3GF6A

Crystal structure of a bacterial lipoprotein (bt_1233) from bacteroides thetaiotaomicron vpi-5482 at 1.69 a resolution
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
219
structure length
219
Chain Sequence
DAIYYPVGDVDIERGGPALEVGEEDVLVARSFNEEDYVLDTIAQYPNDPTLGKLTFMIDLKNQQKDQNVADFNGVGKSKLTMSLGYKDGNYPSESQVPIYTSQDVTAKYAVKLRLKGELLVSGDEWMIDYVYAQLASLFQPYPPANFPEVFMCKGGMKLGTFDSFRRTCTFDITYDRSDLSFSQLYFNLFINLAGQKRENRVRLRIDKESYFELYEQSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of bacterial lipoprotein of unknown function (NP_810146.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.69 A resolution
rcsb
source organism Bacteroides thetaiotaomicron vpi-5482
molecule tags Unknown function
molecule keywords uncharacterized bacterial lipoprotein
total genus 48
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.750 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3gf6A00
3GF6A
chains in the Genus database with same CATH superfamily
3NNGA 3T2OA 1DFQA 2HWF2 3KCXA 3KD4A 4PBPA 3F2ZA 4Q29A 3KQRA 2ZACA 2R1DA 2D3PA 1ZREA 2RR13 2WO1A 4P02B 4UBGA 3UL2A 2ZGPA 3ZMOA 4CTEA 1ULCA 3MF6A 4LBJA 3IBMA 2LM3A 2FZ1A 2D6MA 5GZEA 1F31A 2QBXA 2XVKA 4A42A 2ZGKA 5KHIA 2BBVA 2UYAA 2NN8A 1VBB2 4HT1T 2YV8A 5FY4A 1ZA4A 2DUPA 3PDQA 4UFHA 1S2KA 1ZZ6A 4GULA 4NHMA 2DBIA 4C0HA 4R4ZA 2BWCA 1UU4A 2DFBA 5H9SA 2CWMA 1WA6X 4DY3A 1H8VA 3ACFA 1NQDA 1JZ8A 3I59A 1LHUA 1LJ7A 2JG8A 4K1ZA 4OI2A 3WX5A 4BMBA 5LK7B 3J26N 1F35A 1J1TA 2K46A 3H1YA 4XUPA 3MO4A 1CVNA 4JHTA 1LESA 1PVC1 3UJQA 4AEJA 4Q4V1 2E32A 2VUAA 4QXBA 5FYSA 1PO21 2JWPA 3O1MA 1HB4A 1YUDA 3K2OA 3K75B 4YM2A 3VZKA 3LEMA 4LHNA 4NJ4A 5DAWA 1N1SA 2Y60A 4UXAA 3VBHA 1F2NA 1Y4WA 1V9U3 5IAVA 4C90A 4AGRA 5KR7A 4CP9B 3VBFA 1WGPA 3UT0A 2IXLA 3ZFGC 2LW8A 3S5AA 3JCIA 2VCBA 2EIBA 2UY8A 2CAVA 4XTPA 3AMHA 4BIFA 1EV12 2R063 1UY2A 5C3OA 3TNPB 3VV1A 1XU2A 2GP5A 2XXZA 3VDDC 1WCUA 5FPZA 4HK9A 4IEYA 2C9AA 1W99A 3AMPA 4LE3A 2GMMA 1O4YA 4XF4A 3SH3A 4N43C 4RL7A 2X29A 5L7OA 3MW4A 4HN1A 4I0AA 2XBO2 4HKLA 2WYSA 5C71A 3CU7A 2R061 4J6GA 4Q4X2 4XUNA 5B2GB 2DCYA 4IGPA 2B9VA 2DV9A 4FFHA 5FJKA 5FYUA 3SLIA 1O4ZA 1P8JA 1RB8G 4HPKB 1V9U1 2JDZA 5HCAA 3BOWA 1TNRA 2O1QA 4LIUA 4MHUA 3RWKX 4A44A 1WW7A 2CSGA 5A3MA 5JXHA 4ORFA 4D7SA 1YHFA 2FQPA 2VMHA 2Y34A 4EN7B 2JE7A 3IN9A 3O14A 3OF1A 1PO23 4YW4A 3UV9A 4BLJA 4OQ8A 4AFCA 1PVC3 1UW8A 1AHSA 3T4VA 3OB8A 2H6BA 4M0HA 2P3KA 1OPOA 2PHXA 3ACIA 2VTXJ 2ZGNA 3PUIA 1J84A 2Y0OA 4AYUA 4QQPA 4YVWA 1MS4A 1OQDA 3B00A 1LHOA 1LOFC 2OIIA 3OGGA 3ZDVA 3TOJA 3LE0A 4LO8A 3QD6A 5CKQA 1ZBA2 1CD3G 3B5LB 3CEWA 3GZUC 5EFUA 4NIHA 3C8XA 4NAOA 3Q8FA 4FI9A 4R9BA 3NJXA 1UIKA 4QM9A 1XC6A 2Z4FA 4CEWC 3Q8CA 4QQ2A 3MPBA 5FUNA 5DDJ1 1O6UA 1H0BA 2BNMA 2R043 4FO9A 1OA2A 1OVPA 1W8ZA 2ZKNA 4UBHA 3IPVA 3T2PA 3AL6A 4CU6A 3POEA 5C6CA 2HYXA 1QJX1 3NMBA 4YM3A 4FXKB 5LA1A 2A3XA 4NHKA 3HQXA 5FP9A 3VL9A 2QQMA 5F39A 4AAPA 1H8TB 2ARXA 2ORXA 3DYMA 4IE6A 4MGYE 1Q8OA 2BWAA 5F1RA 2D40A 3J7HA 5CIRA 1QJX2 2R073 2WINB 4GB33 5AC91 3MLKA 5C4WB 1A6CA 4QPIA 4XDPA 3VBSC 2JIGA 4QGMA 3VKFC 3BCWA 1LHNA 3ZR5A 4WM7C 5GJ6A 1RVF2 4GWNA 3ECQA 1EAH2 5IT6A 3D4KA 2BERA 4RYDA 4COVA 1JYWA 2SLIA 4H55A 3K51A 3H3UA 4QX7A 2NM1A 1GOHA 4FQ4A 4XBQA 1D0HA 5A6XA 1UO9A 1W39A 5KHKA 2VR4A 4FVVA 3B7MA 2BZDA 3BPZA 1AYM2 5LY2A 4CDUC 5JCTA 1G8WA 4QQHA 3A4UA 1V6LA 5FLHA 1YQ6A 5DAXA 2R30A 5FBJA 3S30A 5ABJA 4HFSA 2CWSA 4OCTA 1TZOA 1R1A2 3ETQA 4H2AA 4HANA 2QNKA 5C3SA 1BQPA 1QJU2 2OUJA 1L7RA 4RQPC 1CAVB 5T5JA 2Y26A 2DVAA 2ZCWA 5DQ0A 4CDQC 1O3RA 1MQTA 4RGAA 3TNQA 4E4DX 5F6LB 5JUVA 4KWLA 1D4M2 2HWD2 2E51A 3KWVA 1XNAA 1AX1A 4J25A 4LORA 5FPVA 3IDBB 1POQA 4L92A 2YU1A 4E2SA 2YBKA 3NNFA 1YC61 2JB8A 4YW2A 1UX7A 2J1EA 1GKBA 1H30A 3BTYA 4URTA 4D7TA 5BNNA 4DINB 2B42B 5E6HA 1LECA 2OS2A 1XSQA 5DZEA 4L8QA 3NAPC 5H9QA 2AH2A 4M4PA 1ODNA 1JH5A 3O7OA 2B46X 4K8FA 1BEV1 5FUPA 3AXEA 2L9LA 4XCAA 1SFYA 2MHFA 1RUD3 2CYFA 2RM23 4RHV3 2VNRA 3OGJA 3OGVA 5JOXA 5FK7A 1XYNA 2WZR1 3M3CA 4RA0A 1OLQA 2F6BA 4FPFA 2JDNA 2VJXA 2X5IA 3CIHA 2E7AA 1N3OA 4B1MA 2VBDA 1AYN3 2VCMA 2PN5A 3CO2A 1U5XA 4C1XA 4KH9A 4A6OA 1DP0A 1ENSA 1MR5A 5CVRA 1QJY1 4DIQA 4YZ5A 1GLHA 3D8CA 5JVVA 1AR73 1AL21 1Z7S3 2NYYA 3URFA 1B35A 1KQRA 3V65A 2PLV3 4W6XA 4N90A 4X6QB 1G6NA 2JDPA 4NN0A 3AFGA 1EAH1 4R52A 1UMHA 1TMF3 1UZYA 4XJUA 4YRDA 5FFOC 5IK8A 3TAYA 2IXCA 1G9AA 2FMDA 3OGRA 3ROUA 2Z42A 3OPWA 2VE1A 5A7QA 2E9QA 2NPIA 1NCQA 2XJUA 3LFIA 1VRH3 3PUQA 4XDQA 5T5PA 3WDWA 5BNPB 5KC5A 4BPZA 2F4PA 2PHTA 5FZCA 1AYM1 1WMFA 5C3PA 1MEC1 4FQZA 4BQWA 4YW5A 3J8F3 3OSDA 2E53A 1BCXA 1CX1A 4AHYA 5FPBA 4N7UA 3C7HA 1SFNA 2TUNA 1D0GA 2QTWB 1K12A 1AR93 2B5HA 1H4HA 1R1ZA 4ISRA 1Y9GA 4LBQA 1L7LA 3AZVA 2WLQA 3WF4A 5C33A 1PM4A 2Q1MA 4ZHNA 1JUIA 4FOWA 2BRTA 1PZ7A 3CQOA 1NX9A 4JQRA 3PNAA 4O9EA 2FDKA 4FPYA 3AZXA 3MV01 3WT3A 1AR91 3PURA 4MXWA 1G7YA 4X6RB 3EBRA 5FZHA 2FCVA 2SBAA 2YY1A 3JQXA 2VVFA 3WDTA 3CHXA 2W95A 4LK7A 3UYJA 1VMJA 4EWEA 3KV6A 2WC2A 2G9ZA 1WLWA 3U0ZA 1PO13 3RNSA 2PHLA 3NJVA 1VRH1 1NLQA 2Q30A 4ZONA 2D5FA 4D7YA 3ZXLA 5IK7A 5J98B 3SEPA 4JZRA 4YVSC 2CAUA 4H7LA 3IDAA 4NPRA 4L97A 1TMF1 4R9DA 2VOKA 2VOXA 4AVTA 1NA1B 5A80A 4M3CB 5F3IA 