4UFIA

Mouse galactocerebrosidase complexed with aza-galacto-fagomine agf
Total Genus 211
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
211
sequence length
644
structure length
641
Chain Sequence
GAYVLDDSDGLGREFDGIGAVSGGGATSRLLVNYPEPYRSEILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYELDENYFRGYEWWLMKEAKKRNPDIILMGLPWSFPGWLGKGFSWPYVNLQLTAYYVVRWILGAKHYHDLDIDYIGIWNERPFDANYIKELRKMLDYQGLQRVRIIASDNLWEPISSSLLLDQELWKVVDVIGAHYPGTYTVWNAKMSGKKLWSSEDFSTINSNVGAGCWSRILNQNYINGNMTSTIAWNLVASYYEELPYGRSGLMTAQEPWSGHYVVASPIWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVALTDGLGNLTIIIETMSHQHSMCIRPYLPYYNVSHQLATFTLKGSLREIQELQVWYTKLGQRLHFKQLDTLWLLDGSGSFTLELEEDEIFTLTTLTTGRKGSYPPPPSSKPFPTNYKDDFNVEYPLFSEAPNFADQTGVFEYYMNNEDREHRFTLRQVLNQRPITWAADASSTISVIGDHHWTNMTVQCDVYIETPRSGGVFIAGRVNKGGILIRSATGVFFWIFANGSYRVTADLGGWITYASGHADVTAKRWYTLTLGIKGYFAFGMLNGTILWKNVRVKYPGHGWAAIGTHTFEFAQFDNFRVEAAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GALACTOCEREBROSIDASE
publication title Azasugar Inhibitors as Pharmacological Chaperones for Krabbe Disease.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 211
structure length 641
sequence length 644
ec nomenclature ec 3.2.1.46: Galactosylceramidase.
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02057 Glyco_hydro_59 Glycosyl hydrolase family 59
A PF17387 Glyco_hydro_59M Glycosyl hydrolase family 59 central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 4ufiA03
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4ufiA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4ufiA01
1UH3A 1DQWA 1V0MA 4XWUA 3TP4A 3WF1A 4WSJA 2YX0A 3M5ZA 4W9TA 3L5AA 3IVSA 3UY7A 1UQZA 4D6FA 3ZT6A 4HP5A 1OYBA 4JTEA 3K4AA 3OLDA 4NJIA 5K9DA 4Y8FA 1QPRA 3WNMA 3LLDA 3C2OA 3W7MA 2WNQA 2V38A 1NF0A 3W75A 3GXMA 4UR7A 5A2CA 3SUUA 1EWEA 3NPUA 1W5QA 4NUWA 3E96A 1WZMA 1UBSA 2W0UA 2PB1A 1WCGA 3SCUA 1OX4B 2V3FA 3S6TA 1ICSA 1LG2A 2HMCA 5AFDA 4NJJA 3J7HA 3F5KA 1XYZA 4WXYA 3HG5A 3TJXA 1VAHA 1RV8A 4U5KA 2CXGA 1V6VA 5A94A 2BVTA 2ZE0A 3MP5A 4IMDA 2XWDA 3K8MA 3W9ZA 3G1VA 4QAWA 1Q6EA 1FX6A 1H41A 2ZUMA 4HMEA 3GX9A 3TA6A 4J3SA 3AIRA 2V82A 3WFAA 1OSEA 2LLEA 3NQEA 4F9JA 3CUJA 1EWDA 2E40A 3QHNA 1OFQA 5I2UA 4B9YA 1OABA 1W1PA 4F8XA 2J24A 4YMZA 4N9BA 3EBVA 4GO8A 1K8YA 5EMUA 1M7PA 2ZZ5A 3NXFA 2Y88A 3YPIA 2J79A 2YDQA 1Q6FA 5D38A 4U31A 7A3HA 1I1WA 3EXRA 1P0NA 3ARZA 1A50A 2ZRZA 3LBCA 3M7SA 1XRVA 4YPJA 3BMWA 2PWDA 2ZFAA 1VGAA 4DELA 1KGWA 3C4UA 2OLHA 4OZOA 1Y7VA 5BRBA 1J18A 1TA3B 2GVJA 5CZJA 5AB3A 4O1DA 4U28A 1CNVA 1FFRA 5DO8A 3VDCA 4UOQA 1R7AA 2FHBA 5FKBA 2J7FA 5J5RA 3T2OA 2CZ5A 3RO8A 3PIJA 2E6YA 3BC9A 4QSHA 4HSOA 2W66A 1US3A 5AC4A 1TG7A 2J77A 1FXPA 3I7SA 2VUYA 5KEZA 4MOZA 5K2ZA 3ZJKA 3NIYA 1FH9A 3RM4A 1EXPA 3K8LA 3PZMA 1I45A 3RK8A 3U75A 4WIWA 4MZ1A 3TSDA 2ZTJA 4WJEA 1H50A 3NSMA 3A4WA 3RMJA 5BXTA 3AMCA 1ITXA 3QW4B 4RZ4A 3EXTA 3W74A 4JHZA 4PMRA 2YA0A 3LEMA 1U83A 3B4UA 4PMDA 2J6XA 3L5MA 4K39A 1Q4NX 4W5UA 5F1UA 1Y9GA 1GEQA 4X9YA 3M41A 3ANYA 4IWWA 2QQUA 4MUZA 3RF9A 3EXSA 3P82A 1C91A 2QMKA 4W85A 1TPH1 3AROA 1PE1A 5CZ0A 2C0HA 1TTJA 5LHEA 5KMYA 1VCGA 1XDLA 5E9AA 4LYPA 5ABFB 4HU0A 5EFFA 3M47A 3TONA 4FNUA 1OFDA 4ZE5A 2Q8XA 4D6JA 3DYPA 1W5NA 1JF6A 2G3IA 3AMGA 3VIFA 4JIEA 4QM1A 1UKTA 2BX7A 3HOJA 3BGJA 2VXNA 2EPOA 1KFJA 2Y85A 1EA0A 2AOSA 1XL9A 1F73A 2V3DA 1TSIA 3BSGA 2QAPA 4DF2A 3CO4A 2CBJA 5G2HA 4NU7A 3EX2A 3ZSSA 1JQVA 2YL8A 2V5CA 2PC4A 1PHQA 2ZCGA 1KQZA 3BO9A 1DJQA 2NWRA 3M5VA 2Y5EA 1PZ2A 3VVGA 2CLEA 1NOUA 3VE7A 2WVTA 5DT5A 3W85A 3EDKA 4M6QA 1JZ6A 3UESA 1CXEA 3U6WA 1XH1A 4CCEA 3NMBA 1TE1A 4K37A 8CGTA 3TIMA 1UR4A 5I6SA 3H53A 5K9XA 1MXGA 4AW7A 2YL5A 1H2JA 5EFDA 5LNUA 2ZICA 3Q37A 3TXVA 3ZWSA 4CU6A 4YCPA 1OG0A 3QRHA 3N17A 1JJKA 1H3GA 1QNOA 3KXQA 2UY4A 1N55A 4TVDA 3VGHA 4FLQA 2CESA 1X8FA 1DP0A 1H49A 3DECA 3NL3A 2Y24A 4CNPA 3VD3A 1DKWA 4JYEA 3NEVA 1CGWA 5JIWA 3TA9A 3WBEA 2ZZ6A 5EL1A 1QBAA 1Y0EA 3PG8A 1XBZA 4DEFA 3K4DA 4QHZA 5FF7A 1RPKA 3BAKA 1E5NA 1TPUA 2WB5A 3S5ZA 3AIQA 3WIJA 3MSGA 2CLMA 2VENA 4HZ7A 3CIWA 2D0FA 3PBVA 1FCUA 1GYNA 2RDUA 3H3LA 2CCRA 4O0KA 1V3MA 3LHWA 5TD4A 5E6ZA 1ISZA 3WH7A 4M8UA 4IMEA 3SCPA 4ZE4A 3OB8A 1DORA 3M5YA 1VS1A 2YFNA 1N82A 1SYTA 3L4VA 4WOQA 4FK9A 1BYDA 4N42A 2VC9A 1E43A 4H04A 2V3EA 4OOUA 2ZUSA 3M9YA 2C0AA 2A6NA 4BQ4A 4QNWA 2UWFA 1W5OA 2V2CA 2NZLA 2PRLA 1HJWA 5CZSA 1ZS2A 3OGRA 1YDOA 3OGVA 1W1ZA 3IEBA 1WE5A 5F2GA 1DEDA 1W9XA 2WC4A 3VIOA 1UR9A 5E0FA 4ZL1A 4W8LA 1V0KA 1PAMA 4TXEA 4UCFA 5M3WA 1K7FA 1NVMA 5E0CA 3WD4A 1T96A 4RE3A 2Y6ZA 4LRTA 1YPIA 1HUVA 1EDGA 2XN0A 1B3VA 3ZM8A 3EWXA 1RH9A 4BI6A 5HUOA 2WSRA 4UNIA 3WDQA 4O53A 3W7LA 4D72A 4IXXA 4E4PA 4TVCA 1YXCA 5H2ZA 3NCOA 4OE7A 5TQLA 1JRCA 1UJPA 1QHOA 1L6YA 2ZQ0A 4CNOA 1GZGA 2O9RA 3NSXA 3U8GA 1XD0A 2QV4A 4MNKA 1KFCA 1QNPA 5KZ6A 1LL6A 3SUTA 1VHCA 1UASA 1EHAA 3UR8A 2A7NA 3N12A 5CSYA 4FO4A 3L0KA 1FDYA 1ZHAA 1PJ9A 5TIMA 5FMBA 4ADUA 1W3IA 3T78A 8TIMA 1LCOA 3RIKA 3WF3A 4L4LA 3VFLA 2YBTA 1JULA 3HB9A 4JD4A 3QR3A 1H7RA 1CGUA 2X2GA 5A6BA 4AAJA 3CM4A 4R53A 4QLLA 2E9BA 2ABBA 3AYSA 3EX4A 1CGYA 1GQNA 3NJ3A 2PWFA 4V28A 1WDWA 2ZZ2A 2YL9A 3LCXA 3VIHA 4W84A 3CTTA 3N04A 2YZRA 4OUEA 3QHMA 4IQLA 1I4NA 3W4RA 3WF0A 4PTMA 2J7CA 4AXKA 4UFMA 1IF2A 