4UFIA

Mouse galactocerebrosidase complexed with aza-galacto-fagomine agf
Total Genus 211
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
211
sequence length
644
structure length
641
Chain Sequence
GAYVLDDSDGLGREFDGIGAVSGGGATSRLLVNYPEPYRSEILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYELDENYFRGYEWWLMKEAKKRNPDIILMGLPWSFPGWLGKGFSWPYVNLQLTAYYVVRWILGAKHYHDLDIDYIGIWNERPFDANYIKELRKMLDYQGLQRVRIIASDNLWEPISSSLLLDQELWKVVDVIGAHYPGTYTVWNAKMSGKKLWSSEDFSTINSNVGAGCWSRILNQNYINGNMTSTIAWNLVASYYEELPYGRSGLMTAQEPWSGHYVVASPIWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVALTDGLGNLTIIIETMSHQHSMCIRPYLPYYNVSHQLATFTLKGSLREIQELQVWYTKLGQRLHFKQLDTLWLLDGSGSFTLELEEDEIFTLTTLTTGRKGSYPPPPSSKPFPTNYKDDFNVEYPLFSEAPNFADQTGVFEYYMNNEDREHRFTLRQVLNQRPITWAADASSTISVIGDHHWTNMTVQCDVYIETPRSGGVFIAGRVNKGGILIRSATGVFFWIFANGSYRVTADLGGWITYASGHADVTAKRWYTLTLGIKGYFAFGMLNGTILWKNVRVKYPGHGWAAIGTHTFEFAQFDNFRVEAAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GALACTOCEREBROSIDASE
publication title Azasugar Inhibitors as Pharmacological Chaperones for Krabbe Disease.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 211
structure length 641
sequence length 644
ec nomenclature ec 3.2.1.46: Galactosylceramidase.
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02057 Glyco_hydro_59 Glycosyl hydrolase family 59
A PF17387 Glyco_hydro_59M Glycosyl hydrolase family 59 central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 4ufiA03
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4ufiA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4ufiA01
4S2CA 2GJLA 1YADA 3M46A 4PMNA 3FJLA 3W7EA 1IZKA 1GOIA 3OLIA 3VGBA 4UTHA 3FA5A 4O17A 3THAA 2DZPA 1HJSA 3G1SA 4TXEA 3LCIA 1VYPX 3OVQA 2NXGA 3VNDA 2EBNA 5BXRA 2PRHA 5HMSA 2E9MA 5A6BD 1Q6LA 4WZHA 4K39A 1ME7A 3NQEA 2HISA 4BFAA 1E6QM 3VI2A 1N55A 1XYZA 3JS3A 5HINA 1DWIM 4KH2A 2ZDRA 2V82A 3RNDA 3TE9A 1V6WA 3ZSSA 1KM0A 4GZJA 4UNLA 4UUIA 7TAAA 3GM8A 2ZZ5A 4YL2A 3TSDA 4HP5A 3W1QA 3EWZA 2JEPA 3W28A 5CGMA 3W7NA 3PSVA 1FA2A 2DH2A 2Q8XA 3VDBA 1OCQA 4O16A 2EPNA 2WSKA 1Q45A 4PTNA 2A2IA 3LXAA 1QW9A 4MPKA 1EUAA 4FX6M 3LHWA 3VVGA 1PJ9A 3QMSA 5E0KA 3W27A 2ZX8A 3QJAA 3BLKA 4O0KA 1NARA 1UKTA 3KXQA 2WAGA 3PY2A 1E5NA 1SZFA 4N4QA 2MANA 2X8RA 4GKLA 1K7FA 2VQTA 4UTTC 5U4NA 2Z1SA 4E38A 1DHPA 2VZVA 1GJUA 4JCLA 3ARQA 1VEOA 2ADDA 3L68A 1F2JA 2VVNA 5HR7A 3VD9A 3LLFA 2ZICA 3OGSA 5D38A 2W0UA 5CQ1A 3RDKA 1BYAA 1BTMA 4G1KA 1ISZA 1GOOA 3NQ2A 3VD4A 3BG9A 3QM3A 3MV01 2VEIA 2QJHA 3C52A 1DTUA 2F8QA 3LDRA 3SZ8A 5DXXA 1KR1A 1OGGA 5I23A 4NUWA 5HULA 1V0NA 2CBIA 2E8ZA 3GDRA 1MWOA 4H41A 1WZMA 1KGUA 1V3KA 4UR9A 3U5YA 1X1NA 2FIQA 1E3ZA 3VNYA 4WOQA 2EQDA 3CPRA 2V2CA 3GXNA 4EQVA 1VHNA 1QHPA 4W7UA 1ST8A 1PV8A 3TA9A 2A0NA 2VCAA 2BZNA 4UQAA 2ZZ1A 2GJXB 1E15A 3GYEA 4NT0A 2JIWA 2ZIDA 1OWQA 5D2XA 3VDHA 3TIMA 3BLPX 2V3EA 1E43A 3N18A 3WDPP 1V7YA 1G5AA 3K8KA 3LERA 4B1LA 3BMVA 4Y6GA 1DKWA 3QSRA 2WSQA 2W62A 2DU2A 2W92A 4W85A 1RVGA 1MXGA 2WVTA 3ABQA 3QW4B 1JDDA 3HBKA 1V0LA 1JUBA 2J9YA 2GQAA 4O15A 3ZWSA 3IAQA 3VD3A 4Z2LA 2QR6A 4K36A 2WM0A 4DUXA 4D6EA 5H2ZA 3WQ4A 2GVJA 2ZRWA 3IVSA 4R27A 4ACZB 4LXFA 1LQ0A 1QNSA 4P2VA 2UY5A 2ZRVA 3I3BA 4R7JA 2CLIA 2CETA 1YDOA 3LBCA 3UWVA 3UQNA 2PWDA 5AYIA 4OGZA 5J5DA 1OX6A 5SWUA 1U2YA 2CZEA 1GVSA 3DYOA 5DY2A 5KINA 2W79A 1OD8A 3BSHA 4PTMA 3GNNA 4IPJA 4WJEA 1KB3A 2D73A 1CW2A 1GYNA 5F1UA 1RD6A 1LRNA 1IZJA 2D1ZA 1X1OA 3EKLA 4O14A 4D2JA 3WDJA 4IWWA 4TVUA 5IDIA 3P8JA 4ZMGA 2W66A 3BAYA 4DUVA 1EDQA 3W2UA 3AHXA 1X1ZA 3F5JA 4R5EA 5D09A 1SFLA 2AEZA 1UWTA 1F4AA 4YHGA 3THCA 1IT0A 2Y7GA 2VR4A 3CUHA 3SEPA 5GNYA 3WD4A 1GOKA 3HBLA 5DO8A 1WYIA 3NSMA 3CHEA 1E5JA 3LHZA 3TXZA 1UB3A 2ZA2A 4F9JA 5FOOA 3ANYA 4O18A 2GQ9A 3P60A 1JL8A 2OLHA 3GYCA 1B9BA 1UKOA 5CPMA 2QJGA 1B3WA 3WF0A 4O50A 4IOTA 3SCVA 4JY8A 2FHBA 2WC4A 2QMKA 2TMDA 2V3GA 4TMCA 1HJVA 4IX0A 4WOZA 3EX4A 1HX0A 3AHYA 5F4SA 5IM51 3ATYA 1UWRA 4ZQNA 2ADEA 4WLCA 5D8WA 1JNDA 3W25A 5A69A 1VLIA 3TW6A 2F61A 2GK1A 4FF7A 4QCEA 1VLWA 2Y70A 2YFNA 4UQCA 5KZ6A 2J6XA 3GTNA 2CZDA 4LPCA 4W5UA 4EF9A 5HPCA 5DCBA 1ZJIA 4HSNA 3BC9A 3FJ6A 2XFRA 3O6AA 1UUMA 3HF3A 1W5OA 2DORA 2NLIA 2YGYA 3NVTA 2VO5A 3T2QA 3ZO9A 3R5EA 2X30A 3UZJA 4CD8A 3C6CA 1V6XA 5HXMA 1TCDA 2B4GA 1JDAA 4ATWA 1NSJA 3Q37A 1SFSA 4W9TA 2XQRA 1SMAA 1JZ6A 2QCDA 2GVLA 2C0AA 1CGWA 3NQ7A 5CPQA 5I79A 3PZIA 1XRVA 4EANA 1AK5A 4W8BA 1ITXA 2GDUA 3MYOA 3IAPA 3G3DA 3N2XA 1UQYA 4U3AA 2EF9A 1P0KA 3NSXA 1KBJA 1UUQA 5IHRA 4K37A 1D3GA 1W5PA 2XM2A 3W1NA 1LM1A 4ZQOA 3WNKA 4TUFA 1OIMA 4P7LA 1Q6GA 1MXDA 3AZRA 3CBWA 1XH1A 3VFLA 2QF7A 3ZIZA 3W87A 1FH8A 3HG5A 4L4PA 4HPJA 3U8GA 1MO0A 2PBGA 2WJZA 4CLMA 1JFHA 3LV5A 1SPQA 3DC0A 1BSIA 2WZHA 1B0IA 4RXGA 3IIZA 4U3CA 2AEYA 2W6RA 3W1MA 4JKMA 5HDRA 1WDRA 1ODUA 3WUBA 1WDPA 4I9AA 1QVBA 1QI5A 1GVIA 2FTPA 1TIMA 3N1AA 2DSWA 2D20A 2CITA 5E6YA 4KFPA 4CU7A 4QLKA 1NWUA 1FOBA 1HXJA 3WUGA 4PTWA 4LU0A 1HKMA 4PEEA 1JULA 1VC4A 2WSRA 5FEWA 2HVMA 4CU8A 3RFAA 4NJJA 3MUIA 1JJKA 1HUVA 3VIMA 3DHFA 5I77A 2E9BA 5E0CA 1ESWA 3DFTA 4L4LA 2FHCA 2DEPA 2JGYA 1HKJA 3W2LA 3W7IA 1GZGA 4HNTA 2J78A 4RK8A 3TQ0A 3LXCA 4RCXA 4KWWA 1I2QA 4OU1A 3PHAA 4V28A 2CLKA 1FH9A 1JZ2A 2OJPA 5KMYA 3NDOA 3VKKA 3MHFA 1LBLA 4WXZA 3D3AA 