4UFIA

Mouse galactocerebrosidase complexed with aza-galacto-fagomine agf
Total Genus 211
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
211
sequence length
644
structure length
641
Chain Sequence
b'GAYVLDDSDGLGREFDGIGAVSGGGATSRLLVNYPEPYRSEILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYELDENYFRGYEWWLMKEAKKRNPDIILMGLPWSFPGWLGKGFSWPYVNLQLTAYYVVRWILGAKHYHDLDIDYIGIWNERPFDANYIKELRKMLDYQGLQRVRIIASDNLWEPISSSLLLDQELWKVVDVIGAHYPGTYTVWNAKMSGKKLWSSEDFSTINSNVGAGCWSRILNQNYINGNMTSTIAWNLVASYYEELPYGRSGLMTAQEPWSGHYVVASPIWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVALTDGLGNLTIIIETMSHQHSMCIRPYLPYYNVSHQLATFTLKGSLREIQELQVWYTKLGQRLHFKQLDTLWLLDGSGSFTLELEEDEIFTLTTLTTGRKGSYPPPPSSKPFPTNYKDDFNVEYPLFSEAPNFADQTGVFEYYMNNEDREHRFTLRQVLNQRPITWAADASSTISVIGDHHWTNMTVQCDVYIETPRSGGVFIAGRVNKGGILIRSATGVFFWIFANGSYRVTADLGGWITYASGHADVTAKRWYTLTLGIKGYFAFGMLNGTILWKNVRVKYPGHGWAAIGTHTFEFAQFDNFRVEAAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GALACTOCEREBROSIDASE
publication title Azasugar Inhibitors as Pharmacological Chaperones for Krabbe Disease.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 211
structure length 641
sequence length 644
ec nomenclature ec 3.2.1.46: Galactosylceramidase.
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02057 Glyco_hydro_59 Glycosyl hydrolase family 59
A PF17387 Glyco_hydro_59M Glycosyl hydrolase family 59 central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 4ufiA03
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4ufiA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4ufiA01
1FWSA 4IXHA 5D2WA 1XH0A 2J6XA 3IJ7A 1GOMA 1YTDA 3ELFA 3L2IA 5HINA 3W7QA 1HUVA 5K7JA 4HU8A 5KZDA 4R34A 9CGTA 1ZFJA 3CIWA 3N34A 1JNDA 5D9PA 1UZ4A 2BXYA 1FDZA 3GIYA 2G3MA 3VVGA 2B7QA 2QJHA 3U5UA 1KM0A 3MANA 1Q3NA 3O16A 2C7FA 4GZIA 4H7VA 4MB1A 4WZHA 5EKYA 1KXHA 2WWCA 3QSTA 1US3A 3MBDA 3N1AA 1NQ6A 3KHJA 2D0HA 2ZRYA 4JKKA 2VJXA 3JUGA 1W9UA 4F8XA 3HGOA 3BGGA 3SCOA 2PBOA 1H1ZA 2VC6A 3P81A 2AEYA 1FWRA 2FIQA 1HKJA 3W25A 3WNOA 4JDBA 2TAAA 4D6GA 3UNDA 1W3JA 4O0KA 2VI0A 4KGJA 1VENA 1C8VA 3VDHA 4JFTA 1XC6A 1TFVA 3MHGA 1XCFA 4PCSA 4AB4A 3N15A 2ZYFA 4DF2A 3W1QA 3NQCA 1JJKA 2E1DA 2VFHA 1LP6A 4FXSA 1MO0A 4WOQA 1XUUA 4XUGA 1V6YA 4PTWA 5BCAA 2FPVA 5DCDA 3AIRA 1GVQA 2DSKA 3NVTA 3O06A 3AS2A 4HZ6A 1VJIA 3LBMA 1HVXA 4DWSA 3NYDA 1HG3A 1LTDA 3NM3A 3TXVA 1FHDA 1WAWA 4IXXA 3VD7A 2QKFA 4KMQA 1ISWA 3CUFA 3P84A 5IHSA 1G4EA 4NJKA 3EDDA 2E9BA 3WQ8A 3SURA 2GQ8A 4M6QA 1NWUA 2OX1A 2ZA1A 3VIGA 3ARUA 4DO6A 3TE9A 5A6KA 2JKEA 4C7FA 4MY9A 2GJRA 1V7YA 3GNRA 1OK6A 2O9TA 1IZJA 3BMWA 3CTTA 4AYSA 1S5VA 1DV7A 1F05A 3NO5A 3ABSA 4JY9A 1NM9A 3U7VA 3W88A 1DQXA 2Y8KA 1TPH1 5BXRA 1R8LA 4J7RA 5IDIA 3WNPA 2I1OA 3PZNA 4CD8A 1YPFA 2YSWA 3ALGA 3M6YA 5A95A 4TXEA 3M9YA 3U75A 2FPYA 1MZHA 3SCSA 4MNMA 1GHSA 1IXQA 1H5YA 2C16A 2Q3OA 3GXFA 3N9SA 1QCWA 4WY0B 3QZEA 1US2A 3LIHA 3M5VA 1ZJIA 1QI4A 4XV0A 5HUPA 1TZ7A 3HU7A 4MTVA 4W5ZA 5D9NA 4F66A 2ZUNA 3W7RA 4JHZA 3NGJA 2CWNA 1L6WA 2ISWA 1XBZA 3II1A 3IGUA 1Z41A 3HG5A 3CMGA 4GUGA 1AQHA 3PN8A 4D6FA 2VCCA 4TX9A 5HPCA 3CHFA 2VL4A 3O07A 4LT9A 3W2NA 3T7VA 3QOMA 1Q45A 3F4WA 4HHPA 2P1FA 1VH7A 3EMQA 4UQBA 5DMYA 3LRLA 2YW3A 1M7XA 3BLIA 4N4PA 4TX8A 1FXPA 3WK1A 1QWGA 3M41A 1XUZA 3D5HA 2GVLA 1BAGA 1E0XA 2VENA 2WK2A 4MNKA 5ABEA 4O10A 1EPXA 4AD5A 3T44A 4M29A 2EKCA 5AHLA 1SZFA 2PWHA 4NJGA 1TPB1 1ZL1A 1KQZA 3HJZA 4Y8FA 2JEPA 2GOUA 1CGUA 3T2PA 1CXLA 2BX7A 2WJZA 2OXBA 1JXKA 2VKZG 3W38A 1E4IA 2DZTA 2CLKA 3M5XA 3I65A 1UYQA 3LCIA 3VNDA 3SCTA 1V02E 2ZUTA 3VIIA 3WF3A 1B9ZA 5CGQA 1SSGA 1OFDA 1DWHM 2J7HA 3A4WA 3NG3A 5I3KA 4OV9A 3ZJ7A 3EXRA 4CLMA 1KFWA 5CGTA 3AMCA 1QHOA 2F84A 4NRRA 1PJ9A 5G1TA 1VBUA 1GPWA 4CCCA 1V3KA 1FUYA 1MSSA 2Y24A 3L0NA 1EO7A 2FLIA 3MP3A 3RO8A 4AXNA 3CZJA 1FH8A 4FLRA 3L2LA 5GNXA 1GVSA 3G1FA 1E55A 3C2RA 3ZFHA 3N04A 5E0FA 5DCBA 2PI6A 1G4TA 1WDQA 2WVSA 4GQQA 1IV8A 4O57A 4CN6A 3KVKA 4WY0A 1M04A 4G1KA 3EDEA 2WPGA 1K7EA 2O7QA 3PF3A 3PIJA 3L4YA 3BPWA 4WJEA 1GVYA 4JDYA 2A21A 1WOBA 3G0XA 2WAGA 1J11A 4R5EA 3GXPA 3AJXA 4NQ1A 1MW3A 4HOWA 5CGMA 1JRBA 1TPDA 3LHUA 4ZQMA 1WZAA 2YKKA 3HIJA 3UGHA 1EP3A 2VXNA 3LCWA 5CPLA 5SWUA 1X1NA 1ZBCA 1DKWA 1OFOA 5K9DA 1Q6GA 2VX5A 2WHKA 3KL5A 5F4XA 3UWZA 2C15A 2ZX5A 5CPTA 4HU0A 3L68A 3S5YA 1JGIA 3PS7A 3N9KA 2WSQA 2ALDA 1DWAM 1RP8A 2OZ0A 4JFSA 1ISZA 2WWDA 1Q6RA 1LOSA 2CPUA 2UWFA 2XFFA 3ZR6A 2QJIA 2WYSA 1JD9A 4RXFA 4S3KA 3BARA 5I3JA 2HS8A 3W7MA 1VYPX 2YDAA 2V81A 1LOLA 1B30A 3S5ZA 1G0CA 4P61A 3VFLA 1TUXA 3VUPA 4LVDA 4ZVJA 5CPQA 3KEHA 2FH6A 4UTIA 4XX6A 4YCOA 2PWEA 3PB0A 5HR6A 1LBFA 3HGRA 4PC8A 3PTMA 2ATMA 4CQ9A 2FPTA 3WELA 3VI2A 1QPOA 2IQTA 3VD9A 4HPJA 2BLEA 1HO1A 4UXDA 1CXHA 1EQCA 2O92A 4CN4A 1H2JA 5D09A 1KR1A 4JQTA 2YBTA 5AY7A 5C54A 3CWNA 4XB3A 3CHCA 3Q58A 4JGDA 5FEZA 3MMDA 4CD7A 1PX4A 1QNOA 1GVIA 5AC4A 3LCXA 1C8QA 5A6SA 4GJ1A 3AXXA 3NMBA 2NXGA 1JCMP 2BV9A 1QNSA 3W27A 3CEUA 3LOTA 2FDSA 5DF0A 5FF0A 3SIZA 1W3IA 1ZBVA 3LPFA 4P8WA 4A29A 2VFEA 5AFDA 3PWAA 4UQAA 5A6AA 1I2RA 3WQ6A 1I1XA 2Y4SA 1NOUA 3ARWA 3OHIA 3T4CA 3W73A 1PZ2A 3WH8A 4ZXOA 1UWRA 2D20A 4PA8A 4JKMA 3WD3A 5M3WA 1BYBA 2NT1A 1VIWA 4N6FA 4GXMA 5AYXA 1T96A 3U7BA 1EDGA 1QNRA 1E40A 2A4AA 5M5DA 2QUVA 