4UFIA

Mouse galactocerebrosidase complexed with aza-galacto-fagomine agf
Total Genus 211
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
211
sequence length
644
structure length
641
Chain Sequence
GAYVLDDSDGLGREFDGIGAVSGGGATSRLLVNYPEPYRSEILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYELDENYFRGYEWWLMKEAKKRNPDIILMGLPWSFPGWLGKGFSWPYVNLQLTAYYVVRWILGAKHYHDLDIDYIGIWNERPFDANYIKELRKMLDYQGLQRVRIIASDNLWEPISSSLLLDQELWKVVDVIGAHYPGTYTVWNAKMSGKKLWSSEDFSTINSNVGAGCWSRILNQNYINGNMTSTIAWNLVASYYEELPYGRSGLMTAQEPWSGHYVVASPIWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVALTDGLGNLTIIIETMSHQHSMCIRPYLPYYNVSHQLATFTLKGSLREIQELQVWYTKLGQRLHFKQLDTLWLLDGSGSFTLELEEDEIFTLTTLTTGRKGSYPPPPSSKPFPTNYKDDFNVEYPLFSEAPNFADQTGVFEYYMNNEDREHRFTLRQVLNQRPITWAADASSTISVIGDHHWTNMTVQCDVYIETPRSGGVFIAGRVNKGGILIRSATGVFFWIFANGSYRVTADLGGWITYASGHADVTAKRWYTLTLGIKGYFAFGMLNGTILWKNVRVKYPGHGWAAIGTHTFEFAQFDNFRVEAAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords GALACTOCEREBROSIDASE
publication title Azasugar Inhibitors as Pharmacological Chaperones for Krabbe Disease.
pubmed doi rcsb
source organism Mus musculus
total genus 211
structure length 641
sequence length 644
ec nomenclature ec 3.2.1.46: Galactosylceramidase.
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02057 Glyco_hydro_59 Glycosyl hydrolase family 59
A PF17387 Glyco_hydro_59M Glycosyl hydrolase family 59 central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 4ufiA03
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4ufiA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4ufiA01
3VIKA 1MQRA 1CGXA 4AAJA 1B3OA 2XFWA 3MI3A 3OHIA 4HNVA 1V0KA 5D37A 3ZT6A 1Y4WA 4NUWA 4UQCA 3WQ4A 4XQ6A 3LLFA 4PMQA 4TOQA 2EXOA 1YYAA 1MQPA 2WLZA 4TUFA 2YYTA 5EKYA 3AQUA 3NQCA 3AIRA 2XWDA 1U5JA 1EWEA 3L0GA 1AMYA 2E5BA 3WNNA 2ZCGA 1J4EA 4QCFA 3DENA 2A7PA 5LZLA 3DI0A 2VXNA 1KFEA 3MUZ1 4UQAA 1LG1A 1OX6A 3N9SA 3P5ZA 3OIHA 5A8OA 3SC7X 2PWFA 2ADEA 3QF0A 4LWWA 5I6SA 4N02A 1DWAM 4RE4A 3L21A 2Y7GA 1BFNA 3L4YA 2YGYA 2WVTA 2WHLA 1M5WA 4HXCA 4XWUA 5SWUA 4YCPA 3EWUA 4MDOA 4F79A 4O13A 4TTGA 4JFWA 3BV4A 3P81A 1SZEA 4AH7A 1DHKA 1E4IA 5AYIA 3ZM8A 4D6CA 3DHUA 3MYOA 3TW6A 3NQGA 4PMUA 4U2YA 2VOTA 2E5DA 4JYEA 5G5IA 2C15A 5A6BA 1GVSA 4PMZA 2RDUA 3M5XA 4MYXA 2BXYA 2XGIA 5F4SA 4AHPA 1Q6OA 3YPIA 2ZXQA 1H09A 1KTNA 4UFIA 6TIMA 2EPKX 3G6LA 4PMVA 1I2RA 4CVWA 1ZENA 3UWUA 1D7FA 4A4AA 4HMCA 3PTKA 4KRTA 1ICSA 4MOZA 7TIMA 3WQ8A 1EA9C 5AOUA 2FH8A 3PUDA 5FK8A 5CJ5A 3B8SA 4IPIA 3L4XA 2DP3A 4IMGA 3MHGA 1MVYA 2G8ZA 4LS1A 1XBVA 5AN7A 4CVUA 1BQCA 1IZJA 3NPWA 2RGLA 1ZAJA 2F84A 3NG3A 1OYBA 3SUVA 5HUPA 1GJWA 3S1UA 4CN1A 5FKBA 1GPFA 5IFPA 2QDGA 3KVMA 5G2HA 1MFUA 1JI1A 3CBWA 3W26A 1WA3A 4IX2A 1UR8A 2E68A 4WJEA 4P7OA 3TONA 5I3GA 5JBFA 1F76A 4IM4A 3BSGA 3RU6A 1SO6A 5LHFA 5D9OA 5M03A 2VO5A 4AD2A 4XUYA 1ISXA 2ZUVA 3FN9A 4BI5A 5HNNA 3G0UA 2X2YA 1X1OA 2YLLA 4D1JA 3LPFA 4M56A 2H90A 1LWHA 3VNZA 2GDUA 1K6AA 3AJXA 4U31A 4H8UA 4OWGA 2BVYA 4MJ4A 4JAWA 3O05A 2EQDA 2GVLA 1XC6A 2ZQ0A 3AHXA 1TPUA 2DEPA 1XC4A 2G3NA 1OD0A 3K4AA 4NZCA 2WNWA 2E5CA 4UCFA 2JEPA 1OX4B 1VPXA 1SFLA 3B06A 3L0NA 3GNPA 3PR2A 1EOMA 4M6PA 4D2JA 1QCWA 5LKYA 1UD5A 3UWQA 3NYDA 3CB8A 4PN2A 1DWFM 2BSLA 5C71A 3C61A 1RP8A 3KVLA 3LM7A 2WMHA 3OGSA 3HF3A 3W1XA 2ZZ5A 4PCSA 5HWJA 1C92A 1VEPA 1VFMA 3TTSA 5HULA 1E56A 1DQWA 3TAKA 2PCQA 5F2IA 3HO8A 1LOQA 4HSOA 1EXPA 3CLMA 3EYPA 1O4UA 1XH1A 4ALDA 2CHOA 1FDZA 1RVGA 3AYRA 1ZBKA 1HO4A 1TRDA 4MTVA 1E6RA 1RD5A 1YLVA 2A2IA 1XXXA 5CPOA 4CQ9A 2PI6A 3QC3A 4Y90A 1TTPA 5GNYA 3CMJA 4CD7A 3PY2A 4LRTA 4NNBA 3INPA 3GXPA 2J6XA 3U5YA 1PIFA 2I14A 1GQIA 3NQEA 1QI3A 3NR0A 5HPOA 1B3XA 4GI6A 1OFRA 1OABA 3LPOA 4OOZA 4IJBA 1MWOA 4CNNA 1FY6A 2YYUA 4TXEA 1TPEA 2HMCA 3KZSA 2YR1A 2CESA 4CCCA 2ATSA 4O1BA 4Y8FA 3AIQA 1CXHA 1UKPA 1GVOA 2VOMA 1JAKA 3B03A 3N13A 5FMDA 4JTTA 3POHA 4D6JA 3P8IA 3W82A 8TIMA 2WZHA 4W9TA 5F4XA 3L4TA 4HNTA 2ZRWA 3A4XA 2WAGA 4DEFA 4DO4A 3AOFA 3CWNA 2B4GA 4V2XA 1KV5A 3NQ8A 4YL2A 3LTYA 6CGTA 3PIJA 3RJXA 3WEZA 1DJQA 3W2UA 1JCXA 3PB2A 4J7RA 2A1YA 1CXIA 3WFLA 1WZMA 3L67A 4ZE4A 4NXSA 1X7FA 3THCA 3WBAA 3LTSA 3NGJA 2Y61A 1JJKA 3ZQ9A 1F6PA 3NDOA 3W6LA 1GVRA 3ZWTA 2GVGA 2VFDA 4W86A 2A7RA 1KXTA 4XZBA 3M47A 1TPC1 3ZFHA 4DUVA 3PBVA 3GDBA 3WH9A 4K38A 1E3ZA 3AYSA 2CLOA 3L66A 2YXGA 1XBZA 1QW8A 1SW7A 4EIVA 1P4CA 3P7YA 4JN6A 4MIMA 2QCNA 1KW1A 2EEXA 1PJ9A 4QISA 3W7RA 1HT6A 2ZUNA 1CI1A 4DWSA 2ZDRA 3TQKA 8A3HA 1ZL1A 3QYQA 1YPFA 1ITCA 1MXDA 2FFCA 2JE8A 1W3NA 3A24A 2Y2WA 4GIAA 4Z2HA 5KEZA 4PMNA 4UIOA 4BI7A 5DFAA 2ZA3A 2E8YA 2ZIDA 4UQEA 2O9PA 3WQ6A 2VENA 1UD4A 2OX1A 1XCWA 5F2LA 1VBUA 2EGZA 1CYGA 5CSRA 1TFVA 2W67A 3LCXA 4XTIA 3OGVA 1JFXA 2YJQA 1WPCA 2XIIA 2GJRA 4O1DA 2ATMA 3LCGA 1FHLA 3L5MA 5BRBA 1WDWA 1Z32X 1GG0A 2J77A 4JL1A 3G0XA 3TUUA 1HN1A 2WSPA 2JF6A 1OF6A 1AQMA 3CTTA 3UQNA 3A3HA 3FNDA 1JZ6A 1IF2A 1Z44A 1B3ZA 2NX1A 4OV9A 1RQHA 3WK0A 1GCYA 4QITA 2EPLX 4GPNA 4WKFA 4NZJA 4WKAA 1AVAA 5FL0A 2NXHA 3BAKA 4ZE5A 1PHQA 4FIQA 2O9RA 1PVNA 3LPGA 2OLHA 1QI2A 4KKXA 3LHYA 4OHQA 2O9OA 4RZ5A 3W7EA 1P6WA 5HOSA 2WMJA 1IIGA 4X3ZA 1EP3A 1Q45A 1BYBA 1UYQA 1W9PA 4QQ3A 5C8BB 1E71M 3V75A 6ALDA 5I3JA 2ZX6A 3P80A 3A5VA 2VRJA 3OLGA 5HPCA 4RKAA 3AIBA 