4UFIA

Mouse galactocerebrosidase complexed with aza-galacto-fagomine agf
Total Genus 211
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
211
sequence length
644
structure length
641
Chain Sequence
GAYVLDDSDGLGREFDGIGAVSGGGATSRLLVNYPEPYRSEILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYELDENYFRGYEWWLMKEAKKRNPDIILMGLPWSFPGWLGKGFSWPYVNLQLTAYYVVRWILGAKHYHDLDIDYIGIWNERPFDANYIKELRKMLDYQGLQRVRIIASDNLWEPISSSLLLDQELWKVVDVIGAHYPGTYTVWNAKMSGKKLWSSEDFSTINSNVGAGCWSRILNQNYINGNMTSTIAWNLVASYYEELPYGRSGLMTAQEPWSGHYVVASPIWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVALTDGLGNLTIIIETMSHQHSMCIRPYLPYYNVSHQLATFTLKGSLREIQELQVWYTKLGQRLHFKQLDTLWLLDGSGSFTLELEEDEIFTLTTLTTGRKGSYPPPPSSKPFPTNYKDDFNVEYPLFSEAPNFADQTGVFEYYMNNEDREHRFTLRQVLNQRPITWAADASSTISVIGDHHWTNMTVQCDVYIETPRSGGVFIAGRVNKGGILIRSATGVFFWIFANGSYRVTADLGGWITYASGHADVTAKRWYTLTLGIKGYFAFGMLNGTILWKNVRVKYPGHGWAAIGTHTFEFAQFDNFRVEAAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Azasugar Inhibitors as Pharmacological Chaperones for Krabbe Disease.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords GALACTOCEREBROSIDASE
total genus 211
structure length 641
sequence length 644
ec nomenclature ec 3.2.1.46: Galactosylceramidase.
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02057 Glyco_hydro_59 Glycosyl hydrolase family 59
A PF17387 Glyco_hydro_59M Glycosyl hydrolase family 59 central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 4ufiA03
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4ufiA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4ufiA01
1JNDA 4DEFA 2OLHA 1BLIA 2VZUA 3WEOA 2J9YA 4NNCA 2X8RA 2AGKA 1WCGA 2B4GA 4LVDA 3W53A 2ZTJA 2V5LA 5AHNA 1KXHA 4ZQNA 4CVUA 3NZRA 2QV4A 3C8FA 1CW2A 5I23A 3KEHA 2V81A 4MJMA 3UD6A 4DUXA 1JYWA 2WNQA 3KFTA 4FLSA 4OJYA 5D9PA 3DFPA 4D6HA 2XM2A 1T8XA 3OZPA 1TPDA 3EWYA 1I8JA 3MANA 4Q33A 4BR1A 4PYSA 3MS8A 3ELFA 3KF5A 1B3WA 1XSJA 1FOBA 4RXGA 4D1IA 3HG3A 4M6QA 1THFD 5MHBA 4O14A 1V6YA 2NXIA 2RH9A 4UTIA 4LC8A 4K6AA 2DT0A 2J78A 2E5DA 1V02A 3CTTA 4P7RA 1QMLA 1DHPA 4WY0B 2ATMA 5CGTA 2WV8A 4W93A 5EFFA 3RM8A 3RPMA 1Q6FA 1QPRA 1W0MA 1Y9MA 3U57A 1YPFA 4CQ9A 3IIZA 1HJSA 3DHUA 3B9AA 3P82A 3HJEA 1KFBA 3SGZA 3IANA 4CUCA 3SUSA 2VEKA 1GOKA 2EO7A 3L4UA 1OG0A 4PUEA 3WIJA 1KLYA 1G4TA 4AF0A 1J0JA 2DH2A 3W4RA 4B9YA 4E8CA 4FFHA 2C8NA 1JZ6A 4JIPA 3W88A 1Y0EA 4JX6A 4O0KA 3TH6A 3WNNA 3WQWA 1K8XA 2WHMA 1GQNA 3IEBA 5D30A 2EXOA 4GPNA 5ABGA 3T08A 4AZIA 4MPKA 3STGA 4P8UA 2WC4A 3SCUA 2WMIB 5A94A 3EBVA 2OWCA 2WMGA 4GZEA 4O54A 4DF0A 2OWXA 3T78A 1E6QM 1FCUA 3NVTA 4D6IA 5A6JA 1NP2A 1DOSA 3N2MA 1LG2A 1V5XA 2W67A 2DZTA 3AXXA 3BSHA 2WSRA 5KITA 1BFNA 3EWXA 2XN1A 4ML4A 5FK7A 4KH2A 2DDXA 2X05A 3O6YX 4UFLA 3W24A 3SURA 4TOQA 1R46A 5F4SA 4DPPA 3ZO9A 3ARRA 4JFWA 1EB3A 2WKJA 2ZE0A 3PHAA 4HNTA 3GDRA 3JR2A 1OJXA 4KGLA 1SMDA 2ZUMA 4ORMA 3QYQA 3AMKA 4XWUA 4UFJA 4MAVA 4YWIA 2DSZA 1UOKA 4CVWA 5A8PA 2JEPA 1H1ZA 1HO4A 5I77A 4RK8A 3S6DA 1CNVA 1ADOA 2PURA 3W1MA 3UY8A 3L5MA 3EXTA 1ISYA 2C6QA 4Y96A 1UR1A 3S1UA 2R91A 2JE8A 4EIVA 4KRUA 3KWXA 2VFEA 1HKMA 3VUPA 3W29A 1L6YA 2E40A 2VCAA 2DT1A 4PCSA 4AW7A 4N02A 3L2IA 3WL0A 3M5ZA 2OMAA 2A3AA 1RD6A 2EPMX 2EPOA 3HJZA 2VKZG 1W2TA 3PY2A 1GVYA 2FH8A 3WH9A 1VPXA 4UNKA 3IAQA 1YTDA 5CZJA 4AH7A 4L4MA 1G0CA 2VX5A 4EVZA 5LKYA 1KBBA 1FBAA 2VZTA 1XCFA 2FDSA 1R2TA 1CLXA 5I5RA 4GO9A 2X09A 3BAIA 1XDLA 4OHQA 4HIBA 1CXHA 1JIBA 1HP4A 2DT3A 3STFA 1JQVA 3OGSA 3WK3A 1QO2A 2WCSA 3L4YA 2QCLA 3AIQA 4HMEA 3AMCA 4N0RA 4U33A 1SO6A 5I6SA 2WMJA 3W2MA 3GDKA 4CCCA 3HGSA 2PWDA 1H1NA 1G69A 3BAKA 2EPNA 3QMTA 4ALDA 4XZBA 3O6DA 4MVAA 3EWWA 3OLIA 1PE1A 2GK1B 3T2QA 3ZR4A 3S1VA 1ZAJA 1VS1A 2CERA 2UWFA 3VGHA 1OWQA 3ZOAA 3A5VA 1VFMA 2YA0A 3USBA 3NL2A 3GNNA 5AHEA 3TA6A 1WDQA 3PAJA 5FOOA 2YL5A 3ALFA 3H53A 2QMJA 3BSGA 1PL9A 5FEWA 2Y7FA 3VD5A 3F5LA 1MO0A 4LRSA 2V3DA 2FHCA 2VQTA 3K8MA 5KZ6A 2HSAA 1W9UA 3L0NA 3PVFA 3RJYA 3LXCA 3BCFA 5I79A 3LHYA 4JS3A 1QVBA 3N9SA 2ZRXA 4NXSA 4GFSA 2YA2A 3LMYA 1BSIA 1YDOA 4M7SA 1LP6A 2ZZ2A 4HTYA 4JYEA 1C8QA 1XCXA 3NPUA 4Z1BA 1W3IA 2QQUA 3QOKA 5C70A 3LXBA 2JFEX 4A2SA 2NXHA 4IX0A 1JDDA 3AS2A 4ZFMA 3ARPA 5AC6A 5FEZA 5HNNA 3MI3A 1J0IA 3CB8A 3TOPA 3NSNA 4QITA 5ABEA 1GJUA 2J74A 2W4XA 2PWGA 3HPZA 4MZ1A 3A24A 3G6LA 1R86A 3W7OA 2YW3A 1B3YA 3N9KA 2OYLA 4LOCA 2Y88A 2YJQA 1BGAA 2WAGA 3B03A 3WL1A 1JYXA 3GAYA 4AWSA 1CGYA 3EXRA 1G4SA 5LNSA 4WJEA 2FDMA 4H8HA 4N9DA 2GDVA 2CYGA 3WQVA 3W23A 5AYBA 1UD3A 3PWAA 2A3BA 3W38A 3G8RA 3PN8A 4YCOA 1WV2A 3MUXA 4IXHA 1HFBA 4FEZA 4TX6A 3EDEA 2ZWZA 5G2IA 3W1RA 1JD7A 3WD4A 3G6MA 5F1UA 3A6OA 3VD9A 2YLLA 3S42A 3TONA 3WDIA 3VFLA 5IHSA 3SFKA 4FIQA 1A5BA 3W27A 3AHXA 2J9XA 1W32A 1AG1O 4AY1A 2VFHA 4JTEA 1FXPA 4MYAA 2QCDA 1DKWA 4ZL1A 1QI0A 1YPIA 1V3MA 2PF0A 3A3HA 1HJWA 3ARWA 3BAWA 3T2OA 5FEXA 2V5BA 3RLUA 1IXQA 3WSUA 3WF2A 5KEZA 2BVTA 2RGLA 4Z08A 4UXDA 4JXCA 2ZX9A 1XUUA 4JNMA 1PBGA 1PEZA 2VQUA 4HA3A 4B1MA 2E77A 4EWND 4OUEA 1XYFA 3SC7X 1K7EA 4CCEA 2NT1A 4K68A 1LL4A 4MAZA 2X0HA 3UR8A 3BMVA 1Q6RA 1TPEA 2UV8G 3L67A 2J88A 2YOCA 1DWAM 5EY5A 1D9EA 3AROA 4Y90A 2XTKA 1BTMA 3KRUA 1UUMA 4AYSA 1UH3A 3ZIZA 1F5ZA 4WLCA 3UWQA 3NSMA 1FDZA 4NU7A 3GH5A 4CU7A 4BZYA 1E56A 2JIEA 5TD4A 4TR9A 1JI2A 