3UZ5A 2A3HA 4FFGA 2ALDA 2GK1A 2FPVA 4U3AA 1IT0A 4FLOA 1J01A 4IPIA 4IPLA 3C2RA 4UFLA 3ZMRA 1E56A 1RR2A 2QDHA 1LF1A 1GPWA 2X1TA 3AI0A 1H0IA 2D1ZA 3N9RA 2FH8A 3BSHA 1OT2A 4GI9A 4P8UA 1UD6A 1CI1A 4UTKA 1U5JA 1YLVA 1JYXA 1TV7A 2DSKA 1GYLA 2W4XA 4AEOA 1FCQA 1FBAA 1H1YA 4MFDA 4BWLA 4JCLA 4WJXA 4LVBA 4LS1A 4ZENA 2CKSA 1XC6A 2Y2WA 1W54A 3IGUA 5FEPA 1C8XA 2QR6A 3AHTA 3K46A 1KWGA 1PCWA 1VB9A 1XUZA 2QJHA 3G6MA 4AMAA 4YN5A 3MJYA 3BG5A 2FLIA 2J7BA 2DZSA 2AAMA 3ZT7A 3BLEA 2BSLA 3TQ0A 4B3KA 5CXPA 3G1SA 1R87A 2YYUA 2C18A 1I1XA 4EF8A 3VIKA 2OX1A 3B05A 2BY1A 1BGGA 1UG6A 3I65A 2PWHA 3FHAA 1PX8A 4LU0A 5E0KA 4MPQA 3UQNA 5K3VA 2VO5A 3GNNA 4OWGA 4ZVJA 3VNDA 3JRKA 4FMVA 3N73A 2V5DA 5IFPA 1BG9A 2VFFA 4HNUA 1Y9MA 2FB2A 1SZEA 1A5AA 2E3ZA 4M80A 3GM8A 3DZ1A 3CT7A 1GUVA 1U33A 1KLZA 3ARYA 3TFCA 5A69A 2Q8ZA 4X22A 3ATYA 1HT6A 4P7NA 4PA8A 5DLCA 2XVNA 4PTXA 1KM6A 2JBMA 3GDKA 1V02E 4W87A 1OFBA 1W2TA 2RDTA 3QEZA 4UTTC 1KCLA 4V2XA 1MQQA 1F74A 1JI1A 2IUZA 5C8BB 3EKZA 4HZ8A 4ZMGA 1UR8A 2BHUA 3VD9A 2ZX7A 1JAEA 3VKKA 3ZFHA 4FXSA 5D02A 1VEMA 4AEEA 3ZR6A 2VELA 2YBUA 3RFAA 1UWRA 3BVJA 1WNOA 2W63A 1RQHA 2W62A 3RJYA 1JUEA 3W07A 2YJQA 3W6YA 2DSZA 1OFPA 3WK1A 1EUAA 4IMCA 4XTDA 4JFTA 1IXQA 4DQWA 4Z2IA 3E0IA 1E1EA 1TQXA 1J0KA 4PMVA 3OLEA 3TOPA 4GFSA 3IJ7A 4RR4A 3TTOA 1YTDA 2HS8A 4WKFA 2ZIDA 3V1PA 2V2DA 3TMQA 5EKYA 1ZJIA 3AS2A 2RFGA 1OT1A 5HR7A 4A3HA 2TMDA 3TFXA 3BLIA 4AZIA 1W9BM 5CQ1A 2VCBA 4IX0A 2QCHA 1R8LA 1XV8A 4GXMA 2VCCA 4FNPA 3L68A 1OF6A 2NUWA 3ZOAA 3T7VA 1D9EA 2D73A 1V3JA 1OX4A 2BY0A 2HISA 4R27A 2EPLX 3S1UA 5ANNA 3LHVA 5FK7A 2XTKA 3DENA 3W1QA 3OBAA 3NPVA 1NWUA 3W72A 2G4FA 1ZBWA 2EPKX 2VR5A 5CPSA 2V9DA 3UZJA 4RLIA 1L9WA 4PTNA 1KBBA 2A1YA 1W32A 2ZX6A 3FAWA 5JBDA 1GT8A 1Q6RA 2Q8LA 4Q4KA 5SWUA 3WQ4A 4ATLA 5DCDA 4X2RA 3O8AA 4O16A 1HP4A 4OOZA 4ZQMA 2X8RA 3VNYA 5FK8A 3CPRA 4L4OA 4JY9A 3LERA 5D2YA 2CU0A 2WLZA 4M5PA 2J62A 3GBDA 2WK2A 3RLVA 3W1AA 1ZBKA 2WM0A 4M81A 2WWCA 1LWHA 3F4VA 5I3DA 2GUUA 5C2XA 1B3YA 2WMJA 1RZMA 1JDCA 2FGLA 4LV4A 1AG1O 1TUXA 4MY8A 1VHNA 5M5DA 1VYPX 4PMQA 3CZKA 5D4YA 4K6AA 2B4GA 3THQA 3AZSA 4UR9A 5ABTA 4GI8A 3ZJ8A 5HNRA 1O4UA 2A3BA 3M46A 4N6EA 1SW7A 1ISYA 2D3NA 3QH2A 4HA3A 5AC7A 1WBJA 2VT0A 4RE4A 3W7IA 1TA3A 4O28A 3PG9A 3TW7A 1JD7A 3KL3A 1SSGA 1GVQA 2QMJA 3KOFA 3N14A 1JCYA 3W86A 1R2SA 2QF7A 3PUOA 4MYXA 3CB8A 5AN7A 3M16A 4QLJA 3T09A 1ZFJA 4S1FA 1IIHA 2J4GA 4YL2A 1GOMA 3WDRA 5FF0A 4UTUA 2WHKA 1WBHA 4LOCA 1O5KA 1WOAA 1NEYA 1ZAIA 4FX6M 2CITA 4ADTA 1HF6A 1KV5A 4LVGA 5AY7A 1EGZA 4PYSA 3UR7A 4WF7A 1QPQA 3FFSA 2C7FA 3S5QA 4UTIA 4MADA 5FMDA 3G8EA 2BY2A 5CJ5A 2C15A 4QJ1A 4MB3A 1QHPA 3QFEA 3E02A 4LXFA 1XM3A 3W28A 1HN1A 3S9YA 4O19A 4U4MA 1GHRA 3PZ9A 1FUYA 2VJXA 4P2VA 3QMRA 2VRKA 3ARWA 3QZEA 4Y9AA 1EQPA 2VRJA 3P5ZA 2VX4A 5ABFA 4JDYA 2UV8G 3MYOA 1GQKA 1PX4A 1K9FA 1VLIA 3GVGA 3H55A 1CDGA 3DGRA 4LPCA 4NZCA 1TMHA 1DL3A 3S5YA 3RMEA 2W92A 4QQ3A 3MMWA 2CLFA 1H1NA 1O7AA 1C3FA 2WSPA 1WDSA 1SW3A 3LDRA 3VUPA 3ZIZA 1YPFA 3TUUA 4FIQA 2A5HA 1NWRA 2QCDB 4CNNA 1UD5A 3N11A 1E6SM 3TSMA 3EEGA 1GJUA 3LIHA 3PBYA 5HR6A 3DHUA 2J78A 3G18A 4BR1A 1EP2A 4YCOA 2EPNA 4WOZA 4AHPA 3AZRA 5ECUA 3VX1A 2DDXA 1ST8A 1F6PA 2WPBA 3R12A 4NF7A 2X2YA 2VI0A 1JCMP 3EKLA 4MB5A 3LOTA 3U7VA 3WJSA 3CEUA 3TK7A 1KGUA 4TX8A 4K68A 1KQYA 2XM1A 3T0AA 1MEHA 3CTLA 4WLCA 4O11A 4OBTA 3GXDA 2FH6A 4WY0F 4RJEA 2WYSA 3PTMA 2GOUA 1BTCA 1KXTA 2CWNA 4M29A 5HNNA 3UCQA 3MSDA 3PR2A 3AMDA 1FH8A 3PBGA 2I1OA 4Z2HA 1VQTA 3GXFA 4FF7A 3LRMA 2VX7A 4J3VA 5BCAA 2HVMA 4CN6A 2YKKA 1GVIA 2ZWZA 1RD6A 2ZA1A 1BWKA 2OCZA 2G41A 3L2LA 4W5ZA 3B9AA 1KTCA 2WW5A 3FNDA 2BFGA 2QQVA 4UMCA 4W8AA 5D05A 4JTSA 2CHNA 2BXYA 3SJ3A 1R47A 5KTLA 1OB0A 4FNQA 3ARPA 3GBEA 3RILA 3AIBA 3MO7A 1OX5A 1TJPA 3T08A 1GOXA 5AC8A 4LYQA 2E8YA 5BROA 4I7WA 4XQ6A 4XTIA 4BI5A 1UOKA 1WV2A 1LDCA 4E2BA 1EPXA 1E0VA 3UXDA 1EH9A 4AHOA 3IGSA 4GKLA 2XVGA 2GJLA 1ISXA 3LB0A 4PSPA 3F4WA 2GDUA 5HPCA 4R33A 4E38A 4HA1A 3VGGA 1OGSA 3AIWA 1PHWA 2NV2A 1CIUA 2YPIA 4H8HA 1OX6A 2WC7A 5CPMA 1THFD 4AWSA 1MVYA 3UYCA 3KE0A 3S8HA 4KGJA 1OVDA 4UTWC 4B1LA 1OD8A 5FL0A 1GCYA 3NM1A 4IMFA 5HULA 5C70A 3OA3A 3UG4A 4AZCB 4O1BA 3AQUA 3W76A 5CSSA 4AVFA 3TTQA 5A8GA 4TTUA 2PC8A 3LCFA 1C8QA 1F4HA 1KXHA 2NUXA 2YDSA 3PC0A 1NQ6A 2GUYA 5EB8A 1BEUA 1KM4A 3A5FA 1CGXA 3EMZA 1H7PA 3DHDA 3IAPA 1XSJA 4AB4A 3U5UA 2A6LA 3W7QA 1EIBA 2A2IA 3ABOA 2QLYA 4J9JA 4IXHA 1E4IA 4LUJA 2CERA 4O14A 4LWWA 2WWDA 1S5VA 4TU1A 2WSYA 2KZHA 4L4PA 3WSUA 2ZZ7A 4UQEA 3OVPA 3FJLA 1J0JA 2AAAA 1JZ8A 1PIIA 1K3UA 4MY9A 1TPDA 1GOIA 5LA0A 4KRUA 5A6LA 4P8VA 3MV01 3DKLA 4N4QA 1V03A 3LF7A 4WKHA 4J3XA 1CXIA 2RGMA 1TTIA 5D9OA 3WD0A 2XN1A 3B9EA 4XZWA 5HPOA 2FB3A 1SO3A 2CBIA 4GUFA 1LTDA 2XFFA 1GG0A 1GVSA 3TC7A 1MFUA 1U2YA 2UY2A 5AYZA 3UD6A 3MUZ1 3UEQA 2B7QA 4GUJA 1JNEA 3MUAA 2X0HA 3GXNA 2QAFA 2X30A 3W81A 4MB1A 3R13A 1GVFA 3HPXA 4AZ5A 3W73A 1JVNA 3I6RA 3T0BA 2DGAA 3HJZA 3B8SA 3G22A 1E1FA 4DUWA 3NL2A 1B3OA 1KXQA 1UHVA 3UWWA 4CGTA 2PWEA 3WK2A 4HN4A 2C1HA 3WJXA 1IV8A 4C7GA 2DZTA 3TE9A 2CW6A 3VINA 2H3DA 1KFKA 3PZNA 1A47A 1E6XM 4BS0A 3DHFA 3QJAA 1VEPA 4JTFA 1VLWA 3Q58A 2DT1A 4Z2KA 3W1RA 2QCFA 1D7FA 3GDLA 2ZXAA 3LHUA 4LC6A 1LLOA 4OU1A 4AH7A 3WMBA 3U2OA 4TUFA 3WFZA 3A9IA 2UY3A 1DOSA 2QCGA 3R5EA 4CLMA 2HSAA 5EYWA 