3GF6A

Crystal structure of a bacterial lipoprotein (bt_1233) from bacteroides thetaiotaomicron vpi-5482 at 1.69 a resolution
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
219
structure length
219
Chain Sequence
DAIYYPVGDVDIERGGPALEVGEEDVLVARSFNEEDYVLDTIAQYPNDPTLGKLTFMIDLKNQQKDQNVADFNGVGKSKLTMSLGYKDGNYPSESQVPIYTSQDVTAKYAVKLRLKGELLVSGDEWMIDYVYAQLASLFQPYPPANFPEVFMCKGGMKLGTFDSFRRTCTFDITYDRSDLSFSQLYFNLFINLAGQKRENRVRLRIDKESYFELYEQSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of bacterial lipoprotein of unknown function (NP_810146.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.69 A resolution
rcsb
source organism Bacteroides thetaiotaomicron vpi-5482
molecule tags Unknown function
molecule keywords uncharacterized bacterial lipoprotein
total genus 48
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.750 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3gf6A00
3GF6A
chains in the Genus database with same CATH superfamily
1W6QB 1XNTA 2WWUA 1UX6A 1IGOA 4Z8BA 3AKPA 3KS7A 4CEWA 5CU1A 4AEKA 2D6OX 3K48A 1MZEA 3N9MA 2BQPA 4RS5C 2J1RA 4XF1A 1ZRDA 4LLFA 4AHYA 2TNFA 2R043 3CDZB 1HIXA 5F1RA 3I2HA 1SLIA 4Y1UA 4GH4C 3VBSB 3AZXA 1AX2A 2DFCA 1JHNA 2YU2A 4ASKA 2WT1A 2BGOA 2WSUA 3B01A 3ZXJA 3PUHA 3A4UA 2V73A 4IV3A 3KF5A 3UGHA 5T5JA 2ZGLA 3S57A 1ULDA 4AZZA 5FP4A 3LD8A 2HBUA 3VBHC 2DBIA 3KD4A 3C7FA 1QU0A 5FPBA 1JZ7A 4GJZA 4XZUG 1AR82 1KRIA 1D2SA 1CAXB 2OUHA 4GMP1 3SNMA 4DXTA 2LM3A 2VBPA 2PHXA 3R0RA 3WP3A 1JS9A 5FPUA 2KR2A 4WVWA 3RQ0A 2OIIA 2HWD2 3GZEA 3I2GA 2VVDA 3V0BB 1RVF1 2ILMA 4HK8A 2R6QA 5JSRA 3GZAA 3WCSA 1XXNA 3K4ZA 4FFGA 4H7MA 4P5HA 5CFDC 3RJ2X 2BZDA 3WG4A 5FWJA 2JDUA 5A7PA 2BEOA 1WCKA 3UYJA 1POV1 4QD2A 5G04L 2I07B 5I8YA 1XNBA 4Q4Y2 4UFMA 2RS13 1QEXA 4XC9A 2X53S 1NLRA 2W9XA 4W6YA 1LEDA 4QM9A 3WF3A 4BLIA 1R091 1BQPA 5ACA2 3H8RA 5ISLA 3AB0A 1RUD3 1WCDJ 3ACIA 3UJQA 1GZWA 1RMU3 3VHRA 2RS11 4Y3OA 2WINB 4XYXA 1EUUA 3D0JA 2ES3A 1OFNA 1S4CA 2W87A 1PIV2 4Q0SA 1RMU2 3CIHA 3K4DA 3M3OA 1D0HA 1PMIA 2QE3A 3TBDA 2WO2A 2VZUA 2DCJA 3VZMA 1W2TA 1QDCA 1RUOA 1QJX2 1S2BA 1QGLA 1V6IA 1TME3 2BWCA 2FCTA 2R061 5FV3A 4AL9A 1NQDA 2W5FA 2OXBA 5LY2A 4HL0A 3H3LA 3T2TA 1LR5A 1QOTA 5T3NA 3ILFA 4AAXA 4HONA 5FP3A 3TEWA 1WMDA 4M0NA 5JPMB 4URAA 1RUG1 4Y5TA 4ZXEA 1W8OA 4D7SA 1KS4A 4WM7A 4WVZA 1AZDA 1R64A 2YBKA 3VL9A 2VMDA 2O14A 2YC4A 1UW8A 1FI2A 5BNNA 4KBZA 3THTA 5DPNA 3ZR6A 1OUXA 1D2QA 3GCXA 4OHYA 1DQ5A 4D6RA 4PIZA 1VBC2 2ZGUA 1PO13 4ARYA 3FE5A 1O8SA 3ILRA 2HYKA 3MZHA 2RE9A 4DPNA 1W28A 3ETPA 3AP9A 3OYWB 4DRVA 1DYKA 1OT5A 4YVWA 3PLQA 4DZGA 3EO6A 3G7DA 3CHXA 3FX3A 2H6CA 1OPOA 3NJZA 3BB6A 2PMWB 1YQ2A 4FFFA 5D2AA 5CFCC 1W6MB 1AYM3 1FNZA 2P37A 1SLAA 2ETEA 3NJXA 5FUNA 5FZ4A 5JSOA 3UJOA 4GQ7A 3CKHA 4FPYA 4F8AA 1UYZA 1W8HA 2D98A 3OTFA 1B09A 1HRI1 3R6SA 4FBFA 4RN5A 2ADDA 4COYA 2ZGSA 2QQKA 2VPVA 3UV9A 4YGEA 4RR3C 1REFA 1OH3A 4LBQD 1EAH1 1JI6A 4UI9L 4YGDA 1JZ6A 1EY2A 1TZOA 1YCIA 2GNBA 4XUPA 1AYN1 4Q0UA 4NIGA 3MW3A 5KR7A 1S0JA 2BP6A 4FTBA 2GH8A 3WNKA 4HSJA 1XOYA 4O61A 2BUKA 4XZPA 4H55A 5D1IA 4QKFA 4LHSA 4W4ZA 3A21A 1VPHA 3LAGA 4M3CB 4XJZA 2Y6JA 2FDKA 5F37A 1XU2A 4CXYA 2G4IA 3AKRA 3DEMA 5C8WA 5FDBA 3OEAA 5DQ0A 3PVNA 3W58A 2NMOA 1TVGA 3VZJA 3T0DA 5FY5A 4MG2A 1OXCA 2UWCA 4DFSA 1Q8SA 5JR7B 1RHI2 3VZLA 5EYXA 2VQ0A 5GZFA 2F17A 1QJU3 2HWF1 3JBG2 2YC2A 4Y33A 3AMQA 5FXVA 1JYIA 4RGGA 2XHNA 3ZFEA 4AI8A 1O3TA 1AR81 2FMYA 3B69A 2XVKA 1YO8A 2VVFA 2Z79A 4J1XA 1J1LA 3H8OA 4Q29A 1H30A 2DDUA 2Q5TA 4AQTA 2WFF2 2IZWA 4P02B 3IB3A 1QQP1 5F8PA 4H2AA 3AKTA 4AI9A 2AENA 3PHMA 5JUVA 4OMCA 1MPXA 3T2PA 2RJLA 3GZUC 4XUTA 3IN9A 1W90A 1E57A 4HKWA 4KWLA 1WLCA 3UGFA 5J37A 2VECA 2FHRA 1F9KA 4EZ4A 4QPIA 2QQPA 4YYOA 1R092 3J7HA 2JECA 3JB8A 4UW6A 1HB4A 2H0VA 4Q4X1 5DAVA 5KHGA 4ARXA 2JE7A 1W0OA 2VNOA 1HV0A 3UESA 3UGGA 5A33A 3J7MA 5T5LA 2Q8OA 1U5XA 2VZSA 1KXGA 5F2SA 3OF1A 1JXNA 3AFGA 3LFIA 3KLSA 1R1A1 1YJKA 2VJXA 3POJA 2JDZA 2D3RA 2Y34A 4FXGB 1W9TA 4ORFA 3RS6A 3ZDVA 4EE2A 1W9YA 2BNOA 2ZX2A 1IS3A 4IEYA 1ASJ3 2JEMA 4XFBA 3BTZA 1CAXA 3PJYA 4ZU7A 2WUHA 5BNOB 2JIGA 4NE9A 5IK4A 1GQGA 2WABA 4NPRA 1LGCA 4HPKB 1ASJ2 1UY3A 2D40A 1A8MA 3NQHA 3NV2A 2R16A 5CYYA 5FCCA 3PU3A 2YPDA 1ZX5A 1B35B 5A80A 3WUCA 1JYXA 2WAOA 1VP6A 3GCWA 4WVMA 1OVPA 2ID4A 4DQAA 1ZZ7A 1UY1A 4YFWA 2VMFA 2EVXA 4P14A 4XE9A 3D4KA 5C33A 3MGUA 5LEKA 4FOWA 5F3EA 3HR9A 3RMYA 3MLLA 3ZXKA 5LY1A 1RJ8A 4DXRA 3POYA 1CVNA 1MACA 4XJ9A 1RB8G 3DXUA 2Q8CA 2E9QA 2GN3A 4Y5Z0 3QD6A 1UCXA 4CEWB 5JXHA 1EPZA 1WMFA 3QH7A 5FQ0A 4OLLA 1W8NA 4Q4W1 1GNZA 3BGAA 2EIDA 3OUJA 3HOBA 3GZTB 4JTOA 4XFIA 1CWPA 1AR73 2OW4A 3QLQA 1VBB3 1NCQA 3ZSKA 3A7QA 2FDGA 5CKMA 2WO3A 4J1WA 3SQOA 5C6CA 5E16A 3W5NA 4RS5A 4GH4B 1HB1A 2MEV2 3DKWA 3WDYA 2XMLA 3FUQA 1UMHA 1TMF2 3BTAA 3P1IA 3OBRA 4I09A 2JIJA 4LPLA 4MV2A 5I0TA 2ZX4A 4GWNA 4LA3A 5FYSA 3M3IA 4NWWA 3RZKA 1O8PA 1RUF3 5L9RA 4TTGA 1NCQC 4UFJA 2WBKA 5FZBA 2ZX3A 1SDDB 2DVDA 3KVBA 1MQTB 5DDJ1 2W47A 3SC7X 3ZFEC 5FMOL 2VD7A 4HLTA 5J7MA 3LE0A 4TN7A 3MF6A 1VAKA 1X8EA 4DUVA 4A42A 5BNOA 4GIQA 5CB7A 1JZ5A 4WM7B 5DG2A 1V6LA 1GP4A 4IGOA 1VMJA 2DUOA 1VB4A 4QXBA 2A73B 1OOPA 1PMHX 5AC93 3E6CC 1ENXA 3MICA 4J6GA 