4UFIA

Mouse galactocerebrosidase complexed with aza-galacto-fagomine agf
Total Genus 211
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
211
sequence length
644
structure length
641
Chain Sequence
GAYVLDDSDGLGREFDGIGAVSGGGATSRLLVNYPEPYRSEILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYELDENYFRGYEWWLMKEAKKRNPDIILMGLPWSFPGWLGKGFSWPYVNLQLTAYYVVRWILGAKHYHDLDIDYIGIWNERPFDANYIKELRKMLDYQGLQRVRIIASDNLWEPISSSLLLDQELWKVVDVIGAHYPGTYTVWNAKMSGKKLWSSEDFSTINSNVGAGCWSRILNQNYINGNMTSTIAWNLVASYYEELPYGRSGLMTAQEPWSGHYVVASPIWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVALTDGLGNLTIIIETMSHQHSMCIRPYLPYYNVSHQLATFTLKGSLREIQELQVWYTKLGQRLHFKQLDTLWLLDGSGSFTLELEEDEIFTLTTLTTGRKGSYPPPPSSKPFPTNYKDDFNVEYPLFSEAPNFADQTGVFEYYMNNEDREHRFTLRQVLNQRPITWAADASSTISVIGDHHWTNMTVQCDVYIETPRSGGVFIAGRVNKGGILIRSATGVFFWIFANGSYRVTADLGGWITYASGHADVTAKRWYTLTLGIKGYFAFGMLNGTILWKNVRVKYPGHGWAAIGTHTFEFAQFDNFRVEAAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Azasugar Inhibitors as Pharmacological Chaperones for Krabbe Disease.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords GALACTOCEREBROSIDASE
total genus 211
structure length 641
sequence length 644
ec nomenclature ec 3.2.1.46: Galactosylceramidase.
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02057 Glyco_hydro_59 Glycosyl hydrolase family 59
A PF17387 Glyco_hydro_59M Glycosyl hydrolase family 59 central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 4ufiA03
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4ufiA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4ufiA01
1TTIA 5DN1A 1XSIA 1E9LA 2EPLX 3S9YA 5E09A 2G3MA 5F2LA 1VFUA 1E5JA 1BYDA 3K4AA 3W28A 3LHVA 3KVJA 1WZMA 4G1KA 4TIMA 4AWTA 4F9JA 4H8UA 2Y7FA 3NA8A 3S1XA 2ZWZA 1Q6QA 1GORA 3PTQA 4U5KA 4H2CA 1EXPA 3VIOA 1QNVA 4M19A 2V0TA 1DP0A 3C8FA 5FCZA 1B90A 3GXTA 4AD0A 3IJ8A 1D3HA 2DGAA 4NJIA 2J6XA 3NPUA 1DJNA 2ZZ2A 4WUIA 1YTEA 2IQTA 3KVMA 4HPHA 1WKYA 3AHVA 4EWND 1HF6A 1Q6DA 3O2LA 5CKSA 1V02E 3MI2A 1W1PA 2CITA 5BXTA 2ZFAA 5K4XA 2WBKA 3NMBA 4WKHA 4B15A 4BWLC 1ODZA 1J18A 3RLUA 4AZBA 1ODUA 6A3HA 4BQ2A 1G4EA 3C3NA 4N9BA 1HT6A 1DQWA 1VH7A 4NXKA 3B0VC 3OB8A 4PCFA 1V3LA 2BV9A 3LCWA 1KGWA 3VMNA 3WJWA 3ARVA 3B0UX 2RGLA 3KL3A 3NQAA 3OHIA 3J7HA 4YXGA 4MJ2A 3SECA 3QFEA 1W2VA 4D6EA 1P6WA 1Z32X 3UWUA 5BMWA 2EGZA 3DYMA 1A3HA 5FD0A 1KM4A 4DELA 3W6LA 3HB9A 1J0JA 3N2XA 2R94A 1AK5A 1LP6A 4PMRA 5C71A 1G1YA 2GK1B 3NQFA 3WH9A 2FTPA 1JI2A 1W2PA 3ARSA 2YL8A 3ARXA 5FL1A 2XVNA 4HOXA 2A7NA 4PL2A 3VIKA 2AOSA 1VRXA 3CHVA 2G95A 3MYPA 5MHBA 1W1YA 1ZJAA 1QR7A 3ELFA 1UG6A 3EKZA 5IHSA 1LBFA 2WO5A 1DHKA 2E9MA 1W3IA 5LA0A 5L9FA 5LHEA 1MFVA 1D3CA 1VFFA 2HTMA 1JD9A 5AN7A 3IAPA 3DZ1A 4CN4A 4NRRA 3OBKA 4UMAA 1R7OA 4ATWA 3TQVA 1ZAHA 3PG8A 4UFJA 1GOXA 3DHFA 1PJ9A 2YW4A 1TSIA 4QP0A 2A4AA 2E8YA 2XVPA 2RFGA 3GDMA 4L4LA 5E9AA 2QCNA 4O14A 5F2MA 1C9DA 2NX9A 3N19B 4KWWA 5BXPA 5AOUA 3GXMA 1HN1A 4PTMA 5HQEA 1M03A 3LDKA 2VX7A 2C18A 5CZ0A 3BCDA 1RD5A 3T2PA 1J0YA 2I9EA 4MAZA 3WUBA 3BAJA 3L4YA 5M03A 4JTSA 2HMCA 4UFLA 1UHVA 1PCWA 3C2VA 3SR7A 1E40A 4IUOA 4JXCA 1TG7A 1XCWA 2GVYA 2J7DA 2FDSA 3VX0A 4IMCA 1K7EA 2ZX5A 4LVDA 4BZYA 3HPZA 4D6IA 2E6FA 2YL5A 5D05A 2G41A 1GG0A 2PBOA 4XV0A 2OYLA 2UV8G 4XBSA 1LDCA 1QHOA 2WNQA 3ZWTA 4HNUA 4IISA 3ZM8A 5IBXC 2Z6JA 3TH6A 1SZGA 2NXHA 2DZTA 4IWWA 3SCVA 1QI3A 3POHA 2WQPA 1HTIA 3R5EA 4H4IA 1K7XA 4UTWA 1XYFA 3VIPA 4UXDA 3A22A 4OQVA 4WXYA 2DT2A 2R14A 1AMKA 3IIOA 1BEUA 1DBTA 3EX1A 2WBGA 4HNVA 1JFHA 1LG1A 3QR3A 4L4PA 1W0MA 4WOZA 4B3LA 1YDNA 2BXVA 1C91A 4HIBA 2YJQA 1WDQA 4CD7A 4O0KA 3ALFA 4OU1A 4R7JA 1K8YA 4X22A 1ZAJA 1WXJA 1HJUA 5T26A 3TA6A 2Y24A 2XVLA 4P7OA 2OSYA 1M04A 2QQUA 1H2JA 1R2RA 2E40A 1DHPA 1H7OA 2ZRYA 4JR5A 4KFPA 1WNOA 4JFVA 3IIXA 4PMZA 3OSDA 4WX2A 2WWDA 3PTKA 3EDJA 1HFBA 2ZRZA 4JY8A 4QITA 5CZJA 1DWJM 1OT1A 4XKYA 1CI1A 1R8LA 3N1AA 1GQIA 4LOCA 4QAWA 3STEA 1LLWA 1UWQA 2J75A 5DF0A 3EX4A 1G6CA 4EOUA 1Q6GA 3NQ8A 4RR4A 1WDRA 4MAVA 3CEPA 4PODA 3MV11 3LERA 2W79A 2ZRWA 3HPSA 1KFLA 4OHQA 1ZBCA 4IPLA 4J3VA 3C56A 3H53A 1LWHA 1H1NA 1KM2A 3T55A 1EHNA 3MI3A 1MXGA 1KM0A 1JIBA 4Z1AA 1OGGA 2WVSA 3WD3A 4CVWA 2EPKX 2FPTA 4MZ8A 4M80A 1I1WA 3HBLA 4TR9A 3CT7A 1XH0A 3PHAA 2CZFA 4ZQCA 3UESA 3IEBA 2DIEA 3TSMA 1E6ZA 5M17A 3THAA 3QRHA 4LS1A 1TPVA 1XCXA 4JKLA 4MB5A 2VC9A 4DBDA 3GZAA 4QCEA 4LUJA 1OINA 4AEEA 4W7VA 3A6OA 3FA5A 5CPQA 2YLLA 2NT0A 1G4TA 3GAYA 7CGTA 3BLFA 3STGA 3QM3A 2XYLA 3E1F1 3WDPP 1PPIA 4O50A 1TPC1 3PTMA 5A6BA 1KTNA 1W3HA 1XC6A 3W2LA 2CBVA 2WC3A 4ACYA 3M43A 2XJ7A 5C54A 4PMUA 4M81A 5CGTA 2PURA 1GONA 5D8WA 5EFFA 2ZUNA 4B9YA 1FWRA 1IXOA 2CLIA 1KFWA 4E2OA 1MO0A 1GVIA 1SYTA 1VLWA 1GTHA 2V5BA 2XSAA 3BK0A 5FIXA 3T4CA 2C15A 2Y88A 1W5QA 3PUEA 2DPEA 1QMLA 3DHUA 5LA1A 5BYWA 5AYXA 3F4WA 4TO8A 3D3AA 2J24A 3BGAA 4UR9A 3TIMA 1LM1A 3DFQA 1QAPA 3TUUA 1ST8A 3M46A 1UQZA 2ZUSA 3SUUA 1AQHA 2DZXA 2J9ZA 1C93A 1J0HA 2EAWA 4X3ZA 1JYNA 1J2WA 1JAKA 4RL3A 2ZZ7A 2YOCA 4M82A 4GUFA 3W7DA 3NG3A 1KLYA 3L67A 3LOTA 1KR0A 3QQ0A 2ZZ3A 1W9UA 3VE7A 2ABAA 3T0AA 3ZT5A 5A8MA 1I45A 5EKYA 5K9DA 3AXHA 1TUXA 1H7WA 1MEWA 5HOSA 4RE2A 5M5DA 2VX6A 2QCFA 3H54A 2ZIDA 1K9FA 1GVOA 1OM0A 1I2NA 4NJJA 1UA3A 2ZXAA 1EWEA 2X1UA 4X2RA 2PBGA 5DBTA 3NYDA 