3GF6A

Crystal structure of a bacterial lipoprotein (bt_1233) from bacteroides thetaiotaomicron vpi-5482 at 1.69 a resolution
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
219
structure length
219
Chain Sequence
DAIYYPVGDVDIERGGPALEVGEEDVLVARSFNEEDYVLDTIAQYPNDPTLGKLTFMIDLKNQQKDQNVADFNGVGKSKLTMSLGYKDGNYPSESQVPIYTSQDVTAKYAVKLRLKGELLVSGDEWMIDYVYAQLASLFQPYPPANFPEVFMCKGGMKLGTFDSFRRTCTFDITYDRSDLSFSQLYFNLFINLAGQKRENRVRLRIDKESYFELYEQSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized bacterial lipoprotein
publication title Crystal structure of bacterial lipoprotein of unknown function (NP_810146.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.69 A resolution
rcsb
source organism Bacteroides thetaiotaomicron vpi-5482
molecule tags Unknown function
total genus 48
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.750 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3gf6A00
3GF6A
chains in the Genus database with same CATH superfamily
1IS3A 4LBLA 1CN1A 1NCRA 2RM23 3OBZA 3M3CA 1RHI2 5FO8B 1U0AA 4LO7A 5F8PA 4CCJA 3E6CC 3NAPA 1H8TC 1JW6A 1X8EA 4ASMB 3LOBA 2W9XA 2C24A 4FFHA 4CSWA 5DAWA 1PMHX 1GMMA 4BIOA 4N7IA 1V9U1 4AHZA 3WY6A 5FCCA 3BPZA 1W6MB 1WCDJ 5JZGC 2GNTA 2GMPA 5K0UA 2A1XA 3GYDA 4ARYA 4RGKA 5E1RA 5BNNA 1DGWX 1GSLA 3UV9A 1VBA1 1HRI2 1D0HA 5AVAA 1AZDA 2XKPA 2WAOA 5LASA 5FKBA 2ARBA 2BERA 4IV3B 1OI6A 2BWAA 3U75A 1OH4A 3FHQA 1OQDA 4K1YA 3RZKA 1A3KA 4B4PA 4LULA 1SLIA 3H0OA 4YYOA 3CKHA 4CEWC 3MV11 1JU4A 3BUCA 3WNLA 3ORJA 2W1SA 1ENXA 5EYYA 1GKBA 1SFYA 5DDJ1 3OYWB 4AF9A 3WHUA 2D6OX 3EXUA 3B93A 3T08A 1W9TA 2YC4A 5C8CA 5FYIA 4MHRA 2PQSA 5FP4A 1MS0A 1RC6A 3C3VA 1OF4A 3AP5A 2P34A 1CAVA 4HT1T 5EYXA 1US2A 1Y7BA 1REDA 2ZGLA 2RJKA 2ZXQA 4FPKA 5HXVA 3K48A 4M01A 2VD7A 2PAKA 4LTAA 4RR3A 5FP7A 1BBT2 1OBNA 1ZZ9A 2X5IA 3IDBB 4HFSA 2XQRA 4BE3A 3O1SA 1UY3A 2W39A 3ABZA 2HWE3 1IS4A 3Q8CA 2RDRA 4FPGA 5JI9A 4E27A 2VE1A 3SEEA 1LOFA 3ZXJA 4NPMA 2X53S 4AVCA 3MYXA 5T50A 4UOJA 3V0BA 3AKRA 2C1FA 4E9KA 3VKMA 4YM3A 2YFUA 1DQ6A 1DLCA 2JE9A 5KXCA 1JUHA 5D21A 4CP9A 4JGZC 1SBEA 2ZGOA 3ZR5A 2QDNA 4GB31 3IDEA 1XNTA 1LJ7A 2XJTA 4FFIA 3RZGA 1VR3A 3WP6A 1OFNA 1EY2A 4IV3C 3SMHA 3TEWA 5CISA 3H7JA 3WSOA 2G9GA 3ILRA 3AKQA 4TZDA 5FLIA 5FOJB 1ZZCA 5F3CA 2WNEA 4AXOA 4BPZA 1QH7A 2A6WA 3ZO0B 4MH0E 1OXCA 4IEWA 4Q8LA 1ND2A 3UL2A 5BPXA 1RUD3 2A6VA 2AEYA 5JDBA 1X82A 5FRAA 1HB3A 5H9PA 3BODA 5FLJA 4TWTA 5JSRA 2PXJA 1VRBA 1HXS3 1X36A 4M4PA 2WZR1 3ZPOA 2UYAA 4K8FA 1UW8A 4S2GA 3L2YA 1RHI3 2G4IA 2R061 4D7YA 3BKZA 3ZYPA 1AL21 1O4ZA 1W2AX 3BIWE 2JE8A 1KS5A 2JD9A 4LORA 4HKLA 5FXVA 3GZTB 5FZAA 5DABA 1W06A 1AR73 5A7WA 4AEDB 1RB8G 1HQWA 3T1MA 3JZVA 3AZWA 1GP6A 1S0EA 4HG6B 4L92A 4SBVA 4M0NA 2K9ZA 5FYCA 2FCTA 3DEMA 2DBNA 4HBNA 1JHNA 3CDZB 1S2EA 1QY4A 2MEV2 1QQP1 5JCTA 3GZUC 2W08A 3LD8A 2Z4FA 4DINB 4XUPA 1W6QB 3HQUA 3VUOA 3PVNA 2E53A 2CDPA 2HWF3 2CTVA 4QM9A 3VKOA 5EJ3A 1XU2A 1FAYA 4YGCA 5FWJA 4A7YA 1SDDB 1I3HA 4NMIA 1NCQC 3HQRA 3R0RA 4EV0A 4F7ZA 2P3JA 1POV0 4C1WA 4J25A 1KRIA 4CXYA 1D7PM 1GOHA 2BNNA 5FJKA 1MVEA 1ZZ6A 4AVSA 2ZGUA 3WCRA 1SZBA 2AEZA 1V00A 3FC0A 3K75B 2WZPP 4AHWA 1TG7A 5AFBA 3FLRA 4IE7A 1CPMA 4JX0A 4Q4V2 4AQ6A 4D8MA 2WSUA 3POFA 1ZRRA 5T5JA 4QAWA 4GZ9A 1AR81 4Y1YA 4IL7A 5FMOL 5F3EA 2FDGA 4Q4Y3 4PLOA 4A42A 4K7JA 1C8NA 1JBCA 1GBGA 2DCTA 3WX5A 3SC7X 3RYPA 3VDCA 2VMCA 5A3PA 4FP3A 1CZVA 5KXEA 2QKDA 1X50A 5I8SA 1G9BA 3QH6A 3BU0A 4BHPA 3AP6A 5HCAA 2JDNA 2CSGA 2VOVA 3VBRA 2Y33A 2HWB3 5BNOB 1RUH2 1SLLA 1AR91 1UY1A 1JZ2A 1DYOA 3WDWA 3WVJA 1PVC1 2KR2A 1VBD1 4UYBA 3H3UA 2GC2A 3C7GA 1UYXA 1OH3A 2RMU2 2B4KA 2PELA 2YUEA 1Z78A 4ZS3A 3KV5A 3D5OA 5SV5A 3W58A 3CQOA 2OUJA 1TMF1 4RHV2 5FXZA 3N36A 3NWKA 3AYEA 4E8CA 2FZ2A 3SH4A 5T5LA 1H30A 2A70A 2P17A 3UETA 2NN8A 4COYA 3T0AA 1QJX3 1S55A 2QQMA 1H8VA 5IVJA 2RM21 2XGXA 3SQOA 2Z5WA 1EYBA 2F4LA 1D4VB 2UURA 2ZX3A 1AXKA 4W8JA 2ZHNA 4LBQD 4IV1C 4E2GA 1W9SA 3ATGA 4QX5A 1DGLA 1RUG2 4I30A 5CKMA 4LKDA 3RQ0A 1UU6A 1D4M3 4BQ1A 3AZVA 2WJSA 4Q4X2 1H0BA 3RI8A 5FMCA 3ZSMA 2VOWA 4A7KA 1WZXA 5EV7A 3UK9A 4UFKA 4AFCA 5JXGA 1UWWA 3DPRB 3KT1A 5C7GA 5KHKA 4YM1A 2RS32 2WYFA 3O0XA 1GV9A 4XILA 4LKEA 3POJA 4OQ8A 3H3LA 4BLIA 1S0JA 3RS6A 2BBAA 2XG3A 1LEMA 4L2NA 4R9CA 1WKYA 1MS8A 4DS0A 1CX4A 2DU0A 1Y43B 2JDYA 3FFZA 5L73A 5CG9A 3M3IA 3W9AA 3VDDC 4X8NA 2X29A 4EZ4A 2GC3A 5C9AC 3MF6A 3S5AA 4IEPA 4JZRA 3AK0A 2OZ6A 4YWAA 4UWDA 2J1EA 2ZX4A 3LA2A 4YRDA 3OYWA 4ZY9A 2J42A 3LFMA 3ILNA 1MS9A 2HWC3 4Z92B 3WW2A 4KGQA 4UI9L 4AWDA 1WA6X 1O3TA 4XIOA 4G9SB 1W6OA 1PO12 3FUOA 2JG9C 3GDBA 3BGAA 3IAPA 1ZBA3 2G9ZA 1H2NA 2ZABA 4XDQA 4AHXA 2GP5A 4XE9A 4PI2A 4FCAA 2PN5A 4MGSA 3UNPA 2K46A 5LZ6A 4AVAA 4YLZA 1OC1A 3K4DA 2VH9A 1W8OA 2JDKA 1S0FA 5L9BA 3ZFFC 4W6YA 1Q8SA 2O14A 2EIGA 3RSJA 1ZRDA 5LK7B 2W46A 3L9JT 2PMWB 3VBOC 2JEMA 4AW7A 4YG6A 1AYM1 3TEXA 3NQHA 4NIAA 4D6RA 1AJKA 1BYHA 3IN9A 1W2OA 3DKWA 1B35C 3QACA 3NSTA 5EZWA 3DPRC 5E88A 2HEWF 4Z1VA 2XBO2 4P9XA 3WEZA 1X33A 2XJUA 1M06G 2P37A 3MLLA 3N7KA 3WCSA 3ZXFA 1JUIA 4AQ2A 1KDMA 3WDUA 1VLNA 1RVF3 3KF5A 3D3AA 3M3OA 1YI9A 3QLQA 1ZA7A 4HVRA 5LW9A 2VECA 4LR4A 5E6HA 3J8F1 2W1QA 4Y1UA 3U11A 4AQTA 4KG8A 5IVVA 1OLME 