7TIMA 1OBAA 2BVYA 1W2VA 1VC4A 3AXHA 1BF2A 1CPUA 3W70A 1JUBA 1LYXA 4JFWA 1JYVA 5EBUA 1ZJAA 3K1DA 3Q2DA 4L4MA 1CXKA 2Y7EA 1BWLA 2ZUTA 1RQBA 2XIIA 4LQ1A 2NV1A 2J47A 1E4NA 3QSTA 1CZ1A 1OFOA 1GOQA 3AIUA 4JKMA 1AL8A 4NJHA 2ZA3A 1ISVA 1GTHA 5F4XA 2YGYA 4BF7A 2J27A 3BK0A 1XFBA 5CZKA 4LNYA 5BWFA 1H1ZA 2VCAA 2NX9A 3LDKA 1TPWA 3PB0A 1G6CA 1UR1A 2Y70A 3UETA 2VFEA 3DFQA 4PH6A 5A6SA 3V75A 1E6ZA 4LC8A 4PMOA 2WKJA 1I2OA 1KW1A 1UB3A 4AHQA 2CZDA 4D2JA 1BTMA 2OT1A 1VFOA 1E15A 4CQAA 1W5PA 2FQIA 1PZ3A 1V5XA 4H2CA 1YDVA 2W6RA 3ABSA 3CEPA 1JIBA 4A3YA 4P61A 4MZ8A 1LP6A 2WCAA 1FA2A 3DHPA 1BG4A 3VD7A 1LROA 3A21A 3BAIA 3HGJA 1M7XA 4JEQA 1T0OA 3OA5A 3CUFA 5DBUA 2J9YA 2TAAA 1EIXA 1SO5A 3S1WA 2OT0A 3GNRA 2XGIA 4FFFA 1SR9A 4JKKA 3VGDA 3OLGA 1TPEA 2R8WA 4UZSA 3R8RA 5CGMA 1HO4A 2A7RA 2VFHA 4S2BA 1LJYA 3POCA 4CD7A 2V5BA 4JIQA 2DZXA 2QPSA 2ZUNA 4UXDA 3HGRA 1X1OA 3LRLA 1UKOA 1K02A 1YTKA 1BVNP 2VVSA 3BAYA 1RVGA 3VM7A 2V2HA 1JFHA 2J8FA 5I3KA 3CZGA 3O6AA 1H11A 5BRQA 3MI6A 4RCXA 4U3CA 3BW4A 1DTUA 3BLFA 3PZQA 3UWZA 4QDMA 1V3KA 3WELA 1VEOA 3WMSA 3C8FA 2ATSA 5K7JA 3L2IA 1IIGA 5GNXA 1BLIA 3MV11 4OBRA 4FNRA 2TSYA 3USBA 4GO9A 1QW9A 4NT0A 4ORMA 3PVFA 4OJYA 4ADSA 1TCDA 3KRSA 5MHBA 1W3KA 1HL8A 1NAL1 3LHZA 1O5XA 2O7QA 4UR8A 1TO3A 1J0YA 2GFTA 3AYRA 3WD2A 5BYWA 1JCNA 3W38A 1YXYA 5F1VA 4NJKA 1E70M 5EY5A 3FS2A 1EOMA 1A3HA 3O9NA 4AMCA 1OIFA 2GJNA 2Z6JA 3FOKA 3TV8A 3W7JA 2BHZA 3GAYA 2BXZA 2XM2A 2H8ZA 1WZAA 4URIA 2WO5A 3BG3A 1VJZA 2E68A 3W71A 2VX6A 1SFLA 3FXYA 3L4UA 1Z41A 3TTYA 3T4CA 2XVLA 1NF7A 1C92A 1D3GA 4CQ9A 5E70A 3HQ1A 3NG3A 3CH9A 3OGSA 2D24A 1KV8A 5A2BA 1JZ3A 2H90A 2J88A 1LLZA 3WENA 4H8VA 2ZZ1A 2VFIA 4QP0A 4NX0A 5A8NA 2D2OA 3LTYA 3VD4A 1H61A 4LGXA 1UWSA 1QPKA 1B57A 4O0ZA 2G95A 3KRZA 3W2JA 2YDRA 3FAXA 3CMGA 4O54A 4AWTA 1CXHA 2IXVA 5D32A 4PMUA 5AYBA 2ZX9A 1TV5A 1HFBA 3N9KA 4BI7A 2WHJA 2QUTA 5EMYA 3W87A 1LRNA 3VU2A 3VMPA 3QM3A 3KEHA 3N13A 4W7WA 1IXNA 3SCTA 3SCRA 3IJ8A 2EKCA 4UC5A 5A5WA 1SUXA 1G94A 2E0PA 4OIFA 2PWGA 2C16A 1B4EA 4MJ2A 1XBYA 3WD1A 5LA1A 4ICNA 3LM7A 1M7OA 5D30A 2AEYA 3IIVA 4JNMA 3KVLA 4NRSA 1G0CA 1J2WA 4AY1A 5FKYA 1OM0A 3C6CA 3GDBA 4MFEA 4O10A 2JF7A 3RM9A 5ABHA 4CUCA 3DBPA 1ONRA 2ZRYA 4LVAA 3S6DA 5DFAA 3DFPA 1RP8A 1HKMA 1H63A 4AZ7A 4GC4A 4HNVA 5AHIA 4D1JA 5E6YA 1E51A 1E40A 1SFSA 1TR1A 1KM2A 3VE9A 4DPQA 1UWTA 1W3LA 2QCDA 2WBKA 4J7RA 5JUVA 4E0CA 2VQTA 4PMXA 1AQ0A 1C9DA 1GNXA 1E4LA 4HU8A 5A8QA 1AW1A 4Z1DA 2RGLA 1WO2A 2WANA 1KBKA 2GVYA 2OMAA 3W7KA 4DPPA 2Y8KA 3GAKA 1EUNA 1QPOA 2OSXA 4Z2GA 4AZZA 2ABAA 3TXZA 5IDIA 3DI1A 5LGXA 3MMUA 4JTGA 3Q94A 4AIEA 3SSJA 1X6UA 5F4WA 5HQEA 4ZXLA 1D3HA 3CHCA 3W29A 5D09A 1HJSA 1LQ0A 2GJPA 2OWCA 5DBTA 3EYPA 3W24A 3NOEA 2DT3A 2B7NA 3L4ZA 1GG1A 1Z42A 1TVNA 2WSQA 4EIVA 1IZJA 2DIEA 3VIJA 4M6PA 3WH5A 4WUIA 1X6LA 3HF3A 3UG3A 1UZ1A 5IHSA 5IXEA 5D9PA 3BARA 3G8RA 2YSWA 3R2GA 3W7PA 1L2UA 2WMIB 2YL6A 5GNYA 3TAKA 4UUIA 1OFAA 3WEMA 2WMHA 1H60A 4LVFA 1OYCA 2WVUA 1NM9A 2Y8VA 1JCJA 3TQKA 2GJXB 3MUXA 2WMKA 1XH0A 2WZEA 4GZEA 3TTSA 1XC4A 3VIGA 3SI9A 2NX3A 4TX9A 1GHSA 4F9DA 2FTPA 1OK6A 3O6CA 1SZFA 3NQMA 2CZFA 4R7JA 1LLWA 2FPYA 1HJXA 1E72M 5LNWA 4ORIA 4TVUA 1UR2A 3CLWA 4HTYA 3U7BA 3VX0A 3QW3A 4JQTA 1OHLA 3WFLA 1FY6A 3AS0A 2Y89A 4ZZ9A 1KR0A 2WVSA 3WN6A 5IHRA 5AOUA 3AS3A 4O4VA 2W79A 1WXJA 4WKAA 1NWSA 4GUIA 4B5NA 4U33A 1VPXA 2J75A 3UWUA 1SO4A 1FDJA 2Z2UA 1D3CA 3FW6A 4AZCA 1KR1A 3NQ2A 3M6DA 3G1HA 3U5YA 2BZNA 4W86A 5A95A 4LT9A 3GDRA 1LOQA 3BV4A 2DT0A 2OWXA 2NXHA 2Z1KA 2XGBA 3BXWA 3VILA 3P84A 5HWMA 4DUVA 2WKLA 3AJXA 3OG3A 1DWIM 5LNRA 2ZUVA 1V7YA 3CUHA 3VPLA 3PSWA 1HKJA 1CECA 4H41A 3OZOA 5I3GA 4N9DA 2W5FA 2E5DA 3W1NA 1VBRA 4XB3A 1QR7A 2Z0IA 3NR0A 1UD2A 1ZB5A 2XFRA 2DJLA 2R91A 3KAOA 2J7DA 2ZOXA 4GZJA 3EWUA 2B7OA 1UA7A 2VRQA 3GDTA 4UQAA 3N19B 3TH6A 2D20A 1ICPA 1VRDA 3ECQA 4JX5A 4PL1A 3CQ0A 1J0ZA 3HBLA 3PZVA 2J9ZA 1DQXA 1RPXA 3CHEA 3QOKA 2D22A 1Q3NA 1DBTA 3WL1A 2EQDA 3OSDA 1SZNA 1F5ZA 2ZYFA 2PBOA 2ZXDA 1V0NA 5AHLA 1XSKA 1LOSA 3CC1A 3MS8A 2OSWA 3D3AA 3CZEA 4W8BA 3SGZA 1B3ZA 4GUHA 4I9AA 1PVNA 3K8KA 2WSKA 3LCHA 5GVJA 2BV9A 1H7NA 1VH7A 1VR6A 3W22A 1LBMA 1T8XA 4FHAA 2VL4A 3WQVA 3G3MA 2VVNA 3BGAA 1W5MA 5D8ZA 2OSYA 4LW7A 3HN3A 2ZZ4A 3W7CA 1V6YA 4M82A 1FWTA 2Q3OA 3FKRA 4HOXA 6A3HA 1BHGA 3AOFA 4ML4A 2J7HA 4Q22A 5G5IA 1G1YA 1PS9A 4PCTA 3QQ0A 2ZUUA 1JZ2A 1QOQA 1KBJA 1E6RA 3FN9A 3GNPA 5CLTA 3T40A 4N0RA 1KM5A 3WDIA 3WNPA 4O1CA 4HSNA 5BMXA 2PRMA 4AF0B 1J5TA 2JIWA 2VNCA 3SCWA 3SIMA 3WUEA 3G0XA 1SQ7A 1OINA 3M43A 4CN4A 1K8ZA 5CPNA 4MTVA 3LCIA 4DWSD 2O9TA 4O57A 3LHTA 3PBUA 2WOQA 5ABEA 1P5BA 3WNKA 5EPDA 2X1SA 3GXTA 1VJIA 2MANA 4BQ3A 1Q6GA 1ZAHA 1ICQA 2FDSA 3KHJA 1K9DA 4IPNB 4B9ZA 2PE4A 5FEZA 1MXSA 3E1F1 1W3NA 1EEPA 4R5EA 3VGEA 5G1YA 1SPQA 2DH2A 1GQJA 3EDDA 3LTPA 3EDEA 5LKYA 2CLHA 3ZR4A 3P81A 4PTWA 2D23A 5I0DA 3AZTA 5I3JA 2ZRWA 3RNDA 1EP3A 4C1KA 5K9CA 4GQQA 1ZU8A 4JTHA 1V08A 1S3HA 5A1AA 3GB6A 1BSIA 3MWAA 4O8RA 4OV9A 3EDJA 3PTQA 4FFIA 4NX5A 3RPMA 1GZJA 5A6BD 3MI3A 4I7UA 1ME7A 5D2TA 2J7GA 2ISSA 3VKJA 5IBXC 1OYAA 1OWQA 2QJGA 3HBKA 3M1ZA 1VRXA 5GNZA 4D1IA 3NQFA 2O7SA 3P74A 3LMYA 1XGZA 5F2MA 2H6RA 2JGYA 3OG2A 4IX2A 3W27A 4YWIA 4JTUA 2GQ8A 5U7SA 3ARQA 1UWQA 4QLKA 3EX1A 3PBWA 2F2HA 4D6DA 2VEKA 1NP0A 1FWSA 3W23A 3B0VC 3LBMA 4TIMA 