1UQXA

Ralstonia solanacearum lectin (rs-iil) in complex with alpha-methylmannoside
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
113
structure length
113
Chain Sequence
AQQGVFTLPANTSFGVTAFANAANTQTIQVLVDNVVKATFTGSGTSDKLLGSQVLNSGSGAIKIQVSVNGKPSDLVSNQTILANKLNFAMVGSEDGTDNDYNDGIAVLNWPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords LECTIN
publication title A New Ralstonia Solanacearum High-Affinity Mannose-Binding Lectin Rs-Iil Structurally Resembling the Pseudomonas Aeruginosa Fucose-Specific Lectin Pa-Iil
pubmed doi rcsb
total genus 22
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2003-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07472 PA-IIL Fucose-binding lectin II (PA-IIL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.400 Mainly Beta Sandwich Jelly Rolls Calcium-mediated lectin 1uqxA00
1OVPA 2BV4A 2WR9A 1W8HA 4CE8A 5A6XA 1UQXA 1OURA 2BP6A 5D2AA 1OVSA 3DCQA 5A6YA 2JDYA 5HCHA 2VNVA 2JDNA 5A3OA 2JDMA 5A6QA 2JDPA 1OUSA 2JDUA 4UT5A 5A70A 1W8FA 2JDKA 2VUCA 2WRAA 1OUXA 1UZVA 2BOIA 4AOCA 1GZTA 2BOJA 2CHHA 5A6ZA 2JDHA 2VUDA 3ZDVA 1OXCA 2XR4A
chains in the Genus database with same CATH superfamily
3TEYA 4E4DX 1GNYA 1TMF2 3NRUA 4XVHA 3DPRC 1W8WA 5DAQA 4OVEA 3S5AA 1AL22 3THCA 3UKVA 1H9WA 2PQSA 1PZ7A 5D8AC 2G9GA 4FFGA 2WZ8A 3TRSB 5JXIA 5I0RA 1VALA 3WCSA 3ZN6A 3I97A 1UL9A 1J3QA 2VUCA 1QH6A 1H8TB 3SEPA 3QACA 3PVEA 4BIFA 2BFUS 5GKAC 2JG8C 3JBG1 3RG0A 3ZXFA 5C5TA 4IQPA 4K40A 4LIUA 1DU3D 2DYCA 4YGDA 3NNMA 4QQPA 4A3XA 2GN7A 2YPJA 4DUXA 2WFPA 2ARAA 2WNUB 3PDQA 5DABA 4BK5A 2ZEYA 5FY8A 5SV8A 4A2UA 1NKGA 4EN9B 1Y7BA 4AGGA 1YQCA 3UKNA 3O1TA 5A7WB 1CAVB 4LO8A 3B9IA 4Y3OA 4EN0A 2GC3A 4ITCA 3WG2A 4LPLA 1CAUB 3JBG3 2GAUA 3GCWA 1JH5A 1ULEA 4JQRA 1RMU2 2R071 2WO1A 1IOAA 2BBAA 3OF1A 5GZEA 3IDBB 1OA3A 4DQAA 5KHJA 5E88A 1ULGA 4RS5A 3BPSA 4A7ZA 5A7QA 3ZVXA 3K4AA 4X6RB 4DUVA 1BBT1 1MEC1 1MVQA 1N3QA 5SV5A 4NOTA 4GA9A 4LKEA 1D7PM 2VGDA 4BIOA 4UBHA 3FFQA 1S0GA 4S2HA 4A3ZA 2I07B 1W2TA 3WP5A 5FZHA 1FAYA 2VBDA 3FN9A 5FZ6A 1SLTA 1MS1A 2CYFA 1V6MA 2R073 3N7LA 3OPZA 4SBVA 4CDQA 1JN2P 5C4WA 4LBQA 1JHNA 5FMDA 1ULCA 2XWBB 4BQYA 1BBT3 1C1FA 1S4CA 1LHUA 1Q3EA 3N7JA 3VBSA 2PLV2 4FOVA 1NLQA 4FOQA 2P3IA 2VCMA 2N7GA 4IE7A 3MFCA 4BM8A 4EN7B 5BNPB 5JPMB 