3GF6A

Crystal structure of a bacterial lipoprotein (bt_1233) from bacteroides thetaiotaomicron vpi-5482 at 1.69 a resolution
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
219
structure length
219
Chain Sequence
b'DAIYYPVGDVDIERGGPALEVGEEDVLVARSFNEEDYVLDTIAQYPNDPTLGKLTFMIDLKNQQKDQNVADFNGVGKSKLTMSLGYKDGNYPSESQVPIYTSQDVTAKYAVKLRLKGELLVSGDEWMIDYVYAQLASLFQPYPPANFPEVFMCKGGMKLGTFDSFRRTCTFDITYDRSDLSFSQLYFNLFINLAGQKRENRVRLRIDKESYFELYEQSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized bacterial lipoprotein
publication title Crystal structure of bacterial lipoprotein of unknown function (NP_810146.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.69 A resolution
rcsb
source organism Bacteroides thetaiotaomicron vpi-5482
molecule tags Unknown function
total genus 48
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.750 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3gf6A00
3GF6A
chains in the Genus database with same CATH superfamily
4IV3C 3CIHA 2JG9C 4NJ4A 3TN93 1KFUL 3WF2A 2Z42A 5EJZB 2GDFA 4XFCA 1VBC1 2WA4A 2WNVB 4LTAA 3WZ1A 4Z8BA 4TXWA 1JYVA 1I5ZA 2O8QA 5A7WA 3WLUA 3UJOA 1CD3G 3JD71 4ZONA 4OULA 5EJ3A 3VB9A 3POFA 5BYNA 1G9AA 2KR2A 2TEPA 3BTZA 3VD7A 1MQTC 4XUPA 1ENQA 2HWF2 3VUOA 1PNFA 3WQ0A 2BGOA 3NNLA 5IJRA 5FO9B 2WFF1 3TEWA 1GWLA 1OD3A 4NRPA 4CDWB 1PVC2 1HRV1 2OA2A 1ZNPA 5BV6A 4AI2A 5IHRA 1JZ8A 5FZ8A 2YPDA 1PGW1 2WZ8A 5JWPA 3RMXA 3ZYHA 4XZPA 2WNOA 4AR2A 3EJKA 5A1AA 2V5DA 1AX2A 4Q29A 5A32B 2D5HA 2VQAA 2VCAA 3BALA 3VGIA 3RGBA 2WABA 5JXIA 3ZSLA 2ZHMA 1NLSA 3J4UH 3KB5A 4YVSC 1AHSA 3ZXGA 2VXRA 5K4LA 4AG4A 3OBTA 5IAVA 4BISA 1JODA 4YYOA 1IQAA 1H2MA 4HVQA 5FY1A 4RR3C 5DUUA 3PDQA 3Q8FA 1U5XA 5FPZA 1PGL2 4YGEA 3PUIA 4QQPA 1RJ8A 2P3YA 4HVRA 1QJY2 5FP9A 4META 4Q4W1 4IGOA 1D2QA 5J1XA 3TEYA 4BQ5A 2VQ0A 2W1SA 2VMGA 1RUF2 1CVNA 2W47A 2JIJA 4IEXA 4JGYC 2FDIA 4YW2A 2XBO3 1FPN3 1BZWA 1OC1A 1O8SA 2HWB1 2XWBB 3ZXDA 4F3JA 4LK7A 4AZZA 4CXWA 4XUQA 2N7GA 4H7LA 2C4XA 1MS3A 2IVJA 1C8NA 2QQVA 2VZPA 3N9MA 5HI0A 1W2OA 1CESA 3THCA 3KGLA 4PJYA 3IBMA 3LAGA 5FMBA 3AMNA 1MS9A 1NCRA 1TE1B 2B42B 1ZZ7A 1UYYA 3VZNA 3O7OA 4XFBA 1XYPA 2JB4A 4MVTA 2WBKA 4FP2A 3K4ZA 4FAGA 1BEV3 2PHDA 4AEDA 3UL2A 3OD0A 1Q5OA 1AR71 2RS13 2V5YA 1ULOA 3AVRA 1C5IA 2RR13 2W1UA 5GZCA 2D3SA 1L3JA 1EUUA 3AK0A 1BVP1 1UKRA 3OBAA 2X8KA 4TWTA 4LITA 1GANA 1YO8A 2V4VA 4Q0PA 3TBDA 1OFSA 1LGNA 5DAQA 1QGLA 1NT0A 3D0JA 4OI0A 5BNNA 3AZZA 2FMYA 2Y38A 3VV1A 3AYEA 3LD8A 1NX9A 4LLFA 4OHXA 3MGUA 2WZPP 2R32A 3B01A 4AI8A 4CDUB 1G9BA 1R1ZA 2VMIA 4LIUA 1PMJX 2R0HA 1PIV2 4Y1ZA 1Y4WA 4KQ7A 1ND2B 4HONA 3POJA 5A1FA 3KCYA 1XB9A 1RUE3 1R1A1 2Y34A 5IK4A 1ENXA 4Z92B 4RSUA 4ISQA 5K9YA 3RFRA 4K1YA 1PO22 1ZRDA 1NYWA 3A4UA 3WDWA 4OZXA 2WWJA 1XE8A 2Q0AA 1G9CA 5C5UA 2XDVA 3MV11 4I01A 5IT6A 2NMOA 5EJ1B 4EN6B 2NPIA 2ILMA 1B35A 5FZ1A 1UF2C 3HN3A 1US2A 2W0XA 3IM0A 1MS1A 4COUA 2B9UA 1WCDJ 1S2EA 4LO7A 1JYXA 4YW3A 2GSYA 1W9WA 3POWA 5IAXA 1POV0 4YRDA 1YXWA 2BBAA 2XWJB 1BXHA 3HEIA 3LKJA 3LF7A 2WN3A 1OPOA 3ALQA 3GHMA 3UGGA 1O3SA 5A3TA 3KV4A 1RITA 1ZBE2 2R041 2WNVA 1S2KA 4FXKB 3ILNA 1PO13 1YFWA 1RYYA 2DU0A 4LIVA 4XMIA 5DABA 3WNPA 1W04A 2ET1A 2ZOEB 3B93A 4OMDA 4QPIC 4QWNA 4AYUA 2VNOA 4P5YA 4EN9B 4LJHA 5F1RA 4Q26A 4MG2A 2CYFA 2RMU3 4CUGA 3VBHB 2D6NA 4H3WA 1WD3A 2QBXA 1CJDA 1CAUB 2V4AA 3ATGA 5D1IA 5FUPA 1VBC3 2IWGB 1U5IA 4CDWA 3SHRA 1TG7A 4XZUG 1LODA 3JD73 5KXEA 1AR92 3I3DA 1W2TA 1QJEA 3AFGA 5C71A 3ACIA 4YPJA 4XJZA 5A32A 3K3OA 3UKTA 4L97A 2PA7A 3N9QA 4P08A 1EAH2 2EF6A 5FPAA 3QH6A 5JAXA 2WFF3 3AFKA 4D6SA 3FWEA 3FFQA 2D6LX 4FCAA 2W46A 1WW7A 5F3EA 1HRV3 1VAKA 2GNMA 4W6YA 4KU8A 1ZBA1 2CY6A 4IEPA 2B9VA 3VBFB 3WQ7A 4EN0A 2A6VA 3I8TA 3WXPA 2PAMA 1EPZA 1SDDB 2XONA 2CGOA 3AP9A 2ID4A 3KT7A 3O1TA 4HZFA 2E7QA 2BV4A 3JB4C 4ARXA 1ZZ9A 2C0ZA 1UYPA 1YIPA 1V6LA 2J1TA 3C7FA 5DDJ1 5AC91 5EQUA 2GU9A 2ZX0A 5C9AB 1G8WA 1I1EA 1KGYA 1O59A 2RS32 1LOGA 4H55A 4K20A 1EUTA 2QZ3A 2VU9A 4Q4W3 3WY6A 3ZXEA 2VZUA 2JDNA 5FUNA 3MV01 4P9YA 4YM1A 5FY7A 1EV12 1VR3A 2VXJA 4KWJA 3INAA 1W05A 2XVGA 2ZGPA 2HWB3 1J84A 5FREA 1JW6A 4BLJA 1DYKA 1HB2A 4NAMA 1RUH2 2MNGA 2PHXA 3H1YA 5H9QA 5FOJB 3UNPA 4ITCA 5IK7A 5FYSA 4CTEA 2CAVA 2YMZA 1XNCA 4K6BA 3WEZA 5JOYA 4LR4A 3A22A 1LOCA 4UYBA 4KG8A 1CX1A 2HKXA 4JKKA 5LRSA 1JU3A 2VH9A 4HSLA 1QMJA 3E5QA 4IEWA 3WV6A 3GALA 2HWC1 1W8ZA 1V00A 5FZ9A 3DPRA 4LHKA 4R9BA 5CZKA 4CDUA 1AR73 1NE6A 3FUOA 3T0DA 1NCRC 4MOAA 3NNMA 2PLV2 1S0FA 3WP3A 1SLLA 3BOPA 3ZXLA 1PM4A 5FZLA 4AW7A 1VBA1 4QHOA 1ND2A 1QXPA 5FWEA 4AEDC 1OMIA 3CJXA 3RSJA 4YZ5A 1JZ4A 2OX0A 2ZEXA 1J1TA 2AUYA 5DN2A 2BWAA 4E4ZA 5I0RA 4MGKE 3M2MA 3I2KA 3H8OA 3T1LA 2XVKA 2G1MA 2F4PA 3MYXA 5LEKA 3O1PA 5JVVA 2W68A 3AVSA 1ZYBA 1DQ2A 2XJPA 2WYSA 3NV1A 3CZUA 1SFPA 3T2QA 4LO5B 2NLRA 1NY72 3KQRA 4XW3A 3LA3A 4UFLA 3ZR5A 2VVFA 2CHHA 4XQWA 4XF4A 3VZKA 1YQ2A 4UBHA 1R1A3 1I6XA 3X29B 3GJBA 1ZRCA 4QXHA 2ZTNA 5FY0A 1LHUA 1JYTA 2Y6KA 2ATFA 4FPGA 1X9TA 5EWSA 4PBOA 1V9U1 2A3XA 1CZTA 4EZ4A 2R6QA 4ZHNA 3H3UA 1J1LA 2DF7A 5IVVA 2YPJA 4KWKA 1PGSA 4XFAA 4D7SA 5EV7A 4WM8B 5FPVA 5J3UA 2OZ6A 2DWRA 1W6OB 1W8UA 2C1FA 2JDKA 4K7JA 5LRRA 4B8EA 3WG3A 1U5YA 1NA1A 5FBJA 3VDDC 