1CGPA 2BGCA 1XE8A 3LFMA 4KL1A 2UURA 1REEA 3LEIA 3WF2A 1AL23 1IKQA 1YQ2A 1OURA 2QZ3A 2EVXA 4Y22A 1APNA 1RITA 2YFUA 1WW5A 1Y3TA 1LHWA 4HZFA 3D0SA 1IQDC 1OHFA 3P3NA 5FP4A 1JBCA 2WZR3 1JZ3A 1W6PA 3AMNA 3GCXA 1DU3D 2AYHA 2B7YA 2VW1A 4BQYA 3U11A 4AF9A 1UY0A 4AVBA 1KEXA 1GZ9A 1FOD3 1OC1A 1HRV1 2QVSB 3KS7A 1QOOA 5IWFA 2RJLA 1UOGA 3AJZA 2XLAA 2P3YA 3GBFA 4PJYA 3VGIA 1C5IA 4UFMA 1H2MA 1OUXA 1YO8A 3AKQA 3OYWB 2CY6A 2VMEA 2W52A 1SACA 1V6JA 2YROA 2JG9B 5FXVA 2BEOA 3GF6A 1HXS2 2IFWA 1LNSA 2WO2A 2ETEA 5C5UA 3ALQA 1JZ7A 1T2XA 2DVGA 1IS5A 1H6YA 4AEKA 1XJAA 2HWB3 3ZMNA 3FLRA 4MLOA 4EV0A 3CNAA 3RZHA 5IUQA 1GQGA 3P5BA 3E97A 4YG0A 1BKZA 2WN2A 3AKPA 2ERFA 3LEGA 2ZX3A 2D6PA 4DUWA 2R16A 4UWDA 5CB7A 1U0AA 3HR9A 3HT1A 1K5JA 2VZRA 1PIV2 5A7WA 1YQ5A 2ES3A 2ZXQA 3D82A 5F7UA 5C9AC 2JICA 1F4HA 2CU5A 3VD3A 3AP6A 3IKWA 4NHYA 2K9ZA 4Q0VA 1EP0A 1PMIA 1UL9A 2VBPA 1HJFA 1QNYA 2PTMA 3BODA 3JQWA 2WO3A 5ERLA 5FZ0A 4K40A 3ZR6A 3TN92 3W20A 3VBHB 4P00B 5H9PA 1ZZCA 2WAOA 1WCDJ 1J83A 1OT5A 1UMZA 1YI9A 4QXKA 1Z0HA 1TME2 3GHNA 5FQ0A 1O3QA 2CDPA 3WD5A 1VALA 3AP9A 4GH4A 4XFFA 4K8RB 4DB5A 5I0TA 3HPNA 1IHMA 2XQXA 3AP5A 4XJZA 3ZYJB 1QDOA 1B35C 5FOBB 1YXWA 3K77A 1GQHA 4NROA 4TWTA 5F6KA 1RIRA 1W6NA 1ND3C 1PGSA 1VBE3 3S5QA 1ASJ3 4G4FA 3GZEA 1PK6C 4XFIA 1CESA 2RMU3 5K4LA 3WW3A 2W1UA 4Y22B 4L9BA 4BU2A 2ZHNA 3MYXA 4LOTA 2V5YA 1NOVA 2VGDA 1DQ2A 4BA6A 2FZ2A 1S0JA 1D2SA 1RC6A 2OW4A 2RDQA 1US2A 3LIGA 4QKDA 3WG3A 1TEIA 2KD7A 3B3QE 3KGZA 1UZZA 1ZM1A 3OUHA 5JPNB 3VHPA 4DRVA 1X9PA 4CPBD 3GBGA 3WP6A 3GZAA 1C57A 1UD1A 5A7PA 3SHRA 4CU8A 3RS6A 4TYSA 5A1FA 5BNNC 3DUIA 2IXJA 3FJSA 2EIEA 2XJSA 2R1BA 4XHBA 5EXOA 2EXJA 2ZX4A 4YPJA 4EQVA 4P9LA 3BB6A 2VQTA 1PGW1 2RS52 1JODA 2HEVF 3CJIB 2HWC3 1WD4A 4GJZA 1RUOA 1BMV2 4XF0A 5I0UA 4KG8A 4K21A 4W6YA 4CDQA 1TE1B 2DWRA 3FHIB 3NKTA 4I3GA 2JE9A 2A70A 3HQUA 1ZZBA 2XJVA 1DQ6A 1W0NA 3KM5A 4B29A 2VC9A 3Q9OA 4JGZC 2BVBA 4NVPA 2B9UA 3LSEA 3SCFA 5AFEA 4DQAA 3ELNA 1URXA 2ARAA 3THTA 3WLUA 4AFDA 4CDUA 4E4SA 4LO6B 4OHVA 4B1LA 2FDFA 3MF9A 1BYHA 2G1MA 2YBSA 1UY1A 1XOYA 3J7NA 3AVRA 2JDYA 4LQRA 2WJSA 3ZFFB 4P9YA 4TN7A 5C4WA 3O0XA 4KWKA 2WIIB 3AL5A 5DDJ2 1HXS1 3OUJA 3USUA 1DYOA 4QD2A 1UZWA 3I2JA 3MLJA 4OUEA 1RUH3 1W6OA 2VMFA 3OOXA 1FX5A 2CL2A 2EXKA 3A22A 5BUVA 2J1VA 4KI5M 2XLFA 2GDFA 2RG4A 2ARCA 3PVBB 3H1WA 4QMAA 3T0DA 1Q8PA 1CZVA 1W8FA 1VB4A 3BOPA 3I2DA 3NV4A 1FNYA 4QXCA 3BPSA 2ZAHA 2HWE2 5EJ3A 3DGTA 1S0FA 3JBG2 1UQXA 4INDA 1U12A 4AAXA 1VR3A 2HJIA 4LHKA 2RS13 3QH6A 4OI1A 4LT5A 1XQNA 4CCKA 2GALA 3M7AA 3MLLA 5GZDA 1B35B 4B7EA 4E2GA 5K0UB 3RZGA 3PVEA 3NRUA 1F4AA 2ZHMA 3RQ0A 2I45A 3J9SA 1QJEA 3OD0A 1ZNPA 1CAVA 3NL1A 5CFDC 2VBBA 1MS1A 4MGZE 1IGOA 4J1WA 1HRI3 1N1YA 3WZ1A 2IWGB 1HN0A 3OEAA 4LXLA 1OQEA 3VBUB 3AJYA 4PT6A 5JDBA 2JD9A 5FYHA 2VXJA 3THCA 5JSRA 4YVWC 1BBT3 4OFGA 5D8AA 1COV3 3OBTA 2AZ5A 2V72A 2A5ZA 4JGZB 4RFT0 1RGSA 3N7JA 1PM7A 2RDSA 2LS6A 1O3SA 5F9TA 4YVSB 5F5AA 2J42A 5FO7B 3VZMA 1CPMA 4ZPIA 1ULGA 1ZBE2 2CNAA 2WNVB 3E1F1 1VBB3 3OJBA 4FPCA 4K7JA 5FZKA 4LBQB 4XFCA 3RFRA 2CV6A 4CDWA 3WNPA 5GLVA 2D6NA 2VG9A 3FUQA 3RZKA 1NLSA 1CX4A 4XJWA 3C7OA 3DYOA 5FYCA 4YFZA 3LQCA 3T08A 1DCSA 2WNUC 2TBVA 1XRUA 5F32A 4Q1RA 4HN0A 2X5IB 4DRRA 1QOTA 4EJRA 3FL7A 3O0WA 5C9AB 1JXNA 3HAGA 1RUE3 4LE4A 2MPFA 4AOCA 4CEYA 1W06A 1LCLA 2G9GA 1A8MA 1EY2A 1WLCA 1CAWB 1JOJA 4JC1A 3ZYRA 1UXXX 4CP1A 1NE4A 2JD4A 2GU9A 3D6EA 1JYTA 2PHUA 5A3UA 1HX6A 1AXZA 1N1TA 3WF1A 4XJAA 3KV4A 3IMNA 3M3EA 2Q8CA 3VBFC 2GNBA 5FZIA 5H9RA 3UK9A 4LBLA 1E5HA 3M3IA 4IE0A 4QQLA 2HKXA 4IE4A 5KXBA 2XG3A 3HT2A 1BBT1 4TLGA 2Q8EA 2PAMA 3C7EA 3CBNA 4PIYA 1LULA 3PJQA 1MACA 4OLLA 3FWEA 3IB3A 2FDGA 4XACA 3ZYIB 1RINA 3GNEA 1KFUL 1V00A 4Y5TA 2Q8OA 3WF3A 1W04A 5BNNB 4KWJA 4U2AA 1O3TA 1JW6A 2OUHA 3ACGA 4XYXA 3I49A 5FY0A 3MIEA 4BJ0A 3KF5A 5FYBA 4A4AA 4BE3A 2A71A 2BFUS 4CU9A 5D21A 3PMEA 1W2NA 5IJRA 5C8CC 2WAAA 2VXRA 1S55A 5FMDA 2DUOA 5ACA2 1AR82 2OPKA 2W3JA 2ZBJA 3HBZA 5HCHA 1W9TA 2VOWA 4KG0A 5ISLA 4HVRA 4LKDA 5E16A 2W1WA 4V1PA 4XZUG 3L9JT 5F37A 1TVGA 2RS51 4JRLA 3VKOA 5F5CA 4EN0A 1H6XA 4RN5A 2XUEA 4ASMB 1JU3A 1QWRA 5JIUA 4YNIA 1OXCA 1KJRA 4XAAA 2ZEWA 1STMA 1NT0A 3KT1A 3POBA 1RUH1 3HEIA 3QLQA 5LA2A 3ZXGA 1JZ2A 1NYWA 5GZFA 3MBWA 4PI0A 1C5HA 2WS92 4KU7A 3D0JA 2B45X 2WFF1 4IEWA 3VZJA 2Y6LA 1GV9A 3VZNA 2YMZA 1JZ6A 3BVCA 2RJ2A 4L99A 3WHUA 4N53A 3ILFA 3NQHA 3VLBB 4CCDA 5FZAA 2DYCA 3HIFA 4R4XA 1GUIA 5JSOA 3NJYA 1DYKA 1ZVFA 1I5ZA 2QFEA 3IAQA 1YRZA 4TSVA 2YUEA 4OHXA 5FY7A 5FY1A 1EV11 4ITCA 3BTXA 2OA2A 5I0SA 2AR6A 4HVOA 3M70A 2NLRA 2Z79A 3E5QA 2W91A 1LAJA 4IUGA 3X29B 1QJZA 3JZVA 3KLSA 3QBQA 2PHFA 3AKTA 4WM8C 4YZ4A 4I0WB 2YU2A 4AHWA 4IV3C 2VZPA 1NXD1 4NO4A 1RUF3 1VBA1 2UWBA 1O59A 3ZKUA 3LKJA 1CAXA 4HETA 3NVCA 4CDQB 4D94A 1VE0A 1GNYA 5C3QA 3DECA 4OMDA 4BIOA 5HXMA 1A34A 3T2TA 3AC0A 1MZEA 1H4GA 1YFYA 3GM8A 1PZ9A 1YNAA 1RHI2 4GA9A 4GJYA 4ATFA 5HXVA 1JI6A 3U07A 5FZ1A 2D6OX 2YYOA 3RG0A 5IFTA 3E5UA 1LB2A 1GMMA 4UFJA 3H8XA 2XMLA 1JMUB 2XWJB 2QE3A 4J1XA 4AVAA 1ULEA 5ABJB 5CG9A 3N7LA 4P9GA 4M3CF 4Z07A 4XILA 1RJ7A 3NJZA 1OH4A 2Y6KA 2FHRA 4BXFA 4I01A 5CISA 3RZMA 5LBCA 3LD8A 5LBFA 1ENQA 2P2KA 1FMD2 4NR1A 1Y9MA 2CTVA 3UJOA 3BTAA 1W2OA 