4HN1A 2OKXA 3FJSA 5JXJA 4NE9A 1QJY3 4GA9A 3ZDSA 2VZQA 2WR9A 1RTVA 3BU7A 1WCKA 1L7QA 4QXBA 5IVBA 1UD1A 3WP5A 3WNMA 1ULPA 4CCDA 1Y9MA 1K5MB 2HH9A 1W90A 2SBAA 3DV8A 5CFDB 1D0GA 2EXIA 2A3WA 2GNDA 2DFBA 4PCRA 1EV13 2YDEA 4DQAA 4HK9A 3ZFGB 4Z2WA 5LA1A 3V0AB 1RHI1 1QOOA 1UU4A 5IVYA 2ZX2A 4RD7A 1DFQA 2QQOA 2XVGA 1W8NA 2XQXA 4AEDA 4K1ZA 1AR71 1JI6A 3LDBA 2ZX1A 4MG2A 4MADA 4P9JA 3RVHA 2I74A 3AP7A 3LA3A 4IUGA 3ZN4A 2A7AA 3O1RA 5DZFA 4JTNA 2VXJA 3LFIA 1HN0A 2ZACA 3BVCA 1KD7A 3GHMA 2RS33 1BVP1 4LIVA 3UKNA 2DTWA 3ACIA 3ACHA 1HRI1 2V09A 4K21A 1JZ7A 2ZGKA 4NAOA 5IYYA 2D6PA 2WLQA 2BWCA 4O9EA 3I2HA 3A7QA 1IPJA 2VMFA 2RR13 2O8OA 4M0HA 2ZGTA 5FZDA 5JR7B 4V2WA 4WM7A 4BLJA 5DUXA 1GP4A 3DCQA 3HMYA 1DYKA 5DN2A 4XZPA 5T5OA 2ZHKA 1HIXA 4UW4A 3FE5A 3PJQA 3OPTA 2BV4A 4LPLA 5J7MA 3R6SA 3MIHA 5DMYA 2R043 2BJSA 3AJYA 5I0SA 4KU8A 4X6RB 3U1XA 5FZ3A 4OHYA 4BK5A 4BMBA 2VZPA 3THDA 4Q4W2 4C1XA 4XHBA 2ORZA 1QOSA 2QQIA 3ZDVA 1JMUB 3OF1A 1UO9A 3VDAA 4LHSA 3A0KA 2R1DA 2UY9A 4BDVB 4Q4Y1 5KC6A 3VDBA 4QQOA 1RMU2 3SXWA 3WQ0A 1O5UA 2Q8EA 5C5TA 2ENRA 3H8XA 4YW1A 3N7LA 4BQ2A 1BBT1 3BI3A 5CZKA 3B02A 4HVQA 1CVNA 4BZ4A 2WQ4A 1YRZA 2CHHA 1LHUA 4ES8A 2PLV3 4OUMA 3PLQA 5BNOA 3SISA 4LLFA 1HX6A 1JN2P 4B8EA 2CL2A 1AYN3 2Q1MA 2WNVC 1PM7A 2AYHA 3BPSA 3KHBA 4DOUA 4QB2A 1JYTA 2PAEA 1RXGA 1UKGA 2GDFA 1X9TA 2KD7A 4AFDA 1WLTA 2YG0A 4U2AA 4XUNA 3HD8B 3C2UA 5IFTA 5FYYA 1BJQA 1QJX1 3NO8A 4R4XA 4ATEA 4QQHA 4YVWB 4J1XA 2DVDA 3F2ZA 2X09A 3I7DA 4XACA 1ZZBA 3FWEA 1O59A 3HR9A 4BB3A 4CDWB 2X8KA 4P5YA 2WYSA 4BWOA 4BQYA 2XPJA 4CP1A 1QDCA 1MEC2 2YHJA 3DL3A 4A3XA 1W04A 1D4M1 4I01A 2Y0OA 5HV0A 3JB8A 3HT1A 4R8HA 3ZXAC 2GSYA 2DBIA 1F2NA 4J1WA 4P9WA 1NZIA 4RA0A 4YNIA 2V5DA 3HEIA 3WG4A 3MPBA 1CJPA 1HJFA 4Y1VA 4DEVA 5FWEA 2Y6HA 5FZEA 4MSVA 4YGDA 3V64A 4CU7A 4ZU7A 1LU1A 3WG1A 3ZVXA 2ZKLA 4A4AA 3CIHA 4HXCA 1VBE2 2H6CA 4TLFA 1L7LA 3UYJA 5IK4A 5FZ0A 4JV4A 1F5JA 3TAYA 4LOTA 4B7EA 4AI2A 3LIGA 1R1A3 1MS3A 1V70A 2JENA 2VZTA 3AL6A 2HWC1 2WL1A 1H9WA 5KHHA 4QX3A 3H1MA 1X7NA 3OUJA 2Y6GA 5JWPA 1TME3 3IMNA 3OGRA 4S2HA 4Q0PA 3U4SA 5BNNB 1OT5A 1VBA3 5FYBA 2DCJA 3K4AA 4YVWC 5IJRA 1JYCA 1YHFA 3NMBA 4FPJA 5I0TA 1W2NA 2VBPA 3LPGA 3MIEA 1OUSA 2V4AA 1ND3C 3MGUA 4UXAA 2QQWA 2BBVA 3AZZA 1UU5A 2C5DA 5IVEA 1JTZX 2PHTA 5FPLA 4Q4W3 4Q4V1 5SV8A 3AXEA 4ZXEA 2AENA 3OB8A 1POQA 5EJ1B 3T0BA 3S0MA 1EUUA 2VTXA 5DDJ3 5I0DA 1SFNA 5IK7A 2DWRA 1HW5A 4HSJA 5FPZA 1C1FA 5FZ4A 3K46A 3NNFA 3JU9A 3POWA 1QJZA 3MF9A 4WVMB 5C8CB 4CCLA 3VD4A 1O7FA 1RUC3 2NZ9A 3WDVA 4ET7A 3VB9A 3PL0A 1SG3A 3I3BA 4CDXC 1UQXA 3HIFA 3LB9A 3OGGA 4ZZ5A 4SLIA 3VBHC 1X9PA 5D2AA 1RUH1 1NCRC 3JBG2 4EWEA 1W9FA 3OCPA 5L7OB 3ETPA 4RR3B 2WFPA 3N9PA 3H1WA 4C0BA 3NAPC 2RMU1 1IKPA 3JQXA 2SLIA 4LXLA 5FUNA 3NV2A 2YFZA 4HLTA 2ATFA 2F4PA 2P6CA 4FPOB 5DPNA 4AI8A 4MUVA 3O1OA 1GQHA 5LATA 1K5MA 5AFEA 5CFDA 4XCAA 4Y1ZA 3V0BB 4LMFA 1GANA 1DU3D 1LRHA 2EAKA 3W21A 3ZFGA 1OPOA 4AI1A 1EV11 3CO2A 2YBPA 3W20A 1LOEA 5K0UC 2FMDA 5BNNC 4GWIA 3K2OA 2VNOA 5GLTA 5IWFA 5LBEA 4CP9B 2QQVA 3RJRA 3S5QA 4Y20A 2YBSA 2JKXA 5IK5A 4YGBA 4UFJA 2ZHLA 3WG2A 2YU2A 4XFIA 2CYFA 2WINB 2WQZC 5FY4A 1ULGA 1ST8A 5FYVA 4Q4X1 1GZ9A 5EPAA 4BJ0A 1W2TA 4COUA 1QXPA 5DUUA 3E6BA 3U4XA 3CEWA 5FY5A 5L19A 3BIEA 4BU2A 1S0CA 4C90A 2GH2A 2RS31 1W3VA 3VD5A 4FPLA 1UY2A 2J22A 4XVHA 3FZ3A 3H7YA 4K20A 2ERFA 1UOGA 5F9TA 5LB6A 2GN3A 4AI0A 3KB5A 4FQ4A 4CP0A 4EN9B 1GZTA 4CXWA 5C8CC 1MZFA 2A73B 2A71A 1AJOA 2IXKA 3ALQA 4A2UA 1LGCA 5FZIA 2D7FA 1QKQA 1UN1A 2R041 3IDAA 5A7WB 2GC0A 5A33A 4RR3C 4FT8A 1LOGA 2RDNA 4LIUA 2OZJA 2X5IC 1I9RA 1R64A 3BN6A 2R32A 3NNLA 3POBA 3SCGA 4GULA 1AX1A 3AYDA 3SEPA 1LOFC 3B94A 3EQEA 1QQP3 4UFHA 1CGPA 2KA3A 2VU9A 4OMDA 3SKJE 3AP9A 4L0PA 4E4HA 1EP0A 2W91A 4UBHA 5C3SA 4EWDA 4NWWA 1HJGA 3RZZA 1B09A 2P3YA 5A3TA 5FY1A 4B7KA 4QXKA 4EROA 3L2HA 2R1BA 1J3QA 1G6NA 1H2LA 3OG2A 3QH7A 5JOXA 3D82A 1COV2 4GMP0 4FQZA 5J96B 2IXLA 1F15A 2CDOA 3DUIA 4XABA 1N3OA 3ZPYA 2W94A 2XLGA 3QBQA 2IVIB 4L9BA 1VAKA 4W4ZA 2ZS6B 2WRAA 1ND2C 4FP2A 1DDLA 1S1AA 3BB6A 1FX5A 3WG3A 4H14A 3EMRA 5M0TA 5ISLA 1SFPA 4CDWA 1Q56A 4JAAA 1ZBE3 1H6YA 5GLVA 2PA7A 3WOGA 3VLBB 1F31A 4ZONA 3WF0A 4M3CE 4B29A 1OHFA 1ZVFA 3A22A 4N8MA 2J1AA 2R072 3VBRB 3RZMA 1ZRCA 4AGRA 1YFWA 4QX0A 4N43B 5FR3A 4XBLA 4QKNA 2DU1A 4COWA 4OYUA 5JIAA 1VBD3 1VJ2A 1POV3 1I6XA 1IG3A 1FMD3 3J7NA 4XXPA 1WGPA 3KQ4B 1YQCA 1A6CA 1VBC2 3H8UA 2PAMA 1ZYBA 3WNOA 2ZZJA 1Q8VA 2FDIA 3AM2A 4KGGA 5ANNA 5CEHA 3DYPA 1AHSA 4IDZA 1YC61 3DECA 3NNJA 2VMGA 2DVGA 1R1A1 2EALA 5EQUA 4LHLA 3VBFB 2PQQA 3WDYA 3I54A 5DAXA 5FPVA 4AEKA 4CCKA 3FLPA 2GAUA 4BQ4A 1DBNA 4N53A 1MS4A 2BU9A 4XUQA 4GWMA 2CGOA 2W52A 1YEWA 1LECA 2IWGB 1TME1 4NRQA 5LBCA 2ARCA 3PUHA 1H1IA 3GJBA 1S0BA 4JGYA 5LK5A 5JSPA 4WBBA 1I5PA 1UX6A 4A6SA 4HK8A 2CU5A 2BFUS 5FZKA 3PUSA 1JZ8A 1HLCA 1VMHA 1REFA 5DAQA 4D69A 2QNKA 4CDQB 1AR62 3MW3A 2RS12 2WAAA 4M00A 1GWLA 4OUEA 1W03A 4CZSA 2XVLA 3ZSEA 4FBFA 3O0VA 4Q4W1 2B8MA 2JDUA 2WNOA 3VBRC 1REEA 4GQ7A 2Q1FA 2Y64A 2Z2SB 4BQXA 4CCOA 3C7HA 4Y4YA 4PF5A 4ASKA 4WVMA 2DVBA 4M3CF 5CBLA 1W28A 1LEDA 3NW4A 1PGL2 1TVGA 2CGNA 4P5HA 3IT8A 1RUC1 1T6BX 1JH5A 2YU1A 3POIA 3VGIA 4XDPA 1NT0A 1QH6A 1W6OB 3ME2A 5JXIA 3SLIA 