2VR4A 3LFIA 3ZSTA 1D9EA 1EPXA 3MP3A 4ALDA 4W93A 4LVBA 1X1ZA 3QZEA 5BW6A 4K8EA 2J8GA 4E8CA 3WF2A 3UZ5A 2TMDA 3W7EA 1G9HA 3IJ7A 4LS0A 4DWSD 3LV6A 3WDQA 3LRLA 3W23A 4H7VA 3EEGA 3LCIA 4AF0B 3MYOA 1E3XA 2BNJA 1HUVA 2ZZ5A 1MVYA 3IVTA 1V08A 1FUYA 1LRQA 3PZOA 4F9DA 1UD5A 1Y7VA 4JS3A 2Q8XA 3NEVA 3QGVA 2P1FA 1GOQA 3M07A 5A69A 4JTFA 3II1A 1ML1A 2NZLA 3SCUA 1XM3A 4WY0F 5AC7A 3NQ7A 4U33A 1AW5A 4ZXOA 1BYAA 1RP9A 4ZMGA 1Q3NA 3GKFA 2FQIA 3VM5A 1JF6A 1OK6A 1TVPA 2F2HA 4ZXLA 4H8HA 1GOMA 3N9RA 1LF1A 2EEXA 2G3JA 2C3ZA 5E0KA 4YMZA 3VM7A 3FY1A 1SPQA 1Z42A 2NWRA 3FLUA 3MBDA 4BI7A 4NRSA 1XBVA 2A3BA 1S5VA 4ADSA 3NL2A 2WMFA 3WK1A 1E1FA 3L21A 2ZUTA 3DXIA 5KTLA 3HMJG 3RFAA 1LLZA 4MYAA 3B9DA 2EPHA 4W7WA 1VZWA 1EX5A 2QCCA 2ZE0A 1E43A 2JGYA 3LPFA 4JCLA 2VURA 1L6SA 1M7OA 3L4WA 3DKJA 4XB3A 4IGHA 5EB8A 3NSNA 5D2WA 1PS9A 4ADTA 2CZ5A 3C0JA 2GUUA 3WH5A 2CESA 4LVGA 2A5HA 4Z0SA 1CW2A 3HG3A 3CO4A 3G0XA 3W37A 5TBOA 1VFOA 1BWLA 3DGRA 3RO8A 3WNMA 3DAQA 1XRVA 1PX8A 4GC4A 3FYPA 5LGZA 3DFNA 1JZ8A 4R27A 4YN5A 3W1NA 1UKQA 3DFPA 3CTTA 3M5XA 3VUPA 4WY0B 3W29A 2JIWA 3A21A 2ZUUA 2ZTKA 4RX0A 1WYIA 1RZMA 3BLKA 3I7QA 1MFUA 4X0VA 1RVGA 2VXNA 1MXDA 3HGJA 1I4NA 1KBJA 4JFSA 4DBEA 4LTSA 4DF0A 3TFCA 4IMEA 3WEOA 4EF9A 4QFUA 2OWCA 2ABBA 4NU7A 3QJAA 1BYBA 1EUNA 3L5LA 4ZVJA 3MMUA 3S5YA 1N55A 2QLYA 1IV8A 1U2YA 3WBEA 3A4AA 3S2CA 2DSWA 2V2HA 2ZX9A 5IFPA 4P8WA 4A2RA 3L0NA 5DFAA 3P60A 4OBRA 4A4AA 1ISYA 1H60A 4NX5A 4FX7A 4MJZA 1KBKA 3WELA 4R5EA 1OF8A 3W7HA 1CENA 1JQVA 1EOMA 4PSPA 1WP6A 3OVQA 2X1RA 1PIGA 1Y4WA 1OF6A 5KEZA 2AC1A 3W7OA 4F66A 3B03A 4ICNA 2J47A 4S1FA 5FMDA 2H8ZA 2CFFA 1JYXA 2E1DA 3PZMA 3WNPA 1TRIA 3NJ3A 3TAOA 3W88A 4MNJA 2X8RA 1SUXA 1IZKA 2VUYA 2FJKA 3WBAA 3G24A 4LU0A 1FBAA 5DCBA 3W7RA 2ZUVA 1UUOA 3W25A 2G5WA 3W70A 1G7VA 3A4WA 4AD1A 3A23A 3LCHA 2RHGA 3MU7A 1UKTA 3GH7A 2CNCA 2X1TA 1NQ6A 1QBBA 1X6NA 1TRDA 2QCHA 4PTVA 2WC4A 1QDSA 1LBLA 2QJIA 3U6WA 1KFBA 4CNOA 4ORIA 2QAFA 3NM1A 4M6QA 3UR8A 2XQRA 4WD0A 3HG5A 3T78A 5F4SA 5A6JA 2CU0A 3G0UA 4OOUA 5I23A 2PRHA 4EK7A 5EPDA 1W1TA 2EO7A 2CPUA 4HMDA 4HZ8A 2UWFA 2VT0A 2VMFA 5I79A 2H3BA 4QJ1A 3UGGA 1BWKA 3KFTA 3NVTA 2WHJA 2ZCGA 1GOWA 4YHEA 3LDRA 4QNEA 3PZGA 2ZICA 3WDIA 2UY4A 2MANA 3KZSA 3RJXA 4DXVA 3W1XA 2QCGA 4PH6A 4W5UA 3G1FA 5K3VA 3AMLA 4YLWA 3VNZA 2WZHA 3Q94A 4W85A 2EPOA 1XBXA 1Z41A 3A5FA 1E4MM 1ZS2A 2P0OA 2GK1A 2G96A 1MEHA 1JZ3A 1UH2A 1VEOA 1YPIA 4QLJA 4UNIA 1JYWA 3E02A 3EDFA 3N9SA 4H3DA 3IK2A 3RMJA 3SCPA 1CDGA 3PSVA 3N73A 3NZRA 4N4QA 3WNKA 3WH6A 3DFOA 1JCYA 3AHZA 4RE4A 3RWKX 1OSEA 2OWWA 3GR7A 3WUGA 5KZ6A 2E8ZA 1DJQA 3EX2A 1CTNA 1JZ4A 1TPDA 4MOZA 1OFPA 2OJPA 3DC0A 4O1DA 3BAIA 3EB2A 1MZHA 3GAKA 2YA1A 1QO5A 3TW7A 5C55A 2XN0A 2I14A 4RJEA 4JICA 4EIVA 3HJEA 3ZT7A 3VDAA 2DZSA 1TPB1 2R91A 5AHFA 4MZYA 4AMCA 4M8UA 2OWXA 4ZENA 4UTWC 4MYXA 1WBJA 4FFGA 2C13A 2WWCA 2YLAA 5E0FA 1FX6A 1R46A 1TVNA 5GQBA 4Z2KA 1ICPA 3QPZA 4LS2A 1CGTA 4O28A 1UZ4A 3EMQA 3ECQA 2NW0A 4V27A 3LTYA 5EL1A 1VEPA 3ARPA 3MSDA 4IX0A 2BX7A 2V5DA 1KLZA 4AZ6A 3FJLA 3GDTA 1C8QA 3OGVA 4FLSA 5HBFA 2QDHA 4JL1A 5G2WA 3ZR5A 1TPWA 3IGSA 4W7UA 1TTJA 1LWJA 2EF9A 1DWIM 5FI8A 5D38A 1OX5A 1DWHM 2A7PA 2QV4A 4B9ZA 1T0OA 4JX5A 1JYVA 1SMAA 1W91A 1VS1A 3HGOA 2VL4A 3IGUA 2WCGA 5CZTA 2F7FA 1I2OA 3RPMA 2Y63A 1NWTA 2WW5A 2OLHA 3UG4A 3WKZA 2QKFA 3AHXA 1XDMA 2WKLA 1C3FA 1NM9A 1VJZA 3TNOA 3TXVA 4F79A 1JNDA 3P5YA 1XD0A 3O07A 4MVAA 5LZLA 1BVNP 1OD0A 1SFLA 4FNRA 3VIJA 2B4GA 1XYZA 4MY1A 1G69A 4DO4A 1V3KA 2O9OA 4HP5A 2D0HA 4D6HA 3BLIA 1OVDA 1NF7A 1H61A 4KKXA 5FKYA 3T2OA 3RNDA 4JQTA 5I2UA 3PUOA 3MUIA 4IJBA 4O15A 4UCGA 2RKXA 4FLQA 3NZ1A 2WSRA 2WANA 5KZDA 3WJSA 1CGVA 2WMIB 3EMZA 3GNRA 3VGBA 4CD4A 2YL9A 3N14A 1HJVA 5KINA 4UNKA 4CNNA 5D8ZA 2OSWA 1L6WA 3W2KA 4Q7NA 3T0BA 1JFXA 3BC9A 3AJ7A 1JCMP 1F6KA 5LNSA 1FH8A 3PZVA 3FYOA 3RLVA 4UQCA 1AW1A 2OXBA 3TMLA 1ISZA 2G3NA 2QPSA 3WNLA 3E49A 1E6XM 3L4ZA 4NSBA 3VNYA 1PV8A 5BXRA 4XUGA 2ZOXA 1YYAA 5EYWA 2YA2A 2GJLA 3W1TA 3CM4A 2AMGA 2Q8ZA 5J5RA 1EDQA 3VIHA 1JCLA 3P8IA 2QMJA 3EWUA 3I7SA 4OV9A 1AL7A 1JDAA 1ICQA 4JTIA 2RDUA 3F03K 2WHKA 1F5ZA 4UUIA 4O0ZA 1LTDA 4QSHA 5D33A 1QNRA 3AXXA 3G1DA 1ZAIA 5DY3A 4GZJA 4JFWA 5DT5A 5CLWA 3OZPA 2PRLA 4P8VA 4JFTA 3NQ6A 1LQ0A 4PTXA 4DUXA 1QFEA 1VHCA 4JDYA 4AVFA 1BSIA 4JTKA 1FHDA 1HKJA 4M56A 3WD2A 4JYFA 4J27A 5GNZA 1K02A 4GQQA 8TIMA 3S6DA 2VZTA 1KFEA 2EKCA 3RK8A 3VDHA 2EBNA 3GYCA 1ZCOA 3L2MA 3AXIA 3GNNA 2X30A 4NXSA 1J10A 5D9NA 4RKAA 3TKFA 3PVFA 2TPSA 3P67A 3A3HA 4BQ5A 1IIGA 3N34A 1VR6A 2WVTA 4CKQA 1WX0A 4DM2A 1LORA 4W9TA 2G97A 3TDFA 5D09A 1NVMA 5LNWA 1GVYA 3W38A 2FGZA 1JRCA 1F73A 1FCQA 1CBGA 4GI6A 5CZKA 2WNNA 5FEZA 2C14A 3SW6A 1W31A 1BYCA 2QPUA 3F5KA 2PWFA 3NDZA 1EP3A 3AO0A 3UWYA 5JBDA 3ZFHA 3MP5A 3GNPA 3O16A 3KX6A 3KRUA 3VD3A 2G3IA 3PZUA 1HG3A 3U8GA 4K6AA 3UCQA 3MP4A 2JKAA 5H2ZA 3QYQA 2WV8A 1OCQA 1ITCA 3M0ZA 3FKKA 1GUVA 4AZZA 1V0KA 3CTLA 1JI1A 1XCFA 1HO1A 4Z2GA 1FXQA 4M7SA 4JHOA 1ISVA 1PIFA 2FLIA 3PY2A 3TQ0A 3KL5A 3O8AA 2B0MA 1H1ZA 3W6YA 3AIQA 1OABA 3D5HA 2AEYA 1UQYA 2BLEA 1U33A 2PE4A 3UPBA 3I7RA 1E51A 1GZJA 4OOZA 3UG3A 1GHRA 3P8JA 4HMCA 8A3HA 3CZJA 1H51A 3KL0A 4CCEA 3R2GA 4D2JA 4W88A 1A5AA 4AWEA 2YDAA 4ZQNA 5AFDA 3ZQ9A 3VILA 3KVKA 2JALA 3PBUA 3LHTA 1TMHA 3PS7A 2BFGA 3K1DA 3BGJA 1NOUA 1OFQA 