2EIGA 1OQEA 1L7LA 2W3JA 1SFPA 2XONA 3AXDA 4GWMA 3WV6A 3ZPOA 5LRSA 2YBSA 4COVA 3ITQA 4NUBA 4WVVA 5FMDA 3IBMA 3OB8A 2HWF2 3KZ4C 2Y6HA 3C7HA 1NLQA 4WM7C 5GZDA 3OYWA 2D6NA 3HQXA 2GC0A 5FBZA 3VD3A 4Q0QA 3U0ZA 3DUIA 2DVAA 2X29A 4YGBA 1LOFC 5FZOB 4XHBA 5JXJA 4YG3A 3GDBA 2DU0A 4ASLA 5EQUA 2WFF1 5AVAA 3AZVA 1CX4A 4JGZC 4LULA 3ZFFC 1C3HA 2IXJA 1QQP2 1J3PA 2W1UA 5FRAA 4ET7A 4IEOA 4QU2A 2ZGTA 4W65A 2KXLA 2ET7A 3BN6A 4RR3B 1JHJA 4AEMA 1W39A 1S0IA 3T2OA 2W0XA 3FFZA 4CUCA 4QM8A 4BQ4A 4BMBA 2JKXA 5F9TA 2VBBA 4YZ4A 4B7KA 3GNEA 3JD71 5A7WB 1OLME 4LOTA 3LOIA 3GYDA 3LZZA 3NAPB 2A3XA 5L7OA 3VUOA 4AEJA 4XUOA 3LA3A 2AZ5A 3RDIA 5EZWA 3GM8A 1QOSA 1ULFA 4NO4A 4YM0A 4F7ZA 2YG0A 5GLVA 2NN8A 1SG3A 1SMVA 1H6YA 3UT0A 3LSDA 4YLZA 3WXPA 4YGCA 2AR6A 1R1A2 2PLV2 2R1BA 4LIUA 4QXHA 1LULA 3E1F1 4EZHA 1OF4A 1GANA 2IVJA 2R072 1FMD1 1WA6X 2C24A 3FMGA 4LIVA 3VBRA 4EN6B 3UNPA 3W9AA 1FNYA 5BNNC 4QB6A 2XJTA 1QMJA 1JZ4A 1O91A 2AEYA 4FQ4A 3ZPYA 3ON7A 2VU9A 3B93A 1HDKA 4JX0A 1IPSA 2VTFA 4OQ9A 3PTYA 4K9SA 2DCKA 2G9ZA 1T6GC 2RMU3 1W8ZA 3IDBB 5BXXA 1O6UA 2ATFA 4XILA 2ZEYA 4CP0A 4ZZ8A 1DF0A 2VCAA 4OHVA 3RZMA 2RMU1 2W1WA 4ZONA 2AUYA 3ATGA 1Y43B 2XJQA 2WNOA 4PBOA 1DHKB 1LGBA 4NHXA 2IXIA 3GGLA 4CCNA 4XFGA 1BVVA 3WP5A 2SBAA 3N9OA 2C26A 5DG1A 4E9KA 4Q4W2 1XC6A 4AXOA 5JIAA 5EPAA 4G3YC 4MX3A 2VZ1A 4UBHA 4XXPA 4Y20B 2VNRA 4I2OA 2AEZA 1F8VA 3WQ1A 3O0WA 1LHOA 4P08A 5DABA 3NNLA 5A7WA 1N3OA 5F5IA 5FKBA 3MHZA 3B3QE 1PO12 2A6VA 3R4UA 1KFUL 3MIEA 1ULGA 1W2UA 2PYTA 3CBNA 2FDFA 4AYUA 3DL3A 4P5YA 2ZEWA 4N8MA 3WNXA 1W3XA 2MEV1 1MEC1 4OI2A 4Y4RA 3RYKA 1AF9A 5I0RA 1H2KA 2BDRA 1OH4A 3BU7A 4DNYA 5F3CA 4KWKA 1MVQA 5FLIA 2UY9A 4QGNA 3SH4A 1CAVA 2JDYA 2MHFA 1CZTA 1DU3D 1V00A 4BA6A 3N3HA 2WZR3 4PLNA 2ZGNA 1L7QA 3AMMA 4NRMA 4X8NA 4HKLA 2XJPA 5T55A 3CJIC 4EWAA 3DN7A 4ASMB 1W99A 2YBPA 3O1RA 1EV13 5J98B 4AG4A 5HCHA 1BEV3 1SZBA 4YZ1A 4E27A 4U2AA 5JOWA 3HIFA 4WVMB 4HVOA 3RZHA 3Q8FA 5DAWA 1VBE3 1BBT1 3NV4A 1E5RA 3U1XA 4NPLA 1CX1A 3M8LA 2XWJB 2VM9A 3CJIB 4BDVB 4D3WA 4DIQA 1UOGA 2BBAA 4L0PA 4Q8LA 4CSWA 3ZFEB 4FPEA 5FJKA 1BHGA 3MI8A 1UU6A 1S0EA 3FUOA 1W3VA 4LOSA 4CPBD 4A44A 3OG2A 5H9SA 4NIAA 2O8QA 5T50A 1N1VA 3H3ZA 5E1RA 1LHVA 4DB5A 2A6YA 3AVRA 3W21A 3IWZA 5FZOA 3RWNA 4N7IA 5HXVA 1HXS1 3I4IA 1SCSA 3IIIA 2XL9A 4AQSA 5IUQA 3NVCA 3CU7A 2WNVA 2Z42A 1MZ5A 1IPJA 1C8M3 2Z4FA 1XSRA 4W6WA 1ZRFA 2RVAA 2DF7A 1AR92 2BNNA 3ZXFA 1NAEA 2YPJA 2G9GA 4Y24A 2ZX0A 5K7PA 1JUHA 1JYNA 2WWSA 5GLTA 1PO23 1LU2A 3MW2A 1J3RA 2VCCA 4OHWA 3E5QA 1RXFA 4TLFA 1BMV1 4OYUA 1FV3A 2ZOEB 3D3AA 4TLGA 2C9KA 2HWD3 4K8RB 2ZKNA 4HMZA 5C9AB 1BXHA 1CZVA 1OHFA 2Y64A 4XQDA 4META 4B4RA 5JI9A 3N7JA 4RFT0 1ENRA 3LA7A 3ZSEA 3ECQA 3IMNA 3MIGA 3NO8A 1PVC1 3MPPG 3MF9A 4AHWA 1WLTA 1D7PM 2WZEA 3B02A 3J26N 1FMD2 4PBPA 4UW4A 4BOWA 5CKQA 4AAPA 1SLTA 2RS33 2WZR1 1U0AA 2XBO3 4OI0A 1BZWA 1GICA 3IZOA 3AP6A 2ZPXA 4FXKB 3O1MA 3NRUA 2JG9B 1LECA 2OVUA 2RS32 4QX8A 3ZR5A 4CDWA 3KCYA 2D6PA 3O7OA 3ZSJA 4YM1A 5CADA 1DZRA 2VCBA 5FPVA 3ZXEA 4MXVA 1PX4A 3PU8A 4GWJA 3D8CA 1F15A 4XTPA 2BFUS 3VGIA 4CE8A 5JZGB 1TE1B 2XOMA 2CU5A 4YSFA 4ZS2A 1ZBA1 3K3NA 1F4AA 2A6WA 1ZZ6A 1LCLA 1VRH2 2WA4A 4GALA 4MADA 1CN1A 3O5SA 4AQ6A 4GB33 2VBDA 3PURA 2QQOA 3RRDA 1VBE1 3I2JA 3WG3A 4LO6B 4GD4A 2EXHA 4AVVA 1VALA 3NAPC 3O0VA 3WF4A 3ZLIA 5HBAA 5IK8A 2XDVA 1ZBE1 5F7UA 3HQRA 4PQ9A 3H42B 4QQLA 2ZMNA 3HN1A 2VOXA 3F2ZA 3PJQA 2W91A 5JPNB 1D4M3 3GXUA 3SCHA 2VQTA 3B9IA 3J7LA 4XIKA 1UZVA 4FPOB 2VZTA 4Q2FA 5IFPA 4B1MA 4XBNA 3U07A 4IL7A 3LQCA 2ZGPA 4A7KA 4QXCA 3CL1A 2NPIA 1MS4A 1PK6C 1KDKA 5A3WA 1YFWA 4BQ2A 5C8CA 1JOJA 1GU3A 2MPFA 4IW3A 3VD9A 2J1AA 4S2GA 5EJZB 2XLAA 4Q5OA 4XF0A 5CIRA 4O9EA 3ST7A 1XE7A 3ZIXA 4B4PA 4MGIE 3ZN6A 1PZ7A 1COV3 1R081 1WCQA 2F4LA 2FZ2A 3O0XA 3U4XA 4DEQA 2E6VA 1FPN2 3E5XA 2ERFA 1T6BX 4BXSV 5HV4A 3D6EA 4XHXA 4JHTA 3VBFB 2YHJA 4CCCA 1R1ZA 1TMF3 4C8DA 3VN4A 1OA4A 2RHPA 3H3UA 3EMRA 2W68A 3ZYJB 1BBT2 1S2EA 2IFRA 3KCCA 4RHV3 3VKNA 5JSPA 1U12A 4Z2WA 5LA1A 1RC6A 3POIA 1WLDA 5EWSA 5EV7A 4N9HA 4V2VA 4XMIA 4FPKA 1AR63 1DFQA 2VOVA 4XUNA 4CDXA 2Q30A 2QZ2A 4OUSA 5D8AB 3J8F3 3H1YA 4BK5A 1DLLA 1MS9A 1GR3A 1CAUB 2V72A 2VXJA 4Z07A 1QJY3 5FZ9A 3AP5A 3WCRA 4COUA 2V5YA 4EROA 2DYCA 3PL0A 4NHYA 1SBEA 1ZBE3 1LGNA 2WIIB 5HCFA 4A2UA 1QY4A 2VE1A 4ES8A 4F3JA 3LPGA 4LT5A 3EQEA 1QJY2 2WT0A 3JCIA 2CNAA 5GLZA 3ZO0B 4MXWB 1AR91 1JUIA 3FLRA 3LF7A 2PQSA 4XF3A 2E31A 4YWAA 5C3QA 4AFBA 5IVCA 5KXEA 1DIWA 1VLNA 2Z5WA 3I2KA 3OPWA 1WKYA 1YFXA 3J4UH 5I0SA 2JG9A 1PX3A 4P00B 1LOBA 4A3ZA 1BMV2 4KMQA 1NLSA 1CONA 2RS51 2B45X 3C2UA 4LA2A 4MZUA 1WWYA 4UFLA 4CDWC 4C1WA 4GXLA 2GC2A 2VO5A 5EJ3A 2QKDA 3GJAA 3KCXA 2RG4A 1QXJA 1UMIA 1X7NA 4QPGC 1OD5A 5EYYA 3RSJA 3SHRA 5C5UA 5JLVA 1ZREA 1VBB2 2RDSA 3AMHA 3VBSC 2RJKA 2WL1A 1PZ9A 3ZYHA 3ZXGA 4HZFA 5KC6A 2ORZA 1H2NA 4AR2A 1YQ8A 4NVPA 5FOBB 1X50A 1ZA4A 3VDDA 3DPRC 2X10A 4OI1A 3O1TA 5ANNA 4LO5B 4NMIA 4CDQA 2Y6LA 1K5MC 1HRV3 2GC3A 2JD4A 1NG0A 2CWMA 3O1OA 1KEXA 1NE4A 2IXLA 3INAA 4CEWC 1W9FA 3MEPA 1URXA 2CWSA 4IV3B 4L2NA 5IVYA 2VMIA 4E8CA 4KU7A 3OUIA 5FYCA 1ZBA2 3POSA 4D8MA 1NA1A 1EYBA 1PGW2 2RV9A 3EYPA 3JQXA 3QACA 2RR12 4FPLA 3V0AA 2ZZJA 1QF3A 3AZZA 3THCA 3I3MA 4LHNA 5GZEA 