4RN5A 1UPIA 2VW0A 4B4RA 3JB4C 5LY2A 2QQUA 1LESA 2Q8OA 4DUXA 1VRH2 4OHWA 5L7OA 5FZOB 1S0GA 1H1AA 4I0WB 1HDKA 3NKTA 3ZIWA 3WQBA 1U5IA 3WW1A 2VOXA 5IT6A 1WMEA 2VZSA 1CR7A 1FXZA 4AAXA 1WA4A 5F2SA 3SNMA 5HCFA 1AYM3 2PHFA 4MGYE 4Y5TA 5FXXA 2Y60A 3MUY1 1W0PA 4D7TA 3ES1A 3R4SA 2RS52 4TTGA 2NMNA 2EIEA 3MFCA 1C8M2 2BDRA 3E5QA 4Q0QA 1PO23 3PHMA 4HZFA 1DQ0A 3FMGA 1RUJ2 2ILMA 5AC92 1OVPA 1MEC1 1SQ4A 1XPWA 4AI9A 1H4GA 2BYVE 4HVOA 1WWYA 1NXMA 2GC1A 3BCWA 1S0DA 3A4UA 2BTVC 3UGGA 1IHMA 1Y9QA 1HB2A 1HN1A 3J8F3 2ORXA 2V4VA 3I4IA 1UZYA 1XE7A 3OPWA 2HYXA 4QPGB 5ACA2 2BVVA 4JHZA 2UWCA 5LCWL 1S0IA 4NIIA 4BQWA 1A78A 1XNBA 5FZ1A 5I0UA 2LALA 1LHNA 2OS2A 4JRLA 4ORFA 1UZ0A 4IESA 1YFXA 4QPIA 1ODMA 4H7LA 1IS6A 5FIXA 3J7MA 1HQLA 1ZRIA 4RL7A 4YPJA 2J7MA 1VBE1 2C9KA 4HOOA 5F5IA 4L11A 2A5ZA 1UY0A 2E7TA 3I2KA 2YPDA 3POEA 2PFWA 1SCSA 1XSRA 4AAPA 1OKOA 1J59A 4D6QA 4LO6B 1RUOA 3AP4A 2VOTA 1P8JA 1XU1A 3GNEA 3JCIA 3M4FA 3DF0A 4CPBD 3LDKA 2VMDA 3AL5A 3ZSKA 5FO9B 1SLTA 2QUOA 2UWBA 1HRI3 3N7MA 1MZ5A 3MV01 3BTZA 4EJRA 1BMV2 3ZXLA 4LO8A 4CVUA 3GZEA 4FPEA 2JE7A 3ACGA 1QNYA 4WM7B 1YQ2A 3PUQA 1JODA 1OSGA 1JZ6A 4MGZE 3AMQA 3MEPA 4CCCA 1ZRFA 1RINA 4MV2A 1XXNA 5JIUA 5T3NA 3ZN5A 2JDZA 5A7QA 4BXFA 2WN2A 5T54A 2N7GA 3RWNA 4HSLA 4O65A 3TWIA 5A80A 4KMQA 3ZFEB 3D6EA 3O1MA 5HI0A 4FTEA 2IFRA 3GXUA 4V1PA 4XQWA 3IIIA 2B5HA 2QZ2A 1ODNA 5A6QA 5C3RA 2R0HA 2WT0A 5FUPA 1O3QA 2OQ7A 2YYOA 1O4YA 1ZBE1 1BBT3 5CKNA 2B45X 2MHFA 4EWAA 2WFF2 3KZ4C 5EHDA 4AEDC 1CPNA 3I59A 4N43A 3KT7A 4WVVA 1WMXA 4LOSA 1IOAA 3AZYA 2QE3A 2DV9A 3P1IA 5EXOA 3WINE 4I0AA 3BOPA 1POV1 5A3NA 5J09A 1FMD1 1CJDA 1UYPA 3LF7A 2OVUA 1IG0A 2WUHA 5AVPA 2YGLA 1KJRA 2DVFA 4LE3A 2Y6FA 4LLOA 2XLFA 5T52A 3LZZA 4MGIE 2VNGA 2Y26A 1YCIA 1DQ4A 2HLEA 2VQAA 3GGLA 3S7IA 4WM7C 3U14A 3QCWA 1YIPA 3VBFA 4I3GA 1FI2A 2VG9A 1LOAA 4BCUA 1WW7A 3NV1A 2VQ0A 3W5NA 1GYKA 2HBTA 1ZZ7A 3S7EA 5IFPA 5FY0A 1PNFA 3O1UA 5JMOA 4LBMA 1IPKA 2IFWA 1HB1A 2AUYA 2D6KA 4XW3A 3PURA 1NLRA 1OLMA 1CONA 1UXZA 4CU8A 1AVBA 4GJZA 1L7RA 4CP2A 5KXDA 2E31A 4LBNA 2BPA2 3Q8FA 3LEMA 1GICA 5FYSA 4YZ3A 1WW6A 3B3QE 2GP3A 4CDQA 1NG0A 3NV4A 2CY6A 2VQTA 3H3ZA 3N9QA 2XXZA 2HWD2 4META 5A7OA 2DTYA 2UYBA 4LBQB 1W6PA 1OA4A 3VZJA 4QXCA 2UY8A 2WWSA 4Y33A 3ZX7A 5BNOC 3SHRA 4GD4A 5GJ6A 2XLAA 1T2XA 1QEXA 1W3XA 2MEV3 5FK7A 2B46X 2RG4A 4LT5A 4OI1A 2ZGNA 1W8WA 3ZKUA 3K3OA 2F6BA 5CYYA 5I0RA 1JZ5A 1GOGA 1YI7A 2HBUA 3IWZA 1V6OA 5A7PA 5J48A 4OUSA 3O1TA 1UZWA 4W6XA 1UNBA 4G4FA 3OY8A 3R4DB 3TB0A 2YROA 1O8PA 2AH2A 4PDWA 4RYDA 5H9SA 4ATFA 5FZOA 5C8WA 5ABJB 4YW2A 2BEOA 3CMGA 1EAH2 3JUUA 2R6QA 2D40A 4JKLA 4LHKA 3OGSA 3E1F1 3F95A 4XJUA 2LW8A 1BHGA 3ZYGA 2VVDA 4KG0A 3WF2A 2A6XA 1O6UA 4Q4V3 4YFWA 2QTWB 3C8XA 2G1MA 2WO2A 2W47A 1NA1B 4KWLA 2BOIA 4YW7A 1XNDA 2Y6KA 2EA7A 4XF3A 1OD5A 2HEYF 4H7MA 3Q8EA 4YG3A 4C91A 4PIZA 3TN92 1PO21 3K3NA 4QKBA 3WNXA 3AKPA 2VY0A 3JD72 5JOYA 1O5LA 5JI7A 2XJVA 4UFMA 1XB9A 4CXXA 1NUKA 2ZHMA 4PLNA 4F3JA 2GU9A 2VM9A 4XC9A 1RUH3 1RL3A 5A32B 3NV3A 3VHNA 3FN9A 3IPVB 4QPGA 5LA9A 5C4WA 2FDFA 1OLRA 2ZEZA 2RMU3 5LWBA 1ULOA 3DGTA 3KM5A 4FTSA 4K6BA 1BXHA 2E6VA 1VBC1 2VZVA 4RHV3 4Q1PA 1CZSA 2W87A 1C3HA 4JDOA 4ZPIA 4C8DA 2NMOA 1OKQA 4EN8B 1L3JA 1SLAA 1OQ1A 2VUDA 1E5IA 4XAAA 1F8VA 3RRDA 4AGVA 1HV0A 1ZNPA 3T2QA 1FPN2 3FBYA 1K5JA 4E2SA 2P3KA 3TNQA 2XMLA 2VNVA 5FDBA 4K40A 5EWSA 1Y3TA 4FPHA 4AE2A 4Y20B 3ASIA 1Q3EA 1ZM1A 1SCRA 1N1SA 2V73A 4TYSA 3RFRA 1ZREA 4XYXA 3VV1A 1RUG3 2ARAA 2ZGQA 3HPNA 4AFBA 2JG8A 3MICA 4P9LA 3OGJA 4Q4X3 2ID4A 2JD4A 1BK0A 5FUIA 1BEV2 2NPIA 4QQPA 5B2GB 3PUAA 1JOPA 1LCLA 4NHKA 4XF4A 4GIQA 1R082 4LK6A 4LITA 4BXSV 2NLRA 4FFFA 5A6YA 5JLVA 1VBB2 4DIQA 2LM3A 2YGMA 3MI8A 1HB4A 4FOQA 4PJYA 1GWMA 1WW4A 1AR61 1Y4WA 2IZWA 1AUYA 1K45A 2RS11 4ARXA 2HWD3 4NIGA 3MDPA 1C28A 2XHNA 2ETEA 4IW3A 4URTA 4NRMA 3WF3A 1YXWA 3J4UH 3DKQA 4CPBA 1J1TA 4NPLA 5B4NA 4Z82A 1OF3A 2QCSB 4P14A 2Q8CA 4QPYA 3ZYBA 1MACA 2D3SA 2PHUA 3PVEA 4MXVA 4Y4RA 5A33B 1GNYA 4XIKA 4DY5A 3ZSJA 1FOD2 1XNCA 5F6LB 3HAGA 1WCQA 4DNYA 4QX7A 2GZWA 5FZCA 1PGL1 2RVAA 1XBFA 3MLJA 3ZFEA 1QOTA 1PO13 2CNAA 3A23A 2XDVA 2YBKA 1K5MC 2EAAA 4A45A 1F9KA 1C5IA 3WXPA 3ZN6A 1ACCA 2WS92 5BY5A 5CFDC 4Z07A 1ULDA 1VRH1 3I3EA 3ZFGC 4DXSA 5GM0A 5FZ8A 5C70A 2JDMA 1JS9A 3OBAA 1Q8OA 3MO4A 4MHUA 3OTFA 4DRRA 3SH3A 2FBEA 3B9IA 4QHZA 1HV1A 4QX1A 1US3A 2IVJA 1DZTA 2ZEYA 5FFOC 4GWJA 4IEZA 4LEJA 1VB2A 2EIBA 2OPWA 3M7AA 3UJOA 4Y26A 3BTXA 2VBBA 2ET7A 3KF3A 3KV6A 1JYIA 2XBO3 1QWRA 3VZOA 2ZJCA 3ZKYA 4DY3A 1RJ8A 1YNAA 2RDSA 2VGDA 4MZUA 4QU2A 3UGHA 3U0ZA 1UMHA 3UKVA 3T2TA 1RUJ1 2IXJA 2YZ4A 1KEXA 4PBPA 5FP9A 4COZA 1XNAA 4MXWB 3IIAA 4AHYA 5G04L 2D3RA 4B1LA 5K9YA 1SMVA 4ZU5A 2VULA 2E7QA 3POGA 4RGGA 3A21A 1IQDC 1NQJA 3I49A 2BP6A 3LSDA 1QDOA 3HNMA 4MX3A 1UOBA 1UL9A 1WBLA 2BW8A 1DZQA 1YQ8A 4XFFA 1W39A 3N3HA 3ZXGA 5KWRA 2J1UA 2AC1A 2DUQA 4AFMA 2D6MA 4NIDA 4CCEA 5DUVA 1T6GC 4QMAA 5KR7A 4XETA 4Q8KA 4NAMA 2G9FA 5F1RA 2C26A 4XJWA 3WD5A 2GN7A 1W8HA 2R7EB 1PK6A 2YMZA 1YIFA 1ASJ2 1XE0A 4GB32 4LBQA 3KSCA 5DXDA 3ZYFA 2ZGSA 1PIV2 3QOPA 5FPXA 3EJKA 3FL7A 3KVBA 2B9UA 1PNGA 1UAIA 1Z7S2 1NAEA 2D3PA 2KXLA 3M8LA 1BEV3 2MEV1 1SLBA 1LHVA 4NOTA 3ZXDA 2ADEA 4WM8A 4DMIA 