4UFIA

Mouse galactocerebrosidase complexed with aza-galacto-fagomine agf
Total Genus 211
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
211
sequence length
644
structure length
641
Chain Sequence
GAYVLDDSDGLGREFDGIGAVSGGGATSRLLVNYPEPYRSEILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYELDENYFRGYEWWLMKEAKKRNPDIILMGLPWSFPGWLGKGFSWPYVNLQLTAYYVVRWILGAKHYHDLDIDYIGIWNERPFDANYIKELRKMLDYQGLQRVRIIASDNLWEPISSSLLLDQELWKVVDVIGAHYPGTYTVWNAKMSGKKLWSSEDFSTINSNVGAGCWSRILNQNYINGNMTSTIAWNLVASYYEELPYGRSGLMTAQEPWSGHYVVASPIWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVALTDGLGNLTIIIETMSHQHSMCIRPYLPYYNVSHQLATFTLKGSLREIQELQVWYTKLGQRLHFKQLDTLWLLDGSGSFTLELEEDEIFTLTTLTTGRKGSYPPPPSSKPFPTNYKDDFNVEYPLFSEAPNFADQTGVFEYYMNNEDREHRFTLRQVLNQRPITWAADASSTISVIGDHHWTNMTVQCDVYIETPRSGGVFIAGRVNKGGILIRSATGVFFWIFANGSYRVTADLGGWITYASGHADVTAKRWYTLTLGIKGYFAFGMLNGTILWKNVRVKYPGHGWAAIGTHTFEFAQFDNFRVEAAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Azasugar Inhibitors as Pharmacological Chaperones for Krabbe Disease.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords GALACTOCEREBROSIDASE
total genus 211
structure length 641
sequence length 644
ec nomenclature ec 3.2.1.46: Galactosylceramidase.
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02057 Glyco_hydro_59 Glycosyl hydrolase family 59
A PF17387 Glyco_hydro_59M Glycosyl hydrolase family 59 central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 4ufiA03
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4ufiA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4ufiA01
3OBKA 1QFEA 5E0CA 1MZHA 4M7SA 3S1UA 4GZEA 1CZ1A 4AZHA 2C3ZA 2O9TA 3YPIA 1WDSA 3LPOA 4D6CA 4BQ5A 4PA8A 2G3IA 4AC1X 2W91A 4H8VA 3MHGA 2HS6A 3GLCA 2QCFA 2PC4A 2G3MA 3MMDA 4PMYA 3EWWA 2G96A 5HUPA 5HR6A 4CUCA 3AS3A 1JXJA 2RGMA 1QOPA 4J9JA 5HWJA 1JR1A 1XH0A 4P8UA 3KVLA 2JKAA 2ZQ0A 4GUJA 2DT1A 2FB2A 2VX6A 2VZTA 3RDKA 1V02A 3PN8A 3EDFA 4MLRA 2DSVA 2TRSA 1ALDA 3J7HA 3CPUA 1KWKA 3N2MA 3HIJA 4ZZ9A 2X0YA 2ZUNA 4DF2A 3S5QA 1PS9A 3PBGA 4JIEA 4BQ3A 5KZ6A 4KFOA 4R7JA 3GR7A 1AMYA 2NUXA 2CWNA 2Q8LA 3THAA 3UGHA 2A3EA 4BI7A 4PL2A 5FD0A 1HJVA 2E6DA 3RF9A 4PODA 3TIMA 7TIMA 1LZOA 1GWJA 5DLCA 2WBGA 4K37A 4WD0A 2J79A 4HHPA 5K9DA 3BC9A 1EEPA 1KFLA 2J88A 1B9BA 1XI3A 4LS1A 5IM51 2XUCA 2BVDA 1K7FA 1Y7VA 4V27A 3M47A 3CHVA 1HKKA 3BPWA 3RLUA 4H41A 2XVPA 5DT7A 5E6YA 2BHYA 1EDQA 4FNPA 5A6MA 3TCEA 3RM8A 2FJKA 4GWEA 3PWAA 4MLJA 3GXTA 3O63A 3W1UA 3M07A 4ATWA 4UTUA 4DUXA 2QQVA 5AYXA 3AHZA 3NJ3A 4I9AA 1K3UA 4JTLA 7CGTA 4UFKA 1UZ1A 4O14A 3WK0A 1HKIA 3H3LA 1PCWA 3LF7A 1K8XA 1R86A 1UWTA 4AD1A 1UYPA 4YN5A 2VEPA 1E0WA 4JTFA 3G8EA 2A6LA 1UR8A 1XRVA 1ME8A 3VGFA 5FMCA 2PC8A 1RV8A 1TSIA 4NJIA 4UMBA 2WCSA 1Q6QA 1FP9A 3OVRA 2JK2A 3JR2A 2X8RA 3IVTA 1TQJA 3DU0A 2GVGA 2WMJA 4MDPA 3NL3A 2YBUA 4PTVA 4U2YA 3VVGA 1KQZA 1GOOA 1XBVA 2AAMA 2C8NA 4Z2LA 3F03K 2WQPA 4MKNA 1J18A 5FOOA 5A8QA 2A3CA 3TC7A 2P0OA 3NPVA 3WH7A 2B4GA 4Z0JA 4WY0B 5HWNA 1GJWA 5EMUA 1CGXA 4PTWA 3VIOA 3W76A 1MVYA 1GVSA 3GDTA 4CN1A 2J74A 1E3XA 1B1YA 1I2NA 4M19A 2WOQA 3AHTA 3IIXA 1ECEA 1R47A 2DORA 5FCZA 4RLIA 3OA5A 3GYCA 1A50A 4UTWA 3AXHA 3CH9A 4FX6M 2XFFA 3IAPA 1QI0A 3TTQA 1E4LA 3DAQA 1OSEA 1PVNA 1DWAM 1H11A 3CUGA 2R14A 4K38A 2XG9A 3ARSA 3MW7A 3WDRA 3GDMA 4O15A 1I2QA 4UQ9A 1KFBA 1DEDA 8CGTA 1Q6FA 4MOZA 4HNNA 1PX4A 3AIEA 4MJ2A 3UESA 1YHTA 3ZJ8A 2GJRA 2OWXA 4B9YA 2ZCGA 1H1ZA 4O52A 4DELA 2V8ZA 1FUYA 3L4ZA 2NXGA 3NM3A 1LJYA 2WHLA 4J3WA 1ITXA 4PL1A 1HKJA 1XDLA 3WH6A 3NM1A 1JUKA 4UMCA 2WVTA 2X2YA 2GK1B 2J77A 2CLOA 4IMFA 2W63A 3GAYA 4WK9A 4LRTA 2GOUA 2JKEA 2CLHA 4NX0A 3S42A 2DEPA 1ICQA 3VIIA 1SZEA 5GQBA 2PWEA 4FX8A 3TXVA 1MW0A 1GT8A 2J8GA 5CJ5A 3MUZ1 1GCYA 3LHUA 2BY2A 3KL5A 3LGEA 1V0LA 2VNCA 1OX6A 4HT3A 1XKYA 4JGDA 1LTDA 3VI2A 1M03A 1HO1A 4FEZA 1G0CA 1ZB5A 3AZRA 4UCGA 1THFD 4JFVA 5EBUA 4YPJA 4PN2A 1OFAA 3GAKA 1DV7A 3RU6A 1SUXA 3PC0A 5CZKA 3FHQA 2X1SA 4Y7EA 4TX8A 1TPDA 3PVFA 5ABHA 1LG1A 1AW2A 3P5ZA 2YL8A 3BG3A 2GPTA 5JUVA 2QLYA 5A8PA 1GVRA 5F2GA 1TREA 3NPXA 2V5DA 1YXCA 4JY8A 2YL5A 4QP0A 4IQLA 4OE7A 1FY6A 2NUWA 1EOKA 1DWFM 3GDRA 1W91A 4TTGA 3APGA 4AWUA 1NARA 2XJ7A 2FH6A 1W9PA 3BARA 4XZBA 5IFPA 3TP4A 1LOLA 4L4LA 1BVNP 2OLHA 3V1PA 3QZEA 3L2LA 4JTEA 3CWOX 4W85A 1CPUA 4NRRA 4ZENA 3TSBA 3EWXA 2BSLA 3PZIA 5A6SA 1T99A 1B9ZA 1VHNA 2YA2A 2C0AA 1FH7A 2CXGA 2WKGA 4IPLA 2XN0A 1F6PA 4W89A 2NW0A 1XBYA 4FNUA 1ESWA 4R5EA 1QHOA 2CLEA 4ACYA 3LMYA 3LXAA 4A29A 1GPFA 2QUUA 1VZWA 3C2FA 3P60A 3VD7A 4ACZA 1G67A 4AEOA 3VD3A 1MWOA 2C16A 4K8HA 4BR1A 3MWAA 3NL6A 1SQ7A 4UCFA 3SIZA 2YJQA 3GM8A 2J7FA 4YWIA 4B9ZA 4A2SA 3TH6A 5FF0A 2WWCA 4CN4A 3ZM8A 4IXHA 3HN3A 4I7VA 3WD2A 4AMCA 1TPVA 2ISSA 2D20A 2CLMA 4P8VA 1UR2A 3S5NA 2CBJA 2XGIA 4B3LA 3NNTA 4HIBA 4M1RA 4DWSD 3VINA 3MMTA 1YPIA 1VS1A 2CBIA 4NNCA 3F4VA 4OOZA 1QVBA 4FXRA 5E93A 5AC5A 2GJLA 1OWQA 3RMEA 1H51A 4M6PA 5JBEA 2ATMA 3W7MA 1EPXA 1V3KA 4UTFA 3MYPA 3TTSA 3JUGA 3R89A 4XTDA 4UTTA 2PCQA 3RWKX 2E9LA 4B5NA 3G22A 1F05A 4M5PA 2WB5A 4IM4A 3WUGA 2GUUA 3UY7A 1PIGA 2QJHA 5A2AA 4O4WA 4QNEA 3W1AA 4G1KA 3AHXA 5FEPA 5FMBA 4IOTA 3P61A 1OF8A 4RXFA 3VU2A 2W79A 5DT5A 1LRTA 4OV4A 3HMJG 1I4NA 2JFEX 2VENA 1ISWA 2CZFA 1V03A 3DC0A 4MAVA 3EWBX 