4E9KA 2VVDA 1B35C 1KJRA 1POQA 2HWE1 1BHGA 2K2SA 4V2VA 4AGRA 5FZIA 4GKXA 4K8RB 4IUGA 2R043 1UZWA 3C7HA 4E2GA 2P6HA 4B4PA 2VUAA 1FXZA 1RC6A 1M06G 2CDPA 4MH0E 2WJSA 1QOSA 1BVVA 3B9IA 3CKHA 4L8QA 5CKQA 3RZJA 4JGZC 1UD1A 1KXGA 3DKWA 4TLGA 4DY5A 4XFGA 2H6BA 3JQWA 4DFSA 4HLTA 2D40A 1ZRRA 3I3EA 5LK5A 5JCTA 5ANNA 3VBFA 3WNXA 4AEJA 1IPJA 4NIAA 2R0FA 3SH3A 2MEV2 5GZEA 2IUWA 1GZWB 1VBD1 4I3GA 4XVHA 4CDWC 1MEC2 2R7EB 1AJOA 3ZYJB 4XF1A 4A7KA 1QOOA 4OHYA 2VNGA 4IEYA 4RGAA 3NV2A 4EQVA 1W6QB 1LKNA 2VMCA 1MS5A 4PDWB 1UPSA 3UT0A 3IAPA 3OF1A 1MR5A 3WW1A 1XE7A 4N53B 4SLIA 3ZXAC 1OOPB 1ZBA3 1V6JA 2HWD1 4EZHA 3KT1A 4XE9A 5C9AA 1JOPA 2P6CA 1CZVA 4GJYA 1AZDA 4R9AA 1LHOA 5DZFA 3GNEA 3O12A 1ASJ2 2HWF1 2VMDA 4IE5A 1JUHA 4GH4B 1RUI1 3VBOC 5C3RA 3CJIC 1ODMA 1PVC1 2D3PA 4LEJA 5I0TA 3IDCB 4RQPB 4CP9A 3GBFA 2WZR1 4Y24A 4XABA 2BGPA 4H7MA 3ACHA 3E6BA 5DDJ3 4CCNA 2LW8A 5AC93 3IPVB 1KRIA 1REDA 5C3OA 3LWCA 1EY2A 3HN1A 1VMJA 3BKZA 4MGYE 4AFAA 4W8JA 1VRBA 5L36A 1JYCA 2C5DA 2P5BA 4LHLA 1U12A 3THTA 3DXTA 1XNDA 2D44A 1T6GC 2NZ9A 4H2AA 3OSDA 3IWZA 1QJY1 4QGMA 1DGRA 3O0XA 1XU1A 1GR3A 1YI9A 2IXCA 3POGA 3H9AA 5C8CB 1US3A 1RUF1 3L9JT 1OHFA 4QGLA 4Q0UA 3WF4A 4Q1RA 3FJSA 3AYDA 5CADA 4AVAA 2BFUL 3BGAA 3J7LA 3B69A 2Q1FA 3BPZA 5DAPA 4BA6A 4EROA 1LGCA 2HWC3 2ZHLA 3PVEA 5LWBA 4JQTA 3DGTA 2PQSA 4AAXA 3IT8A 5KC6A 2BERA 5FZFA 3RJ2X 3T1MA 3VL8A 1MZ5A 1KITA 2FCVA 4Z2WA 2L9LA 1JZ2A 1O6UA 3DF0A 3R6SA 1VBA3 5LCWL 1ULEA 3NKGA 3DPRC 3E5XA 1OLMA 2ET7A 1OUSA 5CNAA 4Q0QA 5FZ7A 5FJKA 4YW5A 3VBUB 4MGZE 5A7PA 2E51A 3P1IA 4KU7A 4BXFA 5JMOA 1BK0A 4I09A 1DF0A 5CU1A 1H6YA 5FO8B 4YW4A 1GNHA 5T5LA 2Q8CA 1TNFA 1VRH2 2V72A 1F5FA 4GJZA 2XLAA 4P9LA 1REEA 5D8AC 2PAEA 2W3JA 3J8F2 4XAAA 5FZAA 1W8NA 2XXZA 4AI9A 1R092 4WM8A 4CEYB 2E53A 1W6OA 2PFWA 2VE1A 2WL1A 1UZZA 4B1MA 1X82A 1KD7A 5HPOA 2OT7A 2V73A 3N7MA 4M0HA 1H30A 4UAPA 3VHOA 4D8MA 2IXIA 4N43B 1V9U3 3POIA 3AYCA 5LBEA 4MYEA 1PIV1 1XU2A 4LBMA 4Z07A 3GBWA 5B2GB 1S2BA 4CPBD 4YLZA 4M4PA 3HPNA 5FYBA 2DCTA 4EWDA 1W06A 2X29A 1VE0A 5GALA 2BDRA 4RL7A 2Q8EA 3I2DA 4YW1A 4CEWB 1PO21 2HH9A 2RHPA 4AAPA 4RFRB 3J7HA 2ZHKA 3JBG3 2DUQA 1K42A 2ES3A 2HWE3 4XBLA 3ZVXA 5I8YA 1MS4A 1HQNA 4RS5B 2D98A 1JYNA 5E6HA 1VALA 3UYJA 1ZZCA 5T52A 2KD7A 2GP5A 1NA1C 2JDYA 2HBUA 3PVBB 4NOTA 2E33A 5C33A 3IN9A 2XHNA 4LQRA 2RVAA 2F4LA 1GZWA 1CAVB 1ZZ8A 4BH9A 2DUPA 4EN7B 4PHZA 4YZ4A 4C91A 5DZEA 2PELA 4UOJA 2IZWA 1W6QA 2OYZA 3GDBA 1HB3A 3K2OA 2GC3A 5EFUA 3SCHA 5A3MA 1ZBE1 2ZPXA 4YW7A 3FX3A 2QQOA 4N53A 1XPWA 3U07A 2YUEA 1WMXA 3B02A 2DVBA 2WSUA 3WW2A 2DCJA 4Z82A 3RZZA 1UN1A 5KXCA 4CYDA 3LEKA 1KDMA 4IE0A 3AL6A 4I02A 4ORFA 1VBD3 2WYFA 2Y64A 3UK9A 4C1XA 2W94A 2W52A 3NAPB 1FOD2 3MW3A 4FPJA 4GH4A 4W6WA 5L7OA 4XFFA 1UL9A 5GLVA 2BFUS 1JOJA 4P9XA 4P9GA 4XDPA 3S7IA 4RQPA 3H42B 5I8SA 4YSFA 4QX7A 1J3QA 1XYOA 2NP0A 5JIAA 2HWD3 4DB5A 2ZABA 3ZXJA 4IV1B 1R082 2VMHA 3LQCA 2RS52 2CWMA 3TRSB 5DQ0A 2HWF3 3PTYA 4DZGA 1OF3A 4M0NA 4QPGA 1EAH1 3ZOIA 4JHZA 5F3CA 2CAUA 3RYPA 1RUI3 1AYN2 1A8MA 1V6IA 2RDNA 2RDRA 5H9SA 2BW8A 3ZFFC 4BQ1A 2XPJA 1H8TB 1RUG2 1PVC3 3MBWA 1SZBA 2W1QA 2WZR3 2NM1A 1XE0A 2WS92 2VTFA 4MX3A 3CO2A 1FX5A 1DDLA 1S0IA 1X33A 4FO9A 1YI7A 4OHVA 4JCKA 1VAMA 1JN2P 3AC0A 4F8AA 1AX0A 3FLRA 5C8CA 4DXTA 4FPLA 5DPNA 3BU0A 3CLPA 2H6CA 1WA6X 4LMFA 2XGXA 3FHAA 2AYHA 2AR6A 3MUY1 5F3GA 2DURA 3IZOA 3AL5A 4QB1A 1QKQA 4RN5A 4H14A 4FAHA 3LOBA 1QJY3 2JDHA 3VBRB 3OGVA 5L19A 3AB0A 5FZ0A 5CFCC 2WRAA 2JENA 3M3QA 4JRLA 2JE8A 3ZYFA 1RUF3 3VHRA 4BU2A 4CA9A 2ORXA 2PHWA 3PL0A 4HL0A 1F4AA 5ACA2 4YM0A 3H50A 2LALA 4FFIA 3VBUA 3ZDVA 1RUH1 1PMIA 4QX0A 3P3NA 4YWAA 4QX5A 1JZ6A 4QX3A 1NZIA 3GJAA 4AXOA 5AVAA 1XOYA 1LU1A 2VBPA 3VKNA 5FZOB 4YM3A 5L9BA 3V64A 1YQ6A 2VZ3A 3I2IA 5HV4A 3EMRA 5FP3A 2AC1A 4BMBA 2QQLA 4A7ZA 4E8CA 2FD8A 3F95A 2A75A 1UU4A 2XJTA 1VBB2 5EXOA 3RJRA 1AR82 4CEYA 3SITA 1PX4A 4CCMA 1LHWA 3OJBA 4CCLA 3NSTA 1PHMA 3PMEA 1IKQA 2OPWA 4N43A 4XJWA 1Y43B 3EXUA 4AOCA 3IMNA 3M1HA 1C57A 3AM2A 4F7ZA 2XQRA 2R49A 1O4YA 2XUMA 4GALA 4L99A 3I7DA 2XKOA 3D5OA 3H7JA 3KZ4C 1MACA 4IDZA 3VL9A 4DXRA 4Z2AA 1QJU2 3PJQA 2QQMA 2XJUA 1HX6A 1NXD1 3N35A 4CEWA 1OLME 1OA2A 4PF1A 5GJ6A 4DIQA 2BVBA 3UESA 3WSOA 2GAUA 1ZM1A 4LO8A 5FMCA 4BXSV 3VBSB 4K1ZA 1PIV3 3K4AA 4KGQA 4RS5A 2OW4A 2ZMKA 1HXS1 2JE9A 3SEPA 3O1SA 3RWNA 1QJFA 1H1MA 3O1VA 4W65A 4LT5A 1DQ6A 1RJ7A 1X36A 3B00A 1PVXA 1LOFC 2ZZJA 2CTVA 3RPQA 5K8SA 1CAVA 1Q3EA 4YVWC 3UGFA 1PO23 1UX6A 1XSQA 2ENRA 2O14A 1RUJ2 3POSA 4A42A 2D3RA 4WVMA 2ARAA 3TNPB 4IESA 2VVEA 3JZVA 2P1BA 4WM7B 3HNBM 1LGBA 3OG2A 4Y3OA 3WP6A 4ET7A 5FFOC 1Y9GA 4UFMA 1JMUB 1UOFA 1UXZA 3OPTA 1WMDA 4NROA 2YU2A 1SCRA 4QM9A 4NUBA 1E5SA 2ADEA 4U36A 1J3RA 3BB6A 3KMHA 1HN0A 4NR1A 1OI6A 4A6OA 4M3CF 4AEKA 3ELNA 4EN8B 3NAPA 1YYNA 3PUQA 4P9WA 5DXDA 1UOJA 4IQPA 1FNYA 1COV2 1S4CA 1WZXA 3FLTA 4S2GA 3SMHA 3O14A 5E88A 3BIWE 2WNUB 4HKLA 4GWNA 1ZBE3 5CKMA 3VDAA 1BCXA 5LZ6A 3S6PA 4OI4A 1JHJA 1CIYA 2UU8A 2ZX4A 3OYWA 2WUHA 3LE0A 1XSRA 4IV1A 3WNNA 5FYTA 3KT4A 4AEMA 4CCDA 5M0TA 3PU8A 5I91A 5J7MA 3ITQA 2JECA 5CEHA 5IVBA 1C8M1 3FZ3A 5BNPB 4PI0A 4YARA 5A3NA 2WT0A 1E5IA 1C28A 2YYOA 4AVBA 3T2TA 4AHZA 1BQPA 3OD4A 2RJKA 4B7EA 4FVVA 2B8MA 