1GNZA 4DB5A 2XJPA 2Y6LA 4N53B 1OUXA 4YW3A 1IS5A 4RQPA 5FREA 1LB2A 1VB4A 1LGBA 4CDUB 4JGYB 3KLSA 1UCXA 1NYWA 3N9MA 4LUKA 5ABJA 3AZXA 3SITA 1YJKA 3NJVA 4LKSA 1F4AA 2P4EA 1PX3A 4GAZA 2DVAA 2E7AA 4MO3M 2XKOA 1GP5A 3WHTA 1CX1A 4BOWA 4CDWC 5BNPB 1V6NA 2OIIA 3WDTA 1IQAA 2EIDA 4GJYA 1ULEA 4YZ5A 3AC0A 4M4RA 4ISQA 4UF0B 2PHRA 3RGBA 3SKVA 2QQPA 2D93A 1NA1A 5EP9A 3MBWA 3BOWA 4RS5A 3WUCA 1RUF2 4QGLA 1N47A 3CZUA 4QX2A 2W95A 2L9LA 1RUE2 4AGGA 5KHGA 1RMU3 4R52A 5FQ0B 4I0BA 2DURA 2VVFA 1AF9A 5LA0A 2VXRA 4DRVA 2XJSA 5F37A 5C5UA 2BNOA 1KJLA 1QJU2 4QB6A 2WFF1 3CBNA 3FHAA 5A32A 3KVAA 5FBJA 3IPVA 3LCPA 3P3NA 2R49A 1QU0A 2W0XA 4Q0VA 2GH8A 1J3RA 4HONA 3UGFA 4P9YA 2FDKA 3WW3A 4Y5SA 4XUTA 3ILFA 2BNMA 4RHV1 1M4WA 1SEFA 3AFGA 2AREA 4XJ9A 2OPKA 5LBBA 4N53C 1S2BA 2AACA 4IXLA 4J6GA 3K4ZA 5HXMA 3OJBA 1DP0A 3KCYA 4ES9A 1AR82 5J36A 4DPNA 4Y1XA 5A1LA 1W9WA 2GMMA 3WNNA 4JGYC 4BH9A 3AMHA 3ACFA 2WQ8A 1F4HA 3C7OA 4AFAA 3PJYA 4CUAA 1MPXA 2JWPA 3N9OA 1LNSA 2I2SA 1MEC3 1PZ8A 1RUG1 2VZUA 2PYTA 3IZOA 5CFCA 5HCHA 4PLMA 2D97A 2DFCA 1OOPB 5FJHA 5J1XA 5JSOA 1AR92 4BYYA 2JKBA 4EYUA 2D5FA 4JKMA 1PVC2 3U07A 2DCYA 2A75A 4M3CA 4IEOA 4OULA 3V65A 5C33A 3GZAA 2QZ3A 1TMF2 1ULFA 1G8WA 1OFSA 4QKDA 3URFA 1RUI2 3EHKA 4KBZA 4KL1A 5BYNA 3THCA 1RUNA 4QPIB 3GCWA 1LTEA 3I2DA 3KCXA 1EUTA 2JB8A 4FXGB 3T30A 2HWD1 1VBE3 1VPHA 1UOFA 2RM22 3KWVA 4UW6A 4WV8A 4XMIA 1JYVA 2Y38A 4QGNA 1QGLA 3B00A 4CE8A 5JOZA 4XQ4A 3KMHA 1N3PA 5L7OC 1RJ7A 1VMFA 2CAUA 3VL9A 1WCSA 3HN1A 2D6NA 1KQRA 4IETA 4KI5M 5FZBA 2D5HA 1KDKA 2ZTNA 4LA2A 3H1YA 5DG1A 5FZGA 1O3RA 1DF0A 1QMJA 4IQPA 4ISRA 4CEYA 1TNFA 1PO11 2Q4SA 3ENRA 1PGW2 1YQ6A 3VBUB 5D8AA 4LBKA 3TNPB 1WLCA 5E8AA 3V56A 2JJ6A 4Z8BA 4NJ4A 4NUBA 3WW4A 3W59A 2WC2A 5FZLA 4A6OA 4OZXA 4LJHA 1VIWB 3B9CA 1U5YA 1UXXX 4GH4B 2ES3A 4W50A 1XRUA 3I3DA 2VL4A 2DDUA 4XPVA 4XJZA 1Q5OA 1SBFA 1KFXL 4XOGA 4YW4A 3VKLA 1APNA 3J9SA 1RUF3 4QHBA 5JPNB 1EPZA 4YG0A 5ERLA 3WT3A 1RUE3 3MPPG 3KS7A 2XBO1 4N7UA 3GALA 1UMIA 4A7ZA 5L36A 3TN91 3ECQA 3DYOA 4FOWA 4H55A 3OEBA 2H0BA 5JR2A 4WZCA 2DUOA 1G9AA 4MXWA 4A44A 2XJQA 5JPMB 4QPIC 2JECA 3AFKA 1XQNA 4INDA 5FYUA 4IE6A 5CKQA 4BM8A 3VD7A 3Q8BA 3I3QA 1H8TB 3CNAA 4UW3A 3JBG3 4QDQA 2XVKA 1NLSA 3WZ1A 4JVAA 4XFBA 4FOYA 2HWE2 2WIIB 1WCUA 4IE4A 4XJ8A 4JC1A 1CWPA 4OMCA 2CGPA 3RZLA 1PX4A 3I59B 2I07B 1QF3A 1DQ1A 2TUNA 5GLWA 4DUVA 5JZGB 1I1EA 2ZMNA 5DG2A 1BQPA 5A7SA 3VBHA 4H2AA 3WP4A 1TEIA 2A3XA 2ARXA 3ZMNA 2VMIA 4GMP1 3KV9A 2PHLA 1FPN1 4YVSA 1HRV2 2O8QA 4IGPA 4AK3A 2R16A 1V6JA 1W99A 3ON7A 3S6PA 1CIWA 2HYKA 3PUIA 5A7NA 2O0OA 5ANQA 1DQ5A 3I2IA 4Y22B 2ZGMA 3CF6E 1W8UA 2P6HA 2FHRA 3MW4A 1BEV1 4IEXA 1JYXA 4QGMA 1JXNA 2VCAA 3HNYM 2BFUL 3GM8A 4JQRA 4CA9A 1R081 4AOCA 1RUD2 1LR5A 2KM2A 3ZYHA 4ZZ8A 1CQ9A 1VBB1 3K77A 1FV3A 1TQ5A 4R9DA 3X29B 5TSWA 4CDUA 1MS1A 4LO4B 4L8QA 1HXS2 3LDRA 1MQTA 2Q30A 3JQWA 4PI0A 3J26N 5K7PA 3RZHA 2DCZA 3IKWA 4NPRA 1SLCA 2OA2A 4GKXA 5BNPA 2J1TA 2HEVF 3CJIA 4ASLA 4XBNA 4CTEA 2JX9A 1AR72 2PHDA 4UF0A 3WV6A 1NX9A 2WO7A 1FOD1 1W6PB 1TE1B 1E57A 4XF1A 4HKOA 5FTTC 2JICA 2QFEA 4WVWA 1XOYA 4EN0A 4QM8A 2VOKA 1UZVA 2WWUA 1D2QA 4N43C 4F8AA 2BZDA 1PZ7A 5FQ0A 1NE6A 1RMU1 3VBSA 3ZXEA 2WS91 1YUDA 4JGZB 2HWF2 2FCUA 3LIHA 2ZBJA 1W9YA 2QVSB 4JDNA 4AI3A 5HCBA 2OXBA 2R0FA 4OI4A 1SACA 4G3YC 3T2PA 1PGSA 2TBVA 4CYDA 3OY8B 2IC1A 4PDWB 2P5BA 2VZ1A 4EQVA 3UKTA 4IGQA 4XF9A 3OSDA 2HJIA 1LU2A 2NYYA 2WT2A 1COV3 2XL9A 2WWJA 2YV8A 4NHYA 4D3WA 3VBFC 3UT0A 3ZMOA 1IZ3A 2IUWA 2VTXJ 2ZCWA 5LEKA 2FCVA 3CJXA 4BQ3A 1TZOA 1GZCA 4KWJA 4OHXA 1UYYA 1YFYA 4YZ1A 3RI9A 4IGOA 5FAXA 3WNPA 4AR2A 2YC0A 1UYZA 4Q4Y2 3ZYIB 1QJEA 1YJLA 2TNFA 2UWAA 1G7YA 5LRSA 5DUWA 1LODA 5F6KA 2GNBA 3MIDA 4I3PA 4YW6A 4I2OA 5A3OA 5HBAA 3VHOA 4FVVA 2WO3A 1A8MA 3D8CA 4OHZA 5GLZA 4QT6A 2CWMA 2LROA 1AXZA 1JU3A 4K9SA 4KH9A 4UW5A 4CDQC 2DCKA 3DXTA 3B01A 1OOPA 1A34A 2R073 2ET1A 5A3WA 2HWB2 2Z42A 4P02B 1H9PA 3HBZA 3J7HA 3EB7A 1I5ZA 1U5ZA 2ZA9A 3TBDA 2J1VA 5C4WB 4LBJA 1GZWA 3I3MA 4QPWA 3G6JB 4NVPA 1A8DA 5FZHA 1VBC3 1XSQA 4PHZA 1HRV3 5DZGA 2LUWA 3LEGA 3R4UA 2VCBA 3AJZA 2PHWA 4X8PA 1ASJ1 1NCQB 1QJX2 2B39A 5H9QA 1PIV1 1QNWA 4XQDA 5KXBA 5J37A 3IDCB 4LKFA 1GFF2 4NR1A 3A0NA 3MFAA 5FZFA 1Z7S1 1BK1A 4NO4A 1C57A 3ZSLA 1CAXB 4PDWC 3ROUA 5BV6A 1NXD1 4HPKB 1GUIA 5IVCA 4NWVA 3INAA 5T55A 4BISA 4YSFA 4OI2A 3AMMA 1D4M2 4IEQA 3U10A 3E5XA 2JG8B 3MZHA 4WVZA 3VBUA 5FY8A 3VHPA 5A1AA 4ZKTB 4JCKA 4QD2A 1R092 5HV4A 3GJAA 3VZNA 4FAHA 1E5RA 5A1FA 3S57A 5BNQA 3D0JA 4XHXA 1ZZ8A 2K0GA 1AR63 4GH4A 1W2UA 2RS13 2E51A 2WNUB 4BQ5A 1DYPA 2YY1A 5DQ0A 4S2DA 3RDIA 1BCXA 5JXHA 1UOJA 5EJZB 3PTYA 1RUF1 2RE9A 5BXXA 1V6KA 1XJAA 4FFGA 4GXLA 4R9AA 4QPGC 5DZEA 5C4WC 3KHCA 1RUE1 1OURA 2RDQA 2ZEXA 2HWC2 4R9BA 4B3NA 1BZWA 1G86A 5C3PA 4RGAA 4PIYA 1K42A 1U12A 2CV6A 2WA3A 3RMXA 3OGVA 1QJU1 1W8FA 3ZOIA 4DO0A 3LKJA 1ZBA2 3E97A 2OT7A 1NZCA 4UFLA 1FNYA 1H8TA 4YM2A 3ZN6B 3AX4A 4CU6A 1VRH3 1DCSA 4EZHA 3MIGA 3JBG1 2WZ8A 1OA2A 3WQ7A 4IV1B 2OYZA 5F3GA 1YYNA 3TOJA 1W0OA 2IXHA 4TXWA 5FP8A 3AKTA 3W5MA 1U5XA 1GU3A 5JZGA 1XE8A 3FFQA 3MHZA 1NY72 4Q26A 2XUMA 4P08A 4NHLA 2JG8C 4YFZA 4AVTA 2AGSA 4YZ2A 2RS53 1W6NB 1SPPA 2P3IA 3RZJA 3RYKA 3APBA 2Y0IA 1C8M3 1W8ZA 