3U7VA 2YYUA 3N18A 4ADUA 2VRQA 4HNNA 5A2CA 3W7JA 1ONRA 1TV7A 1W9VA 1H63A 2VQTA 1QI0A 2J7BA 4O1CA 4GI9A 4D1JA 2IXVA 4U5IA 4Z2IA 5ABFA 1K9EA 1VYSX 4GRSA 3ARUA 4PL1A 3E96A 1B4EA 3NQVA 4UMBA 1V6XA 3UWVA 4N9CA 5LNUA 1Z48A 4IXXA 1LOLA 1GJPA 1K7FA 1P4CA 4DEFA 2ISVA 2CBIA 4YCPA 2WAGA 3AYSA 2GJXA 3AS3A 2CLLA 1LCOA 3CB8A 1M6JA 1DTUA 3CIVA 3AQUA 3BLEA 1KGXA 2XWDA 2DDXA 2IUZA 4K68A 3LX9A 3N15A 2WMJA 2X2GA 1G5AA 1H0IA 4AYSA 3CZLA 4M1RA 2YL6A 3CEUA 1NOFA 2GDVA 1TPEA 4JX6A 1H7XA 4FB7A 2D3NA 2WLYA 4N42A 1QPKA 1KFCA 3QH2A 1TQXA 3FIGA 2GVGA 1XSJA 1X8FA 2F61A 4GZEA 1B3OA 3LTPA 2A2IA 1UYQA 4QLKA 2V2CA 3GXPA 1NP2A 1VJIA 4MFEA 4JTJA 1VCGA 5FMCA 2YXGA 2WVVA 3VTRA 1OG0A 1XUZA 3VIFA 3DFSA 4BI6A 2NT1A 3AIEA 1ZFJA 1XDLA 3S1VA 4TU1A 2QR6A 5G1YA 4ZZ9A 1HL8A 1OIMA 1UD3A 1M5WA 3IGXA 2BVDA 1LRTA 2ZYFA 1P0NA 3MW7A 2VEIA 5BMXA 2CLOA 1R85A 2UY2A 4LYPA 3W9ZA 2TRSA 2WKGA 1VJSA 1W3JA 3GH4A 2TYSA 1N7KA 2C8NA 4ZQOA 1V3JA 3M6DA 2DH2A 2Z1BA 1DV7A 5LA2A 4PTWA 4JFUA 1HJSA 3UPWA 4KFNA 4FFHA 1UD4A 3DBPA 4P7NA 1GJWA 4MDOA 4AIUA 3ZJ8A 2XG9A 4LYQA 1OYCA 3PB0A 3U5UA 1CXIA 1E0WA 1JG9A 3NQMA 1CECA 2PWEA 3QHNA 1RQBA 3JS3A 1B3VA 4EF8A 1FWNA 2XIBA 3OLIA 1EQCA 1W9PA 1UA7A 1R47A 3K46A 1W5MA 5JIWA 2J7GA 3WMSA 1VLIA 1EDGA 3UWQA 3SUWA 1KBIA 3LEMA 3PIJA 3EWYA 2EQDA 2F84A 1NOWA 1JUBA 1Q6EA 1VCVA 1UD2A 3ARQA 4J3TA 4FNPA 6TIMA 3AMGA 3SIMA 2A21A 5A6BD 4JYDA 2A6LA 3GBDA 4O52A 1B3WA 3W73A 1UYPA 3BMVA 2AGKA 1EA0A 3A9IA 1F7BA 1HP4A 2PWHA 3CHEA 1UUQA 3AZRA 3W87A 3OIHA 3M5VA 5AC6A 4OJYA 1XFBA 1VBUA 1KM1A 2X09A 3GH5A 1L8NA 3NQDA 1TR1A 2RDTA 4LRSA 3PM6A 2GDUA 1CGUA 3W86A 4QDMA 3S42A 1A53A 1EDTA 2E9BA 1V3HA 4O16A 1UWIA 2WSYA 5HUOA 3AMDA 3GXIA 1OFAA 1HJXA 4PSRA 3MI6A 3P81A 3F4VA 1W9XA 1H49A 3LCLA 5K7JA 2X1IA 4PMYA 1F05A 1YTKA 1CEOA 1SFSA 3NSMA 3JRKA 2NX1A 4AZCA 1JZ5A 1BTCA 2A85A 4JNMA 2B7OA 4PEEA 4D6JA 4D6CA 4DUVA 2WZIA 2XGIA 1QCWA 1WDPA 4BQ4A 5IFTA 3MUXA 4JHZA 1HJQA 2Y8KA 3TTQA 2YGYA 3R13A 1E6PA 1MW1A 4CD6A 3OGSA 3T08A 1IT0A 2DQXA 5LSMA 3UEQA 1JULA 2A6NA 4BF9A 3QHOA 3WH7A 3K30A 2ZX6A 2VFEA 4JIPA 3W7IA 4QISA 3TC7A 2WNZA 3M1ZA 5I3GA 3ZS4A 3WL1A 1FOBA 4ML9A 2GFTA 5CPLA 4JYEA 1BGAA 1U5JA 4Q32A 2OYKA 5FIPA 5HUPA 1G94A 4MB4A 5A1AA 2O92A 2HS8A 1KB3A 3HN3A 3NO5A 1WOBA 4N0RA 1QO2A 1J12A 1V6VA 2FB2A 2JEQA 5D30A 4W8LA 3VMOA 4DF1A 1FCUA 3AZSA 4GUJA 4GWEA 2H90A 2DORA 2NV2A 3N2MA 1FH7A 1H3GA 3ABRA 3WF1A 5H91A 1DORA 1YLVA 3LIGA 1Q4NX 2WMIA 1C8VA 3IAQA 1EO5A 3KOFA 3WK3A 1QNPA 3ZT6A 5JBEA 1OYAA 2GOUA 1H7NA 5EFDA 3WFZA 4Q4KA 3WMCA 2JGQA 4MFDA 3TMQA 5TIMA 1QW8A 2DSKA 3BSGA 5ECUA 4MUZA 3W7NA 3OA3A 2XM2A 3AS2A 3T09A 2Z2UA 3KXQA 2C0AA 2LLEA 2NXGA 4UNLA 3OVPA 4WKAA 5ANNA 2YSWA 3P82A 4OV4A 3W7QA 5CLTA 1D2KA 2XVGA 4S2CA 4EVZA 3UR7A 3PZQA 4AZCB 2V82A 4K7VA 4C7DA 1VYPX 2CEQA 5CSUA 4HKPA 3AOFA 3LPOA 3U75A 3GIYA 3W72A 1QBAA 3CZGA 4XTIA 2BHUA 2W66A 5DT7A 2I1OA 5CJ5A 4W89A 3TTOA 3W24A 5I3DA 2WPBA 1BQCA 1GVSA 1JGIA 4HA3A 5F2GA 2VRJA 1O6IA 1GQKA 1XH1A 1MSSA 3W84A 4JCMA 5CSSA 4O19A 3HF3A 1G7UA 4LRTA 4MLJA 2XTKA 1ZALA 1I2PA 5C6MA 2WOQA 1K6AA 3GXDA 3RM8A 1FA2A 1NFBA 3FJ6A 1X1OA 3AICA 1US3A 3I3DA 3VDCA 1E72M 2FH8A 2YDRA 4GINA 3LCXA 3SI9A 1SR9A 2BXYA 2QUUA 4GUGA 3W7MA 4LV4A 1C90A 4M7TA 3VE9A 4AWSA 1UH4A 1FCVA 1C8YA 5A6LA 4Z1DA 1KFJA 3MMTA 1SMDA 4HPXA 2J7CA 4N4PA 3G3MA 5U7SA 1H09A 1GQLA 1TE1A 1MW3A 4HPJA 2NUXA 2IXUA 4AIEA 4WSKA 2OCZA 4Z1BA 1W56A 4B5NA 4TMCA 4V28A 3ABQA 1CWYA 3UQNA 1UWSA 4UZSA 4AZHA 1UOKA 3KRSA 3LMYA 4FLOA 1LG2A 1O5KA 3A24A 3BG9A 3ARTA 1B3XA 2A1YA 2E6DA 3PIGA 1I2QA 2ISWA 3LHUA 3W1RA 3CLWA 4HXCA 4FX8A 1MEIA 3WDRA 4N9EA 4U3AA 4B1LA 5A3HA 4MPQA 4FO4A 3W75A 4AHPA 1H41A 4NJGA 2XWEA 4KH2A 1JZ2A 1C7TA 3VD9A 1H62A 1OX4A 2C7FA 4J3SA 3GDKA 1ZNNA 2X16A 3OLDA 2C19A 3MO7A 2QAPA 2FHBA 3POCA 2CLFA 2FHFA 2D24A 1W5PA 3L65A 3THQA 1WQ5A 4YL2A 2YDSA 2WCSA 5LNVA 1WO2A 3OLEA 2FDMA 1SO4A 1UASA 1SFJA 3WDHA 2X1SA 3WJYA 1PL9A 4D72A 1CX9A 3CIWA 3PWAA 4WQ6A 3SGZA 5LKYA 1NSJA 2BY2A 2YKKA 3L4VA 5F1VA 4J28A 1NF0A 2YW3A 1Z44A 5AC4A 2VFDA 4UC5A 3ALGA 3F5LA 2O7QA 3G6LA 3LI1A 3SUVA 1N82A 5F4XA 4EANA 3THCA 4Z0JA 3ZJKA 2Y6ZA 4Y6GA 2BXZA 3LCFA 3VIIA 3KVLA 5F7UA 5KZMA 3PAJA 5AHNA 4N02A 4Z1CA 3NPXA 3M47A 2QQVA 1K9DA 4MPKA 5DO8A 2UY5A 3OZOA 3IVUA 1D7FA 3IVSA 1RQEA 3FFSA 5CPOA 2W63A 2CW6A 4W8BA 4FEZA 4ATLA 2ZX7A 3G1XA 3OEXA 3WUEA 5DLCA 4P8UA 3TV8A 1BAGA 1S5WA 4RLIA 4DF2A 3O15A 2XM1A 3NAVA 2GQ8A 5K4ZA 3QW4B 3W07A 3WQ8A 2WVUA 4Z08A 1MQQA 2CLMA 1ZBVA 2JE8A 4ZQRA 4MKNA 1O7AA 4HZ7A 5HWMA 2W92A 2CXGA 5CZSA 1SR0A 1ZB5A 4HSNA 4YWIA 3QHMA 3AMKA 1PHWA 3EDEA 1A5CA 1XBZA 1OIFA 1RH9A 4K8HA 4M5PA 2QCLA 2CKRA 3WF4A 2ADEA 3L9CA 1YXYA 1GPWA 4R53A 3NPVA 1ECEA 2WXDM 2VRKA 2HS6A 1XKYA 1BKSA 1E4IA 3OGRA 2FPYA 3LXAA 5IM51 1WA3A 3CHCA 5L6UA 1FDZA 3P5ZA 1TPH1 1BLIA 3UGFA 4ACZB 2JF7A 1E4LA 2YBUA 1D3GA 1SO3A 2J9XA 4L4MA 5E6YA 3TTSA 3LHZA 3W74A 1PBGA 3RU6A 3R8RA 2A3EA 1OFDA 5CGQA 3M41A 4XTDA 4B1MA 4NNAA 4TMBA 3S5ZA 3B8DA 2CLEA 3TROA 1OFOA 2WMHA 1CLXA 1GYLA 3DH7A 3DI0A 1KGUA 3CZKA 1SU5A 3ATYA 1JAEA 5HULA 3BARA 1XSKA 3UERA 1ZHAA 5HPCA 1IXPA 1E0VA 4FNTA 2GSJA 1JCNA 2Y70A 4UQAA 3LIHA 2V9DA 1MQPA 3IIVA 4TVCA 3F5JA 4WSJA 5GNXA 3WUFA 1HO4A 4CLMA 2ZRXA 1E5NA 3B9AA 1GOKA 1MYRA 3VINA 5CXPA 1JJKA 3DENA 2NLIA 3BPWA 1EQPA 3AIRA 