5D9PA 4Z1AA 1G69A 3U5UA 2CLKA 3E0IA 2E8ZA 1VRDA 4ADTA 3TJXA 3TC7A 1WE5A 4KRUA 1JZ4A 1FUYA 3ARXA 1VYPX 3NL3A 4JICA 4FFFA 4PA8A 4CQAA 4NF7A 4CLMA 1H2JA 3NDYA 3P8JA 4AZHA 1LRQA 4L4OA 4B3KA 1X1NA 2CWNA 1XV8A 4RK8A 5I23A 3BGGA 1HP5A 2C7FA 2QUTA 5AC5A 1LLWA 1BGAA 1ZJBA 1WXJA 2QCHA 2C6QA 4AY1A 1UCWA 5D38A 4NX0A 1E6ZA 3AIEA 3IEBA 2P1FA 4N9DA 2QPSA 4AW7A 4TIMA 1HVQA 2H6RA 3QGVA 2X16A 4GKLA 2YZRA 4CD4A 3WY1A 3WUEA 5A6KA 4WLCA 4XKYA 3POCA 4IMEA 4UQBA 1VC4A 2VX6A 2ZRZA 4Z0JA 2E4TA 1XCXA 1J11A 3CMGA 1OYAA 4Y96A 2G41A 3M6DA 3UZJA 4Z08A 4DO6A 4RL3A 5IDIA 1C8VA 4U4MA 1Z42A 3RMJA 3RK8A 1WOAA 4DELA 1Q6FA 1NP0A 3QOKA 5BXRA 1XUUA 4UFHA 2J79A 2CETA 5D4YA 5IBXA 4U33A 3WL1A 4ZZ9A 4DUWA 1S5WA 2DQXA 4MNJA 1UWSA 2PB1A 1UR0A 1C9DA 1VIWA 3SFKA 4H8HA 2VVSA 1NAL1 4ML9A 3SCPA 3G0SA 4AD1A 1QBAA 4MY8A 1H0IA 3LLDA 2G3IA 1R2RA 2NWSA 4IPNB 4A3UA 4TTUA 1RD6A 5LA1A 1AQ0A 1SR9A 3T2QA 4ZMGA 2WCAA 1B0IA 3ZO9A 1E5NA 1OCQA 2ZXAA 3WD2A 2GJLA 1ZHAA 2GQ8A 4WSKA 1W3TA 1KFKA 1LL7A 5BRQA 2VEPA 3CHVA 3VD7A 4GXMA 3EX1A 3TDFA 3ZR4A 4AISA 1RQEA 3IV3A 1EDGA 3SCUA 3NM1A 3L9CA 4LV4A 4JCLA 4B16A 5D8WA 1SU5A 1BF2A 1LL6A 2CLLA 3HGSA 3ELFA 3W1AA 2CITA 2ZFAA 4S2BA 1R85A 2JK2A 3W72A 2BHZA 1J01A 1ZBWA 3CHCA 3AMLA 4CCDA 4DUXA 4HPXA 1HJUA 2XM1A 5KZEA 3W1NA 2WV8A 3AS1A 2XQRA 1ESWA 2E6DA 1B57A 2UY3A 2E1DA 2YFNA 4UC5A 4JXCA 3N1AA 3CZLA 5TQLA 1TR1A 4N42A 2PBGA 1I2QA 4DF2A 4AF0A 5HR6A 4B1LA 1JVNA 4C7GA 5E70A 3GXIA 1A50A 2FB2A 4HP5A 1PPIA 3RCNA 3RLVA 3USBA 1MYRA 4E8CA 4L4MA 1P0KA 3ATYA 5G1TA 3VILA 2VEIA 3W23A 1JIBA 1LWJA 3QMSA 2ABAA 5CKSA 2WQPA 1LCOA 3AIVA 2OMAA 3HBKA 3W7MA 2QPUA 1I2PA 5K7JA 3O63A 2XFRA 3GZAA 3VIMA 2F8QA 4PSRA 3QPYA 3NQFA 1V6VA 1ZAIA 4MPQA 4JX4A 1V0NA 3IVSA 4ZQCA 2WWDA 3PHAA 4D71A 2FGZA 5FK7A 1ICPA 3W0KA 1PHWA 4ZXLA 3PB0A 3LHVA 3MP5A 3O1NA 5LNSA 1KBKA 1T8XA 2G97A 3HGOA 1KCLA 1WDQA 3QR3A 1JCNA 3PUOA 1G01A 1PBGA 5GNZA 1JQVA 1TJRA 1EGZA 1AQHA 3N11A 3WNMA 3CC1A 4BWLA 1XYZA 2W62A 1SO5A 4UTTA 1D3HA 2GJXA 2BS9A 5DY2A 2ZICA 5D33A 1C90A 4LS2A 4ATDA 4QDMA 1GTHA 4F9JA 3PZIA 3GVGA 3WUBA 1NFBA 1C7TA 2D0GA 3WNOA 4WIWA 1LG2A 2Y8VA 1NP2A 1RPXA 2CLMA 3H55A 3MI6A 3QEZA 3IIZA 3R2GA 4M80A 3N04A 3SSJA 4KFNA 1JD7A 4FB7A 1DHPA 3GXDA 2YDAA 1CDGA 1WX0A 2EHHA 2Y85A 2CERA 2XYLA 1XL9A 4KWWA 2FIQA 3LHTA 2BVTA 3TXZA 2Q3OA 4ACZA 3ZIZA 4JDYA 3DHDA 4UUIA 1G7VA 5F1UA 4JTUA 5KMYA 2A6NA 1ZBVA 1W1ZA 1X8FA 1GVFA 3CLWA 3WH7A 1P5BA 1OFAA 1BHGA 1KFCA 5ABFB 3W7IA 3SECA 3AMKA 3EX3A 2DSKA 5BYWA 4DF0A 4IXHA 1JL8A 4B15A 5IM51 4MNMA 2CFFA 2PRMA 1UR9A 2H8XA 1X6NA 5JIPA 2FDSA 3GDMA 3W7OA 1NWUA 3KWXA 4ZQPA 4EF8A 4XV0A 4LU0A 5D05A 4N6EA 1LBLA 1WDPA 4RCXA 1JXJA 1TTIA 2Y8KA 4AEEA 3IGXA 3BO9A 4CUCA 3ARUA 3Q2DA 3IJ8A 1AG1O 3RM9A 1SO3A 3KFTA 1GORA 4JTIA 4AZCA 1H7WA 2BZNA 5BXPA 1SW0A 2XIBA 3NQ2A 1J2WA 3BAIA 3K8KA 4PUDA 3NPUA 1H49A 3C6CA 4K39A 5EA9A 2ESCA 4FMVA 3NL5A 3AMDA 3W2NA 1EQPA 3LPPA 1XKYA 4W8LA 1C29A 1H5YA 2X1SA 1GEQA 1LF1A 3UNDA 3RNDA 2RDWA 3KRZA 3B0VC 3UGGA 2PF0A 4JZ5A 1ONRA 5LGZA 5BXTA 5AC8A 3UYCA 3ECQA 3NPXA 4RE2A 2D22A 5DBTA 2QCCA 1I8JA 3FKKA 2YA1A 1W1PA 1AL8A 4DPPA 2JIEA 3M5VA 3QRHA 1G1YA 4Z2KA 1WAUA 3KF3A 1QAPA 3M0ZA 5E93A 3ZJ6A 1ZY9A 3TCEA 2PWDA 1HKKA 3ZJ8A 3RFAA 3VNDA 2EJ1A 1DTUA 4YHGA 3WF1A 2WC4A 5AYZA 4FLRA 1PEZA 3WDHA 2OWXA 2NV1A 5HWNA 3DFOA 4P7LA 3SJ3A 1GZGA 2J7GA 1JDAA 3S5ZA 1J5TA 1DBTA 3GNDA 1OB0A 2ZX7A 3A47A 5CPTA 3HOJA 4ZEPA 4NVTA 5EPDA 2BTMA 3GB6A 3PSWA 5GVJA 3VMNA 4O1CA 5AFDA 4YN5A 1KFLA 2C13A 4ZQRA 3HJEA 4M82A 4HKPA 2XN0A 5LNUA 2XPKA 2EO7A 1P1XA 2WSKA 3LRMA 5DCDA 2WZEA 3TE9A 5IHSA 5EFDA 1TPH1 1FCUA 2ZUSA 3STCA 2V5DA 5BMXA 3PZOA 3KL5A 3L5AA 4AIEA 1H50A 5E09A 3IVUA 3GKFA 2VZVA 3U75A 1GPWA 3H54A 4MZ1A 1TE1A 1HIZA 1TMHA 3VIGA 4LVDA 3H3LA 3S2CA 3LXCA 3M1ZA 4IMDA 4E0CA 1TO3A 3R89A 1OD8A 1FCBA 2WPBA 1EO5A 1VEMA 3OZPA 2V3FA 4MPKA 3HU7A 5A8MA 3WF2A 3WF3A 1CBGA 4J3UA 1FXPA 1K02A 1ZFJA 1IV8A 5A69A 4NQ1A 1E4MM 1FDJA 2E9BA 1VGAA 3E12A 4H7VA 2LLEA 1W3LA 4E2BA 1EIBA 2JIWA 3K4DA 3N15A 3W7HA 1OFQA 4J27A 2GQAA 1WDRA 1JFHA 4JGDA 4HZ7A 3IIXA 2BFGA 2CXGA 1W3HA 1FWNA 1L6YA 5CGQA 4P2VA 3VI2A 5CG7A 3M7SA 4BCEA 5FIXA 2W6RA 4UMAA 3BGJA 3VE9A 3W1LA 2Y5EA 4ATLA 1UWQA 4ATWA 3MUXA 1XGZA 1W5OA 3T55A 4UCGA 4BK9A 1GW1A 1YHTA 3F5KA 3BAXA 4K8HA 2BX7A 4AZCB 1P0NA 1S3HA 5KITA 3A6OA 4UTWC 3AZTA 4E8DA 1MXSA 3FHAA 2CZFA 2ZXDA 4W85A 4S3JA 1V3HA 1QVBA 4OE7A 4P8UA 1PZ3A 5FMBA 1EUAA 1TV8A 4EOUA 3ZSTA 1TYGA 3OVQA 1KV8A 4UFLA 1CXFA 1NARA 5AC7A 2BNJA 3VGHA 1TVPA 1WZKA 3QH2A 3EWWA 2NZLA 3CTLA 2X0YA 3GM8A 3PULA 5FF0A 1B31A 4GUJA 1E70M 3VDAA 1NQ6A 1VHCA 5EFFA 5KSWA 4BFAA 1HKMA 4EQVA 3UD6A 4AEOA 1C3FA 1E9LA 1EHNA 1LLOA 2YDQA 3DECA 2AC1A 3VX0A 3W6YA 3EWYA 4JDBA 4W5ZA 5A3HA 3FAXA 3QMRA 4MB5A 1JYXA 4XZWA 3W2JA 3F4VA 4QP0A 3WF0A 3DKJA 3VM7A 1H4PA 1I1XA 2CLFA 1FOBA 5HMSA 1OGSA 1IXQA 1JUBA 5JBEA 3DYPA 2BLEA 3ZS4A 5E6YA 2VRQA 2WC7A 3SCOA 1CGTA 4UNKA 4FNRA 3HG2A 2P10A 3CM4A 1DP0A 3SY5A 5LHEA 4Z1DA 3IJ9A 2JF7A 3W6MA 4F8XA 3TV8A 3W75A 3BLKA 3OA5A 1SYTA 3GBEA 5J5RA 1GT8A 3TAOA 3OVRA 4IWWA 3QFEA 2FDMA 4N9CA 5AYXA 3G1FA 1D2KA 5FD0A 2DIEA 3OBAA 2C16A 1W3JA 3AHVA 4Z2GA 2VVNA 4PMDA 1GOKA 3W88A 3W2MA 3APGA 1S46A 3CUFA 5HINA 2W5FA 1TG7A 1L2UA 3EX4A 4NNAA 1ITXA 2OSYA 4NX5A 1SZFA 1MW2A 4AZGA 4IUOA 2RH9A 