2C4XA 2H0VA 2XONA 3M2MA 3PDQA 4MGKE 4OHVA 5GLUA 4XBQA 4Y3OA 1PHMA 4XCBA 4P9IA 4AEMA 3LA7A 4AG4A 2VMEA 1RUJ3 1HKDA 5FP3A 4ZS2A 4FI9A 5AC93 3VDDB 4CEWA 4RSUA 4Y22A 3O7OA 1RVF2 5C9AB 1WMFA 2WNUC 4L99A 3LPFA 5FMOS 1IGOA 2ZAHA 4MYEA 2D98A 2ZZQA 2Q5TA 4P9GA 1DHKB 5ACA3 5I8YA 1MVQA 2JIGA 4MVTA 1CAUA 5FOBB 4QDSA 3I2OA 5FO7B 2RJ2A 1QJY2 1N1VA 4I02A 3IM0A 2NP0A 4XZUG 2ZX0A 4N9HA 2JIJA 1FT9A 2ZPXA 1RUI1 2JG9B 2GALA 3AXDA 3JXSA 3T0DA 1ULCA 2LS6A 5CIRA 2C9AA 2WKKA 2B9VA 3I97A 3ZFEC 1EV12 3RNSA 4AVVA 1BVVA 3ETQA 3ZLIA 3HBKA 5KBFA 4LUMA 5JMCA 2PTMA 4AYUA 4DUWA 3B69A 3NL1A 1UZZA 2YPJA 1PK6B 3ZFFB 1GQPA 1CESA 3E5UA 4Q29A 5IHRA 1F35A 4D0QA 4ONUA 3M3QA 3AKSA 2JDPA 4YARA 1FV2A 2XB6C 3VBOB 2VCCA 3DYMA 3OBTA 1DGWA 1WW5A 2D6LX 3ACLA 4IE5A 4K8RB 1VALA 1C1LA 5FYHA 1W6MA 5LEJA 5KHIA 1B35B 1PGW1 1G9CA 1XNKA 1J83A 2QQLA 3IB3A 4WM8B 1GOFA 4JGZA 4DFSA 4XURA 1R093 3TYJA 1GNHA 1V0AA 3HN3A 5GZDA 4DEQA 4IV3A 2CAVA 1N1TA 4RQPB 2RR12 1SDWA 3FUQA 5B4XA 5C3QA 1ONAA 1OMIA 5FYTA 3OD4A 3U37A 3POSA 1CAWB 1COV1 4LA3A 5A3UA 4N9IA 4JHTA 3O0WA 1JYNA 3N9LA 4KQ7A 1H6XA 2R042 3LEKA 4TLGA 3ZXKA 4AEJA 4JDMA 4FAGA 3ELNA 3LE0A 4ZXKA 4FPCA 4RS5B 5I93A 4XTPA 5LA2A 2VUAA 2ZAAA 3QD6A 4IEVA 5CNAA 5IVFA 4OVEA 1TNRA 1RITA 4KBBA 4LO5B 2JDHA 2JXAA 3M3EA 5DAPA 5FBZA 5FZMA 1H1MA 4OQ9A 2GMEA 1Z0HA 5FMBA 2WFF3 1SBDA 1V6MA 1PK6C 1SHWB 2HWE1 2PLV2 3HJRA 5FYMA 2R071 4TN7A 2BGCA 1OD3A 3NNGA 3NNMA 3PMSA 1AYN2 5F2WA 3T3YA 4LE4A 2VO5A 1UX7A 3O14A 5J98B 4D6SA 4XDOA 1QXJA 2ZGPA 3H42B 5FPAA 1HRV1 4WM8C 2WBKA 1ENRA 3PTRB 3LOIA 3U78A 3ZR6A 3CHXA 1NCQA 3EYPA 1JZ3A 4YGEA 1AX0A 2MPFA 1JHJA 5FY9A 1D2SA 4GWNA 4RQPC 3VKFC 1GLHA 1UY4A 1Y9GA 2C6SA 1CAXA 2F17A 4XUOA 5ABJC 5I91A 4XEZA 4HPKA 4HETA 4AL9A 2WA4A 3C7EA 1O8SA 2BOJA 3I2FA 4Q2FA 2ZEWA 5K8SA 1H2KA 2OUHA 5FMDA 1RUD1 4QDRA 5GZFA 4URAA 3AMNA 5CFCB 5IATA 4BMEA 1YWKA 1NA1C 2D44A 4A3ZA 2LRPA 3NJXA 2DYCA 4MLOA 4RS5C 4M3CB 2H6BA 2X05A 1HXS1 1RYYA 2DF7A 2RJLA 3H9AA 4QKFA 3GF6A 3FLTA 5FZ6A 2WSVA 3UESA 5FLHA 3GBWA 2MNGA 2XWJB 1G9FA 3TRSB 2WNUA 2HKXA 2IXIA 2W5FA 4GALA 4XTMA 3GBFA 2EXHA 2BGOA 4QWNA 1UKRA 1Q43A 4MGQA 4FPFA 4QB1A 5F39A 3VZLA 3DXUA 2WNVB 3HVDA 4ITCA 4BA6A 3MIFA 5FV3A 5JUVA 1R1A2 4NHXA 4E2QA 5JAXA 4CUGA 3G7DA 1R1ZA 3PU8A 1W6QA 4NHMA 2FD8A 3GCXA 4Q5OA 1DGRA 2EICA 2HWF1 1V9U2 4FSJA 4CEYB 1TME2 3KGZA 2QQKA 1J1LA 5D8AB 2XL7A 3AVSA 3LGRA 5IW0A 1LOCA 1VBA2 3N35A 5A6XA 1LAJA 5CADA 4OI0A 1LULA 2J1RA 1KFUL 1EAH3 3FBMA 3OPZA 4IV1A 4DXRA 2C0ZA 2W2IA 2E33A 2O1QA 1VAMA 2VZRA 2FMYA 2WLPA 2BRTA 5F5QA 3ZM8A 3SCHA 4DZGA 3KCCA 4CU9A 4QX8A 2FDHA 4LBOA 4IERA 4OFGA 4EE2A 5CA6A 2W68A 4RFRB 5CFCC 1W6NA 1NKGA 3PVBB 3ST7A 3WP3A 2RS51 1VE0A 5DDJ2 1E5HA 1C8M1 1N3QA 3VZKA 3OUHA 1QJFA 1H2MA 3M70A 3N9NA 4PT6A 3TN93 3VHRA 2E26A 2OX0A 2VW1A 4UT5A 4KNCA 1RUC2 2W1UA 4KWUA 3JD73 3VDDA 5AC91 3OOXA 1MR5A 5C9AA 1VP6A 1XYPA 5FPBA 3CLPA 3VL8A 2HWB1 3OBRA 2G19A 5FYZA 3AVRA 2E32A 2VTFA 5KHJA 4PF1A 3S30A 4MGTA 5E16A 5ACA1 1JYWA 1LGNA 2ZOEB 4O61A 2RHPA 4DXTA 1J58A 1S2KA 1O4TA 2WO1A 2Y6JA 4XFGA 5K4LA 3LSEA 3EBRA 3USUB 5I8TA 3B5LB 2A3YA 2XR4A 3KD4A 2JG9A 4NROA 1IPSA 4A41A 3MLKA 2A6ZA 3NKGA 2D43A 1JZ4A 2B7YA 3FX3A 1FYUA 2VW2A 3M1HA 4RFT0 3WLUA 4K3UA 3I8TA 4X6QB 4CEYC 1NOVA 4GMP3 1Q8PA 1KITA 2UU8A 1FPN3 2V72A 2XHKA 2YXSA 3CU7A 5D8AC 1OA3A 1PVXA 4HN0A 3EO6A 4YVSB 4CUBA 1ENSA 4GKYA 1ALYA 3ZFFA 1ND3B 4W65A 3LQCA 4B4QA 3AYCA 3P5BA 3BYWA 4AQSA 2Y8KA 3VBOA 2ADDA 2J1SA 2BUKA 4FTBA 3O12A 3ZIXA 1YO8A 1C4RA 3WUDA 1B35A 4FXKB 4PQ9A 3DPRA 3WR0A 4E4DX 3LEIA 2VR4A 1R083 3RJ2X 3SCFA 4JTOA 2EXJA 1R091 3C7FA 4PBOA 5T5PA 3USSA 1MZ6A 4LQRA 1CZTA 1BMV1 1VBB3 2XOMA 4MOAA 4P00B 3RWKX 4IE0A 4C0HA 4CDXB 4PQQA 2X10A 1JOJA 4JRAA 3NJZA 3VBHB 2WZR2 3ZYRA 4B1MA 1AX2A 1MQTB 1WUVA 1CAWA 1NCRB 3AYAA 2R062 4XXAA 3THTA 1AL22 2VC9A 2B42B 2XWBB 2OW4A 5HPOA 3NAPB 2W3JA 3CJIB 5C71A 3GHNA 2JDAA 3CZJA 1FOD3 2ZMLA 1DZRA 3RYRA 3POYA 1YFUA 4CUCA 1RIRA 2W92A 1V9U3 2VZ3A 2ZMKA 3PIGA 4ZU4A 1JOBA 3N4MA 3VZMA 1QQP2 3I2JA 1DLLA 1ZBA1 2P2KA 4HKWA 4XAEA 4CCMA 1PM4A 5K0UB 2WS93 3TEZA 3VBSB 4FOVA 2EVXA 1OLQA 5IAVA 4LHNA 4E4ZA 3FHIB 2LTNA 4UFIA 1DGRN 5G05L 4YVSC 3IBMA 1W8TA 2EXKA 1WLWA 1QIQA 4DXZA 1BLZA 5CB7A 3O1VA 1UF2C 1XYOA 3MIBA 2ZGRA 3NJYA 1G9DA 3VD3A 1AL0G 4TSVA 1NQDA 3H8RA 3PNAA 1NY71 5FKCA 4COVA 1YQ5A 5KC5A 1STMA 1O91A 1RGSA 4QHOA 5D1IA 5C3OA 4S2FA 4UBGA 5LY1A 1UIJA 1HQNA 5J3UA 1UPSA 1N1YA 3HWJA 3MW2A 1OVSA 3Q9OA 2WT1A 1WMDA 3HT2A 3T4HB 4E4SA 2ZKNA 3K51A 1CAVB 4CDUC 3WF4A 1ENQA 1RVF1 2XH6A 3WNKA 4HL0A 4OCTA 2Q1ZB 4BK4A 4D7SA 1MQTC 3AMPA 3R05A 1K3IA 1LOBA 5GKAC 3VN4A 1ZX5A 1ZBE2 2VUCA 3VKNA 1PMJX 4YM0A 2X5IB 1QJY1 3CJIC 1WD3A 4U36A 4CCNA 5BNPC 1K12A 2CWSA 1PMIA 1WBFA 2VCMA 4OZOA 1C5HA 4Q0SA 1S4CA 5F3IA 5FZ9A 3T2OA 3I2GA 1VBD2 5FZ7A 5GZEA 2EF6A 1FMD2 4BIFA 5JVVA 3V0AA 1GZWB 5FPUA 1X8MA 1GR3A 5FK8A 2GNMA 5F5CA 5A6ZA 1XC6A 3T09A 1W0NA 4IEYA 2VAUA 5CVRA 3VBSC 3H50A 3D0SA 1NLQA 2Q8DA 1ASJ3 4H3WA 2VBDA 2WZEA 4GB33 1GWKA 1PIV3 1DQ2A 4KWKA 4O7XA 2WNVA 1KXGA 3TEYA 1Z7S3 3H8OA 3ITQA 3HOBA 2FDJA 2WDBA 4XF0A 1CIYA 4AZZA 4F83A 1F5FA 5BUVA 4FPYA 4E8DA 5DAVA 2R30A 1ZA4A 1QXRA 5L9RA 3B7MA 1ND2B 4AVBA 2VPVA 2Y34A 2E63A 2BVBA 