2QQKA 3WX5A 3VKLA 1OC1A 2DWRA 2XR4A 2QQVA 3M3EA 4J1WA 4ASKA 1YXWA 2W1UA 3T08A 1QJY2 2EXKA 4CCEA 1WZXA 1AZDA 2VXJA 3WDTA 5A33A 2AYHA 2DU1A 2VOTA 3BCWA 3FLPA 1Q43A 3MUZ1 4KG8A 4OUMA 3GZTB 4CDXB 4NN0A 2WO3A 4N53A 5DN2A 5A3NA 4D7YA 1FMD2 1HN1A 4LO4B 1N1VA 4L99A 4RL7A 2A6VA 2VQ0A 4CDWC 1FOD2 4N9HA 4BXFA 3J7MA 1MZEA 1WKYA 4DFSA 2JWPA 3S30A 4PCRA 4RHV2 4QPIA 4BXSV 1J83A 1WCKA 1IPJA 2WNVC 4GH4C 3VBUA 2BNOA 2Q5TA 3V0BA 4QGMA 3ZFEC 1XOYA 5F3GA 4NIDA 1R64A 2DVGA 3BIWE 4QKNA 3RVHA 1V70A 4W50A 2E7AA 3MW2A 1HN0A 2YHJA 2DURA 2E53A 1AR61 5F39A 4PBPA 4BCUA 1CX4A 3C3VA 4M0NA 3PUIA 4URTA 5FMOS 4XZUG 5FLJA 1SLAA 3U37A 3ZKUA 2NZ9A 4J1XA 3AFGA 3WR0A 3NAPA 5I0UA 5JCTA 3ZLIA 1DGLA 2ZGMA 5AC92 1T2XA 2OYZA 2E9QA 1H0BA 1WUVA 1WBLA 2WN3A 3GZUC 4M3CA 4V1PA 2VL4A 1AR91 4P9YA 5AVPA 5DXDA 4CYDA 4CDUC 3PTYA 5BNOA 4BISA 1R092 1J58A 1RC6A 5TSWA 2JJ6A 2HWF2 1NCQB 3ES1A 3K77A 5FXWA 3G7DA 3UGHA 3HQRA 1AR63 5FYHA 4LE4A 3BUCA 1H1AA 1IGOA 3HPNA 3QLQA 3ETPA 3VDDB 2J1TA 4XJUA 1OURA 2YGMA 2QQMA 2EVXA 2ZGTA 1AYM1 1K5MB 1QJX1 2VZSA 1X9TA 2D6LX 3I59B 3I2OA 4IV1C 1QY4A 2RHPA 3H8RA 1AR93 4ISQA 5LK5A 1OUSA 2PHRA 5A70A 1QU0A 2CDPA 3JD72 1TNFA 4RYDA 4E8DA 4JGZB 1GZWA 1W6MB 2SBAA 4LKSA 3LA7A 4YM2A 1UZVA 3MF9A 4P9IA 2AH2A 1Y3TA 3E6BA 4GJYA 5EHDA 4BHPA 2ZKNA 4ZKTB 3V0AA 1DG6A 2W5FA 5J09A 2NN8A 2X5IC 3KVBA 2XMLA 4FPHA 4ZZ8A 4AI9A 2ADEA 1QJX3 2RJ2A 1EV12 4Q0UA 2QE3A 2E63A 2QVSB 4M4PA 5A7SA 1ZBE1 4QKBA 1Y4WA 5T54A 3SISA 4Q0SA 3SKVA 4YZ4A 3VKOA 3Q8FA 3CDZB 4K9SA 5FP9A 4B8EA 1ND3A 5DUVA 5IUQA 4GD4A 4FI9A 3T0DA 1YQ8A 5FR3A 2GC1A 1ZM1A 3ZSLA 2XJRA 2R043 5FWJA 1COV3 1YEWA 1Y9MA 3P3PA 1G86A 2Q1ZB 3PJQA 1PO21 2Q8CA 5C3SA 1VR3A 2HH9A 2O8QA 3CZJA 1XU2A 3PVBB 1JYCA 1ZBE3 2R16A 4CUBA 4AGVA 3OUIA 4RFT0 5FJHA 5CG8A 4K7JA 2GN3A 3QD6A 4PI0A 1LU1A 3RWNA 4ES8A 1LEMA 5FZOA 4CCDA 2JX9A 2K46A 2BNMA 2XUMA 2QFEA 5FZEA 1R081 2QQLA 1PO23 4PF1A 2FDFA 3NJYA 4MUVA 3UYJA 1A8MA 1VBC2 4PDWC 2I74A 2VD7A 1YI9A 2J1RA 4CU6A 2C9AA 4LHNA 2CGNA 4XDPA 4CP9A 2G19A 1FNZA 2XJPA 2WBKA 3LZZA 5L7OB 1UNBA 1PM4A 1ST8A 4JTOA 3S5QA 3VD3A 4I2OA 4QXBA 1ACCA 2DVDA 3D3AA 4CUCA 3PUQA 4GQ7A 4QAWA 2JDHA 3PTRB 5FIXA 4JKLA 3WT3A 2BV4A 4WZFA 1TG7A 1R083 1LOGA 1W9YA 3ZDSA 2BGCA 4P9GA 4AGRA 2W91A 1GBGA 1OKOA 2V72A 3LEIA 4LE3A 1GWKA 3KD4A 3OCPA 3VZMA 