2BW8A 2JDPA 3SCGA 4Q27A 2R041 1V6JA 5DUUA 1UF2C 5FPAA 5J96B 2LROA 4BCUA 4MSVA 4M0HA 2DURA 4CDUA 3MO4A 4CUBA 2XKOA 3LCPA 5EXOA 5GKAC 2JX9A 1RUI2 2Y8KA 5IK5A 2XUMA 1NA1C 1J59A 4HFSA 3R05A 1A6CA 1QKQA 1ZZCA 3OY8A 3T0BA 4A41A 2JWPA 1W8WA 4HANA 4KGGA 4N43C 4OQ8A 1PGSA 3CJIA 1VJ2A 3FBMA 4HXCA 3BALA 3ILNA 2P34A 5DZGA 3LOBA 1GLHA 1J3QA 4UW3A 4LK7A 2ZEZA 3ZDSA 4O65A 5C3SA 5FZIA 1UZWA 2PTMA 4OULA 5A7NA 2ARCA 3ZKYA 1AR72 4AGVA 2BGCA 1W6OA 4K7JA 1G6NA 4OHXA 3AKSA 3L9JT 1SLLA 5A1AA 1WCUA 4XJWA 3I7DA 4B1LA 4YNIA 2ZABA 5FY9A 2WDBA 2XHKA 5C71A 5BY5A 4LBQA 1W6QA 4FPGA 4CXXA 1GNYA 1ND2B 5FXXA 4UFHA 5L36A 4JTNA 1XYPA 4A6SA 3WF0A 1ACCA 2HWC3 5FLJA 4YM2A 1WA4A 1JZ2A 3EJKA 2QDRA 1EV11 2DVFA 3Q9OA 4FO9A 3WW2A 3WF2A 3AKQA 4Y22B 3UKNA 4CCOA 3TRSB 2UURA 4URTA 2YUEA 3N4MA 2VXRA 1IG3A 2HWC2 2Q1ZB 4XFCA 3HBZA 1IHMA 3IM0A 3WNMA 5I91A 3VZOA 4IEPA 3U11A 1CJDA 2CGOA 4PDWA 3MIDA 5FP9A 4CEYA 4EWDA 4AWDA 5AVPA 2GZWA 3DECA 2GNDA 4NIHA 3PVEA 1DG6A 5K0UC 1UIJA 4MGYE 3MUY1 4D7TA 3OGGA 4CCDA 2YGMA 4IGQA 4SLIA 2Q8EA 4E2SA 4OFGA 4DY3A 1BK0A 5FZDA 4EN7B 4IV1B 3OD4A 1LU1A 3MLKA 5FZCA 1AXZA 2LS6A 1RUG3 1AR61 1MS3A 1XYOA 2QNKA 2Y0IA 3FC0A 4AHZA 3WDWA 4C0BA 4CUGA 3FBYA 1C5IA 4M3CF 5FKCA 1W6MA 3ZN6B 4L92A 2A7AA 4WM8C 1T2XA 5HV0A 4NWVA 2G1MA 5JR2A 1VRBA 2E26A 5A1LA 5C8CB 5DN2A 3WNPA 4B29A 1RL3A 3EBRA 3MFAA 4CCMA 2B46X 4HKOA 3LEKA 3KV9A 2PQQA 2WZPP 3HNBM 3FN9A 3NV1A 4LBKA 2W52A 5FY7A 1N1YA 1PNFA 4A7YA 3S0MA 1W04A 3ES1A 1XE8A 3H9AA 1CQ9A 1LENA 1W05A 4DOUA 5A3OA 3BTYA 5C9AA 3HNMA 1K3IA 4DUXA 4L99A 1AYM2 1XNAA 4LBLA 3WNNA 4ISRA 4RA0A 3RMXA 1FX5A 5FZGA 4Y1XA 4IETA 3WVJA 4XFAA 2VOWA 1RUJ3 5FY0A 5C70A 5IVEA 3S6PA 3WT3A 2RS12 5J3UA 2OZJA 3TEYA 3TEZA 5DAXA 3SH5A 2PLV3 1G86A 3AZYA 4QPGA 1GBGA 4P9YA 3T2QA 3VDAA 1RMU1 1NE6A 3K51A 5FZMA 1YC61 3IKWA 2DVGA 5FY4A 2I74A 4EYUA 2JG8C 5F39A 1HN0A 2R1DA 5LBEA 2E7TA 3VBOA 1PHMA 1XQNA 2UU8A 4RSUA 1HQLA 5A6QA 5CFDB 2ORXA 2QQUA 3DYPA 2R042 1IS4A 1ND3C 3VD5A 5FO7B 1ULEA 2WWJA 5JOXA 3DYOA 4KWUA 1KD7A 1GMMA 5CFCA 2CV6A 3BI3A 4I3GA 4E4HA 4PF1A 2R063 1SFYA 4Q1PA 1E5SA 1HJFA 4R9DA 1GUIA 1DGRN 1HB3A 2FMDA 3CZUA 4XUQA 1AHSA 3U78A 1UD1A 1NXD1 1NY71 3U10A 3JXSA 4AEDA 2D6KA 3WG2A 4A3XA 5LCWL 1BK1A 3FJSA 5BNOC 2G9FA 4FTEA 1NYWA 1YRZA 4Q4V2 1AR71 4D94A 3HAGA 4P9WA 2K0GA 1NQJA 4MGSA 1FYUA 2N7GA 1K12A 1HRI3 1YI7A 2WZ8A 3LDRA 1D4M1 5JVVA 5FIXA 4EQVA 1KITA 4QX3A 1MZ6A 5L19A 1DYPA 4TSVA 3I54A 4IV3C 5GZCA 2CHHA 5C3RA 2LRPA 5L9BA 4ZHNA 1HRI2 2QQWA 2L9LA 3ZXAC 4G9SB 3DPRA 3WNOA 1YIPA 3VDDC 1GWKA 1BCXA 5GJ6A 5FPXA 2JE9A 4BZ4A 4XMAA 3IDCB 5FO8B 3OGRA 3AZWA 3ZYPA 3ORJA 4LLOA 3ZXLA 4K1ZA 4Y26A 3AYEA 4LITA 2PHWA 1POV0 2XJVA 3IPVB 2EXJA 2A3YA 3BCWA 4MGQA 3RFRA 1COV2 3LEIA 1ZVFA 4H3WA 4ZU4A 1YI9A 3ZSMA 1OPMA 1ZNPA 3VHPA 3FFQA 4Q4Y3 2ZZQA 1ONAA 3POBA 2VOKA 2VMCA 1US2A 2SLIA 4Y1YA 3N9PA 1QHDA 2Q0AA 4H14A 4LHKA 2JG9C 3HEIA 4KQ7A 4V1PA 3A0KA 1C57A 5IYYA 2BFUL 5JDBA 2GSYA 1D4VB 1V6MA 5EHDA 2VZPA 2OQ7A 4OMDA 2FBEA 2VUJA 2JDNA 2ZTNA 4CU8A 5KXDA 1GQPA 5SV5A 2JE8A 4KGQA 3U37A 3ZYBA 3FHIB 4CCJA 4IERA 1AR62 3EHKA 2C5DA 4QPIC 1TME1 1ZZ9A 2BRTA 3ACGA 1NCQB 3NNMA 4IEZA 4MO3M 3ZYGA 2CDOA 1JZ8A 1YEWA 2KM2A 3V56A 1VMFA 4AI2A 1VBC3 4L8QA 4ZU5A 4LO4B 4Z82A 1NCRA 3KV5A 4PCRA 5A3LA 4E2GA 4DO0A 4N9IA 4HPKA 4XTMA 5I0UA 2MNGA 4OZXA 1GSLA 1CIWA 4XAAA 3KM5A 3ZFFA 2WO7A 4YPJA 4UYBA 4YW6A 2WFF3 1JODA 2BTVC 5A3TA 1JMUB 1I5PA 1PZ8A 5FYTA 1HKDA 3AC0A 1VIWB 4AVBA 4IEUA 5FYHA 1JOBA 4RFRB 3OUHA 2DCTA 1XNDA 4Q1RA 2VUDA 3BODA 3KSCA 3VD4A 1AL22 2Q1MA 3WDUA 1WD3A 4I02A 4AGRA 4Q4X2 1DQ2A 2KA3A 4YZ2A 1Z7S3 5JOZA 5D8AC 1H9PA 2A6ZA 3RZGA 5DZFA 2PAMA 1K5JA 5HXMA 5F5QA 3SXWA 2ET1A 1WW4A 5KC5A 4FVVA 5JOYA 3JZVA 2JD9A 1PNGA 5IAVA 1RXGA 1W03A 1GZTA 1OOPC 3HMYA 3JUUA 2AYHA 3KWVA 4JQRA 4JKLA 4QT6A 2H6BA 4AI1A 1BBT3 3KVAA 3FZ3A 4V2WA 2W46A 2VC9A 3M1HA 2BERA 3L2YA 3ZN5A 1ASJ1 4C90A 3V0AB 3KF3A 3C8XA 2HJIA 3MLJA 3NJVA 3OOXA 4AGGA 5FZFA 2BNMA 4UFKA 2P6HA 3P3PA 1J84A 5FZ0A 5LEJA 1OLRA 2HH9A 3I59B 3C7EA 1N3PA 1UU5A 2DTWA 1X36A 3VKMA 4IESA 3TN91 3VV1A 3NV3A 3KT1A 3OD0A 4NR1A 2K9ZA 4YVSC 2ZCWA 1NY72 5FXWA 5LA2A 1NCRB 3GJBA 5T5OA 1JU3A 1Y9MA 2WKKA 1ZYBA 4CP9B 3VLBB 1KGYA 4OI4A 4IQPA 4F83A 2UYBA 4LKDA 3PUQA 2A3WA 3Q8BA 3VZNA 1W8TA 4AVCA 5LK7B 1A3KA 3CO2A 1OQ1A 1UAIA 4Q4V1 3VBUB 2E33A 5IAXA 1C8M1 3MW4A 1D4M2 4K40A 4PIXA 4YG6A 5FYYA 4D69A 1C1FA 4AHXA 1HQWA 1GWMA 4A7ZA 5LBFA 3UETA 2ZACA 5JZGA 5FR3A 2E32A 2ZXQA 4CP9A 1TG7A 3AYCA 3MIHA 4TXWA 3JQWA 3C3VA 1W2NA 2VMGA 1IQDC 3T1MA 4CCKA 3TOJA 2W2IA 2C0ZA 4TWTA 1TMF1 4I3PA 3UKTA 1LHWA 2ZGMA 4J25A 2XVGA 4Q0VA 1UNBA 2W92A 5A7QA 5A7SA 4ZS3A 4RL7A 4GMP0 4LR4A 4NRPA 1UN1A 2EIEA 4QB2A 4UXAA 3BPZA 4IEQA 4A45A 4U36A 4K3UA 3ZN4A 4TZDA 1GZCA 5KHKA 1LEMA 1G9CA 1O7FA 1EAH3 2YMZA 3FL7A 4OCTA 4Y20A 4JGYC 1GYKA 2OQ6A 4XBLA 5DXDA 5ERLA 5C5TA 1YIFA 1AYN3 1JW6A 2ARAA 3OY8B 4AE2A 1UMZA 4XJ8A 1YQ6A 1IKPA 1UYYA 2Z2SB 3WZ1A 2XUEA 4IEXA 2WAAA 1WD4A 1S0FA 2PAKA 5IVJA 1DQ0A 2JDMA 5CAZA 5C4WB 4QX1A 2YDEA 1ND2A 4RHV1 5ABJC 3B9CA 2BOJA 2DTYA 1FT9A 1SLBA 3AMNA 4XQWA 2VUAA 1WW6A 1MQTA 5C9AC 3ZYIB 4M3CA 4H7LA 1QIQA 5GLWA 1K45A 3ZMOA 2HWB3 4R9CA 5FYIA 3KHCA 1YQCA 4RGAA 5B2GB 2GNMA 