3VPLA 1HO4A 1QNRA 4DWSC 4QCFA 3WEZA 1CGTA 3A6OA 4EF9A 1LM1A 4PMNA 4GUFA 4EANA 5GNXA 1VRXA 1IZKA 1VRDA 3MUXA 3KXQA 4LNYA 2D3LA 4F79A 3F5JA 3WL0A 4U4MA 4GO8A 3LPFA 2XHYA 1JZ8A 3I65A 5LKYA 4RL3A 1AL8A 4HN4A 1TTQA 5C54A 3CZKA 3MHFA 3G3MA 2J4GA 1VCFA 1W32A 3P8IA 3SFKA 1CXIA 3R2GA 4JX5A 2J7HA 2JEQA 1QO2A 2FLIA 3SUSA 3A21A 1OABA 1UH3A 1UR1A 1BAGA 4BFAA 2Q3OA 1H4PA 1XH2A 3FKRA 2ABBA 1FBAA 3QSTA 4ADSA 2A7NA 1LL4A 2PBGA 4O50A 3PS7A 1UQYA 1UOKA 4H7VA 4XWUA 5I3HA 3S8HA 5E1QA 1JRCA 5AHFA 4E0CA 4D1IA 4PCTA 4Z2JA 9CGTA 1CW2A 1TA3A 2F8QA 5D8WA 1UD2A 3BAXA 1RPXA 5CZTA 4Y6GA 1C7TA 1OD0A 5CQ1A 2CLFA 1JULA 3WDHA 1PAMA 3SGUA 4HP5A 2E68A 4H6KA 1E6XM 3AXXA 4EQVA 4K68A 2E77A 3N73A 3W1TA 2V30A 1K8YA 2AAAA 3NGJA 4LS2A 1ZBCA 3S2CA 1RPKA 3VIFA 2WSKA 4LW7A 4KH2A 3Q94A 1QR7A 4FNSA 4N9CA 4R33A 3VIMA 1PZ3A 2E40A 2C19A 5G1YA 3HGSA 2DP3A 1PIFA 5KEZA 1JZ5A 1IGSA 1JYNA 1ZAIA 5JIPA 1AQ0A 3EB2A 3O16A 5KZMA 3WF0A 4JTKA 4JTTA 3W84A 2I14A 3BLIA 2WXDM 2H8XA 2QJIA 3N9SA 3ZJKA 1DWGM 3WNLA 3IGXA 1VIWA 2QKFA 2G8ZA 4TMCA 1WE5A 2DSKA 2EO7A 3VGGA 3WN6A 3ANYA 4AEFA 4D6HA 4N4PA 3W75A 4OHQA 2VX5A 2WANA 5G5IA 3ARQA 4JCMA 1RZMA 4P8XA 4DBEA 3U6WA 3W87A 3VM5A 1JFHA 4NRSA 2CYGA 3LHTA 2V3FA 3AIUA 3QSRA 4MYAA 5ABTA 3TUUA 2G4FA 2VFEA 3SCQA 3W82A 4AZCB 1B31A 4PH6A 3U8GA 3W85A 3UG5A 3FLUA 1E40A 2NX9A 3LDVA 3AO0A 5D03A 3NQ2A 2J6XA 3BAIA 1EXPA 3ZT7A 1E70M 3LI0A 3BO9A 2XM2A 5LA2A 2DJLA 2YXGA 3VOCA 4GQQA 4QCEA 1ICPA 3GKAA 1W3LA 4B1MA 4M24A 5K4ZA 4F9JA 3SC7X 3BW2A 2XQRA 3NMBA 3CTTA 4RJEA 3BAYA 5FIPA 2XVKA 3L2MA 1LBMA 4X22A 1WO2A 1F2JA 3KHJA 3SGZA 5LHEA 1OCQA 1O94A 1ZAHA 1BYCA 1H0IA 3B8SA 3HG4A 1W9UA 3ZQ9A 3LHWA 3K8MA 2A2IA 4CD5A 4CNNA 4YXGA 5AHIA 1MQPA 4LQ1A 5FK7A 2XSAA 3O6YX 4BI6A 1EX5A 5TIMA 2XWEA 4LYRA 5CGTA 1UYQA 3QMSA 3ABSA 1KBBA 3L4VA 4OWGA 3TMLA 4P7LA 4P7NA 4F9DA 3C4UA 1W3TA 3TKFA 4NSBA 2VFDA 3AMKA 4O1DA 3W1QA 3KZSA 3PTKA 1LWJA 3WQWA 2WKLA 4DM1A 3QQ0A 3NQDA 1FHLA 3G1AA 1W1TA 2Z6JA 5D38A 4E38A 1VR6A 3ARZA 4HOXA 1NOUA 3ARVA 5F7UA 4O8RA 1Y9MA 2WZHA 2VX4A 3PY2A 1BF2A 3W2KA 2JGYA 3DKLA 3W7EA 2YDSA 3P80A 4WZHA 3FJ6A 1ZU8A 3CBWA 3MSDA 1TG7A 2W6RA 2YX0A 1UA7A 2UY3A 3HQ1A 3I7SA 2ZX6A 3WEMA 4GI6A 3QYQA 1DWJM 1ZJBA 3T2QA 3IGSA 3W6MA 4NUWA 1QO5A 3WL1A 2XFRA 2E09A 2D24A 3AICA 4WXYA 2WNWA 3WNPA 1KM2A 1UWQA 4TR9A 4AIUA 2J25A 4U2ZA 3HBKA 1TPB1 2PBOA 2GDUA 5DBUA 1E6RA 1Y4WA 2W61A 3AJ7A 3TFCA 2W4XA 1S3HA 2QCDA 1OVDA 3O9NA 1I2PA 4AWEA 2Q3RA 4GBUA 4J3SA 3LM7A 3TQKA 3BGAA 2NUYA 5FL1A 5BMWA 3QMRA 4UNIA 1H3GA 1K02A 2QCGA 1J0KA 1CDGA 4NQ1A 2RHGA 3LRKA 2F61A 3WDQA 3GZ3A 5HXMA 4IISA 2QDGA 1TRDA 4HNUA 3USBA 5ANNA 5FESA 1GOMA 4UQAA 1CGWA 1WZLA 3PIJA 3BV4A 5G4EA 2TAAA 3AS2A 4UOQA 3IJ7A 3JRKA 5CPMA 1KQYA 1HF6A 1WZKA 3N1AA 3L4UA 3VGHA 2J7DA 4EE9A 1Q6DA 4HSNA 1K6AA 2Z6IA 4K8EA 3UY8A 5BOOA 1U33A 1H0GA 2QUTA 5KZDA 1CXKA 4WKFA 1Q6GA 1FWTA 1D3GA 1CNVA 4UOJA 4Z2HA 4R34A 1EDGA 4ZQRA 5CPLA 5CGMA 4WOZA 4AB4A 3WF3A 3SURA 3M7WA 3HPXA 2EPKX 2J7BA 3AMLA 2VCAA 4NZCA 3SCRA 1KR0A 3UR8A 1UWSA 1WDWA 1WPCA 2QUVA 3NSMA 4CD4A 5ABFB 2ZXBA 1SW0A 1V08A 3M5VA 4JFUA 3UD6A 4D1JA 7TAAA 3BGGA 5F2LA 4YHEA 3BW4A 5C71A 3BLFA 5BRBA 4AZZA 4HKPA 3VD9A 3AISA 1V3JA 3CC1A 4CU8A 1NF0A 5A6KA 4A21A 1KFKA 2WV8A 2BS9A 3OZOA 3W2JA 1UA3A 1UB3A 1WV2A 2E6AA 1MFUA 3IIOA 2RDWA 1UZ4A 4XB3A 4K7VA 2ZDRA 2O9RA 3PULA 4W84A 2WMIB 1DWHM 5CSRA 3HGOA 2UWFA 2YZRA 3OGVA 4MJ4A 1XC6A 4QLJA 2EEXA 3PR2A 4EWND 3CHDA 1H7PA 1QOQA 2ZXDA 2FFCA 2Y88A 3EWUA 4Y9AA 3CUIA 3GDLA 2QCEA 4IGHA 4MB5A 1OYCA 3CGTA 3W38A 3M46A 1BYDA 1GTEA 1SO3A 1EIBA 4E2OA 2E8YA 1JDCA 2H8ZA 3DFPA 5CPSA 3WJSA 1CIUA 4Z1BA 4FX7A 3NZ1A 3UPWA 1LF1A 1NF7A 4LV4A 4GI8A 1XSIA 3N18A 2ZTKA 4MDOA 1TV5A 4JS3A 3BW3A 3BLEA 2W66A 1OGBA 2PWGA 4MNLA 4Z2KA 2A0NA 3AYSA 2ZX9A 3TR2A 3AFBA 1J0JA 2VFHA 3SUUA 2CERA 1N7KA 2PWDA 3QMTA 3W6YA 3K1DA 5BXSA 1W3NA 1XSJA 2YA1A 5DFAA 1CYGA 1RP8A 3EKZA 1KTCA 4P7OA 4WIWA 1SR0A 1RQHA 5IHRA 1BPLB 1EQPA 1PHWA 3B4UA 1ZENA 2Z1BA 3LTPA 4CCCA 3LCHA 3N13A 3LI1A 1VJIA 5J5RA 3NSNA 3TXZA 3WY1A 3GNNA 2WZIA 4HOWA 5A6BD 5IFTA 4EVZA 2EQDA 2CITA 3BG9A 4JCLA 2VRQA 4N42A 1EUNA 3CU2A 3N17A 3O1NA 3M0ZA 5EA9A 2TYSA 1RP9A 1E55A 3KEHA 4LGXA 1F6KA 3PB2A 1ZBVA 4AD5A 4OT7A 2ZZ4A 5T26A 4URIA 4O28A 5DF0A 1W8SA 3LPGA 3I3DA 1PV8A 4GKLA 4XBSA 2HSAA 1JAKA 1OD8A 3CHEA 1XYFA 1VCGA 1JNDA 1NP0A 1E71M 1X1OA 2ZRZA 3LERA 4ZQOA 3WK1A 3CIWA 1Q4NX 2CNCA 1VFMA 4JFSA 5DXXA 2IXVA 2VR5A 4WJXA 4NJJA 2JKPA 2CESA 1ZL1A 3NO5A 3ARPA 1W1VA 1H1YA 2XGBA 4P8WA 1SFSA 5I3GA 3W37A 1OJXA 2EPHA 3FOKA 1KBJA 5HUOA 3GH4A 4LT9A 2OSWA 1R7AA 3WD0A 3D5HA 4PTMA 1I2RA 3VO0A 3A3HA 1ISYA 2GVJA 4JL1A 4WSKA 2Y63A 1RD6A 3G3DA 2QF8A 1OX5A 3T44A 3N12A 1WCGA 3S1XA 2E3ZA 4H2CA 4S3JA 3GKFA 4ZFMA 3RPMA 5CSSA 2WHMA 2ADDA 2E5CA 1W1PA 4JZ5A 2H90A 3A5VA 3B8DA 1UD5A 1V0MA 5CSYA 4NI3A 1FWSA 5CXPA 1CLVA 1LRNA 3WNNA 1D2KA 3GBEA 1BYAA 1EHAA 4PMQA 1ADOA 3HPSA 4H8UA 4NNAA 4OU1A 3P82A 2WNNA 1KW1A 1WAUA 4LVDA 3G6LA 3ARYA 3EKLA 1HG3A 1TPC1 1H62A 5CG7A 1NSJA 4RZ5A 3WMSA 1E51A 3SI9A 3AIVA 4O0KA 4CCDA 1W9VA 1H50A 3EWZA 5CPOA 5LSMA 3AHYA 3TU9A 5AC6A 1JDDA 5ECUA 3L2IA 4PTNA 1WBHA 2E4TA 1Z48A 2ZZ1A 4O19A 3IMMA 1ZY9A 1SPQA 2J7CA 4JKMA 2BFGA 2VVNA 2CFFA 4I7WA 3ZWTA 3LX9A 1MSSA 1OHLA 4FHAA 4J28A 5E70A 1H5VA 1QNPA 3W7IA 3FW6A 3SEPA 