3GZEA 5C33A 2VBPA 3LA3A 4XBNA 1EP0A 5B2GB 4Q4V1 5FY4A 4LK6A 3ZFFB 5AFEA 5DPNA 4XAEA 1SFNA 5J98B 1AJOA 2P6HA 4IXLA 2WAAA 4LA2A 3WP6A 4Z82A 4B1LA 4MLOA 2FCUA 2H0VA 4AVBA 4Z2WA 2D44A 4HVRA 2BERA 2XHKA 4NRMA 5CEHA 3AZXA 3TOJA 3K75B 2VVEA 1QHDA 1VE0A 5FYVA 3WDYA 4YVSC 5C9AA 2E32A 2OQ6A 4TWTA 1DQ2A 5E16A 4KG0A 4Q4V3 5JWPA 4CUAA 4QM9A 3APBA 2MNGA 4L2NA 4OUEA 2OW4A 4NIIA 5KXEA 4LXLA 1EAH1 2YC4A 1DQ4A 4PF5A 4Y24A 1W05A 4ONUA 1RUI2 4ET7A 2IXKA 1B35B 1EUTA 1UYPA 1XYNA 1YIPA 2ZS6B 5JSOA 5F32A 2JG9C 4CXYA 1SDWA 5A7PA 3MICA 5JR7B 3H1MA 1JU3A 1O8SA 1KRIA 2VCBA 2HWC2 3BALA 3OY8B 1EAH3 5FK8A 4YWAA 4D7SA 1LHWA 3HMYA 4H2AA 2XPJA 2WIIB 3AKTA 1IZ3A 1F5JA 1UO9A 4QQ2A 3ES4A 1G9BA 1GWMA 5D8AB 4FCAA 4AVVA 5FZ0A 1MVEA 4FPKA 1Z0HA 2WT0A 3R4UA 4JVAA 3KV5A 1U5IA 3MIDA 4LOTA 2A73B 1H2NA 4BQ4A 2DUOA 4HSLA 1PX4A 4AL9A 2JG8B 3PL0A 3JXSA 1SQ4A 1Y43B 3AMMA 4X8PA 4XMIA 3U78A 3BVCA 4AHWA 1BMV2 3B7MA 2DCZA 2RS31 1JZ6A 3BU0A 1O59A 3ACHA 1UYXA 1STMA 2R49A 3WNOA 3ZFGC 4HONA 4CEWA 2IXLA 3LIGA 3PVOA 2X8KA 3RZHA 3ZMOA 2R1DA 2VMDA 4PJYA 2VR4A 4CCCA 3RMYA 4UXAA 1W6NA 2GNBA 4B4QA 3ECQA 4AI2A 2FDIA 1S2KA 3S0MA 1QWRA 4LITA 4E9KA 5KHIA 4CPBA 2IC1A 5BV6A 1VLNA 4GB32 3ZXDA 3DYMA 2RS33 2VZQA 2WLQA 3ILNA 3MF6A 5T5PA 5HCFA 1S1AA 1D4M1 4I01A 1RUG2 1VJ2A 4AEDA 3N3HA 4A6OA 3RDIA 2BJSA 4QU1A 1IPKA 1GP4A 2QBXA 2V5DA 3KSCA 4KWLA 1JYNA 1N3OA 1H8TC 5I0DA 1HQWA 1QEXA 1PGW1 4WZCA 1RXFA 2ZGNA 3U07A 4QX2A 4LBQD 3EMRA 4EZ4A 1A6CA 3RZKA 4H7LA 3PIJA 3WUCA 5GLZA 5KXCA 1OHFA 3A21A 5T50A 3KT4A 4HSJA 5JMCA 5C6CA 1PZ9A 3O0XA 3OG2A 1ULDA 3WNXA 3NKTA 1L7LA 4Q0QA 3IIIA 1D4M3 4DOUA 2P17A 4XQWA 1XNKA 4FP3A 1VIWB 3H3UA 2AC1A 4LBOA 4QHBA 1S0BA 2A7AA 2Q0AA 4XMAA 4RFRB 4DRRA 1K45A 3U1XA 4XF3A 3ZSJA 4HANA 3GBFA 1DQ6A 2EAAA 5EQUA 4A44A 3IT8A 4EWAA 2AACA 2P6CA 4MO3M 1PMJX 3RZMA 4CUGA 5KHGA 4LKFA 3S7IA 3VBHA 5IAVA 1UY3A 2WFF2 2ET7A 3Q9OA 1BVVA 4W8JA 1BHGA 2A5ZA 4FPEA 1LHVA 2UWAA 3H3ZA 4IEYA 3SLIA 1PVC3 4XACA 4EYUA 5DDJ2 2HJIA 3CKHA 4Y4YA 4FO9A 3A22A 2ZGOA 5A80A 1LEDA 2Y6LA 1VB4A 2LRPA 3D6EA 4XIOA 1WLCA 5F2SA 5JIAA 5CFDA 1UOGA 1W8UA 3BN6A 1BK1A 1QNYA 3POGA 4CDWB 2JKBA 2XLAA 5GJ6A 3O1SA 1RJ8A 1W8OA 2BRTA 1UMZA 1XNDA 3NNFA 1V6KA 3U75A 3L9JT 1OF4A 3AK0A 2WNVB 3NNGA 2X53S 1K5JA 4GH4B 5F5IA 1F5FA 3KCXA 2IXIA 3ZFEB 4WM7C 2G9FA 