3S5QA 1XL9A 1LJYA 4GJ1A 3ZJ7A 3WSUA 3M6YA 4AWUA 4I7VA 1EGZA 1GW1A 1KWGA 2VEPA 5ABEA 4BI5A 3FHQA 2X2YA 1L9WA 3QEZA 3PG9A 5CPSA 4D1IA 3DU0A 3CU2A 3K8MA 4LNYA 1LROA 3TCEA 1W3LA 4MTVA 4FNUA 1DWGM 1UR0A 2PRMA 1TA3A 3U1XA 4O8RA 3S1WA 3CUJA 3F4NA 2PC4A 5FF7A 1WDSA 3DHPA 3THDA 4KRUA 3VFLA 1J0ZA 2PB1A 3AS0A 3UYCA 1W9DM 3W2UA 3CPUA 4EKJA 3DHDA 3TSBA 3G1HA 1QPOA 4M29A 3W2JA 5D37A 3N11A 4TVDA 1VGAA 4IPNB 1J0KA 3NM3A 3LPPA 1HXJA 1H5YA 2X05A 1JZ7A 2QCEA 1TTQA 3HGSA 5G2HA 3FAWA 2DU2A 1UR1A 1W32A 1HNYA 3EBVA 4AY1A 2NX3A 2ZRVA 4N9DA 1U83A 3SC7X 3TFXA 4MLRA 3TW6A 1HKMA 3A5VA 1PVNA 3C2FA 3L5MA 3QMTA 4RXGA 4E38A 2W5FA 1FFRA 4CD8A 1SSDA 1IGSA 2CETA 5I77A 1W5OA 2OX1A 3C6CA 4M6PA 3SUSA 3M16A 4CCDA 1G01A 4I7WA 4GZIA 1W3NA 1ITXA 4FX6M 4W87A 5CPNA 4NF7A 3SCTA 4A3YA 4J3XA 4A22A 5E6ZA 3OBAA 3TOPA 2FH6A 3GNDA 1V0LA 1MWOA 3WD4A 5I3IA 4UMCA 2CLHA 4AISA 5D9PA 1W8SA 4XZ9A 5HXMA 1H1YA 1Y0EA 3LBMA 1T8XA 2WVVB 2ATMA 3CBWA 1HJWA 1F4HA 3W7GA 4CD5A 3JR2A 1WB0A 3G6MA 5IXEA 4FXSA 5DXYA 1W5NA 4AF0A 1WZLA 3NQGA 4GXPA 3W76A 2ZTJA 3AISA 3MV01 3SFKA 4LVAA 1H7RA 3I68A 5I24A 1Q6OA 2VQUA 1NP0A 1AMYA 2VVSA 3TJLA 2Y8VA 4FNQA 2VCBA 5BRQA 1GTEA 2VEMA 4O1AA 2J7FA 5DEZA 3GLCA 2OSXA 4FIQA 3CGTA 1ISXA 4TXEA 3CWNA 1TQJA 3W7CA 1PE1A 1MW0A 1WPCA 4C1LA 3BH4A 5BROA 1KV8A 1UKSA 5A95A 2OZ0A 5D32A 1GOIA 4TX8A 1SZEA 2XFWA 3G3DA 3TK7A 3WJXA 1Q6FA 2DT3A 2WMKA 2ZXBA 3HPXA 4MIMA 2CIPA 5HINA 3KEHA 4ORMA 3W1MA 4FMVA 1J11A 2ZZ4A 3GKAA 3L4XA 4K36A 3WFLA 2AQWA 4P61A 3VD4A 7A3HA 3MHGA 4WJXA 1YDOA 3G1VA 2CHNA 5HMSA 5I3KA 2FB3A 1TB3A 1JR1A 5I3FA 1GVQA 4OBTA 1CXFA 1WZKA 2YCEA 1RD6A 3CMJA 3IV3A 4DO5A 4NI3A 1WV2A 5I0DA 7TIMA 1AVAA 3N9KA 2WMGA 3ZMRA 1DWAM 2H3DA 2WPGA 3B8SA 3S5OA 1V6YA 3FAXA 4AIOA 5CGMA 3UNDA 3CC1A 1EP1A 4URIA 4LXFA 3GM8A 4U28A 2Q3RA 3GX9A 3AZTA 2CZDA 2Z0IA 3AYRA 1OBAA 3OIXA 1DEDA 4HSOA 4UTJA 1QPNA 4GPNA 3WMBA 1OGBA 3W26A 4EE9A 3HOJA 4CQ9A 3W3OA 1XH2A 5A8PA 1BPLB 2PF0A 2QDGA 5KMYA 3WF0A 1ME7A 1KM5A 3MKKA 3WN6A 4N6EA 4CUCA 1GT8A 3EWZA 2Z1SA 1Y9MA 1O60A 1M7PA 1BGGA 3B0PA 1E70M 1P5BA 1FP8A 5F2IA 3HG4A 4NX0A 3M44A 2ADDA 5A8GA 3WQ5A 1JL8A 4AAJA 4CU7A 3BAXA 3OA5A 1UWRA 2JFEX 5BRBA 3UETA 1YPFA 4C1KA 4YHGA 3RIKA 1UD6A 5JUVA 4NZFA 1V02A 3T44A 2VZSA 3P80A 1W1ZA 3GK0A 1E6NA 1HL9A 4WIWA 5FK8A 5AC5A 2X0YA 1NEYA 5JBFA 3U7BA 1OYBA 1EIXA 4AZGA 2QCDB 5DBUA 1EIBA 3HU7A 4LC6A 1RPXA 2X0HA 4GKLA 4X0NA 2VO5A 1ICSA 4FXRA 2C1HA 4LPCA 5GNYA 1ZJIA 5A6SA 1AG1O 1TCMA 5F4WA 1WCGA 1K8ZA 2WYSA 3G18A 4B3KA 5DY2A 4UTUA 2XVKA 3UZJA 3ABSA 4OKDA 1H7PA 1KXQA 1QPRA 4O17A 4IMFA 1UD8A 1ZU8A 1UR9A 2A0NA 1YXDA 2QQWA 2ZQ0A 4K37A 3PZ9A 4HA1A 1ZBWA 2V30A 2GVLA 3LLFA 4PFMA 3LB0A 2V3DA 4PUDA 2V38A 4AD3A 1FWTA 3GDLA 5EA9A 1RP8A 3KAOA 2PCQA 4PUEA 3Q58A 3QSRA 5IHRA 1RV8A 3W85A 4OT7A 3DYOA 4A3UA 4ML4A 1FCBA 3SEPA 2VX5A 2WCAA 1O95A 2HSAA 3RM4A 4UTTA 3AS1A 4H04A 5A6MA 4QHZA 1CZ1A 2NWSA 5D03A 4BQ3A 3I3BA 3F1QA 4BFAA 4Y7EA 4GO8A 4P2VA 1LZOA 4KWUA 2GJRA 2PWDA 2VCCA 2AEZA 4K38A 4MNKA 3AIWA 4PN2A 5I3HA 2J78A 4ZQMA 1KFKA 5DELA 2ZX8A 2ZUMA 4AZ5A 4JKKA 4RCXA 4RE3A 4L4OA 3JUGA 1TJRA 5G4WA 1J0IA 1BHGA 4AHOA 1QWGA 3AIVA 3HIJA 4CN6A 1J4EA 4PC8A 5FF2A 2RGMA 3STFA 4NZCA 4JTEA 3VCRA 1VBRA 2D0GA 3BW3A 3V1PA 5HNRA 1PIIA 1UZ1A 3TX9A 2VENA 3KF5A 2NUWA 5LGXA 3SZ8A 2VZUA 5D2VA 3E0IA 3TJXA 1AQMA 4S3JA 2J9YA 3G1SA 2FIQA 3W4RA 4UQBA 4PMNA 3GR8A 3W2MA 2BVTA 2W62A 4KGJA 5J5DA 4OZOA 4A3HA 1SW3A 1PAMA 3LPGA 1OX6A 3O6DA 1E3ZA 5A6KA 3LI0A 4IUGA 4TTGA 1JF5A 2YZRA 1QI5A 4HPGA 4C7GA 3EDKA 1KBBA 1EO7A 1OT2A 2O9RA 3W2NA 1GYNA 2J74A 2FPVA 5AYZA 4PMOA 1EB3A 2ALDA 3C2EA 2JEPA 4R34A 4HA4A 5D9OA 1VPXA 3SCQA 3SGUA 4HHPA 3MWAA 1MQRA 4O4WA 4FHAA 3L4TA 4H41A 4J7RA 5E1QA 2VFGA 5E0CA 2YR1A 4K7YA 5SWUA 3LBCA 1R86A 4LV9A 1ZJBA 2G4FA 3SCSA 4HU8A 5FOOA 2RH9A 3KHJA 2NSXA 3CIXA 1SW7A 4OWGA 2VEKA 3WD0A 1SW0A 3VU2A 4IOTA 4O10A 1XUUA 2VELA 3G8RA 3PBGA 2Y61A 4UTFA 2VI0A 1IXNA 3HG2A 4HOZA 3PN8A 1T96A 3PUDA 2YBTA 5C5YA 2JIEA 3ARZA 3GNOA 4ZFMA 4PMVA 4X9YA 4NT0A 3SJ3A 2XFFA 4JZ5A 3RMEA 1JDCA 1EOKA 2V81A 4YCOA 2QEZA 3P61A 5FEPA 4S3KA 3OG3A 5F1UA 4AD5A 3M7WA 1QI4A 3SCNA 3MBFA 3UXDA 2ZZ1A 3WD1A 3W7LA 2JK2A 3RILA 1YADA 4MY8A 4D6DA 3CWOX 3LF7A 3VD7A 3UGHA 4UCFA 1B2YA 1XI3A 3USBA 1G0CA 5CSRA 3MUAA 5BNKA 4KGLA 2ZZ6A 1XGZA 2YFOA 1BFNA 5D2TA 2VJXA 2ATSA 1L0PA 3GBEA 4WZHA 2QJHA 1KV5A 4U3CA 2BSLA 3VPLA 3W7KA 1K3UA 3P74A 4KFOA 4FF5A 2WB5A 4BWLA 3M5YA 1TFVA 2DT1A 4CGTA 1TYGA 1TPUA 2CYGA 3IMMA 1CLVA 1F6PA 1OX4B 2B7QA 1HKIA 2DH3A 1LOQA 3LM7A 3NR0A 4UFMA 3INPA 3LRMA 5D02A 2ZXQA 4TTUA 1VCFA 2VFFA 3UXAA 4CU8A 4PMQA 4WF7A 1PX4A 5IDIA 3EWWA 1XHGA 2EXOA 4HMEA 3LTSA 2D73A 2D23A 3O9NA 1JNEA 1H0GA 4WK9A 3VGGA 1GNXA 4JX4A 1HL2A 5A8NA 5C8BB 3PBWA 3VIGA 3B4UA 3BSHA 3MSGA 1PZ2A 4DM1A 3B04A 3VGHA 3PZIA 1H5VA 3VOCA 3OLGA 2Y7DA 1UKPA 3NSXA 4GO9A 3AHTA 4MB3A 4BCEA 2CBUA 1TA3B 3UY8A 1OK4A 1TO3A 1CXKA 3W22A 1FY6A 5HWJA 2WK2A 5HJLA 4C7FA 2A3AA 3BVJA 1Y9GA 1AW2A 5FMBA 4XUYA 5CPMA 5LYRA 1GQJA 3WIJA 1US2A 3BXWA 1O5XA 1W3TA 2O9TA 2J79A 2Y5EA 2D22A 5DCDA 3OVRA 3C2RA 3TE9A 3TONA 1FH9A 3VKJA 1LLOA 4TX6A 1J5TA 5U4NA 1B9BA 4UTMA 1W2TA 3MJYA 2E6YA 1W3KA 4J3UA 4ACZA 3C2OA 1CXEA 4FK9A 4JTLA 5A94A 8CGTA 3DKLA 3IANA 4J9JA 4JTUA 4UIOA 1OFBA 4UFIA 1F74A 3W1AA 4IQLA 1TTPA 3C4UA 3QMRA 