2WANA 3LCHA 3QHNA 3UZJA 5L9FA 1VEOA 1PCWA 4JTKA 4NZFA 4GXPA 5C55A 3VDAA 1H61A 1BG9A 3LOTA 2Y6ZA 3W70A 4OZOA 1TMQA 1R7AA 2CKSA 4JCLA 1GYLA 2J9ZA 4TTGA 2OCZA 1EA9C 3KZSA 2RDWA 1LJYA 1P0NA 4L4OA 4JTFA 1E3ZA 4W7VA 2GK1A 4J3TA 4BI5A 2WZIA 2VL4A 1GVOA 4ZQPA 4B3KA 1EXPA 3LEMA 3IVSA 1WBHA 3R89A 1NM9A 3H54A 4GUGA 2BXZA 3BLPX 1FFQA 1J0ZA 2G5WA 5AYZA 3WK1A 1NWRA 4UR9A 3WDRA 1W54A 1VENA 1Q6DA 1TA3A 2JKAA 1MW1A 3NDYA 4QIUA 1VRXA 1VIWA 4AC1X 2OT1A 3E96A 3LERA 3ZT6A 5HWNA 2OX1A 3S5YA 5GNXA 4JICA 1V6WA 2J24A 3WH6A 2RFGA 2W5FA 5HMSA 4PMVA 1C91A 1BYDA 1ZL1A 1H50A 4FK9A 3AISA 2VVSA 2ZXAA 5A95A 1PX8A 2PI6A 1UD6A 2CFFA 2E3ZA 1S3HA 1LBFA 5CPMA 1V3KA 4U2YA 4GUIA 3P5YA 3W6MA 1E4MM 3O15A 1VAHA 1T0OA 2HMCA 3Q2DA 2YA1A 3VMOA 3ZT5A 2F61A 3QHMA 3CHCA 1KV5A 3IVTA 2ZTKA 3BW3A 1OK6A 1E0WA 1UWTA 3LBCA 5CXPA 5D8ZA 4AZHA 3TTYA 5BYWA 3F03K 2FFCA 3FYOA 5K9CA 1TPVA 5ABTA 2A3HA 3FA5A 3EDFA 1W5MA 4X0NA 3CIXA 5FF2A 2ZRUA 3STCA 5HINA 3BO9A 2FIQA 1PV8A 3FEMA 5D37A 1WKYA 4WD0A 4A4AA 3AJXA 3B0UX 1CXLA 4UQDA 2DSVA 1C3FA 3SECA 2Y7GA 2ZBTA 1Q6QA 1JNEA 1XCWA 2VOTA 3HMCA 1C92A 1DWFM 1QPQA 4UR8A 1E72M 2WWCA 3BAXA 2WCGA 2ZXBA 1E1FA 3LCWA 3P80A 1UKQA 2H3BA 4H2CA 2WBKA 4FXSA 4MKNA 4OWGA 2E09A 3U7VA 2DSWA 3TJLA 4B9ZA 2CZFA 3BK0A 1CWYA 1GOOA 4TIMA 1VJSA 1E6XM 2PWFA 3WD3A 4JQTA 5C6MA 5LHFA 4BWLA 1H60A 3ARQA 3MMUA 3TAKA 3MHFA 3SCVA 2WKLA 1Y9GA 1B3VA 4Z2GA 1D3HA 1EHAA 2ISWA 1VFOA 2B0MA 3CUJA 3MO7A 4ZENA 1V3IA 3LCGA 4GE8A 4DF1A 5A2CA 4H41A 3DYPA 3L4XA 4JTJA 3HPSA 2Y62A 1DL3A 3PZIA 2C18A 2EKCA 2WWDA 5FMCA 4GQRA 4FX6M 3B8DA 1JGIA 1JI1A 2QCNA 2Y7DA 2ZA2A 1IGSA 1QPOA 4A3HA 2XJ7A 3MP4A 5FK8A 3PZUA 4PMYA 3W2JA 2JKPA 2FJKA 3RK8A 3SCSA 3PG8A 2EF9A 5LA0A 4LY8A 2V2DA 3ZWTA 2ZCGA 5E6ZA 1L2UA 3ZJ6A 3CWOX 3WDQA 3OVPA 1BWKA 4PA8A 5K9XA 4XKYA 1U2YA 2G3MA 3BXWA 5DF0A 3LLFA 4ZXLA 1ZBVA 3GXTA 4QHZA 2XVGA 1SZGA 2ZZ6A 3K4AA 2NV2A 3ZFHA 4JDBA 4XTDA 2WHJA 3T0DA 3GTNA 3R5EA 2ZX7A 1XFBA 1TRIA 1V3JA 2BXYA 4K37A 2VEPA 1V0LA 2VT0A 4QCEA 3PUOA 3M44A 5H91A 1H49A 3P74A 1W5PA 4ZZ9A 1LLZA 3BG5A 1LRNA 1FWWA 4DWSA 2WVSA 4AIUA 3W0KA 5JIWA 1GOWA 3E12A 3MP5A 3LPFA 3MUIA 3M5VA 4PMNA 3FJLA 5SWUA 1NH6A 2OYMA 4PMXA 1TPUA 2JIWA 2XHYA 2RGMA 4AD1A 1OCQA 4J3SA 3DYMA 3WMCA 1ZJIA 2W61A 3CPUA 1K3UA 7TIMA 4LVFA 1GEQA 3PR2A 1KBKA 3HQ1A 2QCMA 3VIMA 3MUAA 1DBTA 1Q6GA 4QP0A 3WQ4A 2I1OA 2NX3A 3W85A 3POHA 4JEQA 5HWMA 2VNCA 1FH7A 4FB7A 3FAWA 4TMBA 4IJBA 1KGUA 3ABQA 2A3CA 1OM0A 4EKJA 1LTDA 4H7VA 3MV01 1JRBA 4FXRA 1SZNA 4GI9A 4OBTA 4Y9AA 2DZXA 1JVNA 3WJYA 2Z2UA 2ZXDA 2V9DA 1WYIA 3L4TA 4UIOA 1VR6A 1UWRA 2YDAA 1M01A 2E9LA 2JF6A 1EIBA 2I9EA 2OYKA 4CCDA 2P10A 1YXDA 4Z1DA 3RM4A 1OFRA 1GJWA 2RKXA 4KFNA 4Q4KA 5D9OA 1YLVA 3ZJ8A 2AC1A 1W1YA 5K9DA 4ZMGA 5BXRA 1FY6A 1NSJA 2ZZ7A 3PULA 1JXKA 1TZ7A 1LG1A 5TBOA 5BMWA 4GJ1A 1V03A 1GTEA 4DELA 4NX5A 4HSOA 3EXSA 2ZX6A 3AOFA 3W7EA 4LRTA 1Z42A 3M6DA 1RR2A 3DHFA 3W2NA 4C7FA 3MUZ1 1GQJA 3C2OA 5DBTA 1XXXA 5A6KA 4WUIA 4OKDA 1FWRA 2CLEA 5AYYA 2DSUA 4U31A 1VF8A 1UWUA 4TMCA 3U14A 1I75A 3WY1A 1H3GA 4K8EA 3VDBA 1H4PA 1PX4A 5AC5A 5D2XA 3UETA 3SUUA 3UGGA 3V75A 2CLFA 3OIXA 1H7RA 5L6UA 1UWQA 1JFXA 3ARUA 3U5YA 1DORA 5D2TA 2Z1KA 2XVLA 3VIKA 5AHIA 4IMCA 2FQIA 5FF3A 3S8HA 1ALDA 2Y8KA 3W1PA 1BQCA 1HX0A 3D5HA 1DWGM 1K9DA 1ISVA 2Y63A 1XHGA 1IIHA 4IXXA 3R8RA 2Y8VA 1OYAA 4QLJA 4W8BA 1TCDA 5AHMA 1Z48A 1SFSA 3DFQA 2WHLA 3CHDA 4FNUA 1GONA 2CNCA 4F66A 3LF7A 3LB0A 2PC8A 2YDRA 1G67A 1Q6EA 2WSQA 2JGYA 4NI3A 3W75A 4K8HA 1AMYA 2QPSA 1X7FA 3TP4A 4JL1A 3GB6A 3OA5A 2XWEA 5F4WA 3QRHA 2BHYA 2W91A 4LYRA 3VIJA 3O1NA 5I3IA 4BWLC 2QKFA 3MJYA 2E9BA 3G1YA 1I2NA 2ZUUA 5ANNA 3RLVA 2XVKA 4MLJA 4OIFA 3M07A 1LCOA 3KVKA 2UY5A 1PZ3A 2E8ZA 2YDQA 4Z2LA 3WK0A 1F4HA 3GAKA 4C1LA 4QNEA 1EUAA 1S5VA 2YPIA 1LBMA 1O6IA 3D3AA 1RQHA 2QJHA 5DLCA 1W9PA 1P5BA 4D72A 3WK2A 1A53A 4I7VA 1IXOA 5DXXA 4O13A 2GVLA 3BGGA 4F8XA 4H6KA 1JG9A 3CTLA 4UMBA 2YSWA 1KM5A 4E38A 1PHWA 3FHQA 5G1TA 5J5DA 4PMUA 1N8FA 3I65A 4PMDA 2E9MA 4D6JA 1LRQA 4M7TA 1J9YA 1WDRA 3HO8A 3WFZA 4EAMA 3P8JA 3PB0A 2CCRA 3WF4A 4TU1A 3WDHA 1QR7A 3W07A 3NZ1A 3EDKA 6ALDA 1GHSA 1TYGA 4IPJA 3HBLA 1ZNNA 2OXBA 2WKGA 4DUVA 2J6XA 1TREA 5GNYA 3O8AA 1JYVA 3VGGA 3DI0A 4ZE4A 3A4XA 1T99A 5A6BD 1XV8A 3A47A 1XD0A 2EEXA 3WNPA 3TE9A 2NUWA 1GZJA 1E6RA 2CLLA 1QO5A 3MMWA 5D9MA 1J2WA 1EP2A 4JY8A 4AD2A 1ST8A 3IGXA 3C2FA 2HTMA 1AVAA 2X16A 2GQ9A 2H3DA 3HBKA 4ML9A 2WVTA 4CGTA 1R8LA 2BXVA 4UTHA 3TXVA 1DWJM 1B1YA 1KR0A 1ONRA 2G41A 1JZ4A 4UQ9A 1JYNA 2Y61A 5D04C 4UTFA 1ZB5A 1QNSA 4X3ZA 5A2AA 3WJXA 1GOIA 2CBUA 4J27A 3ARTA 3RWKX 2BTMA 3SY5A 4RJEA 3PIGA 2O7QA 3AYSA 1CXKA 3WNKA 1QW9A 3ARYA 4GIAA 2O9RA 1QOXA 1CTNA 1RP8A 5A8GA 5T26A 3GXFA 5D02A 1KTNA 1O60A 2D3LA 1OIMA 4WF7A 4AD5A 3SCRA 1W2PA 2AAMA 1B4EA 3L0GA 3F1QA 1DJNA 1J4EA 2F7FA 3T55A 5FMBA 3LTSA 2NZLA 4HNVA 1W9BM 2P0OA 3CMGA 4NZJA 5DELA 4P7NA 1MEHA 1ME7A 3V1PA 1ZFJA 3QR3A 3DU0A 2H8XA 1KXTA 5ABHA 2I14A 3LHWA 1KFWA 5G4WA 4O53A 3TCEA 1Q6LA 2A3EA 4OOZA 3ARZA 3CZLA 3ABOA 4UFHA 4AZGA 3UG5A 3EMCA 3TX9A 3N19B 4AWTA 3QSRA 1IF2A 2DJXA 4D1JA 4MFEA 4UFKA 1C8VA 1HXJA 2W0UA 2ZX5A 3LXAA 3PBGA 3W9ZA 3FHAA 5F2GA 3LCIA 3PM6A 1SYTA 2W92A 3GXDA 1WDSA 1MWOA 3W81A 2TRSA 4NVTA 1JCJA 2WO5A 2O92A 1H51A 3T2PA 4U3AA 3UR7A 3PTQA 3G1VA 4AHQA 3FKKA 1J18A 1FP8A 