4LGXA 2Y24A 4J3VA 1OFEA 5BW6A 1NOWA 4E8CA 1GVRA 1MFUA 3A5VA 3LRLA 4XUGA 3T44A 4CCCA 5AB3A 1TVPA 2XVLA 4NQ1A 1H3GA 1TMQA 1E9LA 3M6DA 3WQ6A 5D05A 1CXHA 1K03A 3BLEA 1XDMA 3EDJA 4GUHA 3BAIA 1VH7A 1W3JA 3QHOA 4GXPA 3VD5A 3SIZA 1CI1A 4ORIA 2Q8LA 4GZEA 3G1HA 3W76A 4UIOA 5K9DA 5LZLA 1I45A 1SZNA 3WY1A 3ZT6A 4JX4A 1MW2A 3AZTA 3GZAA 3AFBA 5FF3A 3IJ7A 3C2RA 2WKGA 3MSDA 3VDAA 3CIVA 3KVJA 1OGBA 3B9DA 4O4WA 1JDCA 1TV7A 3BW3A 4HXCA 4PA8A 4U2YA 1TPH1 1EWDA 3KOFA 2PCQA 3DZ1A 3OBKA 2XGBA 4CNNA 1ISXA 1TTQA 3W7LA 4LS0A 4AVFA 5IXEA 3ZT5A 3AYSA 1OFBA 3TONA 4NJKA 5DT5A 3BV4A 4Y9AA 1O94A 2CLHA 4ZL1A 4M80A 2JF7A 2NSXA 3VM5A 1D9EA 1SO6A 1C8VA 3G8RA 1R47A 1Z42A 4GC4A 4DPPA 4EWND 1CXFA 2DSVA 5DT7A 2I1OA 3KX6A 1FWSA 2VELA 3F4NA 3ZWTA 4HT3A 5EKYA 4UC5A 1V0MA 2XUCA 1TFVA 2RGMA 1WDSA 1QHOA 4AZHA 1GEQA 3GDKA 2WMFA 4AB4A 5LHFA 4XUYA 3BPWA 3KFTA 4W88A 1UD5A 3HJEA 4FIQA 3NDZA 2OWCA 1ML1A 2A85A 3NPXA 3PC0A 2RFGA 2A3HA 1VAHA 3CMGA 4X0VA 4FMVA 1ISWA 3TH6A 4O0ZA 1T8XA 2QPSA 3VPLA 3M1ZA 1H5VA 3HQ1A 1JYVA 3MP5A 4R53A 2ZX9A 3KF5A 3W1RA 4DEFA 5M3WA 2WV8A 1Y7VA 3KVMA 3PZ9A 3P61A 3N15A 1US3A 2C0HA 3M7SA 3A5FA 1CXEA 1V3LA 3F03K 1JI1A 4D71A 4IXXA 3L5LA 3AHTA 1AG1O 2P0OA 3DGRA 1XCWA 3WNLA 4AH7A 1MQPA 1OYAA 4FX7A 1LYXA 5A3HA 2H3DA 1W9BM 1DWAM 2WCGA 3LI0A 1EIBA 4MAVA 4PCTA 3G18A 3MMDA 3WEOA 3DHPA 1OF6A 3PAJA 4U5KA 4MNMA 4XKYA 1QNQA 3DFNA 3SFKA 1C7TA 2UV8G 3TV8A 4KGJA 1W1ZA 3T2PA 3T4CA 2CZFA 3L0KA 2WZEA 1WAUA 1JR1A 1H11A 1HL2A 3EX1A 1KFCA 3EWWA 4LS2A 2BVTA 2X09A 1CGVA 1KM4A 2XIBA 3HMJG 4YXGA 4DM2A 3VIIA 4LRSA 3HGRA 2WHKA 2YL5A 1F76A 3UGHA 2YYUA 5BXPA 1CNVA 3L4ZA 3M47A 2ZUTA 4LC8A 2BVDA 5ABFA 2ZRYA 2QUUA 3W1XA 2W63A 4BA0A 3W2JA 1C93A 2J9XA 1N8FA 4MNLA 3I3DA 1P0NA 2CLOA 4LQ1A 2YCEA 3WD3A 3NSNA 3SUTA 1KWKA 1X8FA 1K7EA 3PS7A 1E56A 1KTCA 2JGQA 1Q6CA 3IEBA 1HP4A 1ADOA 3HU7A 3G24A 4LV4A 3CUJA 1UOKA 5EY5A 1TB3A 4UTKA 2FFCA 2PE4A 1GG1A 4JYEA 4IPIA 5CXPA 3ECQA 3UNDA 1L0PA 3O6DA 1G7UA 5C55A 4XTIA 1PEZA 2A5HA 4FO4A 1MYRA 3CLMA 1H4PA 4M56A 3A22A 5K4ZA 2Y89A 1RZMA 5BXSA 4IX2A 4P61A 2ATMA 3NO5A 4EKJA 2DZSA 2C7FA 2XM1A 2YDRA 5AHEA 5ECUA 3HJZA 1LCOA 1XSJA 3F5KA 1SW7A 5CZSA 1ZBCA 1TCMA 3BAWA 4LVGA 1JCNA 1S5WA 1H0GA 3YPIA 5EFFA 4MOZA 1S46A 2UY3A 4PTVA 5DXYA 4WK9A 3G6MA 4AZ5A 1RH9A 1OG0A 3LGEA 1B3VA 2Y61A 1XBVA 2WXDM 1OX4A 1RPXA 2C16A 4DXVA 2GFTA 3SR7A 5AC7A 4O4VA 2YDSA 3OG2A 3WMSA 4PL1A 2IXVA 2ZUSA 1E4LA 5D2WA 3CWOX 3WJYA 1WNOA 2BVYA 2ZX7A 5KTLA 3KF3A 3EDFA 1OJXA 3MJYA 1H62A 4EVZA 3AS2A 1AMKA 1HVQA 2QQUA 1MW1A 2VRJA 3W85A 1W2PA 2WNWA 3CB8A 4S2BA 1VRDA 1EB3A 3UWZA 2WMIA 3VD7A 1XUUA 2YA0A 3VIKA 1HG3A 1OYCA 2NWRA 3J7HA 5BOOA 2ZZ7A 2ZXQA 3VIHA 4XZ9A 4OZOA 4JR5A 4H8UA 5F2MA 5KSWA 2ZBTA 3RLUA 5MHBA 1TA3A 2FPTA 3WUFA 5AN7A 4DWSB 2D0HA 1E4NA 4XB3A 3L4YA 3L67A 1YXCA 3N3MA 2X1RA 2DJXA 4JTTA 3W3OA 3P7YA 1IF2A 4FF5A 1H09A 1I1WA 2EJ1A 1AL8A 1XBZA 1W2VA 5CLWA 4JGDA 4UTFA 2V38A 4D6FA 5C54A 4RJEA 4IPNB 5G5IA 2V3FA 3A4XA 1EQCA 2E77A 1HJXA 4TX8A 3UR8A 3MO4A 1NOUA 3SY5A 4ZFMA 1WOBA 4NVTA 2GJPA 1WBJA 1DEDA 1UR4A 1PVNA 2FH8A 4FK9A 4L4OA 4JX5A 1O6IA 3VMOA 1KFEA 3GKFA 4NJGA 2GDVA 1MEHA 2NUWA 1J0ZA 1WKYA 1SO4A 1TR1A 4AC1X 4M6VA 5F2IA 1B31A 5G1YA 3W29A 4DWSD 5I3DA 3PB2A 1J2WA 4PMOA 4N6FA 4UMAA 1F6PA 3NAVA 3PZVA 1R86A 3C8FA 5FMCA 3O8AA 3QSTA 1G67A 3NL3A 4J7RA 4Z2JA 1JZ3A 2FPYA 3MI3A 3S8HA 3LTSA 1QHZA 3NQVA 4UCGA 1VJIA 4JIPA 1CGUA 2J75A 2Y7EA 2C8NA 1CIUA 3W7QA 3W6MA 5FF2A 1OT1A 2WC3A 3MS8A 4JKKA 3W7MA 1TJPA 2YLAA 1W3TA 4IMDA 4D6JA 4AAJA 1YPIA 1DWHM 1EO5A 2G3JA 4IUGA 2PB1A 3QEZA 4W7VA 3W37A 1GVOA 2F2HA 4Z08A 2HSAA 3T78A 3W70A 1FCUA 1DVJA 1R2SA 3G0XA 1E4IA 1FFQA 3CZGA 4NZCA 3B4UA 2A7NA 3O06A 1GOMA 2JKEA 1SZEA 1EP1A 3UGFA 2Y6ZA 2DPEA 5A1AA 4GBUA 4ADUA 3N19B 1MEWA 4LYQA 4XZWA 4D6HA 4UNKA 5LA2A 4QAIA 1RP8A 1KGXA 1LLOA 3WELA 3U1XA 3W7KA 2V0TA 3IJ9A 4ZE4A 1MFVA 3P81A 4XQ6A 3ZR4A 1TE1A 1PS9A 1LOLA 2HTMA 3MP4A 4B15A 4GUJA 3CC1A 1CEOA 1A53A 1Q6QA 4ADTA 4UFHA 3AIBA 4M82A 5I3IA 5D37A 1JGIA 1UUOA 1BG9A 3PZMA 5A8NA 1UKPA 3R2GA 4RE4A 1OBAA 2CYGA 1M01A 2QMJA 3RJXA 5A2AA 3C56A 2FDMA 2WWDA 3T40A 1KBKA 2NWSA 1UD4A 1ZL1A 1R8LA 2XIIA 1XFBA 4OT7A 1RP9A 1JVNA 4KRTA 1GT8A 3P8IA 3W53A 3OLGA 1XBXA 3IIXA 1E0WA 2WBKA 4ZQRA 3ZJKA 5DBUA 4EK7A 4ZXLA 2QEZA 4UTWC 3W7HA 1HJUA 2CXGA 2VUYA 4TTUA 3LX9A 1JYNA 1DOSA 3NQDA 3BGAA 2E6DA 1SW3A 3NQ6A 1H7PA 2TPSA 3BAKA 5A6MA 3LPOA 4JTLA 4BWLA 2WHJA 4HIBA 4O13A 1XV8A 2WB5A 4MNKA 2J27A 1DORA 2V5LA 3LRKA 4PEKA 4EF8A 1K9EA 3MSGA 5A6KA 2GUYA 3BG3A 3O07A 4AIOA 4U4MA 2H3BA 2WMGA 2YBTA 5FIXA 2YZRA 1F05A 2B0MA 1BGGA 5C70A 2XHYA 2VFEA 1K6AA 4FLOA 3GK0A 1PX4A 5DEZA 4O1CA 3F4VA 3UESA 5KZMA 3W73A 3EXSA 3S1UA 4NU7A 3QZEA 4UTMA 1PIGA 2DT0A 3AS3A 4WUIA 1AQMA 2NXHA 3WJZA 2EKCA 4TMBA 5TBOA 3EBVA 4UCFA 1FFRA 2WSYA 1J12A 3L65A 1GTEA 2BHZA 3NG3A 1MW3A 1QNRA 1V6YA 2EEXA 3AHZA 1KFWA 3HGOA 1M03A 1BPLB 5FK7A 1XBYA 3DFPA 4FFGA 3GNOA 5EBUA 4I7UA 5FESA 3CLWA 5F1VA 1CLVA 1WV2A 1CECA 2P1FA 3JUGA 4BF7A 1NEYA 3CPUA 3T08A 3LIHA 1H7OA 1D3HA 3JR2A 5IHSA 1XXXA 2EGZA 3NEVA 1SR0A 4K68A 1G0CA 3W72A 1P1XA 1TQXA 1GOXA 2C6QA 4LW7A 2CKSA 3UWYA 1GOWA 2XFYA 3TJXA 5A2BA 4S3JA 1UG6A 4W87A 2A3AA 1UBSA 3BLFA 3M44A 3O6YX 5BMXA 2BHYA 4WY0A 3NJ3A 4NF7A 2QDHA 2GUUA 3PULA 4OUEA 4DWSC 2PWGA 3NA8A 