1AL8A 2KZHA 3EXTA 4EAMA 2J7HA 4HNTA 1KQYA 1YQ2A 3RJYA 4MJ4A 4D6FA 3SY5A 5EMUA 1V5XA 2FGLA 1QOXA 2ZA1A 6CGTA 4A29A 1ADOA 3CMGA 3NYZA 2DT0A 2WZEA 1F4AA 2V5CA 2VVNA 2Y2WA 4IMGA 5HNNA 3WQ4A 2CKSA 3CLMA 1I1XA 1V3MA 5C70A 1V03A 3CUHA 2BHYA 2AAMA 2V3EA 1TV5A 1VYRA 5FK7A 4E0CA 4WKFA 3SCWA 3ABOA 1E6RA 4LGXA 4V2XA 1KW1A 2OYMA 1O94A 5I3JA 3MMWA 4MY9A 5A5WA 2E5DA 3L0KA 4NJHA 1BF2A 1KQZA 1X6LA 2A3CA 3W7PA 2VX4A 2CERA 4JAWA 4TUFA 4AXNA 5JIPA 3TR2A 1EA9C 1EHAA 4JTTA 5G2IA 2V2DA 5K9XA 1V6UA 2Y85A 4DPPA 1HVQA 2C0HA 1W9BM 4U31A 5BOOA 3W27A 1Q6LA 3PBVA 3NL3A 1CIUA 2XUCA 2PI6A 5AY7A 2ZRUA 3HQ1A 3WK0A 1R87A 1V6WA 1SZNA 3E9AA 3L5AA 5CQ1A 4XX6A 3FOKA 2A3HA 5FEWA 4GBUA 2XPKA 2A7RA 1VIWA 4XZWA 4AC1X 3HBKA 3L2IA 3QMSA 2BTMA 3LCGA 2H8XA 3W0KA 5AYYA 3HO8A 4RK8A 2B7PA 3EWBX 3WNOA 2BWGA 2Y89A 1VHNA 4AB4A 1IZJA 3CUFA 2UY3A 4U2ZA 2E5CA 4PEKA 3LXBA 1OB0A 2WSQA 3PC0A 3EXRA 5KZEA 2DEPA 5HR7A 2WNWA 4XZBA 3IIPA 4JIQA 3M9YA 1TV8A 2BHZA 2B31A 3TQKA 4JL2A 2W91A 3BAKA 5LHFA 1CPUA 2D0FA 5D2YA 1YHTA 3TP4A 4OE7A 4NZJA 2J62A 2NUYA 4GNJA 1B1YA 3LDVA 2E68A 3O6YX 2QF7A 1VQTA 4GUHA 1UH3A 1WAUA 2E9LA 1EH9A 4Q33A 4B16A 1Q6CA 1UKOA 4DO6A 2W67A 1LL6A 3VDBA 5HPOA 3HGRA 2XIIA 2BY3A 3FW6A 1Q45A 2ZBTA 1F2JA 3NQEA 4S2BA 1GVFA 3LXCA 3WEZA 1LOSA 3NDYA 3EYPA 3OG2A 5BXSA 3CUIA 2VFHA 1ME9A 2NV1A 3O6AA 4AH7A 1A47A 4Z2HA 1PCKA 2VOMA 5AHIA 5TQLA 3PULA 1C92A 3CH9A 4LX4A 3W53A 3ZIZA 4Z2LA 5I78A 2Y4SA 1GVRA 4UR8A 3K4DA 2DJXA 3VMPA 4UTIA 4E4PA 3SSJA 4UTLA 3CZ8A 1J9YA 3PZTA 2QCDA 1ME8A 2TAAA 3PBYA 1E55A 1JCXA 1UR4A 4OBSA 3G1AA 2Q3OA 5FF3A 4OUEA 2VNCA 2DZWA 2V5LA 3GDRA 3U57A 1JUKA 3T0DA 2YFNA 3NNTA 2VR5A 1EUAA 3ZOAA 3LV5A 3LLDA 1SSGA 1B3YA 4FFFA 4NVTA 1KCKA 3N17A 4QLLA 1QNSA 3T40A 4PCSA 5G1TA 5ABGA 4DWSA 1E6SM 1KXHA 2C6QA 1QI2A 1YTDA 3VI2A 4WY0A 3BV4A 1UJPA 2XN2A 4A2SA 4P7RA 1UBSA 2QF8A 1QOPA 1TREA 2GQAA 2VFIA 5E93A 5EBUA 2ZDRA 1ISWA 5EY5A 4PBGA 3GXFA 5AYBA 3YPIA 3NXFA 3AHYA 3FXYA 5HDRA 1UR8A 4Z2JA 3LHYA 1CYGA 2ZWYA 5I6SA 4DQWA 2WKJA 4O53A 3GDBA 5AHLA 5FF0A 3C61A 2J88A 1A50A 3EMCA 4PMXA 4UOZA 1E71M 1GWJA 5D04C 2GUYA 2BZNA 4AMAA 2ISSA 4AHQA 2YIHA 1JDDA 3M7SA 1UCWA 4NNBA 2CCRA 2VTFA 2HVMA 1JRBA 3ARYA 2E0PA 3FN9A 4MADA 5D4YA 5LNRA 4BS0A 1KM3A 3K8KA 2J77A 4PTNA 3IIZA 1QNQA 2D20A 2WLZA 1K03A 3ANYA 3W1QA 3N04A 4JD4A 3WL0A 4QIUA 1OHLA 1HIZA 2DZPA 4DPQA 4WJEA 4LYRA 3GXNA 1S5TA 1C7SA 4GIAA 2WSPA 2TSYA 2EHHA 3TSDA 2P10A 2QUVA 3W1LA 5AYIA 3BW2A 1N8FA 3ATZA 4KWVA 1GZGA 1C8XA 2VZOA 1B3ZA 4AZ7A 4TOQA 2NXIA 4BR1A 3ARRA 5M3WA 1E56A 1FFQA 1KWKA 4N6FA 4JGDA 1E4NA 1K9TA 3O1NA 1NAL1 4RXFA 3S0CA 5CSYA 1X7FA 1P0KA 1GQNA 5FESA 1DWFM 3UWZA 2J25A 3WQVA 1WOAA 2JKEA 1RR2A 4JDBA 4H8VA 3KF3A 4M24A 1WBHA 1V3IA 3DECA 4ZEPA 2GJXB 3R12A 4CNPA 3BO9A 3KRZA 4M6VA 1FWWA 1ZBKA 3CHFA 2WJZA 3CUGA 4H6KA 4LUIA 1YDVA 4UTHA 3TA9A 3ZJ6A 1R30A 3FS2A 2JBMA 3P7YA 5HWNA 3CZEA 2XN1A 2QHAA 1LYXA 1OFRA 1ZL1A 1VEMA 4O54A 3UD6A 1R2TA 5FKBA 4GXMA 4FLRA 1LBMA 5AHMA 3W81A 5EBAA 3IRDA 3PSWA 4ZL1A 1ALDA 5ABFB 5FF4A 3L68A 1NWSA 2VOTA 2F8QA 4GI8A 3O63A 3NIYA 3VVGA 3WEMA 4OGZA 4PA8A 3AFBA 2HISA 4ZE4A 3MANA 3VGFA 1E73M 1BTMA 2BY1A 3ZR6A 2D3LA 3BCFA 3RF9A 3L66A 4O4VA 4LC8A 1BG9A 2BS9A 3FEMA 3NGJA 1FWSA 4QAIA 3L0GA 4MJMA 3RDKA 3BG5A 4E2BA 3W1PA 2XFRA 4J3WA 3VGEA 3ZWSA 3H3LA 3WFAA 1B9ZA 3I6RA 4W5ZA 3NUKA 3S5NA 2VC6A 4CVUA 4LQ1A 5K9CA 1OGSA 1XV8A 2DJLA 4R33A 1CXLA 1JQXA 4RV8A 1CGYA 1JXKA 5ABHA 1YXCA 1U30A 3V75A 3UG5A 4QCFA 3HMCA 1PZ3A 3VO0A 4D71A 1DKWA 2CWNA 5C2XA 3NL5A 1V0MA 2CBJA 2QMKA 3VKKA 3TXZA 3AROA 2XHYA 2G8ZA 1W37A 1SQ7A 3MMDA 2DSVA 3BG3A 4UQEA 4CCCA 2V3GA 1KA9F 3TAKA 1OD8A 1TPFA 2O7SA 1QW9A 1V7YA 4UOQA 3LRKA 3O6CA 3BLPX 5G4EA 6ALDA 3SIZA 1IIHA 1O4UA 3O06A 2XFYA 3BMWA 1JZ6A 4PRWA 5A2BA 1X6UA 4O1BA 1NARA 4Y9AA 4PYSA 1VB9A 1KTBA 3STCA 3D0CA 4UQ9A 3WENA 2V8ZA 1S46A 4TX9A 4IMDA 1VFMA 4CQAA 1KTCA 1F76A 3DFTA 2XGBA 4AEFA 1MXSA 2WM0A 4IM4A 1SZFA 1BG4A 1J01A 1WAWA 3SUTA 5BCAA 1QPQA 2PWGA 2GVJA 2R8WA 6TAAA 4UTTC 3S8HA 1JUEA 4Y96A 3UWWA 2DIJA 1RPKA 3AI0A 1UWTA 3MO4A 4OIFA 2Y7EA 1FDYA 4IXHA 2DSUA 4ZE5A 3S1UA 1DQXA 2V3FA 2J4GA 5IBXA 4E2DA 3GTNA 2E5BA 4XWUA 5AHEA 3NCOA 3SCRA 2Z6IA 3DI1A 3NQCA 4A21A 3K8LA 2QUTA 3AIBA 3EDDA 3RCNA 1PEZA 4N2YA 4O13A 2Y7GA 1CNVA 3KWXA 1G4PA 2W0UA 3P62A 1I2RA 1X1NA 2JKPA 1RQHA 1QHZA 4NNCA 1NWUA 2VCAA 3G1YA 4FIRA 1DOSA 1FHLA 1R7AA 5GPRA 4UOJA 1H4PA 3EWXA 3FKRA 4ZQPA 3SCOA 1L2UA 3MUY1 1GJUA 4ATDA 1UWUA 4BF7A 3AMCA 1LL4A 1JCJA 4P7LA 3N12A 3HJZA 2W6RA 1IF2A 3EXSA 3WQWA 2E4TA 4JTGA 4MZ1A 5CG0A 1TJPA 4FFIA 4LT9A 2FFCA 3MS8A 3WNNA 1Q6RA 4BK9A 2ZXDA 1I8JA 3FHAA 5ABTA 4HU0A 2OT1A 4UR7A 2RDWA 5I5RA 1AQ0A 3WY1A 1TCDA 1QNOA 2J7EA 4W84A 1VF8A 5A6AA 5D2XA 1MW2A 4JN6A 1T99A 1NH6A 3TC6A 1VRDA 5CG7A 3AJXA 1M53A 1H11A 2WHMA 4Q22A 4DWSB 4UZUA 3WQ6A 3WF3A 4UTKA 4POCA 3Q2DA 4NJKA 2AAAA 1NWRA 1E0XA 3G0SA 1A5BA 1W54A 1M01A 3NPWA 5GVJA 4HZ6A 3I3EA 1R2SA 2ESCA 3IJ9A 2DZVA 2E6AA 3GZ3A 3NDOA 4XQ6A 4LVFA 1WZAA 4D6GA 5K2ZA 1OWQA 3C52A 1GPFA 1M7XA 1DL3A 1THFD 3ARWA 5A8OA 9CGTA 3QSTA 3ZO9A 1SO6A 1TMQA 3R89A 4P8XA 3VNDA 3NOEA 1H50A 4TVUA 3SURA 1ESWA 1I75A 2ZUWA 3EX3A 5E70A 3T7VA 1FDJA 2Z1KA 4P7QA 4HN4A 1E1EA 4MB1A 1CXHA 4BA0A 1KR1A 4WXZA 3TU9A 1B0IA 4U2YA 1QHPA 5A8QA 2YPIA 3I65A 4O11A 5FKCA 1OFEA 