4H8VA 4NI3A 5CG0A 2WMIA 3TJLA 3QW4B 4FFHA 3U7BA 4JKLA 3WSUA 5HBFA 4NJIA 1K8ZA 3NM3A 1FH8A 4HTYA 1H41A 2ZBTA 5BCAA 1M03A 1K8YA 1PIGA 3LTPA 3MMDA 1B3VA 1VBRA 4HOWA 2YW3A 6TAAA 3NA8A 4WUIA 3AO0A 4HSNA 4UTJA 3WJXA 1G5AA 1HP4A 2O92A 3DC0A 2ZUTA 1FWTA 2PC4A 2CHNA 2Q8LA 1MZHA 3EKLA 3EWBX 1SQ7A 4FFIA 2V9DA 3SCWA 1R2SA 3SCVA 5CSYA 1IXOA 3ARYA 3LV6A 1GOWA 3ARSA 2RGMA 4RJEA 1F5ZA 1YQ2A 4PMYA 3TP4A 4F9DA 2ADDA 5D2YA 1Q3NA 4CN4A 5JUVA 2GQ9A 1GHRA 5BOOA 2W92A 4GUGA 4RV8A 3CUJA 5CZTA 3W9ZA 3DYOA 2QF8A 2Z1SA 4XBKA 1GONA 2CPUA 4J3WA 1OGBA 1ME9A 1EP1A 2ZRYA 3ABOA 5ABTA 2GSJA 4BZYA 2VX7A 1YTDA 2JALA 1K9TA 4UFKA 4Z1BA 3VM5A 2GUYA 1GJUA 3MMTA 4U28A 4IQLA 1OINA 5I2UA 1G4SA 1TQJA 1UOKA 3DFSA 3UXAA 5AHEA 3L68A 1W1YA 2WVSA 3BGAA 1A5CA 3CIWA 3IIPA 1GWJA 1QNPA 4PRWA 4GUHA 1GOOA 4PCTA 1TV7A 1DWHM 2NT0A 2YL8A 1UWTA 3MO4A 4LVAA 4AWSA 1SZGA 1XYFA 1GUVA 3LI1A 5FF2A 3NEVA 1HX0A 4MLRA 3W1RA 3HBLA 3ARWA 1E51A 1V6UA 3VKKA 1GZJA 3WD4A 3PUEA 3LX9A 3GKAA 3UWWA 5ABEA 4O57A 3BW4A 3F5JA 1TJPA 3LHZA 2WCSA 1KWGA 1GQKA 2VC9A 4CU8A 1Q6EA 1SFSA 4D6IA 1Q6QA 1ME8A 3VCRA 1E0WA 2WHKA 4UZSA 3VOCA 4LUJA 4OBTA 1N55A 2GOUA 1MFVA 4W93A 4CD8A 2WO5A 2E40A 2F61A 3WENA 4O11A 2QCLA 4M81A 4LVBA 3WH8A 5KZ6A 5CPSA 1XRVA 3M5ZA 3W1MA 1YXYA 2ISVA 1JULA 4B5NA 2G95A 2XFYA 2VQUA 2VT0A 1NM9A 1FA2A 4MFDA 2UV8G 4GQRA 4YHEA 2ZZ7A 2A6LA 2X1UA 1FQ0A 2QCGA 1JI2A 5FF4A 3R12A 2QJGA 3TSBA 4DF1A 2YX0A 3TA9A 4M8UA 1XI3A 3IRDA 3UWZA 3ABRA 3FFSA 3OG3A 3W70A 4O1AA 4W5UA 2WMIB 3VMOA 1FWSA 2QHAA 2YL5A 3AS3A 4TO8A 1LROA 3P67A 3DFPA 3DBPA 3OA3A 3TFXA 2VEMA 3JRKA 1RP9A 2J9XA 3L4WA 1ML1A 4ZQNA 5LNVA 3B9EA 3HGRA 4LY8A 3UY7A 4N2YA 4QJ1A 4MB3A 4A2SA 3LEMA 1CGWA 1M7OA 4D6FA 1TA3B 2Q8XA 1SUXA 5T26A 4BF9A 4JYFA 1Y9MA 1E4LA 4J9JA 1FP8A 2KZHA 2WKJA 3LI0A 1XD0A 3VIIA 5JBDA 4PL1A 5I3IA 2J8FA 3M7WA 2DZXA 5J5DA 2CKRA 4JIPA 4O12A 1RH9A 3U57A 3G3DA 1A5AA 3EXTA 1L6SA 2FTPA 2WJZA 4J3XA 2X1RA 3HG4A 4FIRA 1W5MA 1KFWA 3CPUA 2FHCA 3CZGA 1QI5A 3UESA 1I2OA 3EDJA 5A6JA 1OG0A 5E0KA 1MW1A 4IUGA 4AXNA 4Z2JA 3NVTA 1W56A 3FJ6A 1NEYA 1ZB5A 3IAPA 5CZKA 4QNEA 1ZS2A 2J4GA 1O7AA 1H11A 1HJVA 2A3AA 3BLEA 1YDVA 4LVGA 3PS7A 1J0KA 1V3JA 3UGHA 2D24A 4QLKA 4S2CA 3T09A 4D6DA 3B9AA 1B30A 5KZMA 1VCVA 3OEXA 1CXKA 5BROA 1DWGM 3TU9A 4GZEA 3WK2A 5BMWA 1V02E 3UPWA 3SUUA 3UWYA 1BGGA 4UZUA 3VGDA 3FAWA 4NJKA 3K8MA 4KFOA 1KFBA 2B7OA 4FX6M 3L4UA 3QQ1A 2DJLA 3SCSA 2ZWZA 1O94A 5I0DA 3LOTA 3VFLA 3MV11 3W7PA 3I3DA 2DZPA 3PZMA 4UTUA 2WC3A 3VINA 3STGA 2O7SA 1I75A 5D02A 1G4TA 3PTMA 3P61A 1J18A 4DXVA 1V0MA 2C3ZA 2BXVA 1KGXA 1W54A 1JYWA 1ADOA 5L6UA 1SR0A 2E3ZA 4LGXA 2DZUA 3SURA 4UOZA 3UG5A 5EY5A 3TX9A 1JYNA 3VTRA 3WFAA 2V38A 9CGTA 2A7NA 2WCGA 3S6DA 1VAHA 3SCNA 4L4PA 3QW3A 2VMFA 4A3YA 3LCLA 3WUGA 2OJPA 1MEIA 3VD9A 3TKFA 4M6QA 1DV7A 4DBEA 2VUYA 4HNNA 2NUYA 5DBUA 1W5QA 4LQ1A 3VPLA 1R2TA 4WD0A 4KMQA 4W8BA 2ZOXA 4NT0A 1TPB1 1W5PA 1DVJA 4PCFA 1L9WA 3ZJKA 3MYPA 2XN2A 3N9RA 4M7SA 1ZU8A 2VQTA 4YPJA 4JCMA 3EDKA 3WMBA 4DPQA 1JCMP 1CWYA 1ZAHA 5DXYA 4EF9A 1XDMA 4TX6A 4FFGA 1WBHA 3FA5A 1O5XA 2X8RA 3PZUA 5DT7A 1UR4A 4W87A 3CHFA 3DFTA 2WOQA 4ORIA 2UY5A 3QQ0A 4LTSA 3L2LA 5I79A 4WXYA 2OYKA 4FLSA 1JDCA 3O9NA 3OGRA 3SGUA 2Y24A 1V3KA 4W7WA 4POCA 2JFEX 4K7VA 1DJNA 5K4ZA 3G1DA 2UY4A 4XX6A 1DWIM 1B2YA 1FBAA 2R91A 3KX6A 4RX0A 1OWQA 2PWGA 1LQ0A 2C0AA 1QPKA 4M24A 3I7QA 3GZ3A 3NXFA 3WQ5A 2VFFA 1UH3A 4UNLA 3EXRA 1X6LA 2YL6A 3MHUA 4QLLA 3V1PA 1OYCA 4FF7A 1KGUA 5A6AA 1NOFA 1FWRA 1Y7VA 3LDVA 2YBTA 4A3HA 3TSDA 3IIVA 1FCQA 2Y62A 3K8LA 3B4UA 3D3AA 1U33A 3W53A 5E6ZA 1WKYA 3U14A 2RKXA 1W2PA 3CZKA 5G1YA 2AMGA 1WBJA 3CHEA 4TX8A 3WJZA 2XVKA 3W7JA 3VVGA 1JCJA 1OFBA 1HJXA 1V5XA 2R14A 4O50A 3T0AA 1H62A 4UOJA 3OLDA 4W7UA 1B4KA 2D1ZA 1LBMA 4PTVA 3AFBA 3B0UX 1QDSA 3MO7A 3G1XA 3ARPA 3GYCA 4UXDA 1QFEA 3O06A 2J27A 2X2GA 1H7PA 3CUGA 1W9BM 3L0KA 1R86A 1XSJA 1HNYA 1OX5A 4IPLA 2WANA 4LYPA 1GOQA 3A4AA 3GIYA 4A2RA 4FNPA 1UJPA 2YW4A 3IGUA 3NIYA 3S42A 4OJYA 5AY7A 1TVNA 3U1XA 5D30A 4HA3A 5BNKA 1E6XM 3SCRA 4W8AA 3S9YA 3DHFA 3NAVA 1R8LA 1UA7A 1L0PA 1UKOA 2RDTA 5LNRA 3CO4A 1RV8A 4HMEA 1YADA 5E0CA 4GBUA 3NYZA 2DSZA 3AHYA 2PWHA 1GOXA 1VS1A 1VJIA 1FFRA 3FYPA 2E0PA 3VDHA 1ALDA 3DXIA 3WQWA 2GPTA 1G0CA 5FL1A 2DZWA 1UKQA 3IIOA 3RLUA 5CQ1A 1WZLA 3T08A 3JUGA 4GQQA 3UEQA 1XCFA 3RIKA 3W1TA 3NUKA 3WFZA 4QLJA 5GQBA 4HIBA 2B7PA 3BPWA 4U3CA 1E1EA 1A47A 4Y7EA 5ABFA 2DGAA 4O10A 2FB3A 1QOXA 3NSMA 3W7CA 3W83A 4CD6A 1NOUA 2WNZA 1QBBA 3W87A 3OZOA 4L4LA 4WY0B 1FP9A 1BKSA 3BAWA 1O60A 4O4VA 3AISA 3P84A 3G1SA 5U4NA 4PFMA 1W1VA 4X22A 1E6NA 3LRLA 3VDCA 4AWUA 3OVPA 4BF7A 3LB0A 2W63A 1CXEA 4D6GA 3LIHA 3T44A 2CBUA 4LC8A 3K30A 4UTHA 1OGGA 3IK2A 3FHQA 5EL1A 1Z41A 4MJ2A 1T99A 1GQJA 1JCYA 2Z1KA 2XN1A 3G1HA 4MZ8A 3W74A 2FPVA 1JQXA 1GHSA 4FEZA 4WK9A 5KTLA 1UD6A 1F7BA 1AW1A 3CUIA 5C2XA 1MEWA 1ISZA 1DL3A 3E02A 3DZ1A 2HS8A 3BW3A 3NQ7A 4CQ8A 1EHAA 3Q94A 1WQ5A 2DZTA 3WNKA 3SUWA 3HG5A 1UR2A 2YPIA 3ABQA 1L6WA 1MEHA 1HO1A 2FHFA 1BAGA 2DT1A 2VFHA 1YXDA 5HUOA 3C8FA 5F7UA 4XUGA 1TZ7A 3A4WA 3AIWA 1CGVA 3WH6A 1JGIA 2YDSA 3ZT7A 4Z2LA 4RLIA 4YMZA 2GJPA 1J9YA 4PMRA 2P0OA 2YFOA 2D3NA 1E55A 1G4EA 5FEZA 4DWSC 3G1AA 4UTMA 1CPUA 2TPSA 4H2CA 4X9YA 4AZBA 1W9DM 4OUEA 1ISYA 5FOOA 2BY3A 2G3MA 2QJHA 3VD4A 4QHZA 5I3DA 1K9EA 5CGMA 