2YDQA 3P5ZA 5HR6A 5AHFA 1GVFA 2Y8VA 3WH6A 3L0NA 1CX9A 3POCA 3M7WA 1Q6EA 3AROA 3U57A 2BY3A 3RO8A 3TFCA 1WQ5A 3PZOA 3W2KA 3E96A 3BXWA 3K1DA 4QAWA 4QJ1A 2WVSA 2Y8KA 4FXSA 2ZRXA 2ISVA 3FHQA 3NZ1A 4AIEA 4B3KA 1QWGA 2CNCA 3WK0A 1ZJBA 1HF6A 3W1AA 1GOQA 3N13A 4DF0A 1VPXA 2JE8A 1Z32X 2QV4A 3WH5A 3GNDA 2W4XA 3RM9A 1JD9A 5EA9A 4BWLC 3LHTA 1GHRA 1OM0A 1IV8A 3W24A 3RM8A 5CPLA 5A94A 4HA4A 4RE2A 5D4YA 1U33A 5FKBA 1GQIA 1OB0A 2VC9A 4NZJA 5FKYA 7TIMA 1UCWA 3AIUA 3EMQA 4KFNA 3TCEA 1NWTA 1EUNA 2OWXA 1FDZA 1GG0A 4O52A 3W22A 2FLIA 3GZ3A 3TW7A 1JCYA 2GOUA 1WZLA 2X0YA 1G01A 3F5LA 1YPFA 1PZ3A 3FY1A 4V2XA 3INPA 1TTPA 3IIVA 3GNRA 4H04A 4FXRA 3OA5A 5HUOA 4JDBA 1W56A 3FAXA 4HMCA 2VZSA 3NDYA 2QCNA 1EQPA 1PIIA 4PODA 3LCFA 2NXIA 3CZEA 3MUXA 4FFHA 3VX1A 5FMBA 2YA2A 3TTYA 2GQ8A 5BROA 5A6AA 4XWUA 3CUFA 4W86A 1HL8A 3PBUA 1JUKA 1YXYA 4NNBA 4CCEA 2GVYA 2E9LA 3DFQA 1AMYA 2PBOA 1W3KA 4EAMA 4O12A 8TIMA 2VXNA 2E6FA 3C2FA 4BI5A 1KFJA 1LLZA 2A1YA 2GJNA 2ZCGA 3SIMA 1Y0EA 2F84A 1EOKA 1LDCA 1JZ8A 4PFMA 4JYFA 3GXTA 3FIGA 3W07A 1C3FA 1WAWA 5AC6A 3FYOA 5BMWA 2H8XA 1YYAA 1OFDA 3PB0A 5CZJA 3B9EA 3W6LA 1KCKA 2XTKA 4UQEA 1Z41A 4UOJA 5HWNA 1EGZA 2G96A 3RM4A 3ABOA 1C7SA 1R87A 3T0BA 1LG1A 3W0KA 3DFSA 2GK1B 3WEMA 3ZQ9A 4K38A 2FHFA 3TNOA 3W7OA 1E3XA 3RK8A 2OT1A 2Z2UA 3DBPA 3UCQA 2CIPA 1NFBA 1WPCA 1EWEA 1SYTA 5ABGA 3HO8A 1GONA 1IXPA 4RL3A 1M7PA 4MIMA 6CGTA 3QQ0A 3SGUA 4BF9A 2X1SA 4JD4A 1LG2A 3C2EA 3BGJA 4MY1A 1HO1A 1JUEA 5U7SA 2EPOA 3ARUA 1BVNP 4MB1A 2G3MA 3TSMA 4KGLA 1M04A 2WVUA 3AS0A 1E6NA 3VILA 1JXKA 4TO8A 5C2XA 2BXVA 1LROA 2Q8ZA 5A8MA 1JZ5A 3NNTA 1TPEA 4JEQA 4BK9A 1J0YA 3EDEA 4OBRA 3BLIA 2EPHA 2VR5A 3FAWA 4N0RA 4XX6A 2VOTA 1VEMA 2JKPA 1GQJA 3TK7A 3PG8A 3C2VA 1W5QA 3DKLA 3NM1A 1BF2A 2GPTA 3NL6A 1CDGA 1E6RA 4DO5A 3BAJA 3ARPA 4HMDA 3S5QA 1L2UA 1B9ZA 1BQCA 4C1KA 4JFTA 5AYXA 4Z1CA 1J5TA 1IIHA 3OLEA 3DI1A 1LTDA 3LTYA 1Q6FA 1XC4A 2DJLA 2JK2A 4JIEA 3W1LA 3CZKA 3W75A 1EHNA 3NQAA 3SW6A 3ARWA 3WMCA 2D23A 5DF0A 1IXOA 4TX6A 3AXHA 4N9DA 2OZ0A 5GNXA 2WVVA 5HBFA 2YPIA 4QIUA 3ZT7A 3VO0A 2QUTA 1WZKA 1G9HA 3WNMA 4NI3A 2XFWA 1SR9A 3TMQA 1NAL1 4J9JA 2V3DA 3UGGA 2C3ZA 3MUY1 3A47A 5I3GA 6TAAA 5LKYA 1K7XA 4KKXA 4H3DA 1XCXA 1J9YA 2UWFA 4JICA 2G41A 1VHCA 1UH3A 1JQVA 2X1IA 3KZSA 4L4MA 4IPLA 8CGTA 5KEZA 4HPXA 4GUFA 3NZRA 4CQAA 1YTDA 3M16A 2VEKA 3F1QA 4U28A 4FB7A 3CMJA 1VQTA 3VUPA 3CIWA 5A95A 3QPZA 4HTYA 1CYGA 2WZIA 3MHUA 2ZZ3A 5LHEA 3BMWA 5D33A 4Z2HA 4AY1A 1E6XM 4J3XA 3WDHA 5LGZA 2E09A 3OGVA 4D1IA 5JBDA 2WO5A 4JHZA 2OX1A 2ZX6A 1HKKA 1OVDA 2DSZA 2V5BA 3AS1A 3UWWA 3ZJ6A 2EPLX 2Z0IA 3MANA 3H54A 1E6SM 3UXDA 2CBJA 4O1AA 2OCZA 3EKZA 1CENA 4OV4A 1JF6A 1W5NA 3B05A 1QI0A 3MI6A 2YYTA 1VYSX 3VMPA 1IXNA 3LM7A 2J7FA 3WN6A 1CXKA 4NNCA 3OLDA 1ZENA 3WF3A 3TU9A 4AZ7A 4UFJA 2OSXA 5BCAA 2ZRUA 2ZTKA 3EX6A 4MY8A 5D9MA 1KW1A 2V5DA 3MI2A 2BWGA 1YDVA 2J47A 3PUDA 5D30A 2W61A 2Y2WA 4H2CA 3RJYA 4NXKA 1RQBA 1BAGA 1FXQA 1JFXA 2G3IA 1AW2A 1KGWA 4AW7A 1W54A 2VMFA 4HZ6A 3VGDA 3WF1A 2EXOA 1FP9A 4GJ1A 4YHEA 5M5DA 1AQ0A 4RZ5A 3L2MA 1J4EA 1QOPA 3M6YA 2EPMX 4PSRA 3IMMA 5TQLA 3WQ5A 1JZ4A 3PBVA 4O28A 1K9FA 4IISA 4JL2A 3IANA 1G4TA 1B3ZA 3EWYA 4Z2GA 2Z1KA 2ESCA 1DJNA 1BYCA 1FQ0A 4LYRA 5E6ZA 2VQUA 2BSLA 4M5PA 2DT1A 1OABA 2VCBA 5A6SA 5CG7A 4H7VA 3LBMA 1W31A 5I3KA 1B30A 2ISWA 4QSHA 3WJSA 3ZR5A 3OBAA 1WXJA 2WWCA 4OBTA 4B9ZA 1VZWA 4Q32A 5FK8A 4TR9A 4MLJA 3PIJA 1FCBA 1WCGA 4FHAA 1QNPA 1EPXA 4FNPA 3TP4A 1HTIA 1U83A 3G1VA 4Z1BA 3QPYA 1FBAA 5HNRA 4Q7NA 4IGHA 1W3HA 2C19A 3UETA 5BYWA 2DDXA 5EL1A 3AIRA 4ZQCA 5G4EA 1VFFA 2D22A 3DYPA 1QDSA 3E1F1 4CN6A 3E12A 3RF9A 5DCEA 3VIJA 4GUIA 4F9DA 5E0FA 2IXUA 5CPTA 5DELA 5D32A 2ABBA 4OIFA 2XVNA 1OFOA 4JTGA 2E40A 2YX0A 2XYLA 3V75A 1CWYA 4OOZA 4AZCA 2VEPA 1D3CA 1N82A 3VKJA 1WDWA 3PZUA 5FL1A 3U2OA 1UD2A 3VIGA 5AYBA 2WBGA 1OK6A 1H7RA 1EX5A 4XKYB 1F4HA 2XWDA 4NX5A 3LOTA 1GVYA 1J10A 1J0JA 2QKFA 1WZAA 4S3KA 2TYSA 1ZS2A 4GI6A 3MU7A 2FH6A 2FGZA 3U14A 3TXVA 5GNZA 1QPQA 4PMVA 3L4WA 1GPFA 4ATLA 1ZAIA 3C2OA 1XDLA 4ONVA 5A8OA 5HWJA 3P74A 1SSDA 1W5MA 4FNRA 4N9BA 4ATDA 4F66A 3B06A 2DZXA 1QO5A 2ZA1A 3IGSA 5ABFB 1M53A 4GQQA 3QRHA 1JG9A 1PZ2A 1KV5A 3W71A 4ADSA 3B0UX 4CN1A 3ZM8A 4GFSA 3GDLA 4CNOA 6A3HA 5A8PA 3VGFA 1YHTA 3Q58A 5KZEA 3EEGA 1FWRA 3HN3A 3IGXA 1V3HA 3WQVA 4CD4A 3AMCA 3P67A 1TPDA 3QHNA 2CBVA 2R91A 3SUVA 2FB3A 2VL4A 3KAOA 4E2BA 4M29A 4QNEA 5FKCA 2ZUNA 4LVAA 2P10A 1X6UA 2GVGA 4AMCA 4K8EA 1UR0A 4M6PA 2V81A 4HZ7A 4AZGA 4N4PA 3B0VC 4UTIA 4FLSA 2VOMA 4HSOA 1V03A 1SO3A 3LMYA 4GO8A 3HGSA 1KCLA 5EPDA 4X9SA 1SZGA 3WH9A 5I3FA 5LGXA 4PMQA 4CNPA 4JTIA 3LFIA 5A5WA 3Q2DA 1B90A 1KA9F 3UG3A 1BLIA 3TFXA 1QFEA 4Y96A 5CKSA 2LLEA 4C7FA 3W7RA 2W67A 1W37A 1H7NA 3A4WA 1VEPA 2VZTA 3LHUA 3B04A 3AYRA 4J28A 2G97A 5E09A 1OX4B 2VFIA 2QCMA 4JX6A 4EOUA 3BCDA 2AQWA 5A2CA 5LNRA 4D72A 4Z0JA 3KHJA 1G6CA 5GPRA 5HQEA 1VS1A 3FEMA 5E70A 1H49A 3SCRA 1RPKA 2A7RA 1UD6A 1DV7A 1GJPA 3UD6A 3SUUA 5D9NA 3IK2A 4C7GA 2CEQA 2OSWA 4FEZA 1TZ7A 1E6ZA 2WLZA 1KM3A 3L2LA 2WMIB 1K02A 1VYRA 3I3EA 2YDAA 1FUYA 3SCOA 4RX0A 4ZXOA 1E72M 3PUEA 1NWSA 4JQTA 4CN4A 1OX5A 3ARZA 1TA3B 3CZJA 2XSAA 2CKRA 3MUAA 1VCVA 3O6CA 2F7FA 3NR0A 1KM2A 4E8DA 2NX3A 3P5YA 2DSKA 3CQ0A 3O1NA 3A4AA 3GAYA 3ALFA 4A3HA 3NM3A 3K46A 1BWLA 3STGA 3VTRA 3DAQA 