2XJRA 1Q8QA 1J84A 3OD0A 1EPWA 2E9QA 2RR11 2BGPA 2Z79A 1YLLA 2W1WA 3ES4A 5F5AA 3RMYA 2WZR3 4XMAA 3KT4A 4QXHA 1QHDA 1EAH1 3O5SA 1IKQA 3UJQA 5F7UA 2R063 3SH5A 1AL23 3D4KA 3T1LA 2OQ6A 4Q1RA 4YW5A 2VQUA 1LENA 4NIHA 3RPQA 2VVEA 2YC2A 4I09A 2NM1A 4V2VA 5LBFA 4FO9A 1J3PA 3T4VA 5CAZA 1PZ9A 1H4HA 3KV4A 1XYNA 2VMHA 3OEAA 4NRPA 1V6IA 1AXYA 1UIKA 2VZOA 1OOPC 3LAGA 4L97A 4UAPA 4WZFA 3BTAA 3OUIA 4JKKA 4IEUA 4O9GA 4QU1A 4CRQA 1MS5A 5H9RA 4JQTA 4QQ2A 4Z2AA 5IK8A 4Y24A 2YB7A 1E5SA 2VNRA 4W6WA 4Q0UA 1KS4A 2BQPA 1WD4A 1LHOA 5EFUA 1BKZA 5FY7A 2TEPA 5C6CA 2QBXA 2FQPA 3JD71 1QJU3 3IAQA 3PMEA 5LRRA 5L9VA 5CG8A 1OQEA 4ZHNA 2PLV1 4R4ZA 1V6LA 4KU7A 2A6YA 4EN7B 2VUJA 3IMMA 3KGLA 5CU1A 4XJAA 1AYN1 1VMJA 3J7LA 2NQYA 1KGYA 3USUA 1NE4A 4EN6B 5GZCA 2WN3A 2Z69A 1DIWA 3N7JA 3MUZ1 1WLDA 1OPMA 1URXA 4PIXA 2QJVA 4D94A 5IAXA 2VJXA 4LK7A 5APAA 5A3MA 1O3SA 2DUPA 1AYM2 1RXFA 2QDRA 4Q27A 4Y5Z0 1CD3G 3RG0A 2AZ5A 4N90A 4YVWA 2JB4A 3NRUA 1AR83 3HQXA 1SPPB 3PIJA 5E89A 3VBUC 1FATA 1FNZA 1DG6A 1GQGA 1LHWA 2RV9A 3NVCA 1VAVA 3P6BA 2AR6A 4HMZA 3ZYJB 2QQJA 5GZGA 1LKNA 1ND3A 4QQLA 1PO22 3E6DA 3PU3A 5F32A 1UMZA 2V5YA 3THPA 3DN7A 3O1PA 3BALA 5EIYB 5JOWA 2I45A 4XFAA 5GALA 2PHXA 3WQ1A 4CEWB 5A70A 4GH4C 2IXCA 4NN0A 3WF1A 1AR93 3J8F2 3KQRA 4XFHA 1PVC3 2P1BA 5IUQA 1CAUB 3HNBM 2FZ1A 3LWCA 3P3PA 4HANA 3BTYA 1W05A 4YZ4A 4OLLA 2XUEA 1TMF3 3AB0A 4LNVA 3CL1A 3Q8AA 2WABA 2K2SA 4CDXA 1RUI3 4XFCA 1MZEA 2QQNA 3GBGA 5FXWA 3WDXA 5A3LA 2Q0AA 3PVOA 3VD9A
chains in the Genus database with same CATH topology
1IS3A 4LBLA 1CN1A 1NCRA 2RM23 3M3CA 1RHI2 5FO8B 1U0AA 4LO7A 3E6CC 3NAPA 1H8TC 1JW6A 1X8EA 4ASMB 3LOBA 4BIOA 4N7IA 1V9U1 4AHZA 3WY6A 5FCCA 3BPZA 1W6MB 1WCDJ 5JZGC 2GNTA 2GMPA 5K0UA 3GYDA 5E1RA 5BNNA 1DGWX 1GSLA 3UV9A 1VBA1 1HRI2 1D0HA 5AVAA 1AZDA 2XKPA 2ARBA 4IV3B 1OI6A 2BWAA 1OQDA 4K1YA 1A3KA 4B4PA 4LULA 1SLIA 3H0OA 4YYOA 4CEWC 1ENXA 5EYYA 1GKBA 1SFYA 5DDJ1 3OYWB 4AF9A 3WHUA 2D6OX 3EXUA 3B93A 5C8CA 1MS0A 1RC6A 3C3VA 3AP5A 2P34A 1CAVA 4HT1T 5EYXA 1Y7BA 1REDA 2ZGLA 2RJKA 4FPKA 5HXVA 3K48A 4M01A 2PAKA 4LTAA 4RR3A 1BBT2 1ZZ9A 2X5IA 4BE3A 3IDBB 4HFSA 2W39A 4FPGA 2HWE3 1IS4A 5JI9A 4E27A 1LOFA 3ZXJA 2X53S 4AVCA 3MYXA 5T50A 3V0BA 3AKRA 2C1FA 4E9KA 3VKMA 4YM3A 1DQ6A 2JE9A 5KXCA 1JUHA 4JGZC 1SBEA 2ZGOA 2QDNA 4GB31 3IDEA 1LJ7A 2XJTA 1VR3A 3WP6A 1OFNA 1EY2A 4IV3C 3SMHA 3H7JA 2G9GA 3ILRA 3AKQA 4TZDA 5FLIA 5FOJB 1ZZCA 2WNEA 4AXOA 4BPZA 1QH7A 2A6WA 3ZO0B 4MH0E 4IEWA 4Q8LA 1ND2A 3UL2A 5BPXA 1RUD3 2A6VA 5JDBA 1X82A 5FRAA 5H9PA 3BODA 5FLJA 4TWTA 5JSRA 1HXS3 1X36A 2WZR1 2UYAA 4K8FA 1UW8A 4S2GA 3L2YA 1RHI3 2G4IA 2R061 4D7YA 3ZYPA 1AL21 1O4ZA 3BIWE 1KS5A 4DMIA 4HKLA 1RB8G 3GZTB 1AR73 4AEDB 1HQWA 3T1MA 3JZVA 3AZWA 1S0EA 4L92A 4SBVA 4M0NA 2K9ZA 4HBNA 1JHNA 1QY4A 2MEV2 1QQP1 5JCTA 3GZUC 2W08A 4DINB 1W6QB 3VUOA 3PVNA 2E53A 2HWF3 3VKOA 2CTVA 4QM9A 5EJ3A 1XU2A 1FAYA 4YGCA 4A7YA 1I3HA 4EV0A 1NCQC 3R0RA 4F7ZA 2P3JA 1POV0 4C1WA 1KRIA 2BNNA 1MVEA 1ZZ6A 4AVSA 2ZGUA 3WCRA 1V00A 3FC0A 2WZPP 4AHWA 5AFBA 3FLRA 1CPMA 4Q4V2 4AQ6A 2WSUA 1ZRRA 5T5JA 5FMOL 1AR81 4Y1YA 4IL7A 4Q4Y3 4PLOA 4K7JA 1C8NA 1JBCA 1GBGA 2DCTA 3WX5A 3RYPA 4FP3A 5KXEA 2QKDA 1X50A 5I8SA 1G9BA 3QH6A 4BHPA 3AP6A 5HCAA 2VOVA 3VBRA 2HWB3 5BNOB 1RUH2 1SLLA 1AR91 3WDWA 3WVJA 1PVC1 1VBD1 3H3UA 2GC2A 3NO8A 2YUEA 2RMU2 2PELA 1Z78A 3W58A 5SV5A 3D5OA 2OUJA 1TMF1 4RHV2 3N36A 3NWKA 3AYEA 2FZ2A 3SH4A 5T5LA 1H30A 2A70A 2P17A 2NN8A 4COYA 1QJX3 1S55A 1H8VA 2RM21 2XGXA 2Z5WA 1EYBA 1D4VB 2UURA 2ZX3A 1AXKA 2ZHNA 4LBQD 4IV1C 4E2GA 3ATGA 4QX5A 1DGLA 1RUG2 4I30A 3RQ0A 1UU6A 1D4M3 4BQ1A 3AZVA 2WJSA 4Q4X2 1H0BA 3RI8A 3ZSMA 2VOWA 4A7KA 5EV7A 3UK9A 4AFCA 3DPRB 3KT1A 5KHKA 4YM1A 2RS32 3O0XA 1GV9A 4XILA 4BLIA 1S0JA 3RS6A 2XG3A 1LEMA 4L2NA 4R9CA 1MS8A 4DS0A 1CX4A 2DU0A 1Y43B 3FFZA 5L73A 5CG9A 3M3IA 3W9AA 3VDDC 4X8NA 2X29A 2GC3A 5C9AC 3MF6A 4IEPA 3AK0A 2OZ6A 2ZX4A 3LA2A 4YRDA 3OYWA 3ILNA 1MS9A 2HWC3 4Z92B 3WW2A 4KGQA 4AWDA 1O3TA 4XIOA 4G9SB 1W6OA 1PO12 3FUOA 2JG9C 1ZBA3 1H2NA 2ZABA 4XDQA 4AHXA 4XE9A 4FCAA 2PN5A 4AVAA 4YLZA 2VH9A 1S0FA 3ZFFC 4W6YA 1Q8SA 2EIGA 3RSJA 1ZRDA 5LK7B 3L9JT 3VBOC 2JEMA 4AW7A 4YG6A 1AYM1 1BYHA 1AJKA 3IN9A 3DKWA 1B35C 3QACA 3NSTA 5EZWA 3DPRC 5E88A 2HEWF 4Z1VA 2XBO2 4P9XA 1X33A 2XJUA 1M06G 2P37A 3MLLA 3N7KA 3WCSA 3ZXFA 1JUIA 4AQ2A 1KDMA 3WDUA 1VLNA 1RVF3 3M3OA 3QLQA 1YI9A 4HVRA 2VECA 4LR4A 3J8F1 4AQTA 4Y1UA 3U11A 4KG8A 4HN1A 3FJSA 1QJY3 4GA9A 3ZDSA 1RTVA 3BU7A 1WCKA 1UD1A 3WP5A 1K5MB 2SBAA 3DV8A 5CFDB 1D0GA 2EXIA 2A3WA 2GNDA 2DFBA 4PCRA 1EV13 2YDEA 4DQAA 4HK9A 3ZFGB 4Z2WA 3V0AB 1RHI1 1QOOA 1UU4A 2ZX2A 4RD7A 1DFQA 2XVGA 4AEDA 4K1ZA 1AR71 2ZX1A 4P9JA 2I74A 3AP7A 3LA3A 3ZN4A 2A7AA 5DZFA 4JTNA 2ZACA 1KD7A 3GHMA 2RS33 1BVP1 3UKNA 2DTWA 1HRI1 2V09A 4K21A 2ZGKA 2D6PA 2WLQA 2BWCA 4O9EA 1IPJA 2RR13 2O8OA 4M0HA 2ZGTA 5JR7B 4WM7A 4BLJA 5DUXA 3HMYA 1DYKA 5T5OA 4XZPA 2ZHKA 1HIXA 4UW4A 3FE5A 3PJQA 5J7MA 3R6SA 3MIHA 2R043 3AJYA 5I0SA 4KU8A 4X6RB 4OHYA 4BMBA 4Q4W2 4C1XA 4XHBA 1QOSA 3OF1A 3A0KA 2R1DA 2UY9A 5KC6A 4Q4Y1 4QQOA 1RMU2 3SXWA 3WQ0A 1O5UA 2ENRA 4YW1A 3N7LA 1BBT1 3B02A 4HVQA 1CVNA 4BZ4A 2WQ4A 1YRZA 1LHUA 4ES8A 2PLV3 4OUMA 3PLQA 5BNOA 3SISA 