3MHGA 3S1WA 1WAUA 1C7SA 1LDCA 2OSWA 3ALGA 1W3NA 2A85A 3L5AA 4IMGA 4Z1AA 2CESA 3WUFA 3FXYA 5D32A 1D7FA 4UCGA 1HP5A 3CH9A 4M24A 4Z2JA 5A6SA 1F76A 1EUNA 1UKSA 2VI0A 2E6AA 3G18A 4FNRA 1X1NA 2W63A 2C7FA 3UG3A 4F79A 3M46A 5LSMA 1XH1A 2WBGA 3F4WA 1VJIA 4IM4A 2GVYA 3RDKA 5AOUA 1SZEA 2J79A 4J28A 4ATLA 4A29A 1VLWA 2YW4A 3G1SA 3NDOA 5JUVA 5TQLA 2EJ1A 3DBPA 1UR2A 2ESCA 5AC4A 4BS0A 4O57A 4U2ZA 2C16A 3CHVA 4MNJA 4NX0A 1O7AA 1R47A 3E0IA 1OX4A 3BGJA 1TUXA 1TTIA 1W1PA 4EANA 4AXKA 1YDNA 3PC0A 1W31A 4AEEA 3FJ6A 5AHFA 4MB1A 1EO5A 3LTPA 2F8QA 4O50A 5BOOA 2XN2A 1M53A 4RKAA 4K39A 3WH7A 2J77A 4XZ9A 1Y7VA 2XGBA 4MYXA 1CXEA 5DO8A 3H3LA 1US3A 3OLGA 4PMQA 3LCFA 1AQMA 1SFLA 1AW1A 2ZZ1A 1HKJA 2BHZA 4QISA 1H5VA 5EFDA 5FF0A 4D6EA 5BXTA 2DZVA 1GHRA 1Q45A 1XI3A 4EE9A 1OIFA 4UOQA 4O11A 3DECA 4MLRA 1BF2A 1OFDA 3LI0A 3BH4A 3W7PA 2WK2A 2WVUA 6A3HA 4WJXA 3A23A 4XBKA 3TSDA 4LQ1A 1OYCA 2E5CA 3FAXA 2UY2A 3W1QA 4FMVA 1NF0A 4R5EA 4LTSA 2PWHA 2X1IA 3L2MA 1TTPA 1BHGA 2Z6IA 4V2XA 1JCLA 1KTCA 1OVDA 1QFEA 1MQRA 2GJPA 3WDJA 1W9DM 3FFSA 4UQEA 1NARA 3OG2A 3HG4A 3AIWA 3B9EA 3VIOA 1FCVA 3OGRA 3MHUA 1D2KA 1GPFA 3O63A 1F2JA 1PJ9A 5BROA 3N18A 2ZYFA 5CG0A 3W37A 3DXIA 2V30A 3OHIA 1C90A 1OT2A 3WF1A 1EX5A 5CPNA 1M7OA 3W1NA 3NIYA 4R34A 3TUUA 2QQVA 5GVJA 1EP1A 2Y89A 4DPQA 1FCQA 1M7XA 1GOMA 3S5NA 4DQWA 1C29A 1UR9A 3WNLA 3KHJA 5KINA 2FGLA 3OVQA 3CQ0A 1DTUA 3AIEA 4WK9A 4O1AA 4KMQA 5GPRA 5A8MA 3WD0A 4HKPA 3MSDA 5FI8A 4J3WA 1JR1A 1K02A 2EPKX 4RZ6A 3WN6A 3MMTA 5HPCA 4XKYB 2XG9A 4UTLA 2X1SA 3TA9A 5KTLA 3QOMA 3NNTA 4J7RA 1V3HA 3TR2A 3GX9A 3C4UA 3OZOA 5FD0A 2IQTA 5F1VA 3UWVA 3AS3A 4HZ6A 3WJZA 5D9NA 4MZYA 1XH0A 4R7JA 5LZLA 1CGUA 1ZS2A 1JDCA 3U75A 3THDA 4CD7A 2XFYA 1V7YA 2QCGA 4L4LA 2VCBA 4JKMA 3PBWA 1ZJAA 1NVMA 1BAGA 1EGZA 3LRLA 1ISZA 2WPGA 4HP5A 1YDVA 2UY4A 1JZ8A 1OABA 4HA4A 4OGZA 5LNVA 2TSYA 4K7VA 3RMJA 1V0MA 4WKFA 1UH2A 1R85A 3S2CA 2Z6JA 1CGTA 2A1YA 3KOFA 4OU1A 4QQ3A 4M5PA 4Z2IA 1LOQA 1UH4A 3FW6A 1QHOA 1V0NA 4NXKA 4CNPA 3VNYA 2WSKA 2ATSA 1NWTA 4KRTA 4P7OA 3FOKA 3THQA 5DN1A 3WUBA 1I1WA 1MW2A 4HHPA 3IMMA 2E6FA 2A7RA 4RV8A 3DFTA 3OEXA 3RMEA 3KVLA 1KQYA 2Q3RA 1LLWA 4XBSA 2BV9A 1PPIA 1N7KA 3TSBA 4GUHA 1JXJA 3CZEA 2VFFA 1I1XA 1GOXA 4FFGA 1K7FA 1TV7A 1IIGA 2EGZA 4FX8A 5ECUA 1KBJA 2J8FA 2YL6A 4W8AA 3PZOA 1UKPA 1V02E 1ZAIA 4PEKA 3DYOA 1VLIA 2WMKA 4N6FA 4WY0F 4ATWA 4PMZA 3TFCA 3TQVA 4AISA 1VGAA 2RHGA 3GR8A 4GUJA 1VYSX 2WSPA 2QEZA 3NL6A 2DEPA 3QHOA 3F5KA 1NWUA 4ZEPA 3LV6A 3RFAA 4B15A 3N13A 1PIGA 2XFRA 3W7HA 3W3OA 3ZM8A 1AL8A 3QFEA 3KAOA 4JTSA 3GNPA 3IJ7A 4B16A 5FIPA 3KRZA 1UA7A 4FNQA 1EO7A 4W88A 1R2RA 1VYRA 3JS3A 1LOLA 2G95A 3HB9A 1JD9A 5FMDA 2BY0A 4Q22A 1UR0A 4F9JA 4JCMA 4LX4A 3L4WA 1H2JA 1JL8A 3UWUA 1WOBA 3MUY1 4AEFA 1MW0A 3PZTA 1VEPA 3BMWA 3B06A 4NQ1A 1H1YA 1PIIA 5DT7A 2DORA 1GCYA 3THCA 1NOUA 3PF3A 3W83A 1OF6A 1B31A 4M81A 2ZA1A 1SR9A 3EKLA 3QEZA 2A6LA 1AQ0A 2RDTA 2J7GA 2Y5EA 4YXGA 2F2HA 4NRRA 5M17A 1UBSA 4P7LA 1PHQA 1E5NA 3WFLA 1GG0A 3G1FA 4RE3A 1VC4A 3BW4A 4PTWA 3NQAA 1OF8A 2BSLA 3LDKA 3T7VA 5CPSA 4HSNA 1W1TA 2C13A 3MU7A 5E70A 4ADTA 1W56A 3GXPA 1OFOA 1SW3A 2XIIA 3CZGA 3L5LA 1GPWA 1NWSA 3VVGA 3EYPA 3GBEA 1E5JA 1OINA 1G94A 3AICA 3VIFA 2DPEA 1X8FA 2Z1SA 4CLMA 4JAWA 4JKKA 1JRCA 8CGTA 4GO8A 1G9HA 3NQ2A 3S6TA 1W3TA 4CN1A 1GORA 3AZSA 1KFEA 5TIMA 4BF7A 1YXCA 4HOWA 2BLEA 1UASA 1W37A 4ATDA 4AZ7A 2G3NA 1F74A 4TVCA 1E4LA 1BVZA 1VJZA 3LDRA 3LHVA 3VGDA 3TK7A 3W72A 1A5AA 4CD8A 3WENA 3AHVA 4NUWA 3IGSA 3S5OA 1A3HA 3C2VA 4TO8A 4FO4A 5J5RA 1NEYA 1OYBA 1FHLA 3AMLA 3A21A 3QPZA 1EEPA 3M9YA 3ZSSA 2BWGA 3M16A 4JN6A 3BARA 4MIMA 1KXVA 3RIKA 4BA0A 4FIRA 3S5QA 1BTCA 1HT6A 3W7KA 1QNRA 5F2IA 1F05A 3AIBA 5EB8A 5AN7A 3VO0A 4AXNA 1W9XA 3OSDA 4ACZA 4MY1A 4GZIA 1E6PA 4WKHA 1FQ0A 1FWNA 3BLEA 2GQ8A 3Q94A 1I2PA 1FA2A 1GQKA 3NQ7A 4U5KA 2A21A 4C1KA 1V6XA 3PTMA 4W85A 4O19A 5KSWA 7A3HA 5DFAA 1E6SM 4LXFA 2EQDA 5AC8A 2ZDRA 3HMJG 3AHTA 1OGBA 1H62A 1H7NA 1J11A 1HKIA 1OT1A 2JKEA 4JR5A 2ADEA 2XFFA 1JZ2A 1JZ3A 1WP6A 3NR0A 2C0HA 2X2YA 5BRQA 3NQGA 2GJRA 3SIMA 4E2BA 4FLRA 1IZKA 2G3JA 4LVBA 5HQEA 3GM8A 2J7EA 3OGVA 3SUWA 5M3WA 3MW7A 1HJXA 1DEDA 2V3GA 4PN2A 1C8XA 1I2QA 2CBVA 1XRVA 3G22A 5A2BA 3WJWA 2CLMA 4HA1A 1J0HA 1QBAA 1KBIA 3VIGA 1TRDA 4UNIA 4XUYA 4Z2HA 4JTUA 1B9ZA 1A50A 1G6CA 4WX2A 5AYIA 4D6FA 4UUIA 5E1QA 3C61A 4Y7EA 1C7TA 3NSXA 3AI0A 2WCAA 4LC6A 2DZPA 4EF8A 1B30A 4RXFA 3PZGA 1TCMA 5CPTA 4WOZA 1KA9F 3DAQA 3AHZA 4IUGA 1GVSA 2CLKA 3EDJA 1QAPA 3ZR5A 4LVAA 1J10A 1WX0A 3WQ8A 2WC7A 4BQ4A 3SCQA 4M29A 2HS8A 2BX7A 5FCZA 4BFAA 2C3ZA 5E0KA 3T44A 4NRSA 3FYPA 2ISVA 1PZ2A 4AD0A 3LRMA 4JFUA 1FDYA 4UOJA 1UJPA 1QPNA 2WNWA 1ZAHA 1BWLA 1O5KA 4XTIA 1PS9A 1NAL1 1IXNA 4DM2A 3DFSA 1CDGA 3BPWA 5JBDA 4DM1A 4V27A 1BG4A 1JZ5A 1W2VA 3HF3A 1B4KA 5U7SA 3WF0A 2CHNA 2CLOA 5JBFA 3PUDA 2GSJA 5D33A 3SCOA 3GNRA 5E09A 2VFDA 1LRTA 1MYRA 1XC6A 2YL8A 3TTQA 1Z32X 4YLWA 8TIMA 3ZQ9A 4M6PA 1IT0A 1SW7A 2ZZ4A 1RD5A 5I3GA 1WQ5A 2J25A 3A22A 2JF7A 5G2HA 4ZQMA 3E9AA 3TNOA 1DVJA 4Q7NA 2OSXA 3N15A 3VDHA 2YGYA 4NNBA 1CGVA 1ISXA 2NWRA 2R14A 1O94A 3NQVA 3GZ3A 1U83A 4L4PA 5M03A 4AD4A 2BY3A 1EDQA 2AOSA 3IIPA 5LHEA 4UTJA 1UUOA 3P84A 1TE1A 1VB9A 2Y7EA 1QDSA 5DBUA 2VURA 1XDMA 4LUIA 3AJ7A 2P1FA 1JF5A 2NXGA 4E2DA 1W1ZA 1D3CA 1H7WA 2WQPA 