2Z2UA 4UTIA 1E3ZA 3OVPA 5G1TA 2DQXA 3SR7A 1TUXA 5LNWA 4NX5A 5D05A 4IPIA 5G2HA 6TIMA 4FFHA 5HJLA 4N4QA 1N55A 3OA3A 4N02A 4P61A 1L9WA 3BG5A 4TIMA 1UJPA 4O12A 4LYQA 2O9PA 1L8NA 3LLFA 3BXWA 5I23A 1OFQA 4WJEA 3W88A 1JZ6A 2QMKA 4PUDA 3RCNA 1KV8A 5FEWA 2FPYA 3E12A 3G1XA 3IRDA 3L0NA 1GOXA 3E1F1 1J10A 3W73A 2EPNA 3AZSA 5I2UA 3VTRA 3POHA 3MMUA 1G7UA 1ICSA 3W70A 3SCUA 1DVJA 3VIKA 2CZEA 1E6ZA 3S5OA 4ZQNA 1HN1A 1TZ7A 3G1YA 1UKOA 5DY2A 1WZMA 4WSJA 1E0VA 3NQVA 1Z42A 4ZQCA 1TMQA 1JCYA 4J3VA 4HZ6A 2YSWA 4ONVA 2Y61A 3SZ8A 3PIGA 3QPZA 1VH7A 1K9EA 2PB1A 4W7UA 3NA8A 3N19B 1OFDA 4FLQA 3QR3A 2I9EA 1W56A 1XDMA 1KFCA 1EDTA 3TJXA 4TU1A 2GQAA 4MZ1A 1OM0A 1BSIA 3VILA 5I24A 5DY3A 5E9AA 1MEHA 4WKHA 4JQTA 1W9BM 1KGWA 1VQTA 3IEBA 3QRHA 4X2RA 4K39A 2EJ1A 4OKDA 4V28A 3EBVA 4BQ2A 5C55A 1K7EA 1C8YA 1UUQA 2QDHA 3KWXA 4JFTA 1B4KA 1ME9A 2JF7A 4AMAA 1QNSA 3R5EA 1E73M 1NWUA 3W24A 2FHFA 2ZYFA 3CUJA 3W7PA 5A8NA 5CZ0A 1DTUA 3O2LA 4KRTA 2DSWA 2QV4A 2G5WA 3N15A 4PUEA 4U31A 1AL7A 3P81A 1GW1A 1OGSA 2Y7FA 4NT0A 5M03A 2WMFA 3U7VA 4CQ9A 1IV8A 1CXLA 1G9HA 3CZLA 5E0FA 2WLYA 3MBFA 3SY5A 5HQEA 3LCWA 3W86A 3KRUA 1KV5A 4ML4A 4P7QA 1EIXA 5FKCA 4LC8A 4UTTC 1J0ZA 3NG3A 2RGLA 1PPIA 4JL2A 1JZ3A 2BHUA 3AXIA 5A8GA 4W5ZA 1R87A 4YCOA 3EMCA 5BRPA 1H7NA 5HMSA 2P1FA 1Z41A 1UWIA 3CZGA 2QCDB 2ZIDA 3HG3A 1TFVA 3W2MA 3TAKA 4DEFA 2RH9A 5I6SA 4GXMA 3VCRA 3L5MA 1KA9F 4JYEA 3TDFA 1WAWA 1SZGA 4GPNA 1JYWA 5D02A 3G1VA 1XGZA 1WP6A 3NSXA 4DPPA 3OIXA 1J9YA 3DHUA 5FF2A 4N0RA 1EO5A 2TPSA 5BNKA 3OG3A 1D3CA 2QF7A 2WVVB 1KFEA 3Q58A 4OJYA 4GJ1A 1ZJIA 3IVSA 4AH7A 2NT0A 1VENA 2Y70A 1WQ5A 5DN1A 4UOZA 4TUFA 1K03A 2HVMA 2Y85A 4EOUA 2OSXA 4GIAA 1QDSA 3TA6A 5HULA 5BYWA 3H54A 3U5YA 5I3FA 5CLTA 5GVJA 2WSPA 1QHZA 4GFSA 2Y2WA 3P74A 1X8FA 5D2TA 4GZJA 5EMYA 1UWUA 3TONA 1B57A 2WKJA 3ZFHA 1US3A 4LUJA 1GHRA 1MW1A 5A8OA 3TK7A 3TAOA 5FI8A 3P62A 3UWYA 3VDAA 1CX9A 1K7XA 4D72A 3CT7A 3NAVA 2VMFA 1SFLA 4DO5A 4E8DA 4HMCA 1ONRA 3O05A 3NR0A 4JX6A 1JDAA 2WLZA 1E6NA 3AIRA 4QHZA 4UFHA 2OWCA 4BQ4A 3SSJA 3MU7A 3ZJ6A 1GJUA 1RQEA 1RVGA 2BXVA 1AMKA 4ATDA 3QW4B 1GNXA 3WQ6A 3F1QA 1UKSA 3TTYA 2X05A 4V2XA 1JZ4A 1VEPA 2GUYA 2YDRA 3STEA 5KINA 2F84A 2F7FA 1KGUA 5BCAA 1JCMP 2AOSA 4LS0A 1H7RA 1S5TA 1MXSA 2AC1A 2A85A 3TA9A 2DZXA 1YDVA 5K2ZA 5HNRA 4X9SA 4UTKA 2WCGA 1TMHA 3T2PA 4U33A 3PBVA 1XUZA 4J7RA 4IMCA 3W81A 1DQWA 3S5ZA 3STGA 2ESCA 2JIWA 1E15A 2X30A 3WEOA 1JUEA 3OLEA 3N9KA 4HU0A 4AWSA 2V9DA 5M3WA 1V0NA 5EY5A 3T78A 2VFGA 4FXSA 4BWLA 4QJ1A 2V2CA 3PZ9A 1L6WA 4Y8FA 1PIIA 4JICA 2PRHA 4MNKA 3LEMA 3GNDA 1K8ZA 3TMQA 1ZCOA 4HSOA 1FHDA 1OT2A 4KFPA 2VELA 3MSGA 3SJ3A 2V5LA 1FDJA 3B05A 3C2EA 3LCXA 1J2WA 4J27A 3A4WA 2ZFAA 1NAL1 3GH7A 5D30A 1EP2A 1FH9A 1EUAA 5DCEA 1QBAA 2Z1KA 1R8LA 4XZWA 5EBAA 3BMVA 2O7SA 2WM0A 5C2XA 4MAZA 1XHGA 2C6QA 3GYEA 3VIHA 1TIMA 4CLMA 1GQJA 2UY2A 4AXNA 2XIIA 1KM6A 3VDBA 1FA2A 2PWFA 2X16A 3UXAA 1ISZA 3GNPA 4FLRA 1UASA 3HU7A 5D2VA 1JYXA 1LDCA 5CPQA 1L6SA 3ARRA 4M29A 4EAMA 3W1NA 2GK1A 1VBUA 5D09A 3CQ0A 3PZOA 4AYSA 3W7OA 1FCQA 4MY9A 1QPQA 4RZ4A 1JIBA 1I75A 3PF3A 1BQCA 4JHZA 5L6UA 2ZX7A 2AGKA 3PZTA 4IPJA 4ZL1A 1Q3NA 1SMDA 4A3UA 2YGYA 4JAWA 3QHOA 1J0HA 2B7PA 3HMCA 3DKJA 1EP3A 2QCHA 3E49A 5IBXA 3PHAA 1B3XA 3KF3A 1V6UA 4CVWA 2CLLA 4M82A 3OSDA 1A5AA 4B3KA 3WH8A 5I0DA 3M9YA 2YW4A 3AMGA 3AS1A 2DZTA 1O5XA 1R46A 1V7YA 3O6CA 3PBWA 2PRMA 1L0PA 3AIWA 1O60A 4OOUA 4CN6A 3W7JA 4LXFA 3EWYA 1GOWA 4UTHA 3FNDA 4U28A 2H6RA 1XUUA 3MP4A 1O7AA 1UR4A 1UKTA 1X6NA 5I5RA 1YADA 3AS0A 3W1PA 1KGXA 4A4AA 3EX3A 2ABAA 3C2RA 2G95A 3IANA 4W8AA 3OHIA 3LTYA 2CW6A 3DZ1A 1S46A 4AZ7A 1TA3B 4HU8A 2A3HA 1UBSA 4PSRA 4LOCA 5F1UA 1NEYA 3F5KA 1H2JA 3ZOAA 1JCNA 4UR8A 3WJXA 2DIEA 1XFBA 3NZRA 4A3YA 1KB3A 4AZCA 2J78A 4AZBA 1CXEA 5AYBA 4RK8A 3CUFA 3L4XA 1CGVA 1JYVA 3P67A 3IAQA 1BTCA 4GI9A 2CLIA 2FDSA 1JF6A 3AQUA 1MEIA 4JTIA 1UCWA 4WOQA 4WKAA 3BLKA 3T09A 2F2HA 5FK8A 3WELA 1HVQA 1VCVA 1AK5A 5EKYA 2XSBA 3OLGA 2VFFA 3A23A 4UFJA 4EK7A 1H63A 1QI2A 1OF6A 4UQCA 1FCBA 3WBEA 2A3AA 2VTFA 2PI6A 2WJZA 4IMEA 1O4UA 1VJZA 1H7XA 1RQBA 2BV9A 3WD4A 2OSYA 1OGGA 1BVZA 1ZS2A 2FH8A 3EYPA 4OGZA 2VX7A 2ZZ7A 3B03A 4N2YA 4HXCA 1LLOA 1FQ0A 1M6JA 4OUEA 1BGAA 1TPWA 3S5YA 1N8FA 3MI6A 5J5DA 4JFWA 1J5TA 3IJ8A 3W07A 5D4YA 4Q33A 2OJPA 5FIXA 4P7RA 4M56A 5C8BB 4LVFA 5LNSA 2CBVA 3FEMA 1QCWA 4POCA 3RK8A 1G94A 1LBLA 4GE8A 3WH9A 5DMYA 1W1YA 3B04A 2ZRWA 1OFOA 2JGQA 5D32A 1GVIA 4CQAA 5AC7A 1C92A 1W5OA 3HO8A 3UNDA 3HG2A 1WA3A 1OFBA 5H91A 1GORA 3QEZA 5H2ZA 1VLWA 4TMBA 1E4IA 1JF5A 4JXCA 2UY4A 1W37A 2IQTA 4C7DA 5BW6A 5AN7A 3T55A 1F76A 1VYRA 3BMWA 2DIJA 3W1LA 1WBJA 3IIVA 2WAGA 4FF5A 4PMUA 1OG0A 3DI0A 3HOJA 4EF8A 4AD3A 4CVUA 2AEZA 2OT1A 3A4XA 2D3NA 3BSHA 3WUEA 3I7RA 1XCFA 3FXYA 3RM9A 3EX1A 3WK3A 1D3HA 2NX3A 4KGJA 4IMGA 2GJNA 3DHPA 3MV11 3OVQA 2D2OA 2W0UA 1OK4A 1BKSA 2D0HA 2WHKA 1W31A 4BK9A 1BG4A 5BXRA 5MHBA 4DUWA 1FCUA 2YL9A 3SCTA 1H7OA 1Q6RA 4RCXA 2WSRA 1DJQA 2VVSA 3VNZA 3IVUA 1VEMA 2FB3A 3B0PA 4TOQA 2C13A 1G4PA 2Z0IA 3DFOA 3HB9A 1LOSA 2EF9A 3NQEA 3NQMA 3RMJA 8TIMA 5TQLA 3OEXA 4PBGA 3UR7A 1CTNA 3WSUA 5A2BA 2ZWZA 1ODZA 2E5DA 1A5CA 4HPJA 3LIHA 1W3KA 5DELA 1O95A 3W53A 3U1XA 4HPXA 2JALA 2D0GA 3SUWA 5IHSA 4RR4A 2DZSA 1HUVA 1QPRA 1VYPX 3DFSA 4JTJA 2IXUA 2OYMA 3A4AA 3H53A 1U2YA 