1TZ7A 3EX6A 3BGGA 1G4SA 1TIMA 1GHSA 1HP5A 4AD2A 2YX0A 4QM1A 1BVZA 2J8FA 5HR6A 4YPJA 3W6MA 2ZA3A 3E12A 1A5SA 3G8EA 3MHUA 4LW7A 4MNMA 4I7UA 4UQDA 3GYEA 4NQ1A 1XC4A 5KSWA 2B7NA 4LY8A 5FEXA 3BAYA 3P84A 3S6TA 3G22A 5AB3A 2GJPA 3VGDA 4F8XA 3A47A 3WDJA 4AZIA 3QPYA 4JEQA 2CHOA 4JKMA 3UY7A 2OT0A 4O18A 3W1UA 3L4UA 5AC8A 1KXVA 2DZUA 1WE5A 2EPNA 5A2AA 1DVJA 4AXKA 5DCEA 4JTHA 3MUZ1 4WLCA 1ZENA 1HVXA 1KXTA 1QVBA 2ZA2A 4UFKA 2WC7A 3U14A 1IXQA 2QCMA 4QNWA 2JF6A 2VZVA 1WDWA 2E77A 5KITA 3CHDA 3WH8A 2W4XA 4GUIA 1S3HA 1GOOA 2Q8LA 4KRTA 2YDQA 4FNSA 5FL0A 3M5ZA 5CPTA 4O12A 4JIEA 4HOWA 3QQ1A 4IPJA 5DMYA 1L6YA 4GE8A 5EMYA 1ZY9A 3VX1A 3L2LA 3WJZA 4FF7A 3BW4A 1CGWA 3PB2A 5G5IA 4DUWA 4WOQA 4Y90A 2YYTA 2QJGA 3PZNA 2BY0A 2XSBA 1GCYA 5TD4A 1W1VA 3N3MA 4W8AA 1LL7A 4LWWA 4X9SA 1JXJA 2D1ZA 3EKLA 4EQVA 1VAHA 4IX2A 2O9PA 2DP3A 2CZEA 4O57A 3U2OA 3W71A 3A4XA 1G67A 1UUMA 1VENA 4IPIA 4RZ5A 1JD7A 2WHLA 3TTYA 3NQ2A 4JY9A 3QC3A 4XBKA 1PX3A 1FP9A 4GFSA 3BAWA 1KCLA 1FXPA 4Y8FA 3ZR4A 2BVYA 4U4MA 3AIUA 3GB6A 2DSZA 4HT3A 1PHQA 2EPMX 3VIMA 1UR2A 3VD5A 3H55A 3RM9A 1B4KA 1V0NA 1XBYA 2GPTA 2CLKA 4AD4A 1XXXA 1KM6A 4I9AA 3B9EA 3QF0A 1VC4A 3DYPA 5D9MA 2H6RA 1E15A 2D2OA 2PC8A 1C29A 1B31A 4KMQA 4PCTA 2OMAA 3U5YA 2C16A 3NL6A 2FHCA 3T2QA 3CQ0A 4W86A 3QW3A 1JVNA 4GQRA 3ZSSA 4AW7A 3KE0A 4UFHA 4CN1A 5BRPA 2GJNA 1P1XA 4PMDA 1OJXA 3CPRA 1EP2A 1K8XA 3N13A 5DXXA 3PF3A 3O05A 3B05A 4CU6A 3PR2A 1GG1A 4XKYB 1XD1A 3QOMA 4ONVA 3QOKA 2GQ9A 2Y62A 1B30A 3MHFA 2E3ZA 4MNLA 1QOQA 1LRNA 4RZ6A 2W61A 4DWSC 4MDPA 5BWFA 4QQ3A 4NUWA 3W83A 3LHWA 4CQ8A 1E6QM 2WSKA 3WK2A 2YA0A 1UB3A 2J27A 3B06A 4AEOA 1CGXA 3APGA 3FNDA 4E8DA 1GEQA 2E09A 3W82A 1HX0A 7TAAA 2VKZG 1EWDA 3LGEA 1EEPA 1FQ0A 1HKKA 3GVGA 2EJ1A 1SO5A 4HTYA 1B57A 3Q37A 4K39A 4RZ4A
chains in the Genus database with same CATH superfamily
1XLCA 3TZFA 2EPLX 4J35A 5E09A 3S9YA 2G3MA 2OO6A 1BYDA 3K4AA 1PK6B 1IHIA 3D3FA 4G1KA 2PLKA 3KVAA 4AWTA 2E63A 3S1XA 1TE6A 1C5IA 3PTQA 4QX3A 1QNVA 4M19A 2V0TA 3WQOA 3C8FA 1RJ8A 5FCZA 4WDWA 3GIPA 1I5PA 3GXTA 5BNNB 2DGAA 4NJIA 2J6XA 4HT1T 3NPUA 1EGVA 2HEVF 4WUIA 1YTEA 3KVMA 1LHUA 2BFUL 1UOZA 2BYVE 3RZHA 1IG3A 2ZFAA 4HYRA 4IICA 3ZDVA 4HYVA 4WKHA 3SITA 4BWLC 1ODZA 1J18A 3URQA 5EQUA 1EBGA 2OEJA 4XABA 1G4EA 1P0DA 4AK3A 1WMEA 1YFYA 3GTXA 2PAMA 3VBRC 5DDJ3 4JOMA 3WJWA 3KL3A 4MJ2A 2INFA 4YXGA 3DYMA 3W6LA 2PD9A 3N2XA 1G1YA 2GK1B 3O1OA 2XH6A 5EFUA 2YL8A 4H1ZA 2XVNA 2BOGX 4CXWA 4NE9A 4WHBA 4DJEC 5MHBA 2MNRA 2E9MA 1NCQA 4V1PA 5LA0A 1AR61 2TBVA 4BLIA 5IJRA 1OY0A 1VFFA 2HTMA 4Z1YA 3DZ1A 3BWWA 1VRBA 1VB2A 4FOKA 3OBKA 1FKXA 3KTCA 2VD8A 2EVXA 4LOTA 4L4LA 3WINE 4X2PA 3M0VA 2HWF2 1ZTVA 1QU0A 4V15A 3RSJA 3BCDA 1HN0A 1QJU1 3QV7A 3ISIX 3WD5A 3T2PA 1ZP3A 4JAAA 3BAJA 3L4YA 1NT0A 1UYZA 3UKTA 1XRFA 2O4MA 2FJUB 4F0KA 2WM1A 3SR7A 3C2VA 5EJZB 1XCWA 1ZSXA 2J7DA 2ZX5A 4LVDA 5FYUA 3HPZA 3TC3A 4D6IA 5HNTA 3LDBA 1XIBA 2HWE2 2PBOA 3R25A 4XV0A 2UV8G 3C3VA 4HPKB 1K5MC 2PQQA 4IISA 3ZM8A 5IBXC 1YMYA 5FPVA 1QQP2 1OOPC 4DY5A 1SZGA 4IWWA 2W52A 4UTWA 3VIPA 4B4QA 2ZGQA 4ROPA 3A3XA 1IS6A 2DT2A 2GVEA 3IIOA 3EX1A 2N7GA 1JFHA 1LG1A 2C5DA 1W0MA 1C91A 1VBE2 5A7SA 5JZGA 1U5XA 3ALFA 4OU1A 4R7JA 4R4ZA 4Q4Y1 3POIA 3OUIA 4AQ6A 1WXJA 2PDBA 4GBDA 2ZAHA 3B4YA 3B93A 1DHPA 2XJTA 2ZRYA 4JR5A 4PMZA 4WX2A 3DCPA 2E28A 1DWJM 1OT1A 2ZBJA 4QAWA 4LOCA 2QQPA 5FMOL 1G6CA 2GGGA 3NQ8A 4RNHA 2XBO1 1IQDC 5TSWA 2P17A 3LERA 2W79A 2D5FA 4Q0PA 1H1NA 5CU1A 3IDAA 4H9XA 3RI8A 3QV6A 3SEEA 2TUNA 1KM0A 1OGGA 1QXRA 4YARA 4TR9A 1XH0A 4PUNA 4ZQCA 2OIIA 4E4SA 2GGHA 2VC9A 4EN7B 4LUJA 1BLZA 3A6OA 4HN1A 1UMLA 3AXKA 3SLIA 1ND2B 3A7QA 4DEVA 7CGTA 3QM3A 3OBZA 2XYLA 4Q4QA 1K1DA 1KTNA 2DVFA 3LB9A 3W2LA 1N1YA 2VXJA 1O5RA 1RUC3 2TODA 5C54A 3WW3A 5CGTA 2PURA 4AYUA 1JOPA 2VE1A 1KFWA 1MO0A 4F3JA 1SYTA 2BVBA 2XSAA 3BK0A 2P0IA 2R071 2IQ0A 2DCJA 4R7OA 2DPEA 2GC2A 3JD73 5BYWA 3D3AA 1HW5A 2J24A 5FZOB 4UR9A 1UYXA 5A6TC 3OODA 5FCCA 1UQZA 2HWD3 5ACA3 3A0KA 4H00A 1OZMA 2DZXA 2J9ZA 1AQHA 1C93A 1J0HA 4PDWC 3H2FA 1JYNA 4X3ZA 1MMFA 3THUA 2ZKNA 4Q4X1 5C8WA 5J48A 1GGOA 2YOCA 4L99A 4GUFA 3VBFA 4AVTA 2G19A 2ZHNA 3U37A 3NG3A 1KLYA 3L67A 1TEIA 1W39A 2ZZ3A 1V79A 2ABAA 3ZT5A 5M2FX 1I45A 1H2NA 3ZLFA 4RE2A 4E4DX 1QU4A 1RUF3 2PBGA 4X2RA 3LFIA 5FP9A 5CFCC 1EPXA 4LVBA 1VAKA 3QZEA 5BW6A 2J8GA 2OW4A 4HHHA 1MNSA 4K8EA 2TMDA 3UZ5A 3LV6A 3VB9A 3W23A 3IIIA 2BNMA 3EEGA 2BBAA 3J7LA 3WLNA 4AF0B 2XWBB 4C6JA 1MVYA 3IVTA 1V08A 3GU1A 4F9DA 5A7NA 4S3EA 2EAKA 4JS3A 4EXBA 1UY3A 3NEVA 2P1FA 5LIKX 5A69A 4JTFA 2I5IA 3II1A 4P14A 1XM3A 3QN3A 4U33A 2K2SA 3GKFA 3Q4DA 1GZWB 1FAYA 4ZXLA 4H9UA 1GOMA 1LF1A 3N9RA 4H8HA 4HNCA 3E97A 3KHCA 3FY1A 2NWRA 2E67A 5AVPA 1QDOA 5IVCA 2A3BA 1C9WA 4QGLA 1EV12 2OTDA 3WK1A 3L21A 1DZTA 1ZRIA 3HURA 3RFAA 3VZKA 1PM7A 3B9DA 4W7WA 3I10A 2QCCA 3O14A 1H1IA 1DQ1A 3UP8A 5FZGA 5FZAA 1J3PA 5EB8A 4AEDB 1D4M2 2CZ5A 3C0JA 3OBTA 2GUUA 1FTXA 3UJ2A 3QR1A 3G0XA 4ZTYA 1G8WA 4BMEA 3RO8A 1LCLA 3AXEA 4GC4A 3IJQA 5HAOA 3FYPA 3DFNA 4R27A 4IDZA 3V0UA 2X29A 4A35A 3W1NA 3CTTA 3DFPA 1Q56A 1EZWA 3A21A 3I97A 1JYTA 1JGMA 1GQGA 1RZMA 1OOPA 5K8SA 3BLKA 3I7QA 4QJ3B 4A8RA 1DJXA 4ET7A 2ZPXA 4AVAA 1A78A 2CZVA 4IMEA 4QFUA 1BRLA 1BYBA 3TYUA 3L5LA 3MMUA 5G05L 3S5YA 1AR71 3TNBA 2AQOA 1XYOA 3GY1A 1BKZA 2DSWA 3CAWA 