2X2GA 3M5YA 4WQ6A 4Y6GA 1GJPA 3TFXA 3LHUA 1QBBA 2YLAA 3EX2A 3M0ZA 2BHUA 1H7OA 4JY9A 3AMGA 4CD5A 1KWKA 1WXJA 2YZRA 3P8IA 1W3HA 1W3KA 4HMDA 3KRSA 4NSBA 3ANYA 2FB2A 2XFWA 4LS0A 1TJRA 3CUFA 1WBJA 2CBIA 3P61A 2X1TA 3PSVA 4FNPA 3HGOA 4K7YA 3NQFA 4MFDA 2D0GA 1FDJA 3WH5A 4JTIA 4J3XA 1H11A 1JDAA 1NOWA 3VU2A 2Q8ZA 3NA8A 2J27A 1EIXA 3TTOA 3NM1A 3VNZA 3SCNA 5LNRA 2A7PA 2XQRA 4MB4A 4O4WA 3SUVA 4EOUA 4NJHA 5D05A 1E1EA 1DWHM 3TJXA 4NJGA 2VZOA 4TTUA 4X9YA 5M5DA 3KL5A 3C6CA 2CEQA 4URIA 3CEPA 4YHGA 4E0CA 1RV8A 2AMGA 2W62A 1US2A 3CHEA 3PBUA 3GIYA 3B05A 4X0VA 4S1FA 4YMZA 3WQ5A 4E4PA 1VCVA 2VTFA 4W5UA 3N11A 1RQEA 2FPVA 1OD8A 3WNOA 3CMJA 1MXGA 1DWIM 4RZ4A 2V2CA 3N14A 3W1AA 3SUTA 1W3JA 2YL9A 4H8UA 4HZ7A 1C93A 3WMSA 3VMNA 5LNUA 2J8GA 4GRSA 4O0ZA 1SQ7A 2QDHA 3B04A 4GWEA 4UTTC 1SO4A 5AYXA 1R87A 2FHFA 3G1DA 4PTVA 5LGZA 3PZQA 2TPSA 4H3DA 3AIRA 1QHZA 4PEEA 4PCFA 4AZBA 1HVXA 4H4IA 5H2ZA 1OFPA 1C8YA 2QJGA 4CQ8A 5A8NA 4PBGA 1UYPA 2WB5A 5IBXC 4LNYA 2V0TA 1F73A 4PODA 1GVFA 1KFCA 1YYAA 3BGAA 1AK5A 4M80A 5BRPA 1OFQA 3LRKA 5A5WA 1MVYA 2YYUA 1HL9A 1MW3A 4W8LA 1H0IA 4JIEA 2VX4A 3E1F1 3HIJA 4N9EA 4RL3A 1B90A 4D6DA 2QUVA 1Q3NA 1RPKA 2Y4SA 4AHPA 5C5YA 2LLEA 3PIJA 2VRJA 3NXFA 4M8UA 4YN5A 3IK2A 4GC4A 3W71A 4MDPA 3I6RA 3Q37A 1I2OA 2X1UA 4JD4A 2ABBA 4MPQA 1EOMA 3O6CA 1CEOA 1NF7A 4M1RA 4AMCA 1S5WA 1J0YA 3TC6A 5ABFA 1GZGA 2CITA 4MJZA 9CGTA 2O9TA 3QW3A 1QOPA 2J7CA 5CQ1A 2G4FA 3SEPA 4Z0JA 5G1YA 3W76A 4AD3A 6CGTA 1LYXA 1G01A 2ZUWA 2GUYA 3IJ8A 4MB5A 3PS7A 1LZOA 1XKYA 3BW2A 4UTWC 4ORIA 2DP3A 3TC7A 3TIMA 3EX1A 3O05A 1CGWA 1KXQA 2C15A 4OOUA 3EX6A 1L9WA 3L65A 3N3MA 4GUFA 2DQXA 1F4AA 1TVPA 1GVQA 2JK2A 3NPVA 2ZRYA 4LV9A 2XUCA 2ZUTA 3QF0A 1CZ1A 3O6AA 4X9SA 2QR6A 2NT0A 3DENA 3AIUA 4D2JA 3R2GA 3VNDA 1N82A 3R13A 3FY1A 3NYDA 1S5TA 3IIVA 3MWAA 3EEGA 1M7PA 2CHOA 2FH6A 3W2LA 3SCPA 3A9IA 1LF1A 1J12A 2Y85A 2Z0IA 4R33A 5F2MA 3AO0A 1ODZA 2D20A 1R30A 2Z1BA 4N42A 4TVDA 4XUGA 4E2OA 3WH8A 5C71A 4S3JA 5DY3A 4AZZA 1EDGA 4AZCA 3PTKA 5HR7A 1I2RA 1W3LA 2AEYA 1ITCA 5CSYA 4HOZA 4MUZA 3NDZA 4DWSB 4KGJA 1UCWA 3CT7A 4JYDA 5F7UA 3DC0A 3HG2A 3LI1A 2V8ZA 3TW6A 5FL1A 1H5YA 1I4NA 3W22A 2HVMA 4S3KA 6TAAA 1LORA 2PE4A 3W86A 1X6NA 4JKLA 5JIPA 1CENA 4AHOA 1MFVA 1B3OA 5HULA 1JCMP 4HPGA 1G4PA 4LVGA 2ALDA 1KGXA 3EWBX 3VM5A 2NWSA 1KFKA 4O1DA 2WMFA 1V6UA 4BQ5A 3AHYA 3RCNA 3IIXA 3W7MA 4UQBA 1SO3A 3F5JA 3G3MA 2J47A 3LCLA 4MY9A 1XD1A 5K2ZA 3BAYA 3CHFA 2XN0A 1TTQA 4FF7A 4UR7A 3NGJA 2VCCA 4FFIA 4IQLA 2A5HA 2DZSA 1V0KA 1EQCA 1TPFA 4OV9A 1VBUA 1TV8A 4DO4A 2BY1A 4DWSC 1W5NA 2CLIA 4QNWA 5HNRA 1R2SA 2CZEA 4FX7A 3WD1A 1ZY9A 4GXMA 3CBWA 3O9NA 1XSKA 2YYTA 3UPBA 3BLKA 3I3BA 1MQPA 2VUYA 3BLFA 3OG3A 4IOTA 3I3DA 2D1ZA 1M6JA 4ZXOA 4MNKA 4TVUA 2CZ5A 3R12A 4WXYA 3HPXA 1PVNA 4UFIA 1MEWA 1KFLA 4RX0A 4QAWA 2Q3OA 1OX5A 1V3LA 2XSAA 5G5IA 4UTWA 3U5UA 1CECA 3K30A 3DZ1A 2OT0A 3NL3A 2GUUA 4N2YA 3UXAA 3QJAA 4W84A 3VKJA 2Y70A 2DGAA 3BG3A 3I3EA 3NQEA 1IZJA 1ML1A 5KZMA 4IGHA 4NF7A 4C7GA 4KWUA 2QMKA 4LWWA 2C0AA 2XSBA 3C0JA 3Q58A 3W6YA 2BZNA 5AB3A 1XC4A 2V82A 4B5NA 4O17A 3DI1A 5DEZA 8A3HA 2WMIA 3O2LA 3UZ5A 2VMFA 1WDPA 1ZBWA 5CPQA 1NQ6A 2V38A 5I3KA 3C52A 3W7DA 3PZNA 4AB4A 4S2BA 4JGDA 4N4QA 4GI8A 4LV4A 4A21A 1KV8A 4FNTA 3M1ZA 4PCTA 3P67A 1CYGA 3UERA 1JZ7A 3KX6A 2KZHA 2DJLA 2YKKA 2ZIDA 3H55A 3NQMA 4WY0A 1E55A 1HTIA 5IBXA 3F4VA 1CIUA 3S0CA 2CZDA 5IM51 1GVIA 3NPWA 1VYPX 2CWNA 1HG3A 1K03A 5C2XA 2QJIA 2YBUA 5HR6A 1DQXA 4UZUA 3GH4A 3UXDA 1OBAA 1ODUA 4RE2A 3DKLA 1RP9A 3ZR6A 1WE5A 3MMDA 1GQLA 2VJXA 2QCHA 4P61A 1S46A 5HJLA 1Q6CA 3UPWA 3AMDA 1C9DA 4BQ3A 4O8RA 3W7RA 2V5DA 3GH7A 4ZE5A 4RCXA 7CGTA 3AXIA 1ME9A 4A22A 4UTUA 5CZTA 5EMYA 1DP0A 3DFOA 5DY2A 4BCEA 1F6PA 1LQ0A 4ZVJA 3VIIA 3TV8A 4CNNA 4HXCA 4ZQRA 5C8BB 5D38A 5BRBA 3GXMA 3AIVA 3II1A 3U2OA 1KCLA 5LYRA 2WLYA 3C2EA 4GBUA 5FKYA 3M5XA 4PMOA 3T40A 3TDFA 3CO4A 4K38A 4A3YA 1YQ2A 4NT0A 4MB3A 4U4MA 2DZWA 1G4EA 1GT8A 1Q6OA 2YX0A 1Y4WA 1GWJA 1M04A 1LBLA 5A6MA 2VZVA 2ZICA 2VZSA 1J0KA 1UUQA 2IXUA 3EX3A 1O95A 3VE9A 4UTKA 5CLWA 2DSKA 3OBKA 4XQ6A 1L6WA 2VFGA 3KVMA 4MNMA 5HPOA 3NOEA 1OHLA 3BG9A 2IUZA 2GJNA 2G3IA 4UTMA 1QHPA 1UG6A 1UZ1A 3PB2A 3PZVA 3TU9A 3AFBA 4ZQCA 4AIOA 3P62A 3TSMA 3AXHA 4HPJA 3DH7A 3AZTA 4J3VA 4QLKA 3N34A 1GG1A 1E9LA 1GQIA 3W7QA 5EA9A 3L66A 4EQVA 1K8ZA 3N73A 4KKXA 5HDRA 2GVGA 1VHNA 2MANA 3GVGA 2PB1A 4TX9A 5D2WA 2QCCA 5FKCA 3GKFA 1P4CA 1LLOA 1O4UA 4MADA 4WSKA 3L0KA 5K7JA 3ZS4A 1JAKA 4PTMA 2V5CA 1QI5A 2D24A 1X6UA 2A4AA 5FEPA 1L0PA 1K9TA 2VELA 2X1RA 1FFRA 4W5ZA 4AWEA 3ZSTA 1YTKA 4D6GA 2ZRVA 5A6BA 1E51A 5D8WA 3VGEA 4PH6A 1KM0A 3BAJA 5CPOA 3W26A 2NLIA 3SIZA 3G24A 1TMHA 2CW6A 4DBDA 1J01A 1LOSA 5I0DA 1RVGA 2E0PA 1FXQA 4YL2A 3EWZA 1UR8A 4UNLA 3WD2A 2C14A 3VKKA 1E0XA 3W82A 1XM3A 1OGGA 2DT2A 3U8GA 1X1OA 2GFTA 4KWWA 4HU0A 3S9YA 3UGFA 5EPDA 3I7SA 4JZ5A 5E6YA 1B3XA 4QAIA 1B3ZA 2BVYA 2BFGA 4CU8A 5IHRA 1SUXA 3RILA 2AEZA 2OJPA 4D6CA 4FFFA 5FKBA 3G0SA 1ZU8A 1QNQA 3NMBA 1UQYA 3VIHA 3DGRA 1UWIA 2EHHA 2XVPA 3FNDA 5AY7A 2VC9A 1YADA 3WJSA 1MQQA 4BQ2A 3EKZA 4PL1A 5GQBA 1WAWA 1LM1A 4W86A 4Z0SA 1E70M 3JUGA 5LA2A 3TKFA 2Y24A 3FKRA 4UOZA 1TR1A 3L2LA 2X0YA 3LDVA 2DIEA 3EMQA 3LX9A 5K4ZA 5CG7A 1E40A 2E6YA 2XYLA 2ZUSA 1Q4NX 4HN4A 1K7XA 3K8KA 4LGXA 4W7WA 1OGSA 3T0BA 3NG3A 4JX5A 