3ELNA 2PFWA 2PXJA 4R9AA 3THDA 4IXLA 4LJHA 4XACA 3A22A 5BPXA 4GB31 1S0DA 4JC1A 1DQ6A 4N53B 3IAPA 2OS2A 1ND2C 4UT5A 2D3SA 4WZFA 1C28A 2XVLA 4QQHA 1IS5A 1GQHA 2ZMLA 4AVSA 3LSEA 2VGDA 3RYRA 4BYYA 3JD72 3TEXA 3K2OA 1DBNA 1PM4A 1CJPA 1PGL1 3LB9A 4YFZA 1HQNA 4XJUA 1HN1A 2EAKA 4PIYA 2E7AA 5F6KA 4AF9A 1O4ZA 5FZ6A 2Q4SA 4FQZA 2WNEA 2OKXA 3AXEA 4K8FA 2XWBB 1IG0A 3VBFA 3B7MA 5F5AA 2XQXA 2VZOA 1FOD2 2R071 3RI9A 2XR4A 3FWEA 2ADEA 2JJ6A 3VBSA 4IEVA 3ZYRA 1XPWA 2X09A 4IDZA 3AJYA 2D5HA 4PI2A 4MGTA 4OVEA 4BQ3A 2Y6FA 4CDXC 1CGPA 1SACA 3LFMA 4EN0A 2J1SA 4CA9A 2OPKA 2VNGA 4CP2A 5CFCB 2XJRA 4YW7A 4QKBA 1I6XA 4DEVA 4LKSA 1VAMA 1CPNA 1W2OA 3B94A 2GAUA 3ASIA 1RUF2 4Q8KA 2J42A 2JDKA 5AFEA 3SLIA 4D6SA 1V6NA 1VMHA 4BHPA 4COZA 3D82A 2W1QA 2PHLA 4E4DX 3KGLA 4MGZE 4XDQA 4K21A 2RMU2 4BK4A 5IJRA 1WBFA 5BNQA 3DKQA 5K8SA 5L7OB 1GKBA 2NLRA 3CZJA 5A32B 2TUNA 5A3UA 4QDSA 1L3JA 1H9WA 2DVBA 3N9QA 4RQPA 5DUWA 3ZKUA 5AC91 1VAVA 4K1YA 1NA1B 4NN0A 1DGWA 1UZZA 3GALA 4FFHA 1NX9A 3VB9A 2IXHA 4L97A 1LNSA 5A70A 4KH9A 2JDAA 1C8M2 3HPNA 4P9JA 3MFCA 2P1BA 5IVFA 5EFUA 1WGPA 4XEZA 2PHUA 3H7YA 1PO11 3OBAA 1TEIA 2RM23 1MS1A 3KV6A 2HWE3 1POQA 4LUMA 1XSQA 4QU1A 3BUCA 1L7RA 1SHWB 2ZHLA 4Z92B 1M4WA 1LOEA 5FK8A 3PDQA 1MEC2 4LE4A 1CIYA 2D3PA 4ZY9A 2WNUC 4DMIA 4INDA 3QH6A 4QMAA 4CDWB 5B4NA 1AR83 4DS0A 3AL5A 3TYJA 3VDBA 1H8TC 2ZGQA 1UKRA 2VOTA 1VBA3 2GMEA 2CAUA 2HEYF 2ZJCA 3K75B 1OVSA 1HJGA 1PO21 3D0SA 3WHUA 1W9SA 3IDEA 2CY6A 4PT6A 1Y9QA 4KWJA 4LNVA 4R4XA 4RS5B 4XF9A 4XFFA 1Z7S1 1QH6A 2J7MA 1S0BA 3I3BA 3KQRA 2VW2A 4XIOA 2WSVA 1OLQA 2D97A 5A3NA 5C8CC 2ZBJA 4QX0A 5FWEA 2VNVA 2WS93 5FZLA 3WDXA 1HRV1 1DQ1A 3JB4C 3KT7A 4FAHA 1ODMA 5FPLA 4BM8A 1BEV2 1BJQA 3FHAA 1RUD1 3VBOB 1REEA 3LPFA 1U5YA 2ARXA 3VBHB 3A0NA 3T0AA 1W6NB 5LB6A 3H1WA 2NP0A 4UF0A 1GP6A 4NJ4A 2YXSA 3IAQA 1H2LA 4RQPB 3WINE 3N9NA 3ALQA 2R32A 1FAYA 2B39A 3NAPA 1H1MA 4A6OA 2DCYA 4PJYA 4QAWA 3T3YA 5A33B 4HK9A 3T4HB 2PHFA 3VBFC 2W39A 4PF5A 3LEGA 3I3QA 3KGZA 4MHUA 3HN3A 1OURA 4CDQB 2HBTA 2XLGA 4L11A 4Q4W3 1RINA 5FMBA 5FZHA 3SISA 3VKLA 2O1QA 4BIOA 5ABJB 5KXCA 4NHMA 2EA7A 3RI8A 2GDFA 1LKNA 2BOIA 2QTWB 5JMOA 5CISA 4FOVA 3VHNA 5LWBA 1BKZA 4Y1VA 4NROA 1DGWX 4QPGB 5JZGC 3I59A 1CR7A 4XOGA 4Q4V3 2JB8A 2LALA 3ZFGA 1STMA 3RZZA 2QQIA 4JGYB 4N7UA 2B9VA 4PQQA 4QQ2A 4AI0A 3MPBA 1UZ0A 1XE0A 2J22A 3C7OA 2PELA 2JENA 4NHLA 4ATEA 2ZHKA 4EN9B 3OEBA 3VZKA 3S5AA 4MH0E 2PN5A 4MHRA 3OSDA 2WZR2 3ZSLA 5BV6A 3M7AA 4I0WB 4R52A 2UWAA 2HWD1 2J1EA 2XG3A 3PIGA 3TNPB 1AL23 3LIGA 1RVF2 4YVSA 3K46A 3HT2A 4FCAA 3L2HA 4GKYA 3CJXA 3PUSA 1Q8OA 1UU4A 4LK6A 2QQJA 4I01A 2NQYA 3WD5A 2A71A 2P4EA 4FPFA 1QXPA 1U5ZA 5FBJA 1QWRA 1UPSA 3ZX7A 4AEDB 4Q4Y1 1ST8A 2X8KA 5FMCA 1CESA 5LRRA 1NKGA 1DDLA 5ACA1 4LTAA 5FZ8A 1Q56A 4E2QA 5CA6A 1VRH1 1DLCA 2HEWF 3T4VA 5G05L 4QHOA 1JYWA 1QDOA 4OHZA 1RUC1 2W1SA 4E4ZA 1Z78A 2IXKA 1GOHA 3BOWA 2C4XA 3THPA 4DY5A 4Y4YA 4BH9A 1RHI3 3N7LA 1VBE2 3ABZA 1HV1A 3M2MA 1LOGA 3SEEA 2ENRA 3HVDA 4MVTA 1JBCA 1J58A 2QVSB 1LESA 1ZBE2 3GF6A 1RYYA 2R062 3D5OA 4YW4A 2FDJA 1KQRA 2IWGB 3RJRA 4I0BA 1UXXX 1QNYA 1XB9A 4M4PA 2VTXJ 4SBVA 2TBVA 3H50A 4XAEA 5L7OC 4JKMA 4D7YA 5F6LB 2YC0A 4PDWC 5F3IA 5I8SA 4AFDA 4CEYC 2R30A 4JHZA 4FI9A 2WT2A 4JGYA 2CDPA 1PM7A 2P3IA 2C9AA 4LHLA 5BUVA 1SLCA 3OJBA 1VBC1 5GALA 1DGLA 3E6DA 4BU2A 2J1TA 1NZCA 1ZA7A 2WO1A 3OBTA 1P8JA 1OF3A 4DXSA 1O5UA 1Q8QA 1PO22 4LMFA 2QUOA 1GZWB 1FMD3 1BYHA 5HPOA 1YXWA 2NMNA 3KHBA 1YFYA 1FPN1 3AYAA 3MBWA 4G4FA 1Z7S2 4IV1C 2R49A 4MUVA 4XABA 1G9AA 3LEMA 2XPJA 5DAPA 3SEPA 5KHIA 1SQ4A 2YY1A 3LWCA 2GC1A 4PI0A 3CF6E 1HRV2 1REDA 1Y3TA 2HKXA 2GMMA 1I5ZA 1ULCA 2KD7A 2WNUA 1RUD2 1XYNA 4XURA 5H9PA 3N7MA 1OMIA 2C1FA 5C7GA 3NNJA 3WW1A 2YFZA 1BLZA 4I30A 1WMXA 1W6NA 5M0TA 3MYXA 1EAH2 1OOPB 4YZ3A 2CGNA 3ZFGB 4LO7A 1RITA 4K6BA 4IGPA 1VRH3 1AYN2 2IFWA 2VW0A 4QDRA 2GH2A 2ZA9A 2DWRA 2C6SA 4QQOA 1QJY1 4AK3A 5L9VA 2HYXA 3WY6A 1KS5A 4XCAA 2EXIA 2HEVF 3OPZA 1K42A 1FV2A 1KDMA 1GOFA 4C1XA 2LTNA 2Y6GA 5BYNA 2B8MA 4CDXB 1H8TB 1S1AA 2QZ3A 3H8XA 1QJU2 1W06A 1X82A 1PMJX 5FZ7A 2RS52 4BQWA 2P3YA 2ZEXA 3VDCA 1RHI1 2YGLA 2WNVB 1UOFA 3AYDA 3CEWA 1WW7A 3JBG1 3W20A 2AH2A 4YW2A 1VBB1 1SDWA 1OLMA 1O4YA 1JH5A 2DFBA 4P9GA 5FUPA 2X05A 3VKFC 4NPMA 1WZXA 1KJRA 3GBGA 2EF6A 5CG8A 4WM8A 3RYPA 2R0FA 1SBDA 3AVSA 4C0HA 4CCEA 2X5IC 4NRQA 2P3KA 1UOJA 1VBD1 1UY0A 4CU7A 1EUTA 3AL6A 1RUE1 3NNGA 1AJKA 3P5BA 4IE7A 4N53A 5C4WC 4PHZA 1OBNA 1XNKA 1ZRRA 3E97A 1Q8VA 3U75A 1PVC3 1F2NA 4FAGA 4RQPC 5FTTC 3N7KA 1DYOA 1LTEA 2D44A 4Z1VA 1YLLA 1OD3A 1SCRA 1LOCA 1OQDA 1H8VA 4E4SA 3UL2A 1KJLA 2V09A 2MEV3 1G9FA 4LBMA 4YW5A 5K0UA 4ITCA 2P2KA 4CP1A 4JVAA 3ES4A 3WX5A 5A6XA 5DMYA 2K46A 4BE3A 5LK5A 2BJSA 4N43B 4JV4A 2YB7A 3TN93 4BWOA 4UFIA 1M06G 4ZKTB 1RUC2 3RZJA 1JTZX 1A8DA 3SKJE 2JG8A 1J83A 4ZZ5A 1MR5A 1ZZ8A 2GN7A 4QQPA 3NWKA 1YUDA 2E7QA 1NOVA 5FFOC 1OFSA 1SBFA 4KG8A 3DPRB 4XF4A 5FYBA 1GP5A 2OUJA 5E89A 3ZM8A 1OI6A 1OA3A 4DINB 2CSGA 1RUI1 4UF0B 1H8TA 3OBZA 4OUMA 2EALA 5FREA 3O1UA 4NAMA 2XKPA 3DF0A 1W8UA 4DRRA 1V9U3 2WLQA 3DYMA 4P9LA 4HETA 1OSGA 2JG8B 1I9RA 1CAWB 4NIDA 2B9UA 3JBG3 2F6BA 1QJZA 2BYVE 1XRUA 2QDNA 4ZPIA 3WLUA 3WP6A 1H1AA 5IWFA 4COWA 2WJSA 4M3CE 