4LLFA 1HX6A 1JN2P 4B8EA 2CL2A 1AYN3 2Q1MA 2WNVC 1PM7A 2AYHA 4DOUA 2PAEA 1UKGA 2GDFA 4AFDA 1WLTA 4U2AA 3HD8B 3C2UA 1BJQA 1QJX1 4R4XA 4ATEA 4QQHA 4YVWB 4J1XA 2DVDA 3I7DA 1ZZBA 3FWEA 3HR9A 4CDWB 2X8KA 4BWOA 2XPJA 4CP1A 1QDCA 1MEC2 2YHJA 3DL3A 4A3XA 1D4M1 4I01A 2Y0OA 3JB8A 3HT1A 4R8HA 3ZXAC 2GSYA 1F2NA 4J1WA 4P9WA 4RA0A 4YNIA 3WG4A 3MPBA 1CJPA 4Y1VA 4MSVA 4YGDA 3V64A 4ZU7A 1LU1A 3WG1A 3ZVXA 2ZKLA 4TLFA 1VBE2 2H6CA 5IK4A 4JV4A 1F5JA 3TAYA 4B7EA 4AI2A 1R1A3 1MS3A 1V70A 2JENA 2HWC1 2WL1A 1H9WA 5KHHA 3H1MA 1X7NA 5JWPA 1TME3 3IMNA 4S2HA 4Q0PA 5BNNB 1VBA3 2DCJA 4YVWC 1JYCA 1YHFA 4FPJA 5I0TA 3MIEA 4UXAA 1ND3C 3MGUA 2BBVA 3AZZA 1UU5A 2C5DA 1JTZX 2PHTA 4Q4W3 4Q4V1 5SV8A 3AXEA 2AENA 3S0MA 5DDJ3 1SFNA 5IK7A 2DWRA 1HW5A 4HSJA 5FPZA 1C1FA 3JU9A 3POWA 1QJZA 3MF9A 4WVMB 5C8CB 1O7FA 1RUC3 2NZ9A 3WDVA 4CDXC 3HIFA 3LB9A 3OGGA 4SLIA 3VBHC 1RUH1 1NCRC 3JBG2 4EWEA 3OCPA 5L7OB 4RR3B 2WFPA 3H1WA 4C0BA 3NAPC 2RMU1 1IKPA 3JQXA 2SLIA 3NV2A 4HLTA 2ATFA 2F4PA 4FPOB 4AI8A 4MUVA 1GQHA 1K5MA 5AFEA 5CFDA 4Y1ZA 3V0BB 1GANA 1DU3D 1LRHA 2EAKA 3ZFGA 1OPOA 4AI1A 1EV11 3CO2A 5K0UC 1LOEA 2FMDA 5BNNC 2VNOA 5GLTA 3RJRA 4Y20A 5IK5A 4YGBA 2ZHLA 3WG2A 4XFIA 2CYFA 2WINB 2WQZC 1ULGA 4Q4X1 1GZ9A 4COUA 3U4XA 1QXPA 5DUUA 3E6BA 3CEWA 5L19A 1S0CA 4C90A 2GH2A 2RS31 4FPLA 3FZ3A 3H7YA 4K20A 2ERFA 5F9TA 2GN3A 4AI0A 3KB5A 4FQ4A 4CP0A 4EN9B 5C8CC 1MZFA 2A73B 2A71A 1AJOA 2IXKA 3ALQA 4A2UA 1LGCA 2D7FA 1QKQA 1UN1A 2R041 2GC0A 5A33A 4RR3C 4FT8A 1LOGA 2OZJA 2X5IC 1I9RA 2R32A 3SCGA 4GULA 1AX1A 3AYDA 1LOFC 3B94A 3EQEA 1QQP3 2KA3A 2VU9A 3AP9A 1EP0A 4UBHA 4EWDA 4NWWA 3RZZA 1B09A 4B7KA 4QXKA 4EROA 3L2HA 2R1BA 1J3QA 1G6NA 1H2LA 3QH7A 5JOXA 3D82A 1COV2 4GMP0 4FQZA 5J96B 2IXLA 3ZPYA 3DUIA 1N3OA 2XLGA 3QBQA 4L9BA 1VAKA 2ZS6B 1ND2C 4FP2A 1DDLA 1S1AA 3BB6A 1FX5A 3WG3A 4H14A 4CDWA 1Q56A 4JAAA 1ZBE3 5GLVA 2PA7A 3WOGA 3VLBB 1F31A 4M3CE 4B29A 1OHFA 1ZVFA 2R072 3VBRB 1ZRCA 4AGRA 1YFWA 4N43B 4XBLA 4COWA 2DU1A 5JIAA 1VBD3 1VJ2A 1POV3 1I6XA 1FMD3 4XXPA 1WGPA 1A6CA 1VBC2 3H8UA 2PAMA 1ZYBA 2ZZJA 1Q8VA 3AM2A 4KGGA 1AHSA 2VMGA 2DVGA 1R1A1 2EALA 4LHLA 3VBFB 2PQQA 3WDYA 3I54A 4AEKA 3FLPA 2GAUA 1DBNA 4N53A 1MS4A 4GWMA 2CGOA 2W52A 1LECA 2IWGB 1TME1 1H1IA 1S0BA 4JGYA 5LK5A 5JSPA 4WBBA 1UX6A 4HK8A 2BFUS 1HLCA 1REFA 4D69A 2QNKA 4CDQB 1AR62 3MW3A 2RS12 4M00A 4CZSA 2XVLA 3ZSEA 4FBFA 3O0VA 4Q4W1 2B8MA 3VBRC 1REEA 4GQ7A 2Z2SB 4Y4YA 4PF5A 4WVMA 2DVBA 4M3CF 5CBLA 1LEDA 3NW4A 1PGL2 2CGNA 4P5HA 3IT8A 1RUC1 1JH5A 3VGIA 1QH6A 1W6OB 3ME2A 3SLIA 1UPIA 2VW0A 4B4RA 3JB4C 1LESA 2Q8OA 1VRH2 4OHWA 5L7OA 1S0GA 1H1AA 4I0WB 1HDKA 3NKTA 3ZIWA 1U5IA 3WW1A 2VOXA 5IT6A 1WMEA 1CR7A 1FXZA 1WA4A 3SNMA 5HCFA 1AYM3 2PHFA 4MGYE 4D7TA 1W0PA 3ES1A 3R4SA 2RS52 2NMNA 3MFCA 1C8M2 3E5QA 4Q0QA 1PO23 3PHMA 4HZFA 1DQ0A 3FMGA 1RUJ2 2ILMA 5AC92 1MEC1 1SQ4A 1H4GA 2BYVE 4HVOA 3BCWA 1NXMA 2GC1A 1S0DA 3A4UA 2BTVC 1IHMA 1Y9QA 3J8F3 5ACA2 3I4IA 1UZYA 1XE7A 4QPGB 2BVVA 2UWCA 1S0IA 1A78A 1XNBA 5I0UA 2LALA 1LHNA 4JRLA 4ORFA 4IESA 1YFXA 4QPIA 4H7LA 1IS6A 1HQLA 4RL7A 1VBE1 4L11A 2A5ZA 2E7TA 2PFWA 1SCSA 1J59A 4LO6B 1RUOA 3AP4A 1XU1A 3GNEA 3JCIA 3M4FA 3DF0A 3ZSKA 5FO9B 1SLTA 2QUOA 2UWBA 1HRI3 3N7MA 1MZ5A 4EJRA 1BMV2 3ZXLA 4LO8A 4FPEA 2JE7A 1QNYA 4WM7B 1OSGA 4MGZE 3AMQA 3MEPA 1ZRFA 1RINA 4MV2A 1XXNA 5JIUA 5T3NA 3ZN5A 2JDZA 5T54A 2N7GA 3RWNA 4HSLA 3TWIA 3ZFEB 3D6EA 5HI0A 4FTEA 2IFRA 4V1PA 4XQWA 2B5HA 2QZ2A 1O3QA 2R0HA 2WT0A 2YYOA 1O4YA 1ZBE1 1BBT3 2B45X 2MHFA 4EWAA 2WFF2 3KZ4C 4AEDC 1CPNA 3I59A 4N43A 3KT7A 4WVVA 1CGPA 1IOAA 3AZYA 2QE3A 2DV9A 5EXOA 3WINE 5J09A 4I0AA 3BOPA 1POV1 1FMD1 1CJDA 2OVUA 5AVPA 2YGLA 1KJRA 2DVFA 4LE3A 4LLOA 2XLFA 5T52A 3LZZA 4MGIE 2VNGA 2Y26A 1YCIA 1DQ4A 2VQAA 3S7IA 4WM7C 3QCWA 1YIPA 3VBFA 4I3GA 1FI2A 2VG9A 1LOAA 4BCUA 1WW7A 3NV1A 2VQ0A 1GYKA 1ZZ7A 3S7EA 1PNFA 4LBMA 1IPKA 2IFWA 2AUYA 2D6KA 4XW3A 1NLRA 1CONA 1AVBA 5KXDA 4CP2A 4LBNA 2BPA2 1GICA 4YZ3A 1WW6A 3B3QE 4CDQA 1NG0A 3NV4A 2CY6A 3H3ZA 4META 2HWD2 2DTYA 2UYBA 4LBQB 1W6PA 1OA4A 3VZJA 2UY8A 2WWSA 3ZX7A 5BNOC 3SHRA 5GJ6A 2XLAA 2MEV3 2B46X 4LT5A 4OI1A 2ZGNA 2F6BA 5I0RA 1YI7A 3IWZA 1V6OA 5J48A 4OUSA 4W6XA 4G4FA 3OY8A 3R4DB 3TB0A 2YROA 2AH2A 4PDWA 5H9SA 4ATFA 5ABJB 5C8WA 4YW2A 2BEOA 1EAH2 3JUUA 2R6QA 2D40A 4LHKA 4XJUA 3ZYGA 2VVDA 4KG0A 2A6XA 4Q4V3 4YFWA 1NA1B 4KWLA 1XNDA 2EA7A 4XF3A 1OD5A 2HEYF 4H7MA 4YG3A 4C91A 4PIZA 3TN92 1PO21 3WNXA 3AKPA 2VY0A 3JD72 5JOYA 1O5LA 5JI7A 2XJVA 4PLNA 2ZHMA 4F3JA 2GU9A 1RUH3 1RL3A 5A32B 3NV3A 3VHNA 3IPVB 4QPGA 5C4WA 1OLRA 2RMU3 3DGTA 4FTSA 3KM5A 4K6BA 1BXHA 2E6VA 1VBC1 4RHV3 4Q1PA 1C3HA 4JDOA 2NMOA 1OKQA 4EN8B 1L3JA 1SLAA 1OQ1A 1F8VA 3RRDA 4AGVA 1HV0A 1ZNPA 1FPN2 3FBYA 4E2SA 2P3KA 3TNQA 5FDBA 4K40A 5EWSA 1Y3TA 4FPHA 4AE2A 4Y20B 3ASIA 1Q3EA 1ZM1A 1SCRA 1N1SA 2V73A 4TYSA 1ZREA 4XYXA 3VV1A 1RUG3 2ZGQA 4AFBA 2JG8A 3MICA 4P9LA 3OGJA 4Q4X3 2JD4A 1BEV2 2NPIA 4QQPA 5B2GB 4XF4A 1LCLA 4NHKA 4GIQA 1R082 2NLRA 5JLVA 1VBB2 2LM3A 2YGMA 3MI8A 4FOQA 4PJYA 1WW4A 1AR61 2IZWA 2RS11 1AUYA 2HWD3 3MDPA 1C28A 2ETEA 4URTA 1YXWA 3J4UH 1J1TA 4Z82A 2QCSB 4P14A 4QPYA 1MACA 2D3SA 2PHUA 3PVEA 4MXVA 5A33B 4XIKA 4DY5A 3ZSJA 1FOD2 1XNCA 5F6LB 3HAGA 4DNYA 1PGL1 