3AL5A 4F3JA 5ABJA 1GNHA 2WA4A 2E26A 1LRHA 5FZ1A 4CVUA 2NLRA 4IE6A 2TEPA 4L9BA 4W65A 5BNPC 2ZCWA 3O0WA 2RE9A 2Y0OA 1U5ZA 4YGCA 3ZMNA 4AR2A 1BBT2 3RS6A 4L8QA 4COWA 4MVTA 1CZTA 1KDMA 1MEC2 1ZRIA 3OUHA 1RUF2 4XTMA 5IVFA 3OBAA 2ZOEB 4XE9A 2IWGB 4C0HA 3UJOA 5ACA2 1JOBA 2XL9A 2LROA 2D40A 2JB4A 5FZKA 2W92A 1YO8A 4JRLA 2WSUA 5IK5A 5F8PA 1BVP1 4HN1A 3WEZA 3QBQA 2ERFA 3FUQA 1QQP2 1ENRA 4ZU5A 4CDUB 4YZ1A 3VN4A 2P34A 4HLTA 4CDXC 4E8CA 2IUWA 1NA1B 4HPKB 1RYYA 3NV2A 5FPVA 2GMPA 4RQPC 3UGGA 3DXUA 1LOAA 2EALA 4QMAA 1DQ0A 2ZBJA 4QX0A 4RR3C 2JE8A 1WW7A 3AVSA 1NX9A 4RGKA 4XFGA 4OHVA 1Q8OA 4JHTA 2R1BA 2QQOA 2VNRA 2RDQA 4NRQA 4NWWA 2DBIA 4OZXA 5GLTA 3WHTA 4WVMA 2EIDA 4P14A 1ZZBA 1DYKA 4K21A 1NLSA 2CDOA 3UK9A 4LBNA 1W9WA 1FXZA 1LOEA 2CNAA 4AEMA 4CEYA 2F17A 2Z4FA 4OYUA 1WBFA 2X5IB 4LHKA 3VDAA 3USUA 1P8JA 3MIHA 4RSUA 3NQHA 5F5AA 3Q8BA 4P9XA 3B69A 3HNBM 1MZ5A 3HWJA 4UI9L 4CE8A 3E6DA 3PU8A 5DZGA 4CU9A 1XRUA 5JXJA 3RWKX 3EO6A 4IERA 3MZHA 1HJGA 4N43C 1DF0A 1N1TA 4H3WA 4FOWA 4ORFA 4Y26A 3SC7X 4WM8A 5GZDA 3T3YA 2BVVA 1C28A 2HWE2 3J9SA 4QU2A 5BNNC 1QKQA 3KCCA 4K8RB 1GOFA 1JHJA 1H2KA 1MACA 5FZ8A 1WCUA 2ZGSA 3O12A 5EIYB 4KL1A 1HRI1 4H14A 5IVVA 4AWDA 1AJKA 4GMP0 1W3XA 4JGZC 2ZZQA 5BYNA 5JUVA 5CVRA 1Y9QA 4KWKA 1W6QA 1H9PA 2A3WA 3M4FA 4B4PA 3LOIA 5T55A 2FBEA 3GF6A 1GOGA 4UW3A 1YYNA 4HXCA 5I8YA 3J8F2 3IM0A 3NJZA 2QJVA 1VAVA 5GLWA 1SBEA 2ZHMA 4OCTA 4YG3A 4PDWB 4I0AA 1W9SA 1HRV2 4Y20B 3RJRA 4IEVA 4JZRA 3RZZA 1C57A 1HRI3 1EUUA 1KITA 2A1XA 5CAZA 3INAA 3OYWA 5FPAA 3I49A 1ND2B 2DVAA 4AI0A 1AYM2 1QJX2 3TNPB 1O3QA 2HWD2 1W99A 3AMQA 2C9KA 4UFIA 1NXD1 3BOWA 3VHOA 4BQ2A 3ORJA 1PIV1 3KQRA 2OZ6A 4FBFA 4HKLA 5AVAA 3U11A 1W6OB 3K48A 5FBZA 3LA2A 1XSQA 1QNWA 5FYZA 4JAAA 4IE0A 3ZPYA 4R52A 2Y34A 1BXHA 1S0CA 2QTWB 4JGYA 1KFUL 4XJZA 5HV0A 1OI6A 1SPPA 4IESA 3I3DA 1MQTC 1FATA 1O4YA 5EWSA 2WYFA 5FCCA 5FUNA 1GLHA 1AYN1 1HLCA 1ZBE2 3ATGA 4D6QA 1E5RA 4D94A 1G9DA 1YFWA 2IFRA 3ENRA 1PIV3 2CTVA 5LBCA 3WNKA 4OHYA 2FQPA 2KM2A 2QUOA 3OB8A 4DNYA 1JYIA 1QDOA 4QHOA 1OQEA 4L97A 1JI6A 3J4UH 3O5SA 3FE5A 4MGSA 2VQAA 1LOFC 4YVSB 3T09A 1YIFA 1QOOA 4A42A 2IVIB 3NJXA 1PMIA 1PO22 4EV0A 4FVVA 1D4VB 1D0GA 2VZPA 2YY1A 1GSLA 1AYN3 3CEWA 4DPNA 2BDRA 1ZZ6A 3MFAA 2XWJB 5CA6A 3GHNA 1W2NA 1UIKA 4DUWA 4ZS2A 3RPQA 3KMHA 2DVBA 