1K5JA 3HD8B 3ZSEA 3QD6A 1OQ1A 4XYXA 3MLKA 4AHXA 1LRHA 5L7OC 2MEV1 3THDA 4FI9A 5D21A 3I54A 1MEC1 4Y20B 1JOBA 3H8RA 1EAH3 4Y1XA 2ZX2A 1H2LA 4FTBA 3ZFEB 1GOFA 4IE6A 3C3VA 4BPZA 5JOZA 2BNMA 2J42A 4I30A 4M00A 1W6MB 2Y6GA 3R0RA 3FN9A 4N9IA 4XJ8A 5TSWA 3S30A 3VZJA 2Q8OA 5T5JA 2DBNA 4Y1YA 1FI2A 4L92A 4QPGC 1NLRA 3I49A 1GP6A 1VJ2A 1EYBA 1P8JA 1AL21 3SH4A 5A7SA 5HV0A 5IVEA 3KV9A 3WX5A 1GBGA 3PIGA 2VG9A 1SPPB 1BBT2 3VDCA 2ZKLA 5A7OA 5K0UA 5GZGA 1MZ6A 2Y8KA 2FCUA 4QM8A 1Q56A 2JWPA 1HRI2 2W92A 4LBOA 5CBLA 1W8TA 1WLDA 4GB32 2JB8A 1C3HA 3GCXA 4UI9L 5FZOA 1ZZBA 1MVQA 2ORZA 3N7KA 1GSLA 4Q0SA 1HW5A 3AMHA 4ATEA 1UZ0A 3NKTA 3ORJA 1KQRA 1ND3C 3OGRA 4FXGB 4KH9A 5FO7B 2DCYA 3SNMA 2E7TA 5C5TA 3ZYRA 1QU0A 4OHWA 4ZS3A 2AZ5A 3OPZA 5EPAA 4BHPA 1G6NA 2Z5WA 2R071 1H4HA 4PIXA 2A3YA 2MHFA 1CN1A 5F7UA 1QJX1 4TTGA 1YHFA 3D6EA 2WR9A 3ZSKA 2D6KA 3FE5A 4Q4Y2 5CIRA 2Z79A 1WGPA 1O5LA 5C3QA 3U78A 3MHZA 3LIGA 1W03A 3BI3A 3EQEA 2NQYA 4XPVA 3GZUC 4V2WA 4UW5A 5BNOB 2FCTA 3S0MA 1H1AA 2GH8A 2JDAA 2I2SA 2ARXA 5A70A 2BZDA 3WG4A 5FV3A 2XH6A 3K51A 2ZJCA 3SCGA 2GZWA 4Q4V2 5FTTC 3ZFGA 2A70A 2VZOA 4QQOA 4CDQC 1UY4A 1SFNA 2UY8A 5F2SA 3PTRB 1TNRA 4JVAA 5FMDA 3TN92 5LA0A 4FPKA 3RI9A 2VZRA 2QZ2A 4INDA 1RHI2 4AQTA 2OPKA 3BTXA 3DECA 4C90A 1GQPA 1H0BA 3IMMA 2VBDA 4WBBA 1RVF1 3VD3A 5JOXA 4M3CB 2D6OX 4D7YA 2WN2A 3WT3A 4XQ4A 3ZX7A 2DDUA 3AKSA 3O1MA 4DRRA 4A7YA 1V0AA 5ABJC 3RMYA 4LKFA 4LKSA 3C2UA 2VW1A 4WM7A 1HXS3 2ADDA 3DL3A 4UF0B 3J8F1 3NNJA 4RHV2 5KHKA 1GFF2 2IFWA 5GLZA 2A6ZA 4JKLA 1R091 1RXFA 3OGSA 5FP4A 4BQ2A 3ZYBA 2YV8A 4DUVA 4LBLA 4A45A 4OI1A 1DQ0A 5JZGB 4UW4A 4DXZA 3B5LB 2JDMA 2VZSA 1AXKA 1X50A 1E5RA 2WNUA 4P14A 4JX0A 5KBFA 2XJVA 2GC1A 4ZZ5A 1K5MB 4XFIA 3KHCA 1Q8QA 3ACFA 3H8XA 1E57A 2UYBA 2BTVC 4QB2A 4ZPIA 5BNPA 1ENRA 4XURA 3W9AA 4QD2A 4XHBA 4FTSA 4CDXB 3AKPA 4E2QA 4MADA 3AP4A 2D6MA 1VBE2 2JDUA 4Y5TA 2JICA 2WLQA 4QQHA 2HYXA 1GMMA 4D94A 4Y5Z0 3ZN6B 1UMHA 1PX3A 5FPBA 1G9FA 5FYMA 2FMDA 3C7OA 4PT6A 1WLWA 4Y20A 1C8M3 4EE2A 1C5HA 3AXEA 3T3YA 3KHBA 3CNAA 1RUD1 1IZ3A 4JKMA 3ZFEA 2TBVA 1WLCA 2X10A 1K3IA 3OEAA 4OMCA 2WA3A 5C7GA 1W6MA 5JXGA 4ONUA 4CU9A 4QX2A 2CDOA 2DUOA 5FLHA 5T5PA 2Y0IA 2FDJA 3I3QA 5GZDA 3IAQA 4LHSA 1DYPA 1D7PM 4CSWA 3AMQA 3PIJA 4P00B 4NRQA 3ECQA 2MEV3 1W8FA 4QX1A 3V0BB 3FHIB 3M3EA 1MEC3 1FOD1 3O1OA 3CHXA 4TN7A 1DU3D 1SPPA 3IKWA 3OTFA 5FYCA 5A6ZA 3WNOA 3ACLA 3O1RA 3OB8A 4GULA 5EIYB 1UKGA 2JE7A 1QXJA 3PUSA 4OZOA 5BY5A 4R9DA 1R081 4LBKA 1CX4A 4TYSA 1OVPA 2YXSA 1W6PB 2W87A 2JX9A 4IE7A 4NN0A 1O91A 1AL23 4CP1A 4Y26A 5I0DA 5EHDA 1CWPA 4Q4X2 4RGGA 4LPLA 1AYN1 1FMD1 3D82A 2C9AA 2JDZA 4J6GA 1RUE2 4LHNA 4DQAA 1RUG1 1HDKA 1W9FA 3TYJA 2QQPA 3Q8CA 3JB8A 1DZQA 4YNIA 4I3PA 3ZYGA 1WCQA 3M3IA 2DCKA 1D0HA 3Q9OA 4MGQA 1S0BA 4QU1A 4XQDA 4XTMA 3C8XA 4ZY9A 1RINA 2J7MA 1UAIA 3WNMA 3HOBA 1PMHX 3CMGA 4DPNA 5K0UC 4DUWA 5AVPA 2O8OA 3IIIA 2ZMNA 1NUKA 3HQUA 3MIEA 5BNNC 3G7DA 1N3PA 1RUNA 4MHUA 4LE3A 1VIWB 2R073 2YC4A 3N4MA 4NIDA 1QJX3 1URXA 1QXRA 5LBBA 1UNBA 3OCPA 5J48A 1XC6A 4FQZA 2ZHNA 4J1WA 5FZ3A 3ZN5A 4YFZA 3KV5A 5CISA 2CL2A 1QIQA 2XJSA 3WCRA 5F5CA 4MO3M 4ZU4A 5ACA1 5DAXA 3DCQA 4MSVA 5H9PA 4M3CA 1GUIA 2JG8B 2XLGA 1DLCA 5FQ0B 3ENRA 2XQXA 3VLBB 3WNLA 2RM22 3DYMA 3M70A 1JUIA 5IVFA 3VBHA 4DS0A 1VB2A 3V0AB 4UF0A 2BGCA 2VMEA 3BU7A 1CAUA 3ZFGC 3C7GA 3NW4A 1H9WA 4EV0A 2Y6HA 3JD72 1VBB1 1RVF3 1AR81 2R062 1ZZ6A 2FDFA 2WWSA 4X8NA 5JSPA 1WW4A 2I74A 1A78A 2VD7A 4G4FA 4BIFA 2CWSA 3ILRA 5KR7A 4O9EA 3N3HA 2VOVA 3W21A 1W9TA 2TNFA 3SQOA 3I59B 1A34A 4YG6A 4QKDA 1PM7A 2G19A 3FFZA 2WFF2 4Y1VA 1SCSA 1W8HA 2IVIB 3K46A 3WHUA 1NOVA 1OA4A 3P6BA 2WNVC 4HK9A 4IV3B 2GMMA 2JG9B 3J8F3 4MXWB 1IGOA 1R093 4EJRA 2YDEA 1QJU1 1DZRA 2QVSB 1K5MA 3FUQA 4GKYA 2ARBA 3N9PA 4IEQA 4QMAA 4U2AA 5A3WA 2WZEA 4TZDA 1KS4A 5FP7A 4AVTA 4OHZA 4FFFA 1O8PA 3KCCA 3U1XA 4EWEA 3H3LA 2K46A 4MLOA 1UOGA 2EIDA 3K3NA 4QKNA 2EALA 5JI7A 4CDXA 5JIUA 1CGPA 1MQTB 5JSRA 4X6QB 3CZJA 1AL0G 4HKOA 4Q1PA 4Y33A 2ZGMA 3MDPA 3OOXA 4LBQB 1O7FA 3AKQA 4OI2A 1TME2 2ZEZA 3BODA 4Q27A 4GWIA 4LE4A 4LULA 4PQQA 3N9OA 2K9ZA 1RUJ1 2OQ6A 3S57A 2ZX3A 5A3LA 3PVOA 1H9PA 2ZGLA 5GLTA 5CG9A 5J98B 5ISLA 4JDNA 1CR7A 2BNNA 5LASA 4JAAA 1VLNA 1DGLA 4YVSB 1ZVFA 4I2OA 3HAGA 3BYWA 5F5QA 4XF0A 3T4VA 2EXKA 3WF1A 4AVSA 4FPFA 1WKYA 1PK6B 4A44A 1O3QA 4RR3B 4BB3A 3K48A 1KDKA 2D6PA 1YQ5A 2W91A 3I97A 1O3RA 5L73A 1RUD3 3AKTA 1OQDA 2D97A 5K7PA 2Y33A 2QNKA 2YBSA 1NQDA 1WCSA 1YNAA 2RJ2A 4HFSA 4CU8A 2UY9A 2GP3A 4K40A 1GZCA 3C7EA 3N9LA 1F15A 2VL4A 4JGYB 3VHNA 5SV5A 1ZX5A 2ZACA 2VY0A 3GXUA 1AR72 4Q8LA 3AZVA 5FZEA 4E4DX 5A3UA 1IS5A 1W6PA 2B39A 3A7QA 4KNCA 4DO0A 1UX7A 1PGL1 2A6XA 3OGGA 4XBNA 3TNQA 4LA3A 1OD5A 1FOD3 2VO5A 4WZFA 1U5ZA 5E16A 4BM8A 1WW6A 3ON7A 1NXMA 3PNAA 4LO4B 3ZM8A 2F6BA 5EP9A 4DNYA 2D7FA 2P34A 4B1LA 4S2FA 4FPYA 5FY9A 1LOBA 1Y7BA 1DP0A 1R083 2BPA2 4J25A 4COVA 5FZ4A 4ZZ8A 3ZMOA 2Q4SA 2VULA 1NKGA 4QQLA 3RQ0A 1TVGA 1AYN3 1FMD3 4AQSA 1R1A2 5IW0A 4AVVA 1RUG3 4K21A 3B94A 5FKCA 3UKNA 1QEXA 3MFCA 2JD4A 2PTMA 3KLSA 3IIAA 2UURA 4IETA 1ULPA 2O0OA 3EB7A 2OVUA 1UYZA 4XCBA 3RS6A 4CDUC 5HCFA 3M7AA 3SEEA 1K12A 1J83A 2VZTA 4UT5A 1ZRIA 1W39A 4XTPA 5FY4A 1VMFA 2YG0A 4XDOA 3WW4A 1XRUA 