2B5HA 1GV9A 1LAJA 3H1MA 4EN8B 3P3NA 3PVBB 5CZKA 5FZ1A 4P9IA 2G19A 5LBCA 1US3A 2FCUA 4HSLA 4JRAA 3N35A 4XJAA 1QQP3 1AVBA 2OYZA 2ZGOA 4AOCA 4CU6A 4EWEA 1SFNA 1F31A 5FZ3A 4JDOA 1KFXL 1N3QA 3M3QA 5J48A 2A75A 1K5MB 1MEC3 1OC1A 2D6LX 1IS6A 5LBBA 3TNQA 1LJ7A 2VTXA 3HT1A 3ROUA 4KU8A 5F3GA 1WMEA 3GHMA 2ZGRA 1IZ3A 3HBKA 5J09A 4HN1A 2W95A 4CZSA 4QGMA 3JU9A 2AGSA 5SV8A 3WW3A 1UX7A 1GZ9A 2HWC1 4AI3A 2XBO1 2TEPA 2D7FA 1UY2A 2DCZA 2UWBA 2YU1A 5FQ0B 2FZ1A 4UBGA 2VH9A 2WR9A 1ULPA 4NAOA 2AACA 3WHTA 3W5MA 1ZZBA 3TB0A 4XFHA 3BPSA 1APNA 5FYUA 4ISQA 1OKQA 4Y1ZA 5FYZA 1FATA 5JXIA 2WS92 2YFUA 2QBXA 3AM2A 4W6XA 5DDJ2 1IKQA 1W6PB 3HD8B 2QCSB 4GH4A 1MS5A 3WG1A 4QPIB 1AX0A 2ARBA 3M3EA 5FLHA 2D93A 2OX0A 2ZMKA 4UOJA 3RG0A 2JICA 2JKBA 5D8AA 5IFTA 1Q3EA 5FY8A 1A34A 2R7EB 1YHFA 1QJU1 2HWF3 4XXAA 1O4TA 3NSTA 4YW3A 3O14A 4N53C 2A6XA 1TNRA 2P17A 5C4WA 1I3HA 5ABJA 1CAVB 5CNAA 5GZGA 1H4HA 1W9WA 1I1EA 1S55A 3WQ0A 5B4XA 1ZM1A 4B8EA 4S2FA 2NM1A 2CYFA 4JCKA 1O59A 5EP9A 3USSA 4BXFA 2EXKA 4QGLA 3ETQA 5FY1A 3WDVA 2VL4A 5K0UB 2FCVA 2WYFA 1RUI3 3MUZ1 4QDQA 3SITA 2V5DA 2HWE2 3S7EA 1RIRA 5A3MA 1N47A 1O5LA 3OPTA 4WBBA 1GNHA 5JXGA 2XB6C 3ZXDA 4DXZA 2GU9A 3QCWA 3J9SA 4QHBA 4M01A 3AP7A 5DAQA 5FYVA 4BISA 2Y38A 5FYMA 1VBD2 1AYM1 1XBFA 4M4RA 4CDUC 3MIBA 2BV4A 1B35A 5JCTA 5T52A 1RUE2 2PAEA 3UKVA 1WBLA 4IV1A 5CKNA 1VBD3 1F35A 4RGKA 1W2AX 4Y5SA 1LHUA 3I97A 4FT8A 3S5QA 5I93A 4WM8B 3AK0A 3KV4A 4GAZA 5JAXA 3WW4A 4E8DA 1UPIA 4GA9A 4KNCA 4YVSB 4FFIA 5IATA 3T08A 4CXWA 1VR3A 3OGVA 3PIJA 3I49A 2IUWA 4BIFA 2BVVA 5T5PA 3HNYM 4IE6A 2ZX1A 5BNPB 1AUYA 1B35C 4XQ4A 2WFPA 3CNAA 1RVF3 5J36A 4S2DA 3POGA 1A78A 2DUQA 3ENRA 2WA3A 1S0CA 2CAVA 4KI5M 3IT8A 2PLV1 4R8HA 2W08A 3I3DA 2QQMA 1X33A 2Y26A 1PIV3 3S7IA 3IIAA 4MGKE 3S30A 2AREA 4LEJA 3SCFA 5BNPC 1J1TA 4M00A 1NXMA 4XVHA 3BTXA 3H0OA 3LA2A 4HVRA 5H9RA 3URFA 3P6BA 3H8UA 5FPZA 1HLCA 1EPWA 3ZIWA 1NCRC 4YZ5A 5FOJB 4IE0A 3O12A 1HX6A 4YRDA 1X9PA 1Y9GA 3BIEA 5H9QA 5E88A 4JRLA 2XJSA 1AL0G 4LKFA 2V4AA 5DUXA 1G9BA 2Y6KA 4KL1A 2HWB1 1G9DA 4CPBA 3Q8EA 4MYEA 4FP2A 4YVWC 3WQ7A 1QOOA 5A6ZA 1UYXA 2H0BA 4HN0A 3FLPA 1U5IA 2FD8A 4WV8A 2RM22 3IDAA 1Y7BA 1V9U1 3SH3A 5IW0A 1MS0A 1TNFA 2P6CA 2ZKLA 1LOFA 4B3NA 4GMP3 1AR93 5T54A 3AFKA 2ZAAA 1H0BA 3T1LA 3BYWA 2LW8A 2OZ6A 3V64A 3LDKA 4JGZA 1S2KA 5AFBA 5JMCA 2ZS6B 2PHRA 4TYSA 3E6BA 4Q4X3 2VMHA 1WCSA 2XBO2 5LA9A 3IPVA 1VBA2 2ZAHA 5FP8A 5FK7A 2D43A 1XJAA 4A4AA 4QX2A 1COV1 4AQ2A 1NZIA 2XLFA 3WP4A 4QXKA 1CPMA 3M3CA 4IEWA 5ACA3 1AXYA 1IOAA 5J1XA 1C5HA 1LOAA 1ND3B 5LATA 2Q8DA 1DZQA 4OUEA 5CBLA 3SMHA 1W0NA 2WS91 3OGJA 4Y22A 4FSJA 1JYCA 3N36A 5KHJA 2JXAA 1QJEA 4XDPA 1NT0A 1DQ4A 1JU4A 4KBBA 3LGRA 4OZOA 3B5LB 1QH7A 3BU0A 4CVUA 3ACFA 3U4SA 3VDDB 2RDRA 1QJX3 3M4FA 5JWPA 1TME2 2GP5A 2VMEA 4N43A 1S0GA 4UW5A 5EJ1B 4XETA 2VY0A 2VR4A 1G8WA 4BMEA 5APAA 5L73A 2HLEA 3GBWA 1SPPA 4HG6B 4CDQC 5A6YA 2WC2A 1K5MA 2IVIB 3E5UA 3K3OA 4LQRA 1IQAA 2J1VA 1YJLA 1HXS3 5D21A 4Q0PA 5FXZA 4GZ9A 3U14A 1C8NA 5C3PA 3WDTA 1VE0A 3RWKX 2HWE1 5DUVA 2IXCA 1AX1A 4NOTA 1MQTC 5IVVA 5KHHA 5IK7A 1HXS2 4HT1T 3VHOA 2QQNA 3R4DB 4EV0A 4JZRA 2WQ8A 3VBRB 2WN2A 1OKOA 4S2HA 5FUIA 1O3QA 1CAWA 5E6HA 4YW1A 4JGZB 1F5FA 2OPWA 2OA2A 4CYDA 4C91A 1AL21 4JDMA 5K4LA 3GHNA 3N9LA 2B7YA 5EIYB 1BVP1 4DUWA 1RUH2 3AJZA 1JYVA 2RDNA 3VBRC 3I3EA 3PMEA 3ME2A 4AFCA 3PUIA 3AX4A 4L9BA 1RUH3 4QPWA 3POEA 2WYSA 5F32A 3WSOA 2YV8A 2D6MA 2VAUA 3MV01 2VZVA 2YZ4A 3NJYA 4LORA 4P9XA 4QWNA 3X29B 4XCBA 1LODA 1PVC2 4XW3A 3O1PA 3BKZA 1ZRIA 5C3OA 1F4HA 3VBUC 3AP4A 1RUNA 1RTVA 5FAXA 4LE3A 3ACHA 4BLJA 2VULA 3RPQA 1H4GA 1E5HA 2EICA 1YFUA 2IC1A 3RVHA 2VVEA 3PMSA 5LW9A 3TN92 2RS31 5IVBA 1RGSA 3TWIA 3I2FA 1Q5OA 3PUAA 1QNWA 4BQ1A 5CEHA 5FMOS 1LB2A 2QJVA 3QBQA 1YYNA 1DGRA 5FJHA 1W6PA 3CQOA 3J8F1 4LBJA 2HWB2 4CUAA 1CZSA 5JIUA 1ENSA 3VD7A 4FPHA 1PK6B 4LBNA 3WOGA 2DV9A 2WQ4A 4EJRA 3RNSA 4MLOA 2DU1A 3MV11 2PHTA 4K20A 2PHDA 4NHKA 3USUB 3ZFFB 2VG9A 1Y4WA 2RS53 2WLPA 2BVBA 2RM21 5A1FA 4PLOA 5F5CA 5IHRA 1V9U2 3EXUA 3QOPA 5E8AA 4GWIA 3M70A 4HOOA 2K2SA 3G6JB 4RD7A 4YARA 5BNNB 2I45A 4FP3A 3K4AA 4MXWA 3JD73 3O1SA 1LHNA 2WNUB 4XDOA 1UY4A 4IE5A 1N1TA 5BNPA 4BJ0A 3I2OA 4ZXKA 2JDHA 4AVAA 2WNVC 4FPJA 3PTRB 2NYYA 1QXRA 1UKGA 2O8OA 2F4PA 1MVEA 2WQZC 1Z0HA 3R4SA 4ONUA 4YVWB 5FZEA 2LUWA 1JZ3A 1VBA1 2CL2A 2Y60A 3T30A 2FDIA 1WW5A 2WRAA 1C4RA 4YG0A 2QQLA 1EP0A 4UWDA 4XPVA 2GNTA 1TQ5A 1UL9A 3J7NA 4FOQA 4N90A 1JOPA 2RDQA 5CFDA 1RUJ1 4WZCA 5ANQA 2E63A 4FOYA 5F2WA 3W59A 1XNCA 3K77A 4Z2AA 1FPN3 4I0AA 1O3SA 2EIBA 5LASA 4AFMA 1PVXA 1V0AA 3PNAA 4Q26A 1R082 4CTEA 3ZFGC 4GKXA 2VZ3A 2FDHA 3CLPA 1UWWA 2A70A 3HWJA 4R4ZA 4RHV2 1RUC3 3O1VA 4FPCA 1HB2A 2VZQA 2XL7A 3APBA 3F95A 3OGSA 1H1IA 4NIIA 1YWKA 4AEDC 1R083 5HCBA 3CMGA 3POFA 1UYPA 5KXBA 3DV8A 3VBHA 2VQUA 4QB1A 1AJOA 2B42B 4XBQA 4O9GA 2PA7A 4R9BA 2CGPA 4GJYA 3WNLA 4CCLA 5DDJ3 4BQ5A 2XQRA 1V6OA 1GFF2 2RR13 4AFAA 1ALYA 1WLWA 3MIFA 4GB32 1W8FA 3DCQA 2UY8A 3KB5A 3KQ4B 3BOPA 5IT6A 2B4KA 3TAYA 3WUDA 3LIHA 2A5ZA 3V0BA 3I8TA 2GP3A 3ZOIA 4PLMA 4LUKA 3VBOC 3PVOA 3BVCA 4JAAA 4MOAA 1UQXA 4BPZA 3RGBA 1F5JA 4IE4A 5CVRA 1UOBA 1PGL2 1ND3A 2DUPA 2RJ2A 1Q8PA 3UK9A 4JKKA 3ZMNA 3VBUA 4YM3A 1MS8A 