1UR0A 2V5CA 2X0HA 3GH5A 3ZR5A 3W27A 4AD0A 3NQ8A 1IT0A 4IWWA 4LV9A 1VC4A 2OX1A 4K6AA 1V6VA 1XBXA 2DSUA 4O17A 2Y8VA 3TE9A 3WQVA 1W5PA 3QH2A 2R91A 1TVPA 2EBNA 2A7PA 2YYTA 3CWNA 1E56A 2VT0A 3D3AA 3UGGA 2JE8A 3DFQA 4MFDA 4HMDA 3NQ7A 4EKJA 3CM4A 1ZALA 1H60A 4L4PA 3L68A 1LORA 4HPGA 1YTEA 4JR5A 2ZZ6A 4N9BA 3W72A 5AY7A 5AB3A 2E1DA 1VFUA 1FWWA 4IPNB 1TPEA 1FP8A 3B9EA 3MO7A 1OK6A 3M41A 4MY1A 2CZDA 1TVNA 1C90A 1LG2A 5AYIA 1GVYA 5HOSA 3NQCA 2VL4A 1GEQA 2VCBA 2WC7A 4OBTA 5CG0A 1PBGA 2VZUA 3W23A 1VGAA 3LCGA 4OZOA 4GC4A 4TO8A 2VJXA 4NU7A 2WC4A 1OIFA 2VQTA 3LBMA 3VMNA 5HPOA 1WOBA 1H61A 3H55A 1NOWA 1UUOA 4UUIA 1AG1O 1I2OA 1L6YA 2DDXA 2QPUA 5IBXC 4PMXA 2HTMA 3IGUA 1R2RA 5KMYA 1CENA 2YL6A 3VD5A 3WDJA 3GDBA 3B06A 4KKXA 3ZMRA 4M7TA 1HP5A 3QF0A 4AHPA 1B0IA 1C3FA 1V6WA 2JF6A 4QITA 3M5XA 1C93A 1HJWA 1ZBWA 2D23A 4JDYA 4GNJA 4DXVA 4MTVA 1PX3A 3LCLA 4XV0A 3PBYA 3NOEA 3W74A 1OB0A 3HJZA 5C5YA 4QLLA 2JBMA 4AZ5A 1FDZA 3T0DA 1TPUA 4UIOA 5A5WA 1H7WA 1YTDA 4FMVA 1J12A 2BXYA 2EPMX 3NPUA 1CXHA 3B0VC 5CLWA 3G1SA 1YDNA 4W86A 2CLKA 1R30A 2WW5A 4FLOA 4W88A 4WLCA 2FDMA 3WDIA 4ADTA 4RZ6A 3M16A 5DEZA 3MANA 3W7RA 5BMXA 3GXPA 5BXTA 3VNDA 4TTUA 3DYPA 3T2OA 2DZUA 3PZGA 4E8CA 2GDVA 2C7FA 3G8RA 3SECA 3D0CA 3TNOA 2WPBA 1KM3A 2C18A 5LYRA 3ZWSA 4AHOA 1ZNNA 1WZAA 5EPDA 3VKKA 5IXEA 1B3WA 3I6RA 2WMGA 2WMHA 1Y9GA 3DECA 1LYXA 3LXBA 1UWRA 4HZ8A 1IXOA 4LPCA 3WMCA 5A95A 2OCZA 2XVLA 4GO9A 3I68A 2A7RA 2TMDA 3MHUA 1SSGA 3W2NA 2H3DA 3F5LA 1J11A 3EDJA 2OYKA 5TBOA 3VE9A 1J4EA 4AZIA 2AEYA 1DHPA 2WNZA 2Y7GA 4XX6A 4C7GA 1MQQA 4RE4A 5BWFA 2BVTA 3NQAA 3TROA 1FFRA 2DPEA 4XKYB 4ICNA 1EA9C 1W5QA 4PMRA 3NUKA 5K9XA 4JKKA 3QHMA 4UC5A 1GZJA 4LWWA 1ISXA 1G7VA 2CHOA 3II1A 4B15A 3R13A 5LA1A 3C2VA 2X1IA 1SZFA 1XD0A 2V3EA 1X7FA 3DFTA 3LXCA 1W1ZA 3B9AA 2PWHA 2VURA 1E43A 1IIHA 1QW8A 4M80A 2ZUUA 1MYRA 2Y62A 1FH8A 3W1MA 1BFNA 4D71A 3WNMA 2V38A 2WC3A 2E0PA 3NPWA 1HT6A 2V82A 3ZR6A 3C3NA 5D37A 4QM1A 5CPNA 4MY8A 2FPTA 4O4VA 4O0ZA 3S9YA 2DGAA 1J0YA 3WFAA 4W5UA 3GXDA 4Y90A 5LZLA 1OFEA 5U4NA 3N34A 4RE2A 5CKSA 2J7EA 3THCA 2NV1A 4IJBA 4OV9A 1GQIA 2D73A 1KFJA 4MJMA 3KVJA 1OT1A 4ORIA 2CEQA 5DCDA 4GRSA 1F73A 3UERA 3HGRA 1ZFJA 3FAWA 3CO4A 1I1WA 1LL7A 4NJKA 1C7SA 1OYBA 2ATSA 1MQRA 3W1XA 2QCMA 3IIZA 2ZRXA 4FF7A 3WNOA 3K8LA 5FL0A 3W26A 1ME7A 3BK0A 4PRWA 1V6YA 3RJYA 2YFNA 2ZRVA 2Q8ZA 4O10A 5F4XA 1QNOA 4WF7A 4MADA 3SCWA 3RNDA 2A5HA 4O53A 1TPFA 1V0KA 3ECQA 1R2SA 3M43A 4UZSA 3MP5A 2BVYA 2V3GA 1JZ2A 3N04A 4UXDA 4RE3A 4X3ZA 3ZR4A 4DF1A 5C6MA 1A3HA 2VEIA 3UZJA 2R94A 2VEMA 3EXSA 3PZQA 1EO7A 1EWEA 1KBIA 1XM3A 4PYSA 3QW3A 1GOKA 1F5ZA 1CI1A 3S0CA 3LDKA 4UFMA 1A47A 5KZEA 1SO5A 1JAEA 3M6DA 3M7SA 4C7FA 2P10A 3G6MA 1E1FA 2BLEA 4MZ8A 5A6JA 2YCEA 3UG3A 3PTQA 4N6FA 4KRUA 1KM0A 5IDIA 2V2DA 3LHZA 1N82A 1D9EA 4O16A 5SWUA 1BYBA 2J9ZA 1YLVA 5TD4A 4B16A 2CBUA 2WZEA 1XCXA 2ZZ3A 3CUHA 4L4OA 1X6LA 5D9OA 5I3DA 1GVFA 4UTLA 1HIZA 2X2GA 3W7NA 3RFAA 2EKCA 1U5JA 1JNEA 1VBRA 2BY0A 5FKYA 2WSYA 3CEUA 1E6SM 1B3ZA 1L2UA 5LGXA 1EB3A 4FLSA 5K3VA 3AMDA 3PSVA 6ALDA 4LY8A 3PZVA 3L66A 2ZUMA 1KXTA 4I7UA 3SUVA 2QCCA 1SW7A 3FYPA 2ZA2A 3HPZA 1LWHA 3UCQA 1ZJAA 1E5JA 4QISA 2WVSA 4TVDA 3GXFA 4DQWA 1TYGA 3UZ5A 2FPVA 1EHNA 4R27A 3OIHA 2QQUA 3L5LA 3B0UX 1WOAA 4HTYA 3T4CA 1IF2A 3CTLA 4QQ3A 4TVCA 3TSMA 3MI3A 3FA5A 1S5WA 5M17A 2V5BA 2FTPA 4FO4A 3WK2A 2XFYA 4ZEPA 1LBFA 3C2OA 3CB8A 1CGUA 2RDTA 4UTWC 1B3VA 2XVGA 1KLYA 3FJLA 3O07A 4FIRA 4MNJA 3I3EA 5HPCA 5EFFA 4CCEA 4DPQA 3CZEA 4NF7A 1GVQA 4P2VA 1I8JA 1GQNA 3TC6A 3FAXA 2X1TA 3GK0A 1LQ0A 1ZHAA 3FIGA 2J9XA 3AJXA 1RD5A 1NM9A 3AIBA 2Y89A 4KMQA 2Y7EA 1T96A 1K9DA 2A6NA 2Y8KA 1XXXA 5AHEA 3P8JA 3SUTA 1KM1A 5HR7A 2EHHA 4CD7A 3BVJA 1GUVA 1JRBA 2BY3A 1KM5A 4AEEA 4A3HA 4DBDA 3GXIA 2NLIA 1KTBA 1VJSA 5M5DA 1DHKA 3I7QA 4WY0F 3B9DA 2BTMA 1C9DA 1PCKA 1YXDA 5I3KA 1H09A 3EX4A 2YYUA 5FF7A 2WHJA 4FNTA 5EFDA 5I3JA 3VMPA 4D6IA 1Q6CA 2D22A 1CBGA 1LLWA 4QDMA 4JD4A 3GBDA 4UQEA 1XCWA 4D6DA 3N9RA 4NXSA 4CNPA 2DT3A 4AW7A 3FFSA 3QPYA 5K4XA 2ZWYA 5EL1A 3O06A 3MUAA 5A69A 1E6PA 1C8VA 4D2JA 1NVMA 4JYDA 1NFBA 2OWWA 2C15A 3DENA 1HJQA 2BHZA 5AYZA 3MMWA 2ZA3A 3O8AA 1V02E 5BXPA 1QPKA 5JBDA 1G4SA 4E2BA 4XKYA 4GUIA 3ZT6A 4LVAA 1DL3A 5F2MA 1VEOA 1TJRA 1C8QA 4UTJA 2VQUA 5AC8A 3OGSA 2H3BA 2VRKA 4KWUA 4UFIA 3Q37A 2NXIA 2VXNA 4QAWA 3RM4A 5EB8A 3GNOA 1JJKA 4PTXA 3P5YA 1WDRA 3L4YA 5G2WA 3C0JA 1SW3A 3TSDA 3U7BA 3LIGA 2XN1A 4S2CA 3Q2DA 1W54A 3NDOA 5I79A 3WUBA 2VFIA 4U3AA 1FWNA 1UHVA 1J01A 3TTOA 1KXQA 4HA4A 4WQ6A 2ZRUA 1TRIA 4FB7A 3ARXA 1OFRA 2KZHA 1UUMA 5CZSA 3RLVA 2JEPA 2YDAA 3OBAA 2VRJA 1PHQA 4Z2IA 1B2YA 3EXTA 4S2BA 1KCKA 1XD1A 2Y24A 1G6CA 4U5KA 2EPOA 4W87A 4NVTA 4IUOA 1G4EA 1JD9A 2OT0A 4Q4KA 1CECA 3U5UA 3KRZA 1MXGA 4A22A 3DH7A 4J3UA 1IXNA 3W71A 3ZJ7A 1JL8A 2NSXA 4W7VA 3U14A 1M5WA 2DSZA 1M01A 1GZGA 3G0UA 3NYZA 3PM6A 2I1OA 2DZVA 2VUYA 4OBSA 5LGZA 2W92A 3G0SA 3QFEA 4ADUA 3KOFA 4HPHA 2GQ9A 4X0NA 3LFIA 4AISA 5A1AA 1QOXA 1XYZA 4AWTA 4QFUA 3DBPA 2AMGA 2C0HA 2EGZA 4MPKA 1K9FA 4H3DA 3UXDA 1FWRA 2YPIA 4JTGA 3BGJA 3C8FA 1B3OA 3MJYA 4WY0A 3W22A 4GINA 3OG2A 1ST8A 2Y6ZA 1HL2A 4ZMGA 3VE7A 6A3HA 2J24A 2NV2A 2ZZ2A 1V3LA 1GQLA 2HMCA 4A2RA 5KSWA 1BLIA 4UQBA 3TJLA 4O18A 1CEOA 2XPKA 3W25A 5JBFA 3MS8A 3KF5A 2VCCA 3AMCA 5LA0A 3AZTA 2Q8XA 