3GF6A

Crystal structure of a bacterial lipoprotein (bt_1233) from bacteroides thetaiotaomicron vpi-5482 at 1.69 a resolution
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
219
structure length
219
Chain Sequence
DAIYYPVGDVDIERGGPALEVGEEDVLVARSFNEEDYVLDTIAQYPNDPTLGKLTFMIDLKNQQKDQNVADFNGVGKSKLTMSLGYKDGNYPSESQVPIYTSQDVTAKYAVKLRLKGELLVSGDEWMIDYVYAQLASLFQPYPPANFPEVFMCKGGMKLGTFDSFRRTCTFDITYDRSDLSFSQLYFNLFINLAGQKRENRVRLRIDKESYFELYEQSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords uncharacterized bacterial lipoprotein
publication title Crystal structure of bacterial lipoprotein of unknown function (NP_810146.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.69 A resolution
rcsb
source organism Bacteroides thetaiotaomicron vpi-5482
total genus 48
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.750 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3gf6A00
3GF6A
chains in the Genus database with same CATH superfamily
4XVHA 3PL0A 1UU6A 2CAVA 4R52A 4XAEA 1TZOA 4GZ9A 1SFNA 4AR2A 1O3TA 1FOD3 2DUPA 2D3RA 5IHRA 1DG6A 2BDRA 1R082 5T55A 5A33B 1QQP3 1ZZ6A 2VUDA 4HZFA 5EXOA 4K6BA 4W50A 2UYAA 5L7OA 1R1A1 1VB4A 4TZDA 2KXLA 4M3CE 3HNMA 4LXLA 4YZ4A 5DAQA 4XBQA 3EQEA 4UFMA 2V5DA 2YDEA 4XZUG 3NRUA 5GALA 1AR82 2R043 3BPSA 4LO7A 4A7YA 3POFA 3JCIA 2B9UA 5CADA 1RJ7A 2AR6A 2JKBA 1W9TA 3B69A 3OUHA 5CNAA 1YFWA 2B5HA 2YYOA 1UOJA 3S6PA 3VKFC 3TWIA 3AKPA 3AMNA 4BPZA 1JZ5A 4HT1T 3OD0A 2P6HA 2VMCA 2YPJA 3BPZA 3EO6A 3AYAA 2DWRA 2PHLA 2RS51 1HRV1 4O9GA 1AX1A 1EUTA 3O0VA 4CDUC 1XSRA 1Y4WA 2V5YA 3N35A 3A7QA 3NJZA 4J25A 1PMIA 3I2KA 4JDNA 4LE3A 3AKTA 5FZMA 2VOKA 4IEUA 2WYFA 3VZOA 5GLVA 2WLQA 4CDXB 2QDRA 5FYCA 3K75B 4YW4A 4XHBA 4C0BA 4ZKTB 1W8TA 1G9DA 2YMZA 3KMHA 3FE5A 3RZMA 2EAKA 2VXRA 3ZSEA 1MVEA 2JDAA 3KVAA 2E63A 2W52A 4I2OA 4QGLA 3T2QA 3MW4A 4NIHA 1UQXA 4JX0A 2WRAA 3WDUA 3IKWA 3ZYFA 1ZRIA 3UETA 3H8OA 1XYPA 5FZFA 2CGNA 5JZGB 5FQ0B 2RVAA 3ZFEB 3VGIA 3JU9A 1VBD3 5KWRA 3I3MA 3AP9A 1O3QA 3R4UA 1XNKA 3SEEA 4DUVA 1W90A 2B7YA 2WS92 3M1HA 3T3YA 3ROUA 1RUD2 3IIAA 2H0VA 3KF3A 4Z2AA 1QOTA 2ZMKA 3PTYA 5FZEA 4CCKA 1NKGA 3D6EA 3CKHA 4J1WA 4PDWC 4D3WA 5K9YA 3VZLA 4WZFA 1AR73 4XILA 4A4AA 4RA0A 1NCRA 2HYXA 1GNHA 2RR11 4HLTA 4HVRA 3UKVA 1IQAA 2WZR2 4UWDA 3I2JA 3LFMA 2OPWA 4U2AA 2EAAA 1J58A 4MHRA 1HRV3 1O59A 1AL23 5J36A 2Z79A 2W08A 5JSOA 1RUC3 2GN3A 4BQ3A 4YLZA 3VBSA 3QH7A 2ZKLA 4CDQA 2PTMA 4C8DA 1VIWB 2VCAA 4ISQA 1F15A 2BEOA 2WN3A 1JYIA 3ETQA 2QQNA 3VHOA 2A75A 2ARAA 3L2HA 3DPRB 1URXA 2LROA 3RVHA 5ACA3 1RUG3 4CUCA 3HIFA 2JICA 4GIQA 1SBDA 3BALA 2GDFA 5A3UA 5KXDA 5KR7A 4R9DA 3OBAA 2ZGNA 2X8KA 3WG1A 4AYUA 5FREA 1WW7A 3NV3A 4JQTA 4MX3A 4YVSA 3RFRA 3W5MA 1B35B 1SPPA 4CP2A 4QHZA 2G19A 1QXJA 5JAXA 3TNQA 4GH4C 1S0JA 1N1YA 3S0MA 4N90A 5FO8B 1L7LA 5A3PA 2Y33A 3HVDA 3ZVXA 4Y1ZA 3RYRA 2CL2A 5F5AA 3I3DA 3CF6E 2NZ9A 4ASMB 5HXVA 2J1EA 1IPSA 4K8FA 1GZ9A 1RVF3 4QKBA 3SH4A 3ZFFA 4UF0A 1R081 3VDBA 3KV4A 2WFF2 3HN1A 1UY1A 2N7GA 2BFUL 1JZ4A 5E88A 3KHBA 4JHTA 5IUQA 1ODMA 1CESA 3RZKA 2RV9A 2HLEA 2XJPA 4CUAA 1AR81 1EPWA 1SBFA 3UESA 2KR2A 3GYDA 4JHZA 3ZN4A 3H1YA 1QF3A 5IVYA 1C4RA 3GZEA 3LFIA 1MS4A 4FFFA 4XPVA 3U10A 2ZHKA 1LHWA 4BK5A 5FO9B 1WCKA 1OT5A 3WOGA 1ASJ3 2PQQA 1ND2B 4AE2A 2EIGA 4ASKA 1O6UA 4BQ2A 1JXNA 2ZGUA 4D6QA 5L9VA 4UW4A 3LZZA 1Z7S1 3RQ0A 2QQIA 1MS0A 3WR0A 5CFDB 3U14A 1S0FA 3GBFA 4MADA 2H6CA 4WM8B 3ZYJB 1GICA 4Y24A 3FBMA 3PNAA 1W0OA 2H0BA 5FOBB 2WDBA 2DVGA 3POWA 3VKNA 2G9GA 1W6QB 2VNOA 1RJ8A 1I5PA 4TN7A 2F17A 3M2MA 2D5HA 3RS6A 2XG3A 1JOJA 2JKXA 5IAVA 3PMEA 1UN1A 1J3QA 4LIUA 5I8YA 1OFSA 4QPGC 4EN0A 1RUJ1 4ZXEA 4LBJA 4NE9A 3BIEA 1K5MA 2WS91 2WINB 2ZAAA 3FLPA 3TEYA 3JQXA 1RUD1 3EMRA 4DY3A 2OUJA 2Z5WA 1W2AX 2ATFA 1AR83 3KQRA 5FXVA 4HFSA 3ELNA 4GA9A 3TN93 2QQMA 3OUJA 5FO7B 2ARXA 4CUGA 1JYVA 2BGOA 1WKYA 3DL3A 1ONAA 2XKOA 4ATEA 3BU7A 2VOWA 2WZR1 1RUF2 2VOTA 1HV0A 4NHYA 2X10A 5A32A 5CB7A 4FCAA 5DZEA 4Y1UA 3ZSJA 1SLBA 3NAPC 4XUNA 3T4VA 4FFGA 4FTBA 3DYMA 1AYM2 1YFXA 2RM22 2YC0A 3LAGA 3WDWA 3NV2A 2DVBA 3AZZA 1GR3A 5JMCA 4MO3M 4K8RB 4JDMA 2BVVA 4QX3A 1TME2 2VBDA 1KFXL 1DYKA 1ALYA 1DZQA 1AJKA 1GFF2 4C91A 1NCQC 4IV3A 1UIJA 5I8SA 4LKSA 4C90A 2Q5TA 2WO1A 3IIIA 4KWUA 4NIDA 3U1XA 2G1MA 2YPDA 5DUUA 2IXHA 4OI1A 2PN5A 4OFGA 1WCQA 2OQ7A 1I1EA 2VMHA 3VBSB 2JEMA 1PZ8A 4AVSA 2IUWA 5ABJA 3MIHA 5A3LA 1Q43A 3HMYA 2JB8A 1IS4A 3POJA 1OPMA 4PF5A 4YW7A 3S30A 3WX5A 4LQRA 4YG3A 4QU1A 2WO3A 2X5IA 1FXZA 5ANNA 2QQKA 2RDRA 3WF1A 1DQ0A 3WW2A 2A6XA 2WZR3 1SPPB 3POEA 4NJ4A 2UURA 3KCYA 2WFF1 5JSPA 1KITA 3J8F2 3SC7X 3T2OA 1W03A 2P3YA 4XJ9A 3PVOA 1WMFA 1FAYA 1X8EA 5FKBA 3WQ7A 1OPOA 2OXBA 5LK7B 1FPN2 5IK5A 2XBO2 2FZ2A 1UXXX 2YY1A 1GSLA 2D6KA 5CA6A 3DECA 1LU1A 2DCYA 4O9EA 4AI9A 1LEMA 2HWD2 5F5CA 4FPHA 1W2NA 4MLOA 4FP2A 4Q27A 4Y22A 3WEZA 2Y64A 1Q8SA 2JXAA 3AZYA 3DF0A 4QPIA 3AXEA 2VNRA 4UAPA 4COUA 3OEAA 1BVVA 4NIIA 1X7NA 1CAUA 1U12A 1W8FA 1AXKA 3VD3A 4AI1A 4BLJA 3VBUC 2W1QA 1W2TA 1KRIA 4HANA 1JH5A 1KS5A 4P9WA 4KI5M 3M3QA 2VMIA 3AZWA 2A6VA 4N53B 1VBA2 4KU7A 5JWPA 3V0AA 3OUIA 1IGOA 2GU9A 2R1BA 3HT2A 3AX4A 3FHAA 4QT6A 1F9KA 3HBZA 4P00B 1BKZA 5DDJ3 3WP6A 1FV2A 4COWA 3UNPA 4CPBD 