3VZKA 1W0OA 5J96B 1JXNA 2GDFA 2JG9B 4MADA 3SNMA 2PHDA 5FMBA 4QKFA 1MPXA 1VP6A 1W04A 3D82A 1VB2A 1ONAA 1V9U1 2HEVF 4PLMA 3W58A 1R082 3UJQA 2W1WA 3A23A 1C5HA 2IXHA 2WNUA 3KVAA 2BOJA 1FPN2 5BUVA 4LO5B 5LB6A 4FTEA 1GQGA 3RZJA 1VBD2 1B09A 1CAVA 1HIXA 4IEUA 5A7OA 2A75A 2ORZA 3J26N 1CAUA 3FHAA 1RXGA 2JDAA 3TWIA 2PYTA 4I3GA 2VOKA 5JR2A 3AKPA 2QDRA 4ARYA 1H8VA 1V9U3 2Y6HA 3QH6A 2DFBA 4N7IA 5H9RA 1JZ7A 1ASJ2 4UF0B 4BH9A 4XUTA 4GKYA 1UX6A 3C2UA 1BEV2 5FO8B 2YFZA 2OUJA 4CZSA 3N9OA 4Q4Y2 3CJIA 5FUIA 2BW8A 4BDVB 3KHBA 4NPLA 1DHKB 1SLIA 5FKBA 3N9LA 5K0UC 1H1MA 1TME1 3BIEA 2XJQA 1SLCA 2WA3A 2DDUA 4JRAA 5EV7A 3RYPA 4YYOA 1UWWA 3W59A 2VOVA 4MV2A 4OQ8A 2LW8A 4R4ZA 4FPLA 3AM2A 5LRRA 1W0NA 5EJZB 1YCIA 2Y64A 1JU4A 5IK4A 2IFWA 4TSVA 4GMP1 1MS8A 4BPZA 5DUWA 4CCOA 2A3XA 3WW2A 1EAH2 1DZTA 1XYOA 3OOXA 3VBOC 2YV8A 3LIHA 3VBRA 4EJRA 1TME3 1WCQA 5C5UA 2WT1A 4GWNA 1Z7S2 5LK7B 4A4AA 1I9RA 4MG2A 4E4SA 1LODA 4XDQA 1YWKA 4CTEA 3ACLA 5FO9B 4KH9A 1AR82 1RUE1 2RM21 2WS91 2WO2A 3JB4C 5F2WA 1IS6A 2P37A 1LJ7A 4GMP3 5LBEA 4XXAA 1W9TA 2VC9A 4FPCA 4C8DA 4CXWA 1F4HA 1PK6A 1WMXA 2ZX0A 2ET1A 3VKNA 3UKTA 4Q5OA 2JDMA 3AZZA 1VBE2 3U4XA 2FDKA 4D7TA 4MYEA 5GZGA 5JZGA 4LMFA 2FMDA 1PO12 1SHWB 1WD3A 2Y8KA 2O14A 2ILMA 2ZEXA 3P5BA 1RVF1 1APNA 1DFQA 1VBA2 2PHXA 4AQTA 2W87A 1WW4A 4Y5SA 1RUE3 2RM23 2WS93 2D93A 5FDBA 4OHXA 4Z2AA 3C7OA 2J1SA 1ZBA1 2RR12 4P5YA 3BU7A 1BZWA 4KI5M 5FXZA 2Q30A 2JKXA 2D3RA 2R0HA 3OPWA 3T2QA 2ARCA 2CY6A 4JDMA 5FFOC 1WGPA 1HQLA 5C8CC 2RS32 4K1ZA 1UY4A 1W6PB 3O14A 4AI8A 4OI0A 3WQ1A 5FPLA 2AUYA 3N9PA 1H6YA 1CN1A 2IZWA 3TBDA 3DECA 1XYPA 3NNJA 1RVF3 3AMPA 2B5HA 5FYIA 5LEJA 1C5IA 5FLIA 2JDPA 5L9RA 3BKZA 1NZIA 1ZBA3 1QOTA 1NCQA 1CIYA 2YC0A 1R1A1 3GBWA 1NOVA 3E1F1 3HBZA 4HBNA 4WM7B 2EXJA 4XQDA 2RMU1 4XXPA 3O1RA 3IDCB 2C5DA 4AVCA 2NM1A 2Y26A 3VBFC 2WUHA 1KS4A 5FY0A 3VDDA 3OGJA 4FAGA 2VW2A 2UURA 4YW1A 1W90A 1D4M2 3POFA 1K5MA 4L0PA 1W8ZA 4LORA 4M0HA 2Q8EA 4OHZA 4A7YA 5GM0A 5FJKA 5LZ6A 3OGSA 3I59A 2VOWA 3ZO0B 4OQ9A 1W2AX 1M06G 2R061 1QOSA 4BQ3A 1CD3G 1WW6A 1YUDA 3ZSMA 1IS5A 4XABA 1OA2A 1W8TA 1K3IA 1PZ8A 2X05A 2C4XA 1W6MA 4QXCA 2QZ2A 1GOHA 3NV4A 1R1A3 1V0AA 4YRDA 3SQOA 4Q4X1 5FZ4A 2RMU3 2PA7A 3MEPA 4ASLA 1HX6A 2VCAA 4XF9A 1LESA 3WF2A 1KQRA 4PLNA 2FCTA 4D6RA 2JD9A 4YFWA 4XF4A 5JMOA 