3EDEA 4QLKA 3W2UA 1DQXA 1PJ9A 3WF2A 1E72M 2ZXAA 1IXPA 4K36A 2GJXA 3T0BA 4NZFA 1GPWA 3T08A 1KR1A 3LBCA 1UKPA 1GONA 1W2TA 3PUEA 3M44A 3BAJA 5D33A 1ISVA 2NZLA 3MUIA 4PCFA 3WJWA 4MB3A 1IXQA 4DF0A 3WQ5A 1OX4A 5D2XA 3WH5A 4LTSA 2WCAA 1JCLA 4JEQA 4FFGA 2J62A 2WVVA 2Y5EA 1MW3A 1MFVA 1HL8A 3TW6A 1A5SA 2GFTA 3ARUA 3UYCA 1DP0A 1NQ6A 4ZVJA 2QMJA 3CEPA 3FS2A 4HNVA 3PZUA 4CQ8A 4IX2A 3AI0A 2GJPA 3UWZA 1DJNA 2XFWA 3JS3A 3UGFA 2E5BA 1W3HA 1O5KA 4CD6A 4UQDA 4IUGA 4JTHA 1MO0A 1TV7A 3M6YA 3TX9A 1K9TA 2A3BA 4CNOA 5GNYA 7A3HA 3PAJA 2V3DA 1QI4A 1Q6LA 3VGBA 4AVFA 4UMAA 4BS0A 1NP2A 4XUGA 1ITCA 1KBKA 1E9LA 3QGVA 3M5ZA 3WBAA 3LOTA 3E96A 1NWSA 1QPOA 1G1YA 2GQ8A 1G69A 4NJGA 1TJPA 3RIKA 1XC4A 2GSJA 4ZXLA 1WXJA 4MB1A 2B7QA 1SFJA 3PG9A 1GQKA 1QMLA 2D0FA 3MV01 5U7SA 5A3HA 2BXZA 4E2DA 2IUZA 5AC4A 1AQHA 1UKQA 3R8RA 1OINA 3GX9A 3K4DA 1TV8A 1F4AA 1G5AA 4PMOA 1WX0A 4ZE4A 6CGTA 1Q6OA 5FEXA 3KVKA 3THDA 4MPQA 1H1NA 4CU6A 3PSWA 3W7LA 2PRLA 1KCLA 4CU7A 1JQVA 3W3OA 2J75A 3K30A 1OBAA 3EDKA 1QAPA 4PC8A 2D1ZA 2RKXA 4UTMA 3CHFA 3HJEA 5L9FA 1WDPA 3A24A 3W7CA 1G4TA 3QJAA 1Q45A 3FKKA 4BF9A 2ISVA 3S1VA 1H41A 3ELFA 2BWGA 4AHQA 3NIYA 5GPRA 3EX6A 3BSGA 1WB0A 3BLPX 3OZPA 4U3CA 3VGEA 3GVGA 1H49A 4Z08A 1UD8A 1PX8A 5LNUA 1E1EA 1JUBA 1M7PA 5D2WA 3E02A 4X0VA 5GNZA 5G4WA 2RFGA 3DHDA 5F4SA 2PURA 3SIMA 5AHNA 3QOMA 3M5YA 1SU5A 3DHFA 1Z32X 4AZGA 4KGLA 1W5MA 1B3YA 3SCPA 4BF7A 4CD8A 1IZJA 1FOBA 3S1WA 3KAOA 4MUZA 1PZ2A 5HWMA 2O7QA 4Q7NA 1PE1A 1TQXA 1HKMA 4O1BA 2WYSA 4JNMA 4H4IA 3GNRA 5A6AA 1MEWA 5CPTA 3VGDA 5HINA 1HP4A 2QCNA 5EYWA 1JGIA 1ML1A 4FNRA 4D6JA 1W3IA 3R12A 4TX9A 1Z44A 3OGRA 2ZXQA 3PG8A 4GUGA 5D9MA 4MZYA 4BCEA 1WYIA 1LROA 2YKKA 5I3IA 2GVYA 2XWDA 1AQMA 1HXJA 1CXFA 3LLDA 3WFLA 3W1RA 1F74A 1J0IA 2G3JA 3L0KA 1GTHA 1TE1A 5E6ZA 3QC3A 4AD4A 2VKZG 1DBTA 3LV5A 3WF4A 4D6EA 3WUFA 2FHCA 1GG0A 2UV8G 3IV3A 1HJUA 3F4WA 2GJXB 4W7WA 1KXVA 4O11A 1BWKA 1NWRA 4FIQA 3NXFA 1XV8A 3WKZA 1E5NA 3W7HA 1B30A 4WX2A 1QHPA 3MKKA 4QIUA 5D9NA 2V81A 4Y96A 2OYLA 3VIGA 4ATLA 2EXOA 4HZ7A 4ALDA 1TR1A 1JD7A 3G1DA 4FFFA 3T40A 3KL0A 3W28A 1VFFA 3I3BA 1C29A 3FYOA 2J47A 3W7QA 4HA1A 3THQA 1QI5A 4UZUA 5E0KA 5DXYA 1E4NA 4IX0A 4WUIA 1F4HA 4O13A 3UWWA 3W7DA 4UR9A 4DO6A 1S5VA 2E9MA 3CMGA 4JIPA 2WNQA 2X09A 4JTSA 4EIVA 5HNNA 3DYMA 1QWGA 1HTIA 3WD3A 3LCFA 1GVOA 2E6YA 1TTIA 1CLXA 3NCOA 2BZNA 5LNRA 1UG6A 2DT2A 3P7YA 3CPRA 2CETA 5AHLA 4YCPA 1A5BA 2NWRA 3N14A 3EEGA 2GVLA 4MNMA 1P4CA 4OBRA 1T8XA 3W7KA 3WQ8A 3EMQA 2ZX8A 2TSYA 1FCVA 4NNBA 2DH3A 3INPA 4U5IA 4RXGA 5CZJA 3VIJA 1I45A 1SZNA 2PF0A 4OIFA 4F66A 2HISA 3U75A 2ZTJA 3C6CA 4C1KA 2CCRA 2XVNA 5HBFA 5BROA 3SW6A 1BHGA 2DZPA 1NH6A 2CKSA 1FFQA 4AY1A 1GOIA 1X1ZA 3O6AA 2ZZ5A 3VKJA 3LRLA 2UY5A 1P6WA 3ZT5A 2W67A 2A21A 3TW7A 5A6LA 2ZUWA 3QM3A 1UH4A 2G41A 3F4NA 3L4TA 4M81A 1DOSA 2J8FA 4CGTA 1YPFA 1HJSA 3L4WA 4JY9A 5AYYA 4H04A 3T0AA 5I77A 4M6QA 2XM1A 5DO8A 3OB8A 2EPLX 5FF3A 4UNLA 2W5FA 4PMDA 5JIWA 3NQGA 2QCLA 3LB0A 2YIHA 4W8LA 2OZ0A 1BEUA 1VYSX 4W93A 5ABFA 1HFBA 1BTMA 3FN9A 5A2CA 1VPXA 1C8XA 1M7OA 1B4EA 3CLWA 4DUVA 1QNQA 1LLZA 1NOFA 3VX1A 1W9DM 4H8HA 1VLIA 1V5XA 4JHOA 3LRMA 2VC6A 1UH2A 1I1XA 1W2VA 3QQ1A 2R8WA 2G97A 1W2PA 1EQCA 2C1HA 2XYLA 4FNQA 4J3XA 1TPH1 4PEEA 3DXIA 3MYOA 3L65A 3CZ8A 1T0OA 3KFTA 4E4PA 1M53A 3IK2A 3PUOA 1GJPA 2QJGA 3NL5A 1HX0A 1SR9A 5A8MA 2YDQA 2YR1A 3CHCA 4ZE5A 1E4MM 2FGLA 4CKQA 4NXKA 3LDRA 3TOPA 4RKAA 4BI5A 3EX2A 4JN6A 2CU0A 5F4WA 3PZNA 1HL9A 4LYPA 5ABGA 2DH2A 4YL2A 2BY1A 5FKBA 3U57A 3UEQA 2WMIA 3PTMA 3ZO9A 2QHAA 2BX7A 4BWLC 2YW3A 2QQWA 3W83A 4DWSB 3STFA 4AXKA 2WSQA 2VC9A 3RJXA 1SMAA 1KWGA 3BCDA 4BA0A 1RR2A 1SSDA 4F8XA 4LC6A 4LUIA 5C70A 4BZYA 3MP3A 3AROA 3DGRA 2CPUA 1UR9A 2YLLA 2ZBTA 4GUHA 4YHGA 3DYOA 1UD6A 3VNYA 1AW1A 3HF3A 3W2LA 1PEZA 3OLDA 3QOKA 5BRQA 3WNKA 3AHVA 3L21A 2O9OA 3KL3A 8A3HA 3TFXA 4Z0SA 2ZE0A 5LHFA 3MO4A 3DFNA 4JYFA 2VZSA 4LX4A 4M8UA 1QW9A 3VIPA 1H5YA 2B7NA 1NWTA 4DM2A 1E0XA 1M7XA 1WDQA 1OIMA 2WWDA 1YDOA 3WD1A 1RH9A 3W6LA 2A1YA 1GOQA 4GXPA 1FXQA 5FEZA 1C91A 1V6XA 3CZJA 2DT0A 3SCVA 2C14A 4K7YA 1KM4A 3HG5A 4UFLA 3LTSA 4PCSA 1AW5A 1P0KA 1XBZA 3W4RA 3WMBA 4ZQMA 3CIXA 4OQVA 4IMDA 4AD2A 4AF0B 4S3KA 3KRSA 1W5NA 4KFNA 3TV8A 3G24A 1EWDA 2ZUTA 5A6BA 2B31A 1F7BA 1TCDA 3AYRA 4JTUA 2QEZA 3GTNA 3ALGA 3VDCA 4HOZA 2V0TA 4DO4A 4PSPA 4XUYA 4Z1DA 2VZVA 2LLEA 3WF1A 3VUPA 3N11A 3V75A 2ZUSA 3FHAA 3WJYA 3C56A 1BGGA 1AVAA 3ABQA 2NWSA 3S6TA 1SO4A 1LOQA 4RV8A 1B90A 4ZXOA 3WJZA 1XL9A 3W29A 4NJHA 1HJXA 1SYTA 2DJXA 4LRSA 1LRQA 3A47A 4LU0A 1X1NA 4PFMA 1XSKA 4XQ6A 1YQ2A 1TO3A 3P84A 3HBLA 3O15A 3TQVA 3LPPA 3HGJA 1LCOA 3K4AA 2JIEA 3NVTA 1HNYA 3AOFA 4W8BA 1X6UA 4MJZA 2A4AA 4D6FA 4D6GA 2VI0A 1E6QM 4TX6A 1OYAA 4GZIA 1EGZA 1JZ7A 1TCMA 1O6IA 1WNOA 3GZAA 1GHSA 1YTKA 3PUDA 1TB3A 3ATYA 3ZSTA 2AQWA 2FQIA 2OMAA 2X1RA 1BWLA 3CLMA 5D8ZA 3GIYA 4TXEA 3WDPP 2WPGA 3W7GA 3NEVA 3STCA 4JDBA 1QI3A 2XIBA 4NZJA 3VDHA 3PB0A 3IIPA 2EAWA 3L5AA 2J9YA 1W3JA 3LV6A 1G01A 1US2A 3QHNA 1JCXA 1GYLA 2ZUVA 2B7OA 4M6VA 1UD3A 5F1VA 3W9ZA 3ZIZA 2YFOA 3SCNA 3POCA 3E9AA 4X9YA 5LNVA 1W0MA 4QNWA 4AF0A 1WKYA 3VFLA 2V2HA 4O57A 1MW2A 1UQZA 2WMKA 4IXXA 4PEKA 1OX4B 3VMOA 3C61A 1U30A 1V3IA 3EDDA 3N3MA 1V3HA 1EA0A 5F2IA 4LVGA 3G1HA 3UETA 3GR8A 3WENA 3L0GA 2VO5A 3VM7A 3LCIA 