3AXDA 4ZU5A 3MW2A 1ND2C 4I0WB 3ROUA 3WW3A 5LK7B 2PHFA 1HB1A 1RGSA 2X5IB 4D0QA 1V6NA 2X53S 2PN5A 1QNWA 5KHJA 2QTWB 1HRI1 2AEYA 1UMZA 5FQ0A 1V6OA 4GB31 3DEMA 2E6VA 3T09A 5F39A 5C4WB 3KV6A 2DYCA 2CV6A 3A23A 2J1SA 4OUMA 4AI0A 1HKDA 1GZTA 2ZXQA 5FXVA 3FL7A 1OA3A 2WDBA 4KL1A 4Y1UA 5ACA3 4JZRA 3WD5A 3UKVA 4CVUA 1UQXA 1H6XA 3ZN4A 2W95A 3WF0A 4BIOA 1W0NA 4LUMA 2BWCA 1GNYA 1GWMA 1F4HA 1QH7A 3LSDA 1DCSA 4JV4A 2W08A 3BTYA 4Q4Y1 1L7LA 4AFBA 4XOGA 2EXIA 4ZKTB 2YROA 3W20A 4AQ2A 4NO4A 3R4SA 4BMEA 2EA7A 2JG9A 2OQ7A 1JTZX 1LULA 1UYXA 3G6JB 2HEVF 4FFGA 4FOQA 3ZIWA 5A3PA 5KC5A 1VBB3 1BMV2 1AR83 3IB3A 3I3MA 2SLIA 2Q5TA 4KGGA 2HEYF 1GU3A 4Q4V1 4CCKA 5JXJA 1OFNA 3NL1A 3TEZA 2JEMA 3VBHC 1QY4A 4QPIB 5LY2A 3TEXA 5C6CA 5JI9A 2PHLA 4M3CE 3U11A 4NHKA 2OKXA 1LESA 2PQQA 2GC0A 2YBKA 1RHI1 2VNRA 3B9CA 2Q8DA 3USUB 1BLZA 1LNSA 2VOXA 2XJRA 2YC2A 5L9VA 1SFYA 1POV1 4K8FA 5JR7B 2R1DA 2WAAA 4LNVA 5FOBB 1JYIA 2E26A 3EO6A 1H2KA 1FT9A 1QJU3 1IPKA 3JXSA 3EBRA 4LBQA 4PDWA 1GQHA 1CONA 2JIGA 4C0HA 3MW4A 1JZ3A 2A1XA 1OOPA 4YGCA 1U0AA 3F2ZA 4XC9A 2E9QA 3K4DA 4MZUA 4NHXA 5DUVA 1LOEA 3D3AA 5DG2A 2RDSA 5GLUA 3ES1A 1SDWA 3DV8A 5A6QA 4WZCA 3P3PA 5IVJA 4RHV1 2ZKNA 1DHKB 1EPWA 4YVSA 3MLLA 4XACA 3KSCA 4BQWA 2WQ8A 5DDJ2 4KBBA 3VBFC 5AC92 3GCWA 4XAEA 3HJRA 4HPKB 3QLQA 3UETA 1LU2A 1PK6A 3QACA 1SLTA 4RR3A 5C4WA 4FOWA 3OUHA 1AR91 2BRTA 3IPVA 4UFKA 1I5PA 1XNTA 5FZDA 1RUJ3 3PMSA 3AMMA 1H8VA 3JU9A 1BKZA 1NLQA 5CYYA 5FYHA 1S0EA 3H7YA 5APAA 5JR2A 1XNKA 4GQ7A 4PLNA 4NE9A 4IEZA 2J1RA 4JGYA 1XQNA 3I2OA 1B09A 2G9GA 1QF3A 2FQPA 2DTWA 3RDIA 4B7KA 5C9AC 1CZSA 2CSGA 4K9SA 1IKPA 3SKJE 4BJ0A 3RZGA 3B7MA 1DQ1A 4LORA 2YGLA 1WA4A 3H1MA 2DFCA 2J1VA 4OYUA 4XJAA 1CQ9A 5FY8A 2LRPA 1VBE1 3NO8A 3WDTA 5FXZA 2VCMA 4RA0A 1FATA 4QU2A 1OURA 3A0KA 5FP8A 3AJZA 4G3YC 4NWWA 4DINB 4ES8A 3PLQA 2D93A 4XJ9A 5FK7A 1AR62 4N90A 5FMOL 2WC2A 4P5HA 4D6RA 3W58A 2RS31 1VBA2 3DUIA 3KD4A 2A5ZA 3MFAA 1EV11 3H8UA 5A6XA 3QBQA 3KF5A 2C6SA 2P17A 5HBAA 3RI8A 4LLOA 1OH4A 3OY8B 4I0BA 1ULFA 1GOHA 1J3PA 1LHVA 2VZ1A 2IXHA 3HBZA 5GKAC 4L11A 2VUJA 2C24A 1JI6A 3LEMA 4QDQA 4Q8KA 1NCRB 2BBVA 2X09A 2J1AA 2X5IA 1RUC2 1UIJA 1LB2A 2GH2A 1S0GA 5LB6A 1G86A 2DCZA 2CU5A 4EYUA 2C9KA 4AEDB 2WSVA 2GNDA 1OPMA 2WKKA 3HVDA 4FQ4A 1W2AX 2WINB 5A7NA 1STMA 3IDEA 1WUVA 1W2UA 2DBIA 5F5AA 1DIWA 1GOGA 1V9U2 4FT8A 4BK5A 4X8PA 1WCKA 3ZO0B 3ZSJA 3WF3A 3HT1A 1YRZA 5SV8A 2AEZA 1FAYA 3ES4A 5DG1A 1HIXA 4Q4X1 1O4ZA 5JMCA 2PLV1 1UY3A 2ZA9A 3CBNA 2J1EA 2W2IA 2BU9A 3FC0A 3N7LA 2G9FA 2ZEWA 2WO3A 5T55A 4Y4YA 4D6QA 3QOPA 1Y9QA 1HRI3 4MV2A 4W4ZA 3RWKX 4GB33 3UJQA 4QB6A 1PZ8A 2Z69A 3JBG2 4J1XA 3LDBA 5A1LA 3R4UA 2JD9A 1RMU2 1Z7S2 3ZIXA 5KHIA 1HJGA 1FYUA 2J1UA 2Q1ZB 4NIHA 1NY71 1PZ9A 4WM8C 4NAOA 1SACA 1FV2A 4R4XA 2H0BA 1YQCA 1QDCA 4LK6A 3TB0A 3KWVA 2IXLA 4DXSA 1DYOA 1W2NA 1SEFA 2Q1MA 2UWCA 3Q8BA 1DGRN 1YJKA 1SQ4A 2WIIB 4Q4Y3 1YFUA 2PHRA 3VD5A 4CCCA 2R16A 3VDDB 3WP4A 1VB4A 1W6NB 2AACA 3A0NA 3GZAA 3LFIA 5FYYA 1RUOA 2VQTA 1OQEA 3GF6A 5F6LB 2QDRA 5C8WA 4Q4V3 2NN8A 5B4XA 4M01A 3WCSA 3POBA 4P02B 1SLAA 2JJ6A 3T30A 1J58A 4AF9A 4Y5SA 5FXWA 4BWOA 2P3IA 4LUKA 1Q8VA 2RM21 4FTEA 1QQP2 4GMP1 4AQ6A 1RHI3 2VTXA 1DGWA 1M4WA 3MLJA 4I0AA 2UYAA 1POV3 2HWD2 2R061 4JGZB 4HPKA 2OUHA 3LDKA 4YFWA 4OFGA 1QH6A 3EYPA 1YFXA 3MUZ1 3OBRA 5FMOS 5FZ6A 4HN0A 3THPA 2PAKA 1XBFA 2YGMA 1NCQB 2BQPA 1TMF2 3TOJA 5JUVA 5F2WA 2VM9A 1RUI2 2VGDA 1F2NA 4YGBA 4PDWC 2QQJA 2KXLA 3VKFC 4RHV3 3U14A 4NRMA 4N53C 4DMIA 2WZR2 2FDGA 3WDVA 1OOPC 4QKBA 2G9ZA 2E7AA 2ZAHA 2ZAAA 1H8TA 2EAAA 4S2DA 4RYDA 2VTXJ 4NPRA 4HVOA 3AMPA 2A6WA 1AR93 3BOWA 1N1VA 5E8AA 3MIBA 4GH4C 1ACCA 4XUOA 2XL7A 2ZCWA 3BCWA 4BQYA 3T08A 1AYM2 2P4EA 2XKPA 3PURA 5IYYA 4JDMA 3LGRA 5FYVA 4B3NA 2LUWA 4DY3A 2ZGRA 4RQPC 4URAA 1PK6C 5CG8A 3BTAA 4R52A 1DGWX 2UWBA 5AFBA 4R8HA 1I9RA 3VBOB 1BJQA 2A6YA 3I2HA 3VN4A 4AWDA 3CJIB 3PJYA 2Y6LA 2PHTA 5F3IA 1N3OA 5DAVA 3JCIA 1ZREA 1TME1 1HQLA 2JDPA 2UWAA 2VQUA 4DOUA 3W5MA 2JKBA 2FZ1A 4XIOA 3ZYPA 4CE8A 5C70A 3VBRA 2ETEA 4PF5A 5T54A 5F37A 1SG3A 2QCSB 1R64A 3NNGA 1ASJ1 1XXNA 2CGNA 2GNTA 1VBE3 4M4RA 1UO9A 4ASMB 1D4M2 1DG6A 5A6YA 5G04L 3OY8A 2ZGOA 1JU4A 3VZOA 3IDBB 5C8CC 4ASLA 2QQKA 3KCXA 4A2UA 4JTOA 2RS33 1SLIA 1ULDA 1UIKA 3HNYM 3SISA 4QX8A 3U37A 2GALA 3V65A 1WBFA 3RZLA 4BQ4A 5FXXA 4B4QA 4KI5M 2GMEA 2BOIA 1EV13 4FOYA 4OLLA 5F5IA 5J37A 4N9HA 3ZPOA 4NMIA 5CFDB 1WBLA 2AENA 3BPSA 3WQ1A 1RUH3 2BOJA 3A21A 1GYKA 4PBPA 1MZFA 2WAOA 3WP5A 5DZGA 4CCOA 2B4KA 3H0OA 4XMAA 5IFTA 3WDXA 1UMIA 2IXKA 1AXZA 5GM0A 4E27A 2DTYA 3LCPA 4LBNA 5JOWA 2XJQA 5CAZA 3KGZA 3VBUC 3S5AA 2BYVE 2DVAA 3U10A 1ALYA 1OH3A 2E31A 5FZKA 3DPRB 3E5UA 4Q0VA 3ILFA 2X5IC 3RZKA 2OUJA 1G7YA 4N7IA 4UBGA 5HXVA 3MIDA 3MPPG 4Q4X3 1C1FA 1GP4A 1NAEA 2D5FA 2OXBA 2PLV3 4PLOA 3RYRA 3VBSA 1F31A 1RXGA 4QGNA 4AGGA 4CEYC 2WFPA 5C4WC 2QDNA 3DXUA 3E97A 4UW6A 4XXAA 5D8AB 2NMNA 1W3VA 1NG0A 3UV9A 3CDZB 3NVCA 3PVNA 4N43C 5C3SA 5GLWA 3I4IA 4NHYA 2GC2A 4FSJA 2G4IA 1IQDC 1RL3A 3VDDA 4ISRA 4XETA 2YZ4A 3AX4A 1W6NA 3ETPA 1A8DA 1XJAA 1NQJA 5KWRA 2EXHA 4MUVA 1GZ9A 1VRH1 4XILA 1W99A 4XUTA 1Q43A 3RNSA 3EHKA 3OEBA 5F8PA 4IERA 1C1LA 5I93A 4JDOA 4CEWC 1CAWB 4YG0A 5KXDA 4HKWA 1EP0A 2ZS6B 