1TCDA 2I1OA 2QCEA 4KH2A 1Y0EA 3CZ8A 4JY8A 4E38A 2J74A 1NH6A 1WB0A 1GG1A 5LA0A 1OK6A 3OG2A 2ABBA 2AAMA 2WMFA 5D04C 3CHDA 2HTMA 3PSVA 4FX7A 1KB3A 1D3GA 1C7SA 4X2RA 3EMCA 3VIJA 3N19B 1W8SA 3C2FA 4WZHA 5F2MA 4HZ6A 3SCQA 4AHQA 1EPXA 1TTJA 1WDSA 1BTCA 5I5RA 4JIQA 5LNWA 1SFJA 4UNIA 4MNLA 3WMSA 2V30A 2EKCA 1WAWA 1OFPA 4PUEA 5BWFA 5C55A 3WJSA 1CXLA 2QCDA 1VQTA 4C7DA 2RHGA 2XGBA 1DOSA 1VYSX 2J9ZA 1O6IA 3LGEA 1BLIA 5K3VA 3I68A 3O16A 3VGFA 3PZNA 5LSMA 1E1FA 1GQNA 2A3BA 2QMKA 4JFSA 3G22A 1JF6A 1G9HA 1ODZA 3AXHA 5DF0A 2Z6JA 4GNJA 1MW0A 4UTWA 3AZSA 2I9EA 1HL9A 3CGTA 2VR5A 4U2ZA 1GYLA 3P62A 3W7NA 4CNPA 1JUEA 1CLXA 5GNXA 3SW6A 1K7EA 1LOLA 1XUZA 1OJXA 3MP3A 1EB3A 1JF5A 3OSDA 3I7RA 7A3HA 4IMFA 3A5FA 4AWTA 5K9DA 1AK5A 3N3MA 3DAQA 1OT2A 3QJAA 4LC6A 2GFTA 4Q7NA 2ZZ3A 3GNRA 3WDPP 4B1MA 3ARRA 1LLZA 1RQBA 2D2OA 1B4EA 2FQIA 3TK7A 3T40A 3T4CA 3PWAA 1I4NA 4O52A 1BYDA 4A29A 3VGGA 5CZ0A 3NQ6A 2J7HA 3CIVA 1MO0A 1UA3A 3EDDA 3PZGA 3UCQA 4O0ZA 3WD0A 3G24A 2Y7FA 3I65A 1QNRA 1TPWA 2CZ5A 4R7JA 1E40A 1KR1A 5CZSA 4RR4A 4XTDA 4NZFA 3QM3A 3R5EA 4EKJA 1A53A 2IXVA 1WYIA 1CIUA 2WBKA 1M53A 4GI9A 3GAYA 4BS0A 1UB3A 5AHIA 1OFEA 2OT0A 3HN3A 3GNOA 4WSJA 4D6HA 3HQ1A 1UKSA 2DSWA 4P61A 1QNOA 5CZJA 5F1VA 1TCMA 2C19A 3KRSA 3MJYA 5C6MA 1WO2A 3O15A 4MJMA 4KWVA 4LV9A 1K9FA 2OSWA 1LZOA 2E6AA 3AXIA 1FFQA 4KGJA 1R46A 1S5VA 2AQWA 4TVCA 1UWIA 3TMLA 2OYLA 5LGXA 1GTEA 4JIEA 3LCWA 4IX0A 5A5WA 2VZUA 5FESA 4I9AA 5A2AA 2TMDA 1KM2A 2TSYA 2X30A 5F2GA 3ZWSA 1JRCA 3BXWA 3L2IA 4JTEA 4LVFA 2OWCA 2CYGA 3N2XA 1F05A 3S1VA 3SCTA 1PCWA 1LP6A 1C93A 4JTGA 4AEFA 4O19A 2V81A 3A22A 4HOZA 3MUAA 4P7QA 2D0HA 3W85A 2VX4A 4GI8A 2QJIA 1SZNA 1QHPA 3T2OA 5D03A 4ORMA 1ODUA 4DWSD 5A2CA 2PRLA 2VELA 3G6MA 1UZ1A 3WIJA 3T0BA 3L65A 1KBBA 1TV5A 1B3WA 1H3GA 4G1KA 2ZX9A 1GVYA 3TIMA 3E96A 2QCDB 2TYSA 4N4PA 1B3YA 1OHLA 3S0CA 1QPNA 1B90A 1X1ZA 1KM1A 3MSDA 1BEUA 5D2XA 5KZDA 4MB4A 2AGKA 2YCEA 3GDKA 4J28A 4M7TA 3GDRA 4QNWA 2NWRA 1XSKA 4UQ9A 3B0PA 2J75A 2A5HA 4MLJA 4BQ4A 3VDBA 4RXFA 4JD4A 3BVJA 1THFD 4I7VA 2YBUA 4JHZA 1VLIA 4M6VA 4MKNA 3BCDA 3FEMA 1E6QM 2NV2A 2V0TA 4IXXA 2WB5A 3LCFA 1Q6LA 1VYRA 3ATZA 3HGJA 4LW7A 5CSUA 3EWXA 1QWGA 1UHVA 1L8NA 2VI0A 4HZ8A 4ONVA 3P5YA 2DZSA 2RFGA 1UQZA 1B9BA 1T0OA 1VCFA 4AZZA 2V2HA 3U6WA 3OBKA 3THDA 4S3KA 2TRSA 1LOSA 1VFOA 1EH9A 2BY2A 2FHBA 4N9BA 2DH3A 2CBJA 2Y89A 1YXCA 3CEUA 3SIZA 4RE3A 4PH6A 3WL0A 1KTCA 5DN1A 4HN4A 4CGTA 4JKKA 3RF9A 3WDJA 3W22A 3GBDA 2NXGA 2R94A 1J0ZA 2CZDA 1PX8A 4TVDA 3O6CA 1BYAA 1HUVA 5A6LA 1ME7A 4LS0A 1F4HA 1K9DA 3NNTA 4Y6GA 5DCBA 2V3EA 2V5CA 1QI0A 1E4NA 2VZTA 5TBOA 4FF5A 4PTMA 1VHNA 3VD3A 5M5DA 2VFEA 5E1QA 4BR1A 3BCFA 4GINA 2XVGA 4C7FA 3WDQA 5I3KA 1K8XA 3GXNA 4ADUA 3UR8A 4TMCA 1SSGA 2OWWA 1U2YA 4TR9A 3M6YA 4FHAA 5A94A 2Y7EA 1HG3A 1H1YA 2O9TA 3PTQA 4LYRA 1OFDA 3W86A 5G2IA 1PIIA 1W2TA 3WJWA 5BW6A 5A1AA 5EMUA 1UD8A 3MANA 4BQ2A 1I45A 5DLCA 4K8EA 3LCHA 2WWCA 2QQWA 3PIGA 3G18A 1WZAA 4H3DA 3STEA 3SUSA 3UZ5A 3WNPA 5K9CA 2VNCA 3NPVA 2FLIA 1BYCA 3VD5A 2Z6IA 4UTKA 5G4WA 3RO8A 3KVKA 3WKZA 4UMCA 5I78A 5M17A 2WHJA 4NRRA 1W9UA 1C8XA 3E9AA 1V6WA 3MMWA 2NW0A 1K7FA 2XSBA 1QOPA 1IIHA 4DBDA 4MJZA 1QHZA 4RZ6A 4O8RA 2DDXA 2DT2A 2VURA 1ZNNA 4LUIA 1H0GA 3EMZA 4UTFA 1W31A 2J47A 3B8DA 1QHOA 2CLIA 2CU0A 2WZIA 3PBYA 2AOSA 5GPRA 1UG6A 2V8ZA 3VIFA 2HISA 3HMJG 3LDKA 1VRXA 1CZ1A 3ARVA 5FIPA 2B7NA 4O53A 4EWND 3MU7A 4H4IA 4JS3A 2G3JA 3MUY1 1TIMA 5CGTA 5FI8A 1TQXA 3E1F1 1HJQA 3U8GA 1RR2A 4C1KA 4AVFA 2XWEA 2Y7DA 3OIXA 1VJSA 3NCOA 4MVAA 1JNDA 1FHDA 3C2EA 1KLYA 3AZRA 1VH7A 5CLTA 3NO5A 3Q37A 3AHZA 1US2A 3RM4A 2CLHA 3LDRA 2V2DA 1UUQA 2J7FA 3C52A 3EEGA 1XM3A 1E0XA 4AD0A 2QDHA 3FIGA 3QPZA 2A3CA 3LCIA 5U7SA 3SI9A 2JKEA 4LX4A 3UG3A 3PAJA 4JTSA 1W32A 1IXPA 1TA3A 1VJZA 3W7DA 2ZUUA 2WMKA 2CLEA 1QI4A 1FH9A 3QMTA 3II1A 4JY9A 1GJPA 2XTKA 2OYMA 4GFSA 5AB3A 4CKQA 2F2HA 2VCCA 1FXQA 5FMCA 2HS6A 1NF7A 1JZ2A 3G1VA 1Q6DA 5FKYA 1BSIA 4BA0A 3ZR5A 2C8NA 2VL4A 2CBVA 1LL4A 1AW5A 1TPFA 3P60A 2XM2A 1V6XA 3IJ7A 2YIHA 3W25A 5FEWA 2C14A 3RILA 2WPGA 2WW5A 5I3HA 2WSQA 2VR4A 4AZ5A 3TQ0A 3UETA 1KCKA 3BLFA 1PAMA 2C18A 3M41A 3PBUA 2J7DA 3KRUA 4Z1CA 4TU1A 3VNYA 5CPMA 4OT7A 3W1UA 4FLOA 3M46A 2IXUA 1TTQA 2V2CA 3DFQA 4R53A 4ZFMA 3W24A 3TQVA 3AICA 2Z1BA 1VFFA 4P7RA 5AYYA 4U5IA 3WD1A 2ZTKA 3W73A 5IXEA 5K9XA 2QCMA 5M3WA 3TXVA 4AZ7A 1M04A 2HSAA 5CXPA 1FX6A 1V0LA 4LXFA 5D9NA 1V08A 1KXVA 3EX2A 3WUFA 2QKFA 3IMMA 1F2JA 4QAIA 1Q4NX 2A0NA 2OZ0A 3LV5A 4PODA 1HF6A 2WMGA 1KXQA 2Q3RA 3W3OA 2E9LA 3F4WA 3TA6A 1FCVA 2JKAA 1XH2A 1BVNP 1GVIA 4O54A 3I6RA 3BK0A 2PC8A 1XH0A 2GDVA 3C2OA 2FH6A 4AIUA 1GOIA 2QQVA 4OOUA 5KINA 1CNVA 2R8WA 1TUXA 7CGTA 3CUHA 2X1IA 5D9MA 3UWVA 1G4PA 1HL8A 3GYEA 1OIFA 3G8RA 2AAAA 3IAQA 4PEEA 4W88A 1QPQA 1A5SA 3LFIA 3BARA 4W7VA 3KOFA 2BHUA 1J12A 3JS3A 1KLZA 1UASA 1KQYA 3A23A 1ISVA 3K46A 5IFTA 2WNNA 3LRKA 4NU7A 4S1FA 4W89A 4XB3A 2NXIA 5AHLA 3RJYA 1KXHA 4HNUA 3PZVA 5AC4A 2J25A 4FX8A 3LERA 4WF7A 3EDEA 1JR1A 5LA2A 1HJWA 4U3AA 3OB8A 5G2WA 3GNNA 4MADA 4YCOA 1Y9GA 3FKRA 3WJYA 4N6FA 2YSWA 4H41A 4UTLA 2GK1A 5AC6A 3WF4A 3UERA 5CPLA 3RPMA 4H04A 3HPXA 3G8EA 1WP6A 5HWMA 1VZWA 1QNQA 4EK7A 1CEOA 3LHWA 1JAEA 4LRSA 2G5WA 1ZJIA 1FH7A 2QLYA 4WJXA 4CU7A 2PWEA 4V27A 1FDYA 1ISWA 1NWTA 3W81A 4D1IA 3Q58A 