3FY1A 4JIQA 1FX6A 1JI2A 1R2TA 2WO5A 3ABRA 4KWVA 3WIJA 1DORA 1R7OA 3KX6A 4GQRA 1R85A 3ZS4A 2CHNA 1D7FA 1TTPA 3IJ9A 1OFPA 4Q32A 3G0XA 1EP1A 1ODUA 3MBDA 4B1LA 3ATZA 4LVBA 1JCJA 3UWVA 1KTNA 3ZSSA 4AZ6A 2W62A 4N9DA 1VHCA 2J27A 5CGQA 1GYNA 1CGYA 4FFIA 3PBUA 3GDKA 4JX4A 2XTKA 4JKLA 4O54A 2O92A 5I78A 2QAPA 1QNVA 2YOCA 3MI2A 1KFWA 3M1ZA 3S6DA 2DU2A 4J3TA 1JQXA 4ZQPA 4AAJA 3NQ6A 1KLZA 1JXKA 4HA3A 4MB4A 2QAFA 4MFEA 2J7GA 3KE0A 3K46A 4C1LA 2E6FA 2ZOXA 2MANA 1LL6A 4Z2GA 1LP6A 3N2XA 1QBBA 3A22A 5E09A 4WXZA 5D04C 2FGZA 4PMVA 1KXHA 5CSUA 2ALDA 2FIQA 2HS8A 4UR7A 3RO8A 4Q22A 4TVUA 3BCFA 1XH1A 3NYDA 3W0KA 1DKWA 1SO6A 4HNTA 5FMDA 3UQNA 4S1FA 1JG9A 1VF8A 3BAWA 2VZOA 1TTJA 3L9CA 5KITA 3GXMA 5D9PA 1YXYA 3BH4A 2Z1SA 5D2YA 4QAIA 2OXBA 3G1FA 3EXRA 2NT1A 4YLWA 1MXDA 2Y7DA 4MYXA 6TAAA 3E0IA 4QSHA 3CIVA 5G2IA 1EOMA 1FXPA 3UG4A 3RILA 2VOMA 1CWYA 3NL2A 3A5FA 5AFDA 1FDYA 1GG1A 1V3MA 3K8KA 3U2OA 2G3NA 2RDUA 1HVXA 3KVMA 4PMZA 3AIQA 3C52A 3UWUA 2E9BA 4XBKA 3WQ4A 4FK9A 2ISWA 4R53A 2E8ZA 4XTIA 2VOTA 3SCSA 2Y4SA 4O1AA 1PL9A 1VB9A 5ABEA 2CIPA 5K9CA 2WK2A 3ABOA 5KTLA 4Z1AA 3LHVA 3A9IA 2B0MA 1BG9A 1U83A 1DWIM 2ZX5A 4KWWA 4O1CA 3GXNA 4YMZA 3TQ0A 3ARWA 1YYAA 2ZA1A 3SCOA 4DWSA 1Q6EA 2CZ5A 4L4MA 1EH9A 3G18A 2CKRA 3NDZA 3UPBA 2X1UA 5AHMA 1VAHA 3ALFA 3MUY1 2YA0A 2YBTA 1P0NA 3VX0A 2ADEA 5AOUA 1VFOA 3T7VA 4HMEA 4Z1CA 4N6EA 4RX0A 2BNJA 4N9EA 4W9TA 1JFXA 1W9XA 1A53A 3O6DA 3EMZA 5DBTA 5K7JA 2DZWA 2WBKA 3L67A 4UNKA 5HDRA 2PE4A 1ZBKA 4MVAA 1Y0EA 3NQFA 2ZRYA 3ARTA 1JVNA 1P1XA 3CMJA 3NDYA 1IIGA 1QPNA 2YLAA 4ORMA 1UD4A 2QR6A 1JI1A 3GB6A 4ML9A 2XN2A 2WVUA 1ZAJA 3PZMA 3UWQA 4MIMA 2QPSA 1M04A 3WFZA 2FHBA 2VR4A 3VD4A 3LHYA 3BAKA 4AIEA 4AIOA 4XZ9A 3OLIA 1P5BA 2ZICA 4ACZB 2NXHA 2NX1A 5FF4A 3DI1A 5A94A 2VEKA 5DCBA
chains in the Genus database with same CATH superfamily
3OBKA 2W94A 5E0CA 1VBD3 2ZC1A 2WZ8A 1LT8A 4D6CA 4J25A 1MUMA 3VUSA 2G3IA 1PDYA 4EWJA 4OMCA 3QBQA 1VBE2 3GLCA 2QCFA 3MHGA 2G96A 1EC9A 4I90A 5M2FX 1GQHA 2XIMA 5BWAA 5F5AA 2DT1A 2ZQ0A 4MM1A 3QZ6A 4BLJA 1JGMA 2GOKA 5L73A 1AXKA 3EDFA 1UL9A 4YW5A 2DSVA 2OG9A 1ALDA 1KWKA 3N2MA 3EPNA 1UIKA 2GNMA 2WFF1 2WJEA 4DF2A 5A32A 8XIMA 5KZ6A 1RMU1 5JXQA 2NUXA 4KWLA 2OX4A 4BI7A 2DDUA 3RF9A 3TIMA 3WQPA 4Q8QA 1S0GA 2CLPA 4BE3A 1AR71 5DX7A 5CIRA 1KFLA 2J88A 1S2AA 2V5JA 4LS1A 1Y7VA 4V27A 1WD3A 3RNSA 3CHVA 1PTAA 4P9JA 1EDQA 4FNPA 5A6MA 4GWEA 1COV3 1WKDA 3PWAA 4MLJA 3GXTA 4DUXA 3KM8A 4ATWA 4UTUA 3RWNA 4H83A 1FMD2 1O91A 2HJPA 3BZGA 3K3NA 5A3OA 4QJ4B 4JC1A 1QWKA 4AD1A 4YN5A 2VEPA 4IEXA 1XRVA 4CUAA 4L1WA 4H6RA 3VGFA 5FMCA 1OVPA 1YNYA 2EXIA 4KGGA 4WEVX 2WCSA 4UMBA 1FOD3 3JR2A 3IVTA 4PTVA 3FGCA 4SBVA 2XPJA 1OC6A 2YBUA 3QKZA 4Q2FA 4WBBA 5I09A 2V73A 4FXFA 4MKNA 2A3CA 5AKQA 3PVEA 2P0OA 3TC7A 3T4WA 3WH7A 1CB7B 1RMU3 4WY0B 5I02A 3QCWA 5JOWA 3VBUC 3VIOA 3W76A 3GALA 2J74A 2NQHA 1B1YA 1I2NA 1R47A 5FYTA 5FCZA 3OA5A 3CH9A 4YTUA 4FX6M 3VABA 2XDVA 4I9JA 1DWAM 2DVXA 2R14A 1RHI1 1W05A 3WDRA 3GDMA 4TSVA 1A3KA 1L3JA 8CGTA 1PX4A 2IXJA 4MJ2A 3KVAA 3ZJ8A 4NILA 4B9YA 4AEDA 1ZSXA 2W9MA 2YMZA 2Y5SA 2ZCGA 4O52A 3CL8A 1IS4A 2XB6C 4PL1A 1ENQA 3QH7A 1XDLA 5H9PA 4GULA 1QK2A 2IPJA 2X7VA 2PGWA 5MKGA 4IMFA 4OFCA 3IUDA 2QUOA 4LYKA 4NX0A 1SZEA 3BODA 1AD4A 2DFCA 1E57A 3S4TA 1GCYA 1RJQA 3LHUA 5C9UA 3LGEA 1OG6A 1OX6A 4HT3A 3O7OA 4DRRA 3K51A 2H0VA 1G0CA 4C8DA 4YPJA 4IP5A 1OFAA 1XLHA 1DV7A 1XBFA 4XFFA 1UX7A 1R1ZA 5L7OA 2X1SA 4Y7EA 1TPDA 3IIAA 5ABHA 3P5ZA 1NX9A 4YLZA 2QLYA 4ISRA 4COWA 1TREA 1YXCA 1PGL1 3ICJA 4IQLA 2D43A 1EOKA 3GDRA 3WDVA 1A5NC 4EPBC 1QXPA 2FH6A 4GYPA 3UVAA 1W9PA 3BARA 5IFPA 4ES8A 4L4LA 2F4PA 4W85A 4JTEA 3DOPA 4M3CE 5FYIA 2YCLA 3TSBA 4AVTA 1LR5A 1HGYA 3CKHA 2C0AA 2D6OX 2CXGA 4N53C 4JIIX 5CVRA 4FNUA 4GH4A 4IF2A 1K70A 1NDYA 2CXEA 2QUUA 3VD7A 3NQBA 4AEOA 3VNLA 3NL6A 2OO0A 1YQ5A 4UCFA 1MS3A 4E2VA 3RDIA 3ZN6B 2ZX4A 3HNYM 1XIIA 2WWCA 1KCZA 3ZM8A 2PLMA 3HN3A 1YBQA 3B97A 3WD2A 1TPVA 2ISSA 4P8VA 1RUC3 1W8WA 1UR2A 5HAOA 4ECLA 4HHHA 3UA3A 4M1RA 5EMKA 1YPIA 4ZCWA 1QVBA 3AMPA 1QTWA 3CQOA 2GJLA 3RMEA 1AUYA 2ATMA 1EPXA 4UTFA 4W6WA 4LIVA 3JUGA 1TQ5A 3G6JB 3DIPA 4IM4A 5A2AA 3A0NA 5JZGC 2ZKNA 3THUA 5FMBA 4H7MA 5FP7A 5FZ9A 1KRIA 5A7SA 3VKOA 4NHYA 1ISWA 4GWNA 3C7OA 7ENLA 1QOSA 1S0FA 1XLEA 3N9PA 4AI8A 5C4WB 3IRSA 3AZZA 1VPHA 3MUXA 4LNYA 3DC8A 4F79A 3TWBA 1UYYA 2EA7A 4KESA 3NO3A 4HN4A 1SCSA 3FZ3A 4LUTA 1D2SA 3ZXLA 2IQ0A 1W32A 3P8IA 3SFKA 4WM7A 3WUCA 3R2GA 4L0PA 4JX5A 2E7FA 4R88A 1ND3B 5DMMA 3G5EA 4BFAA 5XIMA 5JAXA 4FOYA 2A6WA 1LL4A 2D2GA 3HV9A 4O50A 1K45A 4IH3A 1JRCA 4Y9OA 4E0CA 5C9WA 3U07A 5KHJA 3AAMA 2VOXA 4G9SB 1RPXA 3QTGA 1C7TA 4U2AA 3VHRA 2CLFA 4XAZA 3RJ2X 2JWPA 4HP5A 2OA2A 2E68A 3SY1A 5FYCA 2E77A 3N73A 3W1TA 5LIYX 2AAAA 1ZBCA 4BK5A 2WSKA 1CPNA 1RC6A 3VIMA 3LYEA 5G1YA 4CDQB 1JZ5A 4PUMA 4AVCA 1RUJ1 3ATGA 4Q8TA 1AR61 4JTTA 4Y1ZA 1RB8G 3ZJKA 3WNLA 2PQQA 1VIWA 1V7AA 3CJXA 1WE5A 3VGGA 2VX5A 4OHQA 1AYM3 1RUSA 4DBEA 3U6WA 4A8NA 3VM5A 4NAMA 4NRSA 3PTYA 3F2ZA 3GTFA 1UROA 3AIUA 4XTMA 4GX9A 2E63A 4PH6A 3W85A 3FLUA 4HB7A 1E40A 2NX9A 1SJAA 4PRRA 5D03A 1GP4A 1EXPA 3ZYHA 5JPMB 3ZT7A 3RYKA 3LI0A 5LA2A 1UYZA 3K2OA 3VKFC 2DJLA 3OY8A 3KS6A 1YMYA 1MS8A 5K4ZA 3BW2A 5A70A 2ZTNA 3H2OA 2EIBA 4H14A 3KHJA 2VTXJ 1ZAHA 4AFYA 3LHWA 5CFDB 3MGUA 4GH4C 