3T4HB 4NVPA 5F9TA 2ZMLA 1Z78A 1TQ5A 1QJZA 4HETA 4JQRA 4OUEA 4RS5C 5D2AA 1AUYA 2ARCA 2Y60A 3N7JA 1WWYA 3R4DB 3VD9A 4QHBA 3K77A 4AI3A 2FHRA 4A3XA 4HSJA 4HK8A 4JGZA 4W6XA 5T3NA 4FBFA 3PHMA 4GIQA 3FMGA 3KF3A 1IG3A 3NQHA 4COZA 4OQ9A 2A71A 5FIXA 5FAXA 2B7YA 1NA1B 3LSEA 4FPHA 1NCQA 1Q8PA 1GKBA 4RGKA 4LOSA 3S5QA 4XEZA 3VZMA 2RM23 3MICA 3PUHA 1AXYA 5EYYA 1Y3TA 4GMP3 3NV4A 3UGHA 2QQUA 3M8LA 2VCBA 2OIIA 1CPNA 2HYKA 2R30A 3T0AA 2XBO2 1FPN2 1BMV1 2R063 3APBA 1YJLA 4BQ3A 5JXHA 4QT6A 2EICA 5A7QA 2Y26A 4NHMA 5AFEA 4MGTA 3NAPC 2RJLA 4LKDA 2HJIA 3AJYA 1LEMA 3DKQA 5FK8A 3M3OA 4LXLA 4UFHA 1UWWA 3SXWA 4OCTA 5HCHA 2Y6JA 5C3PA 2QQNA 2JXAA 2I07B 2Y6FA 3GZTB 1XNAA 3ZDSA 3VBOA 4BCUA 4IV1C 3CJIA 2PMWB 4GA9A 1YUDA 3ZLIA 5LBFA 1BEV2 2BUKA 4XFHA 5CA6A 1VAVA 2IC1A 2WO1A 3CU7A 1DZTA 2BNOA 1RTVA 4L0PA 3RZHA 2RS12 2ZX1A 2BP6A 2RR12 2YBPA 2XVLA 3RG0A 1I3HA 5BUVA 1H8TC 4AK3A 5CVRA 1WLTA 4L2NA 2CNAA 3LOIA 1VMHA 2VR4A 1JBCA 4QPYA 1YCIA 1W8OA 4N8MA 4DUXA 4LKEA 5JPNB 1ULCA 3P5BA 3ZFFB 1KS5A 4Y22B 3I2JA 1GLHA 3SC7X 1TME3 1DQ5A 5FZCA 4XBQA 4CU6A 1WCUA 5KHGA 4ZXKA 2WO2A 4GWMA 1UXXX 4CUAA 1O5UA 2WWUA 3O0WA 5FPXA 5HCAA 2RS51 4YW6A 1JS9A 1L7QA 2FZ2A 1Z0HA 4CXYA 1ASJ3 3KM5A 3RRDA 5E89A 4CP9B 1QOTA 5CFDA 4QDRA 2LROA 3VBRC 2H0VA 3NJXA 3ZYIB 2W5FA 4TSVA 3SLIA 2WS91 1OXCA 1OT5A 3W59A 5FKBA 1HLCA 1W3XA 3MI8A 2VZVA 5I0UA 3VKOA 1JYWA 5CFCB 2PHUA 4ASKA 2DVGA 4FPCA 3D4KA 4Z1VA 3NRUA 1S55A 4FPOB 1XYNA 4WVWA 4UXAA 3U4XA 3NNFA 1X8MA 5BNOA 5FDBA 3WDUA 4COYA 2RE9A 1BYHA 2VAUA 4MXVA 4GWJA 4XF9A 1LECA 1AR61 1OLRA 1SMVA 3WOGA 4MHRA 2DVDA 2FBEA 2Z4FA 2VC9A 1A3KA 2WT1A 4O9GA 4DEVA 5GZFA 2PYTA 1T2XA 4PIYA 2VBBA 2EIGA 4Q5OA 1C4RA 3GHNA 5F32A 4AVCA 4HG6B 4YM2A 5FLIA 1N3QA 5D8AA 1PO12 3POYA 4IGPA 4CUBA 3I3BA 3T2OA 4QKFA 3VD4A 1MZEA 3LFMA 1JXNA 3WG1A 1UZYA 4GD4A 5JPMB 5FZMA 2Z2SB 2DFBA 4R9CA 3WHTA 4CCJA 2FDHA 3USSA 3VKLA 4BK4A 2RMU2 3KQ4B 4URTA 2QKDA 1HXS2 1SBFA 2I45A 3HBKA 4XCAA 3QCWA 2XL9A 3VDBA 4FFHA 1RUC1 2P3JA 3MIGA 2HBTA 1VBC2 4A6SA 1D0GA 1HJFA 1HQWA 1UZVA 3AYAA 4JC1A 1RB8G 1GICA 4XIKA 3OGJA 4JHTA 1ZA7A 1CAWA 3AZXA 1APNA 3WG2A 1WMEA 3ZR6A 5LA9A 3VBSC 2VW0A 5I0SA 4XDQA 4K3UA 5JZGA 3ABZA 4NPMA 5DAWA 4QXCA 4QDSA 5IFPA 2B46X 1AF9A 1UU6A 3AP6A 3J9SA 5BNQA 1F8VA 1FV3A 4DRVA 3LEGA 2Q30A 1VRH3 2TUNA 3M4FA 4GMP0 4R4ZA 1F5JA 4KMQA 1YIFA 2K0GA 1HRV2 3BIEA 2VECA 3DYPA 1PGW2 4MGSA 1IS3A 3JBG1 1LJ7A 2DV9A 2YY1A 5BXXA 4C1WA 2V09A 4FP3A 3B3QE 4WM7C 1QHDA 3OUJA 4YVWB 1RMU1 1Z7S1 2C26A 2OZJA 1UW8A 2GN3A 3I2FA 3OPWA 2VJXA 1CPMA 2XLFA 4GXLA 1JZ5A 4YGDA 4Y4RA 3FHQA 2VZQA 3DYOA 2B45X 4CXXA 2YC0A 1H4GA 2ZGKA 4LA2A 4IGQA 4QXKA 3ZN6A 1C8M2 4AFDA 1Q8OA 2O1QA 3JQXA 4Q4W2 2YFZA 2A73B 1UY0A 2P37A 1CIWA 2WNUC 1ENSA 4RFT0 1S0DA 2CGPA 3NJYA 3VZLA 3MZHA 4A41A 2VUDA 4HOOA 1NCQC 1W90A 4AHYA 2HWB2 2QFEA 4IXLA 2AH2A 2JKXA 3WR0A 2VOTA 5FLJA 1F35A 1W9SA 5EYXA 5BNPC 5KHHA 4E8DA 3ASIA 1GV9A 1RIRA 4PCRA 1QQP1 5L9RA 3CEWA 3V0BA 3RVHA 1IG0A 1OKQA 2WQZC 4NHLA 4LO6B 4AI1A 1COV1 2LM3A 1UU5A 2QE3A 4D3WA 3ZFFA 4Y22A 5F6KA 1QWRA 2F17A 2GMPA 2VCCA 3VHPA 4B4RA 5LA1A 3AP7A 5LBCA 4A3ZA 4XUNA 4IW3A 1NZCA 1AL22 1ST8A 5FUIA 3O1UA 4W50A 1TMF1 5FYUA 2HLEA 3MEPA 1KJLA 3ZFEC 5FWJA 4UFIA 5L7OB 4ZU7A 1MPXA 4C8DA 4D7TA 3NMBA 3ZSMA 5KXBA 4WVZA 5IUQA 3GYDA 2XB6C 3ACGA 4HANA 3I2GA 1IS6A 2MPFA 3JUUA 1H1IA 4LBJA 4BQXA 4EWAA 1X8EA 1V6MA 5I8TA 1MS0A 1YLLA 1OKOA 3LZZA 2IFRA 3ETQA 4QPGB 4CP0A 1AYM1 4LBQD 5CFCA 1ZRFA 2RS53 3PU3A 4E4SA 1OUXA 2E32A 2SBAA 5FZBA 3TWIA 1HN1A 1D2SA 3FLPA 1PZ7A 1QDOA 3HQRA 2R072 5T50A 4CRQA 5LY1A 1FNZA 2A3WA 3OUIA 3U75A 1QJX2 1D4VB 1Q8SA 2IXJA 4GAZA 4NIIA 1YEWA 4AL9A 2EIEA 4IEOA 2WS93 4O61A 5B4NA 3DN7A 1AX1A 2QQIA 4IE4A 4B29A 5JSOA 2PXJA 5CKNA 4X6RB 4UFJA 5CFDC 1QNYA 3HT2A 3LIHA 4CP2A 5DUWA 1ND3B 1AJKA 1BBT1 1CAXB 1D4M1 1UY2A 4L9BA 4UW3A 5DUXA 3WUCA 3WNKA 3D0SA 1LR5A 2XMLA 3CF6E 2JG8A 1AR63 4Q2FA 3URFA 1SBDA 1O4TA 4IEVA 1DQ4A 1W0OA 2LTNA 5BNOC 1N1TA 2RDQA 2Y0OA 5IK5A 4AGVA 1DFQA 3BUCA 4FOVA 1RVF2 2W9XA 3HNMA 3ME2A 4O7XA 3V0AA 3KVAA 4PI2A 4YZ1A 2BJSA 2R042 4AE2A 1REFA 1SLBA 5LATA 3J26N 2XR4A 3H3ZA 3LA7A 1WD4A 1WMFA 5FBZA 5LEJA 1YC61 4YZ3A 4BE3A 4N7UA 5A33B 1NE4A 5ANQA 1S0CA 3V56A 4CDQB 1ULGA 2QQWA 5FRAA 3I59A 3KS7A 2YB7A 4G9SB 1RUC3 2D43A 3LDRA 4OVEA 4QAWA 3U0ZA 5JDBA 4KG0A 2AGSA 4IV3A 4D69A 1WW5A 4MXWA 4QQ2A 3MO4A 3N9NA 3SH5A 5FR3A 1IOAA 1XNBA 3MPBA 3J7MA 1LOFA 3WQBA 4HMZA 4QPWA 2ZBJA 1JH5A 2EAKA 4HXCA 4S2HA 4YVWA 5CB7A 3TN91 1LENA 4BOWA 1IHMA 1ONAA 5IVYA 4GZ9A 5IWFA 4HT1T 4AFCA 4ARYA 5BPXA 1IPSA 5ABJB 3CQOA 2QUOA 4PQ9A 1MQTA 1OBNA 1IS4A 2VUCA 1N47A 1OSGA 4ATFA 5JZGC 2J22A 5FZHA 1GQGA 1ODNA 3LPFA 1UOBA 3BVCA 5G05L 1ZBA2 1YFYA 4QHZA 4A4AA 3O5SA 1LAJA 3L2YA 3ZPYA 4XF3A 3E6CC 5HCBA 4FPEA 1RMU3 1Z7S3 2DVFA 3FBMA 3O0VA 3MIHA 4UWDA 5FYIA 5LA2A 3ZKYA 4CUCA 2GNBA 3NWKA 3T0BA 3WINE 5IATA 1OVSA 3WUDA 3NJVA 1K5MC 3RZMA 4PIZA 3GZEA 3NV3A 3K75B 2EIBA 5A3OA 4BYYA 5A7WB 5DMYA 1PNGA 2XHKA 2P3KA 4CU7A 1BK1A 1N1SA 3M3CA 2BEOA 1SBEA 1T6BX 5E1RA 4CDXC 3HQXA 1AVBA 2AREA 1RUD2 4WVMB 4XHXA 3FBYA 4AFMA 3E1F1 1KEXA 5LW9A 2VMFA 3W5NA 2E63A 2ZGUA 4IL7A 5FCCA 1TZOA 1VP6A 2ZGTA 2LS6A 1UCXA 1JZ7A 1W9YA 2VOWA 3R05A 2QJVA 1HV0A 