3LF7A 4OQVA 1GOMA 4Q33A 3L4ZA 2D0FA 2J7EA 2YKKA 1V3MA 5D2WA 3CIXA 4C1LA 1OVDA 1E43A 3B04A 1M01A 4OGZA 4QCEA 2QUUA 5EMYA 4ADSA 3QSTA 1D3CA 4FXRA 4AZIA 1AMKA 3EDFA 5L9FA 3N18A 1VR6A 2QV4A 4JKMA 4X0VA 3EXSA 1TREA 1GQLA 3W27A 3K1DA 4CCEA 1OIMA 3OLIA 2BY0A 5LYRA 4GE8A 4JEQA 4M1RA 1LRNA 1JYVA 2DJXA 4JFVA 3GH7A 2BV9A 3TSMA 5DY3A 1QW9A 4XZ9A 3NSNA 3WELA 3P74A 1HKJA 4K6AA 3C4UA 4M19A 3W76A 2G4FA 2WSRA 4E4PA 5DCEA 4OKDA 5FEXA 1C91A 4MY1A 3WN6A 3WBEA 1R7OA 3BG5A 3MSGA 5TD4A 4QIUA 3VU2A 4PMOA 1LJYA 4Z2IA 4MY9A 2J8GA 1QMLA 1BG9A 1J0HA 4JTKA 1HJSA 1Q6GA 3AI0A 3PBGA 1WV2A 4P7NA 2J88A 4JHOA 5C70A 3HIJA 3QOMA 3W7KA 1EP2A 1UD2A 1H7OA 1O5KA 2B7QA 1QPRA 2A4AA 4FK9A 4A21A 1TSIA 4EE9A 1ZALA 1KM3A 1EEPA 2EPOA 1BPLB 3FYOA 1OBAA 3EB2A 2DPEA 3WEMA 2V5BA 2ZZ2A 3THAA 1N82A 5G4EA 4GXPA 3IANA 1QO2A 2EPMX 5A6SA 5FKCA 1ECEA 1MQQA 4K36A 5H91A 3DHPA 2XVNA 1U30A 1E0VA 3ZOAA 4ACZB 1E6SM 1E72M 3W37A 1G7UA 4TMBA 1HTIA 5A8GA 2CBIA 2FGLA 5AHNA 1M7XA 3KE0A 5A8NA 1UBSA 4TVUA 1PV8A 1IXNA 2PRHA 4J3TA 1H61A 1B9ZA 3WNLA 4MAZA 4UFMA 3PBWA 4WY0A 1CGYA 1JZ8A 5E9AA 5D2VA 4B3LA 3VX1A 3MW7A 3MV01 2DU2A 4O4WA 4UMBA 3TR2A 3UXDA 4GUIA 3CPRA 1W3IA 3WK3A 4LT9A 1LBFA 1EA0A 1EO7A 4OIFA 4M29A 4QAWA 3G1YA 1RZMA 1JUKA 1UH2A 3N17A 3WDIA 4UOQA 4WXZA 2PBOA 1XBXA 2VEKA 4LOCA 3NQAA 3CZEA 2GK1B 2W61A 2H8ZA 3AMGA 3STFA 4BQ5A 1UKTA 4Y9AA 2H3DA 2E09A 1NWSA 3NSXA 2XUCA 2BXZA 2DIJA 1KA9F 4KWUA 3DYMA 3MWAA 2TAAA 2WVUA 1NF0A 4IGHA 4J3SA 3BW2A 3WH5A 4AYSA 3T7VA 3PG8A 2XFFA 4PTXA 1MXGA 4ZVJA 1TPDA 2UWFA 2Y4SA 1K03A 3OLEA 1EUNA 3ZMRA 5DELA 4U5KA 4R33A 4X0NA 3C56A 3PM6A 3GXFA 2VJXA 5ABHA 4O0KA 3I3EA 4JQTA 2WNQA 1AL7A 3KVJA 2FPTA 5DO8A 1YDOA 1QPOA 1ZBCA 2ZA2A 2QAPA 3W7LA 3BLIA 3I3BA 5A8PA 5C54A 3DH7A 2WKLA 3NOEA 5BXSA 4PSPA 1IT0A 3QSRA 2ALDA 4IPJA 4Q4KA 2Y6ZA 3S8HA 3O2LA 3VUPA 2ZZ6A 3U7VA 3W28A 2DSUA 1KWKA 2MANA 2YDRA 4ZXOA 1KTBA 3A9IA 2VCBA 2ZTJA 3NZRA 3B9DA 4MB1A 3L2MA 4ML4A 4QFUA 3ZJ7A 1QR7A 4CN6A 4HPHA 5HDRA 3TMQA 5I3FA 1EDTA 1EQCA 1UH4A 1EWDA 2GUUA 6A3HA 3HPZA 4AWEA 1T96A 4HPJA 2NX3A 3N2MA 4NNCA 2UY2A 2VZOA 1CLVA 2YLAA 3LXBA 3T0DA 4MUZA 1JNEA 1CW2A 4MZYA 4O18A 1SSDA 2WYSA 1ICQA 1R7AA 2XHYA 4P8XA 5K4XA 1BTMA 2ZUMA 3CU2A 3N34A 2W91A 3MBFA 4UR9A 2DORA 2V3GA 4D6EA 2OXBA 2WSYA 3RMEA 3TC6A 1V3IA 3TH6A 3DGRA 2EPHA 1J0JA 1QOQA 1I1WA 1WOBA 2ZWYA 4FXSA 1VFUA 3W2KA 3NDZA 1K3UA 3P82A 4HA4A 2J62A 2E6YA 2J7CA 4HA1A 3F03K 2Y70A 1V02A 2XG9A 4Z0SA 5E0FA 2NUXA 2NUWA 2WK2A 3SR7A 2XVLA 4GZJA 3VGBA 1VENA 3WEOA 4FO4A 1V6YA 3WMCA 3FS2A 4Q22A 3PZ9A 2JBMA 3UY8A 5D09A 5IHRA 2JGQA 3H53A 2O7QA 3NMBA 4GO8A 1C8YA 5H2ZA 1LRTA 1OFOA 1XFBA 1O95A 4I7WA 4JTJA 3KEHA 3KL3A 4FNQA 5ANNA 1KBJA 1UUOA 2D73A 4K7YA 2WHMA 3N9KA 2FJKA 3N73A 5EBUA 5HJLA 1VF8A 2V3DA 4R5EA 1C8QA 2QAFA 4DWSB 1NSJA 2W0UA 4UFJA 3NL2A 2ZRXA 4UTIA 4ZQMA 4P8WA 3W1PA 1SMDA 4AMCA 1ZCOA 1GYNA 5A6BD 3HG3A 1QNVA 4WOQA 1NOWA 4JL2A 5ABGA 4HU8A 3KAOA 2VRKA 1H1ZA 1IZKA 1HL2A 1UUMA 1KM5A 1TRIA 3DFNA 3B05A 1KR0A 4JTFA 3D0CA 1J10A 4AD5A 3M5YA 3ARZA 1EIXA 4IMCA 1FWWA 3GTNA 2VC6A 2VTFA 4HMDA 3TTOA 4LNYA 3LXAA 2QCFA 1LTDA 3TTQA 4ACYA 3C2VA 3M43A 1W2VA 3TTYA 5A2BA 3BMWA 2A21A 2A85A 2OT1A 5TIMA 4AXKA 4OZOA 3W38A 3MBDA 2QEZA 3KF5A 1PL9A 5DEZA 3C3NA 5FF7A 1UQYA 3MMUA 4GO9A 2DZVA 4R27A 2QUVA 4MAVA 3FLUA 2JEQA 3O6DA 4AHOA 1OM0A 4UR7A 4JTHA 3LHUA 3CT7A 5A95A 5HR7A 2EAWA 3WQVA 2ZX5A 4AZ6A 4PMXA 3KHJA 3THQA 3UR7A 1JZ5A 3R8RA 3ABSA 3ARQA 2VKZG 3HMCA 4ZQOA 3DKLA 4MDPA 4TX9A 5EYWA 1YTEA 1JXKA 1GNXA 1VLWA 2VFIA 5DXXA 3W07A 1UZ4A 2VFGA 3EBVA 2A3EA 1NWRA 4MFEA 1G94A 3D5HA 3PZTA 1M7PA 5A8QA 1W0MA 2D20A 4HU0A 3MKKA 1IGSA 2CKSA 1F74A 1JD9A 1N7KA 2Q8ZA 3DI1A 4N9EA 3GH5A 1LM1A 3LBCA 1F6KA 2FPYA 4UR8A 3TFCA 4HPGA 3QHNA 3RM8A 1JZ3A 4DM2A 1LORA 3ALGA 4MNKA 3AMCA 3W84A 3ARTA 1MW3A 2V5LA 1BWLA 2YA0A 1QO5A 1S5TA 1JCLA 1CENA 3T78A 3W71A 3VKJA 1W3KA 5BRPA 1EX5A 4XKYB 3N12A 3GLCA 1G6CA 1I2NA 3MUIA 4AMAA 1TPVA 2OSXA 4R34A 3UGFA 4PL2A 4DO5A 3WD3A 2PE4A 3GDTA 1CTNA 2IUZA 4PBGA 1NVMA 1DWJM 3UPBA 3I7SA 2ISSA 2OCZA 4JX6A 2XVPA 3NQDA 1VCGA 4O28A 3QHOA 4FLQA 4LYQA 3ZT5A 1LYXA 1V03A 3EWZA 2A3HA 3TW7A 1PX3A 3IGSA 4IISA 3AHTA 1HVXA 1F73A 4A22A 2NSXA 1J0YA 4OBSA 5JIWA 3C0JA 4GZIA 3PVFA 5I24A 1V3LA 2NT1A 1YDNA 3NL6A 3W29A 4O17A 1H63A 2WBGA 3W2LA 4JR5A 4ZL1A 3BSHA 1V7YA 2G96A 3VIOA 2CCRA 4AB4A 3T2PA 3GR8A 1W5NA 3GXMA 2NX9A 3GXTA 1CGUA 1KGWA 3S5YA 4JFTA 3BG3A 4O16A 4GRSA 2BWGA 1XSIA 3CWOX 3S5NA 3BG9A 3TOPA 2ZZ4A 4WX2A 4RXGA 1B1YA 2CIPA 4AD3A 2EBNA 4J3VA 4PEKA 2HVMA 3G3MA 4NJJA 3FW6A 2YL9A 2X09A 3FY1A 1A5BA 2JKPA 4WY0F 4PYSA 3HB9A 2X05A 4NJGA 1YTKA 5IBXC 2DH2A 5CPQA 4AC1X 1H7RA 3U2OA 1PZ2A 4CD5A 3M16A 1A3HA 1H1NA 3QHMA 4NJHA 4NXKA 2E6FA 3F5LA 3IVTA 2QMJA 2W79A 5CSSA 4EVZA 3ALFA 2ZZ1A 4AIOA 2H3BA 1OSEA 1UWRA 3EMQA 5F4WA 3SZ8A 2ZYFA 3BLPX 1JZ7A 3BAJA 4YLWA 3ZSSA 2VCAA 3JR2A 3PC0A 4AF0B 4GJ1A 1R47A 3MHFA 4YXGA 2Y88A 1UR1A 4N0RA 2GJNA 3GX9A 1M6JA 3NQVA 1EDQA 3AS2A 2AEYA 1OT1A 2F7FA 3L4VA 4NRSA 2GVJA 2DSVA 3RDKA 4AD4A 3QZEA 2ISWA 4N4QA 5FEPA 2DT3A 4PTWA 5FF3A 1VB9A 2XSAA 3R13A 3S1WA 2W66A 3FXYA 4K68A 4WOZA 3RWKX 2BHYA 3PN8A 1K7XA 2AEZA 1BG4A 3S5OA 1E15A 3NQMA 5CPNA 4URIA 2B31A 1ZJAA 2YOCA 3S1XA 4QSHA 1HKIA 1H7NA 5FCZA 5AHFA 2EF9A 1W37A 1KQZA 2J78A 3C2RA 3S6TA 3VMPA 