5CGQA 4DO6A 3MBDA 1VHCA 3ABRA 4MZ8A 3CZJA 4FLOA 4H04A 4YHEA 1E15A 2WHKA 1EQPA 1EDTA 1EWDA 3ARSA 4I7UA 1V6VA 1W9VA 5A6AA 4D71A 1QNOA 1WZMA 1XUZA 1XSIA 3LIGA 5CGMA 1ME8A 2G8ZA 3OIHA 1D3GA 1T96A 2B7OA 1E43A 3G1AA 1QW8A 1PIFA 4CQAA 4AEOA 4PC8A 2W79A 4LUJA 4N4PA 3UWWA 3L9CA 4O15A 3W1LA 2PBGA 4P2VA 3NQ6A 3HGRA 4HU8A 2UY3A 6TIMA 3WDPP 1EOKA 3CZ8A 4RLIA 3QMSA 3N04A 1ESWA 2QCDB 2CIPA 4P7QA 3TMLA 3EB2A 3UYCA 4OV4A 3K1DA 1BYAA 1K9EA 3LTYA 3QC3A 1CPUA 3L4VA 3SZ8A 5AC7A 1CBGA 2J7BA 5KMYA 1HN1A 4GKLA 1E73M 3QZEA 2JGQA 4N9CA 4AMAA 3UQNA 4O28A 1QPKA 3GDTA 2J7DA 1TIMA 3HG5A 4OE7A 1TG7A 2GDUA 1N55A 3GDLA 1VEMA 1HL8A 5HBFA 3CM4A 3MP3A 3NQDA 3B0VC 4QJ1A 3VD7A 1TTJA 2NW0A 3M47A 5DCEA 4Z1CA 3TQKA 2BVDA 4PMRA 4NNAA 2PC4A 1CXIA 3W1UA 1JUBA 3D0CA 2TAAA 1TA3B 3LGEA 1CLVA 3W28A 3P5ZA 2Q8LA 7TAAA 2XVNA 4HPXA 1WPCA 2WNNA 3B4UA 2B31A 2WC3A 2WVVA 3L4ZA 1AMKA 5GNZA 2D23A 3E49A 2AQWA 2GVJA 3ATZA 2FLIA 5EKYA 5E9AA 1OFAA 4LW7A 5CZ0A 5CPLA 3NPXA 3N12A 1U30A 4O1BA 4IPIA 1OX6A 3W25A 2G97A 2CLHA 3TROA 1UR4A 4DWSD 1VFUA 4UMAA 3SSJA 3GXNA 3ARXA 2QUTA 3VDCA 4MY8A 1TPC1 3PBVA 2G96A 2E8YA 5K3VA 4ADSA 5D2VA 3L68A 1H7PA 2QAPA 2ZZ5A 3U1XA 1XYZA 4GI6A 2A0NA 3NM3A 4UZSA 3B0PA 4YPJA 1HO1A 1HJUA 5CSSA 1BGGA 5KZEA 5ABFB 2H6RA 2VR4A 1IV8A 2FTPA 4JFVA 3AYRA 2NV1A 3BV4A 2WZHA 5CSUA 3VIPA 3SI9A 3A5FA 2YIHA 4GNJA 1UB3A 2BS9A 1Z41A 3EDDA 1FCBA 1ZENA 3VD3A 1JCYA 3RF9A 3PSWA 5HWJA 3VTRA 1ZCOA 3GYEA 3OLEA 2C1HA 1XH2A 1M5WA 4LYPA 4P8XA 4WKAA 2GQAA 1J5TA 1WOAA 2B7NA 3SR7A 5BMXA 3DKJA 4UC5A 2B7QA 3A4WA 1AW2A 4IPLA 1MXSA 3IIOA 1UYQA 1VZWA 1RH9A 1A47A 4J9JA 3ZWSA 1U33A 3CIVA 2O9OA 2GPTA 1EWEA 1W1VA 2PRMA 5LNWA 3CLMA 3GNDA 4PTXA 1QI2A 2QPUA 4ONVA 5F4XA 2IXVA 5BXPA 3O16A 1XL9A 3W73A 4DF2A 4CKQA 3EWUA 5DT5A 1G7VA 1UZ4A 3T09A 1BEUA 3GDMA 4M56A 1W5QA 1VCGA 3PZ9A 5FF7A 4TUFA 5A3HA 5HUPA 2EAWA 3MI6A 1H7XA 1QOQA 3P60A 3PG9A 5BNKA 4Z2KA 4LYQA 3CUIA 2FPTA 2CU0A 4OQVA 3W1XA 2O9PA 4ACZB 4X2RA 5IDIA 5LA1A 2QF7A 3NL5A 4P8VA 1SO5A 5AHLA 1KM4A 1XBYA 4ADUA 1QNPA 4RR4A 4WOQA 1EA0A 2GJLA 2J75A 3CZKA 4UQCA 3MI2A 5FIXA 4BK9A 1X6LA 3M41A 3M43A 2CXGA 2QQWA 3LFIA 1ZBCA 4OBSA 3VM7A 3S1XA 3C56A 2QLYA 4JFSA 5E93A 3GNOA 2H90A 4DO5A 5AFDA 3GYCA 2YDSA 4HZ8A 5CLTA 3RJXA 3LPOA 4JL2A 4MNLA 1EP3A 4ICNA 2VX6A 3CUHA 3LPGA 3G8EA 3LPPA 4HMCA 1JULA 4XV0A 3NAVA 3WBEA 3KF3A 3YPIA 3JRKA 1UKOA 1FUYA 2VOMA 1KM1A 3MYPA 4MTVA 4TXEA 4QCFA 3MO4A 3ZT7A 1KQZA 3GK0A 4IUOA 3W84A 3TAOA 1GYNA 3CLWA 4MDOA 4XZWA 1V08A 4IX2A 5E0FA 1B0IA 1HUVA 3VPLA 3TQ0A 2HS6A 2PBOA 4AAJA 2YBTA 2JBMA 3OB8A 1FWTA 1GTHA 4M6VA 2ZRZA 2V3EA 1P1XA 3QPYA 4RZ5A 3UY7A 3BCDA 1WA3A 5BW6A 5I2UA 2ADDA 1HJQA 2NUXA 1NFBA 2D0FA 4C7DA 1VBRA 1KM2A 1JJKA 3LM7A 2J7FA 4JYFA 5CZKA 1LROA 4KFPA 3VX0A 3WF3A 1G5AA 3VCRA 1HNYA 1H09A 5I3HA 1K6AA 4LS1A 3W7GA 2JALA 2VO5A 4O52A 1UKTA 4PSRA 4NJIA 4AF0B 5D09A 4XB3A 1IXPA 3L21A 3RM9A 2VR5A 2W6RA 5D2YA 4F9DA 3AQUA 1FH9A 4J3UA 1BKSA 1DV7A 3GZAA 3W7LA 3I7QA 1SFJA 1MFUA 3ECQA 3STEA 4CN4A 1L6SA 4CN6A 2WYSA 1A5SA 1TB3A 3FS2A 3W7NA 1CGXA 3TTSA 2Q8XA 3M7WA 1KM3A 1DHKA 1H63A 4NJJA 2VENA 4PTNA 3BC9A 3N1AA 1XBVA 3CGTA 3DFNA 3I7RA 1UD4A 1UD5A 2HISA 1QCWA 2J62A 5JBEA 1VQTA 3QMRA 1TPWA 1OD0A 2XIBA 1ZALA 3QSTA 3UESA 3W87A 2WLZA 3WUGA 4ACYA 5IXEA 1W91A 1FH8A 1ICQA 2DH3A 4EK7A 1JUKA 3SW6A 4NJKA 2DU2A 3PZMA 3UG4A 5IFTA 1MSSA 3O06A 1E4IA 1WO2A 1NP0A 1NOFA 2YFOA 4KWVA 3DHDA 4K36A 3LHZA 1QI3A 4O12A 1CXFA 3NUKA 1B9BA 2WM0A 1XBXA 3EMZA 3HN3A 2DIJA 5IFPA 1WDWA 1U5JA 4MOZA 3VI2A 3SGUA 2JEQA 3U6WA 2D2OA 5D4YA 1EPXA 2QCFA 3W2KA 1B2YA 2A6NA 4QDMA 2E68A 1KB3A 2D0HA 2XGIA 4P8WA 3WMBA 1CX9A 4G1KA 2TYSA 3IJ9A 3AZRA 1KW1A 3RU6A 1YTEA 4BF9A 4GZJA 5CKSA 1FHDA 4GQQA 1A5CA 4JX4A 2XWDA 4S2CA 4JTLA 3DHPA 5C54A 1BPLB 1JQXA 4QLLA 1HVQA 1PAMA 4JIQA 1BYCA 1JFHA 2CKRA 1TPH1 5DCDA 2WZEA 5A1AA 2O7SA 2RDUA 2VXNA 1KGWA 1WZLA 4TX8A 4A3UA 3F4NA 2E5BA 1HF6A 3IRDA 3NEVA 1GUVA 2ZZ3A 2YFNA 2Y2WA 3VE7A 3IVUA 4LT9A 1R7OA 2VRKA 4AIEA 3T0AA 4U28A 4N6EA 1ITXA 5I3DA 2ZWYA 2WW5A 4O16A 1KCKA 1GNXA 1PCKA 2V2HA 3G3DA 3P7YA 1E71M 2V3FA 5BXSA 2OZ0A 3WEMA 2NSXA 3W1TA 2PCQA 2VEIA 1MXDA 4O10A 1E6NA 1P6WA 4ZQOA 1ZJBA 3P81A 3K46A 3N9RA 2XPKA 1OFEA 2ZX8A 4MJ2A 4Q32A 1WZKA 4H8VA 3G0UA 4DXVA 5F2LA 1KM6A 4QSHA 3S5ZA 3UWYA 1KTBA 5DCBA 3LBMA 4OT7A 3W7CA 2J7HA 2VX7A 3EX4A 3WFAA 4W89A 3OBAA 3UCQA 3NQ8A 3WNMA 2EBNA 4PUDA 3ZJKA 1ICPA 4PRWA 1JCNA 1L8NA 2VFIA 3N17A 1UD8A 4HOXA 2BNJA 2B7PA 3FN9A 1TJPA 3GKAA 3CC1A 1O5XA 1QWGA 2YR1A 4Y8FA 3K8LA 4KFOA 3KE0A 3WBAA 4UTTA 4CNOA 4JFTA 1E0VA 5A6LA 5BCAA 1BVNP 3AS1A 4CD6A 5G2WA 2NUYA 2VRQA 3NCOA 1W5OA 5EL1A 1VFFA 2A2IA 4FLQA 5I78A 3VGFA 1UWSA 4LU0A 2ZQ0A 4QM1A 4LPCA 5HOSA 1OX4B 2W66A 5BWFA 1QNVA 1FX6A 3LIHA 2C19A 2WOQA 1TO3A 1OSEA 4YCPA 1JCXA 2TMDA 1SR0A 1OB0A 4O1CA 1HKKA 3QQ0A 3HGJA 1TSIA 3WEZA 1ECEA 4R27A 2E4TA 3WELA 1Z44A 4AWUA 2QDGA 3I68A 2DZUA 3WKZA 4AVFA 1GOQA 1K9FA 2YCEA 1KWGA 1SPQA 3G0XA 2FB3A 2ZA3A 4JTHA 3MV11 5HXMA 1RPXA 4WSJA 3SJ3A 3TMQA 3AS0A 1JF6A 1LL7A 3CPRA 3WQ6A 1BYBA 4BI7A 3IV3A 1GW1A 5U4NA 4QFUA 3UEQA 4UMCA 1XBZA 3BVJA 2D73A 2FPYA 4N9BA 4U3CA 3ATYA 1ZBKA 2WPBA 2ISSA 4CD4A 2NX1A 1EHNA 4HT3A 4RE4A 5A8QA 2WSYA 1G1YA 3RNDA 1HIZA 4DBEA 3BLIA 5I24A 5CZSA 1W8SA 2X30A 1LWHA 2CPUA 3APGA 4M19A 3O07A 3K4DA 