4IW3A 4UFLA 5FZGA 3A21A 1ASJ1 4GQ7A 3RWNA 2JECA 1UF2C 4PDWC 5J96B 1HKDA 2HWF3 2I2SA 3I2KA 4FAHA 4I02A 1ODMA 2JENA 3KVAA 4M3CA 1PK6A 2CDOA 4S2GA 3LZZA 1DBNA 2WQ8A 3MIFA 1J59A 5HBAA 2ZA9A 2VQ0A 2WYFA 3T0AA 4F8AA 1JHNA 4QB1A 4QWNA 4LKEA 4XQWA 4QKBA 2C26A 1RUI3 1W0PA 4LOSA 1IG0A 3H50A 4QB2A 3W9AA 1QGLA 1RUC3 4JTNA 3N9LA 3RZLA 1S4CA 3C2UA 3KHBA 3ZPYA 4Q0UA 1LOEA 1H2NA 3MEPA 4RR3C 5AVPA 2NP0A 1WBFA 3CKHA 2XJQA 1AYN2 1J3QA 1WWYA 3FMGA 2BNNA 2Q5TA 3UESA 4XMIA 3ZSKA 1KDKA 2VD7A 5A7NA 2WZPP 1CQ9A 5FR3A 3OPZA 2Y38A 4MUVA 2NQYA 5GLWA 4W50A 1MS3A 3I3QA 1AR72 1Z7S2 2HEWF 1AR63 4N43B 1US3A 4LEJA 1XNBA 3M3QA 4BHPA 3JD71 3PU8A 1V6NA 4XOGA 1RMU2 1HIXA 2O14A 3M3OA 5J7MA 2ZX1A 2WT2A 3ORJA 3AYEA 3MUY1 5FP3A 3ZVXA 2QDRA 1L3JA 5M0TA 1K5MC 2RDRA 4UF0B 5T50A 3RSJA 1W0OA 2JDMA 4E2QA 2F17A 3RDIA 4AZZA 3E6DA 3UKNA 3J4UH 3H42B 1Q43A 1RL3A 2ZHLA 3DYPA 2BV4A 4N7IA 2LTNA 1E5SA 4Q1PA 4CCEA 4ZS2A 2YGLA 2XBO3 1WBLA 1FOD1 2YGMA 3N4MA 4HLTA 1POV0 4PIXA 4Q4X3 5IYYA 4JKKA 3H8OA 3JD73 4Z1VA 1MS8A 1ND3B 3PUSA 3ZYPA 2VZSA 3DPRC 3GCWA 1V6MA 3N7KA 5K0UA 2QQVA 4HOOA 4UFIA 4YSFA 2G19A 3JB8A 3O1PA 3THPA 4RR3A 1KJLA 3R0RA 4O61A 2VNGA 1DQ0A 4MO3M 4AFAA 2YBPA 5IVJA 2QQLA 4BQ3A 3WOGA 1E5RA 1S1AA 1XSRA 1CZTA 3I2FA 4NIIA 5BNOB 2Q1FA 3VBRA 1F5JA 3VBUA 1GANA 1REFA 5SV8A 1WMEA 1JYIA 5DMYA 3ZFEA 1RUI1 3AX4A 1UIJA 4Q8KA 3Q8AA 5D8AB 1I3HA 3OYWA 3ASIA 4PLOA 4KBZA 1UU5A 2RDNA 2VUJA 3MFAA 4K6BA 3D3AA 4YVSA 2UU8A 3R4DB 1WCSA 2WABA 4Y33A 4RR3B 3O1OA 1NUKA 4CDWB 2R042 3ENRA 3FX3A 4DNYA 3W21A 2N7GA 1DYPA 3R6SA 2J1SA 4RQPB 5IK4A 5LW9A 1NCRB 4M4RA 1OOPB 5B4NA 5J1XA 5FMOS 4AFMA 1SBEA 1OI6A 1Z78A 4XUQA 3AVSA 4YM1A 4YW6A 5CG8A 4B4PA 2C6SA 2C5DA 4QHBA 3WUCA 4JGYC 3ZXAC 1POV1 1ZBA1 4ZXEA 4BQ1A 3QCWA 3O1VA 1V6OA 4K3UA 4QU2A 5J37A 2XKPA 3QH7A 2OYZA 1WKYA 1WLTA 2XQRA 1RUJ3 1GNZA 4AK3A 4UI9L 5JAXA 1XYOA 3MIGA 4QPIB 4D6RA 1KITA 4Z82A 1VPHA 5J3UA 4XIOA 2D3SA 3HVDA 5A3NA 2WWSA 5CKMA 3MIBA 4IV1B 2YHJA 1JYXA 1BHGA 5LBBA 2AGSA 4GH4B 3WW4A 4IV3A 4Y24A 1H9PA 4WM8A 3GJAA 3LDBA 1MEC3 1ULOA 2LALA 1QMJA 3HJRA 1AYM3 3DPRB 1W6NB 4AI3A 1NXMA 5GLTA 3K3NA 2AENA 3I3BA 3VUOA 2GNDA 3U4SA 3I2GA 2DCKA 4BXSV 1H2KA 1UY4A 5FZLA 4CDXA 2Y33A 1EV13 3APBA 2MEV3 3BALA 1NCQC 3W58A 1WLDA 4Q2FA 5E1RA 5CU1A 5FMBA 1XXNA 3KMHA 2PLV1 4E27A 2ZHKA 5L9RA 2ZGUA 5L9VA 2VAUA 3ZFGB 2DCZA 4OZOA 1QKQA 2VZOA 2VH9A 3PVNA 1QJY3 4FOVA 4XBLA 3SNMA 3TEWA 1Q8QA 1R082 4KNCA 3LA7A 1MZ6A 4WM8B 1FYUA 4QM8A 4XEZA 4XUOA 2KA3A 3IPVB 5IVFA 5KXCA 1PIV3 2ZX0A 3FLPA 2WFF3 1NY72 1S0DA 4IE7A 4QDSA 4FXGB 3M4FA 3P1IA 2R7EB 4XFAA 3GYDA 4JHZA 3WQ7A 1H8TA 1RHI1 4E8CA 4AXOA 4GIQA 3ETPA 2PMWB 1RUD1 2RM21 2RS32 3DCQA 5BNOC 4RHV2 1TME3 1X82A 4HPKA 4CVUA 4H14A 1ND2C 1VBC2 2W2IA 2G9FA 1QOSA 1Y9QA 3AFKA 3ZIWA 3T09A 4NUBA 5C8CA 1B09A 1QJFA 1S0IA 2DDUA 2A7AA 2QCSB 2Y6HA 3MUZ1 4NE9A 4R8HA 5T5LA 4ZU7A 2IXIA 2PQQA 3NV2A 2NMNA 1R1A1 3N35A 4RGKA 4CUAA 2D43A 1SFPA 2WWUA 2BNOA 5JR2A 1RJ8A 1RUG3 4GAZA 1MS5A 3IDCB 4XFBA 5T52A 1C8M3 2XJPA 3WSOA 4ASLA 5I93A 3S6PA 4LO4B 1IQAA 1ONAA 4PDWB 2RE9A 5SV5A 2WA3A 1CZSA 1SCRA 4FTSA 3A23A 4GWMA 2UWAA 4A3ZA 3K4AA 1OLME 2WT1A 4S2FA 3POYA 5A6QA 1JS9A 2IXHA 1HV0A 1F15A 1NCQB 4HL0A 5F3GA 3TEYA 1D4M1 4EWAA 1DDLA 5ABJC 3BIWE 5KC6A 4S2HA 1NQJA 3G6JB 4L0PA 1I1EA 1W8NA 2QDNA 2BW8A 1IS3A 2KR2A 3N9OA 1SLCA 1ENRA 1YFWA 4HVQA 4R9AA 4LA2A 2BGOA 2XPJA 4AI9A 3MW3A 3ILNA 3AK0A 1AR81 3SC7X 1DIWA 3GZTB 4DEVA 4H3WA 3H8RA 3VD5A 4XBNA 4GB31 4V2VA 1W3XA 4Z2WA 2A6WA 4P08A 2WZEA 3AYCA 4ASKA 2ZMLA 4CDWC 3NSTA 2VZ1A 4ZKTB 4AQTA 1HQWA 1OPMA 2AEZA 2YC4A 1ACCA 4CCNA 1YFXA 2P5BA 5L9BA 1XNKA 1VBB1 1WW6A 5KHGA 4QDRA 5D8AC 2IVJA 3NW4A 4OI4A 3K46A 4I30A 1QJU3 2G4IA 4BMEA 4TZDA 4IXLA 3ZX7A 4AEDA 2VOTA 1FT9A 5DDJ3 2B4KA 4OUSA 3QOPA 1COV1 5A1LA 2YB7A 3E5XA 5APAA 5FZBA 4JAAA 3O0VA 5DXDA 1OVSA 4MH0E 3VHOA 3MGUA 4E4ZA 1ZRFA 2VVEA 2W1SA 1F8VA 5BNQA 5T5OA 2QQIA 5A3LA 3OTFA 1S0GA 1X36A 4W8JA 5IW0A 3NNLA 1W2AX 3MW2A 3DF0A 1FI2A 4KMQA 4LHLA 3I3EA 4AEDC 5JZGA 2R0HA 2P3JA 2PQSA 2R062 4YGBA 1CAUA 1ALYA 3KCYA 5ANNA 3C3VA 3KV5A 1BJQA 4LPLA 5FPXA 5KXDA 1O5LA 1RUD2 2RM22 1CAWA 3CZJA 3LPFA 1IS6A 5I8SA 4PQQA 4EROA 2P17A 5AVAA 2F4LA 2X05A 3ZYFA 1WUVA 4K9SA 1SEFA 1KDMA 3WCSA 2OT7A 4UF0A 1W9FA 1O5UA 4I09A 1DZTA 2X10A 3J7MA 1PZ8A 3KHCA 4OMCA 3NNMA 4AVVA 5BY5A 4XJ8A 1E5IA 4JDOA 5C4WC 3ZO0B 5A33B 1VRBA 2ZGOA 4RS5C 1PK6B 1ZYBA 1UYXA 2PLV2 2Y64A 4FPKA 3BKZA 3SXWA 4BQ2A 4A7KA 4GMP0 1HRV2 1TMF2 3MIHA 1YIFA 1HJGA 4JGZA 1HW5A 4K20A 4MGIE 2A6VA 3VDDA 1ZRIA 4Y1UA 1ZZ8A 3USSA 2XL7A 4GKXA 3DV8A 1QU0A 5FPLA 1OUSA 4PBOA 5T3NA 1PNFA 4Y20B 3U37A 1YJKA 3WDVA 3ZPOA 4D3WA 5EP9A 2ET1A 4RGGA 1LGCA 2ZEYA 3SKJE 3VZOA 5FXXA 4CEWB 2XWBB 4JCKA 1ND2B 2YDEA 3TEXA 4CCLA 4F3JA 5JXJA 5KBFA 4XJ9A 3VBHC 1EPZA 4LUMA 2Z69A 4NRPA 4Q4V3 1SZBA 5IVCA 1R092 5FZ8A 5FO8B 2D3RA 4HKOA 4OVEA 3WINE 4DXRA 4EYUA 2XHNA 1QHDA 2HWC1 1WCKA 1SDWA 2VMCA 1VBC1 4SLIA 1LODA 3SCGA 4PF5A 3D5OA 4CPBA 4FPGA 2NZ9A 4LA3A 4LR4A 1LGBA 2JG8C 3I3DA 3CJXA 1SBDA 3ZN4A 5L36A 1HV1A 3OUIA 3LGRA 5IHRA 1IPJA 1OA3A 3KQ4B 4SBVA 2Z5WA 4RSUA 3WR0A 3WNKA 1XNDA 2P3IA 4YM0A 2BU9A 1LOAA 3RZJA 1ND2A 4GB32 2LUWA 5JR7B 1OD5A 2FCTA 2RR11 3DKWA 2XL9A 