4RYDA 4QKDA 1WUVA 2GZWA 1DLCA 3E6BA 2IXIA 4ZU7A 4OQ9A 4FQZA 1UPSA 2E9QA 2WFF3 5E8AA 2JG8A 1OH3A 1PX3A 1U5XA 1TNRA 2W95A 3K3OA 3VD5A 4AI0A 3ZMOA 2CYFA 1VR3A 1V6MA 4XUOA 3CHXA 1XPWA 1ZREA 2YBPA 3RNSA 3CBNA 3E5XA 2MHFA 5C4WB 4QXBA 4WVVA 4Q0QA 4CDWC 1OFNA 3H8RA 4COZA 5C8CB 3U11A 5CEHA 4HBNA 4UBGA 5DUXA 4AVCA 3JBG3 1H4HA 1YFUA 2Y6LA 1RUF1 2JDPA 4LLFA 2X53S 1XJAA 4XJWA 3B3QE 1TMF3 2HBUA 4E4ZA 3UT0A 3INAA 2Z69A 1K5MB 3HQUA 1XNCA 1QDOA 2Q8CA 5HCFA 1AHSA 1AYM1 2RM21 1ZBE2 1YQCA 4O65A 5FLJA 2P1BA 4YM3A 2WNUA 3ACIA 3B94A 1QWRA 3IBMA 3R4SA 5IVJA 2J1AA 4Q4X1 3AYCA 5A7WA 1AF9A 1TME1 4YM1A 4CXWA 1W3XA 4BQYA 2PLV1 3RGBA 5JDBA 3K4AA 1JU4A 4AF9A 1MR5A 1BJQA 5T5OA 3VV1A 1J1TA 3VBOB 1PX4A 2C0ZA 1W8OA 2FMYA 1WW4A 2I2SA 3GJAA 2HH9A 1PM7A 4AZZA 2WQZC 4GMP3 1U5YA 3Q8BA 4OZXA 1D2QA 2ZBJA 1O8PA 1F4HA 1I6XA 1WLDA 2VUAA 3TRSB 3ZX7A 4JGYA 4IV3B 1BBT2 4HKOA 1EUUA 3PJQA 4AVVA 4IE4A 4A3XA 3V0BA 4FAHA 3SCHA 1C5IA 5CKQA 4CEWC 1Y7BA 5BNPA 3ECQA 3LSEA 3PMSA 4B29A 2R0FA 1SACA 4AVAA 4ES8A 2P2KA 3LD8A 5HCAA 2YG0A 4B4QA 3AJZA 4FOWA 1VP6A 1WCUA 5JUVA 1GANA 1MEC2 4IESA 2OS2A 3DCQA 4N9IA 1FPN1 2ILMA 2ZABA 4COVA 5HBAA 3VD4A 1LOFC 2XBO1 1ND3A 1COV2 1EAH2 2ZXQA 4XHXA 3NNJA 1W6NA 3N3HA 4Q5OA 3ST7A 1IPKA 1D4VB 2HYKA 1VPHA 2BYVE 2VPVA 3KCXA 2E6VA 3T0DA 1GU3A 4KWJA 3ZM8A 4XE9A 3RJ2X 1PIV3 3LIGA 2ZJCA 4RSUA 2D6LX 4D6RA 4M3CF 4A44A 1CVNA 3NL1A 1HKDA 1S0DA 2AACA 5FYSA 4N43B 1WMXA 1W3VA 1W6MA 4XW3A 4NPRA 4BOWA 1SLTA 4LPLA 4AI8A 3BYWA 1PM4A 1XXNA 2BNNA 4IEYA 2QTWB 4Y22B 1MQTA 5GZCA 4O61A 3B02A 4QPIB 3VBFA 1CAXB 2R063 5CFCC 4OZOA 3CJIA 5BNOA 4FSJA 1SDWA 4FPLA 3GGLA 4CCNA 4P02B 3NKGA 2ZX3A 2RE9A 1H8TA 2JDHA 3RI9A 4EWAA 2R073 1DU3D 4P08A 3POIA 5CAZA 3J8F3 3Q8AA 3EYPA 5FZBA 4DY5A 4LUKA 3V0AB 2HWF3 2YC2A 1GP5A 4E2QA 5K8SA 2ZX1A 1LODA 3IMNA 5FMBA 4W6YA 5LA9A 1MZFA 3EHKA 3S7EA 2LW8A 1WD3A 3E5QA 3THPA 3VN4A 2VULA 2RS33 4N9HA 2QJVA 5BNNA 2BQPA 2FBEA 4EJRA 2HWD3 2D6PA 5C33A 4IEOA 1NA1A 4TSVA 1RC6A 1W6PA 1RUH3 1RXFA 2XJQA 2W1UA 4FI9A 3UYJA 4WVWA 2PYTA 1MS3A 2V73A 3VDDC 2WZEA 4PLMA 5IVEA 3WNPA 5JXJA 1X9TA 1S55A 5F2WA 1WLWA 2B45X 1FOD2 3AYEA 4ZS2A 2VCMA 1ZBE1 4WVZA 3LIHA 4BQ4A 4LBOA 4CU8A 5FOJB 2TUNA 4DXZA 4YSFA 2DUQA 2VTXA 1VBA3 1QQP2 1ZVFA 3NVCA 5HPOA 2VZRA 3AFKA 1RGSA 3ZXDA 4BMEA 2WNVA 2F4PA 1J84A 4OHYA 1KJLA 3PUIA 2XLFA 2WZPP 4KU8A 4LITA 1V6KA 1LCLA 3FJSA 5D8AB 3AP6A 1LHVA 1W99A 2R042 3RSJA 1S0BA 5D2AA 4D6SA 1LB2A 1GNYA 3ON7A 1US2A 4JV4A 1LHOA 1ENXA 2GMMA 3PUHA 1F35A 1H6YA 4ZU5A 3M3OA 5FP8A 3WD5A 4A41A 1LNSA 4XMIA 2PXJA 3AVRA 3EJKA 5A7WB 4FPJA 1UYXA 4HPKB 5FYTA 3SQOA 4C1WA 3ZFGB 4RL7A 1C57A 5A6ZA 5KBFA 4Z92B 2W5FA 4UT5A 3WDXA 1RUOA 2MPFA 4XQDA 1BBT1 1YJKA 5A80A 2ZPXA 2JG9C 4MOAA 2CDOA 4NWVA 5A33A 2WIIB 1W8UA 1GLHA 3AKQA 2QQUA 1RHI3 1N3OA 3MW2A 1H1IA 1V6JA 1ULCA 1HJFA 4B1LA 1IKPA 1MEC1 1XRUA 4LORA 5CYYA 4BXSV 1ZBE3 4JGYB 1S0IA 1EAH1 1COV1 5FAXA 4BDVB 2OQ6A 4FXKB 1FI2A 5F2SA 2BW8A 5BNPB 1ZRFA 3MUY1 2BERA 4XXPA 2BVBA 2HKXA 3HEIA 1CZTA 4EWDA 3AMMA 1YFYA 2VUCA 4JKKA 1E5IA 2GC2A 5IT6A 2WWJA 4KQ7A 1XU1A 3NV4A 1XQNA 3AZXA 4CDXA 2QNKA 1ND3B 1AR72 4E9KA 1Q8QA 1RINA 1PVC1 2I74A 3I2HA 2B39A 3N7JA 1SG3A 1W6NB 2JD4A 4XZPA 2VOVA 2XUEA 3ILFA 4CEYA 2W2IA 4WZCA 3AZVA 1OQEA 2BWAA 1OOPB 1AL22 2WA3A 5FZLA 3VBRB 1RUC2 1S2KA 4ZHNA 1YO8A 3B9CA 5C3OA 5FQ0A 2OKXA 1WBFA 3ZFEA 1DFQA 1RIRA 4GAZA 4GWMA 3LOBA 2TNFA 4XDQA 1OD3A 3I2OA 4FT8A 1Y9MA 4NPMA 1JI6A 4SBVA 2FZ1A 2WFPA 5GLUA 4HN1A 1REFA 5ACA2 1AL0G 3QCWA 4KG8A 5FYVA 2SBAA 3MIFA 4WBBA 1MQTB 1W6OB 3GBGA 4XOGA 2O8OA 3VBFB 1HW5A 3ACGA 4BCUA 3MBWA 4HMZA 3PTRB 3CJIB 4H14A 1O7FA 4LO6B 4QX0A 4S2DA 5F6LB 1CX4A 1H8TB 5IK4A 4WV8A 3T0AA 4AQ6A 2HBTA 4ZZ8A 2OVUA 1QJX3 2ZGSA 1O4TA 1FOD1 5LK5A 1YLLA 2PHFA 5I0SA 2VH9A 1RVF2 1GZWA 3CU7A 4Q2FA 3WHUA 3WNOA 1MS5A 1QQP1 3ZMNA 3WNXA 1GUIA 4MXVA 1CWPA 3Q8CA 1OF3A 3H3LA 1T6BX 1BXHA 1NA1B 3M4FA 3ZLIA 5JLVA 4Y5Z0 5L36A 1FMD3 1U5IA 2RJLA 3DYPA 4IV1C 2YHJA 3PUAA 1H4GA 2ADDA 2DU0A 2R041 4AQSA 1B35A 5BV6A 1PNGA 1UZVA 3I3EA 5KHGA 4I01A 4Y1YA 1QH7A 3B5LB 4Q8LA 1UKGA 2Y34A 3ZXEA 5F8PA 5FKCA 1TVGA 4QD2A 4LKEA 2O14A 1H2MA 4ET7A 2P37A 1WA6X 5FPVA 3Q8EA 2JD9A 1E5RA 2WZ8A 4UFHA 5JPNB 3O1RA 3ES1A 4UFJA 4Y26A 4AEKA 1ASJ2 1WW5A 2ZCWA 4O7XA 1BMV2 4W8JA 5K0UA 3SLIA 2PA7A 5L19A 3O1TA 4URTA 3SKJE 3WW3A 5DZFA 3ES4A 1D0HA 1LRHA 3POSA 3ZKUA 5FBZA 4IEPA 5FYHA 1IG0A 2ZHLA 4JRAA 2D6OX 3RRDA 4EV0A 3FL7A 2WNEA 5EYXA 4PI0A 2XLGA 4DINB 3ZXKA 4PT6A 3KGZA 1SCSA 2VZ1A 4GULA 5FYYA 3OY8B 3J7MA 3LF7A 4FQ4A 1BEV2 4XFCA 1AJOA 3BODA 3B01A 4QQPA 4YW6A 1UNBA 2A70A 2C9AA 2YU2A 2ZX4A 3LCPA 2ORXA 4XFIA 3CL1A 1W9YA 4UYBA 2VECA 1ENSA 2A73B 1OMIA 1QKQA 1MZ6A 2BWCA 1VBD1 3O1VA 2W68A 1LU2A 3ZYBA 5IVFA 4WVMA 4LBLA 2CHHA 1PGW2 3VD7A 1ND2A 4HOOA 4QKNA 4B7KA 1UMIA 1Q8PA 5APAA 5C9AC 1YJLA 1HN1A 3VBHC 5L73A 3CIHA 3ENRA 3KQ4B 3TN92 2WT0A 4NUBA 5CFDA 2PHWA 3H50A 1AR71 1G9FA 1D0GA 4L9BA 4CU6A 3CNAA 5JMOA 3KV5A 2ETEA 3GDBA 4WM8A 3O1OA 3E97A 5F1RA 3I97A 1F2NA 3DUIA 4GMP0 1W6QA 4AEDB 5KC6A 1PK6C 1AL21 2E32A 4HK8A 3BCWA 4BB3A 1RUC1 2XL7A 4HKWA 1LENA 1NE4A 1VMJA 4LBQB 3ZIXA 3O0XA 2DTWA 4QU2A 4XABA 1NQJA 4AAXA 1W06A 1JMUB 2PHDA 3ZXLA 4JKMA 4S2FA 4AHWA 1OHFA 