4AVAA 1W03A 3H7YA 4YZ3A 4RQPB 4BWOA 4KU8A 4AZZA 4FPOB 2R063 5D1IA 1VRH1 4UFMA 5A3MA 4RR3B 1W06A 3WOGA 1XNCA 3NKGA 5FBJA 1SMVA 5FY7A 2D43A 2TUNA 2W52A 1F31A 5FK7A 1O3SA 3KCYA 3MIEA 4Q4X3 2ZX3A 1EPZA 2OKXA 4NMIA 2C24A 1G7YA 1JTZX 1WMDA 4XC9A 1HW5A 4W4ZA 4BZ4A 5A3PA 3WVJA 2AR6A 1DYOA 4MH0E 3U4SA 3ZX7A 5KHHA 1O5UA 1WA6X 3W9AA 2GNMA 2VO5A 5FRAA 5IYYA 5K9YA 3AXEA 1Q5OA 4JKMA 5J1XA 1VRH3 1W2OA 3LD8A 2VZ1A 3RJ2X 4K3UA 1POQA 3ZYHA 4DB5A 4ES9A 4P9LA 3IPVA 2VMCA 4C1WA 3ALQA 3TEZA 1H4HA 3KT1A 2JEMA 4Y1YA 3OEBA 3PIGA 2BGPA 2RDSA 1O3TA 1NA1C 3LPGA 3MI8A 4MGZE 4Q26A 3VDBA 4RS5B 4N43B 2PHUA 3K2OA 4GWMA 1C3HA 1DQ1A 1QXPA 1JMUB 1JS9A 2I2SA 5CIRA 4BB3A 4EQVA 4KGGA 1PX3A 1LTEA 4DEQA 5BNNB 4QKDA 1N1SA 2IXJA 2ZGUA 3AJYA 4XW3A 5GLVA 5L7OA 2JIJA 1OFSA 2ZABA 3AP4A 2P3KA 4YVWC 4Q0PA 1LB2A 3U10A 3RZLA 4COVA 1RIRA 3MHZA 1N1YA 2OQ7A 5C4WB 3AP6A 2R041 4P9WA 1SACA 1COV1 3LE0A 1J84A 4XILA 3HT2A 2D6KA 1N47A 1MZ6A 2MEV2 3IMNA 4MX3A 4XETA 3VBSB 1VPHA 4IW3A 1HDKA 4S2DA 2FD8A 3ZFFA 1AUYA 3POWA 1RUC2 5FYBA 1OOPA 4E2QA 2VQTA 3CNAA 5FY9A 1US3A 4OULA 4IEPA 3I2JA 3ZKYA 4AI3A 5A3LA 4L11A 3S57A 1VMFA 1YFYA 3KS7A 3LOBA 3WNMA 4E2GA 3AVRA 3LWCA 2HEYF 4ZZ5A 3M3OA 3RMXA 1AVBA 1CESA 1URXA 3M3IA 5FMCA 1UCXA 5EPAA 2VNGA 3MBWA 4RA0A 4HVOA 2B39A 4O65A 4W6XA 2ETEA 1AXZA 4G4FA 3SHRA 1W0PA 3F95A 2DF7A 4FPGA 5DZFA 2XB6C 3DKWA 3R05A 4KQ7A 3LEGA 1UZZA 2DTYA 4NAMA 2VPVA 2QKDA 2GU9A 3RYKA 3C7FA 1MQTB 1XSRA 5DG1A 2CSGA 5FY1A 1B35A 2G9ZA 3FFZA 4HOOA 4OLLA 3ILFA 3V0BB 1QXRA 2PMWB 1MS5A 1ZYBA 1IS3A 1W28A 4NIAA 1HB2A 2Q4SA 2ZGLA 3O1VA 2OPWA 1RUH1 4LBMA 4OI4A 4Q4W1 4YZ2A 5L9VA 2P1BA 1LAJA 2VJXA 2WNEA 4D6SA 1BQPA 1LULA 1XE0A 3LEMA 3K46A 2Q8DA 4CCKA 4DXTA 4YM3A 3OY8A 2NPIA 4DO0A 3DPRA 4HG6B 2OIIA 4LTAA 4E27A 1ND2C 1AR71 2Y60A 2HLEA 2LM3A 2WL1A 3I3QA 4MGKE 3VL9A 4TTGA 2WQZC 1BLZA 2WWSA 3AJZA 4LLOA 4Q8LA 2D5FA 2W1QA 3DN7A 5D8AA 3AFKA 1SZBA 3ZDVA 4D0QA 2HWB1 3LDKA 1HRI2 1I5ZA 3A0KA 5FAXA 3MV11 5BNOB 5CFCC 1JZ3A 1XU1A 1YJLA 1RUH3 4Q4W3 5EJ1B 5I8SA 4JQTA 5FZLA 1UU5A 4BE3A 1GFF2 1U5XA 2C0ZA 3H42B 3NVCA 5T5LA 4ZHNA 4XCAA 5FP8A 2JG8A 4I3PA 5B4NA 4XAAA 1I5PA 1U12A 4IETA 5ISLA 1AR73 1SEFA 2Y6JA 4A45A 4KWJA 2VAUA 3C7GA 1S2EA 1RUJ2 4IL7A 1CAXA 1HXS2 1X7NA 3HQXA 5GZFA 3ZYRA 2A70A 2XBO2 2HWB3 4GWJA 3NWKA 2OXBA 2WQ8A 