2WT0A 2ZTNA 4AI2A 4MVTA 4B3NA 5F3CA 4I0BA 4CXYA 1HDKA 5LK5A 5GZGA 1O8PA 5FP7A 3FFZA 1VBE2 2ZOEB 5IVYA 3U78A 2WL1A 4E8DA 1I9RA 4CDUB 3H9AA 4Y1VA 3WEZA 3WXPA 4CUCA 2EALA 3V56A 2VQAA 2RMU1 2W46A 3FBYA 2GZWA 2WLPA 3MPPG 1LOBA 4FFFA 2JXAA 4LMFA 5IAXA 1GYKA 1JYCA 5CFCB 2VZ3A 4P9IA 5I91A 5LEJA 3BU0A 1YEWA 2PELA 1VBE1 5FCCA 4B7KA 1GOFA 2Q0AA 3EYPA 4GH4C 4IQPA 5DPNA 4AG4A 1AR83 2ADDA 1ZRCA 4BZ4A 3OPTA 5E88A 1AL0G 4QPGC 4WVWA 5IFPA 1CAXB 4JRAA 4QPGB 2J1UA 5BPXA 4CP0A 1PX4A 1GZTA 2W87A 3LAGA 3JBG1 5JIAA 2VZUA 3RYKA 4EZHA 4MXVA 5C8CB 1RUNA 3DKQA 4W6WA 5JXIA 4BB3A 2AEYA 1UMIA 4XPVA 4I2OA 3L2YA 1F5FA 3NWKA 5A33A 2GMPA 2P6CA 1VIWB 3VDAA 2RVAA 1OLRA 1FPN3 1D4M3 3NNJA 5JI7A 5F8PA 2D5HA 3VBOB 3ZIXA 1Q3EA 1CONA 1VBA2 2ORZA 4AI8A 4EN8B 3J7LA 3GBWA 3LPGA 4LTAA 1MS0A 2IUWA 1DZQA 1RVF3 2JKXA 3AB0A 1ZZ9A 4QKNA 3LA2A 3LSDA 1NY71 4QX0A 1BLZA 3W59A 1UY3A 2J22A 1W9WA 3ACHA 4NHXA 4Y20A 4CZSA 4Z8BA 1DGLA 4IV1C 5CNAA 3ZYGA 4BLIA 4CCJA 1OKOA 5FY8A 2E7QA 3FHAA 4IEVA 4AHXA 1WMDA 1W6PB 2J1TA 2A3WA 2ZGLA 5FYTA 2W92A 2WSVA 1NCRA 3ON7A 1C8NA 4P5HA 5FP8A 2HEYF 1C8M1 4MGKE 4Y1ZA 1CWPA 2HWB1 1GQPA 5FZOB 5A32A 1SQ4A 3U4XA 3ZN6A 3WG4A 4CE8A 4XC9A 3CL1A 1PNGA 1R1A3 5FDBA 2XVGA 5FRAA 4E4HA 4QXHA 3HNYM 4JDNA 4MXWB 1T6GC 3PMSA 4AVCA 4XTMA 1G9FA 2BYVE 3U14A 2HWB2 1BMV1 1FV2A 5FYYA 4BYYA 2VUDA 3LB9A 3L2HA 3SH4A 2AACA 2WNVA 3K4ZA 3DEMA 3MV11 4HKWA 2EAAA 2FCUA 1IPSA 1SG3A 4H7MA 3GGLA 4GMP1 1BEV2 4FFIA 4XQ4A 1RHI3 1W8UA 2VL4A 4NIAA 4Q8LA 4MSVA 3CJIC 1Y43B 2K0GA 3V0BB 1V9U2 1W8TA 5HV4A 4XDOA 5JSPA 1BK1A 1W6MB 4YLZA 4ES9A 2A73B 3KT7A 4YWAA 1ZA7A 2Y6FA 1IZ3A 2E31A 1VRH2 2ARBA 2P1BA 2XJTA 2GH2A 3S7IA 1GP6A 2R49A 3POWA 2HH9A 2FDHA 3VBUC 3RMXA 1SLIA 3B93A 3PU3A 4O9GA 3ST7A 3VBRC 1E57A 3WP5A 1QXJA 4AI1A 2VTXA 2D44A 1VAKA 2VQUA 3MHZA 2Q1ZB 5I0RA 2UYBA 1W9SA 3I97A 5DAQA 3A0NA 3K48A 5GZCA 4BCUA 4NHLA 2JX9A 5K0UC 3N3HA 1GZWB 2Z2SB 5FYMA 4WVVA 3KGLA 1BBT2 4P9XA 1WW4A 4FT8A 4XF1A 3H8UA 1AF9A 1PO22 1CAUB 3GJBA 2D97A 2VMGA 3VL8A 2WN3A 1TQ5A 4OUMA 5CZKA 1DQ1A 4DO0A 1OLMA 2QUOA 1ZBE3 5FBZA 2GN7A 3FHQA 4JVAA 5JWPA 5KHJA 1NKGA 4CCOA 3SCHA 4PCRA 4IEZA 1L7QA 3WUDA 3WNMA 1JOPA 1XB9A 4GALA 2ZX2A 3VBFB 1LTEA 3WDXA 1RUJ1 1K5MA 2JDKA 4OQ9A 4AW7A 1LR5A 5AC92 1ZBA3 1D7PM 3ES4A 3WVJA 3AKRA 4D8MA 1OH3A 1OQ1A 2CHHA 3RI9A 5A6ZA 4YGDA 1YQCA 5EWSA 2ZPXA 3KV9A 4G3YC 5A7WB 5JPMB 4COYA 2AC1A 1UOBA 1V6IA 2BQPA 2WKKA 5FJHA 1GBGA 1ZBE1 2PHRA 3OD4A 5J48A 2JIJA 4IE5A 4Q4W3 3R4SA 3WW2A 4CDXB 1U5IA 4CU7A 2W68A 3PVOA 3J8F1 3ZSEA 1PVXA 2WSUA 1FATA 1IPKA 2PHDA 1Q5OA 2H0VA 1W9YA 2QZ2A 4JTOA 4LO7A 5FY9A 3RMYA 5D1IA 5FZMA 1M4WA 3UNPA 3WW1A 1J1LA 5FZ9A 3PHMA 3ZM8A 3WP4A 4OHYA 2FDJA 2LROA 4PI2A 2X53S 4WVMB 4JQTA 1AXKA 1EAH3 2VOVA 2WZR2 4A7YA 2FDIA 1QQP2 4HBNA 4C1WA 1W8HA 4AGGA 4IGOA 3CDZB 4Q4Y2 5LRRA 1Q56A 3KB5A 1LEMA 1R091 4Q5OA 5CAZA 4TTGA 2VMDA 5C8WA 1D2QA 4OYUA 4L2NA 1SLBA 1GOGA 3R05A 4FPEA 4NWVA 1I5PA 5FOJB 1TNFA 2ZAAA 1LGNA 2ZS6B 3B9CA 3IIIA 3ZSJA 5CBLA 1OMIA 5F5QA 2R6QA 5A3TA 1M06G 3HWJA 3I2IA 4QX8A 5I0DA 4LHSA 2O8OA 1EPWA 3FC0A 4AFBA 4I3PA 4CCMA 1C28A 3WCRA 2EXIA 1W8WA 2YPJA 1VAMA 3AZYA 3B9IA 3I54A 4Q4X1 4X8PA 3WQ1A 1GFF2 1J3PA 4GMP3 3VBRB 4RHV1 2XBO1 3NAPA 4FTEA 2PAEA 4NAMA 1Q8SA 3SISA 4XQDA 1UXZA 3QACA 5LZ6A 2B8MA 2W0XA 1GWMA 5FY5A 1UOFA 1CJDA 2H0BA 4MZUA 4GWJA 1HB3A 1VB2A 4XFHA 3TEZA 1X50A 5FPAA 4XAEA 3T30A 1HRI2 3RZZA 2BTVC 3DL3A 2HLEA 2YZ4A 4YZ2A 1TG7A 4RD7A 4BM8A 1WZXA 4EE2A 2H6CA 1O91A 2BOIA 5IK5A 4RQPA 2D6LX 4JKLA 4AGVA 4YFWA 5TSWA 1COV2 3N7MA 2DBNA 2XONA 4XF3A 5A3WA 3U1XA 2XH6A 4Y5SA 1W8OA 1DGRN 1PVC2 3BTZA 1WA4A 3IMMA 2ID4A 4YYOA 2A6ZA 5FKCA 1SHWB 1S0CA 5FIXA 1RUJ2 1RVF1 4UOJA 2UY9A 1XBFA 5LCWL 5K8SA 1PGL2 1FPN1 3HN3A 4B4QA 3FFQA 2WNEA 1S0EA 2GN3A 1OF3A 3IDEA 4N53C 3HQRA 4FP3A 2RMU2 4HONA 3E6CC 4UT5A 3TWIA 2PXJA 1NZCA 4A2UA 3ZXFA 3HN1A 3AYAA 1GP5A 2JKBA 3VBSA 1O4TA 4XXPA 5FXWA 1N3QA 3ZKYA 2A6YA 4AQ6A 4NWWA 3E6BA 2RHPA 4Y4RA 3VN4A 2GH8A 1QIQA 4QHZA 4GXLA 1C1LA 2BOJA 5DN2A 1MVEA 5FWJA 3WNNA 2C0ZA 2I07B 2XR4A 2R071 1ZRRA 3LEKA 4F83A 4LIVA 1DZRA 5B4XA 2MEV2 2GAUA 1GR3A 2ADEA 3LWCA 3LDKA 3CF6E 2VECA 5DABA 1R64A 1VJ2A 1W03A 3CJIA 3OG2A 4LKSA 1QXPA 2E63A 2I74A 5AFBA 4YZ3A 1QJX3 1HN1A 2R072 3GHMA 3V0AB 2XB6C 4CEWA 3H0OA 1W3VA 5JOYA 3VHNA 2DFCA 3I7DA 3PUAA 4N53B 5FAXA 2VULA 3WQ0A 4BISA 5FZ6A 3N9NA 2R041 1AJOA 4XETA 1WMXA 4ARXA 2DTWA 3OGSA 3ZFFC 2Y6JA 3WY6A 1LOFA 4F7ZA 1GWLA 4LUKA 3AZZA 5JZGB 2ZEXA 2GC0A 2WWJA 4COZA 3POJA 2JEMA 5FREA 2EXHA 4ZY9A 3SQOA 2DU1A 1RUI2 3ILRA 1N47A 3CLPA 3P6BA 4BQ5A 3JUUA 4LULA 5GLUA 4IEPA 4NPLA 2OKXA 1VBC3 2VPVA 4X8NA 4D0QA 1NCRC 1RUF1 4IETA 5HV0A 5GALA 3LCPA 4DXTA 4GZ9A 1F9KA 2W47A 4P9JA 1YIPA 3VHRA 5FYIA 2WR9A 3KVBA 3RRDA 1W05A 4FOQA 4IV1A 3ZDSA 4QPYA 3O1TA 4XABA 1VBD3 3BU7A 3WHTA 1JN2P 1V6KA 2DF7A 1RUG2 5BNPA 1PO12 4LKFA 4QU1A 3PTRB 4WVMA 3LOIA 3WNLA 1C8M2 3MDPA 2YC0A 3PLQA 4MADA 3ZN6B 4AR2A 4PQ9A 1IS4A 4C8DA 2GP3A 2ZGMA 1PHMA 1SDDB 3ZFEB 4KGQA 5A7OA 4CEYC 5L7OB 4CEYB 2RV9A 5L7OC 1BVVA 1JUHA 2EICA 1UX6A 2VU9A 2WNOA 3SKVA 1OSGA 2WBKA 2YPDA 2D7FA 1KXGA 2RR12 4MGSA 4BH9A 5FTTC 4EWDA 2P4EA 2W9XA 1K42A 2WNUA 2ET7A 4COUA 2DU0A 3KCCA 1AX0A 2DURA 1AL22 