1R093 5J98B 1OC1A 1O5LA 1DHKB 4W65A 4AFDA 2O1QA 2C1FA 3C7OA 4QGMA 5DAXA 5FY8A 4CEYB 5A7QA 1C5HA 5FP9A 4EN8B 3CZJA 1RUG1 4YPJA 3RG0A 5ACA1 4L2NA 3CZUA 3JUUA 4A3ZA 5LY1A 2OYZA 1UY4A 3VL8A 5FPBA 1TNFA 2X05A 3N7LA 4XFAA 4OLLA 2NN8A 3KHCA 1Y9GA 3A22A 1V0AA 3IAQA 4S2HA 4A6SA 5C8WA 1HB2A 4AHZA 4P9XA 4QM9A 3VL9A 4PBOA 2RHPA 5KXCA 3GF6A 3WY6A 2W9XA 1DZTA 2CTVA 1DQ4A 1AR63 3I4IA 2DCKA 3WLUA 4NVPA 3DPRC 1J3PA 1ODNA 4XDOA 1RVF1 4Z82A 1UMHA 4KGGA 2GNTA 3PVBB 4CZSA 1US3A 3B7MA 3WG3A 3THCA 3IDCB 1XNAA 1RMU3 2E33A 1ULDA 4DQAA 1OUSA 3O14A 4X8PA 3PJYA 5FDBA 1OI6A 1OKOA 4FPEA 1Q5OA 3HN3A 1KJRA 4RGAA 4BM8A 1S0GA 4XF0A 1GWKA 2BTVC 4JVAA 1CAVA 2EIEA 3LQCA 4KH9A 5EJ1B 4MH0E 4AEMA 4QWNA 1QNWA 2WQ4A 3ASIA 1GZWB 4XUPA 1A3KA 1GZTA 2VTFA 3MIBA 3WNMA 3S57A 2GMEA 1CIYA 1Q56A 1HRI2 3U4SA 4YW2A 1PHMA 4DFSA 1FATA 3ZYPA 5IAXA 4UFLA 1ASJ1 3MGUA 1BMV1 4LOSA 2ZMNA 4QMAA 4RGGA 4YVWC 3NJYA 5DG1A 2ZOEB 2BRTA 3S7IA 1ZM1A 2BUKA 1WGPA 4EQVA 4OULA 4NRQA 2Q1ZB 5LWBA 1P8JA 1SFYA 4R4ZA 1DIWA 4RQPA 1MZEA 5DDJ2 1BEV1 3SMHA 4BQ1A 3GZTB 5K0UB 5KHJA 5JIUA 5F9TA 3LA7A 1CIWA 3WQBA 1LKNA 1VBC2 3WVJA 3ORJA 3WUCA 1XBFA 1CONA 1SLIA 5L7OC 2ZGOA 5FYIA 5IW0A 4CP9B 1V6OA 4JZRA 1AR93 3OF1A 1W28A 1QY4A 4RR3A 3U07A 4YM2A 3QOPA 3TBDA 4BISA 2JE7A 2OA2A 1OLQA 3SCFA 3TN91 4N53A 5HV0A 3MIEA 1SDDB 3LDKA 4LBMA 3JBG2 4EWEA 1M06G 4XURA 2ZA9A 3WUDA 5CBLA 4IE5A 1TMF2 2ET7A 4R4XA 2GP3A 2IXJA 1MZ5A 4WVMB 1ZRDA 3K3NA 5GLZA 1PO13 5EZWA 4H7MA 4QAWA 5A7NA 4LO8A 4MGZE 1YXWA 4GH4B 3BN6A 1UZ0A 2W1WA 3WNKA 5AFBA 1DQ1A 3O7OA 4CP1A 4D8MA 5FMOL 4YARA 5A3NA 4TTGA 1AVBA 2DDUA 2ZEZA 1FNYA 3HR9A 4CXXA 2XR4A 1RUI3 1WMEA 3QACA 4BQXA 1H6XA 5T52A 1W8NA 4AFMA 2IVIB 5FP3A 5C4WA 3PU8A 4J1XA 1R64A 2UY9A 1POV3 1BEV3 2J1RA 2OW4A 3R05A 4I0WB 4Q26A 5FZKA 5C8CA 4GQ7A 4PQQA 2W46A 1MACA 5IFTA 2MEV2 2D5FA 3OBTA 1VBB2 4V1PA 3BGAA 3WINE 2XVGA 2WABA 2RG4A 1V70A 2CWMA 5FJKA 1OBNA 3FHIB 1E5SA 4B3NA 4OI0A 4HVOA 1W04A 1OLRA 1OVSA 2DF7A 4XF3A 2K46A 3W58A 4LUMA 2QQVA 5H9QA 1AX2A 2H6BA 2PAMA 1KS4A 4NAMA 1NCRC 3O5SA 5HCBA 1LOGA 2YGLA 5T5JA 3ZDVA 2WNOA 4K20A 4R9BA 1X8MA 2WYSA 3AKSA 1GQGA 1QJFA 1PZ9A 2J1UA 3MFAA 4HKLA 3ZSLA 1JHJA 3IMMA 4P5YA 1VALA 4YWAA 5I0DA 3VBOA 2W87A 4P9JA 4FAGA 4XFBA 1SLLA 5JPMB 1CJDA 3VBSC 4CDQC 2DCTA 2BOIA 2JDKA 3H9AA 1AX0A 2QQOA 3SH3A 5JXHA 2WLPA 2ZEWA 3H42B 3O1PA 1CR7A 5F7UA 1BZWA 4LJHA 4CDWA 2DYCA 4YNIA 1PIV2 2R7EB 2ZGPA 1HRI1 4UI9L 5I0TA 5B4XA 3BTZA 3PUSA 5I0RA 2Y6KA 4QPGB 1SEFA 4YVSC 4ZY9A 4Z2WA 3AL6A 1T6GC 3LA3A 5DQ0A 5FY5A 1REEA 4XQ4A 2Q1FA 1CAVB 4DZGA 3T1LA 2D43A 4CP0A 2C26A 3RI8A 3RZGA 3AC0A 1W0PA 4AGVA 3K2OA 4BQ5A 1M4WA 1UD1A 3P3NA 5DDJ1 2R062 3H7JA 2QDNA 1KFUL 4AI3A 4GALA 1C1LA 4CCEA 4CUBA 3ZFFC 3PHMA 4GWNA 1JW6A 2R072 3NAPB 4FBFA 1ZZCA 3BUCA 1ACCA 4EROA 2VW0A 3FMGA 2R49A 2HWF2 5FMCA 1G8WA 3C8XA 1VE0A 4OHXA 3U75A 4A6OA 2E7AA 3ZR6A 5JOYA 5FV3A 4F7ZA 5IK7A 5FTTC 1G6NA 4N43A 2O8QA 4RQPB 4XXAA 3ZXFA 1QXPA 3G7DA 2DTYA 3I59A 3MPPG 1SMVA 2FDFA 2RS32 1YQ2A 1WA4A 4NRMA 1GZCA 3RJRA 3CJXA 1W8WA 3JBG1 3NJVA 1K12A 4NRPA 1RUH2 1HRI3 1POQA 3OGJA 3A21A 3SEPA 1OXCA 1QJU2 1CAXA 1TMF1 5CKNA 4DUWA 3DXUA 4IERA 1WMDA 3MPBA 4RR3B 3ZSKA 4EZ4A 2Y26A 5DPNA 3TEWA 1NLRA 3GHNA 4OMDA 4XJAA 2WR9A 3J9SA 4RFRB 4YG0A 4YGBA 3ZXJA 4ARXA 1HQNA 5A6YA 3F2ZA 4LULA 1DBNA 4QB2A 3I2GA 4KNCA 4P9LA 1LOFA 3T2TA 2VL4A 3J7NA 4PCRA 1WW6A 3H3UA 1I3HA 4EN7B 4LTAA 4DXSA 5FZHA 3KV6A 1Q8VA 5CISA 5GLTA 4QXKA 4DUXA 3HNBM 5BYNA 4AFCA 5FY1A 2QKDA 2WT2A 5A3TA 4CYDA 3FFZA 5A3WA 4MHUA 4IE7A 1VBC3 2R32A 4GMP1 4XEZA 4CRQA 5F6KA 3QLQA 4QQ2A 3AP4A 4A2UA 4PI2A 3ETPA 4X6QB 4NN0A 4JC1A 1BK1A 2D6MA 4LR4A 2YBKA 1HX6A 5SV5A 4DS0A 1KGYA 3M70A 4UW5A 1VMHA 4JGZA 5FZOB 4QXCA 5LW9A 1YNAA 1UXZA 3OGRA 2EXKA 4Y5SA 4FOQA 5JCTA 4XJZA 1JYTA 1DGRA 1LOBA 2ZGLA 1RHI2 4RS5A 2WAAA 3I2IA 4PBPA 3TYJA 2F6BA 3LEKA 4MGSA 3VBUB 1K5JA 4E8CA 3I54A 1H1MA 2AH2A 2VR4A 4LKFA 4OUMA 3KCCA 4Q29A 4G4FA 1UIKA 3OGVA 5D8AA 3TB0A 1HB1A 1FT9A 1SBEA 3CLPA 4COYA 2MNGA 2RDQA 2Q0AA 3ILRA 5C3PA 4LT5A 2WWUA 4K9SA 2GH8A 4HPKA 2OUHA 4Q4V3 4QPYA 5FLHA 4BA6A 4NROA 3RZZA 3ZFGA 2BOJA 3JXSA 3P1IA 1PIV1 1YQ5A 1VBE3 1YQ6A 2A6WA 2WQ8A 4ZONA 3WXPA 3D8CA 3N9NA 4JCKA 4WM7C 3UV9A 5FPXA 4CE8A 1LECA 1N3PA 1HJGA 4AFAA 3RZJA 1Q8OA 3POBA 1A8MA 2MEV3 4CVUA 5ABJC 4XUTA 1VBB3 1YC61 3WNLA 5JR7B 3MV01 4DNYA 5GZEA 1W8ZA 3BKZA 3WW4A 1LHNA 2PHRA 3NMBA 3AYDA 4M4PA 4U36A 5FRAA 4CDWB 2HWE2 3JD72 4NHLA 2VOXA 4BMBA 3FLRA 5A7OA 2R061 2JE8A 2X5IC 3RMXA 1C8NA 2BFUS 2Y60A 2QZ3A 4ZZ5A 5BY5A 5T3NA 1IOAA 4CU7A 4W6XA 5J1XA 2FD8A 3SCGA 2VQTA 1HXS3 4EE2A 4Q4Y2 2R071 3R0RA 4E2GA 1DGWX 3J8F1 2VZPA 2GSYA 3HD8B 1IPJA 1QJY3 4Q8KA 1SCRA 2HWF1 4UOJA 5EJ3A 5B2GB 3LGRA 5M0TA 2XMLA 4IXLA 1SQ4A 2D3SA 2VW2A 5JXIA 3GNEA 5FFOC 2DVDA 4DEQA 4EN9B 5DAPA 2RS31 3I3BA 2I07B 2WL1A 4UFIA 4XF4A 1IS3A 4I30A 3W20A 2HWD1 1QMJA 3J7LA 2W39A 2VZOA 4AGRA 1OOPA 5C71A 3W21A 1RUH1 4QPIC 1LJ7A 1ZZ8A 1RTVA 3VBRA 3H1WA 4GKXA 4F3JA 1QJU1 2GMPA 3IDEA 4M0NA 3KM5A 1JODA 1QJX2 4YZ3A 1DDLA 3TEXA 5H9RA 2TBVA 4XBNA 2E31A 3FUQA 5LZ6A 2VXJA 1N1SA 3IWZA 4KWKA 4Q0SA 3VHPA 3I59B 1MS9A 1W2UA 3PU3A 4A42A 3EB7A 4OVEA 1VBA1 3A0NA 1S2BA 5D21A 3AMQA 4BK4A 2IZWA 1UCXA 3MICA 