1K6WA 1O3SA 1WGPA 5DFAA 3ZVHA 3P60A 4OBRA 3OD0A 4FX7A 1UNBA 1KBKA 4R5EA 1WP6A 2ZKMX 3OVQA 1U5ZA 2ILMA 1PIGA 5GJPA 1OF6A 2P5BA 2AC1A 3W7OA 1UJQA 4ICNA 2HYKA 4S1FA 1JYXA 2H8ZA 1W6MA 2E1DA 3MWCA 1SVDA 2R063 1VBB1 4LBMA 4IEXA 5F2WA 1SUXA 2X8RA 1V9U3 4UB9A 3WBAA 1FBAA 1UUOA 1G7VA 4KEMA 3LCHA 3ABXA 1AR83 5B7ZA 3GH7A 3UCCA 2GNTA 1X6NA 2QCHA 3Q8CA 4FOYA 1QDSA 3ROUA 2QJIA 3OVGA 5RUBA 1F5FA 1KFBA 3NM1A 3LBOA 4WD0A 1LT8A 2FZNA 1J83A 5F4SA 1GWKA 2WLQA 4EK7A 4EWAA 4HZ8A 3BVCA 2VMFA 4GY7A 4JEJA 3BTYA 1YYNA 4Y9NA 2WHJA 1GOWA 3TTEA 4GGHA 3E5XA 1NYWA 4XAZA 3DPRB 7REQB 2MANA 2OUHA 4XVEA 3G1FA 4YLWA 2G96A 4JGZB 1VEOA 2OODA 5DN2A 4IGPA 4H3DA 3UKNA 3USUB 3N73A 5A32B 1NA1B 2Z24A 3NV1A 3WNKA 2ZEWA 3DFOA 5E16A 3AHZA 5FZIA 3GR7A 1JZ4A 4C6BA 3EX2A 1LNSA 4HBKA 2VWSA 4E4UA 3POEA 5F3GA 1DE5A 2Q09A 3CAVA 1GZ9A 3P3NA 2D6PA 3BAIA 3EB2A 2O8QA 4MWAE 3GG0A 4IHCA 4JGZA 1UIPA 4RJEA 4JBRA 2IVIB 4W4ZA 5AHFA 4MZYA 3KS6A 1OQEA 2OWXA 4ZENA 4UTWC 2C13A 4D6SA 1TVNA 1R46A 1BEV3 4LS2A 4JDMA 5C33A 4V27A 5EL1A 1RUOA 5FYHA 4IX0A 2EF6A 3CWHA 3GDTA 1C8QA 5HBFA 2DZAA 3APBA 1A0EA 1TPWA 4W7UA 2AACA 4KNCA 3RO6A 1LWJA 2XJSA 2ETEA 1XLBA 2QV4A 4B9ZA 1T0OA 3HGOA 2R1KA 2A6VA 1I2OA 5SV5A 3UG4A 2QKFA 1OZQA 5ANQA 2ENRA 2RDXA 5FXZA 3TNOA 1BQPA 1JHJA 1QJX3 1B54A 3P5YA 4GX8A 4MVAA 1BVNP 3PPFA 1OD0A 4FNRA 2B4GA 2QV5A 1V3KA 4XQWA 4HP5A 1OVDA 4I30A 1ENUA 4XACA 2XB6C 4JQTA 4O15A 1CCWB 1R082 4NN0A 4I9TA 1CGVA 5KZDA 3HOBA 3BQ5A 4IEVA 2WZPP 5D8ZA 2OSWA 4DIQA 4A3XA 3U9IA 4Q7NA 4DY3A 1CAUB 1SLLA 1F6KA 3VZJA 3RLVA 1NDVA 4UQCA 4QPGC 1AW1A 3TMLA 3P0XA 2QPSA 3LQLA 3MVTA 3ETQA 4ECLA 4FO9A 2WLPA 2GJLA 3CM4A 1S0CA 3I2JA 4LAOA 3ZFFB 3N4MA 4O1EA 4XUNA 1Q63A 1ICQA 2WHKA 1BBT3 3F03K 2VM9A 1LTDA 4GZJA 4OHYA 4TZDA 1QIQA 3GUWA 4DUXA 5DABA 1QFEA 4NIHA 4M56A 3WLRA 4GAZA 5FZ9A 1XG3A 2HWD2 5ACA2 5GNZA 8TIMA 3S6DA 2HLEA 3RK8A 3VDHA 4BIFA 1TE1B 3KM5A 2UZ9A 5D9NA 3KLSA 3TEVA 3TKFA 3RWNA 3TQPA 4L5ZA 4NHVA 4REQA 4Q4RA 4W9TA 1NVMA 5LNWA 3W38A 2C26A 4MO3M 1CBGA 4M01A 2WNNA 1BYCA 3F5KA 3KDNA 1W31A 3BANA 5JBDA 3ZFHA 3GNPA 2YC2A 4H7LA 5FREA 1LHVA 3H1YA 1QH7A 2VMDA 3GWQA 5BNOA 3U8GA 3UCQA 1OLMA 4B29A 3AU6A 4OULA 5H2ZA 1OCQA 1FMD2 4X8NA 5BUVA 1VIWB 1JI1A 1XCFA 1HO1A 1P0BA 1FXQA 2PDIA 2ID4A 4B2DD 2FLIA 3TQ0A 4WDTA 4GACA 3D5HA 5E6HA 3NV3A 1U33A 2ACSA 1GZJA 3INAA 2Y5JA 3CZJA 5FOJB 3PJYA 3ZXJA 3MIBA 1RMU1 5I0RA 4ZQNA 5IOBA 1BZWA 2Q0AA 3OUHA 2JALA 3KVKA 1D0HA 3LHTA 4MKVA 4W50A 1TMHA 3PS7A 3JQWA 2JIJA 1NOUA 1OFQA 2PODA 1QH6A 5LIUX 3N18A 1AJOA 4JQ4A 3W7JA 3HQPA 1W9VA 2J7BA 4O1CA 4GI9A 4I90A 4U5IA 4C6OA 4I3PA 3FX4A 4HCDA 2R9RA 4GRSA 2LTNA 4Q4V2 1MEC2 3AWNA 1B4EA 3WQFA 1V6XA 3NQVA 4GC3A 3UWVA 4XBQA 4IXXA 2ES3A 1GJPA 1K7FA 2WAGA 1AFSA 4YCPA 1FXZA 2CGNA 3ZIXA 4H3WA 3CB8A 1AYM1 3B40A 2DDXA 3TN3A 4K68A 3LX9A 4QDWA 2Z7GA 1H0IA 3CZLA 3PNAA 4Q8KA 2GDVA 1TPEA 3RX4A 3ON7A 1KFCA 3FIGA 1KD7A 1U0AA 1Z0HA 2F61A 4QLKA 2Q8EA 3QGAC 2X7VA 4JTDA 4L1GA 1EGMA 4DJDD 1VCGA 5FMCA 3AK0A 4RDZA 1OG0A 4BI6A 1XDLA 3S1VA 4ISRA 1LRTA 1HRV2 1P0NA 2EXJA 1N7KA 1V3JA 1HGWA 2Z1BA 3N3TA 4FFHA 3U10A 5I8SA 3E6CC 3VHPA 4P7NA 1GJWA 1X82A 1OYCA 4Q26A 4BPZA 4DFSA 1AJZA 3PB0A 3URAA 2NP0A 1JG9A 4GCXA 3QHNA 2BOFX 4EF8A 5KC5A 1W9PA 1QOOA 1UA7A 3K46A 1XIFA 5JIWA 1AJKA 2P3EA 1EDGA 2QQOA 5IAXA 1KBIA 3UWQA 4EACA 2EQDA 4LAZA 1YLLA 3AMGA 4HSHA 3EOSA 5A6BD 3ILFA 3VL8A 3BALA 2PS2A 2P8CA 4O52A 1B3WA 1V9U1 1UYPA 3BMVA 2Y0IA 3I2IA 4OUMA 2PWHA 3CHEA 4QX4A 1LGBA 4ZOCA 4E2VA 3M5VA 1QK2A 1G9FA 3K48A 1OD5A 2O14A 3GCXA 3PM6A 3KLKA 2GDUA 1QWRA 2B46X 1CGUA 3W86A 1EDTA 3WDUA 1OFAA 3V0BA 4WM7B 3P81A 3VYLA 4J2PA 1MQTA 3WLTA 3LCLA 2R82A 3VKCA 3SCHA 1N8WA 3JB4C 4YM3A 3GFZA 1OXCA 1ZRQA 1W8NA 3N7MA 3H8XA 2A85A 4PEEA 4DUVA 2B7OA 4D6JA 2XGIA 2IWGB 4BQ4A 3VBOB 4QMAA 4I6VA 3HT2A 1O91A 4AYGA 3LZZA 1XLMA 3ITQA 1IT0A 4XBNA 2DQXA 2A6NA 1F8IA 3N29A 3B9CA 3UYJA 3PJWA 4JIPA 1NX9A 2NLRA 2J1UA 3GF6A 2GAUA 5JSOA 5I3GA 4XIKA 4NILA 1RUI3 1FOBA 3PUIA 5CAHA 4JYEA 2Z2SB 2OYKA 3C86A 2PDNA 1PZ9A 5HUPA 2O92A 2HS8A 1KB3A 4N0RA 1J12A 1QO2A 2JEQA 1H1AA 2FB2A 2QGHA 2VR2A 4LKEA 3VKDA 1H3GA 4GUJA 4GWEA 3HWJA 2ORZA 3VBFC 2DORA 1NIUA 2WJDA 4MWAB 3OBRA 1DORA 3LIGA 1Q4NX 2GC1A 1C8VA 3IAQA 1PO13 4N7QA 2BVVA 5ECUA 2DSKA 5TAOA 4HKLA 3VNLA 3AS2A 3U4AA 1PZ8A 4MGQA 1IT8A 2C0AA 1XKJA 5ANNA 2YSWA 2FDGA 1Q7QA 4OV4A 5T3NA 3M0LA 2V82A 3MZ2A 4C7DA 2CEQA 4LUMA 1HLCA 4DO0A 4UWDA 3LPOA 4YTSA 4F0MA 1LOEA 1O8SA 5DAXA 5CJ5A 1TQ5A 1V70A 2WPBA 4E6MA 3CQOA 1XH1A 1OQ1A 4JCMA 1QJY2 2JDNA 4MLJA 1VMHA 1TWWA 1NCQB 2BDQA 2D69A 1I2PA 4LULA 1KQRA 3CQKA 4ZB2A 5FSEC 2VBDA 1OSGA 4GIYA 1X1OA 3I3DA 5HV4A 4GINA 4N43A 3LCXA 1SR9A 4QXIA 3OPTA 3U0ZA 1W90A 2Y5SA 1DE6A 3C7HA 5FXWA 1AUSL 1UWAA 3VE9A 1UH4A 1FCVA 1ZM1A 3AC0A 1OA3A 4GWIA 2D97A 1CAUA 1AR73 2HWF3 2YUEA 5U7SA 1GQLA 1MW3A 4AIEA 2O4QA 4ZCWA 4B5NA 1UWSA 1FWCC 1IQ8A 4UZSA 1UOKA 3KRSA 3LMYA 3V0TA 1O5KA 4PDWA 2YFUA 4YIWA 1OVPA 5CC5A 4GA8A 4KU8A 2A1YA 1QNWA 3CQJA 3CLWA 4ZKTB 5FYSA 4Z92B 4N9EA 1NLQA 4AGRA 2IPJA 1ZJHA 3EB7A 4KH2A 4AHPA 1U5HA 1O4YA 1JPHA 3GDKA 2C19A 1PUDA 2CLFA 1O3RA 3HJRA 2V6AA 2FHFA 3FMGA 2D24A 4XVHA 4IE6A 3HPNA 3WLKX 1SO4A 2WABA 3GHTA 2X1SA 3WDHA 3RCMA 3L4VA 3CIWA 2NQJA 1XNDA 1NF0A 1DHKB 5BPXA 4IV1A 2YW3A 5AC4A 9XIMA 4E2GA 3LI1A 1R0MA 