4S3JA 2WO5A 1AQ0A 1JZ5A 4LV9A 3WL1A 1SYTA 2WXDM 3TIMA 3U6WA 3UWQA 2ZUSA 4J3VA 3IEBA 3TFXA 4UFLA 4JX4A 2IXVA 2VQTA 1O5KA 1TG7A 2ZUMA 5CXPA 5BMWA 5A8MA 1VRXA 1J0YA 3GR8A 1HKKA 4UQCA 1H0GA 2CBVA 1AK5A 3VINA 3LLFA 6TIMA 3W6YA 1ALDA 1DJNA 5ECUA 3NR0A 2H3DA 5L6UA 2JALA 3GDKA 1UKTA 2R14A 1LLOA 2A0NA 4BQ4A 3E1F1 1AMKA 4LUIA 1GG1A 5EB8A 1YDNA 1JCJA 4RE4A 2GVGA 4W9TA 1RP9A 2D1ZA 3AZSA 4OBSA 2UY4A 3WUGA 5C70A 5FMDA 4JYEA 4NNAA 3UXDA 1DWIM 5CG7A 1E0VA 1LL4A 1RQHA 1OINA 3GZ3A 4E8DA 2GQ9A 1OYCA 1Y0EA 3PZTA 4UCGA 5E6ZA 1I2NA 4XZ9A 3ZT5A 2DDXA 3W6MA 3VGEA 3HBKA 1G69A 3FKRA 1GHRA 1OVDA 4CVWA 4YN5A 2W79A 1OSEA 5A3HA 5EYWA 3SCRA 2WKJA 2AQWA 1W1PA 3QRHA 5LNUA 2VRKA 4AH7A 3QYQA 2NX3A 1J0JA 1V5XA 4AD0A 1ZJBA 2E6YA 2WC7A 4WXZA 2CETA 5CPSA 1ITXA 3MUXA 2W61A 4LYPA 3AYRA 5E93A 3GNDA 5BOOA 2VTFA 4W7WA 4IISA 2HMCA 4QM1A 2DQXA 3T0BA 1BYAA 1J18A 1LCOA 3GX9A 2DT3A 3GTNA 4U31A 2HTMA 3KXQA 1KCKA 4GI6A 3ZR5A 4QLKA 2WB5A 2J9YA 3L0GA 2DZVA 4CQ8A 2BY2A 2CBJA 1IXPA 2ADDA 2V3FA 1EO5A 2YIHA 4PYSA 3VOCA 2XM2A 1VYSX 2TSYA 3VE9A 4CN1A 4FK9A 2BHZA 3WD2A 2QQVA 1WNOA 2D0GA 2WANA 4O1AA 2ZRVA 3SW6A 5I6SA 4KKXA 1V3HA 1DOSA 2RHGA 1SO4A 3NQ8A 4E38A 1H51A 3DFOA 5D2VA 2X1SA 4TX6A 4FNTA 5JIPA 1GOQA 4ONVA 4WOZA 1NWRA 4I7UA 1JDDA 1W31A 1CGVA 4UTWC 5CQ1A 3WENA 2E8YA 1OB0A 3CZEA 2Q8LA 5BXSA 3TP4A 3DC0A 4EE9A 2B31A 2Y70A 1JQXA 3KRUA 3WK2A 3OIHA 2VURA 2C18A 1XBYA 3UYCA 2A3EA 3RFAA 5DT7A 4UNKA 4EANA 1KFKA 1P5BA 1G1YA 1W1ZA 2CKSA 4S2BA 1Y4WA 3MBFA 3UXAA 2JF6A 2ZUWA 4IMEA 2WMHA 3MO4A 1HO4A 2E3ZA 3VIJA 4HNVA 1LZOA 1P1XA 3DYMA 1M5WA 3BG5A 3IIPA 1DJQA 2QV4A 3LTYA 3LCHA 3NL5A 4QHZA 1SO3A 4FNSA 3TJLA 3GYCA 3G3DA 4GRSA 3K4DA 4DXVA 3LDVA 2GDUA 3P8IA 1E3ZA 2WM0A 2GJNA 3ARTA 4BI7A 2XUCA 1XD0A 1BVZA 1C9DA 3OZPA 5FKCA 4NXSA 1KR0A 4B15A 3GXNA 3S9YA 1YYAA 1BTMA 1UWTA 4V28A 5LYRA 1D3GA 3L66A 2PF0A 4UQ9A 1R2RA 5CSYA 3S5QA 4JFVA 1E4MM 4PMOA 2ZZ5A 3L4VA 3SCWA 2Y62A 3N19B 2QCFA 3OVRA 3L4XA 3HN3A 3NYZA 4GINA 4K38A 1GJUA 1L2UA 4LRSA 2Y61A 1EUAA 1K8YA 2XIBA 3CZLA 3RJXA 4Z1BA 1ME7A 4XTIA 3N17A 2EBNA 1XM3A 5CZTA 2W62A 4ZFMA 4LVGA 4CD6A 4TTGA 3WMSA 3LHWA 2R8WA 4K39A 2JK2A 1CYGA 1W0MA 3W1UA 1W1VA 4BA0A 3AMGA 3THDA 3I6RA 4C7DA 3DENA 4N02A 1D9EA 1OFEA 1UHVA 4J3WA 3IIZA 4WIWA 3WQVA 3ZO9A 4M1RA 1TSIA 3R13A 1MW0A 1EOMA 3W23A 3W1LA 1C7TA 2WC4A 3WD4A 3W85A 3BGJA 1E73M 2WMKA 3SUWA 4AEEA 2ZCGA 2GDVA 5I3FA 5FMCA 4IQLA 2A7PA 4X9YA 3A9IA 3NQEA 2V8ZA 1VAHA 2GK1B 4AXKA 1E6QM 3W1PA 2BWGA 1UKQA 3L4ZA 3UERA 3CH9A 1GEQA 2A1YA 2RDTA 2QEZA 4TMBA 1PCWA 5BNKA 3TFCA 4ZQNA 2YZRA 1XFBA 4JCLA 3IJ8A 4A3YA 4HKPA 2E9LA 3C2OA 2J7DA 3RNDA 2J24A 2DU2A 4NZFA 1ZB5A 3KE0A 5AHMA 3NNTA 5CLTA 1WOAA 3VIKA 2C6QA 3EXSA 2DSUA 3NSXA 3WJXA 4GPNA 5AYBA 1IXNA 1X6NA 3QHOA 2W91A 3E96A 4HA3A 2B7OA 2FB2A 1FFRA 3VNYA 1LG1A 2NUXA 1WPCA 4W7VA 4O13A 4ZEPA 2WHLA 2DSWA 4S1FA 3GM8A 1NSJA 4FXRA 3NZRA 1FCBA 2J62A 2YDRA 2PC8A 2WVUA 2G3NA 4FFGA 2PRHA 3PTKA 1JULA 2CLLA 2FHBA 1TYGA 3M0ZA 1HJVA 3ARXA 4BQ2A 1VHNA 5U7SA 1MFVA 1KXTA 1Q6DA 1WV2A 3TV8A 1WDRA 3D3AA 4Z2GA 1EGZA 2J7GA 4UMCA 4DQWA 4OOZA 4E4PA 3NA8A 1EDTA 3N13A 4UMAA 2H6RA 4MPQA 1RPXA 2XN1A 3AHTA 2AGKA 4ZENA 5G2IA 5LA2A 5F1UA 3AIQA 3AJ7A 4AZBA 3WK0A 5DN1A 3AQUA 1WBHA 3TQVA 1SO5A 3TJXA 3JRKA 3OIXA 3EX1A 4EVZA 1LORA 3W84A 4TMCA 5EBUA 1CGWA 5I77A 2PRMA 3ATZA 1GUVA 1MXDA 3SSJA 4PMQA 1O95A 1JAKA 4WSJA 4ATDA 1F73A 3OGSA 1BSIA 4P8XA 4PL1A 2CBUA 4TVUA 5LGXA 3SCUA 2JIEA 3R89A 4GUJA 4KH2A 2CHNA 3ARZA 2CHOA 3B04A 2Y7DA 2ZXQA 1J0HA 1Z32X 4KWWA 4K7YA 1Q4NX 5EY5A 1QW9A 3C4UA 2YJQA 3TTYA 5JBDA 1DBTA 4FNUA 4GFSA 3BG3A 1CLVA 4CVUA 3RM9A 3O05A 1F5ZA 2EPHA 4TIMA 5F1VA 5GVJA 5AHIA 5TIMA 2GK1A 3GNPA 4D6JA 2EO7A 3EMZA 3WH9A 2QF7A 3NPXA 3CGTA 3FIGA 3NZ1A 3P80A 4UTJA 5BYWA 2ZA3A 4IPIA 2ZICA 1Q6LA 4V2XA 3MI3A 4B3LA 4MAVA 1JL8A 3BAIA 4WJXA 3LV5A 2W4XA 1TJPA 1CGYA 3SCVA 2YL6A 3HG4A 4Z0SA 3ECQA 4FMVA 4XUYA 2RDWA 3W26A 3G24A 4A4AA 3PZVA 3CZKA 1V0NA 2X1IA 4MAZA 2OSYA 3RILA 2D0FA 2V2CA 1LRNA 1YTEA 2G5WA 3DKJA 4JY8A 2A7RA 5DLCA 4HNUA 1EIXA 1FH7A 3MUY1 5DFAA 4GBUA 4QQ3A 3TROA 1EHAA 2ZZ6A 3FA5A 3PG9A 2Y5EA 3N11A 1UR8A 2EQDA 5I3IA 3PZIA 1GNXA 4HPGA 4LRTA 4LVFA 4A22A 2RGLA 4QAIA 1KGXA 2J8FA 2XVKA 1V6VA 3WQ5A 1H1NA 4BI5A 1QHPA 4U3CA 1JYXA 2V5DA 4NZCA 5I3GA 3GBEA 4PMZA 2XGBA 3DAQA 3PBUA 4K6AA 3CLMA 3A47A 3KWXA 4MYAA 3SECA 1RQBA 1W2TA 1KTCA 2ZZ7A 2D24A 1CI1A 1UG6A 1NWTA 4UTUA 1UWUA 3W1TA 1XYFA 2QUUA 3EKLA 4D6HA 3ATYA 4MZ8A 4D6EA 1ICQA 4FLOA 4UQDA 4B9YA 2JF7A 2X0HA 4OGZA 5D37A 3EWXA 4OU1A 2A3CA 3QOKA 3FHQA 2QPUA 3PZ9A 4LQ1A 2FHFA 1GQKA 1WX0A 5TBOA 1LYXA 2PRLA 5LZLA 3STFA 1MVYA 5DEZA 2ZRZA 4OE7A 3SEPA 5FEXA 1HVQA 1N55A 4LNYA 5C55A 2J77A 3AYSA 1JYVA 1R46A 2X1TA 5GPRA 4HT3A 4PMNA 4AD1A 3MMUA 3W70A 1K02A 3PBVA 3MV01 2TRSA 1GOXA 3R5EA 4UC5A 1FH9A 1QO2A 3L9CA 1OFAA 2X2GA 3UY8A 3HF3A 4RJEA 3TDFA 3NPVA 2ZFAA 1VR6A 1QI0A 2BS9A 3K8LA 3SCPA 5KZ6A 2VOMA 1LG2A 4GO8A 4JNMA 4YWIA 4LYQA 1VEOA 5AYIA 3SFKA 3O6DA 2XN2A 2J7CA 4RE3A 3VIPA 3AS0A 1Z44A 1Z48A 3EWBX 3B05A 5LSMA 2XFRA 3MU7A 1FY6A 4N9CA 3FNDA 3EX6A 5CLWA 5LNRA 3O6CA 2ZX9A 3W3OA 1T99A 5F2LA 2E4TA 3H3LA 1NF7A 1NVMA 3DFSA 2DH3A 1AQMA 3L5AA 2E8ZA 4UTWA 2HISA 3BAKA 4WLCA 3VTRA 3W1AA 3VMNA 1J5TA 3GLCA 1NWSA 1JYNA 2DSZA 2QF8A 5FK7A 1XC4A 5BRQA 2ZZ2A 