4QX8A 1NX9A 3KB5A 1PO23 1W6OA 1FMD2 3D0SA 4IL7A 2JWPA 4CEWB 3IPVB 4GJYA 2W1SA 5JOXA 2FDHA 4M4RA 4TYSA 5A3MA 1A78A 2AREA 5FUIA 1EYBA 3RWKX 3QD6A 2JG8C 4IEWA 3THTA 4L8QA 2XKPA 2ZKNA 4W4ZA 1W0NA 2VBPA 1T2XA 2XVLA 4AEJA 2K0GA 4HL0A 1QJEA 4OYUA 2DURA 4AHXA 2EIBA 5AC92 3LPFA 4ASLA 1BK0A 2HWB2 3DGTA 4JAAA 5A6XA 2W94A 5J3UA 2D93A 3NNMA 1RHI1 4K40A 5FY0A 2AEZA 2GC3A 1SZBA 2Y6JA 4XAAA 1L3JA 5D1IA 3UGFA 1JUHA 1SFPA 1IS6A 1YHFA 1QJU3 4CCDA 2ZACA 4QQLA 3KV9A 3BTXA 1OUXA 1EV13 2R6QA 1VMFA 3ACHA 1UZYA 2AUYA 2VNGA 2WNUC 1HB3A 3BIWE 1CGPA 1JOPA 1V9U3 1ZNPA 4JGZB 4LLOA 4MV2A 4XBLA 5ANQA 3A23A 4DXRA 1DGWA 1N47A 1GQHA 3POGA 4YW5A 1XC6A 3AVSA 3D3AA 5FYMA 4RS5B 5I93A 2KM2A 5CFCB 5BXXA 4OCTA 1ZZ7A 4E8DA 4IEQA 2BZDA 1YYNA 4DRRA 3HT1A 5DAVA 2QVSB 2XQXA 3MF6A 4UW6A 3DN7A 2JDMA 5EFUA 2DVAA 1POV0 2QFEA 3H8UA 4MVTA 3TEZA 1PGL2 1CAWB 4BJ0A 1IKQA 1LOCA 2B4KA 3WF3A 4FTEA 1ULFA 3OY8A 3MLLA 1CPMA 2J7MA 2HWE1 2W0XA 2RMU2 3MYXA 1GKBA 1E57A 1YEWA 2GNDA 3AMHA 4MGTA 1LGNA 4HSJA 4DRVA 2UWAA 3AL5A 3DYOA 3OTFA 3WF0A 1S1AA 3VDDB 2PHTA 1R092 1YI7A 3K4ZA 4GXLA 1NXMA 4XYXA 5FK7A 5E89A 1RUE2 4ORFA 2BPA2 1E5HA 2V4VA 5JR2A 3ABZA 1SLCA 5LEJA 1UY0A 4DMIA 1CZSA 4DO0A 3IM0A 3M3EA 2A3YA 2Q30A 5CIRA 5H9PA 5C6CA 5C7GA 3OGSA 1RL3A 3VUOA 1C8M3 5FZ3A 1S0EA 2RDNA 2JDYA 3VLBB 4YGCA 1ZBA3 4P9IA 4QXHA 4AEDA 4AL9A 2ZHMA 2ZX2A 1B09A 5BNQA 2D6NA 1U0AA 3OCPA 4FVVA 1XNBA 4LBQA 3SKVA 1DZRA 3NSTA 1PMJX 3VZKA 2EIDA 3PUQA 1QJX1 1AR62 4QQHA 3WQ0A 4OHZA 2OT7A 2C5DA 4XC9A 5CU1A 3AP7A 3D4KA 1H30A 2AGSA 2D3PA 3C2UA 5EIYB 1RXGA 2YGMA 1YQ8A 4LBNA 2FQPA 3N7MA 4XFHA 3WDVA 4YZ2A 1RMU2 2BGPA 1MQTC 2ADEA 5IYYA 2JG9B 1F8VA 4YW1A 2C6SA 2HWE3 2VU9A 3JD73 2Q8EA 3VBFC 1FMD1 1NAEA 2W47A 4AI2A 4L92A 1V6LA 3CJIC 3ZN6A 1C1FA 1YIFA 3WDTA 5BNOC 2C24A 1QOOA 2FHRA 2QUOA 2YBSA 2VZUA 2ZX0A 3OJBA 4RFT0 2HWC3 4TLFA 2Q4SA 3V65A 3LEGA 3O12A 2WWSA 3NWKA 1UAIA 5IFPA 2PHUA 5C3RA 1S0CA 4Q4Y3 5FWEA 4H3WA 3OG2A 1O8SA 4XJ8A 4M0HA 1JU3A 1QNYA 1OLMA 4FOVA 3T30A 1K42A 1JHNA 2PELA 3V56A 1Y43B 5C5UA 5SV8A 5JIAA 1UPIA 5AC91 1CN1A 1F5FA 5BNNC 2AENA 2JIJA 2IWGB 4CDUA 1N1TA 1OH4A 3D5OA 4I3GA 2PFWA 4RGKA 1JOBA 4QDQA 3ALQA 1LAJA 4MGYE 1LGCA 2UYBA 3UGGA 3BU0A 4FOYA 1YCIA 3OPZA 5F39A 2VJXA 3C7HA 4EYUA 1HIXA 4Q4W3 5DN2A 3LB9A 4LHSA 3PIGA 2ERFA 1VRH3 2P6CA 5DZGA 2DUOA 4JRLA 2DFBA 4XACA 2IXLA 2WNVC 2JECA 2Y38A 1DYPA 3T08A 3BVCA 1ULPA 2VQ0A 2OZ6A 5GKAC 1AR92 2QQJA 3PIJA 1NT0A 4PLOA 4BQWA 3RYPA 2F4LA 2VBBA 1H9WA 4HETA 4K21A 1X50A 3R6SA 3T09A 3OPWA 5FIXA 3UGHA 4XTMA 4AOCA 2VMEA 1W9SA 2BV4A 1UOGA 4LHKA 2UY8A 2WKKA 2AC1A 3SITA 3U78A 1JUIA 5FY4A 3WZ1A 4AK3A 3FWEA 4QB6A 5C3SA 1PGL1 2EXHA 2IFRA 2UU8A 1XSQA 3FZ3A 4LA2A 4PDWA 1OLME 2LTNA 2AEYA 4OI4A 2ORZA 1NZCA 3LDBA 3WNNA 3HAGA 1YRZA 1PO12 2KD7A 2RMU1 2VE1A 3I8TA 3MEPA 3ZIWA 3L2YA 4YGDA 5AC93 2DU1A 2GNMA 4MZUA 2HWB3 2D97A 2Y6GA 1TEIA 4ZU4A 4N8MA 2NMNA 4E27A 3KT1A 4CP9A 1R091 1UX7A 4I02A 4DEVA 5GJ6A 1J1LA 1RUI2 1IHMA 3UKNA 5KHIA 1APNA 5CZKA 1XB9A 1H2NA 3USUB 4Y20A 1V6NA 1AYN3 1GWMA 4BZ4A 4CU9A 4YGEA 1UX6A 5J96B 1CJPA 4QM8A 4LEJA 5LRRA 4P5HA 1PNFA 2E7QA 2C9KA 2LRPA 4FPOB 2A7AA 2A3WA 2I45A 4JDOA 5AVAA 5FZ9A 4IV1B 4B8EA 3RMYA 4AXOA 2XLAA 4NR1A 1UOBA 1QEXA 3ACFA 2J1TA 1UMZA 2W91A 4XFFA 4GH4A 3V64A 3NW4A 4CDXC 1C28A 4IE0A 1AR61 5G05L 5LRSA 1WCSA 2W92A 2Z2SB 3LSDA 3ZXAC 2ZZQA 5EYYA 5FZGA 5H9SA 1JYXA 5FZ6A 4CEYC 2EXIA 2AZ5A 4GB33 3BOPA 3MIGA 4OHVA 3UKTA 4AVTA 2D40A 1RMU1 1PGSA 2GC0A 3RWNA 2XPJA 4Y33A 3X29B 1CX1A 5JZGC 2RMU3 5I0UA 3O0WA 4K3UA 1GOGA 1WLCA 4ES9A 3OEBA 3ZFEC 1NLSA 3TAYA 2JDZA 1ENQA 3GXUA 1FNZA 1HQWA 2VVDA 4QHOA 3FUOA 2ENRA 4ONUA 2WBKA 3DXTA 1QOSA 2IXCA 1WD4A 2V4AA 1RUE3 2ES3A 2CAUA 2CU5A 3C7GA 3PVEA 4LA3A 4MXWB 3ZKYA 4AFBA 1Z78A 4ATFA 3ZYGA 1XE8A 4ITCA 5LATA 4IETA 4IGPA 2YUEA 2ZEYA 3ZN6B 2WA4A 3FLTA 3T2PA 5FZCA 5FYBA 2D98A 2BNMA 1DQ5A 2LM3A 2ET1A 2NM1A 2WO7A 3FX3A 4D7TA 5IJRA 5C9AB 1Z7S2 3NJXA 1VB2A 2OX0A 4V2WA 3VBHB 3ZPOA 4D69A 5KC5A 4NMIA 4GKYA 2PAKA 3OGGA 4A45A 3WW1A 1BHGA 2EF6A 4NHKA 3VB9A 1JBCA 2B9VA 3P6BA 4BIFA 2QCSB 1QU0A 4EZHA 1V00A 3GZUC 2BBVA 3L9JT 2DCZA 3ZDSA 1PK6B 1OF4A 1W8HA 1J3RA 1ENRA 4CDUB 4LOTA 4FTSA 2XJVA 2DBNA 1GP4A 3LWCA 5A70A 1AR91 4L99A 1W39A 1QDCA 2EVXA 1R1A3 1RUJ2 4QPGA 2A3XA 4H2AA 1B35C 3M3CA 4RN5A 3WCRA 4D0QA 1GNZA 4PIXA 4AAPA 2EXJA 4YZ1A 1NE6A 4LK7A 1GP6A 4PQ9A 3J26N 3VKMA 2WN2A 4MGKE 4H7LA 5JI7A 2EICA 1OVPA 2JB4A 5K0UC 1NLQA 1DLLA 1PO11 1ULGA 3RPQA 4M01A 2RS53 5FZDA 2P5BA 1XE0A 5DXDA 5KHKA 4KMQA 5FZIA 4KBBA 3DKWA 3NAPA 2BGCA 2DVFA 1BCXA 1YUDA 5L9RA 4JTNA 3VZNA 2ZGTA 1F4AA 1O91A 5DUWA 4DXTA 2Y0OA 1RUI1 5IVBA 4PDWB 1JZ3A 4TWTA 4BE3A 1POV1 5FMDA 1I9RA 3VDCA 5F3CA 4YFZA 1NOVA 1OQDA 3RZLA 2GC1A 3ILNA 1NCQA 2GP5A 4M3CB 4G9SB 3W5NA 1UWWA 4Z8BA 1NG0A 1U5ZA 1XYNA 2LS6A 1RITA 5LBBA 1ND2C 3ITQA 2XUMA 4FXGB 4BWOA 1PGW1 4H55A 1LOAA 1ZX5A 3NNLA 3ZYHA 5LA1A 5F5IA 5F32A 4Y20B 3N9PA 1LR5A 5CFDC 5JSRA 3JB8A 3PLQA 4YYOA 4Y4RA 5LBEA 2DV9A 4WM8C 5A1AA 1QJZA 2VAUA 3MV11 4FPCA 1BQPA 5BPXA 3KLSA 4AQTA 5KXEA 2LALA 2EALA 2D7FA 4IEZA 4BLIA 2RR13 2WT1A 4GJZA 1REDA 3ZOIA 3BTYA 4YVWB 5LA2A 2OPKA 2R1DA 4PJYA 3A4UA 3OBRA 4B4RA 4CCJA 1FYUA 4UFKA 2VZTA 5E16A 1DYOA 