3WQBA 4LXLA 2XGXA 4PDWB 1RUH1 4CEYB 3WF1A 1G7YA 5HI0A 4O7XA 5A7OA 4QX7A 2BWAA 4AW7A 2BPA2 3VL8A 5DZEA 3DXTA 3FHQA 1FOD1 2Z69A 4LBQB 3EB7A 5I8TA 1R093 3H7JA 2XXZA 5CG9A 1GWLA 1H6XA 1N1SA 2W94A 1GOGA 3NNFA 1OUSA 4AVTA 4X8PA 2E51A 1W6OB 3NKTA 3OCPA 2VW1A 3HQUA 3HJRA 2R0HA 3MDPA 1PK6A 2J1UA 4ATFA 2BU9A 3IMMA 3V65A 1R1A3 2XJUA 1YQ5A 1ENQA 3Q8CA 2P5BA 1VB2A 1NUKA 2R073 1ZRCA 2EAAA 1RUF1 1V6KA 4D6QA 2ZGKA 1D0GA 4KG0A 2I2SA 4IUGA 1JN2P 1UIKA 1WUVA 3KT4A 4LO8A 3ZVXA 1DZTA 2CTVA 3BIWE 1ZBA3 2QFEA 1QJFA 3C7GA 2FQPA 3POWA 3T09A 4ES9A 2ZHNA 4HBNA 5AC92 5LA0A 1X8MA 3NKGA 5TSWA 1PIV1 3J8F2 1C1LA 2VQAA 3FLTA 2BGPA 4B4QA 5LZ6A 3I2IA 2VUCA 1PGW1 2Y0OA 1QJX1 1LRHA 3RZLA 2RR11 4QHZA 4X6RB 3WR0A 3GBFA 2O0OA 1H2MA 1JYTA 2XH6A 2NZ9A 4QKDA 3USUA 4B7EA 4CU9A 1DCSA 5JI7A 2A1XA 5KWRA 4JQTA 5GLUA 1CD3G 1ODNA 4RYDA 4BQXA 1RUG2 1RJ7A 2WN3A 2V4VA 2GMPA 1OA2A 2E53A 3A23A 5KBFA 2X5IA 1AXKA 1DP0A 1XU1A 4W8JA 5A32A 1IPKA 5FO9B 1V70A 2AC1A 1ULOA 2P3JA 2QQVA 3NMBA 3KMHA 3B00A 1SEFA 4GULA 4JDNA 4LBOA 1POV3 2Q1FA 4RR3A 5FZKA 1HW5A 2Y33A 2VZRA 3LDBA 4QKNA 1YNAA 2JB4A 3WEZA 3DGTA 1Q43A 4LKEA 1RUE3 2D5FA 1UO9A 1RUJ2 1UXZA 1UZYA 2DBNA 4X6QB 3ZYFA 2X5IB 1CAUA 3NW4A 2YYOA 5A3PA 2BBVA 3NL1A 4BQYA 1X9TA 3LKJA 4BB3A 1W0PA 5GM0A 5FZAA 4D0QA 4FTSA 1BEV1 2OT7A 5I0DA 2YROA 3AMPA 5FP7A 1FOD3 1FXZA 4UAPA 3SKVA 2GALA 4CRQA 4QPYA 2VCMA 1SPPB 1O3RA 4HVQA 1EV12 4W50A 2UYAA 3ACLA 3I2DA 1MZFA 3VKOA 5K9YA 4QX5A 1E5IA 5HCAA 4CDUB 3Q8AA 2ZHMA
chains in the Genus database with same CATH topology
1W6QB 1UX6A 1IGOA 4Z8BA 3AKPA 3KS7A 4CEWA 5CU1A 4AEKA 2D6OX 3K48A 1MZEA 4RS5C 2BQPA 4XF1A 1ZRDA 4LLFA 4AHYA 2TNFA 2R043 1HIXA 5F1RA 1SLIA 4Y1UA 4GH4C 3VBSB 3AZXA 1AX2A 2DFCA 1JHNA 2WT1A 2WSUA 3B01A 3ZXJA 3A4UA 2V73A 4IV3A 5T5JA 2ZGLA 1ULDA 3VBHC 3KD4A 1QU0A 1AR82 1KRIA 1D2SA 1CAXB 2OUHA 4GMP1 3SNMA 2LM3A 3R0RA 2PHXA 3WP3A 3RQ0A 4WVWA 2OIIA 2HWD2 2VVDA 3V0BB 1RVF1 2ILMA 4HK8A 2R6QA 5JSRA 3GZAA 3WCSA 1XXNA 4H7MA 4P5HA 5CFDC 3RJ2X 3WG4A 2BEOA 1WCKA 1POV1 4QD2A 2I07B 5I8YA 1XNBA 4Q4Y2 4AGVA 2RS13 2X53S 1NLRA 4W6YA 1LEDA 4QM9A 4BLIA 5ACA2 1R091 1BQPA 3AB0A 1RUD3 1WCDJ 3UJQA 1GZWA 1RMU3 3VHRA 2RS11 2WINB 4XYXA 3D0JA 2ES3A 1OFNA 1PIV2 4Q0SA 1RMU2 3M3OA 1D0HA 1PMIA 2QE3A 3TBDA 3VZMA 2DCJA 1QDCA 1RUOA 1QJX2 1S2BA 1QGLA 1V6IA 1TME3 2BWCA 2R061 1NQDA 4HL0A 3T2TA 1LR5A 1QOTA 5T3NA 3ILFA 1WMDA 4M0NA 5JPMB 1RUG1 4D7SA 1KS4A 4WM7A 4WVZA 1AZDA 3VL9A 1UW8A 1FI2A 5BNNA 3THTA 1D2QA 4OHYA 1DQ5A 4PIZA 1VBC2 2ZGUA 1PO13 3FE5A 3ILRA 2HYKA 3MZHA 2RE9A 4DPNA 3AP9A 3OYWB 4DRVA 1DYKA 4YVWA 3PLQA 4DZGA 3EO6A 3G7DA 3FX3A 2H6CA 1OPOA 3NJZA 3BB6A 5CFCC 1W6MB 1AYM3 1FNZA 2P37A 1SLAA 2ETEA 5JSOA 3UJOA 4GQ7A 4FPYA 4F8AA 2D98A 3OTFA 3R6SA 4FBFA 1B09A 1HRI1 2CGPA 4COYA 2ZGSA 2VPVA 3UV9A 4YGEA 4RR3C 1REFA 4LBQD 1EAH1 4YGDA 1EY2A 1YCIA 2GNBA 1AYN1 4Q0UA 3MW3A 1S0JA 4FTBA 2GH8A 4HSJA 2BUKA 4XZPA 4H55A 5D1IA 4XJZA 3LAGA 4M3CB 1XU2A 2G4IA 3AKRA 5FDBA 5C8WA 3PVNA 3W58A 2NMOA 3VZJA 2UWCA 4DFSA 1Q8SA 5JR7B 1RHI2 3VZLA 5EYXA 2VQ0A 5GZFA 1QJU3 2HWF1 3JBG2 3AMQA 1JYIA 4RGGA 3ZFEA 4AI8A 1O3TA 1AR81 2FMYA 3B69A 2XVKA 1YO8A 2Z79A 2VVFA 4J1XA 1J1LA 4Q29A 1H30A 2Q5TA 4AQTA 2WFF2 2IZWA 1QQP1 3AKTA 2AENA 3PHMA 2RJLA 3GZUC 3IN9A 1E57A 4HKWA 4KWLA 1WLCA 5J37A 2VECA 2FHRA 1F9KA 4QPIA 2QQPA 4YYOA 1R092 2JECA 3JB8A 4UW6A 2H0VA 4Q4X1 5KHGA 2JE7A 1W0OA 2VNOA 1HV0A 5A33A 5T5LA 2Q8OA 1U5XA 1KXGA 3OF1A 1JXNA 3AFGA 3KLSA 1R1A1 1YJKA 2JDZA 2D3RA 4FXGB 4ORFA 3RS6A 2BNOA 2ZX2A 1IS3A 4IEYA 1ASJ3 2JEMA 4XFBA 1CAXA 3PJYA 4ZU7A 5BNOB 5IK4A 1GQGA 4NPRA 1LGCA 4HPKB 1ASJ2 2D40A 1A8MA 3NV2A 2R16A 5FCCA 3WUCA 1ZX5A 1B35B 1VP6A 4WVMA 4DQAA 1ZZ7A 4YFWA 2EVXA 4P14A 4XE9A 3D4KA 3MGUA 5LEKA 4FOWA 3HR9A 3RMYA 3MLLA 3ZXKA 1RJ8A 3POYA 1CVNA 1MACA 4XJ9A 1RB8G 2E9QA 2GN3A 4Y5Z0 3QD6A 1UCXA 4CEWB 1EPZA 1WMFA 3QH7A 5FQ0A 4OLLA 4Q4W1 1GNZA 4JTOA 3GZTB 4XFIA 1AR73 2OW4A 3QLQA 1VBB3 1NCQA 3ZSKA 4J1WA 5C6CA 5E16A 4RS5A 4GH4B 2MEV2 3DKWA 3WDYA 3FUQA 1TMF2 3BTAA 3OBRA 4I09A 4MV2A 5I0TA 2ZX4A 4GWNA 4LA3A 3M3IA 4NWWA 1RUF3 1NCQC 5BNPA 2ZX3A 2DVDA 1MQTB 5DDJ1 3ZFEC 5FMOL 4HLTA 5J7MA 3MF6A 1VAKA 1X8EA 5BNOA 4GIQA 5CB7A 4WM7B 5DG2A 1V6LA 2DUOA 1VB4A 2A73B 1OOPA 5AC93 3E6CC 1ENXA 3MICA 4J6GA 2EIGA 1OQEA 3AXDA 4GWMA 3WV6A 5LRSA 4COVA 4WVVA 3IBMA 2HWF2 3KZ4C 4WM7C 5GZDA 3OYWA 2D6NA 3HQXA 2GC0A 5FBZA 4Q0QA 3U0ZA 3DUIA 2DVAA 2X29A 4YGBA 1LOFC 4XHBA 4YG3A 2DU0A 4ASLA 2WFF1 5AVAA 3AZVA 1CX4A 4JGZC 4LULA 3ZFFC 1C3HA 2IXJA 1QQP2 1J3PA 5FRAA 4IEOA 4QU2A 2ZGTA 4W65A 2KXLA 2ET7A 4RR3B 4AEMA 1W39A 1S0IA 2W0XA 3FFZA 4QM8A 4BMBA 5F9TA 4YZ4A 4B7KA 3GNEA 3JD71 3LOIA 3GYDA 3LZZA 3NAPB 2A3XA 5L7OA 3VUOA 4AEJA 3LA3A 2AZ5A 3RDIA 5EZWA 1QOSA 1ULFA 4NO4A 4YM0A 4F7ZA 5GLVA 2NN8A 1SMVA 3LSDA 4YLZA 3WXPA 4YGCA 2AR6A 1R1A2 2PLV2 2R1BA 1LULA 3FMGA 1GANA 2R072 3VBRA 1FMD1 4EN6B 3W9AA 1FNYA 5BNNC 2XJTA 1QMJA 1O91A 4FQ4A 3ZPYA 2VU9A 3B93A 1HDKA 3PTYA 4K9SA 2DCKA 1T6GC 2RMU3 3IDBB 5BXXA 2ATFA 4XILA 4CP0A 1DF0A 4OHVA 2RMU1 2AUYA 3ATGA 1Y43B 2XJQA 4PBOA 1DHKB 1LGBA 2IXIA 4XFGA 1BVVA 3WP5A 2SBAA 5DG1A 4E9KA 4Q4W2 4AXOA 5JIAA 4G3YC 4MX3A 4UBHA 4XXPA 4Y20B 1F8VA 2VNRA 4I2OA 3WQ1A 3O0WA 