4XTDA 3QW3A 3RMEA 3A24A 2X1UA 4UFMA 2ZZ2A 3TROA 4F8XA 1OHLA 1K8ZA 4W5ZA 3MBDA 2CFFA 1ECEA 2JIEA 2IUZA 1F6KA 5DLCA 3WK1A 4MJ4A 5A6JA 1YTEA 3PZTA 1SU5A 5G2HA 1OFPA 5F2GA 4S1FA 3ARXA 3TC7A 4UR8A 4AXKA 4ML9A 2ZUUA 1ZU8A 4A2SA 4LV9A 4O1BA 1TQJA 3UWUA 3OVRA 5K9XA 3TAKA 1V6VA 4GI8A 2ZZ4A 3NQGA 1EXPA 3TAOA 2ZOXA 3S42A 4HNNA 2YLLA 2Z6IA 4GNJA 3EMZA 2QCLA 3OGRA 3L9CA 2CERA 5EMYA 3I6RA 2DZUA 3G8EA 4AD3A 3PSWA 3EWUA 2J7BA 3T0AA 3TTQA 4CQ9A 4JXCA 3GXIA 5CJ5A 3G1XA 2CU0A 1SFJA 4HOZA 5I0DA 2VRQA 1XD0A 1E70M 3IJ8A 1OD0A 2QQWA 3PG9A 4JTKA 4JTSA 5LYRA 1B3XA 1BTCA 1YTKA 3QGVA 2DH3A 5D02A 1JYWA 5E9AA 4JHOA 1W1PA 1BKSA 1JYXA 5T26A 4X2RA 3TQVA 5GVJA 2OWWA 2G3NA 2AAMA 1CGYA 3LCXA 3AISA 1H1ZA 4TIMA 1HVXA 4O11A 5FF7A 1LOSA 1UYQA 3K4AA 5D04C 1UH4A 4JFSA 4HHPA 4QM1A 3NQCA 3RIKA 1TJRA 4QISA 1Q6DA 1IIGA 3WFLA 2ZRZA 3PWAA 1IGSA 3RCNA 2I9EA 1ZCOA 4A29A 1OT2A 3W86A 4AXNA 3M41A 2DIEA 3LPGA 2ATSA 1OIFA 3SC7X 1TV5A 3ARTA 4PBGA 2XPKA 2XVPA 2PC4A 2DGAA 3PF3A 1CPUA 1GW1A 5IBXA 3S6TA 1A5CA 1ZHAA 1ODZA 3BSGA 2UY2A 3P80A 3N04A 4JTHA 1J0IA 1UYPA 2ZYFA 3LDVA 2VRKA 3LF7A 3NYZA 3ZS4A 5FEZA 3KL0A 4UQ9A 5FD0A 1I1XA 5CLTA 3W2NA 1QOXA 4URIA 4TX9A 1KM6A 4J3WA 5D9PA 4Z2IA 4H4IA 2NW0A 1JAKA 1B3OA 2Y4SA 5CPNA 3SUWA 3WENA 4C7DA 3LHYA 4I7VA 4FNSA 1VCGA 2GSJA 2NT0A 4N02A 1I8JA 2A4AA 1N7KA 3W2MA 2O7QA 1QMLA 2WCAA 3N2MA 3KEHA 3RPMA 4NZFA 1HL9A 3U7VA 4PYSA 1GZJA 3FNDA 4UQBA 3WNOA 1FCVA 5K2ZA 5D2TA 1UWQA 5EB8A 2B7OA 4AZBA 5CGQA 3WH7A 4ZQMA 1KFLA 4UQDA 3H3LA 1I2RA 1ZY9A 3GB6A 3UG5A 1T96A 3NQ8A 2YOCA 4UNIA 2QJIA 2FQIA 3JRKA 5A8GA 1UZ1A 3NL2A 1FCQA 1W9XA 2CCRA 2VX7A 1KV8A 1A3HA 3PUOA 5I3JA 4P7OA 4EE9A 1CLXA 2WMJA 4POCA 4O19A 2WQPA 3P62A 1K3UA 4M7SA 4MZYA 3TTOA 3I68A 2CHNA 1QI4A 3CTLA 2WOQA 3GAKA 1XD1A 4PN2A 2D24A 3S1XA 1LBMA 3PTMA 1XCFA 1TREA 4U2ZA 3L4XA 4ACYA 5CZTA 3WSUA 1LOQA 1GQLA 4AHQA 3HGJA 1G4SA 4JTJA 3PTQA 1XI3A 5I2UA 3U6WA 4NSBA 1I2NA 2GJRA 4FX8A 1E1EA 2C1HA 2JKAA 1DP0A 1UA7A 2V5CA 4PUEA 5AC8A 1R7AA 4GI9A 3N12A 2ZXBA 3DKJA 1UWUA 3U7BA 1AW5A 5E1QA 3TSBA 1GORA 3SJ3A 1LLWA 1PAMA 5BRBA 1M7XA 3WK2A 1V02A 2VFHA 4WY0F 2XGIA 2QDGA 3MWAA 4WY0B 5ABHA 3UPWA 2E5BA 3IVUA 3KWXA 2J8GA 3O9NA 5IBXC 3T09A 4JS3A 4QNWA 1A50A 3W26A 3E02A 1X6NA 1NWRA 3D0CA 4AWSA 3O16A 4V27A 3VX0A 4FFIA 3HIJA 3HPZA 3A21A 3I7SA 2BXYA 3UG4A 3C3NA 5HJLA 3LCGA 3GLCA 2QPUA 3L66A 4X3ZA 4GINA 1W0MA 2XFFA 3B0PA 1ZJAA 4PSPA 3GBEA 4MYAA 1EOMA 2VX6A 2HS6A 1H2JA 1E0VA 1UD3A 3H55A 1US2A 1LRQA 4MZ8A 3M5YA 5IFTA 1OGSA 4BQ2A 4W84A 3S6DA 4DF1A 1QBAA 4PMZA 1A47A 2VX4A 2QHAA 1R2RA 1W91A 3QMTA 2G95A 3E9AA 4Y8FA 2WW5A 3AJ7A 2OYMA 4LT9A 4Y7EA 3WL0A 1DWGM 4HA1A 1PE1A 1E71M 2Y5EA 4RE3A 2VC6A 4PUDA 4JFVA 3ZFHA 1OFRA 1SQ7A 2WHLA 2ZXAA 4JYDA 5D2VA 3P84A 3THDA 3UR7A 4HU8A 2AC1A 4DELA 3HG3A 3SGZA 1FH7A 2YIHA 4JL1A 5F7UA 3P82A 1C8QA 3CGTA 3CUGA 3N34A 1SUXA 4TU1A 1LWHA 3I7RA 1TUXA 5AC4A 1H7WA 4MADA 4GUGA 5TD4A 4YLWA 1HJQA 4UZUA 5G2WA 1P5BA 7A3HA 3L5AA 3DI0A 3LHVA 3CEUA 4AD1A 1ZAHA 1TRDA 3FHAA 2J25A 1JAEA 2YL6A 4J3SA 3I65A 1D7FA 4K7VA 2QLYA 5K7JA 4WIWA 2Z1BA 2ZQ0A 4O53A 4UTLA 4YMZA 3DFOA 1GNXA 1W1VA 3IIOA 1TPC1 1H5YA 4FIRA 4RZ6A 5ANNA 5FF4A 3VM7A 3TUUA 1A5SA 3CT7A 2O9RA 4BZYA 3WJXA 4PMDA 3C0JA 3AMKA 1H60A 4MFEA 3SCTA 2ISSA 2Y63A 2NZLA 1UHVA 1ITCA 3CZ8A 2VKZG 3PBWA 1U30A 1PPIA 5DY3A 5LNWA 1EA0A 1QI2A 4RKAA 4HN4A 4ORMA 3UY7A 1CXIA 3ARRA 2QAPA 1Q4NX 1G69A 1EP3A 3LB0A 3NQMA 3OIHA 4UTTA 1MVYA 3L5MA 3W23A 5BXTA 4QHZA 3EB2A 3S5NA 1V02E 2VI0A 5BWFA 4TOQA 4AYSA 3LCHA 4UOZA 4BQ5A 3FKRA 1YQ2A 3W82A 4KMQA 2Z6JA 3E49A 2CHOA 4GO9A 5D03A 3USBA 4MPQA 4AWUA 1E1FA 5GQBA 4CCDA 1R2TA 2CESA 1JCLA 2ZZ6A 3EWBX 2O7SA 3QQ1A 4H6KA 1O60A 1C90A 1O7AA 1VJZA 1X7FA 2E3ZA 3VINA 5FMDA 1U5JA 4MJZA 3LV6A 2J74A 1UR9A 1ZBKA 2PURA 4FNTA 1W9DM 3S2CA 4RXFA 3TKFA 2NV2A 2O92A 1H1YA 5CSSA 3GDMA 4MB3A 1XHGA 2WK2A 4K8HA 4NRSA 3QMRA 1O95A 1WA3A 2V30A 1I75A 3G22A 1R30A 3NL5A 4UFIA 5AHLA 1ZFJA 4M81A 4M7TA 1BGAA 3R89A 3PR2A 4GPNA 4ZQPA 1AW1A 2VURA 4AMAA 1T0OA 3IIPA 2CZ5A 4AD0A 3POHA 1QNVA 4UOQA 4ZENA 1SSGA 3U75A 1UJPA 3WEZA 4WF7A 1NOFA 3CUIA 4ZEPA 3MYPA 1F7BA 3C4UA 3GNPA 1JD7A 1UKQA 2VJXA 2FGLA 3KE0A 1RQEA 1V0KA 5LNVA 3NOEA 4LVFA 1TVNA 2V2HA 1BYBA 1WE5A 4HMEA 3W6YA 3M43A 3PTKA 1DWFM 2WVVB 5FEXA 3GH7A 4BI7A 4U31A 4FNUA 3KRUA 4WJXA 4M8UA 4AD4A 3CHCA 1VB9A 3SUSA 2R8WA 4I7WA 4PMUA 1W9VA 3R8RA 2BHUA 3K4DA 1I2PA 2BNJA 3TA6A 4PMYA 1LF1A 2UY4A 3SCQA 2WPBA 1VFOA 4IMCA 4BQ3A 2VTFA 4E2DA 2WYSA 3PBYA 3QF0A 3TJLA 4AF0A 3UYCA 4UTUA 1C9DA 2XN1A 1UQZA 3VGEA 2Y85A 4JNMA 2I14A 5AYYA 5EYWA 3EMCA 1TRIA 4YWIA 1WB0A 2WSPA 3BH4A 4OBSA 1VRXA 3OZOA 4P8UA 1E0XA 1XUZA 2R14A 1BEUA 1UR8A 4KWVA 3EX2A 1VBUA 3WD0A 4J27A 2ABAA 4D6GA 2YFOA 3M5VA 2XN2A 2QCDB 2ZX5A 1W1TA 1HP5A 3GDTA 5A6BA 3A6OA 2Q3RA 2BFGA 1XL9A 5K4XA 4MB5A 4PMRA 3W38A 1IXQA 3QC3A 4HNUA 1QCWA 3EX3A 5AYZA 1C8XA 3N17A 4LUIA 3MO7A 3O63A 4JFWA 4UTJA 2R94A 3STEA 4JFUA 3FOKA 1R46A 2V8ZA 1B3YA 3W7PA 2VFFA 1GWJA 1FHDA 2JEQA 5ABEA 4MB4A 1H7XA 1TSIA 5EBAA 4YCOA 4UFKA 3O05A 3NXFA 3QR3A 2AGKA 3CEPA 4XV0A 3RU6A 4N6EA 2YL8A 3QOMA 1JIBA 1GQNA 6TIMA 3QYQA 1TTIA 3CWNA 3BGGA 4AIUA 4LOCA 1WDQA 2CPUA 3DU0A 4B3LA 1M6JA 4AEEA 3GX9A 2BTMA 2XN0A 4ZE5A 3HB9A 1EDGA 1BFNA 2CLMA 3AICA 1LRTA 6ALDA 3WKZA 1TPVA 5A6LA 3KL5A 