2CDPA 3CO2A 4XUQA 5A3OA 5T5PA 1ST8A 4LMFA 4PIYA 4Q4V2 4IUGA 3WQ1A 3N9QA 3U0ZA 4D7SA 4ARYA 1ZRCA 1CD3G 4NHXA 3I2FA 4YW3A 3B93A 1VBE2 1X33A 3Q8FA 3FFQA 5L7OB 2FCUA 4XTPA 1RUNA 2A6YA 2FDKA 2XDVA 4M00A 5T54A 3VZMA 3PVNA 1A6CA 3WV6A 1ZYBA 1ZZ9A 5EPAA 4LBKA 5LBCA 3VBUA 4BIOA 1QIQA 2XJSA 1KXGA 4IDZA 5GZDA 4FPYA 4Q1PA 4MUVA 4EN6B 2NLRA 2SLIA 2ARCA 4KGQA 5FZAA 2OIIA 4BXFA 5A7PA 1H2LA 2V09A 3EXUA 3K46A 2K2SA 4Q1RA 4YG6A 2UWBA 5IK8A 1HN0A 4CA9A 1UL9A 4E2SA 2XOMA 4Q0UA 4JQRA 1HXS2 3RYKA 1QHDA 5IWFA 3SXWA 2C4XA 3DV8A 4BU2A 3URFA 1DQ2A 5TSWA 1QJY2 1R083 2PQSA 3VKOA 1LEDA 2FCVA 3C7EA 1VRBA 4Y5TA 2V72A 3N9OA 1DP0A 1D2SA 2LUWA 3VKLA 1GMMA 5DABA 1F5JA 4ZS3A 3D0JA 4AGGA 4INDA 5IATA 3W59A 1Z0HA 3IT8A 2BBAA 5FZ8A 5C70A 1UZZA 4XF1A 3FN9A 2XJTA 1KQRA 3OYWA 2B46X 3HJRA 3S5QA 3J7HA 4NAOA 4LNVA 4X8NA 1RB8G 2Q8OA 1S2EA 2R30A 3PURA 3IAPA 4FO9A 2D44A 1IQDC 5IVVA 3T4HB 4ISRA 1L7QA 1SHWB 4X6RB 2VTXJ 3GJBA 3J4UH 4B1MA 1GOFA 2QZ2A 2YFUA 1TQ5A 2J1VA 1XU2A 2XHNA 5HCHA 5FZOA 1Z7S3 3N36A 2XONA 3NO8A 2ZS6B 1JYCA 3KWVA 2P3IA 1PO22 2VG9A 3LKJA 2OZJA 4K1ZA 3JQWA 1NCRB 3NNFA 4Q4X2 4RQPC 4BHPA 4DB5A 4BYYA 2PLV2 4IGOA 3GALA 2GH2A 3FBYA 3H1MA 2VO5A 2O0OA 3N4MA 1GBGA 4LO5B 1DQ6A 4W6WA 1VBC1 4QDSA 3WP5A 4AWDA 2L9LA 2ZGRA 4WM7A 5GZFA 1O5UA 2K9ZA 1EY2A 1PVXA 1V6IA 1MS1A 2IXKA 4DIQA 4RR3C 2IC1A 4CDQB 2FCTA 2JE9A 2P34A 2VY0A 1RUJ3 2Y0IA 1MS8A 2PHXA 2WS93 3E1F1 2GNBA 1D4M2 1RUD3 4N53C 3U37A 2VZSA 2VQUA 1VAVA 4F83A 4Z1VA 5DG2A 1C3HA 3HBKA 4FPGA 2RS12 1NCQB 1OQ1A 1VAMA 2QQWA 3EBRA 4J6GA 3WF2A 4Y1VA 4C1XA 3POYA 3N9LA 4CEWA 5LCWL 2E51A 3IPVA 4HONA 3AB0A 4LIVA 4YVSB 5FZ1A 4R9CA 5ERLA 3MDPA 1W9FA 2A1XA 1EV12 4QDRA 5T5LA 1O3SA 1CPNA 4I0AA 4LHNA 2ZGMA 2XQRA 5E1RA 4Y1XA 3ZXGA 1V9U2 1W9WA 5C5TA 2P3KA 4Q4V1 4LK6A 4URAA 5F37A 5C4WC 5GM0A 3C3VA 1VBE1 3ZFFB 4UF0B 2R16A 5C8CC 3CEWA 4Q0VA 2QE3A 4QX7A 5KHHA 3UL2A 1R1ZA 2XWBB 3B9IA 2VZVA 2MEV1 3M8LA 4YFWA 3VZJA 1VBB1 1HQLA 2E26A 5FUPA 3WCSA 2WSVA 5EV7A 1K5MC 3JB4C 5EP9A 4KL1A 4AW7A 1WLTA 2YV8A 2WO2A 3S5AA 2YC4A 2ZAHA 3H7YA 1WZXA 2ZEXA 2YXSA 2VCBA 4FFIA 2BP6A 2DCJA 5I8TA 2ZZJA 1GYKA 4OHWA 2YFZA 4KWLA 1HXS1 5CFCA 2E7TA 2HEWF 3DKQA 4Y3OA 1H0BA 3ZPYA 4IEVA 2X09A 3ZYRA 3JZVA 1QJY1 1DGRN 4NPLA 3VBOC 5C3QA 1X9PA 4OQ8A 3AMPA 4F8AA 3SNMA 4QPWA 3OBZA 1H1AA 1HLCA 4RHV2 3DEMA 4LO4B 5FYZA 1CAWA 1IG3A 5EQUA 3AKRA 3NNGA 5J7MA 2XXZA 2VUJA 3M7AA 1C8M2 2Z42A 4L0PA 4N7UA 3SH5A 4LHLA 2VGDA 1GV9A 3G6JB 1ZBA2 4S2GA 4IV3C 1OA3A 5F5QA 1O4ZA 2GAUA 3P5BA 2XL9A 1MVQA 2NYYA 3N9MA 5IVCA 5FZ4A 1WWYA 2VW1A 4YM0A 3MLJA 1STMA 2WJSA 3VDDA 3OPTA 5LY2A 4JTOA 3GHMA 1ULEA 4QQOA 1NY72 3LOIA 2XHKA 3IZOA 4PHZA 5F3EA 3WG2A 3WG4A 2A5ZA 1XYOA 4JKLA 4OI2A 4LBQD 2YROA 4NIGA 1OSGA 1H2KA 3W9AA 4D94A 3I49A 4KG0A 3TOJA 3OYWB 2QBXA 1PO21 3IN9A 2BJSA 3KF5A 2FMDA 3ZSMA 5FK8A 1JZ2A 4META 2A6ZA 4HXCA 5A32B 2HEVF 1LHUA 2HWC2 3H3ZA 3KS7A 1UYPA 4DOUA 3K51A 2NPIA 4FFHA 1FX5A 1G9BA 2B42B 4IQPA 3AFGA 3LEIA 4N7IA 1LOEA 5FPLA 3FHQA 2RDSA 2P17A 4N43C 4NIAA 2XWJB 2FDIA 2VC9A 5EJZB 1D4M1 5FXZA 4XDPA 1TE1B 3BOWA 3IB3A 3MF9A 4PIZA 4QX1A 3CDZB 1UOFA 2YU1A 1A34A 2RS11 1W2OA 2XB6C 3AP5A 3PDQA 5FYUA 2JG9A 2VVEA 1JTZX 4WM7B 1G9CA 2VQAA 3P3PA 5FWJA 5FMOS 1JZ8A 1JS9A 1RUF3 3VHRA 4HVQA 5ABJB 5CG9A 1EV11 2VZ3A 1WBLA 5J09A 1K45A 4Q4W2 2NP0A 4MYEA 5GZGA 1VRH2 2R0HA 4E4DX 1V9U1 2VMFA 4QX5A 1AYM3 1UKRA 2RM23 2PMWB 4GWJA 2J42A 4V2VA 5ISLA 5FP4A 2Y8KA 1AXZA 5FBJA 1QGLA 2WUHA 2X5IB 4GWIA 1YI9A 4Q4X3 1TME3 2ZTNA 3SHRA 5HXMA 1JZ6A 3T0BA 2PLV3 5K4LA 1UU4A 2WSUA 3WT3A 2Q1MA 3LPGA 4I09A 2Y6FA 3ME2A 3QBQA 1DF0A 1PMHX 3WF4A 3E6DA 2XVKA 3AXDA 2VMGA 3WP4A 1H9PA 5T50A 2XJRA 4XF9A 3ZN5A 1LESA 1UU5A 3KGLA 1PVC2 5FP7A 1F31A 1XOYA 3ACLA 5F3GA 5A7SA 3CMGA 3LDRA 4QB1A 3MLKA 4P9GA 3GZAA 1AXYA 5JVVA 1ZRRA 1G7YA 2JX9A 4JGZC 4BH9A 2TEPA 1X36A 1D4M3 4I3PA 4K1YA 4XJUA 2XH6A 3OB8A 1VAKA 5FXWA 4AG4A 1Y9QA 1DGLA 2JDUA 2RS13 3KD4A 4RS5C 4UXAA 2P3JA 3ATGA 1UYZA 3I2DA 3KZ4C 4XIKA 1CAUB 5DAWA 3HNYM 3O1SA 1O4YA 3F95A 5D8AC 5L9BA 1G86A 1AYN2 1K3IA 4NWWA 5F3IA 3OOXA 3LE0A 4E4HA 5AVPA 1AZDA 4RHV1 3I7DA 1FPN3 1Q3EA 4LKDA 5FCCA 2UWCA 1QXRA 2XBO3 5FLIA 3WSOA 1QH6A 4AHYA 5DMYA 1UO9A 2CNAA 2G9FA 4XCBA 3ZFGC 4MG2A 5JOZA 1C8M1 1OA4A 3I3QA 1ZBA1 2RJ2A 5FJHA 3ZR5A 1KDMA 1N1VA 2GN7A 2ZHNA 4XCAA 3VDAA 1ULOA 4IEXA 2JG8B 5A1FA 5LB6A 2YZ4A 3RDIA 3ZO0B 4CTEA 3WP3A 1KDKA 1NY71 4QX2A 2XJUA 3UJQA 4GB32 4PLNA 4XMAA 3USUA 4CPBA 2J22A 2Q8DA 4MSVA 1BLZA 3D82A 4JGYC 4L97A 2J1SA 3JD71 1A8DA 3MFCA 2Z4FA 3SISA 1G9AA 2JDNA 4KBZA 5FUNA 5BNPC 2HWC1 3WDYA 4CCLA 5FPUA 4XQWA 3MIDA 4IV1A 3WHTA 1TG7A 1UF2C 1NQDA 2QQPA 3Q9OA 4Q4Y1 2VNVA 2CGPA 2WNUB 3B00A 1LTEA 1BVP1 1AUYA 4MGIE 3ZYIB 1ND3C 1FV3A 2G9ZA 1VLNA 3H0OA 3MI8A 1OURA 1UW8A 4Z07A 3THDA 5JI9A 3O1MA 1HDKA 1I5ZA 3KT7A 1GQPA 1WCDJ 4OUEA 4RHV3 4YRDA 4NHMA 4FPKA 4PF1A 5JXGA 1XE7A 2VZQA 1JYWA 1Y3TA 1JN2P 2VM9A 4P14A 3NKTA 2W3JA 2VMDA 1OOPC 4HN0A 3HWJA 5CVRA 4K7JA 4ZXKA 3VBRC 3MHZA 4XETA 1YWKA 1RYYA 2ZGKA 2BU9A 3O1UA 3AK0A 1LGBA 3K48A 5A1LA 4A7KA 4E4SA 4UBHA 3AJYA 4R8HA 4Q4W1 1N3QA 1VRH1 3IDBB 1H8VA 5B4NA 5EHDA 2CWSA 4MXWA 3H8XA 5CKMA 3V0BB 1NZIA 1NXD1 3HQRA 1VBD2 1DCSA 1OA2A 2IVJA 4QGNA 1SLAA 3VD9A 