1LHOA 1N3OA 3B3QE 1PO12 2A6VA 3R4UA 1KFUL 3MIEA 1ULGA 1W2UA 2PYTA 4AYUA 3DL3A 3WNXA 2MEV1 1MEC1 4OI2A 3RYKA 1AF9A 5I0RA 1H2KA 4DNYA 3BU7A 4KWKA 1MVQA 5FLIA 2UY9A 4QGNA 3SH4A 1CAVA 2MHFA 1DU3D 1V00A 4BA6A 3N3HA 2WZR3 4PLNA 2ZGNA 3AMMA 4X8NA 4HKLA 2XJPA 5T55A 3CJIC 4EWAA 3DN7A 4ASMB 1EV13 5J98B 4AG4A 1BEV3 4YZ1A 4E27A 4U2AA 5JOWA 3HIFA 4WVMB 4HVOA 1VBE3 1BBT1 3NV4A 3M8LA 2XWJB 3CJIB 4D3WA 4Q8LA 3ZFEB 4FPEA 3MI8A 1UU6A 1S0EA 3FUOA 5H9SA 2O8QA 5T50A 1N1VA 3H3ZA 5E1RA 1LHVA 4DB5A 2A6YA 3IWZA 3RWNA 4N7IA 5HXVA 1HXS1 3I4IA 1SCSA 2XL9A 4AQSA 5IUQA 3NVCA 3CU7A 2WNVA 2Z42A 1MZ5A 1IPJA 1C8M3 4W6WA 1ZRFA 2DF7A 1AR92 2BNNA 3ZXFA 2YPJA 2G9GA 4Y24A 2ZX0A 5K7PA 1JUHA 2WWSA 5GLTA 1PO23 1LU2A 3MW2A 1J3RA 4OHWA 4TLFA 3E5QA 1BMV1 1FV3A 2ZOEB 2HWD3 2ZKNA 4HMZA 5C9AB 1BXHA 1OHFA 4B4RA 4XQDA 4META 5JI9A 3N7JA 4RFT0 1ENRA 3LA7A 3ZSEA 3ECQA 3IMNA 3MIGA 3NO8A 1PVC1 3MPPG 3MF9A 4AHWA 1WLTA 4PBPA 3B02A 3J26N 1FMD2 4UW4A 4BOWA 1SLTA 2RS33 2WZR1 1U0AA 2XBO3 4OI0A 1BZWA 1GICA 3AP6A 2ZPXA 4FXKB 2JG9B 1LECA 2OVUA 2RS32 4CDWA 3KCYA 2D6PA 3O7OA 3ZSJA 4YM1A 5CADA 1DZRA 3ZXEA 4MXVA 3D8CA 4XTPA 2BFUS 3VGIA 1TE1B 4YSFA 1ZBA1 2A6WA 1ZZ6A 1LCLA 1VRH2 2WA4A 4GALA 1CN1A 3O5SA 4AQ6A 4GB33 3RRDA 1VBE1 3WG3A 4LO6B 4AVVA 2EXHA 1VALA 3NAPC 3O0VA 5IK8A 5HBAA 1ZBE1 4PQ9A 4QQLA 2ZMNA 3HN1A 2VOXA 3PJQA 1D4M3 3SCHA 3B9IA 4XIKA 4FPOB 4Q2FA 4XBNA 3U07A 4IL7A 2ZGPA 4A7KA 3CL1A 2NPIA 1MS4A 1PK6C 1KDKA 1YFWA 5C8CA 1JOJA 2MPFA 4S2GA 2XLAA 3ST7A 4XF0A 5CIRA 4O9EA 1XE7A 3ZIXA 4B4PA 4MGIE 3ZN6A 1PZ7A 1COV3 1R081 2FZ2A 3O0XA 3U4XA 2E6VA 1FPN2 3E5XA 2ERFA 3D6EA 4XHXA 3VBFB 2YHJA 1R1ZA 1TMF3 3VN4A 1OA4A 2RHPA 3H3UA 2W68A 3ZYJB 1BBT2 2IFRA 3KCCA 4RHV3 3VKNA 5JSPA 1U12A 4Z2WA 1RC6A 1WLDA 5EWSA 5EV7A 4N9HA 4XMIA 4FPKA 1AR63 1DFQA 2VOVA 4CDXA 2Q30A 2QZ2A 4OUSA 5D8AB 3J8F3 3H1YA 1DLLA 1MS9A 1GR3A 1CAUB 4Z07A 1QJY3 3WCRA 3AP5A 4COUA 2V5YA 4EROA 2DYCA 1SBEA 1ZBE3 1LGNA 2WIIB 5HCFA 4A2UA 1QY4A 4ES8A 4F3JA 4LT5A 3EQEA 1QJY2 2WT0A 3JCIA 2CNAA 5GLZA 3ZO0B 4MXWB 1AR91 1JUIA 3FLRA 4XF3A 5KXEA 4AFBA 1DIWA 1VLNA 2Z5WA 1YFXA 3J4UH 5I0SA 2JG9A 1BMV2 1LOBA 1NLSA 2RS51 3C2UA 1CONA 2B45X 4LA2A 4MZUA 4CDWC 4C1WA 4GXLA 2GC2A 5EJ3A 2QKDA 3KCXA 4QPGC 3RSJA 1QXJA 1X7NA 5EYYA 5JLVA 1OD5A 5JZGB 1ZREA 3SHRA 1VBB2 3AMHA 3VBSC 2RJKA 2WL1A 1PZ9A 3ZXGA 4HZFA 5KC6A 1H2NA 4NVPA 5FOBB 1X50A 1ZA4A 3VDDA 3DPRC 4OI1A 4LO5B 4CDQA 1K5MC 1HRV3 2GC3A 2JD4A 1NG0A 2CWMA 1NE4A 2IXLA 3INAA 4CEWC 3MEPA 1URXA 2CWSA 4IV3B 4L2NA 2VMIA 4KU7A 1ZBA2 3POSA 1NA1A 1EYBA 1PGW2 3JQXA 3QACA 3V0AA 4FPLA 2RR12 2NP0A 2ZZJA 1QF3A 3AZZA 4LHNA 5GZEA 2BW8A 3SCGA 4Q27A 2R041 1V6JA 5DUUA 1UF2C 5J96B 4BCUA 4MSVA 4M0HA 2DURA 4CDUA 2XKOA 3LCPA 5EXOA 5GKAC 2JX9A 1RUI2 5IK5A 2XUMA 1NA1C 1J59A 4HFSA 3R05A 1A6CA 1QKQA 1ZZCA 3OY8A 4HANA 4KGGA 4N43C 1PGSA 3CJIA 1VJ2A 3FBMA 3BALA 3ILNA 2P34A 5DZGA 3LOBA 1GLHA 1J3QA 4UW3A 3ZDSA 2PTMA 4OULA 1AR72 2BGCA 1W6OA 4K7JA 1G6NA 4OHXA 3AKSA 3L9JT 1SLLA 4XJWA 3I7DA 4YNIA 2ZABA 2XHKA 5BY5A 4LBQA 1W6QA 4FPGA 1ND2B 5L36A 4JTNA 1XYPA 2HWC3 5FLJA 4YM2A 1WA4A 3EJKA 2QDRA 1EV11 2DVFA 3Q9OA 4FO9A 3WW2A 3AKQA 4Y22B 3UKNA 3TRSB 2UURA 4URTA 2YUEA 3N4MA 2VXRA 2HWC2 2Q1ZB 4XFCA 3HBZA 1IHMA 3IM0A 5I91A 3VZOA 4IEPA 3U11A 1CJDA 2CGOA 4PDWA 3MIDA 4CEYA 4EWDA 4AWDA 5AVPA 2GZWA 2GNDA 3PVEA 1DG6A 5K0UC 1UIJA 4MGYE 4D7TA 3OGGA 2YGMA 4SLIA 4E2SA 4OFGA 4DY3A 4EN7B 4IV1B 3OD4A 1LU1A 3MLKA 1AXZA 1RUG3 1AR61 1MS3A 1XYOA 2QNKA 2Y0IA 3FC0A 4AHZA 3WDWA 4C0BA 3FBYA 1C5IA 4M3CF 3ZN6B 1W6MA 4L92A 2A7AA 4WM8C 4NWVA 5C8CB 4B29A 1RL3A 3EBRA 3MFAA 2B46X 4HKOA 2PQQA 2WZPP 3NV1A 4LBKA 2W52A 1N1YA 1PNFA 4A7YA 3S0MA 3ES1A 1XE8A 3H9AA 1CQ9A 1LENA 4DOUA 5C9AA 4L99A 1AYM2 4LBLA 4ISRA 4RA0A 3RMXA 1FX5A 4Y1XA 4IETA 3WVJA 4XFAA 2VOWA 1RUJ3 3S6PA 3WT3A 2RS12 5J3UA 2OZJA 3SH5A 2PLV3 1G86A 3AZYA 4QPGA 1GBGA 4P9YA 1RMU1 1NE6A 3K51A 3IKWA 2DVGA 2I74A 2JG8C 2R1DA 2E7TA 3VBOA 1PHMA 1XQNA 2UU8A 4RSUA 1HQLA 5CFDB 2R042 1IS4A 1ND3C 5FO7B 1ULEA 5JOXA 1KD7A 5CFCA 2CV6A 4I3GA 2R063 1SFYA 4Q1PA 4R9DA 1DGRN 2FMDA 1AHSA 1UD1A 1NXD1 1NY71 3U10A 4AEDA 2D6KA 3WG2A 4A3XA 1BK1A 3FJSA 5BNOC 2G9FA 4FTEA 1NYWA 1YRZA 4Q4V2 1AR71 4D94A 3HAGA 4P9WA 2K0GA 1NQJA 1FYUA 2N7GA 1HRI3 1YI7A 1D4M1 5JVVA 1KITA 1MZ6A 5L19A 1DYPA 4TSVA 3I54A 4IV3C 5GZCA 1HRI2 3ZXAC 4G9SB 3DPRA 1YIPA 3VDDC 1BCXA 5GJ6A 5FPXA 2JE9A 4BZ4A 4XMAA 3IDCB 5FO8B 3AZWA 3ZYPA 4LLOA 3ZXLA 4K1ZA 4Y26A 3AYEA 2PHWA 1POV0 2XJVA 3IPVB 2EXJA 2A3YA 3BCWA 1COV2 4ZU4A 1ZVFA 4H3WA 3ZSMA 1YI9A 1OPMA 1ZNPA 3VHPA 3FFQA 4Q4Y3 2ZZQA 1ONAA 2VOKA 2SLIA 4Y1YA 1QHDA 2Q0AA 4H14A 4LHKA 2JG9C 4KQ7A 4V1PA 3A0KA 1C57A 2BFUL 5JDBA 2GSYA 1D4VB 1V6MA 5KXDA 2FBEA 2VUJA 2ZTNA 3V0BA 5SV5A 4KGQA 1AR62 3FHIB 4IERA 3EHKA 2C5DA 4QPIC 1TME1 1ZZ9A 4IEZA 1NCQB 3ZYGA 2KM2A 3V56A 4AI2A 1VBC3 4L8QA 4ZU5A 4LO4B 4Z82A 1NCRA 4PCRA 5A3LA 4E2GA 4N9IA 4HPKA 4XTMA 5I0UA 2MNGA 4OZXA 1GSLA 1CIWA 3KM5A 3ZFFA 2WFF3 2BTVC 1PZ8A 1HKDA 4AVBA 1VIWB 4IEUA 2DCTA 1XNDA 4Q1RA 3BODA 3KSCA 1AL22 2Q1MA 3WDUA 1WD3A 4I02A 4AGRA 4Q4X2 1DQ2A 2KA3A 1Z7S3 5JOZA 5D8AC 1H9PA 2A6ZA 5DZFA 2PAMA 5F5QA 3SXWA 2ET1A 1WW4A 5KC5A 4FVVA 5JOYA 3JZVA 1PNGA 1OOPC 3HMYA 3JUUA 2AYHA 