4NWVA 1X9PA 1H2NA 1X7NA 4LOTA 1HV1A 1UPIA 2GN7A 1SHWB 3OBZA 3J7NA 5A80A 3S7EA 2ZGQA 1UY1A 1YQ8A 1QQP3 2WLPA 1MS8A 1JHNA 2R1BA 1KFXL 4XJUA 3T2PA 1A6CA 2W1WA 5FPLA 2ZGSA 4ZXEA 3ST7A 1COV3 4KBZA 3OYWB 2XBO1 3N36A 1FPN1 4COWA 2YHJA 3GBGA 3WVJA 4DEQA 1MVEA 3AZWA 1HB4A 2W39A 3HIFA 2HWC2 3H1WA 3MIFA 2BVVA 2EXJA 4BZ4A 1LEDA 4TLFA 3ZXKA 3D8CA 2FDKA 1S0JA 4P9JA 1TMF3 3VKMA 4YG3A 3LEIA 4ZS2A 1W28A 1FMD2 2ERFA 2NYYA 3MF6A 2KA3A 2P2KA 1OLQA 5J09A 4QXBA 2WNEA 3HMYA 1SLCA 3GM8A 4RD7A 5H9RA 4O65A 4E2SA 2VW2A 1BEV1 4F83A 4SBVA 2KM2A 5FJHA 2RG4A 4CPBA 2RS11 2RR11 4KWLA 1AYM3 3L2HA 4XXPA 5FZGA 3MF9A 4P9IA 3SKVA 2ZZQA 3TAYA 1ND3A 4PLMA 1CAXA 1TEIA 2X05A 2WT2A 4CZSA 3LA2A 4NIGA 4OUSA 1K45A 2VPVA 1OF4A 4V1PA 5EZWA 3QH7A 1GWKA 3IDAA 5FYZA 3WDYA 2VNVA 1LHNA 1LCLA 1YWKA 2WQ4A 4HBNA 4YZ2A 1GNZA 2HEWF 3GGLA 3HWJA 3RYKA 3NJZA 1S1AA 3Q8EA 4E4HA 5FPUA 5K0UB 1BBT3 1D4M3 1Y9MA 1RUE1 4NPLA 5JLVA 1N1YA 3ZXFA 1V6KA 3HR9A 5BNNB 3LPGA 5A33A 3POEA 4CCEA 1O3TA 3ZKUA 4CDQA 4MGIE 1F9KA 3LB9A 4JRAA 2A7AA 1LTEA 2VOKA 2HWE2 2YFUA 3AP5A 3Q8AA 1W8WA 1LOAA 3CL1A 1L7RA 2JG8C 5IVCA 2EVXA 1GP5A 5ERLA 3BN6A 2XUEA 2B5HA 2XG3A 2DU1A 1E5HA 4AHWA 1J59A 4WVVA 3E6DA 2YU1A 2ZGNA 5T5OA 5J36A 5IK8A 4IEUA 3AZYA 4OQ8A 4QPIA 3U4SA 4KWUA 1DBNA 3ZMNA 1ZA4A 5ABJA 5FY5A 3AKRA 2OS2A 4BLIA 3KVBA 4C0BA 5HXMA 1W0PA 4HN1A 3USUA 4JTNA 1G9DA 1CJPA 1B35B 1PO11 3ZFGB 1DLLA 3PUAA 3SCFA 1V70A 1VPHA 4ES9A 4WV8A 4BDVB 2XOMA 2RV9A 5J96B 2ZEYA 2RMU1 2WO7A 1VBD2
chains in the Genus database with same CATH topology
4IV3C 3TN93 2JG9C 1KFUL 2Z42A 2GDFA 4XFCA 1VBC1 2WA4A 2WNVB 4LTAA 3WZ1A 4Z8BA 1I5ZA 2O8QA 3WLUA 3UJOA 1CD3G 3JD71 4OULA 5EJ3A 5BYNA 1G9AA 2TEPA 1MQTC 1ENQA 2HWF2 3VUOA 1PNFA 3WQ0A 5FO9B 2WFF1 4CDWB 1PVC2 1HRV1 2OA2A 1ZNPA 5BV6A 4AI2A 1PGW1 5JWPA 3RMXA 4XZPA 3EJKA 1AX2A 4Q29A 5A32B 2D5HA 2VQAA 3BALA 3VGIA 3ZSLA 2ZHMA 1NLSA 3J4UH 3KB5A 4YVSC 1AHSA 3ZXGA 2VXRA 4AG4A 3OBTA 4HVQA 4YYOA 1IQAA 1H2MA 4RR3C 5DUUA 1PGL2 1U5XA 5FPZA 4YGEA 4QQPA 1RJ8A 4HVRA 1QJY2 4META 4Q4W1 1D2QA 2VQ0A 2VMGA 1RUF2 1CVNA 4IEXA 4JGYC 4YW2A 2XBO3 1FPN3 1BZWA 2XWBB 2HWB1 3ZXDA 4F3JA 2N7GA 4H7LA 1MS3A 1C8NA 5HI0A 1CESA 3KGLA 4PJYA 3IBMA 3LAGA 3AMNA 1MS9A 1NCRA 1TE1B 2B42B 1ZZ7A 3VZNA 3O7OA 4XFBA 1XYPA 4MVTA 4FP2A 4FAGA 1BEV3 2PHDA 4AEDA 3UL2A 3OD0A 1Q5OA 1AR71 2RS13 2V5YA 5GZCA 1C5IA 2RR13 2D3SA 1L3JA 3AK0A 1BVP1 1UKRA 2X8KA 4TWTA 1GANA 1YO8A 4Q0PA 3TBDA 1OFSA 1LGNA 1QGLA 3D0JA 4OI0A 5BNNA 3AZZA 2FMYA 2Y38A 3VV1A 3AYEA 4OHXA 4LLFA 3MGUA 2WZPP 2R32A 3B01A 4AI8A 4CDUB 1G9BA 1R1ZA 2VMIA 2R0HA 1PIV2 4Y1ZA 4KQ7A 1ND2B 3KCYA 1RUE3 1R1A1 5IK4A 1ENXA 4Z92B 4RSUA 4ISQA 5K9YA 4K1YA 1PO22 1ZRDA 1NYWA 3A4UA 3WDWA 4OZXA 1XE8A 2Q0AA 1G9CA 4I01A 5IT6A 2NMOA 4EN6B 2NPIA 2ILMA 1B35A 1UF2C 2W0XA 3IM0A 1MS1A 4COUA 2B9UA 1WCDJ 4LO7A 4YW3A 2GSYA 3POWA 1POV0 4YRDA 1YXWA 2XWJB 1BXHA 3LKJA 1OPOA 3ALQA 3GHMA 1O3SA 1RITA 1ZBE2 2R041 2WNVA 1S2KA 4FXKB 3ILNA 1PO13 1YFWA 2DU0A 4XMIA 4QPIC 2ET1A 2ZOEB 3B93A 4AYUA 2VNOA 4EN9B 5F1RA 4Q26A 2CYFA 2RMU3 3VBHB 2D6NA 4H3WA 1WD3A 1CJDA 1CAUB 3ATGA 5D1IA 1VBC3 2IWGB 1U5IA 4CDWA 3SHRA 1LODA 3JD73 5KXEA 1AR92 3AFGA 4XJZA 5A32A 3UKTA 4L97A 2PA7A 1EAH2 2EF6A 3QH6A 5JAXA 2WFF3 3AFKA 3FWEA 3FFQA 2D6LX 4FCAA 1WW7A 1HRV3 1VAKA 2GNMA 4W6YA 4KU8A 1ZBA1 2CY6A 4IEPA 3VBFB 3WQ7A 4EN0A 2A6VA 3I8TA 3WXPA 2PAMA 1EPZA 2CGOA 3AP9A 3KT7A 4HZFA 2E7QA 3JB4C 1ZZ9A 2C0ZA 1YIPA 1V6LA 5DDJ1 5AC91 2GU9A 2ZX0A 5C9AB 1G8WA 1I1EA 2RS32 4Q4W3 1LOGA 4H55A 4K20A 3ZXEA 2QZ3A 2VU9A 3WY6A 4P9YA 4YM1A 1EV12 1VR3A 4KWJA 3INAA 2XVGA 2ZGPA 2HWB3 5FREA 1JW6A 4BLJA 1DYKA 1RUH2 2MNGA 2PHXA 3H1YA 5H9QA 5FOJB 5IK7A 4ITCA 4CTEA 2CAVA 2YMZA 1XNCA 4K6BA 5JOYA 4LR4A 1LOCA 4KG8A 2HKXA 5LRSA 4HSLA 2VH9A 1QMJA 3E5QA 4IEWA 3WV6A 3GALA 2HWC1 1V00A 3DPRA 4LHKA 4R9BA 4CDUA 1AR73 1NE6A 3FUOA 1NCRC 2PLV2 1S0FA 3WP3A 1SLLA 3BOPA 3ZXLA 4AW7A 1VBA1 4YZ5A 1ND2A 1QXPA 4AEDC 1OMIA 3CJXA 3RSJA 1J1TA 2AUYA 2BWAA 4E4ZA 5I0RA 4MGKE 3M2MA 3T1LA 2XVKA 3MYXA 2F4PA 5LEKA 5JVVA 2W68A 1ZYBA 1DQ2A 2XJPA 3NV1A 4LO5B 2NLRA 1NY72 3KQRA 4XW3A 3LA3A 2VVFA 4XQWA 3VZKA 4XF4A 4UBHA 1R1A3 1I6XA 3X29B 1ZRCA 2ZTNA 1LHUA 2ATFA 4FPGA 5EWSA 4PBOA 1V9U1 2A3XA 2R6QA 3H3UA 1J1LA 2DF7A 2YPJA 4KWKA 1PGSA 4XFAA 4D7SA 5EV7A 4WM8B 5J3UA 2OZ6A 2DWRA 1W6OB 2C1FA 4K7JA 4B8EA 5LRRA 3WG3A 1U5YA 1NA1A 3VDDC 4E9KA 2VVDA 1B35C 1KJRA 2HWE1 2K2SA 4AGRA 4GKXA 2R043 4E2GA 4B4PA 2VUAA 1FXZA 1RC6A 1M06G 4MH0E 2WJSA 1QOSA 1BVVA 3B9IA 4L8QA 4JGZC 1UD1A 1KXGA 3DKWA 4DY5A 4XFGA 2H6BA 3JQWA 4DFSA 4HLTA 2D40A 1ZRRA 5LK5A 5JCTA 3VBFA 3WNXA 4AEJA 1IPJA 2R0FA 3SH3A 2MEV2 5GZEA 1GZWB 1VBD1 4CDWC 1MEC2 1AJOA 3ZYJB 4XF1A 4A7KA 1QOOA 4OHYA 2VNGA 4IEYA 4RGAA 3NV2A 1W6QB 1LKNA 1MS5A 4PDWB 1UPSA 3OF1A 1MR5A 3WW1A 1XE7A 4N53B 4SLIA 3ZXAC 1OOPB 1ZBA3 1V6JA 2HWD1 3KT1A 4XE9A 5C9AA 1AZDA 4R9AA 1LHOA 5DZFA 3GNEA 3O12A 1ASJ2 2HWF1 1JUHA 4GH4B 1RUI1 3VBOC 3CJIC 1PVC1 2D3PA 4LEJA 5I0TA 3IDCB 4RQPB 3GBFA 2WZR1 4Y24A 4H7MA 3E6BA 5DDJ3 5AC93 3IPVB 1KRIA 1REDA 3LWCA 1EY2A 3HN1A 4MGYE 4AFAA 5L36A 1JYCA 2C5DA 4LHLA 1U12A 3THTA 1XNDA 2D44A 1T6GC 2NZ9A 3IWZA 1QJY1 4QGMA 1DGRA 3O0XA 1XU1A 1GR3A 1YI9A 2IXCA 3H9AA 