2HBUA 3M1HA 3ZFGA 3WQBA 1UYPA 3DXTA 1S2EA 4FP2A 3H7YA 4FPLA 4AQSA 5EIYB 3OCPA 2XVLA 2GC3A 4O65A 3RYRA 4XIKA 5DZGA 5GKAC 5G04L 1HQLA 4QGNA 3UKVA 2EA7A 4LO5B 3VD7A 4HSJA 5K9YA 1H2LA 3EB7A 1AVBA 1C3HA 2BVVA 4FPJA 4PLNA 3MZHA 2OVUA 1VLNA 4YVWB 1HB2A 4CYDA 3KZ4C 2D93A 4R9CA 4UFKA 2VUCA 3TB0A 4DY5A 1GWKA 4EN9B 1FOD2 4Y5Z0 3R4UA 3SMHA 2GC1A 3ME2A 3TBDA 4B8EA 2GC2A 1KD7A 5JI9A 2AUYA 3H1MA 3RPQA 1DLLA 2V5DA 5DAVA 5F5IA 4LK6A 3IT8A 3USUB 1SLLA 3GDBA 5CFDA 3N9MA 1IG3A 1RXFA 5FYZA 1MQTB 4NRMA 4LLOA 5HI0A 1IKPA 5LA9A 1RYYA 3FZ3A 4UW5A 4FPHA 3RGBA 1YFUA 4UW6A 3T3YA 1XYPA 5IATA 2E26A 2RS12 3FE5A 5CFCC 1RMU1 2FMYA 3VKMA 1KGYA 5EZWA 2VTFA 2ZGSA 2O0OA 2MNGA 1UNBA 5CKNA 1D4VB 2P6HA 1H9WA 5FPUA 1N3PA 4ZZ5A 3AP4A 4XXAA 5FYVA 4AEDB 1NA1C 4QKFA 3J8F2 1N1VA 1QJU1 1A3KA 2FD8A 4BWOA 2HYKA 4JDMA 1J3RA 4MYEA 2BP6A 3PUHA 3OBAA 1QY4A 2VNVA 1FMD1 5FQ0B 4L11A 1CIYA 3LA3A 1JTZX 4EZ4A 5FZ3A 5FLJA 5CA6A 2WDBA 1J58A 1O7FA 3ZOIA 4MGTA 4DFSA 1DQ5A 1YYNA 1CPNA 5EQUA 2JG8B 3PTYA 3AP7A 5DUVA 1W6MA 3FN9A 2YG0A 2QJVA 2OZ6A 3OBZA 4CSWA 3O1UA 1K3IA 1LENA 4IEUA 1QF3A 3WG2A 1Y7BA 1RUC2 4KBBA 4BK5A 4QX1A 4RS5A 4CRQA 1KFXL 1JOBA 1KS5A 1DF0A 5DG1A 1DHKB 2EF6A 4YZ1A 3UGHA 4CUGA 1FAYA 1HLCA 5C70A 4ZU5A 1MPXA 3ITQA 3B69A 3T1MA 3PIGA 2C9KA 3ZXJA 1UZVA 2ATFA 1SPPB 2CGNA 4W65A 4Y4YA 4QB6A 1GZCA 1GU3A 1DGRA 2WZ8A 3AM2A 3SEEA 3U75A 1XE7A 5IVBA 1C4RA 4U36A 4O7XA 3N9QA 2JJ6A 1AXYA 5D2AA 5G05L 2ZABA 3OY8B 4UW4A 1ULFA 1X8EA 5L19A 4FPOB 1NA1A 1NLRA 1RMU3 2ZMNA 4PLMA 3VD4A 3EMRA 2GNMA 1V0AA 2OPWA 1DGWA 3ACLA 5JZGC 4D6SA 4RS5B 1HRI1 3H3LA 2W94A 4JX0A 5CFCA 1VP6A 4Y1YA 1EYBA 2IXKA 2KXLA 2Q8DA 3ZLIA 1U5ZA 5DG2A 2VO5A 1RUG1 4EN6B 3PIJA 3IIAA 3UGGA 3I2HA 1SPPA 1R083 5C5TA 4Q4V2 2V09A 4OULA 4E9KA 1SMVA 1UPIA 2AREA 1NAEA 2RS11 4BDVB 4COWA 1OOPA 1KRIA 4BOWA 1MZFA 2VCCA 2WS91 5A1AA 4WV8A 4QT6A 1H1MA 1DGWX 1RXGA 2OXBA 4ISQA 4D6QA 1TME1 1NZIA 3HNBM 4ZU4A 2VY0A 4DMIA 3H3ZA 3WNOA 1JZ5A 1W2UA 1ZRDA 1RTVA 3LF7A 1K45A 1ND3A 1YLLA 3EQEA 3AMQA 1OD3A 1PMJX 5FMOL 3OBRA 5ACA3 4LBMA 2WNUB 1V70A 2QQJA 1ZZ7A 1HXS3 4IL7A 5FMCA 4QDQA 3ZSLA 3ZXKA 4YG3A 4XF9A 1PIV1 2GMEA 3O12A 5E8AA 3VD9A 2JDAA 2X09A 4A6SA 3GXUA 2ENRA 4ZS3A 3ZSMA 3KF3A 3ABZA 2RS31 2PA7A 3O1RA 4CXWA 2WQZC 5CYYA 2HWD3 1GZWA 4N9HA 2JG9C 5LB6A 4C91A 1U5YA 4WZFA 1MZ5A 4WZCA 4AHZA 2DUQA 2GSYA 5KWRA 5C9AA 2E33A 2P34A 3ZXDA 2MEV1 4AE2A 4YW1A 1YJLA 3N36A 1VBD1 5JOZA 4B4RA 1BVP1 2J1RA 4LJHA 3BN6A 1JYVA 2PAKA 4QX5A 2VVDA 3SITA 5HPOA 5BNPC 3WP3A 1W90A 2EIDA 4XHXA 1YWKA 2WA4A 2O8QA 4FTBA 1OFNA 3ZXEA 1FNZA 4WVZA 4LNVA 3F95A 4LITA 2TNFA 3NKGA 1YQ8A 2PFWA 4QHOA 5CFDB 3LOBA 4OI0A 4WBBA 4Q27A 4ES8A 1W6QB 5IVEA 3AXDA 3W5NA 2BBAA 3T2QA 5A3OA 3VDCA 3MI8A 3I59B 1BZWA 5EJ1B 1ULPA 4HXCA 5I8TA 2QQKA 3TN91 5HCBA 3S0MA 5A3PA 4A45A 4A41A 4K1YA 4YARA 5JMOA 4P14A 4ZXKA 3VBOA 1GICA 1DG6A 4ZZ8A 2D98A 2Q4SA 1ASJ2 1UPSA 3NV1A 5F2SA 4XFGA 3M2MA 1FXZA 1POV3 2PHWA 3ZFFA 4Z92B 3EHKA 1KS4A 4AI0A 1S2BA 3IZOA 4Q4Y1 2XUMA 3RJRA 3ZYHA 1QQP1 1ZX5A 4KGGA 4OHWA 3O5SA 2LRPA 4FAGA 4LBQD 4MHRA 4GD4A 4IV3B 5BNOA 5DUXA 2C4XA 5FZOA 2RJKA 5A32B 1H8TC 2QQWA 3BGAA 3M8LA 4Z2AA 5L73A 4LBOA 4NIDA 2B39A 2X8KA 1XNTA 4AEMA 2EIGA 3ZYBA 3I4IA 4Q0SA 1LOGA 5IVVA 3HOBA 3NO8A 1QJY2 4XZPA 2ZMKA 4IEXA 1H1AA 5ANQA 5HCFA 2ZEZA 1WD3A 3AMMA 2DTYA 2TEPA 3KSCA 5FZ4A 3BYWA 5KHHA 1CR7A 1AR92 4Q0PA 2ZZJA 4JV4A 4OZXA 2IVIB 2HWC2 1JYNA 4QX3A 3HNMA 4NIGA 4QPWA 1X8MA 4Q26A 2ZJCA 4META 2VMIA 5LASA 2R0FA 3TRSB 4DXZA 2IZWA 4CDXC 4NMIA 4YGCA 3AYDA 5C3RA 2VZQA 2BJSA 3I3MA 3V64A 1JZ4A 3GALA 4M01A 4Y1XA 4W4ZA 2W5FA 1PGL1 3T1LA 1XPWA 1UAIA 2HWE1 4UAPA 1AJKA 4CXXA 1UWWA 3WV6A 1AUYA 4IERA 3JD72 2OQ6A 4IEQA 2QQNA 3WF0A 4DPNA 5GLZA 2DVDA 5FZ7A 4LBKA 3HMYA 4AVSA 1RUH2 1UN1A 3NV3A 3VKLA 1AR62 2VW2A 3RJ2X 1G9DA 3SH5A 2D6KA 5FKBA 4CCCA 3LDRA 1HRV3 2WFPA 1OKQA 4BQXA 1LU1A 4JGYA 3EXUA 4G9SB 1EUUA 2YXSA 3H7JA 1REDA 2HWE3 1G9BA 3JB4C 2J1AA 3HD8B 3POIA 3VDDB 4AQ2A 1AR61 3O1SA 3THDA 5JOWA 1SCSA 2XDVA 3RYPA 2VM9A 3CZUA 2IFRA 5JMCA 4ET7A 1K5MB 1ST8A 4WM7B 5KXEA 1R093 1UKGA 2GNTA 2FBEA 3DXUA 5FLIA 2BPA2 2BDRA 4KQ7A 4RFRB 1W28A 4HSLA 2W08A 1OA4A 2JDHA 2VZTA 4GWIA 4XURA 4BK4A 2QQPA 5K7PA 5E89A 1G9CA 2PYTA 3OY8A 3WG1A 1RUC1 3T0BA 3B01A 3POGA 4YW3A 3INAA 4TXWA 2WRAA 4TLFA 4JGYB 1QXRA 4Q4W2 2XGXA 4KU8A 3ZFEC 1ENXA 2Y6GA 5I8YA 1EUTA 2X5IC 1PO11 3ES1A 1QDCA 2V4VA 3B94A 4V2WA 2XLGA 4Y26A 4A7ZA 4URAA 4KWUA 2HWF1 2Y0IA 5BV6A 5LWBA 3ZN5A 1XNCA 4DUVA 4Q4W1 4A3XA 3EO6A 1W6OB 5A7SA 1CJPA 1X7NA 1AX2A 1IOAA 2E6VA 4XVHA 1YI7A 4LBNA 1RUF2 1UZ0A 1QQP3 4PIZA 5DAPA 3DPRA 4Q4Y3 5EPAA 4QQOA 3FBMA 4P9WA 3RI8A 1AZDA 4S2DA 2OX0A 1A8DA 2V4AA 3VBOC 4DOUA 5JXGA 5CADA 2QQUA 3S57A 2JE8A 4HG6B 1GP4A 1RUE2 3C7FA 1SLTA 2ZGQA 2ZZQA 1DLCA 1XE0A 3A0KA 3FUOA 4IEOA 4JKMA 4N9IA 1BK0A 2VZVA 1O8SA 1LOCA 2OQ7A 1SLAA 5FUIA 5JLVA 1PMHX 3TN93 1MQTC 3I8TA 4NRQA 4AWDA 4OHZA 2YFZA 2R32A 1YCIA 3MICA 2UWCA 3VBSB 4PHZA 1NE6A 4Y3OA 2BFUL 4UYBA 4CP2A 5F2WA 1S0BA 1WCQA 2P37A 4ATEA 3JU9A 3V0BA 3ATGA 2OZJA 1FPN2 2XOMA 3S7EA 1UYZA 3EJKA 1VBA3 3LIHA 3WDYA 1JU4A 1LKNA 3PJYA 4P5YA 5FK8A 5FWEA 2A3YA 4QAWA 1VMFA 4HK8A 3POSA 1DQ4A 3JXSA 5EJZB 5FXZA 1UYYA 3VB9A 2JG9A 2WFF2 