2BVTA 1IF2A 4OUEA 2AEZA 2WCGA 4JAWA 3M47A 3UWWA 1UH4A 2XGIA 5CSRA 3WDRA 1LBLA 2QHAA 1QW8A 2G41A 1ITCA 4Q22A 3KAOA 3NL6A 1E6XM 2FGLA 3NQDA 3BCFA 3UY7A 2NUYA 3SI9A 1BYDA 2W66A 1QI2A 1AMYA 1J0KA 4O50A 2V3GA 3DFNA 1B31A 3PR2A 2VZUA 2VVSA 4W89A 4W85A 1E72M 2V5LA 1KA9F 5BROA 1QO5A 3P62A 4U5IA 2E40A 3ABOA 3B0PA 5I78A 1GWJA 4AZZA 3FOKA 1H09A 2NWSA 3T0AA 1VCGA 3QH2A 3W87A 2VO5A 3W72A 3WKZA 5JBEA 3AOFA 3RDKA 5G5IA 2ZRWA 2JE8A 5AN7A 1RR2A 3IVTA 3C0JA 2DIEA 3VPLA 1V6WA 3IAQA 1DTUA 1TREA 1YDVA 3UGGA 1IT0A 3CWOX 5CPMA 4AWSA 1TCMA 1TB3A 3L0KA 4Q4KA 3MHUA 3QPZA 2ZIDA 3QGVA 1W1YA 2WNNA 1WKYA 2XVPA 4OBRA 3I7QA 1KWGA 1Q6QA 1NEYA 3EEGA 4Z0JA 3LRKA 1ICPA 3OSDA 2C0HA 1Q6OA 4CU8A 1C93A 4UTHA 4MADA 3M16A 3ZMRA 5FF4A 3LI1A 1KGWA 1CIUA 3NSMA 2VEKA 4AY1A 1JDAA 1W2VA 4L4OA 3LFIA 3VIHA 4DELA 4YXGA 4Y96A 5D9OA 3W4RA 3STGA 1ZS2A 1MXSA 4DEFA 3V1PA 2V0TA 3EDKA 1M6JA 3M1ZA 3H54A 1MQRA 4JKLA 3LHTA 1ZNNA 3CTLA 1DP0A 2XM1A 3EDFA 3HMCA 4H04A 5C71A 2ADEA 3VIFA 1YLVA 2PBGA 5L9FA 1A5CA 3DZ1A 1GVFA 4Z2HA 2FB3A 1DL3A 1NFBA 4R53A 1NOWA 3CBWA 1TPEA 5EBAA 2TPSA 3YPIA 3TA9A 3W81A 5HPOA 3MW7A 5D32A 1A5AA 5K3VA 3L5LA 1A5BA 1KV5A 1KM2A 1IZKA 1I2QA 3G8RA 3S1XA 2X2YA 4WKHA 3WF2A 3IVSA 3TAKA 1B3OA 1TQJA 3DI1A 2DJXA 1TTJA 1G4SA 4MJMA 4H6KA 2C14A 2J88A 3NOEA 1DEDA 5E6YA 1JZ3A 3BW3A 1MWOA 4F9DA 4LYRA 3ZWTA 1HTIA 5EA9A 1FP9A 2VC9A 2XVLA 5A2CA 2W63A 5HMSA 2YA2A 4I7WA 1H41A 1H61A 3GNOA 1GYNA 2DZPA 1S5TA 1JIBA 2VQUA 3I3DA 4A2RA 3GVGA 3WSUA 1TTQA 1OF8A 2VFIA 3K30A 1JUEA 3HQ1A 3IIXA 1TTPA 4ML9A 2C8NA 2CLFA 3F03K 4J9JA 5CPNA 4CCEA 3C8FA 2ZUUA 1NP2A 3LLDA 2VRQA 2OT1A 2WSKA 1JXJA 3A4XA 4YHGA 4QDMA 3LRMA 4O54A 2WMGA 1PVNA 5D33A 2X05A 1VRDA 2EF9A 1E5NA 1TTIA 1WXJA 1EDQA 4AF0B 4FF7A 4IX2A 2CLOA 5FF2A 2ABAA 4RV8A 4H41A 2RFGA 3PC0A 3W0KA 2H90A 1ADOA 3M44A 1OCQA 4MY8A 4Q7NA 1YXDA 3UD6A 2QMJA 1OFRA 3AICA 2OT0A 1FDJA 1LWJA 4D72A 3LCFA 2JEQA 2VT0A 5A69A 3VGFA 4NNBA 2WNQA 2OYKA 3TMLA 1CGXA 4ATLA 5KSWA 4MDOA 2J7BA 2JKAA 1W91A 4W8BA 4PSRA 3T0DA 1XDLA 4ALDA 3TA6A 1NARA 3G6LA 2OWCA 2WSRA 3HPZA 4AHQA 4JN6A 3NQMA 3QPYA 1OGBA 3PG8A 5E9AA 2ZBTA 4M7TA 1GOWA 3WNNA 4AZCB 3KVJA 3HG2A 4XBSA 1UR1A 4FX8A 5HULA 5FKBA 1FXQA 3SR7A 3VILA 3HO8A 3VNZA 2F61A 2F7FA 3W07A 1UA7A 1K03A 3BAXA 4AMCA 2ZQ0A 3UEQA 4JICA 3VGHA 4HPHA 2ZOXA 5HQEA 1H4PA 1J12A 3KZSA 3TTOA 1YPIA 1UH2A 4S2CA 3L4TA 2XN0A 4O4VA 3P82A 4YMZA 4GXPA 1OJXA 4MB3A 2JFEX 5E09A 1VB9A 3ZM8A 1TRIA 4MKNA 4JTIA 4DM2A 1ZY9A 3FYPA 4PH6A 4UTMA 5DELA 2ZA2A 5D05A 4NI3A 4O12A 1TVPA 1WZLA 4N6EA 1B90A 3LMYA 5G4WA 3W76A 3OGRA 1TA3B 4UFIA 3NUKA 4AD4A 4AZGA 5TD4A 3E49A 1MEIA 1MW2A 2BY0A 3J7HA 1VFOA 3FJLA 4GQRA 4FIQA 1AG1O 5DY2A 4CNNA 4AEFA 2XFWA 3W7HA 2ZRUA 3LTPA 2CESA 3E9AA 5HWJA 1M53A 4MZ1A 5DXXA 2WVVB 3BAWA 3NM1A 1CNVA 4PMUA 1TPWA 5D4YA 5D9MA 3B8SA 2XYLA 3GXMA 2ABBA 2CZEA 2GUUA 5FESA 1M03A 1SO6A 4UR8A 1PEZA 1FWTA 3HJEA 2F8QA 5T26A 1PX8A 3TTQA 1W5QA 1HKMA 5K4ZA 2WBGA 3U2OA 3EDJA 3FAWA 4GUHA 4AZ5A 3HBLA 2CYGA 2J75A 2YBUA 1E43A 2A3HA 2AOSA 3NIYA 4W7UA 2B7PA 2YCEA 3G0UA 4AF0A 1CXKA 2VR4A 3KX6A 3GYEA 1F7BA 4O1BA 1CGTA 3WF4A 2FJKA 2UY3A 1U33A 4EF9A 3SIMA 3ZT6A 1UD5A 1EWDA 4MLJA 2VX7A 3THAA 4M6VA 3WH7A 3WJZA 3VIOA 2WOQA 1W9XA 3ZOAA 5KZMA 2JKPA 1LL6A 1UR2A 4RCXA 4D6DA 2WMIB 2YDSA 4K68A 2CLIA 5DY3A 4L4LA 2G3JA 5K4XA 1TVNA 2Y85A 3OB8A 2EJ1A 2YGYA 1ZBKA 2FTPA 3AISA 4JFWA 3G1HA 5HR7A 3K8KA 5FEPA 4KWUA 5JUVA 4AZCA 2BZNA 3AXIA 2W6RA 3A24A 3W7DA 3KOFA 7TAAA 1ML1A 3W75A 1K9FA 4ZQPA 4PEKA 1BPLB 4O28A 4QLJA 3S0CA 1J01A 3OBKA 3U1XA 2ZZ3A 3ZS4A 4OZOA 1X1OA 2JBMA 3SZ8A 1H49A 1X6UA 3B0VC 1Y7VA 2GJXB 3G1SA 5LNWA 2D2OA 3L2MA 3PTQA 5CJ5A 1A3HA 1BYCA 1OBAA 4FB7A 1JCYA 1B0IA 1KFEA 3H55A 3GBDA 3QEZA 4ORMA 4XZWA 1R2SA 4LX4A 1TA3A 5M17A 2DSVA 5F2MA 2XWEA 1WAUA 1TIMA 3VIMA 2ZRXA 1I2PA 4KFNA 4A2SA 1SR0A 4GC4A 3WEMA 1W32A 3ARRA 4U3AA 2Z2UA 1TO3A 1I2OA 4X22A 3ZR4A 3LPGA 4OOUA 4O1CA 1UD3A 2WCSA 2WVVA 3KL3A 3S42A 1VYRA 2A6LA 1JF6A 1JUKA 1QVBA 3F5LA 4W5UA 3T08A 4K36A 1JZ6A 1PIIA 4NJIA 1V08A 2YYTA 1R30A 3TUUA 4RK8A 4ZQRA 4JTEA 4UTKA 5G2HA 3W7IA 1CDGA 1LLZA 4W86A 3S1WA 4B16A 1PIGA 1KM4A 1H7RA 1WB0A 3Q37A 3ARQA 3W7OA 3O6AA 5DO8A 2WV8A 3EX3A 1JG9A 2WZIA 3OG3A 4MYXA 3CZ8A 5LNSA 1AL8A 3W2JA 3APGA 1GTHA 5ABTA 5A8NA 1W9VA 1UD4A 3LEMA 3UR8A 1WA3A 3U57A 3MHFA 4AIUA 2DGAA 5FMBA 1AVAA 1PBGA 5A8PA 1Z42A 5A2AA 1HX0A 1D3HA 3C52A 3EX2A 3VMPA 5KEZA 3P5ZA 2WMIA 2PWGA 4HMCA 2RH9A 1CPUA 1TV8A 1VJSA 2YA0A 3CPUA 1OD0A 3NQGA 4JTLA 4JTKA 1OIFA 3L21A 4YPJA 5HBFA 3VKJA 4JIEA 4R33A 1YDOA 2VZTA 5IFPA 2J47A 4M80A 1LL7A 3VDCA 4BF7A 1VEMA 1DORA 5A6BA 4LU0A 1E4NA 5CZ0A 1F4HA 3WNMA 3RMJA 3PULA 3TR2A 2Y2WA 3FS2A 4DUXA 5IBXC 3TQ0A 2WVTA 4GE8A 2J79A 3B06A 3QJAA 2C1HA 4PFMA 1M01A 4RL3A 3PZGA 2GJXA 4L4PA 3LCLA 2EPOA 4QCFA 4RE2A 1YHTA 4JXCA 3W2UA 4HTYA 4PTMA 4H4IA 3VX0A 1H7WA 3PY2A 3AHXA 3OBAA 1KFJA 4CD4A 1O4UA 3Q94A 3WFZA 4UR9A 4LUJA 3GDTA 3CUJA 2CLMA 2HVMA 1KBKA 3WQWA 4PL2A 4NU7A 1A50A 5H91A 4PUDA 2Z1SA 4X9SA 4RZ6A 5AC5A 3DHDA 3WBEA 1L9WA 2D22A 2EXOA 5HNRA 2GUYA 8A3HA 3L67A 1WZKA 4KRTA 4O15A 3WDHA 3N2XA 5I0DA 1B3XA 1JDCA 5DBUA 2BSLA 4LS0A 1TRDA 4LC6A 2ZDRA 4QITA 1JUBA 1XYZA 4PN2A 4CQAA 3TTSA 2Y8VA 1H1YA 1EX5A 2E5CA 3W7PA 3LXCA 1FP8A 1FWWA 4AWEA 4P7QA 1TQXA 2E6FA 4QNEA 1G94A 