3EKGA 4WGHA 1YC61 2Y6ZA 2BXZA 5LK5A 3KVLA 4IFKA 4N02A 4Z1CA 2QQVA 1CQ9A 3APTA 1NUKA 3UZXA 2JE9A 4LBSA 5DO8A 3OZOA 1BBT2 3IVUA 3IVSA 5FZEA 5BNOB 2W63A 2CW6A 3A12A 2RS31 3UL2A 4DF2A 3NAVA 2R1BA 4Z08A 2JE8A 1O7AA 2W92A 2CXGA 2XBO3 3CLPA 3HAGA 3QHMA 4H9TA 1QJZA 1PHWA 3EDEA 4HPNA 1PO12 1RH9A 3WCSA 1Q7MA 4R53A 1FT9A 2VRKA 5IATA 1ITQA 3OGRA 2FPYA 5IM51 4PE8A 3CHCA 1BLIA 2XIQA 4ACZB 1EC7A 1D3GA 4LE4A 1SO3A 4UBPC 5E6YA 5FZMA 1HX6A 3RU6A 1HB1A 4YGDA 5F3EA 3ZLGA 4XTDA 2P3JA 4B1MA 5HQLA 3B8DA 1IR1A 2CLEA 2RG4A 3TROA 3DG6A 5BNNC 2B9VA 1O12A 2Y6KA 3CZKA 3N35A 3DI0A 5HULA 2NVDA 3LMZA 2PDHA 4WRHA 5HPCA 1E0VA 3F2DA 4UQAA 1JCNA 2Y70A 4DXRA 2V9DA 1J6PA 4TVCA 3HZ3A 5GNXA 1HO4A 2ZRXA 3VINA 1W6MB 5CXPA 1TNFA 4CE8A 3BLDA 3WSUA 1OLQA 3AMQA 1O7FA 3U0HA 4BM8A 2X2YA 3QEZA 5CPSA 4D1IA 3WQEA 3DU0A 4IV1B 3K8MA 4MTVA 2JG9C 2PRMA 4S3GA 4Q4W3 4XF4A 5FDBA 5JCTA 3HFTA 1R6WA 1XGDA 3THDA 3DHPA 2JB8A 1XLAA 4ZFCA 4MHRA 3V64A 3NURA 5F3IA 1J0KA 2PLV3 1R3TA 2W87A 4K8RB 3NJXA 1JZ7A 1R3SA 2QCEA 3FAWA 4BJHA 4P00B 1HNYA 4MYEA 1CT5A 4HB7A 4AY1A 1NXD1 2ZRVA 2G37A 1DJZA 3C2FA 1PVNA 4RXGA 4E38A 3CAKA 4SLIA 1SSDA 1IGSA 1UXZA 1W5OA 3RZZA 1ZLPA 3VDDB 3CJIC 1H8TB 5E6ZA 3D6EA 2PEVA 3Q9OA 2FH6A 3GNDA 4C5YA 4ZOEA 1MWOA 1MZRA 3WD4A 4RSUA 4CCMA 5HXMA 4LBUA 2WVVB 5A7PA 2F17A 2VNGA 1Q65A 3JR2A 1BXHA 5IXEA 1XE7A 4CCJA 1CWPA 3U4FA 1YQCA 3LOBA 3MV01 4LHLA 1XPGA 4OI0A 5FAXA 4DXSA 3V56A 2VQUA 1GWMA 2VVSA 1HRV3 1Y43B 5BRQA 1GTEA 1SG3A 5DMNA 1A5UA 2WAAA 4FIQA 3CWNA 1MW0A 1WPCA 3H7UA 5BROA 3S2LA 1RUG2 4W4QA 2NPIA 1DJIA 5D32A 4QU1A 1GOIA 5FPUA 3TK7A 1Q6FA 3WJXA 3POJA 2ZXBA 5HINA 1WUEA 3KVBA 4OI2A 1OF3A 4K36A 3HTWA 2O56A 4HD5A 4NL1A 3WFLA 3VD4A 4WM7A 4XIAA 4DJED 1WZKA 4OBTA 2YCEA 3CMJA 2QQLA 5I0DA 3I2DA 2OQYA 3ZMRA 1CPNA 3NKTA 5CGMA 1V6YA 3FAXA 4URIA 4U28A 2R043 3WG4A 3V7PA 3PBMA 3P2VA 1MEC3 4HSOA 3GSMA 4EE9A 3WMBA 4ES4A 3ZFFC 1SBEA 1XH2A 3ZYRA 1KC7A 1GVEA 3HPFA 4QQ2A 1AH0A 3SY8A 5ENLA 3LGDA 2GH2A 1KM5A 3MKKA 3EWZA 5F1RA 4K3UA 2Z1SA 4ZSTA 2MNGA 2DF7A 4HSJA 4QPGB 1BGGA 1MDRA 3KM8A 4QE5A 3FEQA 1FP8A 3HG4A 3M44A 2X40A 2ADDA 3COTA 3BAXA 1NCRB 4LXLA 3RMXA 2OELA 3UETA 2R0FA 1FKWA 3DGBA 5FJIA 1UD6A 3RRAA 1IKPA 3GK0A 1RBAA 2C0ZA 4WIWA 1DG6A 2X0YA 5A32A 1D7PM 4Y1YA 3U7BA 4B5UA 3I59B 3SQMA 3AFKA 3VHNA 5DBUA 2Z1VA 4FXRA 1GQPA 1PK6C 1ZJIA 1UW9A 1TCMA 2CWXA 1C8NA 1WCGA 4B3KA 1AVBA 1QPRA 4O17A 4B7KA 1ZU8A 3VC5A 1NCRA 3APYA 2QQWA 2ZQ0A 2V30A 2LRPA 3LLFA 4IFRA 2V38A 3H7YA 1NZIA 1FWTA 2A79A 3Q58A 3ZSMA 4BU2A 1BQGA 3ORWA 2YU2A 4L1XA 3TVAA 1RV8A 4ERAA 3R94A 4OT7A 3DYOA 4HVOA 1UBPC 4OVXA 2WCAA 1DXFA 2HSAA 3AS1A 5A6MA 1BK0A 2IS7A 3JU2A 1S38A 1JOJA 3M3IA 1SJAA 2Q6ZA 2PWDA 2ZEZA 3OYZA 1HKVA 4ZQMA 2ZX8A 4RCXA 2HVNA 4RE3A 4DQAA 2J1SA 4IIFA 5G4WA 2ISDA 3E5PA 2CWMA 4AHOA 1QWGA 3WBWA 3HIJA 4CN6A 5FF2A 1HXS3 4YVWA 2D0GA 1VBRA 1SFPA 1QY4A 3V1PA 5FBJA 4A8LA 3E0IA 1AQMA 4X60A 3TJXA 2J9YA 4UQBA 3W4RA 4PMNA 2W62A 4KGJA 4OZOA 5EGRA 2B9UA 1E3ZA 3O6DA 5CBLA 4TTGA 5FPAA 2YZRA 3CS2A 5CC3A 3ZXAC 1EO7A 3J8F2 1I9RA 2FPVA 2J74A 1EB3A 1RY0A 1E5IA 1JDFA 3C2EA 1R092 1P7TA 4HA4A 5D9OA 4YZ5A 3BN6A 1XICA 5IVJA 3L4TA 4FHAA 4J7RA 4CXXA 2YR1A 5D8AA 3LBCA 5FOOA 3H2NA 3PUAA 1VBGA 5T5LA 1UC5A 3GQYA 3KHJA 4G7EB 2PDGA 5A7WA 4OWGA 1VRH1 3M7AA 3K3OA 1OURA 4IOTA 4O10A 2FZMA 2VELA 1S2EA 2QULA 3WQDA 4UTFA 2IKHA 1XYMA 1T96A 3PUDA 2JIEA 1PO22 3E74A 4GJZA 2XFFA 1EOKA 4YCOA 1IR2A 2QEZA 2OVLA 3M7WA 4AD5A 1F9CA 1YADA 3LA4A 2Z79A 4D6DA 1ALYA 2ZX0A 1TIWA 3R1ZA 1B2YA 1G0CA 1XI3A 3MUAA 1K5JA 4EN0A 1M7JA 1XGZA 1BFNA 5D2TA 2ATSA 3GBEA 4LR4A 3C0SA 3NW4A 2QJHA 1MS3A 3VUSA 3W7KA 4CDQC 1K3UA 3BOWA 1ZREA 1CAXA 4COZA 5KXDA 2WB5A 1TFVA 2IKGA 4I2OA 3GFXA 2W1WA 1TPUA 3PFMA 1W1IE 1HKIA 4TTUA 4UFMA 1ITUA 5D02A 1H8TC 4CU8A 3UXAA 4QEHA 4PMQA 2YCLA 4Y4RA 3LTSA 4QJ5B 2D23A 3MDWA 3KGZA 4XK2A 2IKJA 4I5UA 4LTAA 2RS13 3OLGA 2Z5WA 1YEYA 2Y0FA 3TCSA 2J22A 1TA3B 1OK4A 1FYUA 1FOD1 5HJLA 3N36A 4C7FA 2E33A 4K40A 4H55A 4HN8A 5LYRA 3WIJA 1EUUA 1US2A 3BXWA 1O5XA 2O9TA 1C28A 2HWB3 5F5CA 2W1QA 3C2RA 3TE9A 2W0XA 1FH9A 1JXNA 1W3KA 4J3UA 3UVAA 1GBGA 3FWEA 4AR2A 1DJYA 1OFBA 1OKOA 1NXMA 3LGRA 4G4FA 4EAMA 3RJYA 4D6FA 3SY5A 1V5XA 1YBQA 2XL9A 4YGCA 1QHDA 1ADOA 1W8GA 3TN93 1BEV1 2GN7A 4XIOA 2FZ1A 1L8PA 1AR92 1DQUA 1I1XA 5C70A 1V03A 3CUHA 2AAMA 4C65A 5JWPA 2Q1ZB 1OCNA 1SFTA 1VYRA 3SCWA 4E0CA 4YW1A 4LGXA 1OA4A 4XO6A 4ASTA 2VX4A 1X6LA 1S0FA 1DXEA 3W00A 2PLJA 4AXNA 1R093 3GZEA 1JUIA 4JTTA 3UNTA 2PLV1 5G2IA 3IIAA 1RK6A 2OQHA 1V6UA 1IEQA 4E3VA 1HVQA 4AFBA 1P48A 5C7GA 4U31A 3W27A 5HANA 3UJRA 3SRHA 2HQAA 1V6WA 1GOGA 3AUJA 1JW6A 2BJSA 2OLAA 2V67A 1FNZA 3QV9A 2ACQA 3FOKA 5FEWA 1ZBA3 3OJGA 4YFWA 3KUMA 3L2IA 3E2QA 2CAVA 2WNOA 2H8XA 5H8UA 3HO8A 3W0KA 4H9VA 2K9ZA 1OC7A 2Y89A 1VHNA 4HK5A 2RR13 4PEKA 2Y34A 1YO8A 1RVF3 3FFQA 3IIPA 2BHZA 2W91A 1Z78A 3BAKA 4XD3A 3FYYA 4DAIA 4MOAA 2E68A 3O6YX 1VQTA 2E9LA 4GUHA 1W9WA 1EH9A 3ZXFA 1ELSA 2VYOA 4AWDA 4N7IA 4LKDA 3I2GA 1BVVA 2D3PA 4TV5A 3LNPA 3NQEA 4S2BA 3KS7A 3WEZA 4EP8C 2NV1A 2BGPA 1A47A 1JH5A 4LJHA 2VOMA 3PULA 1VBE1 3D82A 3TYCA 1GVRA 1V6OA 4M00A 4QDRA 3K4DA 1FPN1 2QFEA 2DJXA 4L80A 2R061 2XIOA 1XYLA 4L64A 1J9YA 4OBSA 2QCDA 1XU2A 1ME8A 1UR4A 2DCZA 3NNJA 4XVDA 4CEWA 5FF3A 2VNCA 1KFXL 5EXOA 1CX4A 3V3WA 3ZN6B 3WLOA