4E2OA 2XJ7A 1LDCA 5DMYA 3AS0A 1Q6CA 5AYBA 4HHPA 1EOKA 4JNMA 1E73M 2GVYA 2JGYA 1ST8A 2CZEA 4CU6A 1XD1A 3J7HA 2ZXBA 2PURA 5CLWA 1H7XA 3KL0A 4W84A 4UQDA 1SO4A 1TB3A 4MYAA 4WQ6A 1BWKA 3SEPA 4FNTA 8CGTA 3MI2A 4HT3A 2GJXB 4DM1A 1PCKA 2QF7A 4O15A 5D2TA 2WVVA 3PF3A 4E2DA 3NJ3A 4NSBA 3MS8A 1XBYA 3UG4A 1AW2A 3SGZA 3O6YX 1W9XA 2V82A 2Y63A 1HXJA 1QNSA 1SMAA 2VZSA 1DQXA 1JRBA 1GVQA 1XDLA 3GR7A 1U83A 3VIPA 2NLIA 4QM1A 3O07A 4KFPA 5C5YA 2X1TA 4KGLA 2ZA1A 4V28A 5DT5A 4GUFA 5EB8A 1DEDA 2ZX8A 3BMVA 1KFJA 2J9YA 1WCGA 4H6KA 1SPQA 4HOXA 3EX6A 2YA2A 3VE7A 1PS9A 2E77A 2ZUWA 4P8VA 3N14A 5EBAA 2J24A 2ZE0A 3ZR6A 4BWLC 2EPNA 2ZRVA 2ZRUA 4UTTC 3GK0A 1W91A 4I7UA 3S5QA 3CZJA 1R30A 3SUTA 3VO0A 4OU1A 1PE1A 2BY1A 3W1QA 1UD3A 5I77A 3FJLA 3LBMA 4B9YA 1Z48A 1N8FA 4JTLA 3TNOA 3GH4A 5A6MA 4JYDA 4M5PA 1OF8A 3NZ1A 1X6UA 1YPIA 1UWUA 1KM6A 4K37A 3M44A 2CNCA 2QR6A 5ECUA 1KM0A 1R87A 4WKHA 3SIMA 3WK1A 3AJ7A 4PTNA 1RPKA 4GC4A 5K2ZA 2X0HA 4YWIA 3O6AA 4LPCA 1J0IA 2D3LA 1XHGA 4BQ3A 3LIGA 2Z0IA 3CQ0A 3M9YA 3AROA 1MSSA 4OBRA 4O14A 1D9EA 1JDDA 3TROA 5HXMA 1US3A 1WNOA 1W1TA 3WDRA 1E3XA 4F66A 4ZENA 1TMQA 2D23A 4JX5A 3W7GA 2DT0A 4DQWA 1VEOA 3GAKA 3KXQA 4Q32A 2W4XA 3PZQA 3VGEA 7TAAA 3HJZA 1CX9A 3CEPA 4PC8A 1DKWA 1SW3A 4GWEA 1Q6RA 4FNUA 3EKZA 3F4NA 3M07A 1G67A 4XBSA 4CNOA 1OK4A 2WM0A 4OV4A 3A21A 3HPSA 2VX5A 3AXXA 3LMYA 3CH9A 2IQTA 3VIHA 2B0MA 2C1HA 3AIUA 3W4RA 1H5VA 2CEQA 4RZ4A 1F4AA 1PX4A 3PG9A 2Z2UA 3E49A 3FOKA 1E6PA 3W7QA 3BC9A 5HQEA 3O8AA 1H51A 1HFBA 1W9VA 3L5LA 2C0HA 5D32A 5MHBA 2CW6A 1E5JA 2J7BA 3BH4A 2WXDM 4D72A 2QQUA 5AHMA 4FNSA 4IOTA 4X9SA 4BI6A 5D8ZA 1DORA 1JG9A 4ICNA 4EAMA 2WVVB 4EANA 1CECA 3ANYA 4JFUA 3MP4A 1KBIA 3DU0A 1BVZA 2BVDA 2E9MA 3F1QA 2WLYA 1OX4A 1UYPA 5HNRA 3GDLA 4B9ZA 1KM4A 3BAYA 2WKGA 1H60A
chains in the Genus database with same CATH superfamily
1B3OA 4HNVA 3MI3A 3OHIA 4AHZA 5D37A 1Y4WA 4NUWA 3WG3A 3O12A 3ZKYA 4TUFA 4E5TA 4Q8VA 3WG2A 2D6PA 5C9AA 1UOJA 1SZRA 1GZCA 3APYA 4M3PA 2ISFA 3ZN6A 5LZLA 4IGSA 3EWDA 1LG1A 5KC5A 2QZRA 1MACA 2ADEA 4LWWA 1X7IA 5C9UA 4XWUA 1ASJ1 4O13A 4TTGA 3P81A 4PT6A 4RSUA 3DC8A 4YWSA 4D6CA 3MYOA 2VOTA 2E5DA 1LGNA 2WDBA 5A6BA 1GVSA 1XG4A 1XYNA 4GGBA 4IV3C 4MYXA 2BXYA 3RWNA 2G9ZA 4HBNA 3YPIA 2EPKX 1D7FA 4C6JA 1RXFA 4FXKB 3PTKA 3O1OA 5DZEA 2GP3A 3L4XA 3C7HA 4H9YA 2DP3A 1MVYA 2L9LA 4PQQA 4YM0A 4G7EA 4CVUA 3BYWA 1ZAJA 1ZRDA 1EAH3 2F6XA 2F84A 3S1UA 4CN1A 4P08A 5L7OA 5FKBA 3VC6A 2X29A 1MFUA 5G2HA 5LATA 3W26A 5BNPB 1B35B 1P0DA 4IIBA 1OSGA 3WW1A 4WJEA 4P7OA 5DQ0A 3RRAA 4AIBA 2FDFA 4AHWA 4MWAB 4GABA 3UVAA 1YE4A 5DUVA 4CP2A 3I10A 1Q5OA 3GTIA 2QQMA 5M03A 4AD2A 4F40A 1GV9A 1RGSA 1MS1A 3HPNA 3G0UA 4GKXA 3LPFA 4M56A 2IXKA 4J25A 2GDUA 1K6AA 3AJXA 4A3ZA 4U31A 4H8UA 4MJ4A 4JAWA 4X8NA 1XC6A 2GVLA 3KTSA 3AHXA 1MUMA 1TPUA 1Q2SA 3SNMA 5HMFA 4R9OA 1OD0A 2E5CA 1N1TA 4UCFA 2OIIA 2CLPA 4XPVA 4AFCA 2PDUA 1EOMA 4M6PA 4RPQA 3MDPA 4G6CA 2CSGA 3OGSA 1NOVA 1C92A 4N43B 1VFMA 3TTSA 2LALA 1DQWA 4S2HA 4ZTYA 1NDVA 3A3XA 1LOQA 1EC8A 3LDBA 1GZ9A 1P7TA 3FEQA 1XH1A 2ACQA 1FDZA 1RVGA 1J58A 2YGLA 1RD5A 1XXXA 3MZHA 3LNMA 4Y90A 1ZRFA 3HM7A 3CMJA 2VGFA 2O8QA 3PY2A 4CD7A 2J6XA 2XH4A 3EPOA 1ZBA2 2I14A 5HI0A 1GQIA 3NQEA 3NR0A 1DHKB 4GI6A 2VGBA 1OABA 3J7LA 2XH0A 1MWOA 4HN1A 5FR3A 1TPEA 2HMCA 2B46X 3SXWA 2UBPC 2VR2A 4CCCA 3CL6A 4YTSA 1GVOA 3POHA 3ZSMA 3P8IA 1UMYA 2NQ5A 8TIMA 3H3ZA 2WZHA 1V00A 4FOUA 3L4TA 3MEPA 4RN5A 2W9MA 3KBSA 4DEFA 4YZ2A 1GOGA 1PVC1 4YL2A 2OEMA 3LTYA 6CGTA 3PIJA 5BNQA 3RJXA 3LA4A 4A41A 1KRAC 3W2UA 1Z6KA 5B4NA 3SY1A 1XYPA 1WZMA 2QULA 5CB7A 4ZE4A 3K77A 4DY1A 1A8DA 5FZHA 1O4TA 3LTSA 1D2SA 5CC6A 2FVKA 4LAMA 3ITGA 4LEQA 3W6LA 4CE8A 4W86A 2IC1A 2IZWA 3PBVA 2H9AB 2INFA 4YG0A 3GCWA 2YXGA 4YGEA 1QW8A 1SW7A 1P4CA 1FWGC 2BGNE 1QTWA 2EAKA 4Q4SA 3UU0A 3TRSB 1CZSA 5T9BG 4A7YA 3W7RA 1O6UA 1CI1A 1ZL1A 3ZYJB 4HHHA 1MXDA 4N53C 1PKLA 2FFCA 3WCRA 4UIOA 5DFAA 3T30A 2ZA3A 4BI7A 1YEYA 3MLJA 2VENA 2W67A 5F2LA 5JOZA 3KSCA 4XTIA 1K5JA 4XXPA 2XIIA 4ZOBA 4W50A 4IEXA 1FHLA 3TVAA 3VK5A 5BRBA 4JL1A 3G0XA 2R071 4WBBA 3TUUA 4Y9MA 1OF6A 1AQMA 2Z29A 1IF2A 3DN7A 4OV9A 4QITA 2PD9A 2QDRA 4NZJA 4WKAA 1XBFA 2NXHA 1PHQA 3Q8FA 2OLHA 1XWYA 2O9OA 4ZFCA 2EIBA 5HATA 4DJFC 3URBA 1G9FA 4RZ5A 1NFGA 1IIGA 2ZOEB 2IXJA 1W9PA 5C8BB 1E71M 6ALDA 5I3JA 2OO6A 2VRJA 3A5VA 3SAZA 1H2LA 3RZJA 3AIBA 4AWDA 4XFAA 3TC7A 1WE5A 4KRUA 1JZ4A 4EWDA 1VYPX 2WJEA 4E3TA 2GYIA 3NL3A 5C2CA 1UQXA 4GX9A 3GY1A 4NHVA 1HJFA 1VFHA 2YHJA 4ZGYA 1RJ7A 4CLMA 1V6IA 4WGXA 5I23A 1XV8A 1HP5A 3KV6A 2QUTA 1TMF2 4HMNA 1UZHA 3LD8A 1E6ZA 3AIEA 3ZYHA 2P1FA 1FWDC 4AW7A 2FZMA 1PO12 2O0OA 5IVFA 2WS92 4IMEA 4Z0JA 1HQTA 4RL3A 3UZJA 2ZMLA 2W3ZA 3WLQA 2OOGA 3QOKA 5BXRA 1Q6FA 1NP0A 4DI9A 2WNUA 4AX6A 5A6YA 3N2TA 3LWCA 4S3DA 5IBXA 1S5WA 2DQXA 2V5YA 3LZ5A 3AUOA 3D6EA 4OYUA 1O5UA 2G3IA 3LLDA 3VOIA 4IPNB 4A3UA 5C3RA 1Z7S1 5IVVA 1R093 1AQ0A 1SR9A 3T2QA 4I90A 2AL2A 2R1LA 5TSWA 4DLMA 2GJLA 1ZHAA 5JH1A 1W3TA 2VEPA 1RQEA 4GACA 4CTEA 4H9ZA 4JCLA 1PZ1A 1BF2A 2RUSA 2ZFAA 5JZGC 2PP0A 1R85A 1N3OA 1J01A 1FT9A 3H7RA 4AQ6A 1HJUA 2XM1A 2WV8A 1FHUA 4E3VA 2E6DA 2UY3A 1XF0A 1ASJ3 2F38A 4TWTA 2E7FA 1VBA1 3CZLA 2NVDA 5BOFA 2HZGA 2XIJA 1EC9A 4AF0A 3C86A 5E70A 4E2GA 4XACA 1MYRA 3RLVA 3KP1A 3LYEA 4PTDA 4M3CF 4COVA 2Q0AA 3QMSA 