5C8CB 1RUF1 3L9JT 1OHFA 4QGLA 4Q0UA 4Q1RA 3FJSA 3AYDA 5CADA 4AVAA 2BFUL 3B69A 3BPZA 4BA6A 4EROA 1LGCA 2HWC3 2ZHLA 3PVEA 3DGTA 3IT8A 5KC6A 3RJ2X 3T1MA 3VL8A 1MZ5A 1KITA 4Z2WA 3DF0A 3R6SA 1VBA3 1ULEA 3NKGA 3DPRC 3E5XA 2ET7A 5CNAA 4Q0QA 4YW5A 3VBUB 4MGZE 2E51A 4KU7A 4I09A 1DF0A 5CU1A 5FO8B 4YW4A 1GNHA 5T5LA 1TNFA 1VRH2 1F5FA 4P9LA 2XLAA 1REEA 5D8AC 2PAEA 3J8F2 1R092 4WM8A 4CEYB 2E53A 1W6OA 2PFWA 2WL1A 1UZZA 1X82A 1KD7A 2V73A 3N7MA 4M0HA 1H30A 3VHOA 2IXIA 4N43B 1V9U3 3AYCA 4MYEA 1PIV1 1XU2A 4LBMA 4Z07A 3GBWA 5B2GB 1S2BA 4YLZA 2DCTA 4EWDA 2X29A 5GALA 4RL7A 3I2DA 4YW1A 4CEWB 1PO21 2RHPA 2ZHKA 3JBG3 2DUQA 2ES3A 2HWE3 4XBLA 3ZVXA 5I8YA 1MS4A 1HQNA 4RS5B 2D98A 1VALA 1ZZCA 5T52A 1NA1C 3PVBB 4NOTA 5C33A 3IN9A 1GZWA 1CAVB 1ZZ8A 4BH9A 2DUPA 4EN7B 4YZ4A 4C91A 5DZEA 2PELA 2IZWA 1W6QA 2OYZA 3SCHA 5A3MA 2GC3A 5EFUA 1ZBE1 2ZPXA 3FX3A 4N53A 3U07A 2YUEA 3B02A 2DVBA 2WSUA 3WW2A 2DCJA 4Z82A 3RZZA 1UN1A 5KXCA 4CYDA 1KDMA 4I02A 4ORFA 1VBD3 3UK9A 4C1XA 2W52A 3NAPB 1FOD2 3MW3A 4FPJA 4GH4A 4W6WA 5L7OA 4XFFA 1UL9A 5GLVA 2BFUS 1JOJA 4P9XA 4P9GA 3S7IA 4RQPA 5I8SA 4YSFA 1J3QA 1XYOA 2NP0A 5JIAA 2HWD3 4DB5A 2ZABA 3ZXJA 4IV1B 1R082 2VMHA 2RS52 2CWMA 3TRSB 2HWF3 3PTYA 4DZGA 4M0NA 4QPGA 1EAH1 2CAUA 3RYPA 1RUI3 1AYN2 1A8MA 1V6IA 3ZFFC 5H9SA 4BQ1A 2BW8A 5JLVA 1H8TB 1RUG2 1PVC3 2WZR3 2NM1A 2WS92 4MX3A 3CO2A 1FX5A 1DDLA 1S0IA 1X33A 4FO9A 1YI7A 4OHVA 4JCKA 1VAMA 1JN2P 4F8AA 5C8CA 1AX0A 3FLRA 4FPLA 3CLPA 2H6CA 2XGXA 2AYHA 2AR6A 2DURA 1QKQA 4H14A 4FAHA 3LOBA 1QJY3 3VBRB 5L19A 3AB0A 5CFCC 2JENA 3M3QA 4JRLA 1RUF3 3VHRA 2PHWA 4HL0A 5ACA2 4YM0A 3H50A 2LALA 3VBUA 1RUH1 1PMIA 3P3NA 4QX5A 4AXOA 5AVAA 1LU1A 3VKNA 3V64A 4BMBA 4A7ZA 2A75A 1UU4A 2XJTA 1VBB2 5EXOA 3RJRA 1AR82 4CEYA 3SITA 1LHWA 3OJBA 3NSTA 1PHMA 3PMEA 1IKQA 4N43A 4XJWA 1Y43B 3EXUA 3IMNA 3M1HA 1C57A 3AM2A 4F7ZA 2R49A 1O4YA 2XUMA 4GALA 4L99A 3I7DA 2XKOA 3D5OA 3H7JA 3KZ4C 1MACA 3VL9A 1QJU2 3PJQA 2XJUA 1HX6A 1NXD1 3N35A 4CEWA 1OA2A 5GJ6A 2BVBA 2GAUA 1ZM1A 4LO8A 3VBSB 4K1ZA 1PIV3 4KGQA 4RS5A 2OW4A 2ZMKA 1HXS1 2JE9A 3RWNA 1H1MA 4W65A 4LT5A 1DQ6A 1RJ7A 1X36A 3B00A 1PVXA 1LOFC 2ZZJA 2CTVA 3RPQA 5K8SA 1CAVA 1Q3EA 4YVWC 1PO23 1UX6A 2ENRA 1RUJ2 3POSA 2D3RA 4WVMA 3TNPB 4IESA 2VVEA 3JZVA 4WM7B 1LGBA 3WP6A 5FFOC 1WMDA 1SCRA 4QM9A 4U36A 1J3RA 3BB6A 3KMHA 4NR1A 1OI6A 4M3CF 4AEKA 3ELNA 4EN8B 3NAPA 1YYNA 4P9WA 5DXDA 4IQPA 1FNYA 1COV2 3FLTA 4S2GA 3SMHA 3O14A 5E88A 3BIWE 2WNUB 4HKLA 4GWNA 1ZBE3 1BCXA 3S6PA 4OI4A 2ZX4A 2UU8A 3OYWA 4IV1A 4AEMA 3KT4A 5I91A 5J7MA 2JECA 1C8M1 3FZ3A 5BNPB 4YARA 2WT0A 1C28A 2YYOA 4AVBA 3T2TA 4AHZA 1BQPA 3OD4A 2RJKA 4B7EA 4FVVA 2B8MA 3HD8B 3ZSEA 3QD6A 1OQ1A 4XYXA 3MLKA 4AHXA 1LRHA 5L7OC 2MEV1 3I54A 1MEC1 4Y20B 1EAH3 4Y1XA 2ZX2A 1H2LA 4FTBA 3ZFEB 4BPZA 3C3VA 5JOZA 2BNMA 4I30A 4M00A 1W6MB 3R0RA 4N9IA 4XJ8A 5TSWA 3S30A 3VZJA 2Q8OA 5T5JA 4Y1YA 1FI2A 4L92A 4QPGC 1NLRA 1VJ2A 1EYBA 1AL21 3SH4A 1GBGA 2VG9A 1BBT2 2ZKLA 5K0UA 5GZGA 1MZ6A 4QM8A 1Q56A 1HRI2 5CBLA 4LBOA 1WLDA 4GB32 1C3HA 1ZZBA 1MVQA 3N7KA 1GSLA 4Q0SA 1HW5A 3AMHA 4ATEA 3NKTA 1KQRA 1ND3C 4KH9A 4FXGB 5FO7B 2DCYA 3SNMA 2E7TA 3ZYRA 1QU0A 4OHWA 2AZ5A 3OPZA 4BHPA 1G6NA 2Z5WA 2R071 1H4HA 4PIXA 2A3YA 2MHFA 1CN1A 1QJX1 1YHFA 3D6EA 3ZSKA 2D6KA 3FE5A 4Q4Y2 5CIRA 2Z79A 1WGPA 1O5LA 3EQEA 2NQYA 4XPVA 3GZUC 4UW5A 5BNOB 3S0MA 1H1AA 2GH8A 2I2SA 2ARXA 3WG4A 3SCGA 2XH6A 3K51A 2ZJCA 2GZWA 4Q4V2 5FTTC 3ZFGA 2A70A 4QQOA 4CDQC 2UY8A 1SFNA 1TNRA 4JVAA 3TN92 4FPKA 3RI9A 2QZ2A 4INDA 1RHI2 4AQTA 2OPKA 4C90A 1H0BA 4WBBA 1RVF1 5JOXA 4M3CB 2D6OX 4D7YA 3WT3A 4XQ4A 3ZX7A 3AKSA 4DRRA 4A7YA 5ABJC 3RMYA 3C2UA 2VW1A 4WM7A 1HXS3 3DL3A 3J8F1 4RHV2 5KHKA 1GFF2 2IFWA 5GLZA 2A6ZA 1R091 2YV8A 4LBLA 4OI1A 1DQ0A 5JZGB 4UW4A 4DXZA 3B5LB 1AXKA 1X50A 2WNUA 4P14A 5KBFA 2XJVA 2GC1A 1K5MB 4XFIA 1Q8QA 1E57A 2UYBA 2BTVC 5BNPA 1ENRA 3W9AA 4QD2A 4XHBA 4FTSA 4CDXB 3AKPA 4E2QA 3AP4A 2D6MA 1VBE2 2JICA 2WLQA 4QQHA 4D94A 4Y5Z0 3ZN6B 1G9FA 2FMDA 1WLWA 4Y20A 1C8M3 1C5HA 3AXEA 3CNAA 1RUD1 1IZ3A 3ZFEA 2TBVA 1WLCA 2WA3A 1W6MA 4ONUA 5FLHA 2DUOA 5T5PA 2Y0IA 5GZDA 1DYPA 3AMQA 3ECQA 2MEV3 3V0BB 3FHIB 3M3EA 1MEC3 1FOD1 1DU3D 3IKWA 3OTFA 3ACLA 4GULA 1UKGA 2JE7A 1QXJA 5BY5A 4R9DA 1R081 4LBKA 1CX4A 4TYSA 2YXSA 1W6PB 4NN0A 2JX9A 1O91A 1AL23 4CP1A 4Y26A 4Q4X2 4RGGA 1AYN1 1FMD1 3D82A 2C9AA 2JDZA 4J6GA 1RUE2 4LHNA 4DQAA 1RUG1 1HDKA 3TYJA 2QQPA 3JB8A 1DZQA 4YNIA 4I3PA 3ZYGA 3M3IA 4XTMA 2DCKA 1D0HA 3Q9OA 4XQDA 1S0BA 1RINA 1UAIA 4DPNA 5K0UC 5AVPA 2O8OA 2ZMNA 3MIEA 5BNNC 3G7DA 1N3PA 1RUNA 4LE3A 1VIWB 2R073 3N4MA 1QJX3 1URXA 1QXRA 3OCPA 5J48A 4FQZA 2ZHNA 4J1WA 3ZN5A 4YFZA 2CL2A 2XJSA 3WCRA 4ZU4A 5ACA1 4MSVA 5H9PA 4M3CA 2JG8B 2XLGA 5FQ0B 3ENRA 3VLBB 2RM22 3M70A 1JUIA 3VBHA 4DS0A 1VB2A 3V0AB 2BGCA 3ZFGC 3BU7A 1CAUA 3NW4A 1H9WA 4EV0A 3JD72 1VBB1 1RVF3 1AR81 2R062 1ZZ6A 2WWSA 4X8NA 1WW4A 2I74A 1A78A 4G4FA 4BIFA 2CWSA 3ILRA 4O9EA 3N3HA 2VOVA 2TNFA 3I59B 4YG6A 1PM7A 3FFZA 2WFF2 4Y1VA 1SCSA 3WHUA 1NOVA 1OA4A 4HK9A 2WNVC 4IV3B 2GMMA 2JG9B 3J8F3 4MXWB 1IGOA 1R093 4EJRA 2YDEA 1QJU1 1DZRA 2QVSB 1K5MA 3FUQA 4GKYA 2ARBA 4IEQA 4QMAA 4U2AA 4TZDA 1KS4A 4AVTA 4OHZA 3KCCA 4EWEA 5JI7A 4MLOA 4CDXA 5JIUA 2EALA 