5CZKA 3QMSA 3K4AA 5EFDA 4I9AA 1E3XA 4B1MA 3O8AA 1GOOA 4B1LA 1LOQA 4JFUA 1UWIA 4AIOA 3MYOA 4GO9A 2WHJA 1UKPA 1R2TA 3T2QA 4RXGA 2QCLA 1DWGM 4H3DA 1XV8A 2JGYA 3P8JA 5IFTA 3DHUA 1RH9A 2WZEA 4DPPA 4JTGA 5A8OA 4OBTA 4E0CA 2EPLX 3FEMA 5KMYA 2QDHA 1JFHA 2I9EA 3IIOA 3SUTA 4K7VA 3WF1A 4HA1A 1DHPA 1L6YA 4LXFA 3NQ2A 3TC7A 3HGJA 4XBKA 1ST8A 1HN1A 1N8FA 3FW6A 3LPPA 4WSKA 4XZBA 1BVNP 4LC8A 3S1VA 2VFGA 4AD2A 3RM8A 3T09A 3W9ZA 3GDBA 2VEPA 2EHHA 4IX0A 1PL9A 3AHZA 3RJYA 4WF7A 3OVQA 4FFIA 1A5SA 1VCFA 1UCWA 1EB3A 1MEWA 2V38A 5A6LA 4UMBA 2WCAA 2QDGA 3MMTA 4O8RA 3EKZA 1QPNA 3TSBA 1WDWA 1YADA 2Y63A 3UZJA 4BK9A 4OQVA 4WXYA 1E5JA 2Q8XA 4UZSA 4W8AA 3W2LA 1KTNA 4FO4A 4P7RA 4Z2KA 1BLIA 5LGZA 3F5KA 2GVYA 4AIEA 2NV1A 3ARPA 4AHOA 2DORA 2ZXAA 2QCGA 1C7SA 2HSAA 4O17A 2X16A 7CGTA 2Q8ZA 4M56A 5K9CA 5JIWA 3TQKA 1SZEA 2BHYA 2E6AA 3KL0A 3CC1A 3VX1A 4PRWA 2OLHA 3ARVA 4MY1A 1VGAA 3TSMA 2XTKA 4DF0A 4DUWA 1B57A 1SW3A 4O0ZA 1KXQA 5DXYA 3KF3A 2YFNA 1XCWA 2WSYA 2VX6A 1U5JA 3TKFA 1OT2A 4FX7A 5D04C 4P2VA 3UQNA 2J25A 3CLWA 4EOUA 3U14A 3STEA 4OKDA 1F6KA 3TSDA 3WD1A 2P10A 1BWLA 2FQIA 4PSPA 3W86A 2GJPA 5F4WA 4PMRA 5DCEA 1I8JA 5CSSA 3W7EA 2WW5A 4J27A 3QSRA 4CUCA 1X7FA 2QCNA 1GPFA 4EIVA 4MOZA 3NSNA 3PSVA 1Q6CA 4K8HA 3SJ3A 4GNJA 3VDAA 3MO7A 4CGTA 2QJGA 5KTLA 2EPNA 3M07A 2UY5A 4BQ3A 1X6LA 4R7JA 1R87A 4BWLC 4PMVA 4ZXLA 1SW0A 1J10A 1XL9A 4OHQA 2WBKA 5KITA 1C8XA 1JR1A 4HMDA 1R47A 3OA5A 2X1RA 3E12A 3NPUA 4Z1AA 1F76A 4IGHA 3B0UX 3WK3A 4PMXA 4CNPA 3PZUA 1UB3A 1VFFA 1PHWA 1C91A 1OX4A 3LBCA 4JTUA 4DBEA 1OD8A 2VNCA 1UWSA 3TMQA 4NSBA 1WDPA 4PBGA 2HS6A 1IXOA 3IVUA 4TO8A 3CO4A 3GDMA 1HF6A 2CEQA 3DU0A 4JHOA 3WEZA 5FIPA 5A5WA 4FNPA 4WQ6A 2C0AA 3MP4A 3GAKA 3M5ZA 1PIFA 2DT2A 1Y9MA 1GT8A 3LCGA 3B9DA 3R2GA 5I23A 4QIUA 1G7VA 4DWSD 5FKYA 1G4PA 1OIMA 3PBYA 3NEVA 1KB3A 2CW6A 2E77A 2PWFA 2B0MA 1SW7A 1E1EA 4JYDA 1ECEA 1UWQA 3QHMA 2ZX8A 2NUWA 3DYOA 1FWNA 4AMAA 4U2ZA 2Y7GA 3HPXA 1LF1A 1ZBWA 4LVBA 1XHGA 3CHDA 4QAWA 3NQVA 1E6SM 1TE1A 3GH7A 4NF7A 3UWYA 3W7CA 1TR1A 4NX5A 4H8VA 1XSIA 4Z1CA 2YOCA 4DPQA 3TXZA 3BV4A 4XQ6A 2QCMA 1V0LA 3A22A 4O16A 1HL9A 3RM4A 3TCEA 3MI6A 1JVNA 1DWJM 1QOXA 3CUGA 1BTCA 3ARSA 5D02A 3LTSA 1EEPA 3QFEA 1OGGA 1VJZA 4LS1A 1GONA 1V3LA 3MJYA 4KFOA 1BF2A 3INPA 3W1RA 2CCRA 3IRDA 3NDYA 4J3SA 4Z2IA 4P8VA 1BG4A 4D2JA 1B3WA 5A8QA 5ABGA 3SUUA 4MB5A 1D2KA 3UETA 3STCA 1UQZA 1KCLA 3G22A 4U28A 4ADTA 3LERA 1XKYA 1BGAA 3A21A 1XH2A 4H8UA 3LPOA 4C7GA 5HWNA 4Z2JA 3WMCA 3OLIA 4X3ZA 2W5FA 1JI1A 1GQJA 2YR1A 2GFTA 4OV4A 1E15A 5K9XA 1KGUA 1SQ7A 3AIUA 4N9EA 3G1AA 4O19A 3GAYA 1R7OA 3IV3A 1UZ1A 4JCMA 4FLSA 2VZVA 4AZIA 5TQLA 3RF9A 1O6IA 1HL8A 3AMKA 2OWWA 3TNOA 1H62A 2QCHA 2PURA 1HJSA 3MYPA 5BXTA 5KZEA 1C90A 3AROA 1PZ3A 1ME8A 3LXBA 2WNWA 4DBDA 3AZRA 5I3HA 3AMDA 4RKAA 1K8XA 2H3BA 1QPRA 1V3MA 4AVFA 1UUQA 1UKSA 4IPNB 4AD3A 1V3IA 3LB0A 3SC7X 3ABQA 2WZHA 4A3HA 3W74A 1H7OA 2OCZA 3S2CA 3DGRA 1G9HA 4AWUA 4NZJA 4CD5A 2GQAA 2XHYA 3E02A 3G18A 3HPSA 4U2YA 3DFQA 1MQQA 2YX0A 1P0NA 2UV8G 3VCRA 3AMLA 3PBGA 1OG0A 1YXYA 4P7OA 1LLWA 1V02A 3W82A 1RZMA 1SFJA 1BKSA 1F74A 1J9YA 1LROA 3R8RA 3DFPA 1Q6FA 2XVNA 3ZQ9A 5A6MA 3AIWA 1B3YA 1HFBA 3UGFA 1J0ZA 2VMFA 3GK0A 3L5MA 4KFPA 2CLEA 3SY5A 3EBVA 3MV11 3DFTA 4QNWA 3TW7A 2QLYA 5FOOA 4PTNA 1CENA 1HJQA 1K9EA 3A6OA 5C2XA 1UUMA 4Q33A 5IBXA 2OYMA 3FLUA 5AHEA 2J9ZA 4JYFA 2RKXA 4WUIA 1JAEA 4FF5A 3ZSSA 3LDRA 2ZUVA 1H5VA 1UD8A 4NJJA 1FA2A 2CIPA 4M82A 3P67A 2J27A 1W9PA 5CG0A 4RX0A 3C6CA 1SSDA 3T55A 4N9BA 3FXYA 2ZXDA 1GG0A 1V3JA 2ISSA 2BFGA 1W5MA 4PTXA 4Y7EA 3ZT7A 4NVTA 3TK7A 2PWDA 3WDJA 6CGTA 2WMJA 1OABA 2V30A 2A6NA 3DH7A 3BAJA 4POCA 4RZ5A 4PODA 2E09A 2JGQA 3VM5A 3AIBA 3NQ6A 1EQPA 3F1QA 1JCLA 1ZHAA 4ORIA 3QC3A 3PHAA 1UR9A 1ESWA 1BGGA 1XBVA 4TVDA 1KFBA 4MJ2A 4BZYA 3WN6A 1JZ4A 1EIBA 4O14A 5AOUA 3UESA 4J28A 1ISXA 3W71A 1KBIA 4XWUA 4JIPA 2Y89A 5CZSA 1U30A 3BLFA 1A47A 3BLPX 3NL2A 1I4NA 4DO4A 3KVLA 1E9LA 5GNYA 1X8FA 3WMBA 3FHAA 3N14A 1R7AA 2VUYA 3OEXA 1AW5A 5LA0A 2AAMA 2RGMA 4HXCA 1W3KA 2GSJA 2XIIA 4NRSA 1H7NA 1JZ2A 1GQNA 1UASA 4ADSA 1W3HA 2G95A 5D2TA 3SGUA 2ESCA 4LPCA 3UG5A 4ZE5A 5CSUA 1ISVA 4UUIA 3W1MA 1UJPA 4Q32A 4V27A 2VZOA 4QJ1A 1KBBA 5IXEA 1CX9A 1G6CA 1K3UA 2E5DA 4UOJA 1W5PA 3EX4A 2EAWA 3CHEA 3ZSTA 3S5NA 3A3HA 2X30A 3CEPA 1QNVA 1KV8A 2B7NA 3U8GA 1UA3A 2DT0A 4MNLA 4QLLA 3QQ1A 2YA1A 3BSGA 4MNJA 4ACZB 3AI0A 4MFEA 2DZWA 3LV6A 4BFAA 1M7OA 3L4UA 3RIKA 3W22A 1OWQA 3TC6A 1GQIA 3ZJ6A 1WBJA 4FX6M 1KM5A 1KTBA 2X8RA 4J3UA 3BCDA 2ZX7A 3S6TA 5D30A 1GZGA 2DJLA 2VRJA 4B3KA 3A5FA 3NDOA 4C1LA 1IIHA 2YPIA 3WIJA 4W8LA 1B3ZA 3M43A 2X0YA 1UBSA 3UWUA 1MW1A 3VO0A 3W83A 1K7XA 3BLEA 4MDPA 2A3BA 3EB2A 4MUZA 4XKYB 2VVNA 1QR7A 3T40A 1U83A 1KQYA 3NQFA 1J0IA 2ISVA 2VR5A 2YL8A 4IM4A 3WEOA 1DQWA 4E2BA 3BGAA 5FIXA 4DM1A 4W88A 1SMDA 2EPKX 1CZ1A 5I5RA 2D73A 2DT1A 4PTVA 4EKJA 4QISA 4NNCA 1HJWA 1WE5A 1O5XA 2W67A 2H8ZA 4EF8A 3G6MA 3N73A 3B9EA 1H3GA 1B4EA 2FDMA 1EWEA 1W56A 2XG9A 3W1XA 3MKKA 3CPRA 4N4QA 2CXGA 2AC1A 3OA3A 1KM1A 2F2HA 1EA9C 1V6XA 3CU2A 3AXHA 3AHYA 3U5YA 1SFLA 4H8HA 3MI2A 4BR1A 1ODZA 1ZAIA 4JTJA 1AW1A 2NWRA 4P7NA 3JR2A 1OT1A 3C2VA 3RLUA 4FIRA 2OMAA 5BXPA 2Q3RA 1U2YA 1RD5A 1K9DA 1V0KA 2BXVA 2NSXA 1JZ7A 3THCA 2EPMX 2O9RA 3SUSA 3EWZA 3OG2A 4B9ZA 1GW1A 4E2OA 3BVJA 3UZ5A 