3HOJA 2D3NA 3PBYA 1MZHA 2EPHA 4IMFA 3MBFA 5I3JA 3LLDA 1AQHA 3UWZA 1VRDA 3GDBA 1SW0A 2AAAA 4V28A 4HNUA 3THAA 3W6LA 1AL7A 3CWNA 4HPHA 5DMYA 1SU5A 3GBDA 4JDYA 2CBJA 4M82A 4IMEA 1RZMA 2OSYA 2EPLX 4BI6A 4JHZA 4MJ4A 2ZRWA 3W7IA 2VVNA 1PX3A 2XM1A 2QF8A 1B57A 1XGZA 5D03A 3M6YA 1UA3A 1WNOA 2PWEA 1YXYA 3CEUA 4WIWA 5EBAA 1TPB1 4IWWA 5G4EA 1TQXA 3SCTA 3GLCA 4O4VA 1HJVA 1FWSA 2GJXB 3B8SA 3J7HA 3GXIA 1GVRA 3G1XA 4JTGA 3FIGA 5EMUA 1JAEA 1UQZA 1ICSA 3VOCA 1SSDA 2FGZA 4PFMA 1TVNA 4OBRA 3WUEA 4AZ5A 3LCXA 3QGVA 5DXYA 2A7NA 1LL6A 4UQAA 3NJ3A 3VX1A 4B1LA 4W87A 3LHTA 2QAFA 5EYWA 5EBUA 1QI4A 4AZ6A 3ABSA 2WXDM 4UCFA 2VC6A 2D22A 2ZOXA 5KZDA 3PUEA 4I9AA 3INPA 5E0CA 1HL2A 1EH9A 3LV5A 3G1HA 2E1DA 2H8ZA 3VINA 5CJ5A 3TW7A 3ZMRA 3NO5A 4A2RA 4IMDA 2ZUNA 4CU6A 1M03A 4NZCA 3QW4B 1TQJA 3VILA 1I45A 1JUEA 2WJZA 4X22A 3MYOA 3UNDA 2WNZA 3E02A 3NQCA 3VGBA 2NX9A 2QUUA 4EF9A 5CSRA 1LWJA 5A8OA 1KFJA 3QQ1A 3VD4A 3IGUA 3KL3A 3U7BA 3SCWA 3CUGA 2QHAA 5FF4A 2R94A 4O18A 3KL0A 1VCFA 1E4NA 2CETA 2WVVB 2GOUA 1YHTA 4FF5A 1TV5A 1H0GA 4B3LA 4UFMA 5FESA 1UHVA 3OVRA 3KVJA 1G7UA 4JTTA 2FHBA 3MKKA 1CI1A 1E6ZA 3HU7A 2F84A 4POCA 1AW5A 1OK4A 1F7BA 1SSGA 1SZFA 1ZHAA 4WZHA 3W7JA 2GJXA 3FLUA 4W7UA 4DUWA 2E6DA 4LS2A 2OWWA 3UGHA 2BY2A 4IPNB 3TXZA 1P0KA 5HUOA 1KR1A 2ZFAA 1ISWA 2J4GA 3ZJ7A 4GINA 3A4AA 4E8DA 4PSPA 1F6KA 3QH2A 3VMPA 1UD2A 3MSGA 4U5IA 3GR7A 1K8YA 5A69A 3ARVA 3W2UA 2R8WA 3N2XA 1FP9A 1SMAA 5K4XA 4WXZA 4XX6A 4IISA 3KXQA 4W9TA 1H41A 2WMHA 4FNSA 3NYZA 4HNNA 1E3XA 2ZXQA 4JHOA 3T4CA 5LGXA 2YXGA 3W74A 1KLZA 1OFBA 3M7SA 3QM3A 1RQBA 1MEIA 3CIWA 5I3FA 3B9DA 4R53A 3C3NA 2PRHA 4FHAA 4PL2A 2ZUVA 2ABAA 2VEMA 4AZCB 1TFVA 1DQWA 1VH7A 3IAPA 3RO8A 2PRLA 5FL0A 3OA3A 4I7WA 1DJQA 3OLDA 3POCA 3C2RA 1WB0A 2QCEA 1WZAA 1X1ZA 3CU2A
chains in the Genus database with same CATH superfamily
2OLHA 4GNKB 2J9YA 1IEVA 4D7YA 1J1TA 1SBDA 1WCGA 2B4GA 4LVDA 2PDFA 4ZQNA 5BNOA 4MG2A 1M9HA 3QACA 4TZDA 1CW2A 3C8FA 4BK4A 4BY3A 5DN2A 4OJYA 2XM2A 3OZPA 3I2JA 3BIEA 4Q33A 2POZA 4PYSA 3MS8A 3ELFA 1B3WA 4M6QA 3MIEA 3MBWA 3N35A 1V6YA 3M4HA 4ASMB 4C5YA 4LC8A 4K6AA 4P7RA 1I3HA 1XU1A 2ATMA 3RPMA 2WV8A 1NKGA 2A6WA 4JGZA 4QKBA 1YPFA 1ZZCA 3HJEA 1KFBA 5B2GB 3PAOA 4PIXA 3R6IA 4J40A 4LITA 5F3CA 1JZ6A 4U2AA 2DV9A 2C8NA 4NHXA 1NQKA 4JX6A 2ARAA 3WQWA 4Y1YA 2C4XA 4FPJA 3MCNA 1OA3A 1AX1A 1UOFA 5A94A 2IZWA 5JH2A 2OWCA 4GZEA 2OWXA 3T78A 4C1XA 4Q3MA 1LG2A 3SHRA 1F07A 3OJGA 2LTNA 4LO7A 1BFNA 1Q7MA 2HRWA 3EWXA 2XN1A 4QB6A 1TZ9A 3LY0A 2DDXA 2I5IA 1HV0A 3AZYA 3CH0A 2MNGA 4HMNA 4I02A 1UKRA 3ZO9A 5B80A 4Q8LA 1U5IA 1VD6A 3ARRA 4JFWA 1EB3A 2WKJA 2ZE0A 3LMZA 3GDRA 4P9WA 2ZUMA 4KPLA 4YWIA 2Y5SA 5A8PA 3TRSB 1YMYA 5I77A 4RK8A 1CNVA 3POBA 1VBA3 4RFT0 3WP6A 2PURA 5T8GA 3W1MA 3EXTA 1TV4A 1ISYA 1UR1A 2JE8A 3I2FA 1VBE2 3AFKA 4QE1A 2RG4A 1L6YA 3RX2A 3WL0A 2OMAA 3HJZA 1Q8JA 4JN8A 1W2TA 1XYAA 3VNMA 3WH9A 4PLOA 4J1XA 3VZZA 2Q1MA 1YTDA 4GVHA 2X7VA 3PUIA 1KBBA 5LKYA 4H6EA 1CLXA 2PZ0A 4PRTA 2JDHA 3BAIA 2EXIA 4OHQA 3GG0A 3V0UA 4QB1A 3STFA 4YIWA 3WK3A 4YGCA 2WCSA 4COZA 3L4YA 5LW9A 2GC0A 3MW4A 2WMJA 2GGGA 2VW2A 5GZEA 4JIHA 4QX0A 1NLRA 2EPNA 5LXEA 2V4VA 4E5TA 4PBFA 4MVAA 5FXXA 1COV1 3OLIA 2GK1B 3BWWA 3S1VA 3SN4A 3ZOAA 1OWQA 4XJWA 5KHKA 1VFMA 4V15A 3USBA 5CC3A 2B81A 2PODA 1TMF1 3R58A 3LCPA 4RGGA 3ALFA 4JTCA 3BSGA 1PL9A 4G2DA 2Y6JA 1NCRC 2UU8A 2V3DA 5KHIA 3K8MA 4WHBA 4QXHA 3BCFA 5I79A 3DESA 2DTYA 3LZZA 3LMYA 2O55A 2WC2A 4Z1BA 1AA1B 4XFAA 1F6YA 2QQUA 5C70A 3LXBA 5CC7A 2B46X 1JDDA 4ZFMA 1XNDA 3ARPA 1OI6A 3LE0A 5HNNA 4KCTA 5ABEA 2W4XA 3HPZA 1R86A 1CAWA 3VB9A 3RZLA 3W7OA 3N9KA 2Y88A 5DZEA 2WAGA 5L9VA 1JYXA 3GAYA 4AWSA 4F2UA 2GDVA 3WQVA 3JBG1 3W38A 3WUCA 1WV2A 1HFBA 1K70A 1DGLA 5G2IA 1JD7A 5A6YA 3G6MA 1SFNA 4MWAC 3WD4A 1DIKA 2FDIA 5F1UA 3VD9A 2IS7A 2FZMA 2YLLA 2DIKA 2C1FA 3S42A 5BU9A 4IE7A 4FIQA 4LUKA 4MHUA 4CUAA 3GW0A 1QXRA 2VFHA 5FCCA 1TWDA 2QCDA 3ARWA 1YPIA 1V3MA 2PF0A 3BAWA 2RR11 1E9ZB 1IZCA 3R11A 2V5BA 4GI4A 5KEZA 2RGLA 2OW4A 4Z08A 4JXCA 4JNMA 4RR3A 1PEZA 4HA3A 1W9FA 2WQ4A 4XD5A 1XYFA 4K68A 4XILA 7ENLA 3TB0A 2EVXA 4OI2A 3T1LA 1U5VA 1WLTA 1DTNA 2PD5A 3AROA 3P5BA 2XTKA 1REFA 4KRZA 1UUMA 2XZ7A 2RJKA 4QPGC 3UW6A 3OYXA 2W68A 3RWNA 5L9FA 1VEOA 4NZFA 4GXPA 3VDAA 4F83A 2ZA9A 4OZOA 1TMQA 4P14A 2CKSA 1K4GA 4LIUA 1JBCA 2RDWA 3KV4A 3CBNA 4ES9A 1H8TB 3TYJA 2WZIA 3VZNA 4B3KA 3IVSA 2ZKMX 4GUGA 1WMDA 3S4TA 4F0KA 1FFQA 2G5WA 5AYZA 3WK1A 3LGGA 4H00A 2ATFA 3B40A 2UY8A 2JKAA 2BBFA 4X61A 2F17A 2OT1A 4JAAA 4B5VA 5HWNA 5CA6A 2OX1A 3VFCA 2VBPA 1DGRN 4CCOA 1ZL1A 2Y5JA 1PX8A 1IOAA 1UD6A 4YZ2A 2INZA 3V5CA 3H1WA 4U2YA 3PPGA 3P5YA 1VAHA 2R16A 4TN7A 4UWMA 1SJCA 2ZGQA 5BYWA 2QDRA 3AMMA 2BVVA 1E0WA 5D8ZA 4B4RA 3TTYA 5FJRA 1ULGA 4M51A 5ABTA 4H7CA 3EDFA 3OVGA 4X0NA 4ICCX 1HJGA 2MUCA 3PJQA 4W6YA 2FIQA 1AYM2 2WINB 5JOZA 2P3JA 4WD0A 4A4AA 4UQDA 3B0UX 3PJWA 3SECA 1TME1 3MPPG 3IUDA 1Q6QA 1JNEA 1XCWA 1DWFM 2WWCA 4XUTA 2WCGA 2NLYA 1E1FA 3RZJA 2TODA 1TEIA 3K2GA 3HNYM 2WBKA 5FWJA 4MKNA 1PKLA 2E09A 1OADA 3ZLFA 3U7VA 4C6DA 1R3VA 3E2VA 2VE1A 2VW1A 1CWYA 4TIMA 1E6XM 3WD3A 4CDXA 2BODX 5T3NA 4N53B 3MHFA 5AZ0A 3QBQA 3SCVA 1HB4A 2W1QA 2PDWA 3B8UA 1UC4A 1X96A 1M68A 1VFOA 3ONBA 4PDWC 2RS13 5BZAA 3BODA 3ILRA 4GE8A 3ZLHA 4H41A 5A2CA 2VUNA 4JTJA 3HPSA 5GZFA 