3FLUA 1KXTA 2X05A 4E2OA 1PCKA 1SO5A 4C1LA 4OWGA 1HJWA 2VZUA 1Y9GA 4PCSA 4MZ1A 1DWJM 1VBRA 3NUKA 4D6CA 4IJBA 1JCMP 1JNEA 3AIQA 3AJXA 4MLRA 4JCMA 1BHGA 3HPSA 2G5WA 4OQVA 1ISYA 4MKNA 4A3YA 3BCFA 2DIJA 2V2DA 1FWWA 2XG9A 4KRUA 3G1DA 3UZ5A 1XYFA 3DENA 4WKHA 4OJYA 4AZ6A 3RMJA 5J5RA 2YA1A 2Y7DA 5HWMA 3SCNA 3QHMA 2ZTJA 7CGTA 3CM4A 1FP8A 1GJWA 4P7RA 4M24A 1KR0A 4OHQA 2IQTA 3ZMRA 3ABSA 3EWXA 4MDOA 3PIGA 1NP0A 2C13A 4AZCB 4CU6A 1XM3A 4EIVA 1H41A 2QCGA 3HMCA 2XVKA 3RWKX 4Q22A 3ZJ7A 1FXPA 2HMCA 3HG4A 5JUVA 2YBUA 3WL1A 1L8NA 2J7EA 4U5IA 1TV8A 3GXFA 4MAZA 1C29A 3N73A 4CKQA 4Q4KA 5DFAA 3ZR6A 4W89A 3GXDA 2GJXA 3S5ZA 4BR1A 1K9TA 3WJWA 4LX4A 1ISVA 1VENA 2BX7A 3PM6A 2DT3A 3QOKA 3A23A 4PC8A 1TMHA 4W8AA 1KTBA 1ME8A 3B03A 1Y9MA 1PL9A 2TAAA 4W7WA 2OXBA 4NJIA 4AEOA 2O9TA 4UZSA 1BG4A 3F4WA 5AY7A 4D1JA 4E4PA 4CVWA 1OFQA 4TVCA 3T0DA 1FWNA 4A21A 3WBEA 4CUCA 3OIXA 5JIPA 2WKJA 4RLIA 3VGHA 1K8YA 2Y88A 2D3NA 1TPB1 4ACZA 3GVGA 1W9UA 2D3LA 4FNQA 1MQQA 1G94A 3EXTA 5EMUA 5HPOA 1LL6A 2VZOA 1EA9C 1XGZA 2QCCA 2ZXDA 3IVTA 4D6IA 3WNNA 1KWGA 2O9PA 1HNYA 1KXQA 4KWUA 3WD1A 5IFPA 1L6YA 3CTTA 4P8VA 4MNJA 3AOFA 4QCFA 3LPPA 5LA0A 1E40A 1HKIA 2AMGA 3IRDA 5CSYA 1H61A 1QPOA 2A3EA 2DSUA 3SCUA 3BG5A 3CZLA 5LSMA 5K3VA 1XSKA 4IMEA 3TTSA 3M5XA 1LJYA 3G1YA 4Z1AA 2HS8A 3WFZA 2Q3OA 3DYMA 3FS2A 4OOUA 3MKKA 3WIJA 2DP3A 5C5YA 2RH9A 2EPKX 1O4UA 5A8QA 2XWEA 4JZ5A 1H50A 5LNUA 1TO3A 2RGLA 4P8XA 3SCPA 5D9OA 2YJQA 2PRMA 3CO4A 2WPGA 4J3UA 3VIOA 1NF7A 1AQHA 2A3BA 3LDKA 4CGTA 4AHPA 4UMBA 2RDWA 4IMFA 1M7OA 1ZBWA 3BK0A 2RDTA 3W1PA 3DHUA 2ZUVA 3KL3A 3UY8A 2J8FA 1VJSA 1TPWA 5CPOA 1KFKA 3GXPA 3T7VA 1UA3A 4GQRA 2NUYA 1V3JA 2CBUA 4DO4A 5I3HA 1E51A 1F74A 1KBIA 1QO2A 3N9KA 1T99A 1KTNA 1KXVA 5C71A 3OVPA 4NRRA 5AC5A 1ALDA 4BI6A 5L6UA 3W1UA 3SECA 3N9RA 3GDBA 1VF8A 5FIPA 5LA1A 2YXGA 3W7GA 2A3CA 3W7CA 4JY9A 4DBEA 3PBGA 2J7DA 3NIYA 4QLLA 1QPNA 1MEIA 1S5TA 3HPXA 1UR1A 4HZ8A 1ONRA 3NPUA 4DUWA 1V5XA 1LORA 1W3NA 1UKSA 5DMYA 3W84A 3THQA 1GTHA 1ZALA 5AHIA 2WCSA 3W7DA 5EFDA 2J7CA 1RR2A 9CGTA 4H8HA 1VGAA 5M17A 3GKAA 1KM5A 1P4CA 1H0IA 2PI6A 3QH2A 3T2OA 3WF4A 4FLQA 2J7HA 2PF0A 2E0PA 3ATZA 4O1DA 1RQHA 4IUOA 2Y62A 1JQXA 3VU2A 4M19A 1J0KA 4P7NA 2EHHA 4XZBA 3NPWA 3BAXA 4P8WA 3RLVA 4QFUA 5KITA 3NCOA 4O57A 2ZE0A 1FHLA 4HOXA 1R85A 1V3IA 4MTVA 3UXAA 1M5WA 1WOAA 3ALGA 2C15A 3LCWA 3CHVA 1CXLA 1GHSA 2VCCA 3WDIA 2G8ZA 3WUEA 4LRTA 2YW3A 3BARA 1S5VA 3EDDA 3SCWA 3BW2A 3M9YA 4ZZ9A 1CZ1A 2D0GA 1I2OA 4AHOA 5JBEA 5M03A 2FPVA 5CGTA 2E6YA 3AIVA 4JKLA 3VIPA 3G1AA 2PC8A 3FYPA 1Z48A 1L9WA 3WF2A 1QOQA 1HN1A 4HNVA 1GPWA 1WX0A 3AMDA 3CHFA 3SCSA 4B9YA 4AZIA 3B8SA 4OV9A 2PWFA 2X2GA 2E1DA 3KVLA 5F4XA 3VIFA 3NMBA 2FB2A 2J77A 1LP6A 3MHGA 2WHMA 1EHAA 3WNPA 1B4KA 3PZNA 3AQUA 1FDJA 3WK3A 3W74A 1A5BA 3HOJA 2NV1A 3R12A 4IMGA 3STFA 1EIXA 1DHKA 2QCFA 5DCDA 1TYGA 2AAAA 1MW0A 2VX5A 3KRSA 1AVAA 2H6RA 3WDQA 1THFD 3II1A 3ELFA 2PRLA 1J01A 1ZNNA 4GZIA 1XH2A 1PHQA 4GRSA 2D0FA 2TRSA 4MY9A 4RR4A 2BY1A 2WNQA 1UWIA 4HA3A 4CVUA 3LPFA 3FFSA 4DF2A 2RDUA 1C8YA 1VFMA 5ABTA 3T55A 1YXDA 4Y90A 1YDNA 1J11A 4JN6A 2ZA3A 3VNZA 3VOCA 1UWSA 1JF5A 4JAWA 4OE7A 3OG3A 1UZ4A 3G6LA 3VCRA 1GYLA 3KRZA 5C8BB 4JTEA 1FY6A 4MYXA 1UH2A 3DECA 2Y7FA 4PTXA 1NF0A 3TMLA 2E68A 3GXMA 4WD0A 1EO7A 1NQ6A 2W5FA 1TPFA 4WX2A 3TX9A 2X0HA 2CWNA 3AXXA 3EXRA 1R7OA 1ZB5A 3CU2A 2YL9A 1LL7A 3LEMA 5E93A 1W1YA 1TPUA 2CLEA 4O8RA 3AIEA 1DQXA 1ICPA 4M1RA 3WD2A 4IM4A 2WC7A 4XBKA 1VIWA 3VGGA 2B7NA 1V08A 2E6AA 3L4VA 1H63A 3AMGA 2WANA 5DBTA 2B7QA 2VENA 3AXIA 1SW0A 3MP3A 1GUVA 3TDFA 1QPKA 3FW6A 4U33A 1PX3A 4A2RA 1QI3A 1JCJA 4BQ4A 3B8DA 1B4EA 3N14A 5KZDA 2ALDA 1OFAA 1ZBVA 3W7JA 4X9YA 2CW6A 4DBDA 4HPHA 2DQXA 3W81A 5I24A 3LIGA 1HO4A 3NPVA 4YN5A 2X2YA 2QAFA 3NGJA 3TR2A 5CSUA 4O54A 3UERA 1UR2A 3G0SA 4WSJA 4M6QA 2JF6A 3FKKA 2WLYA 3AZSA 2J24A 3LI1A 4MJMA 4WXYA 4F79A 1J0HA 4MJ2A 3W9ZA 3MBFA 3LCLA 4PH6A 3PN8A 3OA3A 1JI2A 1JRCA 1Q6RA 3S9YA 2CLLA 5D8ZA 3GH5A 2A6LA 2NUXA 1EH9A 4P7QA 3APGA 3L4UA 2B7PA 1TG7A 4O10A 5FI8A 1PCWA 2QF8A 5BRQA 3HG2A 2WMKA 1KLYA 4RV8A 2QUVA 2H8ZA 1VR6A 4LY8A 2WMHA 1S3HA 4N9EA 3MUZ1 4YCPA 5G4WA 3CHDA 1WP6A 1JXJA 4CD6A 2A6NA 1W8SA 4MUZA 4B5NA 2J79A 3M5ZA 5FCZA 4W8LA 1QNOA 2PWHA 3GR7A 2NX9A 3U5UA 1EP2A 1L6WA 3GR8A 2FJKA 5CZ0A 2RKXA 3L21A 2BV9A 2XJ7A 3QFEA 5JIWA 2X1TA 3V1PA 3VE9A 4HPGA 2EO7A 4R33A 4BS0A 3ZOAA 1DL3A 1PBGA 3OEXA 3ZJ8A 4QLJA 1MSSA 3DHDA 4UXDA 3CIXA 1C92A 4B1MA 1ICQA 1CGXA 1KXHA 3ARVA 3O2LA 1V3MA 1Q3NA 5BRPA 3GH4A 3AI0A 3N11A 1KQZA 2VFGA 4GIAA 4AISA 2DZVA 3S1WA 3L0GA 4A4AA 4AWTA 2W91A 4GXMA 4ML4A 1XKYA 5CSRA 1F5ZA 4LUJA 5D2YA 4E0CA 2JALA 3E0IA 4WKFA 5HNNA 5K9CA 4JIQA 4DQWA 1UASA 1X6LA 4JDYA 4AD5A 3R13A 3S5OA 1DQWA 4LVDA 3TC6A 5CZKA 2BY0A 1KLZA 3PZGA 2H90A 4LTSA 8A3HA 1XH0A 2VNCA 3EDKA 4DPQA 2C14A 2RHGA 1FX6A 4NXSA 2E5DA 2J9ZA 5FF0A 3UPBA 4X22A 4PMXA 1B2YA 5AOUA 4FFFA 3H53A 3OZPA 3W83A 1KFBA 4PL2A 4NX0A 4RZ4A 1H1NA 3L2IA 1OYBA 4UTWA 3DXIA 1QBBA 2VFDA 3K8MA 1LL4A 4YPJA 4Q33A 4HKPA 5L9FA 1GVQA 3AO0A 3Q94A 2X16A 1G7VA 4LYPA 3I7QA 1JZ7A 1ME9A 1AL7A 4QQ3A 3M0ZA 2J4GA 3B9AA 2C18A 4PRWA 1LZOA 1F73A 2VT0A 4X0NA 1B1YA 1MZHA 2CLFA 1QPRA 3ZSTA 1H51A 3O15A 2WKLA 2B31A 4AWEA 3LLDA 3LRMA 4MFDA 3LXBA 2ZUWA 4WKAA 1XSIA 2TSYA 3PZQA 5I5RA 4ZVJA 1TTJA 