3PM6A 4HP5A 3UPBA 5E1QA 1R85A 5A6JA 2NT0A 4HA4A 2NXHA 1C3FA 3WUFA 5F4SA 5CZJA 4AAJA 4X2RA 3I3BA 1QAPA 5IHRA 5HOSA 2V3EA 2LLEA 3GH4A 1XXXA 1OHLA 1W9DM 1Y9GA 3AS3A 1ZU8A 3RCNA 1XSKA 4GIAA 1XI3A 3PUOA 3E0IA 2XVGA 1WQ5A 4BWLA 1MQPA 4PMYA 1ISYA 4EQVA 2BVDA 2ZXBA 4U5KA 1A53A 1BHGA 1B9BA 4UFMA 1IGSA 2VELA 3WJYA 3QF0A 4B5NA 3QW4B 4FNQA 2OSWA 1OX5A 3S6DA 2ZX6A 1KLYA 3C56A 1GVRA 4ACZA 4CKQA 4JIQA 2J7EA 2QCCA 3EXTA 1JFXA 2VOTA 1QPQA 1P4CA 3NQAA 3QQ0A 4Y90A 1P0KA 2VFDA 4JX6A 3W29A 1HKIA 3SGZA 3WDPP 1XDMA 5LA1A 1ZJAA 4IMDA 4RR4A 3EWYA 1VF8A 2D3NA 2J4GA 4QP0A 3W37A 1O60A 4O4WA 2CERA 1I75A 1TV7A 1OK4A 1XGZA 2FGZA 2WKGA 1QMLA 4LGXA 3IK2A 3F4NA 4XKYA 5I79A 3G1YA 3LIGA 3NAVA 1OGSA 5HJLA 2CZDA 5FL0A 2ZWZA 1PE1A 1E56A 8CGTA 1L0PA 3WNKA 2DH2A 3N9RA 1W54A 3TH6A 3LDKA 3KF5A 2G96A 3LF7A 4NUWA 1V0MA 1LRTA 1O94A 1SR9A 3BLKA 5G1YA 4KRUA 4CCDA 1DHKA 1ODUA 5A1AA 3O15A 2V2HA 2QCEA 3OLGA 1OM0A 3VD5A 4O53A 2Z6JA 1SPQA 1SUXA 1W8SA 3CM4A 1DWFM 2J8GA 1KW1A 4K8EA 3GZAA 4UTTC 3EYPA 4AW7A 1NOFA 5D8WA 1SFSA 2G4FA 3TW6A 5BWFA 1MXGA 3VGBA 4OWGA 3BXWA 2ATSA 1FCUA 1LDCA 1W5NA 4JTFA 3ZIZA 2Z6IA 3A4AA 1PHQA 2WHMA 5A6BD 4WK9A 3GR7A 2C3ZA 2CLHA 3B8DA 2X09A 3LX9A 3I68A 2B4GA 5HWMA 1JZ8A 3DECA 1D7FA 2PCQA 1RD6A 3I3EA 4TVCA 4AZ7A 4JL1A 4DF1A 4CU6A 3AIVA 4AZHA 2J7FA 2WKLA 3ALFA 5BMXA 1NH6A 1UKOA 3GH5A 2WNZA 1S3HA 3VMOA 3RU6A 1MEHA 4FLQA 5A2BA 1CLXA 5K2ZA 1PX3A 4J3TA 1FHLA 4UQEA 3M7SA 3P60A 4AHPA 5AC8A 2EGZA 3CHVA 5EL1A 5LKYA 1E70M 4D71A 2WMFA 1EOKA 2E68A 2OJPA 1L6SA 1PAMA 5AB3A 3G0SA 5D2XA 1QNPA 5F7UA 3G8EA 1F2JA 3NL3A 4HZ7A 4HOXA 3IGXA 3I7SA 4P7LA 3ZJKA 2WLYA 3BMVA 1NP0A 3D0CA 4UTLA 3IMMA 3W6LA 1BG9A 4E2DA 1IIGA 2XWDA 1THFD 2BVYA 1W37A 3QW3A 3UWVA 3B9AA 1YQ2A 4PEEA 4TUFA 2ZWYA 3VGGA 2VEMA 1HXJA 4OIFA 3WL0A 2DP3A 1GQLA 6ALDA 1XD1A 4UR7A 1FOBA 3LXAA 1B2YA 1K6AA 3BAYA 2I14A 1H11A 1JF5A 2E6DA 3RWKX 3LI0A 5HUOA 4C1KA 4YHEA 1UYPA 4HOZA 5LHFA 4NJHA 4Z08A 3C3NA 4PCFA 5A8GA 4MJZA 2QUTA 3DI0A 1JI2A 1SZGA 4H2CA 3WD0A 1TCDA 3T78A 3Q2DA 4N9DA 2YW4A 3AS1A 5FK8A 3S5OA 4CNOA 1JQVA 4LS2A 1BFNA 1R86A 5E0KA 1OF6A 2QCDB 5D8ZA 4M7SA 2BY1A 4TTUA 2EEXA 1QOQA 4UTFA 1YXCA 2QMKA 1JCXA 1KWKA 3P61A 4I7VA 4OJYA 1H60A 1KXVA 2CFFA 1BQCA 3O1NA 1X1ZA 3THQA 4ACYA 2UY2A 1HJUA 1WO2A 1EP1A 1E0WA 2WSPA 3SCQA 3FKKA 3WUEA 1H0IA 4FNRA 4O11A 3F5JA 4HZ8A 4X0NA 1CW2A 4LWWA 4BCEA 1UD2A 3W28A 2WQPA 4DO5A 3VDBA 2BHUA 3UR7A 1QI5A 1CWYA 1TPFA 5HXMA 1BEUA 1FDYA 1QFEA 1SZNA 4MLRA 3N18A 4WD0A 2YXGA 3MP5A 3QMRA 1FCVA 1GOIA 1OYAA 4IMCA 3QM3A 4K37A 2O9OA 3ARYA 4W87A 3GB6A 4O18A 1UD6A 1O7AA 4MJ4A 1ONRA 4A21A 4TR9A 2MANA 3A23A 2XSAA 3DKLA 6TAAA 2VCBA 1TPC1 4PUEA 3G1XA 2C13A 2NW0A 1FCQA 1PS9A 1CEOA 5G4EA 3EWUA 2VFFA 2GPTA 5LNVA 2BNJA 1MYRA 2DPEA 3A5VA 2V82A 1L8NA 4URIA 3C2EA 4JZ5A 1FBAA 4LW7A 1VZWA 4GWEA 5U4NA 2CU0A 2GVJA 4HNNA 4HNTA 3H53A 3QMTA 3NQ7A 2CITA 2DEPA 4U33A 1ME9A 1JYWA 3TOPA 5F2GA 4A3UA 3KFTA 2J78A 2VCAA 1K7FA 5ABHA 2BXZA 3FY1A 1E6NA 4UNLA 3FN9A 2Y88A 4ICNA 4FHAA 2Z1BA 1I1WA 1JNEA 1GVOA 3LM7A 2D3LA 3M6DA 3O6YX 1QDSA 1XBXA 1QI3A 4HN4A 2BTMA 3MUAA 3DHFA 2NX1A 1HL2A 4JEQA 3UPWA 1EP2A 2YL9A 4MB4A 2QCDA 3B4UA 2NV2A 3W7JA 3ABRA 2QAFA 4UZUA 4UOZA 3UCQA 5E70A 8TIMA 5CPOA 1FX6A 2FFCA 2G97A 2IUZA 3CIXA 1TMQA 2XQRA 1KFLA 3EWWA 3PAJA 2BY3A 3W24A 1WP6A 1TPVA 4JTTA 5D38A 2DIJA 3K46A 3KVMA 1M7PA 1JCNA 1E6RA 4GUIA 3GXTA 2A5HA 1CXFA 1V03A 5BRPA 5AYYA 7A3HA 4D6CA 4LY8A 4HSNA 4JD4A 5IM51 3HOJA 1GTEA 4RLIA 2Z1KA 1RVGA 4IUOA 5EMUA 2YYUA 2P0OA 3BK0A 2QR6A 3C2FA 4M6PA 5I24A 4JS3A 2NZLA 3VGDA 4AZ6A 5FCZA 3HGSA 3NCOA 3WY1A 3F4VA 4ZL1A 4F79A 2KZHA 1EA0A 1VFUA 3MSGA 4IWWA 1VS1A 4J3XA 3T2OA 6A3HA 4PMDA 1N82A 3WJWA 4UFJA 1HIZA 2H8XA 2YDQA 1QBAA 1MFUA 3DBPA 1ZENA 1YTKA 1LJYA 4FEZA 3I7RA 5AHNA 4IMFA 3W53A 1SU5A 1E71M 4M8UA 3PSWA 1TV5A 4LVAA 3ANYA 3W2MA 3WH5A 4JX5A 1EUNA 1NAL1 3CUIA 3RMEA 5C5YA 2OSXA 3NJ3A 5C8BB 2V2DA 1TPUA 2ZZ1A 2W92A 3CUHA 2WC3A 1H7XA 1W3LA 5KINA 2D23A 1OX4B 2XFYA 1BWKA 4ZQCA 2PE4A 1G67A 2V9DA 3PUEA 1E6ZA 2CBIA 4TOQA 5E0CA 2W0UA 1B1YA 3ZJ8A 1GORA 1S5WA 2DZXA 3VM7A 4NXKA 3PBWA 2ZZ4A 3G3MA 4DWSC 1HJXA 3WQ4A 2O9PA 2CZFA 3N2MA 3VD4A 3O9NA 4TU1A 1GJPA 4BF9A 4MFDA 3W7NA 3BC9A 2ZTJA 4YCPA 1B3VA 3K8MA 4CU7A 3OLDA 1I45A 1VCVA 4Y6GA 1UR0A 3OLEA 1C29A 4OT7A 1NF0A 1EH9A 1KM6A 1WYIA 4N0RA 2QPSA 4MZYA 2FHCA 1G7UA 5A94A 4ATWA 1OFBA 1AL7A 2DZUA 4UIOA 4QFUA 4R27A 1C92A 1E1FA 5ANNA 1P6WA 3RLVA 2XPKA 3BSHA 4UNIA 4JR5A 3S1UA 1EHNA 4ZMGA 2JIWA 2A7NA 4NX0A 1VBRA 3VD3A 1ICSA 2ZTKA 1CXEA 1SMAA 1LBMA 4QCEA 1HP4A 4M24A 1H50A 4JTHA 3M5YA 3WFLA 4UTTA 4GUFA 4WKFA 3O2LA 1S46A 3AFBA 1HNYA 4D1IA 3NPWA 3CQ0A 4EK7A 3PUDA 5HDRA 1HT6A 5CKSA 5C6MA 1EXPA 4JTSA 2R91A 5FI8A 1LM1A 1ZCOA 1KLZA 4LOCA 3WFAA 4ML4A 1OX6A 3CZGA 5EPDA 3M7WA 4UOQA 3GNNA 4NT0A 5MHBA 3UG4A 3AO0A 4E8CA 1GOKA 1B4KA 3LHYA 3KRZA 4L4MA 4O1DA 1VLWA 3R12A 4MIMA 1WCGA 3IANA 4WKAA 4X0VA 1KBJA 3HG3A 1QHZA 2QQUA 5DBTA 5D03A 3CMJA 5BRBA 5AC6A 5BW6A 3NDZA 3FJ6A 3W1NA 3USBA 4Z2LA 5AHFA 3O63A 2YL5A 1J2WA 1VC4A 4WY0F 3WDIA 1UQYA 3N3MA 3VU2A 3K1DA 3JS3A 1W2PA 1VLIA 4BI6A 1GJWA 1FQ0A 3CT7A 2QQWA 4YL2A 2R94A 1E51A 4GI9A 4IPLA 1ZAHA 3G1DA 1W5OA 3G1VA 5J5RA 4EWND 3AZTA 4MPKA 4GI8A 4EAMA 2X1UA 1OYBA 5FL1A 2XSBA 4LTSA 2Y6ZA 5J5DA 3MUZ1 1JD7A 1RQEA 