3P60A 1X6NA 4O12A 1B2YA 3IV3A 1C29A 4HPHA 2VZUA 3W1LA 1HJVA 3LPOA 1HP5A 1OK4A 4M24A 3CMJA 3MBDA 4TO8A 5A6JA 5BXPA 3L4XA 3O63A 3FA5A 4KFNA 3GDMA 4HT3A 4BCEA 5CLWA 3BW2A 3W53A 1FP8A 3N3MA 3F4NA 2D0GA 3QQ1A 5D2VA 5FEWA 2QPUA 4RZ5A 3HMJG 5U4NA 2VKZG 2WPGA 1L0PA 3W6MA 2A3EA 1Z32X 3WY1A 4GINA 1W3JA 4DWSA 1CW2A 3TJLA 1CEOA 4XX6A 4F79A 1ZNNA 1KM3A 1R2TA 1EOKA 4YHGA 4Q33A 2PBGA 5C71A 1JL8A 3BAWA 3CWOX 1BVZA 3AO0A 3DYMA 4A3UA 3STFA 3B03A 3KRUA 1FOBA 4PMZA 4U2ZA 4MNLA 1JI2A 3L5LA 4CD5A 3HGOA 3MYPA 3LXAA 4ZQCA 5D2XA 1GORA 3VGBA 4HPJA 3S5NA 3PSVA 5G4EA 3BW3A 4HKPA 4PSRA 1KGXA 1G5AA 4J27A 2ZBTA 1XDMA 2NLIA 4NZJA 4RZ6A 2ZRVA 3U14A 3ZS4A 3PIGA 1C7SA 3AIVA 3CWNA 3HGSA 3M0ZA 4MZYA 1TYGA 3EWZA 4ATDA 1B31A 2OYMA 2CLKA 5GQBA 3UWYA 1W1TA 3QMTA 4C1LA 4J3UA 3VGFA 5F7UA 2YIHA 5DT7A 3E9AA 1V02A 1WP6A 4AEFA 3WQ5A 1HJQA 1WOBA 2FPTA 4LS0A 1JRBA 4UFHA 2JFEX 4GXPA 2G5WA 4OV4A 3CLMA 3DXIA 1FH7A 1SZGA 4DWSC 2XJ7A 4HNNA 3STCA 3FYPA 1E3XA 2C14A 4JZ5A 3O1NA 4W89A 2GDVA 1TTQA 2NW0A 3IGXA 3VIMA 4LV9A 4RXGA 5LNVA 2X1RA 3W25A 1G4SA 1BFNA 1B3WA 2B31A 2J74A 4FFHA 2IQTA 2DEPA 3NGJA 4ZFMA 1UYPA 2J8GA 2EXOA 4RKAA 4QITA 3W84A 2J7EA 4JHOA 3HPZA 2EEXA 3SCNA 1BYAA 1FHLA 3U57A 4O15A 5A2AA 4EQVA 1E0XA 4EAMA 4EOUA 2Z1SA 1XH2A 4C7FA 1HO1A 2ZTKA 4X3ZA 1MW0A 5KITA 1OGBA 4UNKA 1HL2A 1W2PA 1UUMA 3N18A 2HS6A 1TFVA 5JIPA 4MNMA 2JK2A 2OXBA 4JL1A 5HJLA 1VYSX 3TAOA 1JFXA 4AZHA 3AHYA 2YA2A 3NAVA 2QEZA 4A21A 4IMGA 1E6QM 2P10A 1XYFA 2JE8A 3WUGA 3NDZA 1QW8A 2E9MA 1QO5A 1TPB1 1DWGM 1HJUA 1GQLA 2J25A 1K9TA 1RQEA 5I3IA 3QPYA 5G1TA 2WNZA 3ALGA 3FY1A 1F76A 4QIUA 4MJMA 3RU6A 1MYRA 4M19A 3PZTA 3SGUA 2CBVA 4MDPA 1CYGA 1OD0A 1W37A 4JGDA 1DVJA 3BGGA 3AHXA 4S2CA 1XD1A 1QHZA 3AICA 1ZAJA 5CGQA 2VC6A 1KM0A 2D3LA 3VTRA 5FCZA 1QAPA 3KVJA 2XQRA 1OIMA 3L0NA 5BW6A 1S5TA 4UFJA 1OF8A 4DBDA 2B0MA 3N15A 1CGTA 3MMDA 4MNJA 2WMIA 2R94A 1F05A 3DFTA 1T99A 3WF2A 4E2OA 1L6WA 3MW7A 1E6NA 1AW5A 3VI2A 2GJXA 4UTLA 2E6AA 2W67A 1B30A 5DCEA 3LPGA 3PN8A 5I5RA 2VOTA 1KTBA 2A7PA 3THAA 4WX2A 1QPNA 1GOWA 3IJ9A 3QSRA 4DWSB 2A4AA 5FF3A 5BXRA 4PCFA 4LTSA 2VR4A 4U2YA 3PHAA 1QCWA 3L21A 1P0KA 1VFFA 5DXXA 5CSUA 3GKFA 1Q6DA 3C0JA 2B7PA 2BHYA 3HU7A 5I77A 1VENA 1AQHA 2A3AA 3HO8A 3PY2A 5DN1A 4O4WA 2AMGA 4DF1A 2E8ZA 4MVAA 2EF9A 2OYKA 4UFIA 1GJWA 1AMYA 1PL9A 1TB3A 1TPFA 1UD3A 1YQ2A 1KFLA 2RKXA 2ZX5A 1QO2A 4NQ1A 3SW6A 4Z0SA 1HX0A 1XCWA 4E8CA 3AJ7A 3O6DA 3AISA 4NZFA 1J10A 4WD0A 3O07A 2X09A 4ACYA 2GVGA 5FMCA 1NOWA 1TJRA 5LHFA 3D5HA 4GI6A 3S1VA 1BKSA 1BPLB 5CGTA 4A4AA 3W1PA 2YXGA 1SMAA 4JIPA 2Y7FA 2YW3A 3W2UA 4XKYB 3II1A 4AISA 2DSVA 5DY2A 4S3KA 1JZ5A 2V81A 5C54A 4OGZA 1QVBA 1LORA 2WC3A 4KWUA 4CVWA 4UTFA 4FIRA 2XN2A 1MW1A 3WNLA 1IZKA 3WD3A 4O1AA 2DSWA 4B15A 3INPA 3MKKA 3WQ8A 3AIEA 1CX9A 2O9PA 3BLKA 4CQ8A 5HWNA 4IM4A 3N2XA 5FI8A 1G4EA 3ZJ7A 4AXNA 1JGIA 1K7XA 1OGGA 1W3HA 2VZOA 3EX6A 4AD2A 3ELFA 4NNAA 4PEKA 4BF9A 2NXIA 1Y4WA 1V6WA 3H54A 3OZPA 7TAAA 4O52A 1M6JA 5A8MA 5HXMA 3PZOA 3FJ6A 3STEA 1HTIA 3VD5A 3W7GA 5CPOA 1CXLA 2TYSA 4QNEA 3A4XA 4XV0A 2XUCA 4KKXA 2ZDRA 3CU2A 3KFTA 1MEIA 5CPLA 4KFOA 4A29A 1PEZA 3W7EA 5J5DA 1M01A 1WKYA 3DH7A 2WVVB 3WQWA 1B4KA 4AD4A 4WK9A 3W7DA 1XSIA 4B1MA 2Y61A 1JR1A 3WL0A 3NL6A 3W1MA 3SEPA 3KZSA 1GTEA 2ADDA 3NVTA 3WK3A 1QWGA 5FKCA 3ARVA 2O92A 3GZAA 2P1FA 3NQ6A 3CZJA 4H4IA 4W7VA 1QI0A 2Z1BA 3N2MA 4JS3A 2XIBA 4POCA 4Y7EA 4TOQA 4CCDA 3A22A 1WX0A 3NZRA 4YLWA 3L4YA 3GR8A 4KFPA 3GXIA 3SUWA 2J9XA 5CG0A 3ABRA 3L0GA 3O6YX 3WH9A 1GOOA 4BZYA 4DM2A 4XBSA 1M53A 1QDSA 3WJWA 3DYOA 3UERA 1RD5A 2BVDA 3WKZA 1H5YA 4CCCA 4XZ9A 1FHDA 3G0SA 3PAJA 4WXZA 5KINA 1ESWA 2CLIA 1H0GA 3PUDA 4JY8A 2WNWA 3WDJA 1UKQA 3G6LA 4GRSA 4JTLA 4PBGA 4YHEA 3TCEA 4DM1A 2AC1A 4K36A 2E77A 4CKQA 1XCXA 3UGFA 2ZWYA 1AK5A 1FCVA 1HXJA 3T2QA 2DZPA 2JEQA 3ARUA 3T55A 3MBFA 6TAAA 3EWWA 1J0IA 4MLRA 3A47A 4UQ9A 2XFYA 3WUFA 4MJ4A 3IK2A 1UZ4A 6TIMA 1GVYA 2EHHA 2C19A 3W2KA 4PC8A 1G01A 3M7WA 3AXXA 3LXBA 1W1YA 1CXFA 1BAGA 3NPXA 4KWVA 3DKJA 5F2LA 1CLVA 5F4SA 1PIFA 4IISA 1UR0A 2V5LA 3MHUA 1EHNA 4JCMA 3CPUA 4TTGA 2ZRUA 2Z6IA 3WDHA 1JZ4A 1P6WA 2JF6A 1LBFA 1E4MM 4PMNA 2G3NA 3ARSA 3E49A 4Z1CA 3MP3A 3NA8A 3UNDA 3GNDA 3W26A 5HBFA 3LX9A 1ME8A 2VMFA 1JDAA 3W2NA 4MIMA 4JFSA 1W1VA 5IFTA 3TX9A 3LPPA 3MO4A 4HNTA 3FEMA 1PX3A 3KVKA 2WQPA 4HMDA 1AL7A 3ATZA 4UMAA 2AQWA 4MKNA 3MMTA 3KWXA 3UGGA 3GIYA 1B0IA 1EA9C 4ZXOA 5EA9A 1UWUA 4C7DA 1XI3A 3CGTA 1R2RA 1C93A 1E3ZA 1OCQA 1KLYA 3SY5A 3BAJA 1DHKA 1B9ZA 2XG9A 3GLCA 3OIHA 2EBNA 4FXRA 3P62A 3W83A 4RX0A 5D9MA 4MLJA 4EWND 4UTTA 3KL0A 3TKFA 5AHNA 5AYIA 3VIIA 4JYDA 1WZKA 4Z08A 3UGHA 1LM1A 3P8JA 1J9YA 4W88A 4D6CA 4EK7A 1VCFA 2Y62A 1J11A 3RDKA 4GZIA 3W7OA 3SFKA 2TPSA 1MO0A 3LLFA 4WY0B 5FF2A 3MANA 3MP4A 1CLXA 3A4AA 3LI0A 2WHMA 3OHIA 4UNLA 2A85A 4JXCA 4DF0A 3AS1A 2JIEA 5FIXA 2DP3A 3QHOA 1JF5A 4TX6A 1H62A 3VMNA 1PPIA 2DZVA 1V3LA 1I2NA 3I68A 4FLSA 4PMYA 2O9OA 4Q7NA 4AIUA 2NWSA 1C8YA 1PIGA 3WQ6A 1PBGA 1JYWA 3A24A 3NQ7A 5DXYA 3PTKA 1NOFA 4PUEA 1TVPA 1V3HA 5KZDA 4F66A 3IIZA 1TIMA 2VTFA 4JTIA 3C2FA 3DC0A 2BNJA 4UTHA 4AZ6A 5A8OA 1TCMA 3TSBA 1R30A 1Q6OA 1C7TA 4Y6GA 4HMCA 4AYSA 3KVMA 3W7HA 5HINA 1XUUA 4PL2A 4TMCA 3MU7A 5LGZA 1UA3A 1V6XA 2D0HA 4D6GA 5A3HA 3SCSA 2DZUA 1K6AA 2XSBA 3W37A 2VOMA 1CBGA 5DMYA 1UUQA 