2QCEA 3FXYA 1CBGA 1MXSA 1NP2A 4BCEA 2DZWA 1YLVA 1O5KA 4UR7A 1QAPA 3W88A 3S0CA 2YKKA 5JBFA 4AD2A 1WO2A 1KM1A 2OSYA 5FL0A 1NH6A 1EDTA 3VMNA 4LVBA 1B57A 1PX8A 4TTGA 1BYDA 1E73M 2ZFAA 3VDCA 3S5YA 1KQYA 5AHMA 1VFUA 2J62A 3TQKA 3GBDA 4WSKA 1EEPA 3KVKA 5TIMA 3WBAA 4N2YA 4CD7A 4QP0A 2FDSA 3N9SA 4CD5A 5FEPA 4HOWA 5DN1A 2XVGA 4N9CA 3GIYA 4A3UA 1E6PA 3A3HA 3K8LA 4FLRA 4LWWA 4K6AA 3BVJA 3BO9A 2E4TA 1I4NA 2NX1A 5CPSA 3SURA 5I78A 5G2IA 1W2TA 3VE7A 3CH9A 3FN9A 2JBMA 3G1FA 3AIWA 3AMLA 1OINA 3OSDA 3WQ8A 1RV8A 4HU0A 2YSWA 4B16A 3C61A 4NJHA 3MW7A 3EYPA 5I6SA 1JRBA 1JCXA 2D2OA 2JFEX 3W4RA 1ZAJA 2J88A 4ALDA 5HUPA 1W3LA 3A9IA 2OYKA 4DWSA 4GWEA 3L4TA 4Z0SA 3SI9A 3WDRA 3UWQA 2VEMA 3DH7A 3D5HA 3OB8A 2OT0A 4CQ8A 3SSJA 4R34A 1BVZA 2J7GA 2EAWA 4Z2KA 3RILA 1V6UA 3AHVA 1W32A 3G3MA 1HFBA 4ICNA 1DBTA 4J3TA 4A22A 1D2KA 1Y4WA 4LS1A 5AFDA 3G0UA 4UFLA 4UMCA 3ARSA 1PHWA 3ABRA 3PVFA 1FWTA 4LC6A 3NYDA 3NQFA 1HT6A 2YR1A 3OHIA 5G1TA 1OK4A 2V9DA 1CGTA 2YW4A 1OF8A 2OMAA 1KBBA 5BNKA 2WNZA 3IV3A 3TOPA 4TVDA 1C91A 1W9PA 3K30A 1O5XA 3BW4A 2XSBA 5F4WA 4XBSA 1G4EA 1W3IA 1GQKA 4H8VA 3STCA 3S1VA 1NM9A 4DM1A 1G1YA 4LNYA 4AEFA 2WNNA 2BS9A 4OKDA 1BWKA 2BY2A 4QDMA 4PCFA 3WQWA 2A21A 3IGUA 1CTNA 1E4MM 2DT2A 1Z44A 2OYLA 2E5CA 4IQLA 1RD5A 4AZZA 1LBFA 4K7YA 2ZWZA 2NT1A 2O9OA 3UEQA 1UD8A 1HIZA 4AF0B 1P6WA 1FDYA 1PIFA 2G4FA 4DO6A 5C6MA 5LNSA 3M07A 1A5AA 4WQ6A 2A7PA 2BXZA 1G4PA 3MMWA 2AOSA 4N42A 1K8XA 2BLEA 2KZHA 1DJQA 5H91A 1VCFA 5AHNA 1L6SA 2PWEA 3ARYA 3W1TA 3MV11 4GE8A 4W93A 3MMTA 1XC6A 2QQVA 2DZTA 1OSEA 1Q6OA 4Z1DA 2VVSA 3WFAA 2ZUMA 1E55A 4JTFA 1K9DA 4D6DA 5CG0A 1NVMA 4MVAA 3WMBA 1QR7A 1WBHA 2E8YA 1ICSA 5F2LA 1SMDA 4QITA 1QW8A 5HOSA 1LWJA 4KFOA 1J18A 4MDPA 3MMUA 4IXHA 4JTUA 1GCYA 2ZWYA 3WH8A 4NNAA 1MQRA 2QCHA 3LTPA
chains in the Genus database with same CATH superfamily
1RBLA 1UL9A 2GJLA 3CQHA 4PMNA 3OLIA 4GKYA 3NWKA 1PMIA 1HJSA 4UAPA 4LHSA 1GEHA 2EBNA 4LO7A 2QQNA 3FA4A 5HMSA 1JPIA 1XYBA 4XQ4A 4K39A 1E6QM 1XYZA 1N55A 4A05A 5EYXA 5XIAA 4D6RA 2OEJA 2ZDRA 3GTFA 3JZUA 2R1PA 3GC2A 2E51A 4UUIA 5H9RA 3OYZA 2ZZ5A 2RM23 1JOBA 1IWPA 4HP5A 3W1QA 3W28A 2D93A 3PSVA 3CMFA 2DH2A 3VDBA 1OCQA 4O16A 2CWMA 3MVTA 1J5SA 3VVGA 4FX6M 1XU1A 1UKTA 2X8RA 1E5NA 4LBLA 4YZ2A 3OBTA 1M68A 3PJXA 4EWAA 1GJUA 4JCLA 3ARQA 4V1XA 1ODNA 3SAZA 2IS7A 1OCJA 4EX4A 3VD9A 5HR7A 3M0MA 1Q4WA 1YFUA 5A7WA 5F1RA 1BTMA 3ZSJA 4G1KA 1GOOA 5JI7A 4IEUA 1IEXA 2VEIA 2QJHA 1DTUA 3C52A 3LDRA 5LBEA 1UMLA 2ERFA 1ELSA 3ITOA 4RSUA 3ZN6B 2WSUA 1WZMA 5DPNA 4Q4SA 3LSBA 1UMIA 1X1NA 1PNGA 3VNYA 4H55A 1Z7S3 3IGHX 1XISA 2FDGA 4CCZA 1UPIA 3OVGA 1VHNA 3VA8A 3AC0A 4W7UA 1PV8A 3RCYA 3NV4A 1Z7S2 2BW8A 4NT0A 1WKFA 1OWQA 5D2XA 3TIMA 4ITCA 1CB7B 3LZ5A 3WDPP 3QZAA 3FX4A 4B1LA 2OEKA 1DKWA 2E7FA 4JZRA 2DU2A 2WVTA 3ABQA 5ECVA 3ACGA 1V0LA 3K77A 2GQAA 3ID7A 4O15A 2Y60A 3ZWSA 4Z2LA 2QR6A 4DUXA 1YE4A 4G6CA 1TZ9A 3WQ4A 1ITUA 5H2ZA 5HMEA 2QBXA 4OUMA 3N36A 1J93A 1DJXA 1LQ0A 4P2VA 1CX4A 1HRV2 2VNGA 5BXXA 1MNSA 4R7JA 2CLIA 2WDBA 5A6TC 1VFTA 2K46A 5J5DA 1DQUA 3H70A 5SWUA 2CZEA 1GVSA 3DYOA 2GMPA 5DY2A 3OUJA 4CEUC 4IPJA 4WJEA 4KETA 5F1UA 1RINA 5FAJA 4XJ8A 5IDIA 3WDJA 4AYGA 3P8JA 1W90A 2GALA 1EDQA 3OGGA 2VBBA 4GI4A 5D09A 1SFLA 2AEZA 1QK2A 1UWTA 2FDFA 4YHGA 2VR4A 3SEPA 3CUHA 2WAOA 3K4ZA 5GZFA 1WYIA 1PYFA 5H8UA 1C8M1 5B4NA 4F0MA 4WR3A 5KWRA 5FOOA 4I5UA 3CKHA 4NPRA 1AJ0A 1UKOA 5A1LA 2WN2A 3SCVA 4JY8A 2WC4A 2V3GA 2TMDA 5FWEA 3TWAA 1CPNA 3ATYA 5FAXA 5D8WA 1JNDA 5FACA 5FPLA 1VLIA 3SRKA 4JIIX 1TZZA 1VLWA 3AP9A 4Q29A 5KZ6A 4WM8A 2JX9A 3BC9A 3FJ6A 2XFRA 1EUTA 1W5OA 2NLIA 3UV9A 3F2ZA 3I7DA 1UP0A 2YGYA 3NVTA 2VO5A 4YW4A 3T2QA 4HYWA 2A79A 3C6CA 4US6A 5AVHA 4IE4A 2W47A 2B4GA 4MG2A 3MEPA 1JZ6A 2QCDA 2GVLA 3CAQA 1AHSA 5I79A 1XRVA 3BLLA 4W8BA 3IAPA 1O59A 5CB7A 3G3DA 3EOSA 1MEC1 4AG4A 1P0KA 4LAZA 1KBJA 3TOJA 3ZIWA 2XM2A 1SHWB 2XL7A 4P7LA 2ZGMA 1XH1A 3W5MA 3VFCA 3W87A 1PSCA 1FH8A 3HG5A 4L4PA 1JFHA 4C5YA 1BSIA 2WZHA 4M51A 3VZLA 3IIZA 2AEYA 5T3NA 4FZIA 4AL9A 3W1MA 4V1PA 3WQCA 1WDPA 2YZ4A 4I9AA 1QVBA 1QI5A 3AJZA 4HVQA 4DJDC 3H2CA 1DGLA 4PUUA 4LJHA 4KFPA 1NWUA 1HXJA 1IOAA 2WSRA 3RQ0A 4ZB2A 3RFAA 4XFFA 1JJKA 4DBUA 2DEPA 2RM21 5T9BG 2J78A 3TQ0A 2QDEA 4YM2A 1KCZA 5A70A 2G0WA 4EPDC 3JBG2 3GW3A 3VKKA 2Z5WA 1N8IA 4WXZA 1KBLA 4J3VA 1OFEA 5BW6A 2A6XA 1QASA 1TVPA 4AEMA 3JU2A 5FXVA 4NQ1A 3VKAA 5F3CA 3HWJA 4AXOA 4BLIA 1CXHA 4GNKB 1K03A 4NG3A 4GUHA 3BAIA 4QE1A 1PWMA 3VD5A 3SIZA 1UPSA 1GOFA 1CI1A 4ORIA 2Q8LA 3G1HA 1CAVB 4RR3A 1I45A 1SZNA 1H1AA 3TQPA 1O68A 3MZ2A 3ZFGB 1PKLA 2FMYA 3KVJA 3B9DA 2EAKA 4V2VA 2Z42A 4U2YA 3SHRA 2HJIA 4BCUA 1EWDA 3KOFA 2PCQA 4YRDA 3OBKA 5FV3A 4TLGA 1TTQA 4LS0A 5IXEA 4BWOA 3ZT5A 1Q56A 3AYSA 5DT5A 2BP6A 2CLHA 4Y9AA 3TOYA 3IWZA 1SO6A 1C8VA 4GOAA 2Z1WA 3ISIX 4DPPA 2NSOA 3DGBA 2BWCA 1KITA 3U0ZA 1FWSA 4R7OA 2PP1A 1OC7A 4NHLA 3VKLA 2XUCA 1TFVA 2OX4A 2RGMA 3OEBA 2QIWA 3NNMA 3IJQA 2WMFA 3GDKA 1ONEA 5LHFA 4CUBA 2QQJA 3HJEA 3NDZA 1XNAA 1DQ4A 2A85A 4I0WB 1NA1B 1G9BA 4IIDA 4GA8A 2PDIA 1F6YA 2FTWA 5IK7A 4ISRA 4QR6A 1AZDA 3S5AA 3KF5A 1N3OA 3W1RA 5FZLA 5K8SA 1Y7VA 3EWCA 3P61A 4XF4A 2C0HA 5AVNA 3A5FA 1CXEA 1V3LA 3AZVA 4IXXA 3IS4A 4N7IA 2P0OA 1V9U1 1OH3A 3M0IA 3OP2A 1UW9A 4XF1A 4QKFA 4MAVA 1PDYA 4BF5A 3PAJA 2OT7A 2QQ6A 1C7TA 2QV5A 