4QT6A 4JQRA 2H6BA 4AI1A 1BBT3 3FZ3A 3M1HA 3L2YA 3V0AB 3ZN5A 1ASJ1 4C90A 2HJIA 3MLJA 4AGGA 2BNMA 3P3PA 5LEJA 1OLRA 3I59B 1N3PA 1UU5A 2DTWA 1X36A 3VKMA 4IESA 3TN91 3VV1A 3NV3A 3KT1A 3OD0A 4NR1A 2K9ZA 4YVSC 2ZCWA 1NY72 5T5OA 1NCRB 2WKKA 1ZYBA 3VLBB 4OI4A 4F83A 4IQPA 2UYBA 2A3WA 3VZNA 5LK7B 4AVCA 1A3KA 3CO2A 1OQ1A 1UAIA 4Q4V1 3VBUB 1C8M1 3MW4A 1D4M2 4K40A 4PIXA 4YG6A 4D69A 1C1FA 4AHXA 1HQWA 4A7ZA 2ZACA 5JZGA 3AYCA 3MIHA 3JQWA 3C3VA 2VMGA 3T1MA 3TOJA 2C0ZA 4TWTA 1TMF1 4I3PA 3UKTA 1LHWA 2ZGMA 2XVGA 4Q0VA 4RL7A 4GMP0 4LR4A 1UN1A 4UXAA 3BPZA 4IEQA 4TZDA 4U36A 4K3UA 3ZN4A 1GZCA 5KHKA 1LEMA 1G9CA 1O7FA 1EAH3 2YMZA 4Y20A 4JGYC 1GYKA 4XBLA 5DXDA 1YIFA 1AYN3 1JW6A 3OY8B 4AE2A 1UMZA 4XJ8A 1IKPA 2Z2SB 3WZ1A 4IEXA 1WD4A 1S0FA 2PAKA 1DQ0A 5CAZA 5C4WB 2YDEA 1ND2A 4RHV1 5ABJC 3B9CA 2DTYA 1FT9A 1SLBA 3AMNA 4XQWA 2VUAA 1WW6A 1MQTA 5C9AC 3ZYIB 4M3CA 4H7LA 5GLWA 3ZMOA 2HWB3 4R9CA 4RGAA 5B2GB 2GNMA 3ELNA 2PFWA 4R9AA 4IXLA 5BPXA 4GB31 1S0DA 4JC1A 1DQ6A 4N53B 4WZFA 4YZ2A 1ND2C 2D3SA 1C28A 2XVLA 4QQHA 1IS5A 1GQHA 2ZMLA 4AVSA 3LSEA 2VGDA 3RYRA 4BYYA 3JD72 1DBNA 1CJPA 1PGL1 3LB9A 4YFZA 1HQNA 4XJUA 2EAKA 4PIYA 2E7AA 5F6KA 4AF9A 1O4ZA 2Q4SA 4FQZA 2WNEA 3AXEA 4K8FA 2XWBB 3VBFA 3B7MA 1FOD2 2R071 3RI9A 3FWEA 2JJ6A 3VBSA 4IEVA 3ZYRA 3AJYA 2D5HA 4OVEA 4CDXC 1CGPA 1SACA 4EN0A 2OPKA 2VNGA 4CP2A 5CFCB 2XJRA 1I6XA 1VAMA 1CPNA 3B94A 2GAUA 3ASIA 1RUF2 4Q8KA 5AFEA 3SLIA 1V6NA 4BHPA 4COZA 3D82A 2PHLA 4E4DX 3KGLA 4MGZE 4XDQA 4K21A 2RMU2 1WBFA 5BNQA 5K8SA 5L7OB 1GKBA 2NLRA 5A32B 2TUNA 4RQPA 1L3JA 1H9WA 2DVBA 5DUWA 5AC91 1VAVA 4K1YA 1NA1B 4NN0A 1DGWA 1UZZA 3GALA 2IXHA 4L97A 4KH9A 1C8M2 4P9JA 3MFCA 5EFUA 1WGPA 4XEZA 2PHUA 3H7YA 1PO11 1TEIA 2RM23 1MS1A 2HWE3 4LUMA 2ZHLA 4Z92B 1M4WA 1LOEA 1MEC2 4LE4A 2D3PA 2WNUC 4DMIA 4INDA 3QH6A 4QMAA 4CDWB 1AR83 4DS0A 3TYJA 1H8TC 2ZGQA 1UKRA 1VBA3 2GMEA 2CAUA 2HEYF 2ZJCA 1PO21 3D0SA 3WHUA 3IDEA 2CY6A 4R4XA 1Y9QA 4KWJA 4LNVA 4RS5B 4XF9A 4XFFA 1Z7S1 1QH6A 1S0BA 3KQRA 2VW2A 4XIOA 2WSVA 1OLQA 2D97A 5C8CC 2ZBJA 2WS93 3WDXA 1HRV1 1DQ1A 3JB4C 3KT7A 4FAHA 4BM8A 1BEV2 1BJQA 1RUD1 3VBOB 1REEA 1U5YA 2ARXA 3VBHB 3A0NA 1W6NB 3H1WA 2YXSA 1H2LA 4RQPB 3WINE 3ALQA 2R32A 1FAYA 2B39A 3NAPA 1H1MA 2DCYA 4PJYA 5A33B 4HK9A 2PHFA 3VBFC 2W39A 4PF5A 3KGZA 4CDQB 2XLGA 4L11A 4Q4W3 1RINA 3SISA 3VKLA 5ABJB 5KXCA 2O1QA 4BIOA 4NHMA 2EA7A 3RI8A 2GDFA 1LKNA 4FOVA 3VHNA 1BKZA 4Y1VA 1DGWX 4QPGB 5JZGC 3I59A 1CR7A 4XOGA 4Q4V3 2LALA 3ZFGA 3RZZA 4JGYB 4N7UA 4QQ2A 4AI0A 3MPBA 2PELA 2JENA 4NHLA 4ATEA 2ZHKA 4EN9B 3VZKA 4MH0E 2PN5A 5BV6A 2WZR2 3ZSLA 3M7AA 4I0WB 4R52A 2UWAA 2HWD1 2XG3A 3TNPB 1AL23 1RVF2 4YVSA 3HT2A 4FCAA 3L2HA 4GKYA 3CJXA 1Q8OA 1UU4A 4I01A 3WD5A 2NQYA 2A71A 4FPFA 1QXPA 1U5ZA 1QWRA 1UPSA 3ZX7A 4AEDB 4Q4Y1 5LRRA 2X8KA 1CESA 1DDLA 5ACA1 4LTAA 1Q56A 4E2QA 5CA6A 1VRH1 2HEWF 1QDOA 4OHZA 1RUC1 4E4ZA 1Z78A 2IXKA 3BOWA 3THPA 4DY5A 4Y4YA 4BH9A 1RHI3 3N7LA 1VBE2 1HV1A 3M2MA 1LOGA 1G9BA 2ENRA 4MVTA 1JBCA 1J58A 2QVSB 1LESA 1ZBE2 3GF6A 2R062 3D5OA 4YW4A 1KQRA 2IWGB 3RJRA 4I0BA 1QNYA 4SBVA 2TBVA 3H50A 5L7OC 4D7YA 5F6LB 2YC0A 4PDWC 5I8SA 4CEYC 4AFDA 2R30A 2WT2A 4JGYA 1PM7A 2P3IA 2C9AA 4LHLA 5BUVA 1SLCA 3OJBA 1VBC1 5GALA 1DGLA 3E6DA 1NZCA 3OBTA 1O5UA 1Q8QA 1PO22 2QUOA 1GZWB 1FMD3 1BYHA 1YXWA 2NMNA 1YFYA 1FPN1 3AYAA 4G4FA 4IV1C 1Z7S2 4MUVA 2R49A 1G9AA 2XPJA 5KHIA 1SQ4A 2YY1A 3LWCA 2GC1A 3CF6E 1HRV2 1REDA 1Y3TA 2HKXA 2GMMA 1I5ZA 1ULCA 2WNUA 1RUD2 1XYNA 5H9PA 3N7MA 1OMIA 2C1FA 3WW1A 4I30A 1W6NA 3MYXA 1EAH2 1OOPB 4YZ3A 2CGNA 3ZFGB 4LO7A 1RITA 4K6BA 1VRH3 1AYN2 2IFWA 2VW0A 2GH2A 2ZA9A 2DWRA 4QQOA 1QJY1 4AK3A 3WY6A 1KS5A 2EXIA 2HEVF 3OPZA 1FV2A 1KDMA 4C1XA 2LTNA 5BYNA 2B8MA 4CDXB 1H8TB 1S1AA 2QZ3A 1QJU2 1X82A 2RS52 1RHI1 2YGLA 2WNVB 3AYDA 3CEWA 1WW7A 3JBG1 2AH2A 4YW2A 1SDWA 1VBB1 1O4YA 1JH5A 2DFBA 4P9GA 3VKFC 1KJRA 3GBGA 2EF6A 5CG8A 4WM8A 3RYPA 2R0FA 1SBDA 4C0HA 2X5IC 2P3KA 1VBD1 1RUE1 1AJKA 4N53A 5C4WC 3E97A 1XNKA 1ZRRA 1Q8VA 1PVC3 1F2NA 4FAGA 4RQPC 5FTTC 3N7KA 1LTEA 2D44A 4Z1VA 1YLLA 1SCRA 1LOCA 1OQDA 1H8VA 4E4SA 3UL2A 1KJLA 2V09A 2MEV3 1G9FA 4LBMA 4YW5A 5K0UA 4ITCA 2P2KA 4CP1A 4JVAA 3ES4A 3WX5A 4BE3A 5LK5A 3TN93 4N43B 4JV4A 4BWOA 1M06G 4ZKTB 1RUC2 1JTZX 1A8DA 2JG8A 1MR5A 1ZZ8A 2GN7A 4QQPA 3NWKA 1YUDA 2E7QA 1NOVA 5FFOC 1OFSA 1SBFA 4KG8A 3DPRB 4XF4A 2OUJA 5E89A 1OI6A 1OA3A 4DINB 1RUI1 1H8TA 4OUMA 5FREA 2EALA 2XKPA 3DF0A 4DRRA 1V9U3 2WLQA 4P9LA 4HETA 1OSGA 2JG8B 1I9RA 1CAWB 2B9UA 3JBG3 2F6BA 1QJZA 2BYVE 1XRUA 2QDNA 3WLUA 3WP6A 1H1AA 4COWA 2WJSA 4M3CE 2B5HA 1GV9A 3H1MA 4EN8B 3P3NA 3PVBB 4P9IA 4XJAA 4HSLA 4JRAA 3N35A 1QQP3 1AVBA 2OYZA 2ZGOA 4EWEA 1SFNA 1F31A 4JDOA 1KFXL 1N3QA 3M3QA 5J48A 2A75A 1K5MB 1MEC3 2D6LX 1IS6A 3TNQA 1LJ7A 3HT1A 3ROUA 4KU8A 1WMEA 3GHMA 2ZGRA 1IZ3A 5J09A 4HN1A 4CZSA 4QGMA 3JU9A 2AGSA 5SV8A 3WW3A 1GZ9A 2HWC1 4AI3A 2XBO1 2TEPA 2D7FA 2UWBA 2DCZA 5FQ0B 2FZ1A 4UBGA 2VH9A 3WHTA 1ZZBA 3TB0A 4XFHA 1APNA 4ISQA 1OKQA 4Y1ZA 1FATA 2WS92 3AM2A 4W6XA 5DDJ2 1IKQA 1W6PB 3HD8B 2QCSB 4GH4A 1MS5A 3WG1A 4QPIB 1AX0A 2ARBA 3M3EA 5FLHA 2D93A 2ZMKA 3RG0A 2JICA 2JKBA 5D8AA 1Q3EA 1YHFA 1QJU1 2HWF3 4XXAA 1O4TA 3NSTA 4YW3A 3O14A 4N53C 2A6XA 1TNRA 2P17A