4Y22A 3D0SA 3O0VA 3PURA 5FZDA 1ZRFA 1SCSA 1UX7A 1RGSA 1GANA 5BY5A 4KU7A 4Q2FA 4ZXKA 4O9EA 2O0OA 1OXCA 5IWFA 1GR3A 4JDNA 2DV9A 3GJBA 1JYTA 4E2SA 3WDWA 2QQNA 4MGTA 4YARA 4R9AA 2GMEA 2V09A 2RS12 3DEMA 5FUPA 5HV4A 4UW6A 1XNTA 2WZR1 2WAOA 3ACFA 3ABZA 4YM1A 3BTZA 1CAWA 5JOZA 1EPWA 3OJBA 4UFHA 1SLLA 1ND3B 1C8M1 5FV3A 3M2MA 2QQIA 2RG4A 3M3CA 1AYN2 2AGSA 3KM5A 4PQQA 5K0UB 1JZ5A 3R6SA 2XGXA 3WP4A 3E6CC 3BGAA 4IV3A 3D0JA 5A32B 2UWCA 4QHZA 2EIBA 2B8MA 4INDA 4QQOA 2R30A 1IQDC 1QXJA 4QB6A 2WZR3 2CV6A 1UQXA 4FXKB 3HVDA 3U0ZA 3WNPA 4QPGC 2E7QA 3EB7A 2OA2A 4DEVA 1C8M3 4Q29A 4EZHA 3E5QA 4FTBA 1VBB2 1RUD2 3VBOB 1Q8PA 3I54A 3ZXKA 3GDBA 5IVCA 4X8NA 1JZ4A 3IIAA 1FT9A 1ULOA 1AL23 3SKJE 1E5IA 2XKPA 1FV2A 1CVNA 1OUXA 2ARXA 1L3JA 4KMQA 4LEJA 4M00A 4XFIA 1D2SA 4PI2A 1DLLA 4BQ5A 3B9CA 3WNNA 3TNQA 4XFBA 1J1LA 1YLLA 1US2A 3AYCA 3D8CA 3VL8A 5IVEA 4P00B 1ODMA 1W8HA 2YBSA 1RHI1 4V2VA 3MIGA 2FDHA 4CDWA 4AQ2A 4H7MA 3ACIA 1GUIA 3SITA 2BZDA 1RMU1 2ZACA 2ZGQA 2E51A 2FZ2A 1EYBA 2VZRA 2ZEZA 2WNVA 4GH4A 4XFHA 3WLUA 1JZ8A 2YFUA 4W6YA 3IB3A 3KF5A 4HL0A 3ZFEA 2BNNA 2OVUA 2OX0A 3K4DA 2Z79A 3DYPA 4LR4A 1UMIA 1RHI3 3OGGA 1OLQA 5JXHA 2HBTA 1LGNA 1S0IA 5A1AA 1REFA 5JOYA 4LA3A 1WD4A 2BUKA 5C8CB 3IBMA 2VVDA 1RMU3 1TVGA 5A1FA 2RDNA 5FZCA 1NXMA 2MHFA 2NMNA 2E7TA 4UW5A 5D2AA 1HV1A 1CQ9A 3I3BA 4JV4A 4YW6A 3ZPOA 3T4VA 4CDUA 3O7OA 4KBBA 3W5NA 2PLV1 3ZYJB 1YQ2A 4NO4A 1CJPA 4YW7A 4DINB 5LRSA 4HPKA 2L9LA 1VMJA 1PVC1 2YUEA 4UT5A 5CB7A 3J7HA 3ZSEA 4EROA 3HOBA 1DP0A 2ZZJA 3M1HA 5A1LA 5CISA 1UZ0A 2A6YA 4I0WB 4LHLA 2ZTNA 3VBFB 5JDBA 2Y6GA 1NCRC 3M7AA 3Q8AA 2J1VA 3AP9A 3UGFA 1SLBA 3D5OA 2WN2A 5IVBA 3V65A 4B3NA 4IV1A 1OVPA 1YC61 2V5YA 2PLV3 3JBG2 3LQCA 1CZVA 1EY2A 4BMBA 1YQ5A 1IS4A 3D4KA 1WLDA 4FT8A 4CU8A 1FOD1 1O4TA 1RUE2 1CIWA 2VMIA 4IE5A 2GNDA 3AP5A 3AX4A 1V6NA 3P3NA 3VHNA 4HT1T 4RHV1 3AZWA 4Z1VA 4FFFA 4HKOA 3ITQA 4QDSA 1W8FA 4Q1RA 4RN5A 2XHNA 2BPA2 1VMHA 4HMZA 2D98A 5LA0A 1DQ5A 1JUHA 4XYXA 4YGEA 1GP5A 5IATA 3A7QA 3KT7A 2EICA 5I0TA 1E5SA 4IEZA 2PQQA 5LWBA 2PAMA 4QDRA 1RVF2 5DAVA 2Y6KA 1UXXX 2R072 2B7YA 3E97A 1FOD3 3B00A 5LATA 4CEWB 1H6XA 1U5YA 2UY9A 4NRPA 4RHV3 5GLUA 3AMNA 1NZCA 4LULA 1RJ7A 5G05L 1XJAA 1W6NB 5HCHA 1KGYA 2O1QA 2RJLA 1R091 3OGRA 2XOMA 4U36A 5F6KA 5JXGA 5A3WA 1XNAA 2PHTA 3H8XA 2HWF1 1DBNA 