1W1ZA 1RXGA 1TVLA 2DVDA 2CZFA 4UW4A 3EX1A 1W0PA 4YZ1A 1WW7A 3HMJG 3Q8BA 3AKPA 4AI0A 3UGHA 1NFGA 2YYUA 2HROA 3VKMA 3M47A 4LC8A 4A8LA 4MNLA 1P0NA 2CLOA 3NSNA 3SUTA 3PS7A 1K7EA 1E56A 3UZWA 1Q6CA 2PTYA 4P02B 2F2KA 4FTSA 2HYKA 4IPIA 3QD6A 4LT5A 3DFYA 3O6DA 1RMU3 1YIXA 5IWFA 2A5HA 2GNBA 2FTYA 3BTNA 4FO4A 4M56A 4PRRA 3K48A 4X6RB 4LEQA 4BMBA 3NO5A 2C7FA 2DZSA 4EKJA 2H9AB 1TCMA 4HYVA 1XE0A 1FKXA 3OD4A 5AC93 4BLJA 5EFFA 3LQGA 2OO6A 2UY3A 3WLRA 5DXYA 3K2OA 3BALA 5JCTA 1B3VA 5AC92 3VZKA 2OEMA 4OUSA 2GFTA 3FXGA 5D2WA 1F35A 3CWOX 3ITQA 1WNOA 5KTLA 1AMKA 1AZ2A 1MW1A 1DTNA 4M3PA 3W85A 4IGOA 5C5TA 4S2BA 3UWZA 1RK5A 1UZHA 4XMIA 2WMIA 3VD7A 3VNIA 5JXIA 4Y1UA 2NWRA 4YWSA 2ZZ7A 1ZZBA 3ITVA 4XZ9A 3R25A 5KSWA 1GICA 1W8NA 1UY3A 4R4ZA 1KS5A 3KV9A 4E9KA 1E4NA 2JQXA 4XB3A 3L4YA 1YXCA 2ANUA 4FVVA 3P7YA 4FF5A 1H09A 1I1WA 3TZNA 5K0UB 1AL8A 1W2VA 4HA0A 4JGDA 4HKWA 4WJ8A 5JDBA 4S3EA 1JOPA 2E77A 3WCZA 4KCUA 3CLPA 4QGMA 1NOUA 1WOBA 2GJPA 5HV0A 4CYDA 5F39A 3RMXA 3W59A 2DTYA 4R52A 1TR1A 5JUVA 5FZMA 3W29A 5CKQA 4FXFA 4PMOA 3UGVA 4CQCA 4N6FA 5KXBA 1QJX3 1JZ3A 3IPWA 4TLFA 4LK6A 4LHLA 5ENLA 1BJQA 3MI3A 2D3PA 2LALA 3S2NA 3QPEA 4UCGA 1VJIA 2J75A 1NA1C 1QJX2 5E88A 1CIUA 3AU2A 1OT1A 3P6BA 3VNKA 3O1UA 3IWPA 2YLAA 4D6JA 1R093 1EO5A 3GZTB 4IUGA 1JPHA 1J79A 5C9AB 1OMIA 4LUSA 3XIMA 1KRBC 3CZGA 4IV1C 3B4UA 3PL0A 3O06A 1R092 3WQDA 3CU7A 4J2MA 2DPEA 3M0YA 5LA2A 1ZQ5A 3RZLA 4FCAA 5EWSA 2AYHA 2G37A 2OQLA 3M0KA 4XQ6A 1SFPA 1GKBA 2WNEA 5CNAA 4B15A 3WY6A 4GUJA 2DFAA 4ADTA 4UFHA 3AIBA 3O12A 1LOGA 1UUOA 3PZMA 2I5QA 1PIV3 3L2HA 1BF6A 5A2AA 2YZ5A 4F0SA 3FZ3A 3T40A 4IEQA 3TYJA 2INFA 1YNPA 4Q1RA 4CDWA 1JVNA 1GT8A 4NPMA 3W53A 1V79A 4LBQD 4INDA 5DZFA 1XBXA 3OLGA 4ZQRA 3ZJKA 2CXGA 4FBFA 1V6JA 3LX9A 3BGAA 3OBRA 4LHKA 3VBUB 1H7PA 2XGZA 1HKVA 4Z07A 1POKA 4MGTA 4BWLA 5CADA 4BPZA 2VW0A 2RS11 2J27A 1DORA 1L8PA 5A6KA 2CTVA 5C9XA 4CEYB 1VBJA 2RMU3 2WMGA 3H2EA 5FIXA 4JAAA 5D8AA 1K6AA 1TJ2A 1ZX5A 1BVWA 5DEZA 3UESA 1YX1A 4O1CA 2RMU2 3I49A 4BHPA 1DQ1A 3B0YA 1U1JA 3QZEA 3AS3A 2YCLA 2NXHA 2HBUA 2WNVA 1CR7A 4UCFA 5TBOA 4K9SA 4Q8QA 1WBFA 1K5MA 2BHZA 3HAGA 3NG3A 3B0XA 5LIKX 1W9YA 5FK7A 2CAVA 4JRLA 4C65A 5JZGA 4A7ZA 4KCTA 1CECA 2P1FA 1NEYA 3T08A 4AR2A 2GC0A 3AALA 1D3HA 1LGCA 2EGZA 1SR0A 2QS8A 4LW7A 1TME3 1A5MC 4W87A 5JMUA 3BLFA 3NJ3A 5BMXA 3THUA 5E16A 2PWGA 3QZ6A 2YDQA 1TME2 5B2GB 1Q5MA 4S3DA 4CDWC 1AXYA 1HKWA 3KOXA 2VPVA 1I0BA 1WCSA 5PTDA 4K1ZA 3W2KA 4XO6A 7REQA 4QJ1A 2Y8KA 5GLVA 4AHXA 4EE2A 4PTDA 4K6BA 4CQBA 4GIEA 1RUI1 2WINB 3N13A 2CXEA 1VPXA 2IZWA 3EEZA 3UF9A 5C2GA 3POIA 4BWLC 3PJQA 3W24A 5EMJA 3VBOB 5A94A 1WD3A 1WWYA 1JHNA 1BD0A 1OB0A 4GVFA 5FKYA 5D8AC 2XHKA 3EMQA 2XIQA 1NWTA 1FDZA 1K5JA 4XAEA 4XZHA 1Q8SA 3BE7A 4QHRA 3R7MA 1Q2SA 1OD3A 4ZONA 3UYJA 4IV3B 1JCYA 2WNVC 4FOUA 1WZLA 1IT8A 5JVLA 3FY1A 4V2XA 1TTPA 3GNRA 4FXRA 1BQPA 1W56A 1JEZA 2QCNA 3GALA 4O9GA 1N1VA 3VX1A 4FFHA 1Q85A 5JZGC 5FMBA 3TTYA 4OI2A 5BROA 5AVPA 3H2AA 1AH0A 4AVOA 1NAEA 5B4XA 1ACCA 1Y9QA 1UNBA 1U12A 2AZ5A 4CCEA 2GVYA 4IZGA 4EAMA 3ZVIA 1ZM1A 4DPNA 4A6OA 1KFJA 2A1YA 3K2GA 3LSCA 1PGSA 1Y0EA 3RPDA 4PLNA 1D4VB 2H8XA 3U10A 1MRAA 5CZJA 1BKZA 1Z41A 5HWNA 1XJAA 1EGZA 3RM4A 1HZYA 1R87A 4PDWB 2PMQA 1LG1A 1W6MA 3DFSA 1D0HA 1TV3A 1RBOB 4DJDD 4IEVA 4LCSA 4QBXA 3ZN4A 4RZBA 1EYEA 2PODA 3BLDA 2Z2UA 2PDCA 3VBUC 1CWPA 3UKNA 2CIPA 2VY0A 1AR71 4QTGA 2GGGA 4Y9PA 1M7PA 6CGTA 4XSLA 4JD4A 2Q1MA 4TZDA 4CEYC 3HTWA 1YBQB 1Q7ZA 3ARUA 2G3MA 3TSMA 1WXZA 3DERA 3USZA 1M04A 3VILA 1JXKA 1UZZA 2UBPC 1HB2A 4V15A 5C6CA 1EF2A 3NNTA 1TPEA 4JEQA 4YVSA 4FPKA 3EDEA 3BLIA 2EPHA 2VR5A 5CEWA 2BGQA 4Y9NA 3KV6A 3PNAA 1E6RA 3ARPA 1B9ZA 1XIHA 3VDDA 3NGFA 2J7MA 5LY1A 1R9XA 1J5TA 2EXKA 3NO8A 4NVPA 1E0TA 3DI1A 5A3NA 1LTDA 4IQEA 4Q7IA 2W08A 2JK2A 4JIEA 4QE5A 3E97A 1VB4A 2JDZA 3ARWA 3NQAA 5EYYA 2D23A 1TJ0A 3AXHA 4N9DA 2WYFA 4TX6A 4XHXA 2YPIA 3ZT7A 1WZKA 4JGZA 2XFWA 3GXUA 3TMQA 4J9JA 4ZS3A 2DUOA 2C3ZA 2HK0A 6TAAA 5LKYA 4H3DA 3PDQA 3UZZA 3VBRC 4JICA 2G41A 3SH4A 4NHVA 1KXGA 2C79A 4LBSA 5JVVA 4L4MA 4IPLA 4GUFA 2VTXJ 4XABA 1A3XA 1VQTA 3CIWA 1HB1A 2XISA 1N1TA 1WKDA 2WO1A 3MHUA 3VBOC 5D33A 4AY1A 1E6XM 2XOMA 2ISFA 3UWWA 3ZJ6A 4HVRA 2Z0IA 2ZHNA 1M06G 1V70A 4YW2A 2CBJA 3KM8A 4B92A 3EMRA 1W2NA 1R3VA 4DO7A 3GZEA 1CXKA 1EAH1 1LUCB 3OLDA 4NNCA 4AZ7A 5BCAA 1Q65A 2ZTKA 3EX6A 4IJRA 4MY8A 3WH7A 3MI2A 3RJYA 1ULCA 1A0CA 1BAGA 1VR3A 4L11A 2QQKA 1FXQA 3VKBA 4LCRA 2VMFA 1IWBA 3ZSKA 1ZTVA 3NNJA 1MZFA 1J4EA 4PSRA 3IMMA 3WQ5A 4O28A 5TSWA 4BA6A 1G4TA 1B3ZA 4Z2GA 1IPJA 1PK6B 1BYCA 1FQ0A 1DZTA 1STMA 2DT1A 4E4DX 3OUHA 4QSHA 1SLLA 3WJSA 2R061 1WXJA 3RN6A 1VZWA 4Q32A 3ZYFA 4MLJA 4M3CB 1I3HA 3VUOA 4Z1BA 3V0BB 1W3HA 2JEMA 5EL1A 4MVTA 2P5NA 1TNFA 1Z6KA 2XJQA 2D22A 3DYPA 2OU4A 2Z26A 3VIJA 5DCEA 4GUIA 1R1A2 1GYKA 3R4IA 4MWAA 5D32A 4OIFA 1LEMA 2XVNA 1YUDA 2E40A 2XYLA 3V75A 1PTAA 1D3CA 5FL1A 2GWNA 3NQBA 3U2OA 1UD2A 1AVBA 2NN8A 2WBGA 4XKYB 3TYUA 1F4HA 2XWDA 1GVYA 4S3AA 5EJ3A 1J0JA 4GJYA 2TYSA 4GI6A 3MU7A 5G4HC 1W17A 1IQDC 1C5IA 3F4CA 1ZAIA 3C2OA 1XDLA 4LOTA 3KCLA 3P74A 1SSDA 4FNRA 3WLOA 4I02A 5LXEA 5ABFB 2YDEA 3IGSA 3IT8A 3KWSA 1JG9A 1UQXA 4PCPA 4QGLA 4CN1A 1DPMA 1FWRA 3HN3A 1EX1A 1QXLA 4FS9A 1TPDA 3QHNA 3SUVA 4E2BA 2R071 1TWIA 1XRTA 3SDOA 5FKCA 3SKJE 2P10A 4K8EA 