4W93A 4LUIA 1N8FA 2NXGA 3C61A 3AHZA 2YDAA 4ZQOA 1VZWA 4N9EA 1I2QA 3GYEA 4NJGA 3VIPA 1KCKA 1JDDA 1TPVA 2EPHA 1KB3A 1VBUA 1W9VA 5IBXA 2WKGA 2QKFA 4IUGA 1FP9A 2YLLA 3CHVA 3NO5A 4S3JA 5FD0A 4FLRA 4ACZA 2G8ZA 4EE9A 2V0TA 1HVQA 2RH9A 3FKKA 3L9CA 1F7BA 3NYZA 1FDZA 4N02A 2F84A 6ALDA 3PZGA 2FHCA 1W9UA 3N9SA 4KWWA 4A22A 3WEOA 4CN1A 8A3HA 3IVTA 4OHQA 1IXOA 4HZ6A 1AW2A 1JCLA 2QJIA 5ABGA 4HXCA 2C6QA 4GPNA 1G4TA 1CENA 3ZR5A 4QCFA 2VZSA 1SFJA 1B1YA 2GQAA 1UCWA 2G97A 4UOZA 3DAQA 2BLEA 5CSRA 3TC6A 1WYIA 2JGQA 3BMVA 4AZBA 2EO7A 3T44A 3PZIA 3ZQ9A 5L6UA 3CUIA 2ISWA 1G69A 4U5IA 3ZJ6A 3QMSA 1M03A 1MW2A 1GVRA 4B3LA 4DO5A 4YXGA 4RL3A 2A21A 3I7QA 3AXIA 3JS3A 4PCSA 1TZ7A 1G7UA 1A5BA 4BK9A 5LA2A 4G1KA 1UYQA 1H51A 1JD9A 3RM8A 2CLLA 1H7OA 3A23A 4AWUA 3SECA 4X0VA 3G3DA 4O13A 1G7VA 5EBAA 4P8WA 3CUGA 1YHTA 1MXDA 3VO0A 4EKJA 4CU7A 1W9DM 1TREA 3O2LA 3PB2A 2QCCA 3WNNA 4NSBA 3HIJA 1KFEA 2F8QA 3QPZA 3G1YA 2V30A 1J4EA 5D04C 3GK0A 3TMLA 3C52A 3W2LA 1LRTA 3PZUA 1E0WA 1HG3A 4J3WA 1KFBA 5BMWA 5A8PA 2XWEA 4HOWA 4UTJA 3OEXA 2CFFA 4ZEPA 3HG2A 4Y96A 4E2DA 3THDA 3ZO9A 4LY8A 4RE2A 1DWFM 5BRPA 3EB2A 3G24A 1YTEA 4UIOA 1W3TA 5E1QA 1O60A 4DBEA 1NH6A 1U30A 3G0UA 3NL5A 2VFGA 2A3CA 5LYRA 3NYDA 3QF0A 4Z1BA 1LG1A 4Z2JA 3P61A 9CGTA 2PURA 1KA9F 5JBFA 5A6AA 1TPC1 2QUVA 5I3FA 2QQWA 1JXKA 2VFDA 1H7WA 1ODZA 2QCMA 3SUVA 2CBUA 1W9PA 3FIGA 2DT2A 3QYQA 1KM1A 1ZBVA 1SR0A 1FCBA 4GBUA 1MQPA 1V6UA 3DI0A 3L2MA 3O06A 4LVDA 1S46A 3NSNA 3O05A 1MFVA 4PUDA 2PCQA 5M03A 3PWAA 1FWNA 1AQMA 4D6HA 1UQYA 2AEZA 1FWWA 4O50A 1ZL1A 3BCDA 3IANA 4QFUA 2XPKA 2GQ9A 4FNSA 4KGLA 1F2JA 2DQXA 3LTSA 3SCQA 3C2EA 3LDVA 3LRKA 1HKKA 3LV5A 4EANA 3TU9A 1E73M 3OVRA 3CHDA 2VURA 4P8XA 1E5JA 1LL4A 4FF5A 1KXVA 4XKYA 1P4CA 5HUPA 5I23A 1V3IA 3GNOA 1S5WA 4M56A 4D6EA 1IXPA 5E93A 3W1TA 3AHVA 4MDOA 3P8IA 2DH3A 3CZ8A 4RXFA 3ZSTA 4K8EA 1W56A 3R89A 2RDWA 5L9FA 3PS7A 3DFSA 3CZLA 1QOPA 1LOLA 1YDNA 3TDFA 3DFNA 4WSKA 4BQ2A 4JX6A 1E9LA 5D33A 5C55A 3GR7A 2GVLA 1QBBA 5D9NA 4LRSA 2VZVA 3L4TA 5KSWA 4XBKA 4MPKA 2WCSA 2X05A 1WB0A 5D2WA 1TRIA 4MJZA 3BH4A 5FOOA 1ALDA 2EAWA 1XKYA 3WMCA 1GOKA 2BTMA 1NSJA 5TBOA 1YADA 5H91A 1HNYA 2W61A 2Y63A 1ZCOA 3LCWA 1GONA 1CTNA 4NNBA 2WMFA 4CD8A 5D37A 3GYCA 3WH8A 3LFIA 4NXSA 2WVVA 3IIXA 4H3DA 1Z44A 3CBWA 4Z2LA 1W0MA 1FFQA 3I3BA 5FEXA 1VCVA 4D6IA 4BFAA 2JKPA 3L66A 1R46A 1NP2A 2FHFA 4HPGA 4JTKA 3W1UA 3UWQA 4W7UA 5CG7A 3EWBX 4ATWA 2JEPA 4X9SA 2CYGA 2ISVA 1I2PA 2FJKA 3DFOA 4JTJA 4UTWA 1G9HA 3L4WA 3RJXA 5CPTA 5DELA 1JNDA 3WH6A 4AIOA 4GJ1A 1EB3A 1VFMA 3SR7A 4UQBA 4FX7A 5HWJA 3B0UX 1QI2A 4E8DA 4NNCA 3STGA 3W82A 3MHFA 2DORA 2DJXA 4ZQPA 1E6PA 4M1RA 3EX3A 1GPFA 3LCLA 3FYOA 2OWWA 2JKAA 3C3NA 3CIVA 2WZIA 3GH7A 3TW6A 2CKRA 3CIXA 1HKIA 1Q6CA 2F7FA 5FESA 2XHYA 3LCGA 2X1IA 1WQ5A 3LGEA 1B90A 1NARA 1O6IA 1LWJA 2ZXBA 3GXPA 2E1DA 1GWJA 2C3ZA 4N6FA 5IM51 4H8UA 2EPMX 1SO6A 3F03K 4CU8A 3K30A 4P7LA 4MAZA 1D2KA 1JCXA 1ZBCA 2Y7DA 1GJPA 1ZY9A 1E71M 1QI5A 3GTNA 3VDAA 4XUYA 4HOZA 3POHA 3T2PA 2DPEA 4XZBA 5AYYA 1HIZA 3VCRA 2CIPA 4QISA 5DF0A 2YR1A 4P7RA 2YYTA 3SZ8A 4IPJA 1BYBA 1QMLA 4M6VA 2F61A 5C5YA 1K9EA 1NWTA 3OLIA 2X0YA 5C6MA 2NT0A 3SURA 1M04A 1QNSA 5D03A 1JAKA 5DCBA 2QCLA 1L6SA 5LNSA 1JXJA 2E9LA 3VMOA 3EMQA 3W3OA 3PM6A 4GE8A 1I75A 2DZWA 3QC3A 2E4TA 3DU0A 2OYLA 4P7QA 3OIXA 3NQDA 3AFBA 3N1AA 1RP9A 4IJBA 1J12A 1XCFA 3E12A 2WMGA 4NI3A 2ZUWA 3ABQA 1AVAA 5I24A 3A6OA 2YCEA 1M5WA 3A5VA 3NNTA 1JQXA 1X1NA 1WZLA 3HG4A 2ZZ3A 3UPBA 4QCEA 2YLAA 3C2VA 1EDQA 2DIJA 1JYNA 1DHPA 4IUOA 1BYCA 4M7TA 3P7YA 1MWOA 1ME9A 4JDBA 2ADEA 1YXDA 2WXDM 3IVUA 4JX4A 3JUGA 4X0NA 1YYAA 1TRDA 1UUOA 2YFOA 2GSJA 3JR2A 3B04A 4NVTA 3VDHA 4LX4A 2TRSA 3SCOA 4DO4A 4TMBA 3LHYA 2VEIA 4FB7A 4FNTA 2G96A 4AZGA 2NT1A 4WY0A 2CNCA 4N4PA 3NQVA 1MSSA 2C8NA 3MUIA 2A0NA 1K7EA 3OVQA 2Y7GA 4JTTA 3S1XA 3RCNA 3F5LA 1EQCA 4UTMA 1UKSA 3O15A 2VQUA 4JAWA 4EVZA 2W91A 2QDGA 1VIWA 3WNOA 3G1XA 1TMQA 3W7NA 4H7VA 3HJEA 4XUGA 5BXSA 1NFBA 3UWVA 4UZUA 4CD4A 4IGHA 1ISWA 4N9CA 3B06A 3NDYA 4AD1A 3VM5A 1BGAA 4OKDA 1MQRA 5GPRA 3WBAA 2JALA 5HDRA 1OJXA 1ADOA 4FEZA 3KF3A 4I7VA 1W91A 4GNJA 5AHFA 1HL9A 1GQIA 3RWKX 3BLPX 1VYRA 2E6FA 5AC6A 1EX5A 3O16A 3ZWTA 3I3DA 4BQ5A 1OFEA 3HPSA 3FHQA 4OT7A 4JICA 5T26A 5LSMA 4O18A 1H4PA 3TQVA 1A53A 3SC7X 1N7KA 3NM3A 5I3HA 2DSUA 3HG3A 3S0CA 4NXKA 4TR9A 3KL5A 5K4XA 1PV8A 3NPWA 2XVKA 1B9BA 1Q6LA 1QI4A 3W2MA 1DWAM 4H6KA 3GKAA 2H3BA 3C56A 1VFUA 1WAWA 2ZX8A 5KZEA 3FLUA 4Y90A 4DUXA 1WAUA 4ML9A 4KH2A 1LBLA 3THCA 5CKSA 2NUYA 4AC1X 4NRRA 4AD0A 2FIQA 4N2YA 5JBEA 3S2CA 4JN6A 1P1XA 3P5YA 3PULA 2WLYA 3BCFA 2I14A 3HMCA 2FFCA 1PCKA 1QNQA 1UWIA 1UD4A 1E55A 2P0OA 2CHOA 2E09A 3G1AA 1HVXA 2WAGA 2CZEA 3APGA 3UXAA 1US2A 1QNRA 4GWEA 5AHMA 2WHLA 4J3TA 5A6KA 5BOOA 3OBKA 3I3EA 5DEZA 3A3HA 1KFWA 3MI2A 1WDRA 1W8SA 2WV8A 1WPCA 2V3GA 2WNNA 3EWYA 5HOSA 3TNOA 4JKLA 1UH2A 2QCEA 4ALDA 2VX5A 3IMMA 4JL2A 2ATMA 1O95A 2WCGA 1I8JA 3UPWA 4UFKA 1R7OA 3KX6A 1WDQA 4ONVA 2H8XA 1SU5A 4Q32A 3G1FA 3KF5A 4A2SA 2JKEA 3AMKA 1O94A 2QCNA 2G3JA 1V0LA 1XHGA 1IGSA 4OQVA 1FWRA 3IIOA 3G1DA 1CGVA 4OBSA 4AWEA 4D71A 4K7VA 3IAQA 1ML1A 4MYAA 3S5OA 3RLUA 1WA3A 1GVOA 3GH5A 4GQRA 3T0DA 2WBGA 1ODUA 2BWGA 2BXVA 1TQJA 1VJSA 3QGVA 4BWLC 2BY3A 1GW1A 2ZXQA 5DY3A 1H5VA 3NUKA 5KZMA 2CPUA 5I78A 