2PCEA 2Y62A 1DL3A 2EKCA 1XKJA 3HV8A 2FBEA 1B5TA 3B8DA 1JI1A 1TZZA 2ZA2A 4COUA 1MZFA 1O4ZA 1QPOA 3KT7A 3BTYA 2XJ7A 4A3HA 2YFUA 4PMYA 2DUXA 3W2JA 2JKPA 3VBRC 2WS92 2UWAA 5LA0A 1PVC3 2ZHNA 3WQ7A 2OLAA 4D6RA 2WNVC 3GALA 4XKYA 2G3MA 4EPKA 3LLFA 1H2MA 1BXNA 1XLGA 5DDJ1 3EB7A 1W6MA 3SQLA 2WHJA 2PTXA 2BXYA 1UZDA 3NAPA 2EIBA 4KW2A 4QCEA 3GCXA 2VGGA 3M44A 4A3RA 5JPNB 4ARXA 2WVSA 5A33B 4AIUA 5F3EA 2YG0A 4RQPA 4AR2A 4MUVA 2OYMA 2XHYA 2ZVRA 4AD1A 3WMCA 5I8YA 1ZJIA 5EYXA 1K3UA 1RUC3 2Q02A 2XPJA 4B29A 1KBKA 3PR2A 4DHGA 3HQ1A 2QCMA 4KG0A 1OCBA 1Q6GA 3W21A 2I1OA 2NX3A 3W85A 4S3DA 4Q4RA 2KR2A 1UMIA 1KGUA 2OLSA 1OM0A 1AJKA 2HBUA 1LTDA 5FZOB 4H7VA 1JRBA 2RAGA 1SZNA 1S0BA 4Y9AA 3VUOA 3RYKA 1O3TA 4GH3A 3FZ3A 2XJUA 3NSTA 2E9LA 4D3WA 1W0OA 3TN91 1VRH1 2P10A 1OFRA 3F2ZA 4QM8A 1YLVA 1WXYA 5C5UA 2R32A 1SVDA 1JXKA 3CV6A 3APYA 3ITLA 4HSOA 3AOFA 1ACCA 3W2NA 3MUZ1 1XXXA 4R52A 2GMEA 2FTWA 3GIPA 2DSUA 2AGTA 5AYYA 2WDBA 5A7OA 2GC3A 1UWUA 1AL22 5ENLA 1WLDA 3WY1A 2BGPA 3VDBA 1PX4A 4AVOA 3IDBB 3O7OA 4DEQA 3MF6A 3WLHA 2CLFA 2RE9A 1LECA 2XVLA 1W03A 1W1A1 1DPMA 4I8YA 3TYDA 2QV5A 1P0DA 3ILFA 5FZ4A 4PCPA 3WLOA 1K9DA 1H30A 4W8BA 5IK5A 3WVJA 1TCDA 5FXWA 2KM2A 1SFSA 3CHDA 4FNUA 2CNCA 1HB3A 5C4WB 2JENA 3LB0A 3CO2A 4NI3A 3UCDA 3AYVA 4LYKA 2QPSA 1EJTC 1X7FA 1O91A 1UY0A 3DGBA 3NNGA 4LYRA 2GWGA 3O1NA 1YNQA 4BWLC 3G77A 3SO7A 4QB2A 1I2NA 2XVKA 1G9BA 2OG9A 2N7GA 2OGJA 1OD5A 2E8ZA 1IS3A 4C1LA 4QNEA 2VZRA 3ZN6A 4AEMA 1GZWA 1WBLA 4IGQA 1RQHA 1W9PA 5DLCA 5EMKA 3QY7A 1ONXA 3WDTA 3KV6A 1RUSA 4H6KA 2QNEA 3CTLA 1FNYA 4UMBA 1O59A 1KM5A 1W3VA 2CL2A 1IZ3A 1YDYA 4PMUA 1N8FA 3I65A 1UPSA 2E9MA 1PGW1 4D6JA 3RZGA 3SY8A 2CCRA 3WF4A 3G7DA 1E0UA 3HBZA 2JDNA 3OPWA 7ODCA 2W0XA 2GNDA 4NZ5A 3O8AA 2B9UA 4ZE4A 3HQXA 1RGSA 5A6BD 4FCAA 3A47A 3WNPA 1WD4A 3BZGA 3VDDA 1QATA 3MMWA 2Y34A 4BQYA 3EOLA 1SBFA 3IGXA 4PBOA 4ZU7A 2HTMA 4CDWA 1AVAA 3PFRA 3AXDA 4BXSV 3UYJA 3FWEA 1LOEA 3VDGA 4DO7A 1VJ2A 2G41A 4XMAA 5JOYA 4A8RA 1POV3 5EV7A 2HE5A 1IQ8A 4FXFA 5A2AA 3WJXA 3E0LA 2CBUA 5FO8B 1V6IA 2IVJA 4RJEA 1QW9A 4Y22B 5A8GA 3GXFA 1Q8PA 2QZ2A 4D94A 5D02A 2V73A 3CU7A 3E5UA 3USUA 1O60A 4WF7A 4AD5A 3I2HA 1U1JA 4Q2FA 4MKVA 3S9ZA 1Q56A 1DJNA 4CUCA 1J4EA 3F1QA 3CMGA 5FMBA 4P7NA 4NZJA 5BNPB 1YKWA 3DU0A 2H8XA 4CEUC 3WW2A 2G9FA 4L9BA 3LHWA 5FY7A 3TCEA 1Q8QA 3CZLA 4AZGA 2WFF2 1UP0A 3EMCA 3TX9A 1IF2A 2QJNA 2DJXA 4MFEA 4C6JA 4KCVA 2Y6HA 1NXD1 3PM6A 1FMD3 1WDSA 4DN1A 1HQTA 1UNBA 5DQ0A 2O92A 2TRSA 4NVTA 3H8XA 1NX9A 1DIWA 1H51A 4U3AA 3CQIA 3E2RA 4AHQA 1J18A 1FP8A 3FKKA 3VHNA 4OVEA 1DQ4A 2OSWA 1BRLB 1HKWA 2PDKA 3L5AA 3U2EA 4RR3C 1D7FA 3CH9A 1VBB3 1FWDC 1AYN1 3G18A 3ZKUA 3POWA 1PIV1 1X1NA 5FOBB 4XD6A 5IWFA 3IJDA 3H2EA 4RDZA 4DBSA 1VBE3 3M46A 2WNUC 5LSMA 2YXSA 1WGPA 5HI0A 1UY4A 3G1SA 2J1RA 1D8WA 2EJ1A 1UR2A 3DBPA 5GALA 4L9XA 4E2QA 3ZFGC 3B8IA 4U2ZA 3POYA 4NX0A 5JQ9A 2JDKA 1TTIA 5FR3A 1Z78A 3AMNA 3ST7A 3VBOA 2JDZA 4UBHA 1JYTA 4AEEA 5JCTA 3RG0A 4MB1A 3LTPA 2F8QA 5BOOA 4EZ4A 3V4BA 3EQEA 3RRAA 2HE8A 3V0SA 2PP1A 1W8ZA 2J77A 4WM7C 3F4CA 1Y7VA 3ALQA 4DJEA 1X36A 3OLGA 2WWJA 3QN3A 1AW1A 4REQA 4Y9MA 2ZZ1A 2BHZA 3ES8A 3T07A 5EFDA 1A8DA 1GHRA 1Q45A 2ACQA 4RNIA 1OIFA 4MLRA 1BF2A 2WK2A 2P53A 3B97A 1XRSA 3BVCA 3LEKA 1POV0 2E5CA 2XH4A 4EWJA 4DYKA 5GJPA 3L2MA 4MGYE 3SURA 3I59A 4E4SA 1W9DM 2JECA 3NURA 3OG2A 3HG4A 3VIOA 5DUXA 1FCVA 3KCJA 2I5GA 1GPFA 1PJ9A 1FV2A 2VD8A 1C90A 5FY8A 3KMHA 3NIYA 1UW9A 4DQWA 4BH9A 4CQBA 5GKAC 1T7LA 1BBT2 3OVQA 4PBPA 1XG4A 4KMQA 3WD0A 1XLCA 4HLTA 3TYAA 2EPKX 4R9CA 4RZ6A 4XKYB 3QY6A 1W90A 4UTLA 2XJSA 1OZMA 3GX9A 3OZOA 5FD0A 2IQTA 1KCZA 3UWVA 3GBWA 3AVSA 2ACSA 1RUD1 3WLNA 3GU9A 4IIFA 4URTA 3KHCA 4GBDA 1JDCA 4LIVA 4CD7A 2JEMA 2XFYA 5M0TA 3AVRA 4JKMA 1EJWC 2VCBA 1V7YA 4WDXA 1NVMA 1EGZA 1UYYA 2UY4A 1COV2 4DI9A 4OGZA 3CK5A 1JI6A 4K7VA 4NWWA 4WKFA 1C8M1 1IKQA 2Z6JA 4G8TA 1R38A 3OZMA 1ODNA 3VNYA 2WSKA 2OZJA 3DPRC 3THQA 3OBEA 1I1WA 4YYFA 1GNZA 3EOEA 2WZMA 3OEXA 3KVLA 1AR73 1ASJ3 5BNOC 2Q3RA 4K7JA 2BV9A 1A3XA 2ADAA 1PPIA 3TSBA 1JXJA 1I1XA 4FX8A 1S55A 3ZYPA 5LIUX 5C2CA 3PNZA 1YC61 4W8AA 3PZOA 4CPBD 4K6BA 4AY7A 2DF7A 4FPHA 2X53S 3TQVA 4AISA 1YNPA 4WDUA 2QEZA 2DEPA 3LV6A 4B15A 1PIGA 3W7HA 1YQ8A 3QFEA 5EGRA 3L2YA 2WKKA 5FY5A 1MDRA 1SFPA 2YXXA 2G95A 3JS3A 1JD9A 2BY0A 3LLXA 2RS33 3L4WA 1R9XA 4OULA 4XUQA 1WOBA 1IWAA 2CDPA 2IPWA 4NQ1A 4YNIA 5DT7A 1YIPA 3SQMA 1NOUA 1OF6A 3GNXA 3RMXA 3JB8A 5FYSA 1SR9A 3QEZA 3SAZA 1AQ0A 2CWMA 1ZBA3 2XH2A 4QGMA 4Y3OA 2JXAA 4WVVA 4P7LA 5LXXA 3WFLA 1GG0A 4RE3A 3G1RA 1VC4A 4PTWA 3NQAA 3M0IA 4HSNA 4IIGA 1BD0A 5E1RA 1OFOA 1SW3A 2IQ0A 2XIIA 4XPVA 3L5LA 3EYPA 3J7NA 1E5JA 3N2BA 1W2OA 2DPEA 2Z1SA 3POEA 4JN7A 4XUOA 3KM5A 1G9HA 1TMF2 1W3TA 3UP8A 1VAVA 3AZSA 1KFEA 5TIMA 4BF7A 1UASA 3JUUA 1FT9A 3TWAA 1MRAA 1VJZA 2OOGA 3VGDA 3SKVA 3TK7A 1A5AA 1Q8AA 1Y9QA 3AHVA 5T5PA 4NUWA 5CAHA 3S5OA 3TOJA 1UZVA 1OYBA 4CDXC 4JN6A 2P8CA 3PJXA 4GMP0 3S5QA 1P7TB 3AIBA 5EB8A 2V6AA 1F35A 1EPVA 1MR5A 4MY1A 1ZP4A 4GZIA 4MV2A 4WKHA 1FWNA 4IFKB 3Q94A 1EL3A 4AK3A 1FA2A 1I2PA 3NQ7A 4U5KA 2A21A 3PTMA 3TNQA 4O19A 5KSWA 7A3HA 2EQDA 3AHTA 4XOGA 1HKIA 4DVOA 3O1PA 4JR5A 4A2UA 1JZ3A 2C0HA 2WABA 5BRQA 1BYHA 2GJRA 4C6QA 2G3JA 3GM8A 5HQEA 3SUWA 3QY8A 3PTDA 1QW7A 2P17A 4MXVA 2QQLA 4C1WA 3V3WA 2MHFA 