1PZ7A 1KEXA 1R1A2 2NMOA 1UY3A 1L7RA 3A0KA 3BB6A 5G04L 4GD4A 4HG6B 4B7EA 1D7PM 4CCMA 1EP0A 1LULA 1IZ3A 1JYNA 1H8TC 2CSGA 3GM8A 2CV6A 4G3YC 3U4XA 3BI3A 3USSA 5C9AA 5LBFA 2AYHA 3VBHA 4DPNA 3HPNA 2IFWA 5A6QA 4MGQA 5BUVA 1HV1A 1YIPA 3TNPB 3K4DA 4Q0PA 5GLWA 4CXYA 2HJIA 1X82A 2RS52 1S4CA 1HRV2 3GCWA 1JZ7A 2VCCA 4OMCA 1PK6A 1KD7A 2HWB1 1BBT3 4D7YA 3MZHA 2RJKA 4IGQA 5JZGA 1NA1C 5KXBA 5FY9A 5FZ7A 1HB4A 2NQYA 4RD7A 4XFGA 5J48A 3MO4A 1ZZBA 3GCXA 4LE4A 3MW3A 1W6MB 3GBWA 5LA0A 2VD7A 1AYN1 4QKFA 3N7KA 3LA2A 1CZVA 4Y4YA 3KVBA 3KT4A 1RUG2 1CQ9A 2X29A 5DUVA 4CSWA 1MEC3 1XNTA 3E5UA 5J37A 1GOHA 1IS5A 2FDJA 3CQOA 1COV3 1EAH3 3NV1A 4ZPIA 2HEYF 2EA7A 4IW3A 4B4PA 3FC0A 5I91A 2VVFA 4XIOA 5BNOB 1W05A 1VJ2A 2WAOA 2FDGA 3QH6A 5JOWA 5LASA 5FPAA 3VHNA 4A7ZA 2JENA 4AVBA 3AM2A 3E6CC 3M3IA 2Y6HA 4FPFA 1J59A 4QHBA 1ZA7A 4P9YA 4YZ5A 2KA3A 2WC2A 4L11A 4IE6A 5HI0A 4UW3A 2CY6A 2CGOA 2ZMLA 1PVC3 2XGXA 4GB31 2RR12 4I0BA 4TXWA 3APBA 3DPRA 3HQXA 1EPZA 2B8MA 3UK9A 5BNNB 4C0HA 5CG8A 2ID4A 1NUKA 2JJ6A 4NOTA 1W6PB 4M3CA 4NO4A 3OD4A 1BYHA 2P4EA 1UY2A 1XNDA 2DFCA 3R4DB 5FY7A 3T1MA 2ARBA 3MUZ1 1OD5A 5EWSA 4AQ2A 1UYYA 4R9AA 5FPZA 5HV4A 3UJOA 5K7PA 1RUE1 1UZWA 1ZA4A 2G4IA 1O3RA 4HSLA 1MPXA 2YB7A 1OKQA 5LEKA 3IDAA 2A71A 4TLGA 2WNVB 2GALA 1NYWA 1GWLA 3C7FA 3K77A 1J83A 3NQHA 4CCOA 2E53A 2BNOA 3KSCA 2QQLA 5FXXA 2DBIA 4FP3A 5FZ0A 4AEDC 2JIGA 4YVWA 3BTAA 4OUSA 2PAEA 4CCCA 3LEMA 3OSDA 2ZGQA 5E6HA 5FR3A 4HK9A 5AFEA 3HOBA 4SLIA 3RZHA
chains in the Genus database with same CATH topology
1UU6A 2CAVA 4R52A 1SFNA 1FOD3 2DUPA 2D3RA 1DG6A 1R082 5T55A 5A33B 1QQP3 1ZZ6A 5EXOA 4HZFA 4K6BA 4TZDA 2UYAA 5L7OA 1R1A1 1VB4A 2KXLA 4M3CE 4YZ4A 4XBQA 3EQEA 2YDEA 5GALA 1AR82 2R043 4LO7A 4A7YA 3JCIA 2B9UA 5CADA 1RJ7A 2AR6A 2JKBA 3B69A 5CNAA 1YFWA 2B5HA 2YYOA 3S6PA 3VKFC 3TWIA 3AKPA 3AMNA 4BPZA 4HT1T 3OD0A 2YPJA 3BPZA 3EO6A 3AYAA 2DWRA 2PHLA 2RS51 1HRV1 4O9GA 1AX1A 3O0VA 4CDUC 2V5YA 4JDNA 3N35A 4LE3A 3NJZA 1PMIA 3AKTA 2VOKA 4IEUA 3VZOA 5GLVA 2WLQA 4CDXB 2QDRA 4YW4A 4XHBA 4C0BA 4ZKTB 1G9DA 2YMZA 3KMHA 3FE5A 2EAKA 2VXRA 3ZSEA 1MVEA 2E63A 2W52A 4I2OA 4QGLA 3MW4A 3WDUA 3IKWA 1XYPA 5JZGB 2CGNA 5FQ0B 3ZFEB 3VGIA 3JU9A 1VBD3 5KWRA 3AP9A 1O3QA 3R4UA 1XNKA 2B7YA 2WS92 3M1HA 3ROUA 1RUD2 3IIAA 2H0VA 1QOTA 2ZMKA 3PTYA 3D6EA 4J1WA 4PDWC 4D3WA 5K9YA 3VZLA 4WZFA 1AR73 4XILA 4RA0A 1NCRA 2RR11 1GNHA 4HLTA 4HVRA 3UKVA 1IQAA 2WZR2 4U2AA 2EAAA 1J58A 1HRV3 5J36A 1AL23 2Z79A 2W08A 5JSOA 1RUC3 2GN3A 4YLZA 3VBSA 3QH7A 2ZKLA 4CDQA 2PTMA 1VIWB 4ISQA 2BEOA 1JYIA 3ETQA 3VHOA 2A75A 3L2HA 3DPRB 1URXA 5ACA3 1RUG3 3HIFA 2JICA 4GIQA 1SBDA 3BALA 2GDFA 5KXDA 4R9DA 2ZGNA 2X8KA 3WG1A 4AYUA 5FREA 1WW7A 3NV3A 4MX3A 4YVSA 1B35B 4CP2A 1QXJA 5JAXA 3TNQA 4GH4C 1S0JA 1N1YA 3S0MA 4N90A 5FO8B 3ZVXA 4Y1ZA 3RYRA 2CL2A 3CF6E 2NZ9A 4ASMB 5HXVA 4K8FA 3SH4A 1GZ9A 1RVF3 3ZFFA 1R081 2WFF2 3HN1A 2N7GA 2BFUL 5E88A 5IUQA 1CESA 2XJPA 1AR81 1EPWA 1SBFA 3GYDA 3ZN4A 3H1YA 1QF3A 1C4RA 4XPVA 3U10A 1MS4A 2ZHKA 1LHWA 5FO9B 1WCKA 3WOGA 1ASJ3 2PQQA 1ND2B 4AE2A 2EIGA 1JXNA 2ZGUA 4UW4A 3LZZA 1Z7S1 3RQ0A 5CFDB 1MS0A 3WR0A 1S0FA 3GBFA 2H6CA 4WM8B 3ZYJB 1GICA 4Y24A 3FBMA 3PNAA 1W0OA 2H0BA 5FOBB 2DVGA 3POWA 3VKNA 2G9GA 1W6QB 2VNOA 1RJ8A 3M2MA 2D5HA 3RS6A 2XG3A 1JOJA 3PMEA 1UN1A 1J3QA 5I8YA 1OFSA 4QPGC 4EN0A 1RUJ1 4LBJA 1K5MA 2WS91 2WINB 2ZAAA 3FLPA 3JQXA 1RUD1 4DY3A 2OUJA 2Z5WA 2ATFA 1AR83 3KQRA 4HFSA 3ELNA 4GA9A 3TN93 5FO7B 2ARXA 3DL3A 1ONAA 2XKOA 4ATEA 3BU7A 2VOWA 2WZR1 1RUF2 1HV0A 5A32A 5CB7A 4FCAA 5DZEA 4Y1UA 3ZSJA 1SLBA 3NAPC 4FTBA 1AYM2 1YFXA 2RM22 2YC0A 3LAGA 3WDWA 3NV2A 2DVBA 3AZZA 1GR3A 5JMCA 4JDMA 2BVVA 1TME2 1KFXL 1DYKA 1ALYA 1DZQA 1AJKA 1GFF2 4C91A 1NCQC 4IV3A 1UIJA 5I8SA 4C90A 2Q5TA 5DUUA 2IXHA 4OI1A 2PN5A 4OFGA 1I1EA 2VMHA 3VBSB 2JEMA 1PZ8A 4AVSA 5ABJA 3MIHA 5A3LA 1Q43A 3HMYA 1IS4A 1OPMA 4PF5A 3S30A 3WX5A 4YG3A 2X5IA 1FXZA 3WW2A 1DQ0A 2A6XA 2WZR3 2UURA 3KCYA 2WFF1 1KITA 3J8F2 4XJ9A 3PVOA 1WMFA 1FAYA 1X8EA 3WQ7A 1OPOA 5LK7B 1FPN2 5IK5A 2XBO2 2FZ2A 2YY1A 1GSLA 2D6KA 5CA6A 1LU1A 2DCYA 4O9EA 1LEMA 2HWD2 4FPHA 4MLOA 4Q27A 4FP2A 4Y22A 1Q8SA 2JXAA 3AZYA 3DF0A 4QPIA 3AXEA 2VNRA 4COUA 1BVVA 1X7NA 1CAUA 1U12A 1AXKA 4AI1A 4BLJA 3VBUC 1KRIA 4HANA 1JH5A 1KS5A 4P9WA 3M3QA 2VMIA 3AZWA 2A6VA 4N53B 1VBA2 4KU7A 5JWPA 3V0AA 1IGOA 2GU9A 2R1BA 3HT2A 3AX4A 4QT6A 1F9KA 3HBZA 5DDJ3 1BKZA 4COWA 3WP6A 1FV2A 1WUVA 2GZWA 3E6BA 2IXIA 4ZU7A 4FQZA 1UPSA 2E9QA 2WFF3 5E8AA 2JG8A 1U5XA 1TNRA 4AI0A 3ZMOA 2CYFA 1VR3A 1V6MA 1ZREA 3RNSA 3E5XA 2MHFA 5C4WB 4WVVA 4Q0QA 4CDWC 1OFNA 4COZA 5C8CB 3U11A 4HBNA 4UBGA 5DUXA 4AVCA 3JBG3 1H4HA 1YFUA 1RUF1 4LLFA 2X53S 4XJWA 3B3QE 1TMF3 4E4ZA 3INAA 2Z69A 1K5MB 1XNCA 1QDOA 5HCFA 1AHSA 1AYM1 2RM21 1ZBE2 5FLJA 4YM3A 2WNUA 3B94A 1QWRA 3IBMA 3R4SA 4Q4X1 3AYCA 1AF9A 1TME1 4YM1A 2PLV1 5JDBA 4AF9A 1MR5A 1BJQA 5T5OA 3VV1A 1J1TA 3VBOB 2C0ZA 2I2SA 2FMYA 1WW4A 1PM7A 2WQZC 4GMP3 1U5YA 4OZXA 1D2QA 2ZBJA 1I6XA 1WLDA 2VUAA 3TRSB 3ZX7A 4JGYA 4IV3B 1BBT2 4HKOA 3PJQA 4AVVA 4A3XA 3V0BA 4FAHA 3SCHA 1C5IA 4CEWC 1Y7BA 5BNPA 3ECQA 3LSEA 3PMSA 4B29A 2R0FA 1SACA 4AVAA 4ES8A 2P2KA 5HCAA 4B4QA 3AJZA 4FOWA 1VP6A 1GANA 1MEC2 4IESA 4N9IA 1FPN1 2ILMA 