4WQ6A 1CWYA 4HHPA 5FL1A 4DO6A 5A6MA 4B16A 4R34A 4UQCA 2IXUA 1DV7A 4KMQA 2DU2A 3WJZA 3W7RA 4QAIA 4RK8A 1K8XA 2XYLA 3LPFA 3GH4A 5K4ZA 5G2IA 1WDPA 2Y4SA 1K03A 3B9DA 1JUKA 3W1XA 4DXVA 5F2IA 3U1XA 3WF4A 2WZHA 3VDBA 3SUSA 3W0KA 4CVUA 1QOXA 4MAVA 1SW0A 3MHGA 3M5XA 2VZTA 2FDMA 4MB4A 3EDFA 3IRDA 1UH4A 3NQAA 3W6LA 3WEZA 1TV8A 1EDTA 2CLOA 1H7XA 1ZENA 2I9EA 1EP1A 5G4WA 3WK0A 4A2RA 3ARXA 3EMCA 6CGTA 2V8ZA 3M07A 3B0PA 5G2WA 1FQ0A 3BPWA 3UG5A 4JR5A 1DWJM 4RV8A 2XFWA 4UMBA 2C13A 3P80A 1R85A 2EGZA 5E09A 3VOCA 1LRQA 1LZOA 2VEMA 2CETA 3WDPP 2R14A 5LZLA 1Q6QA 2GJRA 3SCVA 4PFMA 4BA0A 4WZHA 4JYFA 4PODA 2AGKA 3CHFA 5HMSA 1XBVA 4K7YA 1KWKA 1A5CA 3NQGA 1B3XA 2Q3RA 1UD8A 3LI1A 2YW4A 2GK1B 1QNVA 2XVPA 2X16A 3QOMA 4JFVA 1A5SA 1OFRA 1XBXA 1C8VA 4UOJA 2QUUA 4UQDA 3SIZA 1BQCA 3M6YA 1JG9A 2PF0A 2E5BA 2WJZA 1Q45A 4JFUA 3P67A 4AD3A 4PRWA 3I7RA 2YA1A 2ESCA 3N34A 2UY5A 3D0CA 2BS9A 3NQCA 2OJPA 4P7OA 2HTMA 5I79A 4HA4A 1W31A 2XSAA 3MUY1 1XXXA 1FXQA 3L65A 1ITCA 5CPQA 1QFEA 3GZ3A 1QI3A 1KBIA 1Z48A 1KTNA 2NSXA 3WUBA 4ZQRA 4ACZB 2EJ1A 1X7FA 2E5CA 3L67A 1R86A 3VNZA 4K8HA 3TR2A 5AHEA 3UY8A 1VF8A 2CEQA 3F1QA 1UKPA 1MEWA 1EO7A 3ALFA 3M44A 1F4AA 1EO5A 1LL7A 4HIBA 3PF3A 4FX8A 1G4PA 5M17A 2PI6A 3LIGA 5AC5A 2ZA2A 4LS2A 4ZQNA 4EF9A 4AD5A 1G67A 2GPTA 1C90A 3NZ1A 4Z1AA 1X1ZA 3AMLA 2NX1A 4LYRA 4PTVA 3WJYA 5CZTA 3BAXA 2X1UA 1TTPA 5BNKA 4PEEA 3ZT5A 4M7SA 4O17A 3LV6A 1SSDA 4PN2A 2FGZA 4J28A 1L8NA 5D8WA 1AMKA 1H09A 4GIAA 4AF0A 1DJNA 1I2RA 3LXCA 4HPXA 3TROA 4GUGA 5AYXA 1ZJBA 4UCGA 4V27A 4IOTA 5FF4A 4KRTA 5FIPA 7CGTA 1ECEA 2OZ0A 1SMDA 2QF8A 2E6DA 1DWHM 1JZ7A 3ARTA 3F5JA 1J0HA 4Z0JA 4MY1A 2G3MA 3ARRA 2ZRXA 3NDOA 3PUEA 1F6KA 3S42A 4CD6A 2PRHA 2VEPA 3IIPA 3BG9A 1ZALA 2RHGA 3NQ8A 4K38A 3W88A 1MW3A 2QHAA 2YOCA 3B8DA 1MZHA
chains in the Genus database with same CATH superfamily
3WF1A 3BB6A 1DE5A 4XWUA 3WDUA 3TP4A 4W9TA 5E1RA 3OYWB 3ZT6A 1OYBA 3K4AA 4JTEA 4NJIA 5K9DA 1QPRA 2P8BA 2MEV1 3LLDA 4FOUA 3C2OA 4SLIA 3M4HA 3QPEA 1UOGA 5DZFA 4UR7A 1EWEA 1TWDA 3NPUA 1YCIA 1I9RA 1W5QA 1WZMA 3FUOA 4XJWA 4OHWA 3SCUA 2WDBA 2HMCA 4GGHA 1B35C 2V72A 1EKOA 3IIAA 3F5KA 4WXYA 1A5UA 3RLHA 3TJXA 3N9MA 1VAHA 3JBG3 4U5KA 7ODCA 3AP5A 5A94A 2ZGOA 3K8MA 1D2SA 3KQRA 4M3CE 2ZUMA 1BWVA 3K51A 3GX9A 4IQPA 3GG8A 1AZ2A 1O68A 3CQKA 3CUJA 1W1PA 5DAPA 4XHBA 4AY8A 2OUHA 1K8YA 5EMUA 2VW1A 4GKXA 1PKLA 7A3HA 1W39A 3BQ6A 4LMFA 4BY3A 4QS5A 3ARZA 1A50A 1XLLA 1NTHA 1BKHA 7REQB 3LS9A 2ZFAA 2HEVF 2IXLA 1Y7VA 1POV3 4O1DA 5G04L 3QN3A 1FFRA 3MHZA 4J25A 4C1XA 5J5RA 3AB0A 3I97A 3PIJA 2W66A 4QSHA 2NSOA 1US3A 4AQTA 1JBCA 2DCYA 2VUYA 4MOZA 3ZJKA 3K8LA 3WCSA 1EV13 3NFUA 4WIWA 4MZ1A 4RW5A 1O6UA 3RMJA 4DNMA 3AMCA 1CAXA 2W47A 4RZ4A 1WMXA 3B4UA 2J6XA 4JQ1A 4C6DA 3M41A 1Q4WA 3OCPA 2VNRA 1C91A 3AROA 3H1YA 1AX1A 1FKXA 4MSSA 3F2CA 1XDLA 4AQSA 3WV6A 4RS5A 1UAIA 1OFDA 1U12A 3AMGA 1DXFA 2VXNA 4G7FA 2Y85A 4LAUA 3VZNA 4QDRA 5BY5A 3R43A 3W58A 5FYUA 2P5NA 5C3SA 2V5CA 2ZCGA 3GW0A 4G1NA 1KQZA 5C4WA 3M5VA 4MHRA 2WVTA 5FAJA 1UY3A 4QHRA 3U6WA 2OIIA 4K37A 3TIMA 2BBAA 1YJKA 3H53A 4AW7A 4C8DA 1H2JA 2WC2A 1GK8A 5LNUA 2ZICA 2CC0A 2EG8A 3BZJA 3Q37A 1OC6A 4YCPA 2UY4A 2HKXA 3KBJA 1S1PA 2CESA 1H49A 2Y24A 4CNPA 2NQJA 3XIMA 1DQ0A 1OADA 4JYEA 1VFLA 5EL1A 4BLJA 5GZFA 1QBAA 2JDYA 3D4KA 1Y0EA 3BJFA 1RPKA 1TPUA 3V7PA 5AC92 5CFDA 4CUBA 2YCLA 5E5CA 2CCRA 2RDUA 4E9KA 1VRH1 1V3MA 3URFA 3JB4C 1HRI3 4IMEA 2VHLA 4ZE4A 4HK9A 4DO0A 1LEDA 4L6HA 2C0AA 1AUYA 3EPMA 1O4ZA 2PRLA 6XIMA 2G9ZA 3W02A 4PZVA 3IEBA 1W9XA 2WC4A 4GALA 2EA7A 1BK0A 4AGGA 4XZHA 2E51A 4AEDC 4RE3A 3DF0A 1X98A 1EDGA 5B7YA 1B3VA 2XN0A 3AYTA 2OTDA 4BI6A 3AXEA 3WDQA 1O3TA 3W7LA 4TVCA 5H2ZA 3NCOA 1JU3A 3W01A 1XIGA 2O9RA 4ZFMA 4A41A 3NSXA 4MNKA 3GHNA 3TNPB 1VHCA 1UASA 3NZQA 2IXIA 1L2QA 5FMBA 3THTA 1W3IA 2GLKA 3GYDA 3QTPA 3BMXA 3JB8A 4JD4A 5A6BA 2X2GA 4QLLA 2ABBA 2H9AA 3NJ3A 1RUI1 2Y5JA 2ENRA 4R9AA 5HCBA 3VIHA 4Y3OA 4IQLA 4CQCA 3UZ5A 2A3HA 2PQSA 4Q3MA 2FPVA 1IT0A 4FLOA 4LBQD 3C2RA 1E56A 4DZHA 1F35A 3CH0A 2QDHA 2BOFX 2X1TA 3AI0A 3R79A 5GZDA 4BHPA 2WA4A 3TZFA 1UD6A 2F6BA 3AJZA 4UTKA 1ZQ5A 2W4XA 1W6PA 2YROA 1FCQA 4OHXA 1FBAA 4JCLA 3OUHA 4LS1A 2CKSA 5I00A 1C8XA 3IGUA 2ICSA 4ACZA 3KVAA 3G6MA 3AVSA 2FLIA 1R87A 2OX1A 2BY1A 3N29A 4Y5Z0 3WMLA 3VHNA 4MPQA 4GHRA 2JDUA 5FJKA 5K3VA 5LIYX 4ZVJA 1Z7S2 4YM2A 3VNDA 3JRKA 3L2HA 1BG9A 1OCJA 1A5AA 2GGEA 4CDXA 3ARYA 1KLZA 3WLMA 2RAGA 1HT6A 3ATYA 5AC4A 4PA8A 5EIYB 4UTTC 3TWAA 4V2XA 1OFSA 2IUZA 4M3PA 3EKZA 3VD9A 1ZBE1 6ENLA 3VKKA 3ZFHA 4HK5A 4AEEA 2YBUA 2VELA 1WNOA 3BVJA 2W63A 1RQHA 3ZO0B 3GZEA 4IMCA 3MUCA 2DU0A 4A05A 1CWPA 1XF0A 4JFTA 1IXQA 4DS0A 1J0KA 3EWDA 3TOPA 2BU9A 1YTDA 2HS8A 4WKFA 2V2DA 5EKYA 1ZJIA 2RFGA 2TMDA 3GG7A 2G1MA 4D69A 1W9BM 1OEPA 5CQ1A 3WQEA 3RWNA 1R8LA 2J1AA 3PUAA 1WBFA 3L68A 4XVEA 1K77A 3DX5A 5DANA 3ZZ1A 1V3JA 4R27A 3KS5A 3S1UA 5ANNA 4IGPA 2XUMA 5K0UB 3FA3A 3WW2A 5A3OA 3SISA 2O55A 1ZBWA 3FFQA 4DRRA 1R3QA 4W65A 2RJHA 4PTNA 3VBOA 1W99A 4EPDC 1GT8A 1Q6RA 3ACGA 3FC0A 2DVAA 3VNIA 2E32A 3VNYA 2QTWB 3C3VA 4AQ2A 3CPRA 4XBJA 5LY1A 4BISA 4I6KA 2CU0A 2WLZA 2J62A 4RNJA 5D2YA 3GBDA 3W1AA 1ZBKA 3L12A 3EA2A 3UJ2A 1A8DA 2WWCA 4YVVA 5C2XA 2WMJA 1JDCA 4LV4A 1TUXA 2GNTA 4LIVA 3KP1A 3E2RA 4BXFA 2JKBA 3THQA 3F95A 1O1ZA 1UOZA 4UR9A 2Q1ZB 