3SB0A 4AAXA 1ZGDA 4XBLA 2PTMA 4ZOCA 3B0VC 4DLFA 4EN6B 4XUNA 3HGSA 3NNLA 3LGDA 1T41A 1SZGA 2VNOA 2E25A 3S83A 5BNPC 4OI1A 2WJDA 3LFIA 2FZNA 5A5WA 3NV3A 1B90A 3Q2DA 5I8SA 2LTNA 1QFEA 4Y96A 2LLEA 4RGAA 4D3WA 2W67A 1NT0A 2HWF3 1H7NA 4QU2A 2CSGA 2EAAA 3U4AA 4J28A 2G97A 1X7NA 2QNEA 1KEXA 2QT3A 2HWF2 1OX4B 4MWAC 4XAAA 4JX6A 4EOUA 4D72A 3KHJA 1UX6A 4IL7A 1UY1A 1EZ2A 1VS1A 2DVUA 1UOGA 1ONAA 1XIBA 5D9NA 3IK2A 5LEKA 1DYKA 1E6ZA 1VYRA 3I3EA 3BI3A 1FUYA 2YCKX 4G3YC 1KS4A 4RX0A 4NAFA 5FMOS 3WO8A 1OX5A 1FNYA 3CZJA 4FO9A 4XSMA 3O6CA 3VZXA 1KM2A 1VBD3 3P5YA 3CQ0A 1GV9A 3ALFA 1EGMA 3NM3A 1ENXA 2E7AA 3STGA 3DAQA 2NPIA 3RMEA 4WDWA 2X1UA 3RSJA 1BEV2 4F8XA 2VE1A 1OQ1A 3WK1A 2WR9A 3PZTA 4NIRA 4Y4RA 1OFPA 2XKPA 3ARXA 3ACHA 1PK6C 3WLIA 5A6YA 4AXKA 2ZUUA 3CZUA 2XDVA 2XKOA 4A2SA 4YZ5A 4LV9A 1TQJA 3OVRA 3TAKA 1CT5A 1OZQA 2VEFA 3NQGA 1EXPA 1CAWB 4WEVX 3TAOA 3W02A 2YLLA 3EMZA 4NY2A 3S42A 4J4KA 2D5HA 1GP4A 3MLKA 3R6SA 2DZUA 5AFEA 2J7BA 3EWUA 4FAGA 5CJ5A 4KWLA 1QOSA 1M1BA 3NQHA 5IRPA 4KL1A 4D9PA 4K3UA 5LYRA 1SMVA 1YTKA 2QDRA 3M0LA 1B35B 1SBFA 3KBMA 1PB0A 4DZAA 1LODA 5FZ7A 4X2RA 4XISA 5GVJA 3URAA 3AXKA 2OPWA 4TIMA 4ZTYA 1UYQA 1WLWA 3K4AA 5D04C 3WQ7A 3AKTA 1UH4A 4B5WA 1ZZ6A 5EMLA 3NQCA 3WFLA 1IIGA 5FYHA 5LATA 4D7SA 2I9EA 4A29A 3ZYZA 1OT2A 2DIEA 4FPHA 3E0WA 4DWDA 1JN2P 3B5LB 1HGWA 3REQA 3PF3A 4CDXB 5IBXA 1UIPA 1ODZA 2E9QA 1UYPA 4ORFA 3NYZA 4Z1YA 2I16A 2JG8B 3N7LA 1I1XA 4CEWA 1G8WA 2W3ZA 4Y5SA 5D9PA 4J3WA 1O4ZA 4H4IA 1W8UA 1B3OA 3OTRA 1VPYA 4C7DA 2GSJA 4GB32 1I8JA 2Y5JA 1GZJA 3FNDA 1JYIA 1XICA 1FCVA 1UWQA 4EXAA 1RUG3 3BYWA 4PI2A 4UQDA 2FQIA 2PDLA 4IGPA 1K4GA 4AK3A 2RDNA 4L6HA 2R30A 1KD0A 1LULA 4I5RA 4O19A 3P62A 3TZFA 3DCPA 3I68A 2ZABA 1TREA 4P5YA 3NW4A 4ACYA 3F7JA 1S38A 1GQLA 1LOQA 1X8CA 4JTJA 2PAEA 3ZXAC 4EN9B 3ZYIB 2WZMA 4FX8A 1UA7A 1DP0A 3EZ4A 2Q4SA 1GSLA 3KP0A 2OKTA 3V36A 4COZA 4XHBA 1VMFA 5BRBA 4WY0F 2QDGA 2WFPA 3OO2A 1W05A 5JWPA 2QYGA 5EJZB 5IBXC 3T09A 3N2OA 2ZJCA 4L99A 1WLDA 3W26A 1X8EA 1XJBA 4V27A 4CCNA 5FP3A 2A73B 4CEWC 2PAMA 3GY1A 3I7SA 1RALA 3UG4A 3C3NA 2QPUA 2E1WA 3GLCA 4GINA 4LFYA 4X3ZA 1W0MA 4PFHA 2VX6A 4GHRA 4C91A 1UD3A 4CDQA 4RA0A 1QBAA 3SSZA 1A78A 2A75A 1SVDA 1R2RA 3A13A 4GD0A 3AJ7A 4Y8FA 3DF0A 4LT9A 3WL0A 1PE1A 3SNMA 4RE3A 1O1ZA 2OB3A 3DG6A 1RUD1 3TN6A 2ZXAA 2XUMA 4JYDA 5D2VA 1LHOA 5FZOA 4HU8A 3WDWA 5F7UA 3B8TA 4BB3A 3CUGA 4R3UA 2Y1HA 1WCQA 3N34A 1MS3A 1LWHA 5AC4A 3RS6A 1A80A 1VBD1 1H7WA 7A3HA 4GUGA 1B35C 3V5OA 4F0KA 4K1GA 3L5AA 4GWMA 2P50A 3CEUA 3WLKX 1ZAHA 1REDA 3N9MA 2I17A 2J25A 4AHZA 4K7VA 5K7JA 3Q8AA 4CDUB 3VM7A 3CT7A 4BZYA 4PMDA 1IHIA 4LUYA 2ISSA 3VOHA 1ITCA 3PVNA 1U30A 2VD7A 5DY3A 1EA0A 3PJYA 4QROA 1Q8VA 3R0DA 4PQQA 2QAPA 4IQPA 3NQMA 1XIDA 3S9IA 4QHZA 1ZBA1 2LROA 4QDWA 3H22A 4TOQA 4AYSA 3FKRA 3ZFFB 1YQ2A 2OOFA 3C5QA 3MKVA 4XFIA 3LK6A 4MPQA 1AH3A 4XFCA 3E0LA 3ZXJA 4MGQA 5KBFA 3FK4A 1S2WA 5H9QA 3SITA 4GA9A 3SCGA 4RXFA 5FZ9A 3S2MA 2O92A 2W9MA 2KX9A 2VMEA 1H1YA 4C1NA 3WG4A 4ERGA 3GDMA 3QY8A 4CP9A 4MB3A 2PDMA 5TF0A 3WQBA 2XR4A 1O95A 5K9YA 1WA3A 4F2BA 2V30A 1LJ7A 3IUIA 5FZDA 5AHLA 3NL5A 1ZFJA 1BK1A 1BGAA 2E67A 4NAEB 4GPNA 3PR2A 4ZQPA 4AMAA 1T0OA 1XYLA 3SH3A 3POHA 5IVBA 2ZE3A 4UOQA 1TNRA 4HB7A 1WCDJ 3UYIA 1NOFA 5DZGA 1L7RA 1F7BA 3VN4A 5CKNA 1UKQA 4RL7A 1PKNA 1OUSA 3WVJA 4H3WA 3GO2A 1WE5A 2B7YA 1W3VA 3W6YA 1W8GA 3M43A 1PO13 2WVVB 5FEXA 1QQP3 3SUSA 2FZDA 4GULA 1PO12 3ZLIA 1OD5A 1YLLA 4RUBA 1QQP2 4B90A 2BNJA 1VBGA 3ME2A 2UY4A 4IMCA 1FPN3 1WZXA 3C3VA 5CVRA 4OHYA 2DVBA 3QF0A 4DXTA 3GNXA 4AGRA 4D0QA 3VGEA 2PDXA 4JTDA 3SJNA 5EYWA 4DBWA 1TRIA 4YWIA 2WSPA 2EG6A 2HLEA 3OZOA 4P8UA 5AECA 1UR8A 1VBUA 3EX2A 1TELA 2P3ZA 1TX2A 4XFBA 5LA9A 1JH5A 1NY72 3RO6A 3LLXA 1RUOA 2QCDB 1W1TA 1UYZA 3A6OA 1EP0A 5A7PA 4MB5A 3W38A 2J1SA 1P6BA 4HNUA 2ZA9A 1C8XA 3ITGA 3ILFA 3MO7A 4JFWA 4UTJA 1R46A 3FA3A 1B3YA 3W7PA 3G2GA 4MB4A 1H7XA 3POJA 1TSIA 1LRHA 5EBAA 1NQKA 4XAGA 2AGKA 3CEPA 3E0FA 3RU6A 1EL3A 2YL8A 4L5ZA 5LRRA 1XIJA 4COWA 4P9JA 1ULFA 2VNVA 4JVAA 1OF4A 6TIMA 1IG3A 1TTIA 3CWNA 2FVMA 2WZR2 2R041 2OLAA 3IV8A 4CDUC 4LOCA 3GWQA 2HWE3 5F6LB 4AEEA 3LQCA 2BTMA 1EDGA 2CLMA 1W8WA 3ABZA 1LRTA 3WKZA 5A6LA 3EJKA 2HWE2 4NIAA 1KXTA 2X05A 1G6NA 2VZUA 1Y9GA 3NJVA 2HWB2 3NUKA 1JCMP 3AIQA 3H4GA 2P8BA 4RDVA 4OQVA 1ISYA 2XG9A 2V2DA 3P0WA 2Q0AA 5FWJA 3G1DA 1XYFA 5I03A 3HQXA 5HWMA 3ZFFC 1FWIC 2H6CA 1TX0A 3MCMA 1PGW1 3N3TA 7CGTA 1GJWA 3CM4A 4P7RA 3OPWA 4YVVA 1AR83 4UW5A 3EWXA 4N53A 4MDOA 3PIGA 4CU6A 5CC5A 3D4KA 1UF2C 1H41A 4OULA 4ZR8A 3BJFA 2YBUA 3H8UA 3NV1A 1A3WA 3BUCA 1UMHA 1TV8A 4MAZA 4S3BA 2FJUB 5LZ6A 1C29A 3J26N 2XHNA 1EKOA 1C57A 4MWAD 2TODA 3GXDA 2PLCA 4BR1A 2DT3A 3A23A 4PC8A 3LA7A 5A7NA 3EAUA 4XZIA 1DF0A 4IL0A 2QJVA 4W7WA 4NJIA 4XD3A 4TVCA 1BG4A 4A21A 1NIUA 5A6QA 5JIPA 2WKJA 4RLIA 4EPKA 3VGHA 3GVGA 5KXDA 1W6NB 5F2SA 5EMUA 1LL6A 2VZOA 2QCCA 1E9IA 4D6IA 1J1LA 2V63A 2O9PA 2L5HA 1HNYA 1HW6A 5A7QA 4M6UA 3LPPA 3UZXA 1H61A 1PTGA 2A3EA 3CZLA 3QH6A 1VBE3 4C6CA 4Z1AA 2GL5A 4XZNX 3FS2A 1Y5WA 3B3DA 1VBE2 4KS0A 1PMHX 1VBA1 4JZ5A 1H50A 4P8XA 3SCPA 3G1RA 3ZXKA 4DZ5A 3LY0A 4CGTA 3B7MA 4AHPA 3GG1A 2GNDA 4IMFA 4XFAA 1H8TC 3BK0A 3UY8A 2ONEA 1WUFA 1VJSA 4RE0A 3H1WA 3S5SA 3FFQA 5CPOA 1KFKA 3T7VA 1BQGA 1OBNA 1F74A 4A42A 3N9KA 2NQ5A 1AUYA