1CGPA 1MQTB 5JSRA 4X6QB 1AL0G 4HKOA 4Q1PA 2ZGMA 3MDPA 4LBQB 1O7FA 3AKQA 4OI2A 1TME2 3BODA 4Q27A 4LE4A 4LULA 2K9ZA 1RUJ1 2ZX3A 5A3LA 3PVOA 1H9PA 2ZGLA 5GLTA 5CG9A 5J98B 4JDNA 1CR7A 2BNNA 4JAAA 1VLNA 1DGLA 4YVSB 1ZVFA 4I2OA 3HAGA 5F5QA 4AVSA 4XF0A 2EXKA 4FPFA 1PK6B 1O3QA 4RR3B 3K48A 1KDKA 2D6PA 1O3RA 5L73A 1RUD3 3AKTA 1OQDA 2D97A 5K7PA 2QNKA 1NQDA 1WCSA 1YNAA 4HFSA 2UY9A 4K40A 1GZCA 4JGYB 3VHNA 5SV5A 1ZX5A 2ZACA 2VY0A 1AR72 4Q8LA 3AZVA 4E4DX 1PGL1 1IS5A 1W6PA 2B39A 4KNCA 2A6XA 3OGGA 4XBNA 3TNQA 4LA3A 1OD5A 1FOD3 4WZFA 1U5ZA 5E16A 4BM8A 1WW6A 1NXMA 3PNAA 4LO4B 2F6BA 4DNYA 2D7FA 2P34A 4S2FA 4FPYA 1LOBA 1Y7BA 1R083 2BPA2 4COVA 3ZMOA 2Q4SA 2VULA 4QQLA 3RQ0A 1AYN3 1FMD3 4AQSA 1R1A2 4AVVA 1RUG3 4K21A 3B94A 3UKNA 3MFCA 3KLSA 2JD4A 2PTMA 4IETA 3IIAA 2UURA 3RS6A 2O0OA 2OVUA 4CDUC 5HCFA 3M7AA 1W39A 4XTPA 3WW4A 1XRUA 3AXDA 4ZU5A 3MW2A 1ND2C 4I0WB 3ROUA 3WW3A 5LK7B 2PHFA 2X5IB 1RGSA 1V6NA 2X53S 2PN5A 1QNWA 5KHJA 1HRI1 1UMZA 5FQ0A 1V6OA 4GB31 5C4WB 2E6VA 2DYCA 2CV6A 4OUMA 4AI0A 1HKDA 5ACA3 4Y1UA 1OA3A 4KL1A 3WD5A 3UKVA 3ZN4A 4BIOA 4LUMA 2BWCA 3LSDA 1QH7A 4JV4A 2W08A 4Q4Y1 4AFBA 4XOGA 2EXIA 4ZKTB 2YROA 4AQ2A 4NO4A 3R4SA 4BMEA 2EA7A 2JG9A 1JTZX 1LULA 3G6JB 2HEVF 4FOQA 3ZIWA 5KC5A 1VBB3 1BMV2 1AR83 2SLIA 2Q5TA 4KGGA 2HEYF 4Q4V1 1OFNA 3NL1A 2JEMA 3VBHC 1QY4A 4QPIB 5C6CA 5JI9A 2PHLA 4M3CE 3U11A 4NHKA 1LESA 2PQQA 2GC0A 1RHI1 2VNRA 3B9CA 3USUB 2VOXA 2XJRA 1SFYA 1POV1 4K8FA 5JR7B 2R1DA 4LNVA 5FOBB 1JYIA 3EO6A 1H2KA 1FT9A 1QJU3 1IPKA 4LBQA 3EBRA 4PDWA 1GQHA 1CONA 4C0HA 3MW4A 1OOPA 4YGCA 1U0AA 2E9QA 4MZUA 5DUVA 1LOEA 5DG2A 5GLUA 3ES1A 1SDWA 3DV8A 4WZCA 3P3PA 4RHV1 2ZKNA 1DHKB 1EPWA 4YVSA 3MLLA 3KSCA 5DDJ2 4KBBA 3VBFC 5AC92 4HPKB 3QLQA 1LU2A 1PK6A 3QACA 1SLTA 4RR3A 4FOWA 1AR91 3IPVA 1RUJ3 3PMSA 3AMMA 1H8VA 3JU9A 1BKZA 1S0EA 3H7YA 1XNKA 4GQ7A 4PLNA 4IEZA 4JGYA 1XQNA 1B09A 2G9GA 1QF3A 2FQPA 2DTWA 3RDIA 4B7KA 5C9AC 4K9SA 1IKPA 3B7MA 1DQ1A 2YGLA 1WA4A 3H1MA 2DFCA 4XJAA 1CQ9A 1VBE1 3NO8A 3WDTA 4RA0A 1FATA 4QU2A 3A0KA 4DINB 3AJZA 4G3YC 4NWWA 4ES8A 3PLQA 2D93A 4XJ9A 1AR62 4N90A 5FMOL 2WC2A 4P5HA 3W58A 2RS31 1VBA2 3DUIA 3KD4A 2A5ZA 3MFAA 1EV11 3H8UA 3QBQA 2P17A 5HBAA 3RI8A 4LLOA 3OY8B 4I0BA 1ULFA 1J3PA 1LHVA 2IXHA 3HBZA 5GKAC 4L11A 2VUJA 4Q8KA 1NCRB 2BBVA 2X5IA 1RUC2 1UIJA 1LB2A 2GH2A 1S0GA 1G86A 2DCZA 4AEDB 2WSVA 2GNDA 1OPMA 2WKKA 4FQ4A 2WINB 5C4WA 3IDEA 1WUVA 1W2UA 1DIWA 1V9U2 4FT8A 4X8PA 1WCKA 3ZO0B 3ZSJA 3HT1A 1YRZA 5SV8A 1FAYA 3ES4A 5DG1A 1HIXA 4Q4X1 1O4ZA 5JMCA 2PLV1 2ZA9A 3FC0A 3N7LA 2G9FA 5T55A 4Y4YA 3QOPA 1Y9QA 1HRI3 4MV2A 4GB33 3UJQA 1PZ8A 2Z69A 3JBG2 4J1XA 3R4UA 1RMU2 1Z7S2 3ZIXA 5KHIA 1FYUA 2Q1ZB 1NY71 1PZ9A 4WM8C 1SACA 1FV2A 4R4XA 2H0BA 1QDCA 3TB0A 2IXLA 1SEFA 2Q1MA 2UWCA 1DGRN 1YJKA 1SQ4A 2WIIB 4Q4Y3 1YFUA 2PHRA 2R16A 3VDDB 3WP4A 1VB4A 1W6NB 3A0NA 3GZAA 1RUOA 1OQEA 3GF6A 5F6LB 2QDRA 5C8WA 4Q4V3 2NN8A 4M01A 3WCSA 1SLAA 2JJ6A 1J58A 4AF9A 4BWOA 2P3IA 4LUKA 1Q8VA 2RM21 4FTEA 1QQP2 4GMP1 4AQ6A 1RHI3 1DGWA 1M4WA 3MLJA 4I0AA 2UYAA 1POV3 2HWD2 2R061 4JGZB 4HPKA 2OUHA 4YFWA 4OFGA 1QH6A 3OBRA 1YFXA 5FMOS 3THPA 4HN0A 2PAKA 2YGMA 1NCQB 2BQPA 1TMF2 3TOJA 1RUI2 2VGDA 1F2NA 4YGBA 4PDWC 2KXLA 3VKFC 4RHV3 4N53C 4DMIA 2WZR2 3WDVA 1OOPC 2E7AA 2ZAHA 2ZAAA 1H8TA 2EAAA 4S2DA 4NPRA 4HVOA 3AMPA 2A6WA 1AR93 3BOWA 1N1VA 5E8AA 3MIBA 4GH4C 2XL7A 2ZCWA 3BCWA 2XKPA 1AYM2 4JDMA 3LGRA 4B3NA 2LUWA 4DY3A 2ZGRA 4RQPC 1PK6C 5CG8A 3BTAA 4R52A 1DGWX 2UWBA 5AFBA 4R8HA 1I9RA 3VBOB 1BJQA 2A6YA 3VN4A 4AWDA 3CJIB 3PJYA 2PHTA 1N3OA 3JCIA 1ZREA 1TME1 1HQLA 2UWAA 4DOUA 2JKBA 2FZ1A 4XIOA 3ZYPA 3VBRA 2ETEA 4PF5A 5T54A 2QCSB 1ASJ1 1XXNA 2CGNA 2GNTA 1VBE3 4ASMB 1D4M2 1DG6A 3OY8A 2ZGOA 3VZOA 3IDBB 5C8CC 4ASLA 3KCXA 4A2UA 4JTOA 2RS33 1SLIA 1ULDA 1UIKA 3SISA 3V65A 2GALA 1WBFA 4B4QA 2GMEA 1EV13 4FOYA 4OLLA 5J37A 4N9HA 5CFDB 1WBLA 2AENA 3WQ1A 1RUH3 1GYKA 4PBPA 1MZFA 3WP5A 5DZGA 3H0OA 4XMAA 3WDXA 2IXKA 1AXZA 5GM0A 4E27A 2DTYA 3LCPA 4LBNA 5JOWA 2XJQA 5CAZA 3KGZA 3VBUC 2BYVE 2DVAA 3U10A 1ALYA 3DPRB 3E5UA 4Q0VA 3ILFA 2X5IC 2OUJA 1G7YA 4N7IA 4UBGA 5HXVA 3MIDA 3MPPG 4Q4X3 1C1FA 2PLV3 2D5FA 4PLOA 3VBSA 3RYRA 1F31A 4QGNA 4AGGA 4CEYC 5C4WC 2WFPA 2QDNA 3E97A 4UW6A 4XXAA 5D8AB 2NMNA 1NG0A 3UV9A 3NVCA 3PVNA 4N43C 5GLWA 3I4IA 2GC2A 4FSJA 2G4IA 1RL3A 3VDDA 4ISRA 4XETA 2YZ4A 3AX4A 1W6NA 1A8DA 1NQJA 5KWRA 2EXHA 4MUVA 1GZ9A 1VRH1 4XILA 3RNSA 1Q43A 3EHKA 4IERA 1C1LA 5I93A 4JDOA 4CEWC 1CAWB 4YG0A 5KXDA 4HKWA 1EP0A 2ZS6B 5F9TA 4NVPA 2ZMLA 1Z78A 1TQ5A 1QJZA 4HETA 4JQRA 4RS5C 1AUYA 3N7JA 3R4DB 4QHBA 4AI3A 2FHRA 4A3XA 4HSJA 4HK8A 4JGZA 4W6XA 5T3NA 4FBFA 3PHMA 4GIQA 3FMGA 4COZA 2A71A 5FAXA 2B7YA 1NA1B 3LSEA 4FPHA 1NCQA 1Q8PA 1GKBA 4XEZA 3VZMA 2RM23 3MICA 1AXYA 5EYYA 1Y3TA 4GMP3 3NV4A 3M8LA 2OIIA 1CPNA 2HYKA 2R30A 2XBO2 1FPN2 1BMV1 2R063 3APBA 1YJLA 4QT6A 2Y26A 4NHMA 5AFEA 3NAPC 2RJLA 2HJIA 3AJYA 1LEMA 3M3OA 3SXWA 2JXAA 2I07B 3GZTB 3ZDSA 4BCUA 3VBOA 4IV1C 3CJIA 4GA9A 1YUDA 1BEV2 2BUKA 4XFHA 5CA6A 1VAVA 2IC1A 3CU7A 1DZTA 2BNOA 1RTVA 2RS12 2ZX1A 2RR12 2XVLA 3RG0A 1I3HA 5BUVA 1H8TC 4AK3A 5CVRA 1WLTA 4L2NA 2CNAA 3LOIA 4QPYA 1JBCA 1YCIA 5JPNB 1ULCA 3ZFFB 1KS5A 4Y22B 1GLHA 1TME3 1DQ5A 4XBQA