2ABAA 2WQPA 1ZRCA 1LCOA 5JI7A 5KEZA 2QPUA 3WBXA 2F8QA 4PSRA 2W68A 4JX4A 4D71A 4BISA 2Z24A 5FK7A 3UZZA 3MP5A 5GZDA 4A6OA 1YXWA 1AQHA 4YVSA 2J13A 2PTMA 4IT1A 1IEIA 2GJXA 4IIGA 2ZICA 5D33A 4L61A 1RY8A 1EJUC 4QX4A 1U5IA 3GVGA 2A79A 1YC61 3N9LA 4ONUA 4B29A 1C7TA 1NFBA 4US6A 3NVDA 1W9FA 4M80A 4KI5M 1JD7A 4FB7A 3GXDA 2CERA 2XYLA 3GVWA 3S7IA 2FIQA 3TXZA 2Q3OA 4Z82A 1VMFA 4YTUA 5KMYA 5DRCA 1AJ2A 3M0YA 1IS4A 1W1ZA 1GVFA 2RMU1 4EPDC 3CLWA 3A12A 1OFAA 4ZBCA 1KFCA 4XBLA 1OFNA 3SQOA 1DJYA 1NXD1 4IXHA 1JL8A 2WKKA 1P43A 3C8XA 4MNMA 2CFFA 1NX9A 1ZZ9A 3NQBA 4XW3A 4XQ4A 3ZXFA 3W7OA 1NWUA 3NFUA 3WOGA 4N6EA 1LBLA 4NAEA 1JXJA 1TTIA 3QY6A 1W3XA 4MZUA 2PU1A 4RFT0 4A3QA 3IJ8A 1CAXB 4JTIA 1SW0A 5HMEA 1QJFA 3ZYGA 2XIBA 3NQ2A 3NRUA 4MGIE 4QB6A 4L9YA 2YU2A 4FMVA 1F3EA 2RR12 3W2NA 2ZMKA 4QGCA 1IPKA 4YWAA 1H5YA 2VM9A 2D3RA 2PP3A 3UNDA 4OHZA 1S2AA 2PF0A 5JI9A 1REQB 1OD5A 3UR2A 3UYCA 5CJMA 3NPXA 1J3PA 4RE2A 3POWA 5DBTA 4ES8A 3ITCA 3QRHA 5D21A 4Z2KA 3ZPOA 5HV0A 1QAPA 2WO7A 1PVC3 1E0UA 3VNDA 1DTUA 4PI2A 3WF1A 2LS6A 2XGXA 5HWNA 4P7LA 3DFOA 3SJ3A 2PAJA 4GYKA 1QK2A 2R042 5CPTA 5GVJA 1XNDA 3VMNA 1VP6A 4YN5A 1KFLA 4QRNA 4I30A 2W1QA 2ZAAA 4A45A 2C13A 4ZQRA 3H24A 1UMIA 1P1XA 2WSKA 3AFGA 4B3NA 7XIMA 2TBVA 2YFZA 1YJKA 2O14A 3BKZA 3KL5A 3L5AA 4AIEA 2WR9A 1H50A 5E09A 3IVUA 2CNAA 1OEPA 3EZ4A 1H6YA 4GH3A 1SBFA 3NTYA 1HIZA 1SBEA 1TMHA 4MZ1A 1LWIA 3H3LA 1U5YA 3M1ZA 1VEMA 3WF3A 2WPBA 3B8VA 4MPKA 3WY1A 4B3LA 3HU7A 1V6NA 9XIMA 3R25A 1CBGA 2GC1A 4NQ1A 1E4MM 1FDJA 1VBGA 4YG3A 3IDCB 1ZRRA 1NA1A 1PNGA 2R073 4JGDA 2J7MA 4KWLA 5CGQA 3T3YA 4E27A 3CJIB 4UW4A 4ATLA 4ATWA 3ZFGB 1XGZA 4JPGA 3R7MA 1W5OA 3T55A 2R1KA 4UCGA 1GW1A 4YW6A 1BVWA 1S3HA 3HNMA 4Q8QA 2VVDA 5KITA 3A6OA 3AZTA 4E8DA 3WP4A 1T41A 3ENLA 1HXS1 5BPXA 3ZFFA 4P8UA 1TV8A 3ZSTA 3OVQA 4MLOA 1KV8A 4UFLA 2BNJA 2GNBA 3RI8A 1KDMA 3QH2A 1EYEA 4ILSA 5I8SA 3CTLA 1A78A 3GG7A 3PULA 4GUJA 3U2ZA 5EFFA 3VINA 1E9LA 3UD6A 3DECA 2AC1A 1X50A 4JDBA 3ACIA 5A3HA 1J79A 2PHRA 1XYBA 3F4VA 1H4PA 2CLFA 5CKMA 4NHLA 1JUBA 2QJNA 2BLEA 5E6YA 2VRQA 4FNRA 2ZX3A 5LHEA 4D6RA 4ES9A 1GU3A 3W75A 2YG0A 4CEWA 3ITOA 4GMP1 3OA5A 2B7YA 1W6QA 1BEV1 3KGLA 2FDMA 4Z2GA 2C16A 3T1LA 4PMDA 2IFRA 3W88A 3CUFA 2W5FA 1EUTA 3BALA 4Y4YA 1ITXA 2OSYA 1XRSA 1JPDX 1SZFA 3HQOA 4RE0A 4IUOA 3PURA 2PFHA 4NI3A 6XIAA 4Y33A 3QW4B 4FFHA 4Y1UA 5AVPA 4SBVA 5BCAA 1M03A 1PIGA 2X8KA 1QHDA 2CHHA 3MTWA 6TAAA 4LA2A 3AO0A 2R1BA 4Q4W1 1ZP3A 1FWTA 2R6OA 1XIHA 4FOYA 3EKLA 3MIDA 1QJY2 2XQXA 2V9DA 2MEV1 3SCVA 1YW1A 1YE6A 3VBUA 4PMYA 2OQ6A 3AXEA 3TP4A 3KRBA 3UGVA 2P88A 1GICA 1HLCA 2WM1A 1VBA3 3I2JA 2GH2A 3DYOA 2QF8A 2Z1SA 4IP4A 1GONA 4DEQA 5IVCA 5JMCA 1RBLA 1PYMA 1Z89A 1EP1A 2CPUA 4BZ4A 4AEDB 4PQ9A 1RUD1 1YTDA 1R5YA 4FP2A 4GY7A 2GUYA 2ZHMA 5EQUA 1OINA 4KPLA 3SRFA 5AHEA 3I4EA 5LBFA 1A5CA 3CIWA 1CVNA 1QNPA 3V5OA 1S0DA 4PRWA 3NVCA 4GUHA 2NT0A 1UR3M 1XYFA 1LT8A 1SZGA 5C9RA 1APNA 1VALA 4BEUA 3LI1A 5FF2A 1A0EA 1VBD2 3NEVA 3NO3A 4MLRA 2X5IA 3HBLA 1Y65A 1V6UA 3VKKA 1GZJA 3WD4A 2JG8C 2I07B 2ZGTA 3GKAA 1E1CB 2PF8A 3SFWA 3OBTA 2WCSA 1RBAA 3LHZA 2C6SA 4IQPA 1SFSA 4D6IA 1Q6QA 5FY5A 3VOCA 3WUCA 3UCCA 4W93A 2E40A 4O11A 4XMAA 2GGEA 3WQDA 3W1MA 2VOVA 1YXYA 2ISVA 4B5NA 4BM8A 3LN3A 4GQRA 3T8LA 2UV8G 5FZBA 1AL22 2X1UA 5CFDB 5A3MA 5FF4A 2XGZA 2YX0A 3KLKA 2RMU3 4LKEA 2QHAA 4AR2A 3REQB 3WT3A 2YPJA 5EYYA 5ABJA 3M3CA 4Q4MA 1A5LC 1Q8JA 3DFPA 3DBPA 4TO8A 1RP9A 3L4WA 5LNVA 2G9GA 3HGRA 5FMOL 3TB0A 3LEMA 1SJCA 1M7OA 1CAUB 3MLLA 3KBJA 1D2QA 4C1XA 1E4LA 3L23A 4JYFA 4BF9A 2WKJA 3AYAA 2QDEA 3M7WA 5J5DA 3AZZA 5BNOC 3E5UA 2FTPA 1QW7A 2D97A 4J3XA 1KFWA 3OCPA 3HG4A 3VXGA 3BTZA 4BLJA 4CDXC 5A6JA 1MW1A 3NVTA 3FJ6A 3MCNA 1ZB5A 3IAPA 2WZ8A 3M46A 2D24A 3T09A 1VCVA 2OKXA 5FA5A 4L0PA 1AJKA 4QQLA 1ULFA 3P14A 1BGGA 3VGDA 2PDPA 3K8MA 4KFOA 2B7OA 4FX6M 4JGYB 1KITA 3SCSA 1DIWA 4HONA 3IJ6A 4UTUA 4PIXA 1J18A 1MMFA 3U2EA 1COV2 4I5UA 1JYWA 2BYVE 1SR0A 1PXGA 2E3ZA 4Q8TA 4I8YA 1WMDA 4ARXA 2A7NA 2WCGA 3SCNA 2VMFA 2P0IA 4B5VA 1DV7A 3MZ2A 5E16A 3PUSA 2CXEA 3VPLA 4K40A 4WD0A 4NZ3A 1EXBA 2ZOXA 4NT0A 1BVVA 1BQPA 1L9WA 4YPJA 2VZQA 2ZHNA 2OZJA 3EDKA 1S5MA 1S2UA 4BPZA 1CWYA 3QBUA 1KS5A 3HAGA 4FFGA 4CCMA 5CCZA 3FA5A 1O5XA 2X8RA 5DT7A 4W87A 4IDZA 1CZTA 3QQ0A 4RDVA 4Q0PA 5I79A 3ZMNA 1JDCA 3O9NA 2Y24A 2PDFA 3KCYA 2DCKA 4KCWA 2KD7A 4K7VA 2UY4A 3G1DA 1DWIM 4JTNA 3GC5A 4HZFA 2R91A 4HNCA 4ASLA 2PWGA 1TZOA 3FE5A 1LQ0A 4AQTA 1EYBA 4FZIA 1X6LA 2Q71A 2YL6A 2DUQA 3V1PA 1W06A 4FF7A 4QU1A 3KM5A 3UT0A 1NOFA 1FWRA 1Y7VA 3Q8AA 1P1MA 3UJEA 4KWOA 4A3HA 2Z25A 1RK5A 1PMHX 2Y62A 1XW8A 3D3AA 2WZPP 4NHXA 1M9HA 1F9CA 1RVF2 3PFMA 4H2AA 2Y5JA 3S4TA 3VVGA 2K9ZA 5GZGA 1MS9A 5CU1A 3JXSA 2OG9A 2VOWA 4W7UA 2D1ZA 3LEGA 1LBMA 4GOAA 1DYSA 3ARPA 1EY2A 4D94A 1QFEA 2A71A 3FA4A 3M3EA 1VBB3 3NNFA 3L0KA 1R86A 3CU7A 1OX5A 1U1UA 4UF0A 4LYPA 4MKVA 4AI9A 2P1BA 4A2RA 3NIYA 4OJYA 1WD3A 3NAVA 2ZGMA 1GKQA 1L0PA 1UKOA 5LNRA 1VAKA 2QNEA 1WCDJ 1DE5A 5ANQA 4GMP3 1AH4A 3FYPA 1BEV3 3DXIA 4URAA 1M7JA 1G0CA 5FL1A 1UKQA 5T91A 3UEQA 3M0JA 4QLJA 3O3RA 4QDRA 4HIBA 1WW5A 1X36A 1E1EA 2OA2A 5FJOA 2VOKA 5ABFA 3VGIA 3NSMA 4XUOA 1KRCC 2WNZA 3FDGA 4IE6A 3OZOA 3QTGA 1BKSA 3JD71 2ZGUA 4PFMA 1W1VA 3LB0A 5CBJA 3A7QA 3LIHA 2WL1A 4UBHA 2DUXA 3AXMA 2YGMA 2ZZQA 1XICA 1OGGA 