2GZWA 3MLJA 3ZFEA 1QOTA 1PO13 2CNAA 1K5MC 2EAAA 1F9KA 1C5IA 3WXPA 3ZN6A 2WS92 5BY5A 5CFDC 4Z07A 1ULDA 1VRH1 3ZFGC 5GM0A 1Q8OA 3OTFA 4DRRA 3SH3A 2FBEA 3B9IA 1HV1A 1DZTA 5FFOC 4IEZA 4LEJA 1VB2A 3M7AA 3UJOA 4Y26A 2ET7A 1JYIA 2XBO3 1QWRA 3VZOA 2ZJCA 4DY3A 1RJ8A 1YNAA 2VGDA 4MZUA 4QU2A 3U0ZA 3UKVA 3T2TA 1RUJ1 2IXJA 2YZ4A 4PBPA 4COZA 4MXWB 3IIAA 4AHYA 5K9YA 2D3RA 1SMVA 4ZU5A 2VULA 2E7QA 4RGGA 1NQJA 3LSDA 1QDOA 4MX3A 1UL9A 1WBLA 2BW8A 1DZQA 4XFFA 1W39A 3N3HA 3ZXGA 5KWRA 2DUQA 4AFMA 2D6MA 5DUVA 1T6GC 4QMAA 4XETA 4Q8KA 2G9FA 5F1RA 4XJWA 3WD5A 2GN7A 1PK6A 2YMZA 1YIFA 1ASJ2 4GB32 4LBQA 3KSCA 5DXDA 2ZGSA 1PIV2 3QOPA 5FPXA 3EJKA 2B9UA 1PNGA 1UAIA 1Z7S2 2D3PA 2KXLA 3M8LA 1BEV3 2MEV1 1SLBA 1LHVA 4NOTA 3ZXDA 4WM8A 1GNZA 4DB5A 2XJPA 4N53B 4YW3A 1IS5A 4RQPA 5FREA 1LB2A 1VB4A 1LGBA 4CDUB 4JGYB 3KLSA 1UCXA 1NYWA 4LUKA 5ABJA 3AZXA 3SITA 1YJKA 2DVAA 2E7AA 3WHTA 2XKOA 4BOWA 4CDWC 5BNPB 1V6NA 2OIIA 3WDTA 1IQAA 4YZ5A 1ULEA 4ISQA 2PHRA 2QQPA 2D93A 1NA1A 3BOWA 4RS5A 3WUCA 1RUF2 4QGLA 1N47A 1RUE2 4AGGA 5KHGA 1RMU3 4R52A 5FQ0B 4I0BA 2DURA 2VVFA 1AF9A 2VXRA 4DRVA 2XJSA 2BNOA 1KJLA 1QJU2 2WFF1 5A32A 3IPVA 3LCPA 3P3NA 2R49A 1QU0A 2W0XA 4Q0VA 2GH8A 1J3RA 4P9YA 3WW3A 3ILFA 2BNMA 4RHV1 1M4WA 1SEFA 3AFGA 2AREA 4XJ9A 2OPKA 4N53C 1S2BA 4IXLA 4J6GA 3OJBA 3KCYA 4ES9A 1AR82 5J36A 4DPNA 4Y1XA 2GMMA 4BH9A 4JGYC 3AMHA 4AFAA 3PJYA 2I2SA 1MEC3 1PZ8A 1RUG1 2PYTA 5CFCA 4PLMA 2D97A 2DFCA 1OOPB 5JSOA 1AR92 4BYYA 2JKBA 2D5FA 1PVC2 3U07A 2DCYA 2A75A 4M3CA 4IEOA 4OULA 3V65A 5C33A 3GZAA 2QZ3A 1TMF2 1ULFA 1G8WA 1OFSA 3URFA 1RUI2 3EHKA 5BYNA 4KL1A 1RUNA 4QPIB 1LTEA 3I2DA 3KCXA 4FXGB 2HWD1 1VBE3 4UW6A 2RM22 4WV8A 4XMIA 2Y38A 4QGNA 1QGLA 3B00A 5JOZA 4XQ4A 3KMHA 1N3PA 5L7OC 1RJ7A 2CAUA 3VL9A 1WCSA 3HN1A 2D6NA 1KQRA 4IETA 1O3RA 2D5HA 1KDKA 2ZTNA 4LA2A 3H1YA 5DG1A 1DF0A 1QMJA 4IQPA 4ISRA 4CEYA 1TNFA 1PO11 2Q4SA 3ENRA 1PGW2 3VBUB 5D8AA 4LBKA 3TNPB 1WLCA 5E8AA 3V56A 2JJ6A 4Z8BA 3WW4A 3W59A 2WC2A 4OZXA 1VIWB 3B9CA 1U5YA 4GH4B 2ES3A 1XRUA 4XPVA 4XJZA 1Q5OA 1SBFA 1KFXL 4XOGA 4YW4A 3VKLA 1APNA 3J9SA 1RUF3 4QHBA 5JPNB 1EPZA 4YG0A 3WT3A 1RUE3 3MPPG 3KS7A 2XBO1 4N7UA 3GALA 4A7ZA 5L36A 3TN91 3ECQA 4FOWA 4H55A 2H0BA 4WZCA 2DUOA 1G9AA 4MXWA 2XJQA 5JPMB 4QPIC 2JECA 3AFKA 1XQNA 4INDA 4BM8A 1H8TB 3CNAA 4UW3A 3JBG3 2XVKA 1NLSA 3WZ1A 4JVAA 4XFBA 4FOYA 2HWE2 2WIIB 4XJ8A 4JC1A 2CGPA 3I59B 2I07B 1QF3A 1DQ1A 2TUNA 5GLWA 5JZGB 1I1EA 2ZMNA 5DG2A 1BQPA 3VBHA 3WP4A 1TEIA 2A3XA 2ARXA 3ZMNA 2VMIA 4GMP1 2PHLA 1FPN1 4YVSA 1HRV2 2O8QA 4AK3A 2R16A 1V6JA 3S6PA 1CIWA 2HYKA 2O0OA 1DQ5A 4Y22B 2ZGMA 3CF6E 2FHRA 3MW4A 1BEV1 4IEXA 4QGMA 1JXNA 2BFUL 4JQRA 1R081 1RUD2 1LR5A 2KM2A 1CQ9A 1VBB1 3X29B 1FV3A 1TQ5A 4R9DA 4CDUA 5TSWA 1MS1A 4LO4B 4L8QA 1HXS2 1MQTA 2Q30A 3JQWA 5K7PA 3J26N 2DCZA 3IKWA 4NPRA 1SLCA 2OA2A 4GKXA 5BNPA 3CJIA 2HEVF 4ASLA 4XBNA 4CTEA 2JX9A 1AR72 2PHDA 3WV6A 1FOD1 1W6PB 1TE1B 1E57A 4XF1A 4HKOA 5FTTC 2JICA 2QFEA 4WVWA 4EN0A 4QM8A 2VOKA 1D2QA 4N43C 4F8AA 1PZ7A 5FQ0A 1NE6A 1RMU1 3VBSA 3ZXEA 2WS91 1YUDA 4JGZB 2HWF2 2ZBJA 2QVSB 4JDNA 4AI3A 5HCBA 2R0FA 4OI4A 1SACA 4G3YC 1PGSA 2TBVA 4CYDA 3OY8B 2IC1A 4PDWB 3UKTA 4XF9A 2HJIA 1LU2A 2WT2A 2NYYA 1COV3 2XL9A 2YV8A 4D3WA 3VBFC 3ZMOA 1IZ3A 2ZCWA 5LEKA 3CJXA 1GZCA 4KWJA 4OHXA 1YFYA 4YZ1A 3RI9A 5FAXA 2YC0A 4Q4Y2 3ZYIB 2UWAA 1YJLA 2TNFA 1G7YA 5LRSA 5DUWA 1LODA 5F6KA 2GNBA 3MIDA 4I3PA 4I2OA 5HBAA 3VHOA 4FVVA 1A8MA 3D8CA 4OHZA 5GLZA 4QT6A 2CWMA 1AXZA 4K9SA 4KH9A 4UW5A 4CDQC 2DCKA 3B01A 1OOPA 2R073 2ET1A 2HWB2 2Z42A 1H9PA 3HBZA 1I5ZA 1U5ZA 2ZA9A 3TBDA 5C4WB 4LBJA 1GZWA 3G6JB 4NVPA 1A8DA 1VBC3 1HRV3 5DZGA 2LUWA 3R4UA 3AJZA 2PHWA 4X8PA 1ASJ1 1NCQB 1QJX2 2B39A 5H9QA 1PIV1 1QNWA 4XQDA 5KXBA 5J37A 3IDCB 4NR1A 1GFF2 3A0NA 3MFAA 3ZSLA 1Z7S1 1BK1A 4NO4A 1C57A 1CAXB 4PDWC 3ROUA 5BV6A 1NXD1 4HPKB 4NWVA 3INAA 5T55A 4YSFA 4OI2A 3AMMA 1D4M2 4IEQA 3U10A 3E5XA 2JG8B 3MZHA 4WVZA 3VBUA 3VHPA 4ZKTB 4JCKA 4QD2A 1R092 3VZNA 4FAHA 5BNQA 3D0JA 4XHXA 1ZZ8A 2K0GA 1AR63 4GH4A 2RS13 1W2UA 2E51A 2WNUB 1DYPA 2YY1A 4S2DA 3RDIA 1BCXA 3PTYA 1RUF1 2RE9A 5BXXA 1V6KA 4GXLA 4R9AA 4QPGC 5DZEA 5C4WC 1RUE1 2HWC2 4R9BA 4B3NA 1BZWA 1G86A 4RGAA 4PIYA 1U12A 2CV6A 2WA3A 3RMXA 1QJU1 3LKJA 1ZBA2 3E97A 1NZCA 1FNYA 1H8TA 4YM2A 3ZN6B 3AX4A 1VRH3 3MIGA 3JBG1 1OA2A 3WQ7A 4IV1B 2OYZA 1YYNA 3TOJA 1W0OA 2IXHA 3AKTA 1U5XA 5JZGA 1XE8A 3FFQA 4Q26A 1NY72 2XUMA 4NHLA 2JG8C 4YFZA 4AVTA 2AGSA 4YZ2A 2RS53 1W6NB 2P3IA 3RYKA 3APBA 2Y0IA 1C8M3 2H0VA 3M2MA 4MGKE 4OHVA 5GLUA 4XBQA 1PHMA 4P9IA 4AEMA 3LA7A 4AG4A 1RUJ3 1HKDA 5AC93 3VDDB 4CEWA 4RSUA 4Y22A 3O7OA 1RVF2 5C9AB 1WMFA 2WNUC 4L99A 5FMOS 1IGOA 2ZAHA 4MYEA 2D98A 2ZZQA 2Q5TA 4P9GA 1DHKB 5ACA3 5I8YA 1MVQA 4MVTA 1CAUA 5FOBB 5FO7B 1QJY2 1N1VA 4I02A 3IM0A 2NP0A 2ZX0A 4N9HA 1FT9A 2ZPXA 1RUI1 2JG9B 2GALA 3AXDA 1ULCA 5CIRA 2C9AA 2WKKA 3ZFEC 4AVVA 1EV12 3RNSA 1BVVA 3ETQA 5KBFA 4LUMA 5JMCA 2PTMA 4AYUA 3B69A 3NL1A 1UZZA 2YPJA 1PK6B 3ZFFB 4Q29A 1CESA 3E5UA 4ONUA 3M3QA 3AKSA 4YARA 1FV2A 2XB6C 3VBOB 3OBTA 1DGWA 1WW5A 2D6LX 3ACLA 1VALA 1C1LA 1W6MA 5LEJA 5KHIA 1B35B 1PGW1 1G9CA 1XNKA 4WM8B 4JGZA 4DFSA 1R093 3TYJA 1GNHA 5GZDA 4IV3A 2CAVA 1N1TA 4RQPB 2RR12 1SDWA 3FUQA