3VZLA 4UW3A 1ULDA 3Q8EA 4YG6A 3TYJA 2W39A 5A6YA 5EV7A 5EYYA 2VCAA 4FBFA 3OEBA 1MEC2 3V0AA 2WQ4A 5T54A 2XHKA 2HWD1 3BI3A 1SBFA 1OF4A 1GNHA 4MX3A 1AR71 1Z7S1 2DVFA 4WM7A 3VDBA 2YC2A 2RS33 2DCTA 3C7GA 4QGLA 4QPIC 4M0NA 1QH7A 1GSLA 4NOTA 4IESA 4MGQA 5J09A 3MFCA 1X9TA 4XMAA 1AYN1 1LEDA 3PL0A 1MVQA 2BUKA 5BXXA 2KM2A 4XW3A 2Y8KA 3K4DA 5ACA1 5FV3A 5LRSA 4DXSA 1VAVA 1NG0A 1JHJA 3AZWA 3G7DA 2C24A 3IWZA 3KT4A 2QKDA 4MOAA 4PDWA 3WNXA 4CA9A 1BXHA 4CUBA 3T4HB 2QQOA 3UETA 1OOPC 3BUCA 1HQNA 1BEV3 1OBNA 4M3CE 2E7TA 2RS53 2A75A 2VW0A 4BQ4A 2WS93 3B02A 2ZGTA 1UOJA 3FLTA 2CGPA 2WNVC 5LY1A 2A1XA 3POFA 3RVHA 5FZEA 4IDZA 4FFGA 2CGOA 1QH6A 1R081 3HBKA 5T55A 4FCAA 4ONUA 4XCBA 4N8MA 2HBTA 5C7GA 4ARYA 2EAKA 2V73A 2XKOA 4LLFA 3IAPA 3N9PA 5BYNA 5DUUA 2K2SA 4DUXA 2ILMA 2ZKLA 4M00A 1CIWA 1FV3A 2DVBA 4QX2A 3UKTA 3VKNA 1I6XA 4GKYA 3DN7A 1G86A 1H1IA 2BGPA 2JB4A 3BIEA 4CP9A 5A70A 1XU1A 2A6XA 4D69A 2ZGRA 5DZFA 1UCXA 1Q8VA 2C1FA 1W6QA 4PF1A 1C1FA 4IGQA 1PGW2 1X33A 5FO9B 3A7QA 1A78A 1W2TA 3IM0A 1LHVA 4FOYA 1MS9A 2NMOA 4C0BA 4DS0A 4YGEA 5EYXA 3MIDA 5CEHA 3AKSA 2IC1A 2J7MA 4N43A 4DZGA 2W1QA 1UKRA 4AL9A 3JBG3 3Q8BA 5F3EA 1T6BX 3CMGA 5GM0A 1HB1A 1RUE1 1LRHA 1VMHA 3UGFA 1QNWA 3P3PA 4HMZA 2JDUA 5EHDA 1CN1A 4DEQA 5AC93 4Q0QA 2WUHA 3I2OA 1PX3A 1VBD2 4QPGA 4FSJA 2XJRA 1UU6A 3WDUA 1OFSA 5LEKA 2DCJA 4MG2A 4MV2A 5LA0A 5FZFA 2VNOA 5LATA 5LBEA 4XE9A 3U10A 3K3OA 4YW7A 3W5MA 1FMD3 5DUWA 4XUTA 5FZDA 1QEXA 3NAPB 1LU2A 4NPMA 5J36A 2WO7A
chains in the Genus database with same CATH topology
1DFQA 2HWF2 3KCXA 3KD4A 4PBPA 4Q29A 3KQRA 2ZACA 2R1DA 2D3PA 1ZREA 2RR13 4UBGA 3UL2A 2ZGPA 3ZMOA 4CTEA 1ULCA 3MF6A 4LBJA 3IBMA 2LM3A 2FZ1A 2D6MA 5GZEA 1F31A 2XVKA 2ZGKA 5KHIA 2BBVA 2UYAA 2NN8A 1VBB2 4HT1T 2YV8A 1ZA4A 2DUPA 1S2KA 1ZZ6A 4GULA 4NHMA 4C0HA 4R4ZA 2BWCA 1UU4A 2DFBA 5H9SA 2CWMA 4DY3A 1H8VA 1NQDA 3I59A 1LHUA 1LJ7A 2JG8A 4K1ZA 4OI2A 3WX5A 4BMBA 5LK7B 3J26N 1J1TA 3H1YA 1CVNA 1LESA 1PVC1 3UJQA 4AEJA 4Q4V1 2VUAA 1PO21 4YM2A 1YUDA 3VZKA 4LHNA 1N1SA 4UXAA 3VBHA 1F2NA 1V9U3 4C90A 4AGRA 3VBFA 1WGPA 2IXLA 3ZFGC 3JCIA 2UY8A 2CAVA 4XTPA 3AMHA 4BIFA 1EV12 2R063 3TNPB 3VV1A 1XU2A 3VDDC 5FPZA 4HK9A 4IEYA 2C9AA 3AMPA 4LE3A 2GMMA 1O4YA 4XF4A 3SH3A 4N43C 4RL7A 2X29A 5L7OA 3MW4A 4HN1A 4I0AA 2XBO2 4HKLA 3CU7A 2R061 4J6GA 4Q4X2 5B2GB 2DCYA 3SLIA 2DV9A 1O4ZA 1RB8G 4HPKB 1V9U1 2JDZA 5HCAA 3BOWA 1TNRA 2O1QA 5A3MA 1WW7A 4ORFA 4D7SA 1YHFA 2FQPA 2VMHA 4EN7B 2JE7A 3IN9A 3O14A 3OF1A 1PO23 4YW4A 3UV9A 4BLJA 4AFCA 1PVC3 1UW8A 1AHSA 2H6BA 4M0HA 2P3KA 1OPOA 2PHXA 2ZGNA 2Y0OA 4AYUA 4QQPA 4YVWA 1MS4A 1OQDA 3B00A 1LHOA 1LOFC 2OIIA 3OGGA 3TOJA 4LO8A 3QD6A 1ZBA2 1CD3G 3B5LB 3CEWA 3GZUC 5EFUA 4R9BA 1UIKA 4QM9A 4CEWC 4QQ2A 3MPBA 5DDJ1 1H0BA 2BNMA 2R043 4FO9A 1OA2A 2ZKNA 4UBHA 3IPVA 5C6CA 1QJX1 4YM3A 4FXKB 2A3XA 4NHKA 3HQXA 3VL9A 1H8TB 2ARXA 4MGYE 5F1RA 1Q8OA 2BWAA 2D40A 5CIRA 1QJX2 2R073 2WINB 4GB33 5AC91 3MLKA 5C4WB 1A6CA 4QPIA 3VBSC 4QGMA 3VKFC 3BCWA 1LHNA 4WM7C 5GJ6A 1RVF2 4GWNA 3ECQA 1EAH2 5IT6A 3D4KA 4COVA 2SLIA 4H55A 3K51A 3H3UA 2NM1A 4FQ4A 4XBQA 1D0HA 1W39A 5KHKA 4FVVA 3B7MA 3BPZA 1AYM2 4CDUC 5JCTA 1G8WA 4QQHA 3A4UA 1V6LA 5FLHA 2R30A 3S30A 5ABJA 4HFSA 2CWSA 3ETQA 1R1A2 4HANA 2QNKA 1BQPA 1QJU2 2OUJA 4RQPC 1CAVB 5T5JA 2Y26A 2DVAA 2ZCWA 4CDQC 1O3RA 1MQTA 4RGAA 3TNQA 4E4DX 5F6LB 4KWLA 1D4M2 2HWD2 2E51A 1AX1A 3IDBB 4L92A 4E2SA 4YW2A 1GKBA 1H30A 4URTA 4D7TA 5BNNA 4DINB 2B42B 1LECA 5DZEA 4L8QA 3NAPC 5H9QA 2AH2A 3O7OA 1JH5A 2B46X 4K8FA 1BEV1 3AXEA 1SFYA 2MHFA 1RUD3 2CYFA 2RM23 4RHV3 2VNRA 3OGJA 5JOXA 1XYNA 2WZR1 3M3CA 4RA0A 1OLQA 2F6BA 4FPFA 2X5IA 2E7AA 1N3OA 1AYN3 2PN5A 3CO2A 1U5XA 4C1XA 4KH9A 1MR5A 1ENSA 5CVRA 1QJY1 4YZ5A 1GLHA 3D8CA 5JVVA 1AR73 1AL21 1Z7S3 2NYYA 3URFA 1B35A 1KQRA 3V65A 2PLV3 4W6XA 4N90A 4X6QB 1G6NA 4NN0A 3AFGA 1EAH1 4R52A 4XJUA 1TMF3 1UZYA 4YRDA 5FFOC 5IK8A 3TAYA 2IXCA 1G9AA 2FMDA 3ROUA 2Z42A 2E9QA 2NPIA 1NCQA 2XJUA 5KC5A 1VRH3 4XDQA 5T5PA 3WDWA 5BNPB 4BPZA 2F4PA 2PHTA 1AYM1 1WMFA 1MEC1 4FQZA 4YW5A 3J8F3 2E53A 1BCXA 4AHYA 4N7UA 1SFNA 2TUNA 1D0GA 1AR93 2B5HA 1H4HA 1R1ZA 4ISRA 4LBQA 3AZVA 2WLQA 5C33A 2Q1MA 1JUIA 4FOWA 1PZ7A 4JQRA 3PNAA 4O9EA 4FPYA 3AZXA 3WT3A 1AR91 4MXWA 1G7YA 4X6RB 3EBRA 2SBAA 2YY1A 3JQXA 2VVFA 3WDTA 4EWEA 2WC2A 1WLWA 3U0ZA 1PO13 3RNSA 2PHLA 1VRH1 2Q30A 4D7YA 2D5FA 3ZXLA 5IK7A 5J98B 4YVSC 2CAUA 4H7LA 4NPRA 4L97A 1TMF1 4R9DA 2VOKA 2VOXA 4AVTA 1NA1B 4M3CB 1CGPA 2BGCA 1XE8A 4KL1A 2UURA 1REEA 1AL23 1IKQA 2QZ3A 2EVXA 4Y22A 1APNA 1RITA 1WW5A 1Y3TA 1LHWA 4HZFA 3D0SA 1OHFA 3P3NA 2WZR3 1JBCA 3AMNA 1W6PA 1DU3D 2AYHA 2B7YA 2VW1A 3U11A 4AF9A 4AVBA 1GZ9A 1FOD3 2QVSB 1HRV1 3KS7A 1QOOA 2RJLA 3AJZA 2XLAA 3GBFA 4PJYA 3VGIA 1C5IA 1H2MA 1YO8A 3AKQA 3OYWB 2CY6A 2W52A 2YROA 1SACA 1V6JA 2JG9B 2BEOA 3GF6A 1HXS2 2IFWA 2ETEA 3ALQA 2DVGA 1IS5A 4AEKA 2HWB3 3ZMNA 3FLRA 4MLOA 4EV0A 3CNAA 5IUQA 1GQGA 4YG0A 3E97A 1BKZA 3AKPA 2ERFA 2ZX3A 2D6PA 2R16A 5CB7A 1U0AA 3HR9A 3HT1A 1PIV2 2ES3A 3D82A 5C9AC 2JICA 3AP6A 3IKWA 2K9ZA 4Q0VA 1EP0A 1PMIA 1UL9A 3JQWA 1QNYA 2PTMA 3BODA 4K40A 3TN92 3VBHB 5H9PA 1ZZCA 1WCDJ 1UMZA 4QXKA 1YI9A 1Z0HA 1TME2 3GHNA 5FQ0A 1O3QA 3WD5A 1VALA 3AP9A 4GH4A 4XFFA 