2YPDA 5L9RA 2MNRA 1J0HA 2VWSA 4PT6A 4UNIA 4XUYA 1B9ZA 1SDDB 1RUC2 3M64A 2C1GA 4WX2A 3QR0A 4AQSA 3OW1A 4UUIA 3C61A 4IZGA 3AXEA 1C7TA 1PM7A 2DZPA 2PHDA 4RXFA 1TCMA 1KA9F 4JTAA 3ZR5A 3EAUA 4ZB0A 2ZJCA 4BQ4A 3JZVA 2G9ZA 3HZ3A 3WLSA 2HS8A 1EPWA 2XH0A 2C3ZA 5E0KA 1FDYA 2PFWA 4XBJA 3VXGA 4XF9A 2R0HA 3VZYA 1GFF2 4DM2A 3MPBA 1NY72 1XYPA 2PU1A 3BPWA 3T0TA 4DM1A 1BG4A 1VBC3 5FBJA 3BUVA 2CHNA 5ACA2 3PUDA 1MYRA 2VFDA 1MRQA 4K3ZA 4YLWA 5FY9A 1JPMA 3H8OA 4Y5Z0 3NV1A 5I3GA 2JF7A 1HRI1 7REQA 3ZFEA 4ZR8A 5GLWA 5T5JA 3ID7A 3UFYA 4B5SA 1NTHA 2WS91 4LALA 5IK8A 2OSXA 3VDHA 4FOJA 2YGYA 4NNBA 4XAEA 2Z28A 1REQA 3P0XA 1EJVC 3BIWE 1U83A 1QH7A 5M03A 2AOSA 3I7DA 4DYJA 3FJSA 1VB9A 2VURA 5DBUA 1JF5A 2P1FA 2NXGA 4L5ZA 2O8QA 3URQA 2GSYA 3ANUA 3VNIA 3B02A 1H7WA 4L2NA 2WQPA 5HCHA 3VN4A 1GJPA 4NAFA 3RQ0A 4WQ6A 2YLAA 3M0ZA 2BHUA 3KTSA 3WLMA 2ILMA 4H01A 1W3KA 2OX4A 4NSBA 4H1ZA 1TJRA 3VOIA 3CUFA 1YNYA 2Z25A 4K2SA 2WJSA 3NQFA 4MFDA 2D0GA 3WH5A 4JTIA 3VU2A 1NOWA 3ZXAC 5T54A 4JNZA 3NA8A 4PHZA 3NM1A 3BLDA 2A7PA 1RUG1 3SUVA 4EOUA 1DGWX 3UKNA 2OB3A 1DWHM 2VZOA 4XDPA 3TEWA 1RV8A 4FOQA 4Q4W1 3GIYA 3B05A 4S1FA 2QUMA 3CMJA 1MXGA 4YYOA 1W3JA 2YL9A 3DG3A 3D47A 3VMNA 4ZO7A 3CAQA 3DF0A 4DZAA 4O0ZA 1R87A 5AYXA 1SHWB 5FZ6A 3WLUA 2YCIX 2REQA 3MW2A 1U0AA 4H3DA 4PEEA 1QHZA 4AZBA 4INDA 4HMZA 1OFPA 1PKYA 1V6NA 1UROA 5FY4A 3OY8A 1SJBA 2CWXA 2DW7A 4LNYA 5AVPA 1LGNA 3UJRA 3UCCA 5H8PA 4M80A 4ZU5A 2JG8B 1OFQA 1MVYA 5A5WA 1HL9A 4RL3A 1UIOA 4KERA 3SH3A 1B90A 4C6BA 3CYVA 2Y4SA 4AHPA 5IUQA 4Z82A 4GC4A 3I6RA 3CNYA 1I2OA 2X1UA 4JD4A 4IEVA 5EMMA 1ULFA 1XLJA 4MPQA 1TZOA 1FPN2 2OXNA 3NWRA 1GZGA 3BALA 3QW3A 3ELNA 5CQ1A 2OKXA 4HKOA 2AL2A 2Z24A 1G01A 1LYXA 2ZUWA 1LZOA 3VZJA 2WSVA 3GRIA 3L65A 5I02A 1A3KA 3NPVA 2ZRYA 1VIZA 4LV9A 1BKZA 2XLGA 3O6AA 3AIUA 1N82A 4D2JA 1NCRB 2ZGRA 2ZGMA 1M7PA 1S2TA 3W2LA 3SCPA 1LF1A 1J12A 5FZLA 4H55A 1M65A 4J1OA 4R33A 1XSRA 2X7WA 4S3BA 5F2MA 5B7YA 1H2NA 3OTRA 1Z3NA 4S3JA 5HA7A 4QGNA 4KGJA 1UCWA 2GZXA 1EV12 5FP9A 2PE4A 4QPYA 1UJQA 2WZPP 1R3QA 4F0MA 1CENA 1B3OA 4GABA 1G4PA 1V6UA 4W8JA 3RCNA 2R24A 3IIXA 1OC5A 4UQBA 3LCLA 3CHFA 3BAYA 5K2ZA 5F1RA 2OQ6A 3UJFA 1XLKA 1TTQA 4S3AA 2JWPA 4UR7A 1C57A 1LU1A 2P4EA 4RPQA 4FR6A 1V0KA 1EQCA 2CLIA 3LA2A 4EPEC 5HNRA 2R1DA 2XJTA 4KQ7A 1R2SA 1ZY9A 4GXMA 3OCPA 3CBWA 1XSKA 3AB0A 1UU4A 3DPRA 3BLKA 3M1HA 1WD3A 5C9AB 1MQPA 2VUYA 2VGBA 1M6JA 2YC4A 3CL1A 2CZ5A 1FWFC 4WXYA 4A8LA 4JPGA 3UJ2A 1OX5A 1FHUA 5CFCC 2P3ZA 1LWIA 2A75A 1M4WA 3KS7A 3WX5A 2OT0A 3UXAA 3N2TA 2P34A 5FWEA 3BG3A 4NF7A 4HVRA 4F48A 4KWUA 3W02A 2WO2A 2QMKA 3ORJA 4FQ4A 4B7KA 3W6YA 2BZNA 4O17A 3KUMA 2DCYA 2WMIA 2Z2AA 2VMFA 4Q4V2 1EYEA 1ZBWA 1NQ6A 2V38A 3W7JA 5A32B 3PZNA 4S2BA 2YPJA 4US6A 4AFYA 1KV8A 3NOYA 3M1ZA 2CSGA 1CVNA 1JZ7A 2I7GA 3OOXA 2YKKA 3EWCA 3NQMA 1E55A 2OUJA 5AECA 2GN3A 3TN5A 2XGZA 3GC5A 4Q8KA 2KX9A 3ZZ1A 2W46A 3MIBA 2CWNA 4AVSA 2QJIA 2YBUA 1U5XA 5HR6A 2ODOA 4LB3A 4RE2A 1DQUA 5CBLA 1WE5A 3QV7A 2A79A 1UMHA 2EJAA 4P61A 2WT2A 5HJLA 2Q8DA 4CEWC 3UPWA 3GBGA 4RCXA 2PLV2 1ME9A 1VBE1 4A22A 4UTUA 2QZRA 1DP0A 5MF5A 4RHV2 3TV8A 3MKCA 5BRBA 4NIRA 3GXMA 1PNGA 2WLYA 3WG3A 4GBUA 1LESA 3BURA 3T40A 4A3YA 4K38A 4LKSA 3L2HA 1MS3A 2WZR1 1J6PA 4I0WB 1X7IA 1GT8A 2YX0A 1OOPA 5A6MA 2WZR3 4HBNA 1AFSA 1YPXA 4I5UA 4K20A 4MNMA 1ADDA 3BG9A 3KBNA 1NJJA 2IUZA 2G3IA 3PZVA 1OHFA 1QHPA 1UMLA 4UTMA 5E9XA 2E9QA 3RPQA 4HPJA 3DH7A 3N34A 1UR3M 1E1CA 1N47A 1HJFA 2FYMA 5G4HC 1VHNA 2MANA 3GVGA 2DUAA 3N4MA 3VBRA 5D2WA 3VNLA 3HEIA 5J09A 1LLOA 4MADA 3BOXA 2B45X 4LJHA 2V5CA 2Q30A 2CNAA 4RS5C 4Q7IA 4LY4A 4W5ZA 5FSDC 2VELA 1PZ8A 3ZSTA 5D8AC 1UQXA 3ASIA 4JGZB 2FMOA 4GVIA 4KCWA 4D6GA 2Z1WA 4GGHA 5D8WA 3VGEA 1VIWB 4L11A 1A6CA 5CPOA 4S38A 4A7YA 2CW6A 4DBDA 4AI9A 2E0PA 1FXQA 2FZBA 4U10A 1E0XA 3W82A 1XM3A 3IMNA 4GZ7A 1X1OA 2PDCA 3TN4A 1QXJA 5C33A 4C0HA 3KV9A 4JZ5A 5EPDA 1B3XA 3ZSEA 3MSRA 4QAIA 1C5IA 3WQGA 3MYXA 2DFBA 5FKBA 2BBAA 1ZU8A 3ITTA 3UA3A 2XVPA 5AY7A 1PO22 1KD7A 1MQQA 4PL1A 4R9OA 1RUJ3 2Y24A 3TKFA 4UOZA 1MEC1 4GKYA 3L2LA 2DIEA 3LDVA 3LX9A 1E40A 1ZZ9A 4D8MA 2ZUSA 4HN4A 4LGXA 3T0BA 1R082 1VHCA 4H04A 4KT2A 3UKVA 1E15A 1PIV2 1PO9A 1BMV2 3ITQA 1EWDA 3ARSA 4I7UA 1W9VA 5A6AA 1RAKA 2ZHKA 1R3WA 1WZMA 5CGMA 4XHBA 3AWNA 3PK7A 1JEZA 3FUQA 4RSUA 1T96A 3ES4A 4JIIX 2HWB2 2ZKLA 4DLMA 1MQTB 3TCSA 4PC8A 2W79A 4OI4A 5FSEC 3L9CA 4KBXA 3NXLA 4QSFA 4PTDA 3WDPP 3QMSA 3HPNA 4GB32 1W05A 1K9EA 3N4FA 5AC7A 4DJFC 4TYSA 1WCSA 1HB1A 2JGQA 1ULEA 9XIAA 2QTWB 2VULA 1TG7A 3VBUA 1W28A 4V2WA 1VEMA 4R3UA 1W2AX 3MP3A 3NQDA 3LM3A 2NW0A 4Z1CA 2HWE1 4PMRA 3N7LA 2PC4A 3SSZA 3M3CA 1IS5A 1PSCA 1FWCC 1JUBA 3D0CA 2TAAA 1TA3B 1WCKA 1BEV1 2FDJA 5A70A 1OCJA 4HPXA 1J6OA 1RBLA 2ZX3A 3B4UA 1AMKA 2RDRA 1WBFA 3VL9A 2D23A 4YS1A 4EACA 5DAPA 3KS6A 1TX2A 4IPIA 3FUOA 4DWSD 1VFUA 4UMAA 1GWMA 2DDUA 3B8VA 3ARXA 4MY8A 1TPC1 2E8YA 5K3VA 3L68A 1H7PA 4GI6A 1RUD3 5I07A 1HJUA 2DCTA 2HYKA 1EUTA 2CLPA 4XVEA 5KZEA 2VR4A 3BV4A 3RYSA 3SI9A 3A5FA 5J3UA 2DYCA 1Z41A 3EDDA 3VD3A 1JCYA 3JW7A 1YE4A 1OG6A 1TMF3 1ZCOA 4LLFA 1VP5A 4LBRA 2GQAA 1OF3A 2QXWA 4JDNA 4S2FA 5D1IA 1C9WA 2B7QA 3A4WA 4GQ0A 4IQJA 4EPBC 4FSAA 1VZWA 4G4FA 5MKGA 4Y20B 3K3NA 3ZWSA 3CIVA 1EWEA 5IVCA 4XQ4A 5BXPA 1A49A 3O16A 3RCYA 4DF2A 3HJRA 3H4GA 2ZE3A 4H19A 4M56A 4TUFA