4FFFA 3GKFA 2V5BA 3POCA 4RZ4A 4PCTA 4IOTA 1DVJA 1RV8A 4ZQOA 1J4EA 1G01A 1K8ZA 5G2WA 1UOKA 4W84A 2G3IA 2E5BA 1LRQA 2CZ5A 4WX2A 4W93A 2WPBA 3TX9A 1OFQA 1T8XA 1GCYA 1WDSA 2A2IA 2C19A 3TONA 4O52A 2A3AA 4Y9AA 2NXIA 4IJBA 4ADUA 3NXFA 2DZSA 5ABFB 1E4LA 1T0OA 3P7YA 4IPJA 5FF7A 3GXIA 2OYLA 3HMJG 3OVPA 1XH1A 2NLIA 2AMGA 5DT5A 1GYLA 4Z1DA 1QPKA 2J9XA 4KGLA 5FD0A 3C61A 3TAOA 1ZALA 3PZOA 5F2IA 3ZWSA 5EFFA 5JBFA 3BG9A 3L65A 3LHZA 2V3DA 3MS8A 3QR3A 4U4MA 5D2YA 1CTNA 4N2YA 4HSOA 3VE7A 1D3CA 1QOPA 3SUVA 4D1JA 4GZJA 2Y7FA 5AC7A 2CKRA 4FFHA 5LHEA 1QNQA 1VEPA 3FFSA 2TYSA 1F4AA 4UFKA 4AEOA 1VFMA 3V75A 2E0PA 3MUIA 1KFCA 1OFPA 1TJRA 1V6UA 1CXIA 4UFHA 2VEIA 1KM3A 1C8YA 1JRCA 1PPIA 1H7PA 3GKAA 5AYZA 3WBAA 4D6IA 4YLWA 4M19A 3W7KA 3GDLA 2YLAA 4AWTA 1W3TA 3FAXA 1PV8A 3B03A 3DYPA 3BH4A 2A85A 3IIVA 1VHCA 2TMDA 2CNCA 3BW4A 3GXDA 4UCFA 5M03A 3MWAA 1LQ0A 3P74A 3TU9A 4KWVA 1PCKA 3UG3A 3DXIA 4GKLA 3OGVA 3PB2A 1UH3A 2Z0IA 3RPMA 1H63A 2PC4A 3AHVA 7TIMA 3WDQA 1K9TA 3FYOA 3WJSA 3VKKA 4LV4A 2RDUA 1UUOA 2QAPA 4IMGA 3W7GA 5EMYA 4BS0A 3POHA 3L4WA 3WF0A 3LGEA 2G8ZA 5FF3A 1QBBA 3PVFA 3WH6A 2PB1A 5H2ZA 1ZAJA 2J74A 5I2UA 5I3DA 1LWHA 4MVAA 3OZOA 3P5YA 2YFOA 3RK8A 5GNZA 1VQTA 2O7SA 2XJ7A 3S8HA 4HMEA 3WUBA 2VX4A 3GDRA 3WNLA 4IUGA 3MMWA 1W3NA 1HP5A 1Q6EA 3AIEA 4ZE4A 1UR4A 2Y7EA 1W9BM 3IGSA 3LHVA 1XSJA 3W7LA 3EMCA 4DWSB 4GZEA 5ABFA 3SCNA 2IXUA 5FEWA 4P8UA 1VPXA 3PZQA 4HPXA 2V5CA 4DUVA 3DHPA 2E9MA 3HB9A 3W2KA 4M5PA 1RPKA 1XCXA 1XRVA 1G5AA 1W1TA 3M46A 4M81A 4F9JA 1F6PA 3CIVA 4ZZ9A 1AW2A 2FH8A 1WZMA 5GQBA 3BW2A 4AISA 4N42A 1TMHA 3BO9A 2OWXA 3PIGA 1FFQA 2VZSA 4AC1X 4QSHA 2YLLA 3IJ9A 3QHNA 3KRSA 1CECA 2WLZA 1N7KA 2ZE0A 4HIBA 5HNNA 3MSDA 3N12A 2GJLA 1E6PA 4JL2A 4XTDA 1CBGA 4BQ5A 1GZJA 3CB8A 3IAPA 2AAAA 3PZMA 2NX9A
chains in the Genus database with same CATH superfamily
2Q1ZB 1QU4A 4DJFA 1W6NB 3I2DA 2GN7A 3DFYA 4AEJA 2J6XA 3IJ7A 5CYYA 5HINA 2J1UA 5KZDA 4RNJA 3N34A 3VVGA 1UZ4A 3VOFA 2RJHA 4AU0A 3U5UA 4MGSA 2D2GA 2XIOA 1KM0A 4F0SA 3MANA 1Q3NA 4Q4RA 2OZTA 1KXHA 4RW5A 9XIMA 4F8AA 3GU1A 1GVEA 1ULFA 2BP6A 4LKDA 1P7TA 5EPAA 4JKKA 3ITTA 3N4MA 3PVBB 2PBOA 1H1ZA 2OODA 2JXAA 1RUH2 3WNOA 4Z92B 3T4HB 2VI0A 2VQAA 4LR4A 4O0KA 3IRSA 4JFTA 3VYLA 1FVPA 1XCFA 5AVPA 2ZYFA 5E88A 1Q2SA 1A5NC 4EAYA 4XUGA 4WOQA 1V6YA 4LH8A 3AIRA 3SN4A 1KQRA 2DSKA 1S55A 3O06A 4V15A 3SH5A 3LBMA 1ZA7A 3TXVA 3VD7A 2QKFA 3KDNA 3OEAA 2RAGA 3T8QA 5IHSA 4Q7BA 4NJKA 2V73A 1YIFA 2GQ3A 5SV5A 3EDDA 1W8HA 3PJQA 4C8DA 3VIGA 2WC2A 3ARUA 5FLIA 3VHOA 1BWVA 4C7FA 4MY9A 2GJRA 4EV0A 1X82A 1OK6A 1XIGA 2O9TA 3CTTA 1S5VA 1NM9A 4P9IA 3SCFA 3W88A 2Y8KA 1DQXA 1W6NA 1R8LA 4ARXA 1FATA 5IDIA 2IZWA 4CD8A 1YPFA 2YSWA 2Z1VA 3ONBA 3J7NA 3M9YA 2FPYA 1MZHA 1GZWA 1IXQA 4CXYA 1H5YA 3W9AA 4LITA 2EXHA 1X97A 1US2A 3M5VA 2QT3A 1VBC3 1D0GA 1TZ7A 2IPGA 4MTVA 1I0DA 4P5YA 3GFYA 4A35A 4AVCA 2CWNA 3EA1A 2ISWA 4B4FA 3IGUA 3CMGA 1AQHA 2J8TA 4TX9A 4L9YA 2BB0A 2FVMA 4LT9A 2W9MA 3AK0A 4LJHA 3W2NA 2OS2A 3QOMA 1O68A 3EMQA 1ZBE1 1M7XA 2D2JA 4H1ZA 1ASJ2 4IJRA 1BAGA 4MNKA 3VZKA 2R9RA 5ABEA 2Z42A 4N9HA 2JDHA 1EPXA 4AD5A 2VNOA 2EKCA 1B35B 2BBVA 2W3ZA 5T5PA 2JEPA 3H3ZA 5JSRA 3T2PA 2Q0AA 1CXLA 1GP5A 4XVEA 2OXBA 1JXKA 3E0LA 4K3ZA 3I65A 3N7JA 3N2BA 2JEMA 5C3SA 2G9GA 1QJFA 2J1EA 1SSGA 2QQJA 3TLQA 2WJDA 2EAAA 5I3KA 2W68A 1V93A 3OQ8A 3PPGA 3AMCA 1QHOA 2F84A 3HMYA 4NRRA 1MS3A 3KQRA 2WQDA 1V3KA 1FUYA 4PCPA 5EV7A 5A7SA 3WLTA 4J1XA 3RO8A 3CZJA 4CNTA 5GNXA 3REQB 4Q3MA 3KBWA 4CPBA 3ZFHA 4GQQA 3M0MA 4O57A 4CN6A 1M04A 5KC6A 3KVKA 2YC4A 2WPGA 4GK8A 1D7KA 1SLBA 5A1FA 3PIJA 2GMMA 2PU0A 2WDBA 3L4YA 4PCNA 5A70A 1WOBA 1J11A 3LZ5A 2E31A 3CF6E 1MW3A 3SN1A 1WZAA 3LHUA 4ZQMA 1EP3A 1X1NA 2VXNA 1Q6GA 1HQTA 1IS3A 1WD3A 5JR2A 2R062 1A80A 1VBA2 1XQNA 4QX1A 3BB6A 3RPQA 1RP8A 4JFSA 2UWFA 2XFFA 2WYSA 1KRAC 2QJIA 2PDBA 2O0TA 5I3JA 3W7MA 1B35A 1UY3A 1EFZA 2WS92 4WVMB 1B30A 4ZVJA 2P8BA 1WW4A 2CDOA 1SZRA 1XLFA 1DDLA 3C3UA 4B7KA 1GYKA 2X7VA 4PC8A 3PTMA 3WELA 5JPNB 1R082 2FPTA 1GWMA 3VI2A 1WUVA 1RVF3 2QIWA 1M06G 1XLCA 5F6KA 1KR1A 5C54A 3MMDA 3Q58A 1PX4A 2RUSA 1C8QA 4GJ1A 4HK9A 1U1UA 3NMBA 1JCMP 3BODA 5CFDB 5CCZA 3LOTA 2Q6ZA 2FDSA 4G6CA 3REQA 1RUD1 2HEVF 3IUDA 1W17A 5A3UA 3PVOA 3W73A 3RLHA 3ZSJA 1TZOA 1UWRA 1RXOB 4JKMA 1HV1A 3WD3A 5K7PA 1WKFA 1T96A 4RV3A 1E40A 1Q5MA 4YVWC 4S3JA 3QR0A 3RVHA 3WP3A 1KFXL 4OULA 1L8PA 4J3VA 3IEBA 4UFLA 5AC91 4S39A 3TRSB 1DF0A 5BMWA 3CMFA 3T8LA 3GR8A 4Q0SA 3DOPA 1DJNA 2H9AB 4LBKA 3NR0A 4IEVA 5A3LA 1LLOA 1AR82 1RHI1 4WVMA 2CDPA 2QBXA 1GG1A 5EB8A 4RE4A 1RP9A 3VZXA 4OBSA 2UY4A 4F2BA 3ITOA 4NNAA 1DWIM 5LEJA 5CG7A 5CNAA 5A3MA 4E8DA 4Z07A 2EAKA 1Y0EA 4NL1A 5EQUA 4XZ9A 2F6BA 3VGEA 3HBKA 3FKRA 1GHRA 1OVDA 3GHRA 4CVWA 2BMBA 3IB3A 2BODX 4HG6B 1HGWA 2GMPA 4ZO6A 5DZGA 2VRKA 3S2JA 4YLZA 4GQ0A 4GVFA 2EXKA 2WC7A 3UWEA 2VXJA 3TEYA 4W7WA 3AYRA 5BOOA 1W2OA 4IISA 4QM1A 3M3IA 2R1LA 1ZZ7A 3GTNA 2HTMA 4F0MA 4QWNA 3KXQA 4QLKA 3I3QA 4AG0A 2J9YA 2ZUTA 4CQ8A 2VZQA 3CASA 4P5HA 1W1B1 2XM2A 1YNPA 1JPDX 2QQVA 3HV9A 3SW6A 5I6SA 1RUC2 2RHGA 3GJAA 1LQ2A 4FNTA 1GOQA 4ONVA 3U11A 2PDFA 3N9OA 1NQKA 5CQ1A 4UTWC 3TP4A 4EE9A 1ULDA 4QT6A 2H9AA 4C6PA 2XJUA 2NMNA 2ENRA 1DJHA 3ITCA 4JIIX 5DT7A 4ITCA 1G1YA 4S2BA 3UXAA 2ID4A 3MO4A 2E3ZA 2HDJA 1LZOA 1P1XA 1BVVA 2QV4A 