4DB5A 4LT5A 5I0TA 4XJZA 1IHMA 3ZYJB 3AP5A 1QDOA 1B35C 5FOBB 1YXWA 1GQHA 4TWTA 5F6KA 1RIRA 1W6NA 1ND3C 1PGSA 1VBE3 1ASJ3 4G4FA 1PK6C 4XFIA 1CESA 2RMU3 3WW3A 4Y22B 4L9BA 2ZHNA 3MYXA 2V5YA 1NOVA 2VGDA 1DQ2A 4BA6A 2FZ2A 1S0JA 1D2SA 1RC6A 2OW4A 3WG3A 1TEIA 3B3QE 3KGZA 1UZZA 1ZM1A 5JPNB 3VHPA 4DRVA 3GBGA 3WP6A 3GZAA 1C57A 1UD1A 3SHRA 3RS6A 4TYSA 5BNNC 3DUIA 2IXJA 3FJSA 2XJSA 2R1BA 4XHBA 5EXOA 2EXJA 2ZX4A 4P9LA 3BB6A 1PGW1 2RS52 3CJIB 2HEVF 2HWC3 1WD4A 1RUOA 1BMV2 4XF0A 5I0UA 4KG8A 4K21A 4W6YA 4CDQA 1TE1B 2DWRA 3FHIB 3NKTA 4I3GA 2JE9A 2A70A 1ZZBA 2XJVA 1DQ6A 3KM5A 4B29A 3Q9OA 4JGZC 2BVBA 4NVPA 2B9UA 3LSEA 3SCFA 5AFEA 4DQAA 3ELNA 1URXA 3WLUA 3THTA 4AFDA 4CDUA 4E4SA 4LO6B 4OHVA 3MF9A 1BYHA 2WJSA 3ZFFB 4P9YA 5C4WA 3O0XA 4KWKA 2WIIB 5DDJ2 1HXS1 3USUA 4QD2A 3MLJA 1RUH3 1W6OA 1FX5A 2CL2A 2EXKA 5BUVA 2XLFA 2GDFA 3PVBB 4QMAA 3H1WA 3BOPA 1Q8PA 1VB4A 3NV4A 3I2DA 1FNYA 2ZAHA 2HWE2 5EJ3A 3DGTA 1S0FA 3JBG2 4INDA 1U12A 1VR3A 2HJIA 4LHKA 2RS13 3QH6A 4OI1A 1XQNA 4E2GA 2GALA 3M7AA 3MLLA 5GZDA 1B35B 4B7EA 5K0UB 3PVEA 2ZHMA 3RQ0A 2I45A 3J9SA 3OD0A 1ZNPA 1CAVA 3NL1A 5CFDC 1MS1A 4MGZE 1IGOA 4J1WA 1HRI3 1N1YA 3WZ1A 2IWGB 1OQEA 3VBUB 3AJYA 5JDBA 5JSRA 4YVWC 1BBT3 4OFGA 5D8AA 1COV3 3OBTA 2AZ5A 2A5ZA 4JGZB 4RFT0 1RGSA 3N7JA 1PM7A 1O3SA 5F9TA 4YVSB 5FO7B 3VZMA 1CPMA 1ULGA 1ZBE2 2CNAA 2WNVB 3OJBA 1VBB3 4FPCA 4K7JA 2BPA2 4LBQB 4XFCA 4CDWA 2CV6A 5GLVA 2D6NA 2VG9A 3FUQA 1NLSA 1CX4A 4XJWA 4YFZA 2WNUC 2TBVA 1XRUA 4Q1RA 4HN0A 2X5IB 4DRRA 1QOTA 4EJRA 3O0WA 5C9AB 1JXNA 3HAGA 1RUE3 4LE4A 2MPFA 4CEYA 1LCLA 2G9GA 1A8MA 1EY2A 1WLCA 1CAWB 1JOJA 4JC1A 3ZYRA 4CP1A 1NE4A 2JD4A 2GU9A 3D6EA 2PHUA 1HX6A 1AXZA 1N1TA 4XJAA 3IMNA 3M3EA 3VBFC 2GNBA 5H9RA 3UK9A 4LBLA 3M3IA 4QQLA 2HKXA 5KXBA 2XG3A 3HT2A 1BBT1 2PAMA 4PIYA 1LULA 3PJQA 1MACA 4OLLA 3FWEA 3ZYIB 1RINA 3GNEA 1KFUL 1V00A 2Q8OA 5BNNB 1O3TA 4KWJA 4U2AA 1JW6A 2OUHA 4XYXA 3MIEA 4BE3A 2A71A 2BFUS 3PMEA 5C8CC 2VXRA 1S55A 2DUOA 5ACA2 1AR82 2OPKA 2ZBJA 3HBZA 2VOWA 4KG0A 4HVRA 5E16A 4V1PA 3L9JT 2RS51 4JRLA 3VKOA 4EN0A 4ASMB 1QWRA 5JIUA 4YNIA 1KJRA 3KT1A 1RUH1 3ZXGA 3QLQA 1NYWA 5GZFA 1C5HA 2WS92 4KU7A 3D0JA 2B45X 2WFF1 4IEWA 3VZJA 3VZNA 1GV9A 2YMZA 4L99A 3WHUA 4N53A 3ILFA 3VLBB 2DYCA 3HIFA 4R4XA 5JSOA 1DYKA 1ZVFA 1I5ZA 2QFEA 1YRZA 4TSVA 2YUEA 4OHXA 1EV11 4ITCA 2OA2A 5I0SA 2AR6A 4HVOA 3M70A 2NLRA 2Z79A 3E5QA 3X29B 1QJZA 3JZVA 3KLSA 3QBQA 2PHFA 3AKTA 4WM8C 4YZ4A 4I0WB 4AHWA 4IV3C 4NO4A 1NXD1 1RUF3 1VBA1 2UWBA 3LKJA 1CAXA 4HETA 3NVCA 4CDQB 4D94A 4BIOA 3T2TA 1MZEA 1H4GA 1YFYA 4GA9A 1PZ9A 1YNAA 1RHI2 4ATFA 5HXVA 3U07A 2D6OX 2YYOA 3RG0A 3E5UA 1LB2A 2XWJB 2QE3A 4J1XA 4AVAA 1ULEA 5ABJB 5CG9A 3N7LA 4P9GA 4M3CF 4Z07A 4XILA 1RJ7A 3NJZA 2FHRA 4I01A 1ENQA 2P2KA 1FMD2 4NR1A 3UJOA 2CTVA 3BTAA 1ASJ1 4GQ7A 3RWNA 2JECA 1UF2C 4PDWC 5J96B 1HKDA 2HWF3 2I2SA 4FAHA 4I02A 2JENA 4M3CA 1PK6A 4S2GA 3LZZA 1DBNA 1J59A 3MIFA 5HBAA 2ZA9A 2VQ0A 4F8AA 1JHNA 4XQWA 1RUI3 1W0PA 3H50A 3W9AA 1QGLA 1RUC3 4JTNA 3C2UA 3ZPYA 4Q0UA 1LOEA 1H2NA 3MEPA 4RR3C 5AVPA 2NP0A 1WBFA 2XJQA 1AYN2 1J3QA 3FMGA 2BNNA 2Q5TA 3ZSKA 4XMIA 1KDKA 2WZPP 1CQ9A 3OPZA 2Y38A 4MUVA 2NQYA 5GLWA 1MS3A 4N43B 1AR72 1Z7S2 2HEWF 1AR63 4LEJA 1XNBA 3M3QA 4BHPA 3JD71 1V6NA 4XOGA 1RMU2 1HIXA 3M3OA 5J7MA 2ZX1A 2WT2A 3AYEA 3ZVXA 2QDRA 1L3JA 1K5MC 5T50A 3RSJA 1W0OA 4E2QA 3RDIA 3E6DA 3UKNA 3J4UH 1Q43A 1RL3A 2ZHLA 4N7IA 2LTNA 4Q1PA 3N4MA 2YGLA 2XBO3 1WBLA 1FOD1 2YGMA 4HLTA 1POV0 4PIXA 4Q4X3 3JD73 4Z1VA 1MS8A 1ND3B 3ZYPA 3DPRC 1V6MA 3N7KA 5K0UA 4YSFA 3JB8A 3THPA 4RR3A 1KJLA 3R0RA 2VNGA 1DQ0A 4AFAA 3WOGA 1S1AA 5BNOB 3VBRA 1F5JA 3VBUA 1GANA 1REFA 5SV8A 1WMEA 1JYIA 3ZFEA 1RUI1 3AX4A 1UIJA 4Q8KA 5D8AB 1I3HA 3OYWA 3ASIA 4PLOA 1UU5A 2VUJA 3MFAA 4K6BA 4YVSA 2UU8A 3R4DB 1WCSA 4RR3B 4CDWB 2R042 3ENRA 3FX3A 4DNYA 2N7GA 1DYPA 3R6SA 4RQPB 5IK4A 1NCRB 1OOPB 5FMOS 4AFMA 1SBEA 1OI6A 1Z78A 4YM1A 5CG8A 4B4PA 4QHBA 2C5DA 3WUCA 4JGYC 3ZXAC 1POV1 1ZBA1 4BQ1A 3QCWA 1V6OA 4K3UA 4QU2A 5J37A 2XKPA 3QH7A 2OYZA 1WLTA 1RUJ3 1GNZA 4AK3A 5JAXA 1XYOA 3MIGA 4QPIB 1KITA 4Z82A 5J3UA 4XIOA 2D3SA 2WWSA 3MIBA 4IV1B 2YHJA 2AGSA 4GH4B 3WW4A 4IV3A 4Y24A 1H9PA 4WM8A 1MEC3 2LALA 1QMJA 1AYM3 3DPRB 1W6NB 4AI3A 1NXMA 5GLTA 2AENA 3VUOA 2GNDA 2DCKA 1H2KA 4CDXA 1EV13 3APBA 2MEV3 3BALA 1NCQC 3W58A 1WLDA 4Q2FA 5E1RA 5CU1A 1XXNA 3KMHA 2PLV1 4E27A 2ZHKA 2ZGUA 3ZFGB 2DCZA 1QKQA 2VH9A 3PVNA 1QJY3 4FOVA 4XBLA 3SNMA 1Q8QA 1R082 4KNCA 3LA7A 1MZ6A 4WM8B 1FYUA 4QM8A 4XEZA 5KXCA 2KA3A 3IPVB 1PIV3 2ZX0A 3FLPA 2WFF3 1NY72 1S0DA 4FXGB 3M4FA 4XFAA 3GYDA 3WQ7A 1H8TA 1RHI1 4AXOA 4GIQA 1RUD1 2RM21 2RS32 5BNOC 4RHV2 1TME3 1X82A 4HPKA 4H14A 1ND2C 1VBC2 2G9FA 1QOSA 1Y9QA 3AFKA 3ZIWA 5C8CA 1B09A 1S0IA 2QCSB 2A7AA 5T5LA 4R8HA 4ZU7A 2IXIA 2PQQA 3NV2A 2NMNA 1R1A1 3N35A 2D43A 2BNOA 1RJ8A 1RUG3 1MS5A 3IDCB 4XFBA 5T52A 1C8M3 2XJPA 5I93A 4ASLA 3S6PA 4LO4B 1IQAA 1ONAA 4PDWB 2RE9A 5SV5A 2WA3A 1SCRA 4FTSA 4GWMA 2UWAA 2WT1A 4S2FA 3POYA 2IXHA 1HV0A 1NCQB 4HL0A 1D4M1 4EWAA 1DDLA 5ABJC 3BIWE 5KC6A 4S2HA 1NQJA 3G6JB 1I1EA 2QDNA 2BW8A 1IS3A 4HVQA 1SLCA 1ENRA 1YFWA 4R9AA 4LA2A 2XPJA 3MW3A 3ILNA 3AK0A 1AR81 1DIWA 3GZTB 4H3WA 4XBNA 4GB31 4Z2WA 2A6WA 3AYCA 4CDWC 2ZMLA 