5FXZA 5HNRA 1SW7A 1ISYA 4QKBA 2VNVA 4RE4A 4CYDA 4Q4SA 1Q7MA 3EOOA 4KBZA 3RPQA 3DG7A 1SACA 2ZEXA 2QMJA 2R061 1JCYA 5ACA1 1S2KA 1PK6B 2HWD3 5FZEA 2Z29A 5AN7A 4CDUC 3M16A 2J4GA 4S1FA 4Y2WA 1GOMA 2B81A 2GN3A 4UTUA 3CZUA 1O5KA 2KA3A 4AAXA 1UCXA 2ZX0A 4ADTA 5AY7A 4CEUC 1EGZA 4PYSA 4WF7A 1M4WA 1TQ5A 1HKWA 2C7FA 4I5RA 5FMDA 1D0GA 1AR92 4LXFA 1XM3A 2XH4A 4O19A 1F5JA 1XLAA 2XIOA 5IATA 1S0IA 4IGSA 3AVRA 1EQPA 4Y9AA 4NHYA 4GKYA 1PX4A 1EC8A 3GVGA 4AEMA 1CDGA 1RUD1 2ZS6B 5A32B 3MMWA 1O7AA 1C3FA 2BWCA 4CU9A 3LDRA 3VUPA 1YPFA 4LBQB 1NWRA 2OEKA 2QCDB 4CNNA 1UD5A 3EEGA 3SDOA 4EV0A 2PODA 4YJ5A 2AENA 3J7LA 4IIHA 4D7SA 3DHUA 3TN6A 4NPRA 4BR1A 3L2YA 5JDBA 2WPBA 3R12A 1DU3D 2X2YA 2VI0A 3I4EA 1A0CA 4MB5A 3LOTA 3BZGA 3WJSA 4Q4X3 3QY7A 1KGUA 4WLCA 4O11A 3GXDA 1TMLA 5IVCA 2CDOA 4RJEA 5HNNA 1UY1A 2GOUA 2JG8B 1FWDC 1KXTA 3UCQA 3JW7A 1FH8A 3PBGA 1VQTA 1KKOA 1S1AA 1W6QB 4BB3A 1JOPA 4LUYA 2A6WA 2SBAA 3D46A 1RYYA 3BN6A 5FWEA 2ZA1A 5CNAA 4KG0A 4HSJA 2QQVA 3ZYFA 2GGIA 2BJSA 3CYVA 3ARPA 2A3XA 1VJ2A 3SN1A 1C1LA 3MO7A 1OX5A 2YFZA 4L6DA 4XTIA 5AKQA 1WV2A 4E2BA 2D6KA 1EH9A 3UXDA 3E6BA 2GALA 1ISXA 1WUFA 4PSPA 3ISIX 1ENUA 2GMEA 4S2DA 1OGSA 3HQUA 3AIWA 1IG0A 4FBFA 4A6GA 4UBPC 4CDQB 1MQTC 1R3TA 5XIMA 2PAEA 4B1LA 3RYPA 1GCYA 3NM1A 4KW2A 3G5EA 5HULA 4O1BA 1TME2 5CSSA 5GLZA 4AVFA 3DCQA 5FP9A 5A8GA 1QASA 3JBG1 5G4HC 2YDSA 2QBXA 4INDA 4ZU7A 3WD5A 3LZ5A 3S2LA 1H7PA 3BALA 3IAPA 1PTDA 1R64A 1EIBA 3ABOA 1HRV3 4IXHA 4FS9A 1ND2B 4O14A 2WSYA 5JU6A 2KZHA 2VP8A 4QB1A 3WSUA 2ZZ7A 3OVPA 1ONXA 5FJIA 3O14A 1K3UA 5SV5A 3MV01 5DUXA 5IK4A 2WSVA 1V03A 4RZBA 4CXXA 4J3XA 2RGMA 1TTIA 4XZWA 1LENA 2FB3A 1SO3A 1LTDA 1POV1 1XG3A 3TC7A 3UEQA 3MUZ1 1JNEA 3BOXA 4LO4B 3GXNA 1GVFA 2V6AA 3W73A 3VL9A 2P76A 3B8SA 1E1FA 1X36A 1KXQA 3KW3A 3UWWA 2C1HA 4BQWA 2R071 3JUUA 1E6XM 1UX6A 5A33B 1YQ8A 4BS0A 2UURA 2DUXA 5IAVA 5CU1A 4JTFA 3UJFA 3PU8A 1W8ZA 2ZBJA 4Z2KA 3TCSA 1JHJA 3H50A 2IKIA 3ZN4A 3GCWA 3LHUA 3OBEA 4LC6A 3WMBA 3VKDA 1B09A 4AH7A 3M8LA 3U2OA 3VHRA 4TUFA 4L9YA 4QX0A 3R5EA 1JEZA 4R8HA 1OBAA 4LHKA 1PNGA 4PIYA 1JUBA 1SCSA 3PTDA 2ZGSA 4DXRA 4WBBA 1J8VA 1RQBA 4N7UA 3PJWA 2PTDA 1OFOA 3AIUA 4KF1A 2ACQA 1LKNA 5A7PA 1ISVA 5F4XA 2OU4A 4BF7A 2F4LA 3BK0A 1IR2A 1O1HA 4FP1A 5BWFA 2VCAA 4J6GA 1AH4A 1UR1A 3TYDA 1NLSA 3UETA 2OO0A 4H7ZA 1H1IA 4MKSA 2RMU3 1BTMA 4TN7A 4H2CA 1W5PA 1J84A 2I74A 4DB7A 1YDVA 3CEPA 4GISA 1JIBA 3K5XA 4IETA 1FA2A 3DHPA 1LROA 2JX9A 1UROA 1M7XA 3CUFA 3UCDA 5DBUA 2J9YA 1SO5A 2YC4A 1M41A 4JKKA 1SR9A 2CAUA 1HO4A 2A7RA 2QULA 2WO7A 4B5XA 3V35A 4UXDA 1I0BA 1BVNP 1DLLA 1MS3A 5FPBA 1HQWA 3ZFGB 3VM7A 2JIGA 2J8FA 1ZZMA 2PU1A 1H11A 4RCXA 4ZSUA 4HSLA 3BW4A 5FPUA 3PZQA 2RS33 3AMHA 1V3KA 1E9IA 3T3YA 7ENLA 3WMSA 2KAUC 2ATSA 3L2IA 5GNXA 2VW0A 3MV11 4R4ZA 3VC6A 3R8HA 3QBUA 1TCDA 2GFTA 4IQDA 4UR8A 2Y0FA 4K40A 2Q1MA 5EY5A 4GH3A 5DMNA 4AMCA 4XEZA 2C0ZA 1JOBA 3FOKA 4PCNA 3W7JA 2BXZA 2XM2A 1HX6A 4URIA 3BG3A 2VX6A 3I3QA 3T4CA 1JODA 4CQ9A 1IGOA 3OGSA 3CJIA 2D24A 2WN3A 4MWAE 5H6HA 3FX3A 2OR2A 1XNTA 2BTVC 2VC5A 1K4HA 4O0ZA 3FAXA 4O54A 4DFSA 1VBE3 1W6NA 3CAKA 3KBMA 4NROA 1TV5A 5AYBA 3N9KA 2WHJA 3GD6A 3VU2A 1X9TA 3W87A 4FPKA 1XLGA 5EPAA 3VOGA 4UC5A 3PU3A 1V00A 4FZIA 2A3WA 4GAZA 2C16A 2PWGA 4MJ2A 5LA1A 3VC5A 1M7OA 3H2MA 1AVBA 1OXCA 4DY1A 3E2SA 2AEYA 4OI0A 4NRSA 1AR62 1G9FA 2NPIA 4MX3A 1J2WA 5C0QA 4AY1A 4LUKA 3ORJA 4CUCA 2WA3A 2BZDA 3CIHA 4GC4A 4CNSA 5E6YA 1E40A 1KM2A 4DPQA 4JZRA 4Q27A 1J3QA 4PMXA 2HE8A 4C65A 5A8QA 5H8PA 5IK7A 4Z1DA 1Z78A 1UL9A 4BLIA 2GVYA 2OMAA 4OHVA 3GAKA 5A7WB 4AZZA 4CEWA 1EUUA 3GTIA 2MNGA 5F4WA 1OLQA 1D3HA 3W29A 4GOAA 1HJSA 1V7AA 2B7NA 1GG1A 3WH5A 2DIEA 4WUIA 3SRDA 2GN7A 5L19A 1UZ1A 5GNYA 3R2GA 3S0MA 2YL6A 2INEA 3SNMA 3TAKA 1OFAA 4LVFA 4F2TA 3CV7A 2WMKA 2QV5A 3H23A 1LJ7A 4TX9A 4GJJA 3TYAA 4F9DA 2FTPA 2R24A 1SZFA 3NQMA 1NXMA 2FPYA 1HKVA 3K1GA 1NCQC 5I0SA 5LNWA 6REQA 3ERPA 4E27A 1S0BA 4QXCA 2CV6A 4JQTA 3WFLA 4ZZ9A 3N2OA 4N7IA 2RJ2A 5IT6A 1YRZA 4GUIA 1LOCA 4U33A 1XIJA 3UWUA 2IS7A 4KWKA 1SO4A 3IK4A 4OUIA 2BZNA 4W86A 1W03A 4LT9A 4KG8A 2ZTNA 2OWXA 2Z1KA 4F3JA 1WCQA 4BA6A 2XGBA 3BXWA 3LM3A 3TJ4A 4DUVA 2WKLA 4AFCA 4LCRA 1QQP2 4QD2A 3NV2A 5K4LA 1V7YA 4LBOA 3NKTA 4H41A 4N9DA 2NQLA 3CAWA 3W1NA 4XB3A 1QR7A 2Z0IA 1AJZA 1ZB5A 2ZHKA 2DJLA 2EIDA 1HXS2 3I2HA 2ZOXA 1LODA 1UA7A 2B7OA 4KIRA 3BWWA 3TH6A 1ICPA 4JX5A 4PL1A 1UZDA 3CQ0A 3PZVA 2X10A 4QQ2A 3QOKA 4IESA 1DBTA 2JECA 1Q3NA 4C90A 2ZYFA 3MZNA 2PBOA 2JENA 4IEUA 4TV6A 1LOSA 3J7MA 4NYUA 1VBC3 3CZEA 4GUHA 3PHMA 4I9AA 2VD9A 3K8KA 3RX2A 1EZ2A 1VH7A 1YDYA 1ZRIA 3X29B 1LBMA 2VL4A 2HWD1 1F3XA 2VVNA 2W1QA 4AGRA 2P88A 4YTUA 4M82A 3S7IA 4GA9A 2X7VA 2I2SA 3SQMA 2R9RA 4IT1A 1HN0A 4ML4A 3SBFA 2WNOA 4F0SA 1PS9A 1DXEA 3HPAA 1E6RA 3KVBA 1Y9QA 1KM5A 3SCFA 4O1CA 3SIMA 3SCWA 3EPOA 5FYCA 2JIWA 3O1VA 4L56A 4P08A 1SQ7A 3FLPA 1U5XA 1XLBA 3M43A 4MTVA 3SO7A 2E7QA 3LHTA 3PBUA 1P0DA 2ON3A 2PU0A 1A8MA 3NAPB 3PMSA 1VJIA 1PKYA 5CFCB 4XFGA 1ZAHA 2ZGLA 4PBPA 3UPMA 4Z42C 5DX7A 1MXSA 3DXUA 3FEQA 2FYMA 1SPQA 1SFPA 4DJDD 3EDEA 5KR7A 4G7EB 2VMEA 3ZR4A 4PTWA 2YPDA 5FZIA 5I0DA 2X5IC 1OC5A 4RGAA 1XNCA 5FYYA 5K9CA 4GQQA 1AYM2 2D44A 2HCVA 1S3HA 1QTWA 1MS5A 3GB6A 4OV9A 3WLIA 1P6BA 4HTBA 4FFIA 3KM5A 4Q4X1 4CTEA 2Y38A 4FQ4A 3MI3A 1QJY3 4I7UA 2IKHA 5DAWA 