2A2IA 1J6OA 4CD5A 4CRQA 1QASA 5FQ0A 4LYRA 2AUYA 2WT1A 3J8F1 3W20A 1QQP2 3QMSA 2W47A 1KBBA 4YVSB 2GC3A 1OT5A 2H6CA 4F9DA 3TKFA 2WSVA 4NSBA 1DIWA 2PQSA 3QQ0A 4QBXA 5FYBA 3OODA 2G1MA 4E38A 4HOXA 3UGRA 3LUTA 2PHXA 4LALA 4PFHA 1GANA 1QNYA 5FSDC 2XHNA 4EN7B 3H9AA 4IXLA 1BF2A 3W2KA 2JGYA 2UYBA 3W7EA 3AYTA 4HJFA 1ZU8A 3UJ2A 2W6RA 3F95A 2YROA 1Q7QA 2UY3A 3HQ1A 2ZX6A 1DWJM 3FLRA 2GU9A 2WZMA 3C2UA 3WL1A 3WNPA 1UWQA 3GBGA 4QM8A 1VB2A 1TPB1 2GDUA 1E6RA 2W61A 5DBUA 1LESA 4CNSA 4NIHA 3TFCA 5ABJA 1YEYA 1BK0A 1I2PA 4AWEA 1ZVFA 3LAGA 2J13A 3MKVA 4XK2A 5BU6A 3S7IA 5FL1A 3KDNA 3QMRA 4UNIA 1H3GA 2QCGA 2ARXA 3BLOA 1J0KA 1CDGA 3M0XA 3SRDA 2CY6A 4S3EA 4IISA 2QDGA 1GOMA 2R071 4UQAA 5FESA 1WZLA 1OY0A 1RY0A 3BV4A 5G4EA 4UOQA 2BASA 3UBPC 1WZKA 3N1AA 3L4UA 1J96A 2FZ1A 5C7GA 4GNVA 2DBIA 1DLCA 4HSNA 2Z6IA 3MZHA 2DW7A 5H6HA 5LATA 4ZGYA 1CXKA 2KAUC 4WKFA 5CKMA 1FWTA 3QV9A 1EDGA 5CPLA 4WOZA 1EJUC 1ASJ1 1AZ1A 3HQPA 3UR8A 3Q8BA 1Y43B 2J22A 1WDWA 2QUVA 5J37A 5FZAA 5EYYA 3BGGA 4RZBA 5BRBA 4AZZA 3VD9A 5ENLA 3V65A 3N4FA 2WV8A 3N2OA 3OZOA 3APYA 1DIDA 1UB3A 4XTPA 1MFUA 1UA3A 2E6AA 3BANA 5JMOA 4XPVA 3IIOA 3IDEA 4TLFA 4K7VA 4DJFC 2O9RA 4MKSA 4IV1A 3AWNA 3TCSA 1DWHM 4DJFA 2UWFA 2EALA 2JDMA 3I54A 4QLJA 4LA2A 3B3QE 2ZBJA 2FFCA 2IXLA 4Y9AA 1AHSA 3AXEA 3CUIA 4IGHA 3V0BA 1J3RA 3CGTA 3M46A 2WAOA 3TEWA 1QY4A 3TN93 2H8ZA 2OLSA 3H7JA 4J2MA 1LF1A 3WJSA 4Z1BA 4FTSA 3NZ1A 4C5YA 1HIXA 2NQYA 1XSIA 8RUCA 2ZTKA 2W66A 1OGBA 4MNLA 4Z2KA 2WNEA 2PF8A 3TR2A 4NP7A 2E32A 3SUUA 2PWDA 1Y9QA 4PDWA 1RP8A 1PHWA 2XBO1 5LB6A 4IIHA 1ZENA 3LTPA 1B35C 3N13A 3VGIA 3WY1A 4HOWA 2WZIA 4EVZA 3BG9A 5CBIA 1A8MA 4Q4V3 5GZDA 1ACCA 3M0ZA 1RP9A 5EA9A 3KLSA 1UIJA 4L6DA 1TWSA 2W52A 1DPMA 1AL21 2YGLA 2ZZ4A 3HA1A 4URIA 5DF0A 3LPGA 3I3DA 1PV8A 1OD8A 3C0SA 2CNCA 4P9WA 4Y5SA 5DXXA 4QWNA 4ZU7A 2JKPA 3W37A 5I3GA 1KBJA 2IPWA 2OSWA 2VUNA 1T5AA 4AU0A 3S6PA 1XPYA 1RD6A 3G3DA 1OX5A 3T44A 1WCGA 2E3ZA 3GC4A 3S1XA 3A12A 3KUMA 3VC5A 2H90A 1G9AA 1UD5A 3UYIA 4NI3A 5LCWL 4K8RB 1LRNA 3C8XA 4LOSA 1LJ7A 1GKRA 4PMQA 5FZ8A 2WNNA 5D2AA 2ZKMX 1BJQA 3G6LA 1OCJA 2YBVA 4EAYA 1HG3A 4R9XA 4RZ5A 3WMSA 1RUD3 3R79A 4O0KA 1OFNA 1H50A 3N35A 4WSHA 3SNMA 5ECUA 5IAXA 4FR6A 1UPPA 3LX9A 1MSSA 4FHAA 5E70A 1QNPA 3W7IA 2WO1A 4L65A 4S3DA 2Z2UA 4QEHA 3V0TA 3OVPA 5G1TA 1IE7C 3UJQA 1TUXA 3K1GA 3KP1A 2OGJA 4JGYC 4NX5A 1IZCA 2QQPA 5G2HA 5HJLA 4ZOEA 1IHMA 4P61A 3UL2A 4LYQA 3BG5A 4TIMA 1XB9A 4GGBA 2PCEA 2O9PA 4ZSTA 3MJMA 4A41A 3BXWA 1F07A 1OFQA 3B93A 4TQTA 5I23A 1NY1A 1JZ6A 3DPRB 4LORA 3E12A 4Y1UA 1GOXA 2EPNA 3VTRA 1STMA 4B5WA 1BMV1 1G7UA 1R38A 1DVJA 5J8LA 3AP5A 1ALYA 5DY2A 4NN0A 3WLTA 1Q2SA 4ZQCA 4J3VA 4ZY9A 2XJTA 1I9CB 1VH7A 3Q8EA 1MRQA 2P53A 1OFDA 5FYVA 1AR72 2PDIA 2EAAA 4AEKA 4LBQA 4B5TA 1EDTA 3TJXA 1W6PA 5CNAA 5DY3A 5E9AA 1MEHA 4WKHA 4V28A 4X2RA 1KRCC 1NCQC 1NCQA 4QX7A 1R3RA 1BZWA 1UUQA 1PZ8A 2N7GA 3PJWA 1ME9A 2JF7A 5LEKA 3JZUA 3W24A 4XJ8A 3WR0A 1NWUA 3JQXA 2ODOA 2IUWA 4K8FA 2FHFA 2ZYFA 3F4CA 4Q1RA 3BCJA 4P5HA 5CZ0A 4PIXA 3KCLA 3O2LA 2B8MA 2G5WA 4LNCA 4U31A 3EMRA 1AL7A 1OGSA 3P81A 4F0MA 3B94A 3IPVA 1ADSA 2Y7FA 5E0FA 1Q8OA 1CXLA 3CZLA 2PDYA 3W86A 3LCWA 4MXVA 4TV5A 4ML4A 4JTOA 4LBOA 4ZO7A 4UTTC 3N7KA 3NG3A 1G9CA 4NYYA 3VN4A 4YCOA 5BRPA 3CZGA 1PIV1 2ZIDA 3HG3A 3TAKA 1WDDA 1F61A 5I6SA 2EJAA 3L5MA 3QVQA 1NA1C 4NHMA 5D02A 1KD7A 3PU8A 3GSMA 1SLTA 4IGMA 3OIXA 2GH8A 1RUJ3 4AI3A 4EN6B 3AK0A 2TPSA 2WVVB 2VD9A 3CASA 3IVSA 4AH7A 2PU1A 1EZ2A 3U11A 1JDEA 2HVMA 1Y5XA 4NASA 1WCUA 2Z2AA 1VMFA 1QDSA 4W4QA 1APNA 4RR3A 3LEKA 5BYWA 5E88A 3U5YA 2ACQA 5GVJA 3EXUA 3NWRA 2AKZA 2WSPA 4GFSA 3P74A 4GZJA 3B8WA 1B57A 4GA9A 3ZFHA 1EF3A 1CX9A 2J1TA 4FP1A 3NAVA 2C1FA 2A6ZA 3R4SA 3TWIA 1JDAA 2OWCA 3AIRA 2PN5A 5FFOC 5J36A 2F4LA 2QCSB 5H9QA 4ICMA 3QW4B 4ATDA 3F1QA 3H12A 3MIEA 4V2XA 3VA8A 4DZHA 2PHLA 1H7RA 2GDFA 1C57A 3R7MA 1UNBA 5HNRA 3J7NA 1TMHA 1YE6A 3AC0A 2QDEA 4DXXA 3S5ZA 1POV1 1JUEA 3OLEA 3WLIA 2YCJA 3T78A 4GJYA 3PZ9A 4Q4Y3 2FD8A 1W1A1 4N90A 4HT1T 1K8ZA 1FHDA 4RHV3 2DFAA 2VELA 3MSGA 2LROA 2QT3A 1FDJA 4J27A 3CPGA 3TYJA 1NAL1 3TN91 3GH7A 4QDWA 1PO23 5K8SA 4XZWA 5EBAA 2BGNE 2O7SA 1N47A 3IJQA 2VZRA 4MAZA 1RUE1 1TIMA 4GH1A 4CLMA 4AXNA 4AUBA 3VDBA 1W39A 3HU7A 5D2VA 4Z1YA 1PO13 4DY1A 4M29A 1RL3A 1BKZA 4PDWC 4AI9A 5AC91 1L6SA 1U1UA 5ISLA 2NLYA 4AYSA 3TAYA 1FCQA 3W7OA 1ONAA 2ZX7A 1QU0A 1ULDA 4JAWA 3QHOA 3I2OA 3K3OA 1EP3A 1S2EA 3E49A 1JYCA 1PKNA 2Q30A 4M82A 1A5AA 2P5NA 4YG0A 4C6QA 5GJ6A 1L0PA 1O60A 4LXFA 2I57A 1GOWA 1ZPTA 1DDLA 1O7AA 2IPFA 8XIAA 5I5RA 3W1PA 2VUCA 2F6XA 4KERA 3CJPA 1ULCA 1AUSL 1S46A 4BA6A 2XLAA 2C5DA 4WGXA 2A3HA 1UBSA 4PSRA 4QM9A 2PDMA 1HRI1 4HG6B 1UOFA 4JRLA 1K42A 1NAEA 3K48A 2HDJA 3IAQA 5IUQA 1BTCA 3V5FA 4C6BA 1JF6A 3AQUA 4DYKA 4ZXEA 3BLKA 4REQB 4EXAA 2Y26A 4YZ2A 2F2HA 4AOCA 3ZIXA 3KQ4B 1VCVA 1AK5A 5EKYA 2VFFA 4UFJA 4QX8A 1YDYA 1H63A 1QI2A 3RHGA 1OF6A 2VTFA 1REQB 2WJZA 4YU1A 4HSHA 1H7XA 1RQBA 3FJNA 4FT8A 4JZRA 2OSYA 1OGGA 2OPKA 4YVWC 2V69A 1BVZA 4A8RA 5LBBA 1PDZA 1M68A 5DG1A 4HXCA 1LLOA 1EJ7L 3SN4A 3LEIA 4OUEA 3F2CA 3QQWA 3S5YA 5J5DA 3TN6A 1VKFA 4YYOA 1HXS2 3W07A 3GW3A 4NRMA 2EXKA 4XHBA 5C8BB 1OA3A 2CBVA 4R52A 5DMYA 3KQRA 4YGCA 2WS92 2ZRWA 3RGTA 2WIIB 2J1EA 4Q8OA 1C92A 5AC7A 3UNDA 1YCIA 1OFBA 4H01A 4FPKA 2EVXA 