3NSTA 4ZKTB 4AQTA 1HQWA 1OPMA 1YFXA 1XNKA 1VBB1 1WW6A 5KHGA 5D8AC 4OI4A 3NW4A 4I30A 1QJU3 2G4IA 4BMEA 4TZDA 4IXLA 3ZX7A 4AEDA 1FT9A 5DDJ3 4OUSA 3QOPA 1COV1 3E5XA 4JAAA 3O0VA 5DXDA 4MH0E 3VHOA 3MGUA 4E4ZA 1ZRFA 2VVEA 1F8VA 5BNQA 5T5OA 5A3LA 3OTFA 1S0GA 1X36A 3MW2A 3DF0A 1FI2A 4LHLA 5JZGA 4AEDC 2R0HA 2P3JA 2R062 4YGBA 1CAUA 1ALYA 3KCYA 3C3VA 5FPXA 1BJQA 5KXDA 1O5LA 1RUD2 2RM22 1CAWA 5I8SA 4EROA 1IS6A 2P17A 5AVAA 1WUVA 4K9SA 1SEFA 1KDMA 3WCSA 4I09A 1O5UA 1DZTA 1PZ8A 4AVVA 5BY5A 4XJ8A 4JDOA 5C4WC 3ZO0B 5A33B 2ZGOA 4RS5C 1PK6B 1ZYBA 2PLV2 4FPKA 3SXWA 4A7KA 4GMP0 1HRV2 1TMF2 3MIHA 1YIFA 4JGZA 4K20A 1HW5A 4MGIE 2A6VA 3VDDA 4Y1UA 1ZZ8A 3USSA 2XL7A 4GKXA 3DV8A 1QU0A 4PBOA 5T3NA 1PNFA 4Y20B 3WDVA 1YJKA 4D3WA 2ET1A 4RGGA 1LGCA 3VZOA 4CEWB 2XWBB 4JCKA 1ND2B 2YDEA 5KBFA 4F3JA 4XJ9A 3VBHC 1EPZA 4LUMA 2Z69A 4Q4V3 1R092 5FO8B 2D3RA 4HKOA 4OVEA 3WINE 1QHDA 2HWC1 1WCKA 1SDWA 1VBC1 4SLIA 1LODA 3SCGA 4PF5A 3D5OA 4FPGA 2NZ9A 4LA3A 4LR4A 1LGBA 2JG8C 3CJXA 1SBDA 3ZN4A 5L36A 1HV1A 3LGRA 1IPJA 1OA3A 4SBVA 2Z5WA 4RSUA 3WR0A 1XNDA 2P3IA 4YM0A 1LOAA 1ND2A 4GB32 2LUWA 5JR7B 1OD5A 2RR11 3DKWA 4AI2A 2XL9A 2WT0A 2ZTNA 4B3NA 4MVTA 4I0BA 1HDKA 5LK5A 5GZGA 3FFZA 1VBE2 2ZOEB 2WL1A 1I9RA 4CDUB 3H9AA 4Y1VA 3WXPA 2EALA 3V56A 2VQAA 2RMU1 4AVCA 3FBYA 2GZWA 2WLPA 3MPPG 1LOBA 2JXAA 1GYKA 1JYCA 5CFCB 4P9IA 5I91A 5LEJA 5FCCA 2PELA 1VBE1 4B7KA 2Q0AA 4GH4C 4IQPA 4AG4A 1AR83 1ZRCA 4BZ4A 5E88A 1AL0G 4QPGC 4WVWA 1CAXB 4JRAA 4QPGB 5BPXA 4CP0A 3LAGA 3JBG1 5JIAA 3RYKA 5C8CB 4MXVA 1RUNA 4W6WA 4I2OA 4XPVA 3L2YA 1F5FA 3NWKA 5A33A 2GMPA 1VIWB 1OLRA 1FPN3 1D4M3 3ZIXA 5JI7A 3VBOB 2D5HA 1Q3EA 1CONA 1VBA2 4AI8A 4EN8B 3GBWA 4LTAA 1MS0A 1DZQA 1RVF3 3AB0A 1ZZ9A 3LA2A 3LSDA 1NY71 3W59A 4Y20A 4Z8BA 4CZSA 1DGLA 4IV1C 5CNAA 3ZYGA 4BLIA 2E7QA 4IEVA 4AHXA 1WMDA 1W6PB 2ZGLA 2A3WA 2WSVA 1NCRA 4P5HA 1C8NA 2HEYF 1C8M1 4MGKE 4Y1ZA 2HWB1 5A32A 1SQ4A 3U4XA 3ZN6A 3WG4A 3CL1A 1PNGA 1R1A3 5FDBA 2XVGA 5FRAA 4MXWB 4JDNA 1T6GC 3PMSA 4XTMA 1G9FA 2BYVE 2HWB2 1BMV1 1FV2A 4BYYA 3LB9A 3L2HA 3SH4A 2WNVA 4HKWA 2EAAA 4H7MA 4GMP1 1BEV2 4XQ4A 1RHI3 4Q8LA 4MSVA 3CJIC 1Y43B 2K0GA 3V0BB 1V9U2 5JSPA 1BK1A 1W6MB 4YLZA 4ES9A 2A73B 3KT7A 1IZ3A 1VRH2 2ARBA 2XJTA 2GH2A 3S7IA 2R49A 3POWA 3VBUC 3RMXA 1SLIA 3B93A 4O9GA 3ST7A 3VBRC 1E57A 3WP5A 1QXJA 4AI1A 2D44A 1VAKA 2Q1ZB 5I0RA 2UYBA 3A0NA 3K48A 5GZCA 4BCUA 4NHLA 2JX9A 5K0UC 3N3HA 1GZWB 2Z2SB 4WVVA 3KGLA 1BBT2 4P9XA 1WW4A 4FT8A 4XF1A 3H8UA 1AF9A 1PO22 1CAUB 2D97A 2VMGA 3VL8A 1TQ5A 4OUMA 1DQ1A 2QUOA 1ZBE3 5FBZA 2GN7A 4JVAA 5JWPA 5KHJA 3SCHA 4PCRA 4IEZA 3WUDA 4GALA 2ZX2A 3VBFB 1LTEA 3WDXA 1RUJ1 1K5MA 4AW7A 1LR5A 5AC92 1ZBA3 3ES4A 3WVJA 3AKRA 1OQ1A 3RI9A 4YGDA 5EWSA 2ZPXA 4G3YC 5JPMB 4COYA 1V6IA 2BQPA 2WKKA 1GBGA 1ZBE1 2PHRA 3OD4A 5J48A 3WW2A 4Q4W3 3R4SA 4CDXB 1U5IA 2W68A 3PVOA 3J8F1 3ZSEA 1PVXA 2WSUA 1FATA 1IPKA 2PHDA 1Q5OA 2H0VA 3RMYA 2QZ2A 4JTOA 4LO7A 5D1IA 1M4WA 3WW1A 1J1LA 3PHMA 3WP4A 4OHYA 2X53S 4WVMB 1AXKA 1EAH3 2VOVA 2WZR2 4A7YA 1QQP2 4HBNA 4C1WA 4AGGA 4Q4Y2 5LRRA 1Q56A 3KB5A 1LEMA 1R091 5CAZA 5C8WA 1D2QA 4L2NA 1SLBA 3R05A 4FPEA 4NWVA 5FOJB 1TNFA 2ZAAA 1LGNA 2ZS6B 3B9CA 3ZSJA 5CBLA 1OMIA 5F5QA 2R6QA 1M06G 3HWJA 2O8OA 1EPWA 3FC0A 4AFBA 4I3PA 1C28A 3WCRA 2EXIA 2YPJA 1VAMA 3AZYA 3B9IA 3I54A 4Q4X1 4X8PA 3WQ1A 1GFF2 1J3PA 4GMP3 3VBRB 4RHV1 2XBO1 3NAPA 4FTEA 2PAEA 1Q8SA 3SISA 4XQDA 3QACA 2B8MA 2W0XA 1CJDA 2H0BA 4MZUA 4XFHA 1VB2A 1X50A 1HRI2 3RZZA 2BTVC 3DL3A 2YZ4A 4YZ2A 4RD7A 4BM8A 2H6CA 1O91A 5IK5A 4RQPA 2D6LX 4AGVA 4YFWA 5TSWA 1COV2 3N7MA 4XF3A 2XH6A 1DGRN 1PVC2 1WA4A 4YYOA 2A6ZA 1S0CA 1RUJ2 1RVF1 2UY9A 5K8SA 1PGL2 1FPN1 4B4QA 3FFQA 2WNEA 1S0EA 2GN3A 4N53C 3IDEA 4FP3A 2RMU2 3E6CC 3TWIA 1NZCA 4A2UA 3ZXFA 3HN1A 3AYAA 2JKBA 3VBSA 1O4TA 4XXPA 1N3QA 2A6YA 4AQ6A 4NWWA 3E6BA 2RHPA 3VN4A 2GH8A 4GXLA 1C1LA 1MVEA 2C0ZA 2I07B 2R071 1ZRRA 4F83A 1DZRA 2MEV2 2GAUA 1GR3A 3LWCA 3CF6E 2VECA 1VJ2A 3CJIA 1QXPA 2E63A 2I74A 5AFBA 4YZ3A 2R072 1QJX3 3GHMA 3V0AB 2XB6C 4CEWA 3H0OA 5JOYA 3VHNA 2DFCA 3I7DA 4N53B 5FAXA 3WQ0A 2VULA 2R041 1AJOA 4XETA 2DTWA 3ZFFC 3WY6A 1LOFA 4F7ZA 4LUKA 3AZZA 5JZGB 2GC0A 4COZA 5FREA 2JEMA 2EXHA 2DU1A 1RUI2 3ILRA 1N47A 3CLPA 3JUUA 4LULA 5GLUA 4IEPA 1VBC3 2VPVA 4X8NA 1NCRC 1RUF1 4IETA 5GALA 3LCPA 1F9KA 4P9JA 1YIPA 3VHRA 3RRDA 4FOQA 4IV1A 3ZDSA 4QPYA 1VBD3 3BU7A 3WHTA 1JN2P 1V6KA 2DF7A 1RUG2 5BNPA 1PO12 4WVMA 3LOIA 3ZN6B 1C8M2 3MDPA 2YC0A 3PLQA 4PQ9A 1IS4A 2ZGMA 1PHMA 3ZFEB 4CEYC 4KGQA 5L7OB 4CEYB 5L7OC 1BVVA 1JUHA 1UX6A 2VU9A 1OSGA 2D7FA 1KXGA 2RR12 4BH9A 4EWDA 5FTTC 2WNUA 2ET7A 4COUA 2DU0A 3KCCA 1AX0A 2DURA 1AL22 3M1HA 3ZFGA 4FP2A 3H7YA 4FPLA 4AQSA 3OCPA 2XVLA 2GC3A 3RYRA 4XIKA 5DZGA 5GKAC 1HQLA 4QGNA 3UKVA 2EA7A 4LO5B 5K9YA 4HSJA 1H2LA 4PLNA 1AVBA 1C3HA 2BVVA 4FPJA 3MZHA 2OVUA 1VLNA 4YVWB 4CYDA 3KZ4C 2D93A 4R9CA 4DY5A 3TB0A 4EN9B 1FOD2 4Y5Z0 3R4UA 3SMHA 2GC1A 3ME2A 3TBDA 4B8EA 2GC2A 1KD7A 5JI9A 2AUYA 3H1MA 3RPQA 1DLLA 3IT8A 3USUB 1SLLA 5CFDA 1MQTB 4LLOA 5HI0A 1IKPA 3FZ3A 4UW5A 4FPHA 1YFUA 4UW6A 1XYPA 2RS12 3FE5A 5CFCC 1RMU1 2FMYA 3VKMA 5EZWA 2ZGSA 2O0OA 2MNGA 1D4VB 1H9WA 1N3PA 3AP4A 4XXAA 4AEDB 1NA1C 3J8F2 1N1VA 1QJU1 1A3KA 4BWOA