3 1ND2B 1OA3A 5CG8A 2HEWF 4GIQA 5A33B 5KHGA 4IV1C 1RINA 2BTVC 2CTVA 4JTOA 5T3NA 1KFUL 4OI1A 3ZN6B 3AMPA 4KGGA 4I3PA 1ZZ7A 1ZBA2 1HQLA 4MXWA 1DQ0A 1S0DA 2MEV2 1LULA 1AX0A 5EXOA 3U11A 1F2NA 2VUJA 1N3PA 3HIFA 4AEKA 1LEDA 3AMMA 5LEKA 1ZA4A 4AQSA 4G3YC 3M3QA 3AK0A 4YZ4A 1RUG2 3WG3A 4CDUA 4HKLA 4XFAA 3KCCA 1O7FA 2XJTA 3H7YA 1OKQA 1WBFA 1Q8QA 4LT5A 1K5MC 3ZMOA 3LZZA 4PIXA 5BXXA 4PIZA 2P3IA 4MV2A 5JMCA 3AMNA 2WFF3 5T55A 4JGYA 2NP0A 1QQP1 3POYA 2VOVA 4I3GA 1KS5A 1NCRA 1BMV1