4GZ9A 4LB3A 5L7OB 3M1ZA 3OOXA 3NQFA 1LTEA 3IGHX 2Z42A 1SDWA 2VTXJ 5KBFA 5HMFA 4FOQA 2GQ8A 2VDIA 5J04A 5EFUA 2C1GA 3PBWA 3QFWA 4JEJA 2VEKA 1NP0A 4LAKA 3U2CA 3W23A 3B0VC 1JTZX 3IV3A 4HPHA 4DZ5A 3LPOA 3MKVA 1WMEA 1OK4A 1KITA 4RYDA 1VRBA 3ORWA 2ZHMA 3P14A 1T7LA 3QLQA 3MF6A 4ZOAA 5AZ1A 4ES8A 3BW2A 3UG8A 1FP8A 3N3MA 4WEVX 5LBFA 3F4NA 3V16A 3QQ1A 5FEWA 1EL3A 2QPUA 2WPGA 1GQPA 4Q0UA 3NNJA 4XX6A 1XGEA 2E53A 4LUTB 4S3GA 1LCLA 1JI6A 3CWOX 1COV2 3DYMA 4HETA 1FOBA 3KRUA 4HHMA 3FZ3A 5FZOA 4MNLA 4XAEA 3L5LA 3HGOA 3MYPA 2XLGA 3LXAA 5D2XA 4ZQCA 4GQ0A 1MVEA 1YE6A 4HPJA 5G4EA 3ZS4A 3PIGA 1C7SA 3M0ZA 4MZYA 4JNZA 1B31A 4EXAA 4WM8A 4FSAA 1W1TA 5FO7B 1EAH2 1HRV1 4GCXA 3E9AA 3KMHA 1XIHA 3D3FA 1HJQA 3WQ5A 1WOBA 4ARYA 2XG3A 4GYPA 2QXWA 5T9BG 2WZR3 2XJ7A 4HNNA 1XOYA 3O1NA 3C7FA 4CDWC 1YIFA 4N43A 3KBNA 4RXGA 2Z00A 2X1RA 3W25A 4R52A 1NKGA 2IQTA 5FSEC 1TWZA 2EXOA 3N7KA 4IP4A 2J7EA 2DURA 3U57A 3DEQA 4C7FA 1HO1A 1MW0A 1OQEA 4UNKA 1SPPA 1WA4A 5IJRA 1X38A 5JIPA 1A5NC 1S2TA 3P3PA 4DJFC 2CYFA 2JE8A 1E6QM 4IMGA 1XYFA 1KKRA 5T5JA 3BL3A 3KHDA 2J25A 5I3IA 5FCCA 3ANVA 7XIMA 1V8EA 1QJZA 5F6KA 1CYGA 3KTSA 1U5VA 3AICA 3LY0A 3WLOA 1KM0A 2QGYA 3BICA 2E31A 2VQAA 2XQRA 1I60A 1QAPA 1DIDA 4HHHA 1OF8A 3HPFA 4X63A 3DFTA 1T99A 3WF2A 1SFYA 4U2AA 4E2OA 2VUCA 5F3GA 1AW5A 5TSWA 2XH2A 3IJ9A 1DTNA 1QPNA 2W27A 4WX2A 3E6CC 8RUCA 5DDJ2 2A4AA 5FF3A 3V1HA 1W1IE 1YHFA 3KV6A 4U2YA 4X6RB 1P0KA 1HQTA 5CSUA 3HV8A 1XLMA 4Y4YA 5I77A 2RMU1 1OKOA 4LBKA 3PY2A 1B54A 3J8F3 4DF1A 1FATA 3W00A 2EF9A 3LAGA 2R16A 2OYKA 3BVCA 4CNTA 1PDZA 2RKXA 1GOGA 3W9AA 3AJ7A 2X29A 4AR2A 3AISA 3O6DA 3TAYA 5FY8A 2QQOA 3F4DA 4U10A 4XO7A 2XJUA 3D5HA 3S1VA 1BKSA 1BPLB 2YXGA 1SMAA 2HJIA 2Y7FA 4XKYB 1TMF2 4AISA 2GC0A 1KCXA 1QVBA 1LORA 4ET7A 3QCWA 2Y64A 3L23A 2XN2A 1OQFA 5I93A 3KTXA 1MW1A 5IDZA 3WY6A 3WNLA 1IZKA 1RMU3 1VB2A 3MKKA 1CLKA 3OPSA 1CX9A 4CQ8A 5G05L 5FI8A 5ABJA 4AXNA 2VZOA 2WQ4A 2G50A 2NMOA 3EX6A 4AI2A 4BF9A 1Y4WA 3WW3A 1A0EA 1M6JA 4HT1T 5FZ0A 5CPOA 3W7GA 3NSTA 4DNYA 1IKQA 2XUCA 3CU2A 4QEEA 5CPLA 3SCGA 4FCAA 2D98A 3V4BA 3MICA 3FJ4A 3OJBA 4AEDA 4AD4A 1XSIA 2Y61A 2LUWA 4QKNA 3KZSA 1TIWA 2PDHA 3MVTA 1G9BA 3B9CA 2PUZA 3BPSA 4Y7EA 1QI0A 2Z1BA 4JS3A 4TOQA 4CCDA 3JU9A 4IV1A 3O6YX 4YS1A 1GOOA 3VBRB 1M53A 3N9OA 4XZPA 3UERA 3WJWA 1WW6A 3SM0A 3BIWE 4XZ9A 3PAJA 1H0GA 1SLCA 4WXZA 3ZSJA 4B3NA 2CLIA 3WDJA 2ARBA 3UVAA 5FMOL 3ZVIA 3TCEA 5H9RA 1KRCC 1U5ZA 4K8RB 4L99A 1XCXA 2ZWYA 1TJ1A 1AK5A 2V73A 5BPXA 3JD73 1RBAA 5EU9A 1A3KA 3VBSB 1PIV2 3RUBL 1UXXX 2XFYA 2IXHA 2W08A 1BBT3 2HWB3 4IQJA 2EHHA 2C19A 2DWRA 4PC8A 5J1XA 3HQOA 2P2KA 1CLVA 4XG1A 2V5LA 1EHNA 5CC6A 4KWLA 1Q8OA 4M0XA 1P6WA 2Q71A 2RDRA 4QXIA 5FLIA 4N53B 4PFHA 3ARSA 2ZADA 3GNDA 1DF0A 3W26A 3PJYA 1JDAA 2W1WA 4AVCA 2UY8A 4OHYA 3EO6A 3LPPA 1PX3A 4HMDA 1GLHA 1AL7A 4BKNA 2AQWA 1WA6X 5KWRA 3OP2A 5LK5A 1B0IA 4ZXOA 5A1FA 5CBJA 1XI3A 3HPNA 5L9RA 1DHKA 2XG9A 1NQJA 5JAXA 4OQ8A 3W83A 4UTTA 1DLCA 5FREA 1GKPA 1J9YA 3N6JA 3A7QA 4YW7A 4CP2A 1J11A 4LUSB 5T54A 3BOLA 1PO11 1Z9AA 3TYUA 1MO0A 3MANA 2PMQA 3MP4A 4G6CA 3LI0A 3WBXA 4DF0A 4JXCA 1W1A1 4EAYA 4IEXA 2PLJA 3VMNA 3H8AA 4TX6A 2E7AA 4EWJA 4LALA 1I2NA 2RR13 2UWBA 5K7PA 1PBGA 1H9WA 4GVFA 2AL2A 3ZXLA 1VIWB 1XYPA 2E9QA 4BWOA 1K1DA 2E7TA 1HGWA 1TIMA 3ACHA 3C2FA 1X82A 3DC0A 2WR9A 2WJEA 3OVGA 4XFAA 1K5MB 3ZYRA 4HMCA 4AYSA 3QLDA 4B91A 5HINA 4TMCA 3MU7A 1UA3A 1V6XA 2D0HA 3MIDA 4D6GA 2HEYF 3W37A 4GMP1 5F39A 1N8FA 4RD7A 1NDZA 2NXGA 3C61A 3GC4A 4ZQOA 1Q56A 3DV8A 2PP1A 1JDDA 2EG7A 1XIIA 5JPMB 3AFKA 4KU7A 2QKFA 4IUGA 1FPN3 1F9CA 3CHVA 3IJIA 4EE9A 4F83A 3U0HA 2G8ZA 4EXQA 3VBUA 1HVQA 3BQ5A 1F7BA 1FDZA 2F84A 1W9UA 1V70A 3WDYA 4A22A 1ZBA2 4P14A 3WEOA 4B2DA 2IQ0A 1XE7A 1L6GA 4A35A 4NZ5A 4W6XA 5A3TA 2YHJA 2J1SA 4PLMA 2XQXA 3T9PA 4QCFA 1VBC1 3APTA 3KD4A 4WRHA 1WYIA 3BMVA 3V0AB 2EO7A 3ICJA 3PZIA 3ZQ9A 3ZYGA 5L6UA 3CUIA 5LIKX 2Y6FA 2ISWA 1WKDA 4M3CA 1M03A 4JTRA 4B3LA 4K1WA 1IG3A 5FFOC 3H4WA 4DO5A 3AYVA 4C6KA 5A7QA 5CAHA 3EEZA 5FZDA 4BK9A 1F8MA 5LA2A 4G1KA 3N3HA 5DAXA 4H6EA 1UYQA 1H51A 4DYEA 4QG9A 3O0KA 4RHV2 4X0VA 4JQRA 4O13A 1G7VA 5EBAA 4CU7A 2HJPA 1TREA 4NSBA 1SFNA 2F8QA 4S2FA 1J4EA 2V30A 3F2DA 3W2LA 4Y20A 1T40A 1ULOA 1RK5A 2PF8A 1V79A 5BNPB 4NAOA 3VDDC 2CFFA 3OEXA 4Q8KA 4ZEPA 4W8JA 1AJKA 3MDWA 1AHSA 1RVF3 1MACA 3ITGA 1U30A 1C5HA 5FLHA 2A3CA 3ACIA 3G0UA 3H21A 3NYDA 1ENSA 1GYKA 1M1BA 2Y26A 9CGTA 2PURA 5F32A 1D7PM 1W2AX 5JBFA 1SLBA 5BNNA 5I3FA 1JXKA 1W9PA 2VW2A 2DT2A 4G2DA 3UV9A 4GB33 3AMPA 3O06A 4LVDA 3PPGA 3AALA 5M03A 2GZXA 1R9XA 2CNAA 1QJY1 1CPMA 1ZL1A 3OZMA 2ET1A 3UA4A 4KGLA 3MQTA 3LTSA 4CEYB 2PHDA 3OGGA 4YZ3A 3C2EA 4EXBA 3LV5A 3R0DA 1E73M 3RDIA 2VPVA 3PTYA 4LKEA 2VURA 1E5JA 4FF5A 1KXVA 3TN93 1Q8QA 5I23A 1V3IA 1S5WA 5HBAA 1CGPA 3H0OA 1QIQA 3LEKA 1XE8A 4YM1A 5DZGA 3KV4A 5C7VA 2DH3A 4MHUA 3I2IA 3P8IA 1W56A 1X9PA 3CZLA 3KHCA 2QZ2A 1DJXA 1YDNA 3P6LA 3TDFA 2HWE3 2VCMA 5D33A 5C55A 2XDVA 5D9NA 3L4TA 4LRSA 2X05A 4MPKA 1WB0A 4MJZA 2R043 2VZRA 3ZXJA 4ONUA 1W8NA 1JDEA 1NSJA 4S39A 1YADA 4XZMX 1A4MA 2Y63A 1CESA 1GONA 5GJMA 5D37A 3M3EA 3LFIA 4LULA 2WVVA 3CBWA 1FFQA 3EOUA 1VCVA 2JKPA 1WLDA 5CC5A 5DAQA 4XFHA 2FDGA 2HNEA 4ATWA 2X42A 3B0XA 3FLTA 4X9SA 2CYGA 4Q8MA 4JTJA 3L4WA 1JNDA 3WH6A 3HIFA 5B2GB 3DG6A 1EB3A