2HBUA 3NL5A 3TJLA 4LBOA 2DVAA 3P8IA 3IBMA 3ARTA 4LEFA 3LEKA 1BVZA 3OZPA 1RUE2 4FQ4A 1YYAA 2CC0A 1D3GA 3L66A 2PF0A 4HNOA 2NQHA 4JFVA 3TN91 2ZZ5A 3LM3A 1LOEA 1W2UA 5KR7A 3SCWA 3TYUA 3KCYA 3N19B 3HN3A 3L12A 3NYZA 3VL8A 3MJMA 1KJLA 4NRQA 2HJPA 1L2UA 1K8YA 4Z1BA 2EBNA 1JXNA 2D2HA 2W62A 4ZFMA 1ZCCA 4XAGA 4LVGA 3U07A 4QEHA 3WMSA 3H8OA 1QIQA 3LHWA 3VN4A 1W1VA 4K39A 1BEV2 1ONXA 4BA0A 3AMGA 3D6EA 3I6RA 1D2QA 1ECQA 2ACRA 2VMDA 3JU2A 4WIWA 3WQVA 4QU1A 1TSIA 1CAUB 3WD4A 3W1LA 5JXIA 3BGJA 4AEEA 2VVFA 3OOXA 5I3FA 3NZPA 2QIIA 4X9YA 2V8ZA 3UW6A 3H2NA 4YG0A 3CH9A 1SBFA 1GEQA 2OZ6A 2A1YA 2RDTA 3RMYA 3MSYA 4GYPC 5FP9A 4QG9A 4LO4B 1Z3NA 1WKDA 5LW9A 1FMD2 2P3ZA 1NTHA 4HJFA 4Q7IA 2J24A 4OCTA 2FVLA 1WOAA 2C6QA 3EXSA 1WGPA 2XIMA 3QHOA 3QGAC 2FB2A 1LG1A 4O13A 2JDMA 5CKMA 1FCBA 2G3NA 4FFGA 4FXJA 1RUD3 3PTKA 1JULA 1OC6A 2FHBA 4I5XA 4F0KA 3ARXA 4BQ2A 1MFVA 1BQPA 1LECA 3D3AA 5U7SA 4Q4V1 4E4PA 4L2NA 2B42B 4CYDA 1F5JA 2HWD1 1B54A 3LMZA 2H0BA 1IR2A 3WQ0A 3VDDB 4TMCA 2ZZQA 3ATZA 3T1GA 2AREA 5AC93 2FVKA 4QKBA 1PNGA 4PDWB 1F73A 1TV4A 3F4CA 3RNSA 2JE9A 1QJX1 4KH2A 4C1NB 3J4UH 3OBZA 1GNHA 1H8TB 3B04A 1CAUA 3BSMA 5TNVA 2OX0A 4LHSA 5L9VA 5JBDA 5EY5A 1QW9A 3C4UA 2XH6A 1L2QA 2GNDA 1CLVA 3RM9A 5F1VA 4TIMA 4D6JA 3BV7A 5CAZA 1DLLA 4RUBA 4QKDA 5BYWA 1OURA 4B3LA 4MAVA 3EA2A 4E6MA 3FJ4A 4Z0SA 4FMVA 2BG5A 1STMA 3G24A 3PZVA 1V0NA 3MKCA 1BZWA 2D0FA 4K20A 2G5WA 1YTEA 2LW8A 1FH7A 3MUY1 3D3FA 2Y5EA 2OO0A 2ZZ6A 1R091 1L7LA 1WCKA 4KNCA 1J93A 5I3IA 2EIEA 1K4HA 3H6OA 4BQ1A 4LVFA 3SAZA 4IIDA 2LM3A 4Y33A 1H1NA 2V5DA 2PMQA 2DVXA 5JH1A 3ZYZA 3BCWA 3E5QA 3KCXA 2ZGLA 1LEMA 5I3GA 4PMZA 4ZGYA 2XGBA 1H6XA 3DAQA 3A47A 3KWXA 2LTNA 1DGLA 4L99A 1W2TA 1XIFA 3FUOA 3UCCA 2YPJA 1K6WA 3ZLGA 3B8IA 2JF7A 2X0HA 5GKAC 2XIJA 1FV3A 3VDDA 3L9JT 2OTDA 3C8NA 1WX0A 1LYXA 1MVYA 3STFA 2RMU3 3KOXA 4QXHA 3M0YA 3M8LA 4QGLA 1JYVA 3AYSA 4LNYA 4LUTB 1PGL2 5C55A 1XNCA 1R46A 5DAPA 2E63A 4HT3A 4PMNA 4D8AA 4C1NA 4GI4A 3V7PA 4HA0A 1YRRA 2Q01A 1H8TA 1GOXA 4ZCWA 1QXJA 1OFAA 3HF3A 4RJEA 1VR6A 2BS9A 3C0SA 3SCPA 1I0BA 3FCPA 1C8M1 5H1WA 4LYQA 3SFKA 3VIPA 4YARA 3AS0A 3MU7A 2XFRA 5LSMA 2R7EB 1RBOB 2YXSA 2QQIA 4N9CA 5CLWA 2VUAA 1T99A 4BCUA 3W3OA 4EXQA 5JOYA 1NF7A 4Q5OA 2HYKA 3ZMNA 1AQMA 2HISA 4WLCA 3W1AA 3SDOA 1JYNA 5BRQA 4GVHA 2WCGA 3PPHA 3GC2A 1PSCA 1Q7ZA 4AY8A 2NQLA 2XGIA 4JAWA 1X7IA 1MI3A 4L61A 1QW8A 3FX4A 3USUB 4QB1A 2FGLA 2E51A 4O8AA 4AEKA 1XINA 2YB7A 3J9SA 2V3GA 1B31A 3DFNA 4CCLA 4W89A 4D7TA 4W85A 2V5LA 5A6TC 5J48A 1QO5A 5I78A 3QH2A 3SGGA 4YTTA 1UPIA 2R6OA 5D8AB 1P6BA 5G5IA 3QPEA 3VPLA 4QE1A 4YW2A 2E9QA 3N35A 1V6WA 1TREA 3BQ5A 3POWA 1IT0A 5FREA 4LUTA 1W1YA 1BD0A 2XVPA 1UC5A 1FTXA 3HQRA 4Z0JA 5C9UA 3BMXA 4EWEA 5FAGA 1TWZA 4CU8A 3B40A 1C93A 2TEPA 3TTEA 3SMHA 4MADA 3M16A 3OF1A 4XILA 1BK0A 3POJA 5F3GA 1KGWA 4HVQA 3LLXA 3A0NA 4CCZA 1J3PA 1GP4A 4LCSA 2XLGA 3STGA 2KD7A 1NJJA 2V0TA 1M6JA 4WSHA 3H2AA 4JKLA 4QPGC 5CJMA 1GLHA 1O5UA 2ADEA 2BQPA 1YLVA 2PBGA 3A64A 4F0RA 3SB0A 1UMLA 3M0VA 4C6QA 3HA1A 5HPOA 2YV8A 3YPIA 4YGDA 3MW7A 3LENA 4FAHA 1D4M1 5K3VA 1A5BA 5L9RA 5ISLA 1I2QA 4RQPC 4WKHA 4HN0A 1TTJA 4I9JA 3E97A 3USUA 4YTSA 3Q8BA 3NOEA 2HWE2 2WWSA 2DZBA 1JZ3A 3R0DA 5DG2A 4LO5B 3BW3A 1MWOA 3BU0A 1DIKA 1HTIA 1OZQA 2W63A 4JGZC 4LALA 1JIBA 1S5TA 4IXLA 4QX2A 1RA0A 3H24A 2QJJA 3HQ1A 1QJX3 1TTPA 4KGQA 3TYDA 3F03K 4CCEA 1S38A 5D8AA 3A4XA 4XUPA 1N2VA 1E5NA 3QH7A 3VKAA 2FCVA 2YCLB 1EDQA 1LU1A 4FF7A 4HCHA 4I5RA 1UC4A 4DXKA 2ABAA 4H41A 3PC0A 1SFNA 4GJJA 4M4PA 3M1HA 4PHZA 1QJY1 1IHMA 4LHKA 3MDWA 3UD6A 1SBEA 1S4CA 2WL1A 2JEQA 5A69A 1G9AA 3VGFA 3W00A 4DBWA 4KGGA 1VBE1 5KSWA 4W8BA 4Q4Y2 4PSRA 1XDLA 3G6LA 3HPZA 4OHZA 1OGBA 3EBRA 3L2HA 1AYM2 1JU3A 2ZBTA 1GOWA 5G1MA 2RS31 1FXQA 3SR7A 2F61A 3JQWA 2X10A 3W07A 1UA7A 2IQ0A 1XJBA 1OA2A 5DUWA 1Q8OA 4S2CA 3L4TA 3HM7A 3P82A 4GXPA 1BXBA 1OJXA 5E09A 1ADDA 1KRCC 4IQPA 5H8PA 5C7GA 4UTMA 3VOGA 4N6EA 1XYLA 3NUKA 4XBQA 2V5KA 5I0UA 3DCQA 4ZB2A 4IIHA 1UU5A 4FIQA 1TMLA 4C5ZA 5DY2A 2XFWA 3ME2A 1RMU1 2CESA 3WW4A 5DXXA 3BAWA 4IG2B 5D9MA 4DY1A 3B8SA 4AUBA 2XUMA 1TME2 1DTNA 5M0TA 3N7LA 3HJEA 3TTQA 2WBGA 3U2CA 1PO11 3C3VA 1UZZA 5IVJA 3GR4A 3MT1A 3NIYA 1PMJX 1SVDA 2BUKA 1F7BA 1ZRQA 3WF4A 3WLPA 1GU3A 4ZONA 1UD5A 3V0BB 3AZZA 2WNUB 2POTA 3VKDA 2WOQA 1UR2A 1LHOA 2CWXA 3S57A 4L4LA 1WA4A 2HJIA 2Y85A 5DAQA 2YBVA 3SY1A 2YGYA 4OHYA 5FJHA 2J1SA 3AISA 3G1HA 4KWUA 5JUVA 2W6RA 3W7DA 1W3XA 3FVDA 1A4LA 4KEVA 1BPLB 5JVLA 3ZFFB 3U1XA 4NAEB 1H49A 2GJXB 3G1SA 3VKLA 3GWQA 1A3HA 1JCYA 2XWBB 1S2AA 2GP5A 1E0TA 3H55A 4AR2A 3GBDA 2DDUA 3BOFA 4ORMA 1YRZA 3N2CA 4XZWA 1F31A 2Z28A 2XWEA 1WAUA 1R1ZA 4JZRA 1TIMA 1RUG3 4CDWA 1U5HA 3WVJA 1U1JA 3LPGA 4O1CA 1YIPA 2WCSA 4LF1A 1JF6A 1VYRA 2A6LA 3DUGA 2W1UA 4W5UA 4RGKA 1PIIA 4P5UA 5JSOA 4W6WA 4QDWA 4UTKA 2WFF2 3FLRA 3N9MA 3O6AA 5DO8A 4WCJA 2WZIA 4MYXA 3GHMA 3UJEA 1AL8A 1GTHA 3WBXA 1W9VA 1WCSA 2FDHA 2DY3A 1EJVC 3UR8A 4LAOA 3MHFA 3QLLA 5FMBA 1UYZA 3B8UA 1PBGA 3V0BA 1Z42A 1BCXA 3Q8FA 2WNUA 1HX0A 3C52A 1DQ0A 3ZFEB 1X38A 4HMCA 2YDEA 4SBVA 1CPUA 3RPDA 4LXLA 4S2DA 4N7IA 3KV9A 1OD0A 4YPJA 2ZZJA 1H2LA 1VRH1 4P9JA 4R9AA 3WLMA 2VZTA 5IFPA 2J47A 3MTWA 4GCXA 5MF5A 3VDCA 4LB4A 4LT5A 4S3GA 2QNKA 3DG3A 3PULA 3DEMA 3TW9A 2P3KA 2BEOA 2XL9A 4RGAA 3GE7A 4JVAA 4NAEA 