2ZABA 4COVA 5HBAA 2XBO1 1LOFC 1ND3A 1COV2 1EAH2 4XHXA 1W6NA 3N3HA 3ST7A 1IPKA 1D4VB 2HYKA 2BYVE 2VPVA 3KCXA 2E6VA 4KWJA 4XE9A 3RJ2X 1PIV3 2ZJCA 4RSUA 2D6LX 4M3CF 1CVNA 3NL1A 1HKDA 1S0DA 4N43B 1W6MA 4XW3A 4NPRA 4BOWA 1SLTA 4AI8A 2BNNA 1XXNA 4IEYA 4Y22B 5GZCA 1MQTA 3B02A 4QPIB 3VBFA 1CAXB 2R063 5CFCC 3CJIA 5BNOA 4FSJA 1SDWA 4FPLA 3NKGA 2ZX3A 2RE9A 1H8TA 4EWAA 3RI9A 2R073 1DU3D 5CAZA 3J8F3 4DY5A 4LUKA 3V0AB 2HWF3 4E2QA 5K8SA 2ZX1A 1LODA 3IMNA 4W6YA 1MZFA 3EHKA 3S7EA 1WD3A 3E5QA 3THPA 3VN4A 2VULA 2RS33 4N9HA 2QJVA 5BNNA 2BQPA 2FBEA 4EJRA 2HWD3 2D6PA 5C33A 4IEOA 1NA1A 4TSVA 1RC6A 1W6PA 1RUH3 2XJQA 4WVWA 2PYTA 1MS3A 2V73A 3VDDC 4PLMA 1S55A 1WLWA 2B45X 1FOD2 3AYEA 1ZBE1 4WVZA 4LBOA 5FOJB 2TUNA 4DXZA 4YSFA 2DUQA 3NVCA 1VBA3 1QQP2 1ZVFA 3AFKA 1RGSA 3ZXDA 4BMEA 2WNVA 2F4PA 4OHYA 1KJLA 2XLFA 2WZPP 4KU8A 1V6KA 1LCLA 3FJSA 5D8AB 3AP6A 1LHVA 2R042 3RSJA 1S0BA 1LB2A 4JV4A 1LHOA 1ENXA 2GMMA 4ZU5A 3M3OA 3WD5A 4XMIA 3EJKA 4C1WA 4FPJA 4HPKB 5JSPA 5KBFA 3ZFGB 4RL7A 1C57A 4Z92B 1RUOA 3WDXA 2MPFA 4XQDA 1BBT1 1YJKA 2ZPXA 2JG9C 4NWVA 5A33A 2WIIB 1GLHA 3AKQA 1RHI3 1N3OA 3MW2A 1H1IA 1V6JA 1ULCA 1IKPA 1MEC1 1XRUA 1ZBE3 4JGYB 1S0IA 1EAH1 1COV1 5FAXA 4FXKB 1FI2A 2BW8A 5BNPB 1ZRFA 4XXPA 2BVBA 2HKXA 4EWDA 3AMMA 1YFYA 2GC2A 5IT6A 4KQ7A 1XU1A 3NV4A 1XQNA 3AZXA 4CDXA 2QNKA 1ND3B 1AR72 4E9KA 1Q8QA 2I74A 1RINA 1PVC1 3N7JA 2B39A 1W6NB 4XZPA 2JD4A 2VOVA 3ILFA 4CEYA 4WZCA 3AZVA 1OQEA 2BWAA 1OOPB 1AL22 2WA3A 3VBRB 1RUC2 1S2KA 1YO8A 3B9CA 5FQ0A 1WBFA 3ZFEA 1DFQA 1RIRA 4GWMA 2TNFA 4XDQA 4FT8A 4SBVA 5GLUA 2FZ1A 2WFPA 4HN1A 1REFA 5ACA2 1AL0G 3QCWA 4KG8A 2SBAA 3MIFA 4WBBA 1MQTB 1W6OB 3GBGA 4XOGA 2O8OA 3VBFB 1HW5A 4BCUA 4HMZA 4H14A 3CJIB 4LO6B 1O7FA 4S2DA 5F6LB 1CX4A 1H8TB 5IK4A 4WV8A 4AQ6A 2OVUA 1QJX3 2ZGSA 1O4TA 1FOD1 5LK5A 1YLLA 2PHFA 5I0SA 2VH9A 1RVF2 1GZWA 3CU7A 4Q2FA 3WHUA 1MS5A 1QQP1 3ZMNA 3WNXA 4MXVA 1BXHA 1NA1B 3M4FA 5JLVA 4Y5Z0 5L36A 1FMD3 1U5IA 2RJLA 4IV1C 2YHJA 1H4GA 2DU0A 2R041 4AQSA 1B35A 5BV6A 1PNGA 5KHGA 4I01A 4Y1YA 1QH7A 3B5LB 4Q8LA 1UKGA 3ZXEA 4QD2A 1H2MA 2P37A 5JPNB 3ES1A 4Y26A 4AEKA 1ASJ2 1WW5A 2ZCWA 1BMV2 5K0UA 3SLIA 2PA7A 5L19A 4URTA 3WW3A 5DZFA 3ES4A 1D0HA 1LRHA 3POSA 5FBZA 4IEPA 2ZHLA 4JRAA 2D6OX 3RRDA 4EV0A 2WNEA 5EYXA 2XLGA 4DINB 3ZXKA 3KGZA 1SCSA 4GULA 3OY8B 4FQ4A 4XFCA 1BEV2 1AJOA 3BODA 3B01A 4QQPA 2A70A 2C9AA 2ZX4A 4XFIA 3LCPA 3CL1A 2VECA 1ENSA 2A73B 1OMIA 1QKQA 1MZ6A 2BWCA 1VBD1 2W68A 1LU2A 4WVMA 4LBLA 1PGW2 1ND2A 4B7KA 1Q8PA 5C9AC 1YJLA 3VBHC 5L73A 3ENRA 3TN92 2WT0A 5CFDA 2PHWA 3H50A 1AR71 1G9FA 1D0GA 4L9BA 3CNAA 4WM8A 2ETEA 3E97A 5F1RA 1F2NA 3DUIA 4GMP0 1W6QA 4AEDB 5KC6A 1PK6C 1AL21 4HK8A 3BCWA 1RUC1 2XL7A 4HKWA 1LENA 1NE4A 4LBQB 3ZIXA 3O0XA 2DTWA 4QU2A 1NQJA 2PHDA 3ZXLA 4S2FA 4AHWA 1OHFA 1R093 5J98B 1O5LA 1DHKB 4W65A 4AFDA 2O1QA 2C1FA 4QGMA 4EN8B 4CEYB 1C5HA 5ACA1 1RUG1 3RG0A 4L2NA 3JUUA 2OYZA 3VL8A 1TNFA 3N7LA 4XFAA 4OLLA 2NN8A 4S2HA 5C8WA 4AHZA 4P9XA 4QM9A 3VL9A 4PBOA 2RHPA 5KXCA 3GF6A 3WY6A 1DZTA 2CTVA 1DQ4A 1AR63 3I4IA 2DCKA 3WLUA 4NVPA 3DPRC 1J3PA 1RVF1 4Z82A 4KGGA 2GNTA 3PVBB 4CZSA 3B7MA 3WG3A 3IDCB 1RMU3 1ULDA 4DQAA 3O14A 4X8PA 3PJYA 5FDBA 1OI6A 4FPEA 1Q5OA 4BM8A 1KJRA 4RGAA 1S0GA 4XF0A 2BTVC 4JVAA 1CAVA 4KH9A 4MH0E 4AEMA 1QNWA 2WQ4A 3ASIA 1GZWB 1A3KA 3MIBA 2GMEA 1Q56A 1HRI2 4YW2A 1PHMA 4DFSA 1FATA 3ZYPA 1ASJ1 3MGUA 1BMV1 2ZMNA 4QMAA 4RGGA 4YVWC 5DG1A 2ZOEB 3S7IA 1ZM1A 2BUKA 1WGPA 4OULA 2Q1ZB 1SFYA 4R4ZA 1DIWA 4RQPA 1MZEA 5DDJ2 1BEV1 3SMHA 4BQ1A 3GZTB 5K0UB 5KHJA 5JIUA 5F9TA 3LA7A 1CIWA 1LKNA 1VBC2 3WVJA 3WUCA 1CONA 1SLIA 5L7OC 2ZGOA 1V6OA 1AR93 3OF1A 1QY4A 4RR3A 3U07A 4YM2A 3QOPA 3TBDA 2JE7A 2OA2A 1OLQA 3SCFA 3TN91 4N53A 3MIEA 4LBMA 4EWEA 3JBG2 1M06G 2ZA9A 3WUDA 5CBLA 1TMF2 2ET7A 4R4XA 2IXJA 4WVMB 1MZ5A 1ZRDA 5GLZA 1PO13 5EZWA 4H7MA 4LO8A 4MGZE 1YXWA 4GH4B 5KHIA 5AFBA 1DQ1A 3O7OA 4CP1A 4YARA 5FMOL 1AVBA 1FNYA 3HR9A 1RUI3 1WMEA 3QACA 5T52A 4AFMA 5C4WA 4J1XA 2UY9A 1POV3 1BEV3 2OW4A 4Q26A 3R05A 4I0WB 5C8CA 4GQ7A 1MACA 2MEV2 2D5FA 3OBTA 1VBB2 4V1PA 3WINE 2XVGA 1V70A 2CWMA 3FHIB 4B3NA 4OI0A 4HVOA 1OLRA 2DF7A 4XF3A 3W58A 4LUMA 5H9QA 1AX2A 2H6BA 2PAMA 1KS4A 1NCRC 3O5SA 5HCBA 1LOGA 2YGLA 5T5JA 4K20A 4R9BA 1X8MA 3AKSA 1GQGA 1PZ9A 3MFAA 4HKLA 3ZSLA 1VALA 3VBOA 4FAGA 4P9JA 4XFBA 1SLLA 5JPMB 1CJDA 3VBSC 4CDQC 2DCTA 3H9AA 1AX0A 3SH3A 2WLPA 1CR7A 1BZWA 4CDWA 2DYCA 4YNIA 1PIV2 5I0TA 2ZGPA 1HRI1 5I0RA 4QPGB 1SEFA 4YVSC 4Z2WA 1T6GC 3LA3A 4DZGA 1REEA 4XQ4A 1CAVB 3T1LA 2D43A 4CP0A 3RI8A 1W0PA 4AGVA 1M4WA 1UD1A 3P3NA 5DDJ1 2R062 3H7JA 2QDNA 1KFUL 4AI3A 4GALA 1C1LA 3ZFFC 3PHMA 4GWNA 1JW6A 2R072 3NAPB 4FBFA 1ZZCA 4EROA 2VW0A 3FMGA 2R49A 2HWF2 1G8WA 4OHXA 2E7AA 5JOYA 4F7ZA 5IK7A 5FTTC 1G6NA 4N43A 2O8QA 4RQPB 4XXAA 3ZXFA 1QXPA 3G7DA 2DTYA 3I59A 3MPPG 1SMVA 2RS32 1WA4A 1GZCA 3RJRA 3CJXA 3JBG1 1RUH2 1HRI3 3OGJA 1QJU2 1CAXA 1TMF1 4IERA 4RR3B 1WMDA 3MPBA 3ZSKA 2Y26A 1NLRA 3GHNA 4XJAA 4YG0A 3J9SA 4YGBA 3ZXJA 1HQNA 4LULA 1DBNA 4KNCA 4P9LA 1LOFA 3T2TA 4PCRA 1WW6A 3H3UA 1I3HA 4EN7B 4LTAA 1Q8VA 5GLTA 4QXKA 5BYNA 4AFCA 2QKDA 2WT2A 4CYDA 3FFZA 1VBC3 2R32A 4GMP1 4XEZA 4CRQA 5F6KA 3QLQA 4QQ2A 3AP4A 4A2UA 4X6QB 4NN0A 4JC1A 