1C3HA 3IWZA 4C6CA 2XN1A 1R3VA 1JPIA 1SGJA 3W74A 4FEZA 2MEV3 4TLFA 2WNVC 4ENLA 1TVLA 3PLQA 1ISZA 4CQ8A 3NQ7A 4C5ZA 4O9GA 1EHAA 1UXXX 3ZSJA 5A80A 1WQ5A 2PSNA 4XK2A 3HG5A 4RS5B 5IVBA 2HVOA 1L6WA 1RUOA 4IETA 5I91A 1W6OB 1R081 3TNPB 4DRVA 1TZ7A 4OMCA 1CGVA 3WH6A 1JHJA 1UIOA 3OYWB 4Y20B 2GJPA 4YMZA 2D3NA 4G4FA 5FEZA 1N3PA 3D0JA 1W9DM 2G3MA 2QJHA 3GHRA 4YVWA 1W3VA 4PCRA 4KH2A 3UXLA 4EJRA 2KXLA 1J83A 1POV3 1HB2A 3VDDA 3N19B 1W8SA 3C2FA 4WZHA 5F2MA 3N4EA 1TTJA 1R9XA 3CYVA 4H8NA 4R3UA 4QDWA 1KXGA 3W5MA 4LITA 3NV1A 4PUEA 4EN6B 1CXLA 4YYCA 5CEWA 1VQTA 1RTVA 5DX7A 2TUNA 4HNLA 3BJSA 1VYSX 3IUHA 2ZCWA 3I68A 3VGFA 1JF6A 1ODZA 1G9HA 5DF0A 2Z6JA 4GNJA 3AZSA 2YDEA 2VR5A 3CGTA 3W7NA 1K45A 1Q2RA 1JUEA 1F6YA 4M00A 1ZZBA 3MP3A 3OSDA 2NM1A 2PWUA 3A5FA 4AWTA 1MS5A 3I59B 4EPBC 3N3MA 3DAQA 3B4YA 4F48A 1RQBA 4PIZA 2FQIA 4A29A 4KU7A 1XIIA 1DJXA 1PSCA 3DF0A 3CIVA 3EDDA 1ITUA 3W00A 4JN7A 2E53A 3I65A 3WQPA 1X9TA 1E40A 1M41A 5CZSA 4XHXA 5LB6A 1AUSL 2WA4A 5D8AB 5LIKX 1OFEA 4IV1B 3T6CA 4Y9PA 3RN6A 3HQ1A 4P61A 1K9FA 2OSWA 4GH4C 3U78A 3AXIA 4KGJA 3SQLA 4TVCA 1UWIA 2OYLA 4XJZA 2NQZA 4JIEA 2VC7A 4B4QA 3ZWSA 3N6QA 4L2NA 1L3JA 4UWMA 1F05A 3WLMA 1V51A 1RUH2 1VB2A 4C0BA 4CDWC 4HOZA 3MUAA 1PO21 4P7QA 2QJIA 3T2OA 5FZCA 3G6MA 3WIJA 2AH2A 1RUC1 4XZHA 4JGZC 1KKRA 1OC5A 1H3GA 2GSEA 3TIMA 3M0HA 2QCDB 1B3YA 1B90A 1X1ZA 4ZR8A 1BEUA 1RUF1 5GZFA 1EAH2 1RCXB 2C1FA 1XSKA 1CQ9A 4MLJA 1ZZ8A 3B01A 3TN6A 3VDBA 2ILMA 2YBUA 4M6VA 2XLFA 3FEMA 4IXXA 3LCFA 1VYRA 3HGJA 3EWXA 4ONVA 5FXVA 4FPFA 2RFGA 4Q4X1 1ADSA 2V2HA 5FZ0A 1LOSA 2FJUB 3XIMA 3A4JA 1FPN3 1YXCA 2B8MA 3CF6E 2BNOA 3FFQA 1DFQA 4CGTA 4JKKA 1DGLA 4P9JA 3GBGA 3O6CA 5EHDA 1ME7A 4LS0A 3P6LA 4YG6A 1K9DA 3NNTA 4Y6GA 4AI3A 2V5CA 5M5DA 5TBOA 5IK7A 3R4UA 3VD3A 2VFEA 2BGQA 5CA6A 3UR8A 1MS8A 2JB8A 4IFRA 1Z3NA 1SSGA 3HQUA 4XIAA 4TR9A 4FHAA 1XLEA 2AGTA 4LYRA 1ZCCA 1UD8A 3MANA 3P1IA 4CDUA 1I45A 4K8EA 3LCHA 3K2GA 3T8QA 3PIGA 1O68A 1VLNA 1KCXA 1MQTB 3WNPA 4CNUA 3RR1A 4UTKA 4D8MA 5L19A 1XB9A 3RO8A 3KVKA 2CWXA 2EVXA 5BUVA 3R8GA 1NCRB 5M17A 3R4DB 3WQBA 2WHJA 4KW2A 3VNMA 4NR1A 4MYEA 3POEA 1V6WA 3MMWA 1K7FA 4GXWA 4ARYA 1QHZA 4MJZA 3OD4A 4UTFA 3VKAA 7REQB 3B8DA 5FTTC 1QHOA 2AOSA 4W6YA 4RW5A 4TV5A 1CJDA 2V8ZA 2HISA 4O53A 1GNZA 3VBHA 3MU7A 1YQ6A 2G3JA 3MUY1 3VA8A 4ZB2A 5DAPA 4C1KA 1DU3D 2BU9A 4IIHA 4QB1A 2Q8CA 1IWBA 1VJ2A 1WW7A 1FHDA 4IHCA 2CDPA 1XIDA 5TF0A 3RM4A 3OD0A 2CLHA 3H1MA 3RUBL 3JD73 3EEGA 1XM3A 3FJ4A 1DJGA 4AXOA 2A3CA 2VDGA 3KBMA 3PAJA 2TODA 2ISDA 1QI4A 4GYFA 4S3EA 2HK1A 1UO9A 3TEYA 3QMTA 2AL1A 3PJYA 1L8PA 2F2HA 3LENA 3UJSA 4E4HA 5FKYA 4GD4A 4PLNA 2PLV1 4DWDA 1QUMA 1LL4A 1AW5A 5F3CA 3TN5A 5FZ6A 1V6XA 3CQJA 4H7ZA 3IJ7A 5IUQA 4MGGA 3RLHA 3Q4DA 3RILA 5FYTA 4CEYC 4DXSA 5I3HA 5F3GA 4HFSA 2WSQA 2KA3A 1R083 3TQ0A 4B2DA 1PAMA 3IUIA 1XPGA 4Z1CA 4FPYA 3ZYIB 1YBQA 3W1UA 2ACUA 1PO9A 1SQ4A 1AYM1 3MIFA 3BANA 2GAUA 1TTQA 2V2CA 3TQVA 4A05A 2Z1BA 2DV9A 4V1XA 4U5IA 2ALRA 1J3QA 5IXEA 1YFYA 5M3WA 5KHKA 3TXVA 1M04A 2I17A 2HSAA 4AZ7A 3FSTA 3WUFA 1U5ZA 4LXFA 3MF9A 3IMMA 4QAIA 3S5SA 5LZ6A 1Q65A 3LV5A 4PODA 3D0SA 2ACRA 2WMGA 3F4WA 3TA6A 2CWSA 1H1IA 3ASIA 2JKAA 4KQNA 1XH0A 2JDPA 3VKMA 2NZ9A 4AIUA 1H4GA 2HXTA 4DJFA 2V5KA 1GBGA 1OH3A 4B92A 3CUHA 2X1IA 2W52A 4H00A 1OIFA 5D9MA 4GGHA 1IEVA 1QPQA 2QGHA 3BARA 3MPGA 2O4QA 4Y1ZA 3M7AA 1J12A 3QZAA 3H42B 1V9U1 2BOJA 4V2WA 3A23A 1ISVA 3K46A 5IFTA 3B0YA 1VP5A 4NU7A 2ZE3A 4W4QA 3URAA 3RJYA 4HNUA 4FX8A 2ZGOA 3FBYA 4DJED 4LIVA 2RS32 5LA2A 3VKLA 2HWF2 4U3AA 3ORJA 5G2WA 3GNNA 3H1WA 2RV9A 2BBVA 1Y9GA 4M4PA 3UP8A 2XIQA 1SCSA 2F6BA 2AR6A 1BJQA 4CRQA 3RLGA 1WP6A 5HWMA 1VZWA 2FZ8A 1SPPB 4QM9A 1JAEA 2IKJA 4AEMA 5BNPC 1B35C 4V27A 4JNYA 5J37A 3ICJA 4MWAC 4JQ4A 6ENLA 2J7EA 1R092 3FJSA 2VMDA 5D2WA 4HVOA 4ADSA 5K0UA 5J04A 3DESA 1W05A 3EDFA 5L9FA 4X0VA 2RDXA 3EXSA 1GSLA 3AWOA 1GQLA 4KEUA 3VOJA 3W27A 3PMSA 3K1DA 4CCEA 5K9YA 5JLVA 2BY0A 4XTMA 4JEQA 4M1RA 2QKDA 4XAGA 3JQXA 4QBXA 3TSMA 3V0AA 1QW9A 2QGYA 4XZ9A 5I0TA 3MB9A 4HN8A 4M19A 2WSRA 4K21A 5FEXA 1C91A 3OGJA 3H12A 5TD4A 3DKWA 1ASJ2 3H26A 1R1A1 2BWAA 2PD5A 4MY9A 1BG9A 3BLDA 1NU5A 2XUEA 1WV2A 2J88A 5C70A 3QOMA 1UD2A 1PO23 2RS51 1TSIA 4EE9A 1EEPA 2EPOA 4YFWA 3FYOA 1SG3A 2DZAA 5FPBA 1N82A 3THAA 3EBRA 1RUC3 4GA8A 3IANA 1BYHA 4UW5A 2BV4A 5K8SA 1MQQA 3DHPA 5H91A 4KCVA 1W8OA 1E72M 3VN4A 1JCTA 1G7UA 1HTIA 4LO6B 4XOGA 3KE0A 3KLLA 1RUF3 4TVUA 2WNOA 1F35A 4MAZA 1CGYA 4UFMA 3RYRA 1K5MB 1QXPA 4RHV1 2PAEA 2DU2A 4O4WA 3UXDA 4OIFA 1EO7A 1W3IA 3CPRA 4DBUA 3UNTA 2VZRA 1JUKA 4ZXEA 1UH2A 1WMXA 2X7VA 4WDWA 5A32B 4WXZA 4MHBA 1XBXA 2VEKA 1O7FA 4M0NA 3CZEA 3VBFA 3STFA 4Q4X3 1UKTA 1YCIA 3AYTA 1D4M1 4GVGA 2PGRA 1Z78A 2XUCA 2DIJA 3MWAA 4IGHA 2QT3A 4D7SA 3FVMA 5HMDA 2ARCA 5A7WA 3GZTB 3I2DA 3ZIXA 3ZYRA 5GM0A 2Q09A 1GQPA 1NE4A 3BLOA 1TPDA 2Y4SA 3RX2A 3OU8A 1IGWA 1EUNA 4A3XA 1MDLA 2VDIA 3OLEA 3ZMRA 3GXFA 4DRSA 2VJXA 1VRH1 4O0KA 3I3EA 3BTAA 1AL7A 3VLBB 1TE6A 3KVJA 4QKBA 1OXCA 1GOFA 3BLIA 4S2GA 4CQDA 5C54A 3NOEA 5BXSA 1W2UA 1IT0A 3NOYA 3TNBA 1EV11 4AFBA 2O56A 4FSAA 2DSUA 4RFRB 5FACA 4ZXOA 3A9IA 2VCBA 5FZ8A 1Q13A 2FHRA 2XZ7A 2ZTJA 5FWEA 1K1DA 3W59A 2GUUA 3HPZA 3FBMA 4DB7A 3N2MA 1CLVA 2W46A 1UXZA 2KAUC 1SSDA 1R7AA 2ZX1A 3RMEA 1V3IA 3TC6A 1AR71 3WW4A 3DGRA 4IJCA 4XYXA