2GJXA 2ZX0A 2VGIA 5IW0A 3OUJA 1MQTC 4NJ4A 4I2OA 4H4IA 1H7WA 1BKHA 1YFXA 1IWPA 3WFZA 4IGSA 3GDTA 4M0NA 4G9SB 2HVMA 2OEMA 1KBKA 3WQWA 1HRI2 5KBFA 3AYAA 1VPHA 3ZYGA 2Y6GA 1K45A 1XRUA 3DHDA 3AP7A 3L67A 3DXTA 4LKFA 3N7MA 3N2XA 4Q8KA 1JDCA 5DBUA 4PN2A 2ZDRA 1WW7A 4CQAA 2Y8VA 1H1YA 4C91A 3ORWA 1EX5A 1FP8A 2RVAA 3RLGA 4AWEA 4ZODA 3TYCA 1VBE3 2XGXA 1LHUA 4I9AA 1E3XA 3SRDA 1I3HA 3O8AA 2IXCA 1ALYA 4AFAA 1QDOA 4GO9A 1UKPA 3RITA 1DWGM 1XV8A 5GZGA 2JGYA 4ZXEA 2RS33 1O8SA 2OPWA 3VCCA 3IDAA 2QJVA 1R5YA 3RMXA 3ZFEA 2JG8C 2QDHA 1N3OA 2VR2A 2NLYA 4LSBA 1RXFA 3SUTA 1L6YA 4JTOA 3NQ2A 1R64A 5FR3A 3FW6A 4XBKA 3CQHA 3TC7A 2DVDA 3LB9A 4DJDC 4LC8A 3S1VA 1EAH2 3AHZA 4OI4A 5FYMA 3RJYA 3WP5A 3OVQA 1EB3A 4C6MA 1F3WA 1SG3A 1KS4A 4ZA0A 4GZEA 2Y63A 2X40A 3LQLA 4Z2KA 1XYMA 3F5KA 5LGZA 1XLMA 3AZXA 4XHXA 1Q4WA 2NV1A 2DORA 1TE1B 3KRBA 1OD5A 2Q8ZA 4K1GA 3N3HA 2O4MA 2A6YA 3KL0A 2ASHA 4PRWA 2OLHA 1KDMA 1VGAA 4W4QA 1A3KA 3S46A 2VPVA 3GFXA 4DF0A 5DXYA 2WZR1 1XCWA 4SLIA 2OLAA 1OT2A 4FX7A 4Y1XA 4P2VA 4IL7A 4LPLA 4OUIA 2P10A 4EROA 1BWLA 2P34A 3QSRA 1X7FA 2ACQA 3GW0A 4L6HA 4XPVA 4E2VA 4K8HA 5C2GA 6XIAA 3VDAA 2QJGA 2UY5A 1X6LA 3N7KA 3SCGA 4ZXLA 2QQKA 4HZFA 1C8XA 4DXTA 2G9FA 4HMDA 4INFA 3E12A 4Z1AA 1F76A 1DJIA 3B0UX 4C6CA 1UB3A 1VFFA 2JKXA 1C91A 4Q4W1 2OO6A 4LANA 3A7QA 2PMWB 1R3VA 4WM8C 1WDPA 2HS6A 1AZDA 3H50A 4LBRA 5FYHA 1XNKA 5CEWA 2C0AA 3GAKA 3MP4A 1XDJA 3EB7A 4OVXA 1H9WA 3LCGA 4QIUA 1G4PA 3K5XA 5FZCA 2CW6A 2VW0A 2VW2A 4JYDA 1ECEA 4IIGA 4EP8C 1XYAA 3DYOA 4QHOA 1YKWA 2Y7GA 1LF1A 4C0BA 1ZBWA 4H7CA 3GXUA 1ELSA 1TE1A 2ZC1A 3JZUA 4KQNA 3UWYA 1TR1A 2PLV1 4H8VA 2YOCA 4ARYA 3BV4A 3TXZA 2QCMA 5K0UB 1W9WA 3ZO0B 4COUA 4ZU4A 1BTCA 5E16A 1RGSA 1XLEA 2Q4SA 4KFOA 1BF2A 3W1RA 1T8QA 4J3SA 3NDYA 4IFOA 5A8QA 3VZMA 4D2JA 2RS12 2PQQA 2B39A 1IWBA 3H23A 1D2KA 1UQZA 1TMF2 1OEPA 5MKGB 1BGAA 1XH2A 3LERA 4DLFA 4Z2JA 4EZHA 3WMCA 5EMKA 4HHHA 3URNA 1E15A 2A6WA 4N9EA 4Q0VA 3DX5A 3GAYA 2BERA 3OYZA 4JCMA 4FLSA 4BLIA 1ZRCA 4AZIA 3RF9A 1XPGA 5FZBA 1JPMA 2WNWA 4DBDA 5I3HA 4RKAA 1XOYA 1B35C 1QQP1 4K8RB 4BIOA 5FY0A 2BOIA 1V3MA 1UKSA 3CUZA 5FRAA 4AD3A 1V3IA 2WZHA 3ABQA 1H7OA 3TN4A 3WDYA 1DG6A 2PSNA 4G4FA 1G9HA 4D9PA 3B8TA 1P1MA 3E02A 3VBHB 1AZ2A 3MW4A 4K3UA 1MQQA 2YX0A 3FJNA 3AMLA 3VCRA 1YXYA 1DIEA 5J3UA 3W82A 1SFJA 2PZ0A 1J9YA 4YW6A 3R8RA 5A6MA 2HBTA 1CZVA 3AIWA 1Q8JA 1TWWA 3GK0A 4KFPA 4AQSA 3MV11 4MZUA 1LENA 3CU7A 3TW7A 1HJQA 4AGVA 4GXWA 3V16A 5C2XA 1VB2A 3ZSSA 5AHEA 4JYFA 4W4ZA 2RKXA 4H9UA 5JOXA 1EYEA 3P67A 5K0UA 5CG0A 3PUIA 1AF9A 3C6CA 4RX0A 3T55A 3SO7A 3FXYA 1JODA 4M01A 4LKEA 3AZWA 2PZNA 3KV5A 3TK7A 1AJ2A 4HOOA 1JPIA 2V30A 3GTHA 4M1BA 2A6NA 3BAJA 3DH7A 4RZ5A 2E09A 3SEEA 5MKGA 3Q8AA 4BZYA 1KFBA 4J28A 3MI8A 1QU0A 1VBB3 4MKVA 3BLFA 1IPSA 5GNYA 3NL2A 1I4NA 3WMBA 3ZXAC 4DO4A 3N14A 3UPMA 3OEXA 2Y0OA 2AAMA 3KCJA 1DQ6A 4D94A 3NW4A 1JZ2A 1GQNA 1H7NA 4TXWA 5D2TA 2ESCA 1ISVA 4V27A 1Q85A 3JQXA 1YQCA 5IXEA 1CX9A 4UOJA 1JPHA 3S5NA 3A3HA 1J3QA 2E1WA 3QQ1A 4ECLA 1AR72 2BFUS 4MNJA 4XD3A 2X29A 3VBHA 3TC6A 1RUJ1 1ZPTA 5A6ZA 4FX6M 1KM5A 2X8RA 1EYBA 3O3RA 3T4WA 2DJLA 4Z8BA 3LK6A 3WIJA 3NWKA 2ET1A 3SLIA 1B3ZA 1UBSA 3UWUA 2ZGQA 3VO0A 3W83A 1K7XA 3BLEA 5A7OA 4TLFA 1NAEA 4MDPA 3EB2A 4XKYB 1KQYA 1U83A 3GBFA 4IM4A 5DXDA 4E2BA 4DM1A 3KUMA 5CFDC 1MZ6A 1CZTA 2YY1A 4KT2A 4QD2A 1WE5A 4NNCA 4QISA 4AYGA 1H3GA 1B4EA 1QW7A 2XG9A 3W1XA 1EZWA 3CPRA 3MKKA 2H0VA 2XPJA 3OA3A 4K6BA 4XUNA 2D5FA 3AXHA 1YUDA 3CU2A 3U5YA 1LESA 4Q2FA 1SFLA 4XISA 4BR1A 2I07B 4Q4W3 3JR2A 3RCMA 2OMAA 5JXJA 1RD5A 4QQOA 1K9DA 1V0KA 5JQ9A 2NSXA 3BN6A 2EPMX 2O9RA 1Z0HA 2JJ6A 3OG2A 1HB3A 1GW1A 2FHRA 3AYTA 3GGLA 1R85A 4HP5A 3UZ5A 1DYPA 3BJSA 2R6QA 3ILRA 4IERA 3I3BA 3AYVA 2LLEA 1ZU8A 2EIBA 2AENA 1SFYA 2QXWA 5DQPA 1ISYA 4EN0A 3CO2A 2DBIA 1B9BA 4YTQA 3LE0A 1P0DA 3WDUA 1BBT2 3DUIA 2JG9C 3QW4B 4B5NA 1H8VA 2GGHA 2OSWA 2W3JA 3NQBA 1AXKA 2P76A 3COTA 4LCQA 4E9KA 1OQFA 2J7EA 2QCCA 3EXTA 2PLV3 2DFBA 3QQ0A 4JX6A 3WDPP 1TJ2A 1UP0A 3EWYA 4QP0A 3H21A 2QQPA 1HXS2 5E6HA 1OK4A 4XAZA 2C9AA 4LNCA 3RX3A 3F4NA 2OU4A 4XKYA 5I79A 3G1YA 5FL0A 1PE1A 1I9CB 1W54A 3LDKA 3LF7A 3WQCA 4FP2A 1LRTA 4KRUA 4MUPA 2HV5A 1AR91 2QCEA 1SUXA 1W8SA 4CCMA 3BTYA 1KW1A 2J8GA 2R0HA 3EYPA 1V6KA 3C0QA 3TW6A 3BXWA 1W39A 2TBVA 1OADA 3WQFA 2B4KA 4FXGB 4HD5A 1YC61 6REQB 5A6BD 4WK9A 3PLQA 1QQP3 4BA6A 1LOBA 3VLBB 3BDKA 1JZ8A 3A12A 1XIHA 3P14A 4AZ7A 3KMHA 1WLDA 4CU6A 1FWJC 1N3PA 4ZB5A 4ICMA 3UYJA 3CV6A 1RUOA 2RJKA 1UW9A 4WJ8A 5KHHA 3GH5A 5LATA 1R3TA 1E9YB 5A2BA 1QJU2 3T1MA 3H70A 1KXGA 2C4XA 2YMZA 3P60A 4AHPA 5AC8A 3BWWA 5F3CA 1PAMA 4LMFA 2D6NA 1GKQA 4DIAA 1FPN2 4HOXA 3SXWA 3ZJKA 3BMVA 1WXZA 3IMMA 2XWDA 1W37A 4MKSA 5FBJA 4L11A 5IK5A 1H1MA 1B2YA 4ISQA 3LXAA 4N53B 4YHEA 4C1KA 4Z08A 1O4YA 1JI2A 3MPGA 4HN8A 3T78A 4N9DA 2YW4A 5FK8A 4CNOA 1R86A 3OTFA 4LEQA 1LHWA 4CU9A 4TTUA 1FWFC 1UP2A 4KH9A 2IVIB 4B5UA 4V2VA 4UT5A 2QMKA 4OJYA 3RZLA 1H60A 2CFFA 1LCLA 4D7SA 1KRIA 3O1NA 1W1IE 1Q43A 1E0WA 3MW3A 4AHZA 2DUPA 1H0IA 4O11A 4LWWA 5JOWA 4BCEA 1YI9A 3VDBA 3ILNA 1QI5A 1RUJ3 2D7FA 4NASA 5EYYA 1RUNA 3O1VA 1FDYA 1TX0A 4NHYA 4FBFA 4JPGA 3H2OA 4M51A 3BLDA 3B0YA 3VNJA 3WQEA 4IMCA 4NP7A 4W87A 3KT1A 4MJ4A 1O7AA 4TR9A 3E0FA 1ITQA 5FJKA 6TAAA 2XJTA 3N3TA 1I6NA 3LS9A 1FCQA 1ZBE2 1G7YA 2GPTA