1BK1A 2D6MA 4LR4A 1HX6A 5SV5A 4DS0A 4UW5A 3M70A 4JGZA 1YNAA 2EXKA 4FOQA 5JCTA 4XJZA 1DGRA 1LOBA 2ZGLA 1RHI2 4RS5A 4PBPA 3TYJA 2F6BA 3VBUB 3I54A 1H1MA 2AH2A 5D8AA 4OUMA 4Q29A 3KCCA 3TB0A 4G4FA 1UIKA 3LOBA 1FT9A 1SBEA 3CLPA 4COYA 2MNGA 2Q0AA 3ILRA 4LT5A 4K9SA 2GH8A 4HPKA 2OUHA 4Q4V3 4QPYA 5FLHA 4BA6A 3RZZA 3ZFGA 1PIV1 1VBE3 2A6WA 3WXPA 3D8CA 4JCKA 4WM7C 3UV9A 5FPXA 1LECA 1N3PA 4AFAA 1Q8OA 1A8MA 2MEV3 5ABJC 1VBB3 5JR7B 4DNYA 5GZEA 3WW4A 1LHNA 2PHRA 3AYDA 4U36A 5FRAA 4CDWB 2HWE2 3JD72 4NHLA 2VOXA 4BMBA 3FLRA 2R061 2X5IC 3RMXA 1C8NA 2BFUS 2QZ3A 5BY5A 5T3NA 1IOAA 4W6XA 3SCGA 1HXS3 4Q4Y2 2R071 3R0RA 4E2GA 1DGWX 3J8F1 3HD8B 2GSYA 1IPJA 1QJY3 4Q8KA 1SCRA 2HWF1 5EJ3A 5B2GB 3LGRA 4IXLA 1SQ4A 2D3SA 2VW2A 3GNEA 5FFOC 2DVDA 4EN9B 2RS31 2I07B 2WL1A 4XF4A 1IS3A 4I30A 2HWD1 1QMJA 4AGRA 2W39A 1OOPA 1RUH1 4QPIC 1LJ7A 1ZZ8A 1RTVA 3VBRA 3H1WA 4GKXA 4F3JA 1QJU1 2GMPA 3IDEA 4M0NA 3KM5A 1QJX2 4YZ3A 1DDLA 5H9RA 2TBVA 4XBNA 3FUQA 1N1SA 3IWZA 4KWKA 4Q0SA 3VHPA 3I59B 1MS9A 1W2UA 4OVEA 1VBA1 3A0NA 1S2BA 3AMQA 2IZWA 1UCXA 3MICA 3KB5A 1PO23 1W6OA 1FMD2 3D0SA 4IL7A 4CEWB 3IPVB 5JOXA 4TYSA 5A3MA 1A78A 2AREA 1EYBA 3QD6A 2JG8C 4IEWA 3THTA 4L8QA 2XKPA 2ZKNA 2XVLA 4AEJA 2K0GA 4HL0A 2DURA 4AHXA 5AC92 4ASLA 2HWB2 3DGTA 4JAAA 5J3UA 2D93A 1RHI1 4K40A 5D1IA 2GC3A 1L3JA 1JUHA 1YHFA 1IS6A 1QJU3 2ZACA 4QQLA 2R6QA 1EV13 1UZYA 2AUYA 2VNGA 2WNUC 3BIWE 1CGPA 4JGZB 1V9U3 1ZNPA 4LLOA 4MV2A 4XBLA 1DGWA 1N47A 1GQHA 4YW5A 4RS5B 5I93A 2KM2A 5CFCB 5BXXA 1ZZ7A 4IEQA 1YYNA 4DRRA 3HT1A 2QVSB 3MF6A 4UW6A 3DN7A 5EFUA 2DVAA 1POV0 2QFEA 3H8UA 4MVTA 1PGL2 1CAWB 1IKQA 1LOCA 4FTEA 1ULFA 3OY8A 3MLLA 1CPMA 2HWE1 2W0XA 2RMU2 3MYXA 1GKBA 1E57A 2GNDA 3AMHA 1LGNA 4HSJA 4DRVA 2UWAA 3OTFA 1S1AA 3VDDB 2PHTA 1R092 1YI7A 4XYXA 4GXLA 1NXMA 5E89A 1RUE2 4ORFA 2BPA2 1SLCA 5LEJA 4DMIA 3IM0A 3M3EA 2A3YA 2Q30A 5CIRA 5H9PA 5C6CA 1RL3A 3VUOA 1C8M3 1S0EA 3VLBB 4AEDA 4YGCA 1ZBA3 4P9IA 2ZHMA 2ZX2A 1B09A 5BNQA 2D6NA 1U0AA 3OCPA 4FVVA 1XNBA 4LBQA 4YZ2A 1DZRA 3NSTA 3VZKA 1QJX1 1AR62 4QQHA 3WQ0A 4OHZA 2C5DA 5CU1A 3AP7A 3D4KA 1H30A 2AGSA 2D3PA 3C2UA 2YGMA 3WDVA 4LBNA 2FQPA 3N7MA 4XFHA 1RMU2 1F8VA 1MQTC 2JG9B 4YW1A 2HWE3 3JD73 2VU9A 3VBFC 1FMD1 4AI2A 4L92A 1V6LA 3CJIC 3ZN6A 1C1FA 1YIFA 3WDTA 5BNOC 1QOOA 2FHRA 2QUOA 2ZX0A 3OJBA 4RFT0 2HWC3 4TLFA 2Q4SA 3V65A 3O12A 2WWSA 3NWKA 1UAIA 2PHUA 1S0CA 4Q4Y3 4H3WA 4XJ8A 4M0HA 1QNYA 4FOVA 1JHNA 2PELA 3V56A 1Y43B 5SV8A 5JIAA 1UPIA 5AC91 1CN1A 1F5FA 5BNNC 2AENA 2IWGB 4CDUA 1N1TA 4I3GA 3D5OA 2PFWA 3ALQA 4MGYE 1LGCA 2UYBA 4FOYA 1YCIA 3OPZA 1HIXA 4Q4W3 3LB9A 2ERFA 1VRH3 5DZGA 2DUOA 4JRLA 2DFBA 2IXLA 2WNVC 2JECA 2Y38A 1DYPA 2VQ0A 2OZ6A 5GKAC 1AR92 4BYYA 4PLOA 3RYPA 3R6SA 1H9WA 4HETA 4K21A 1X50A 4XTMA 4LHKA 3SITA 2UY8A 2WKKA 1JUIA 4AK3A 3WZ1A 3FWEA 1PGL1 2EXHA 2IFRA 2UU8A 3FZ3A 4LA2A 4PDWA 2LTNA 4OI4A 1NZCA 3HAGA 1YRZA 1PO12 3I8TA 2RMU1 3MEPA 3ZIWA 3L2YA 4YGDA 5AC93 2DU1A 2GNMA 4MZUA 2HWB3 2D97A 4ZU4A 1TEIA 2NMNA 4E27A 3KT1A 1R091 4I02A 5GJ6A 1J1LA 1RUI2 1IHMA 3UKNA 1APNA 1H2NA 3USUB 4Y20A 1V6NA 1AYN3 4BZ4A 4YGEA 1UX6A 5J96B 1CJPA 4QM8A 4LEJA 5LRRA 4P5HA 1PNFA 2E7QA 4FPOB 2A7AA 2A3WA 2I45A 4JDOA 5AVAA 4B8EA 4IV1B 3RMYA 4AXOA 2XLAA 4NR1A 1UMZA 4XFFA 4GH4A 3V64A 3NW4A 4CDXC 1C28A 1AR61 5LRSA 1WCSA 2Z2SB 3LSDA 3ZXAC 2ZZQA 5EYYA 5H9SA 4CEYC 2EXIA 2AZ5A 4GB33 3BOPA 3MIGA 4OHVA 3UKTA 4AVTA 2D40A 1RMU1 1PGSA 2GC0A 3RWNA 2XPJA 3X29B 5JZGC 2RMU3 5I0UA 3O0WA 4K3UA 1WLCA 4ES9A 3ZFEC 1NLSA 3TAYA 2JDZA 1ENQA 1FNZA 1HQWA 2VVDA 3FUOA 2ENRA 4ONUA 1QOSA 2IXCA 1WD4A 3PVEA 1RUE3 2ES3A 2CAUA 4LA3A 4AFBA 4MXWB 4ATFA 1Z78A 3ZYGA 1XE8A 4ITCA 4IETA 2YUEA 3ZN6B 2WA4A 3FLTA 2NM1A 2LM3A 1DQ5A 2BNMA 2D98A 2ET1A 3FX3A 4D7TA 5C9AB 1Z7S2 1VB2A 3VBHB 4D69A 5KC5A 4GKYA 2PAKA 3OGGA 3WW1A 4NHKA 2EF6A 1JBCA 4BIFA 2QCSB 1QU0A 1V00A 3GZUC 2BBVA 3L9JT 2DCZA 3ZDSA 1PK6B 1J3RA 1ENRA 4CDUB 4FTSA 2XJVA 3LWCA 1AR91 4L99A 1W39A 1QDCA 2EVXA 1R1A3 1RUJ2 4QPGA 2A3XA 1B35C 3M3CA 3WCRA 1GNZA 4PIXA 4YZ1A 2EXJA 1NE6A 4PQ9A 3J26N 3VKMA 4MGKE 4H7LA 5JI7A 5K0UC 1DLLA 1PO11 1ULGA 3RPQA 4M01A 2RS53 5DXDA 5KHKA 4KBBA 3DKWA 3NAPA 2BGCA 1BCXA 1YUDA 2DVFA 4JTNA 3VZNA 2ZGTA 1O91A 5DUWA 2Y0OA 1RUI1 4PDWB 4TWTA 4BE3A 1POV1 1I9RA 4YFZA 1NOVA 1OQDA 2GC1A 3ILNA 1NCQA 4M3CB 4G9SB 4Z8BA 1NG0A 1U5ZA 1XYNA 1RITA 1ND2C 4BWOA 2XUMA 4FXGB 1PGW1 4H55A 1LOAA 1ZX5A 4Y20B 1LR5A 5CFDC 5JSRA 3JB8A 3PLQA 4YYOA 2DV9A 4WM8C 1QJZA 4FPCA 1BQPA 5BPXA 3KLSA 4AQTA 5KXEA 2LALA 2EALA 2D7FA 4IEZA 4BLIA 2RR13 2WT1A 1REDA 4YVWB 2OPKA 2R1DA 4PJYA 3A4UA 3OBRA 4B4RA 1FYUA 5E16A 3CO2A 5T5PA 4PIYA 4Q4V2 3WQ1A 3U0ZA 4D7SA 1ZRCA 1CD3G 4YW3A 3B93A 1VBE2 1X33A 3FFQA 5L7OB 4XTPA 1RUNA 2A6YA 4M00A 5T54A 3VZMA 3PVNA 1A6CA 3WV6A 1ZYBA 1ZZ9A 4LBKA 3VBUA 4BIOA 2XJSA 1KXGA 5GZDA 4FPYA 4Q1PA 4MUVA 4EN6B 2NLRA 2SLIA 4KGQA 2OIIA 1H2LA 2V09A 3EXUA 4Q1RA 2K2SA 4YG6A 2UWBA 5IK8A 1UL9A 4E2SA 4Q0UA 4JQRA 1HXS2 3RYKA 1QHDA 3SXWA 3DV8A 3URFA 1DQ2A 5TSWA 1QJY2 1R083 3VKOA 1LEDA 1D2SA 2LUWA 3VKLA 1F5JA 3D0JA 4AGGA 4INDA 3W59A 1Z0HA 3IT8A 1UZZA 4XF1A 2XJTA 1KQRA 3OYWA 2B46X 4X8NA 4LNVA 1RB8G 2Q8OA 2R30A 4FO9A 2D44A 4ISRA 4X6RB 3J4UH 2QZ2A 1TQ5A 1XU2A 1Z7S3 3N36A<