3I2KA 1W37A 1WWYA 4C7DA 2PDLA 2WRAA 1O12A 3W1LA 4AD3A 1RSCA 3HOJA 4C1NA 2SLIA 4DRVA 4GJJA 2IPGA 4BMBA 3RM9A 3EX1A 1D3HA 2GJNA 3ONCA 2D2OA 3FYYA 1FPN2 2VGGA 3LOIA 3QV7A 5I0SA 2D0HA 2WHKA 4FTEA 2VU9A 1X97A 5BXRA 2I2SA 5F3GA 4Q4SA 2WSRA 4XQWA 1VEMA 4WDWA 5I24A 3NQMA 3UR7A 3H1YA 3GCXA 5A2BA 3OEXA 1IPSA 5IATA 3KOWA 4G7FA 1H1MA 3W53A 2JALA 4HPXA 1UKGA 1Z9AA 2O8QA 1W6OB 1CR7A 3H53A 5FY4A 1AXZA 3W27A 1IT0A 1VC4A 2OX1A 1V6VA 4O17A 2R91A 2EBNA 4GB33 3LZ5A 3UGGA 4WJ8A 4X6RB 3NQ7A 4EKJA 3GTXA 3N2BA 1J1TA 1H60A 3P5BA 1VBE3 3APTA 3EAUA 2E1DA 5AB3A 1TVNA 3RQ0A 1C90A 2YFZA 4HNCA 1GVYA 4PUNA 2P3ZA 4Y2WA 2F17A 2RM23 4LITA 1GEQA 4FI9A 2VZUA 3WQCA 4CQCA 2WC4A 1OIFA 2JDKA 3KZPA 1IR1A 3LBMA 4JTCA 3QGKC 3EB7A 1D8WA 1H61A 1NOWA 4XBJA 3Q8AA 4UBPC 4CPBA 4L8QA 5GKAC 4XF0A 2HTMA 3IGUA 4LF1A 1GWKA 1ZREA 5KMYA 4XIOA 3GTIA 3KHCA 1N1VA 3WLRA 3ZMRA 1KRMA 1Q8QA 3QF0A 5FJTA 2FGBA 3M5XA 4MTVA 4EV0A 2A3LA 4LLOA 3LCLA 3NOEA 4ZO6A 5FZ3A 1TPUA 5A5WA 4AGGA 4O1FA 3UKVA 4GACA 1POKA 2PAMA 4DNHA 3B0VC 5CLWA 2CLKA 1V6KA 2OPJA 4Q4MA 4MUVA 5BOFA 3M16A 2YCLB 3A3WA 3PANA 2VVDA 3SLIA 2JDYA 2GDVA 2ZE3A 2WPBA 2C18A 1AH4A 4QPYA 4AHOA 1ZNNA 1WZAA 5EP9A 1HQTA 3EWDA 3NJVA 3DECA 1LYXA 1IXOA 1YFWA 3C0QA 4H9TA 1O68A 3MHUA 3FA3A 1WLTA 2XJPA 1O4ZA 3FVDA 2OYKA 1MZFA 5TBOA 4V2VA 4AZIA 2HE8A 3BJFA 3QGAC 4X2PA 2BVTA 1UF2C 1EA9C 4ICNA 2CWXA 4XKYB 3QHMA 3QD6A 1GZJA 3FE5A 4UC5A 1G7VA 1QJWA 4FP3A 1W17A 2X1IA 2QQLA 1W1ZA 4FOQA 4F0RA 3LG3A 2YB7A 4KETA 2ZUUA 4KU7A 2NVAA 2HWE2 2V38A 4KGQA 5FPAA 4MY8A 4O4VA 2DGAA 1J0YA 5LY1A 4RE2A 2J7EA 4XKMA 4ILSA 2D73A 3TEZA 2PFWA 3KVJA 3O7UA 4YSFA 4IGNA 3WYZA 1D4M3 2NQ9A 4CUBA 1VPQA 2QQNA 1MQRA 2PP1A 3W1XA 3IIZA 1V6YA 3GCWA 2O0TA 3BUCA 3F2BA 1BCXA 3NO8A 4XDPA 1QNOA 5F4XA 4MADA 4WF7A 5FZ1A 2PTYA 3RNDA 3SCWA 3IUIA 1TMF2 4AFDA 2WA4A 2YUEA 3ECQA 4UZSA 4AQ6A 2A3WA 2RDNA 3N04A 4UXDA 3IWPA 1A3HA 4X3ZA 3PZQA 2VEIA 1DZRA 3EXSA 2X7WA 3AYAA 1XM3A 4PYSA 5C3PA 3OW1A 4XVEA 3LDKA 4C7FA 4AE2A 2P10A 1PXGA 2YCEA 1GKPA 4FI4A 3PTQA 2XIOA 3R0DA 1REFA 5IDIA 2V2DA 4FQZA 4R9BA 2NMNA 1BYBA 2P8BA 5SWUA 3MBWA 3NXLA 4B16A 5EJ3A 3ABXA 3T8QA 3CUHA 2ZZ3A 4L4OA 1A49A 5I3DA 4UTLA 1RBLA 2EKCA 2Z26A 1JNEA 1PVC1 5FKYA 3CEUA 4S23A 2X41A 3L23A 2YBPA 3AMDA 2C71A 3PSVA 5K3VA 4K9SA 3UJSA 3SUVA 2ZUMA 3L66A 1KXTA 3QY6A 3E97A 3WT3A 1LWHA 1ZJAA 1EHNA 3MQTA 4P9XA 3U78A 3WSOA 3BCWA 3T4CA 3NJYA 4QQ3A 5JI9A 3FA5A 5I8YA 1S5WA 3N2TA 2V5BA 2QGHA 2IC1A 2FTPA 3GY1A 3CB8A 5TNVA 2DVTA 2XVGA 3WVJA 2F9RA 3I3EA 4IE7A 3NV4A 3CZEA 2I74A 4IETA 1V51A 1K5MC 3VNKA 2E25A 3CUZA 2X1TA 5BUVA 2J9XA 4YVVA 1RD5A 5A80A 5FXWA 3OUHA 3N4MA 3VDDA 1XXXA 4FA3A 1JRBA 4A3HA 4DBDA 3GXIA 2P5BA 1KTBA 1SDDB 1H9WA 3K77A 4EXBA 1PCKA 4NY2A 2WHJA 3EX4A 5EFDA 5FLIA 1AXYA 2VBPA 1JMUB 3VK5A 4JTQA 4NIDA 3GBDA 1XCWA 1HRV2 4AW7A 3GU1A 5K4XA 3DCPA 2B81A 4QXCA 3FBMA 1NDVA 3VNJA 4XFGA 4DEQA 3PJUA 3WCSA 1HJQA 2ACUA 4OZXA 4US5A 1V02E 3DG7A 2A5ZA 4C60A 4XKYA 5T52A 2VQUA 1S4CA 1DL3A 5F2MA 4UTJA 3PMSA 3UCDA 4QAWA 4XUTA 3H22A 1JJKA 3DPRA 3XISA 3O3RA 5JXGA 4DWDA 2WSUA 3MF6A 4GQ7A 4CCJA 1W54A 5I79A 3T81A 4E2QA 4U3AA 1KXQA 4WQ6A 1UW8A 2ZRUA 4FB7A 3NKTA 1TX0A 3ARXA 2YDAA 2OKTA 1L8PA 4S2BA 2EPOA 1O66A 3MYXA 4IUOA 3PPGA 2CAVA 5FWJA 1XPGA 4LO7A 2R1PA 3TNPB 2DSZA 2EG6A 2DZBA 3OBTA 1M01A 3PM6A 3T07A 2I1OA 2DZVA 2VUYA 4IFRA 5LGZA 3G0SA 4LH8A 2BP6A 2GQ9A 4AISA 1UY3A 2DVAA 1YIPA 4QFUA 3DBPA 1YYNA 2AMGA 3Q9OA 1K9FA 3LENA 4DPNA 3WCRA 1B3OA 5CAKA 1HL2A 4AVOA 3H4GA 1GQLA 5KSWA 4INDA 4FBFA 1PVC2 1ITUA 1CEOA 2IKHA 5JBFA 3KF5A 2BB0A 4MSVA 3RFRA 2UZ9A 3R6SA 3W2UA 1DQXA 4HCHA 4Q4QA 3C8NA 4K36A 1ZRFA 2MUCA 1S3TC 4NZFA 5DZEA 2P3JA 1M3UA 2HWB3 3PUEA 3M44A 1ISVA 3MUIA 4MB3A 4PCFA 4DF0A 5LY2A 3WQ5A 1QK0A 1VBC2 3TOJA 1FWEC 4FFGA 3V5CA 4QKFA 2WVVA 4S2DA 2Y5EA 3ORJA 4Q7BA 3TW6A 3BJTA 1DP0A 4ZVJA 2PTXA 2QMJA 3HPFA 3PZUA 3D8CA 4GVFA 1W3HA 2E5BA 4CD6A 1O5KA 4UQDA 4BIOA 3KBMA 1TV7A 3MIFA 1EXBA 1K9TA 3M6YA 1QJU1 3ZPOA 2BTVC 1BD0A 3A64A 4AVFA 2K46A 3S7EA 1ITCA 3FSUA 5E9XA 3LOTA 3E96A 3ZXGA 1RVKA 1YFUA 4JDOA 2GQ8A 3E0FA 3RIKA 4DNYA 1WXJA 1X8CA 2HNHA 4I5XA 2WQZC 3LQCA 3RAOA 3TYBA 5U7SA 5AC4A 4QQ2A 2FCVA 1RVF3 1PVC3 3K4DA 5DANA 1F4AA 1G5AA 3QPEA 3PAOA 5IVVA 1IOAA 1IEWA 4A35A 1H1NA 1RUH2 3ZFFC 1DXFA 3SN1A 4YVXA 3EDKA 3UGVA 1TNRA 1QAPA 2D1ZA 3AYCA 2RKXA 3VZYA 5L9FA 3A24A 1R1A2 4K8GA 1G4TA 3PP7A 1Q45A 3FKKA 1D7KA 3B9OA 2ISVA 4YVWB 1XQLA 1W9WA 4I02A 3RI9A 3OZMA 4KT2A 3LZZA 3TZNA 3KV4A 5JOZA 3M4HA 1E1EA 1JUBA 3MKCA 4S2FA 5D2WA 1C1FA 4B8EA 3HMYA 1LOGA 1LECA 1SU5A 3S30A 2AMXA 3M5YA 1B3YA 1W5MA 3SCPA 3KHBA 4QHBA 1PZ2A 1DJIA 2O7QA 4Q7NA 1TQXA 5I93A 4CXWA 4O1BA 1S5MA 1VIZA 4H4IA 1HP4A 5BNOB 1I1EA 5EYWA 3POEA 4FNRA 5FYZA 5HJXA 3PG8A 1WYIA 1LROA 4GLEA 3NO1A 3LLDA 2WS93 5I03A 4YFZA 3PNUA 1F3XA 1M1BA 2VKZG 2YY1A 3H8AA 2VWTA 3WUFA 5CKNA 1HW5A 3IV3A 3L12A 4CCMA 2QW5A 4W7WA 1KXVA 4B4PA 5HCHA 3W7HA 4S2HA 4QIUA 2OYLA 3VIGA 3MW2A 1TR1A 1LKNA 5A6YA 1JYIA 5BY5A 3T40A 4I5RA 3VZZA 1C29A 2V67A 1VBJA 4P02B 3SY8A 3W7QA 5E0KA 1E4NA 3T4VA 5DDJ2 1F4HA 3NWKA 2PP3A 3UWWA 5EHDA 4WM7C 4UR9A 3CMGA 1S5VA 5I7GA 2X09A 4Q29A 5HNNA 3WD3A 3GZEA 2BZNA 4UBGA 2PA6A 2DT2A 3P7YA 3ALQA 4N43A 5DAQA 1RCQA 4AVVA 2ICSA 2UWCA 1FV3A 4B7KA 2ZX8A 2TSYA 3SQLA 1DCSA 1PZ1A 2DH3A 3INPA 5CZJA