3ILRA 3QH7A 2UU8A 2VZVA 5I91A 5KXDA 4O9GA 2EXHA 1WMEA 4KBZA 3FWEA 2JIGA 3IN9A 2XQXA 3F2ZA 2LALA 2HEWF 4QB2A 1UAIA 5E6HA 3TB0A 3G6JB 2C1FA 4NWVA 4GZ9A 2RMU2 4E4ZA 4Y20A 4YFZA 3WUDA 3MUY1 1GU3A 3LAGA 3H8OA 2PAEA 3JD71 1R093 2ADDA 4HFSA 4OI2A 3ZSKA 3Q8EA 4COYA 5J3UA 2JDYA 2HWF3 3DUIA 5LA2A 2VW1A 1UU4A 4YVWB 4A41A 5K4LA 2R062 3T30A 3SEEA 2WZPP 3T1LA 3AP7A 1UPIA 3AKQA 4PT6A 1W6OA 3P1IA 2Y38A 3USSA 3H8UA 4LHSA 1EV11 4XEZA 5EJ3A 3LPFA 4MXVA 1RTVA 2AEYA 3HN3A 3N36A 4YNIA 5F9TA 2J22A 2CHHA 2ZX2A 2VZTA 4C90A 4AFBA 3SH4A 3WZ1A 3JD73 4GWIA 4Y33A 2D6MA 1YFXA 3ZOIA 4LJHA 4FPJA 5IT6A 3JQWA 1POV0 4EWEA 1TE1B 1Q8SA 2VE1A 3KHCA 3JCIA 3C7HA 3VBHB 1SG3A 2BP6A 2VMHA 2WJSA 1KD7A 1NYWA 4RS5C 3IZOA 5CKMA 4ATFA 3WSOA 2D97A 2Y0IA 4UW4A 2EIGA 1H1IA 1EV13 3RI8A 3B01A 5FZ7A 2DCTA 3OPTA 4QT6A 4YVSA 1QJZA 2SLIA 1JYWA 3I3EA 1UF2C 2GSYA 3CF6E 1AR62 4DY3A 2ZXQA 5ANQA 1FI2A 2ZHLA 4NIHA 1RINA 4GXLA 4D3WA 1JOPA 1SFYA 2MPFA 3POEA 2I45A 4CDQC 1O6UA 4LUMA 5A6ZA 5C4WC 2J7MA 2PXJA 4BLIA 3NO8A 1OD3A 1AR92 3DGTA 5FYCA 1VBC1 2JG9A 2ZPXA 4IEQA 3VBSC 1YRZA 3TN91 3V64A 1XB9A 1UYYA 1O5LA 1ZZ7A 4FFIA 1PNGA 3N9QA 1DGRA 1QJU1 3PHMA 3H1WA 4CP2A 5FXXA 3MIFA 1X33A 4B7EA 3WDVA 1OPOA 5KWRA 2ORXA 4XPVA 2JDZA 3CO2A 2NMOA 4CU7A 3FBYA 5DAXA 4Y1VA 1E57A 1W2UA 5FOJB 1VBC3 4DXSA 4M4RA 1ZRRA 3LF7A 5CFCB 4OMCA 5HPOA 1K12A 3TN93 4N53C 3ETQA 4Q0VA 2R042 3HJRA 3DL3A 4NAOA 1COV2 4ZS3A 4UF0A 3VZNA 1OLRA 1MR5A 1QJU3 5JSPA 4HZFA 1UZWA 3J7LA 4QPIC 3T0AA 5A6YA 1DDLA 4GALA 1RUOA 5FQ0B 3VBUC 5C3PA 4TLGA 5LEKA 4DRVA 1IKQA 2XDVA 4WVZA 2ZMKA 3ZFGA 3MLKA 1CZSA 4AW7A 4JDOA 3I3MA 3ME2A 3ZYPA 5C3OA 4N9IA 2XL7A 3P6BA 4Y1UA 3FHQA 2VBBA 1BK0A 4OZOA 3LSEA 2YGLA 3QOPA 4XDOA 3KF3A 4YW3A 1S55A 5LBBA 4P5HA 3SCHA 3ZYFA 1YFUA 5JSRA 3QCWA 3SCGA 4NIGA 1CGPA 1G9CA 3NAPC 4NR1A 1RUI1 3FBMA 4LBKA 3NV1A 3OBRA 1W9FA 5F5CA 3VB9A 4CP0A 3ZXJA 2DBNA 2B42B 4S2GA 4BQ1A 2NP0A 5BNOC 5LASA 5J37A 5F6LB 4XCBA 2VH9A 5FZ3A 1H8TA 2WYSA 3BTYA 5C3QA 5M0TA 2HWC1 3WCRA 2W08A 4IGPA 4WM8B 1PHMA 2P2KA 3DYOA 1AL0G 4TXWA 1RITA 2GALA 2G1MA 2YBPA 4UFLA 4AFDA 4ARXA 3ZYBA 4JCKA 4DZGA 4MHUA 5ANNA 2BOIA 1RUI3 2P3YA 3GBGA 4ZY9A 1YQ6A 4B1MA 4NROA 1AXYA 2JD4A 4XFFA 1JYVA 1IG0A 1ULPA 4META 4WVWA 4XBQA 5JAXA 4Q8KA 3N7MA 5T5OA 1UPSA 4QPGB 2GMMA 4LBJA 4PHZA 3ZN4A 2R0FA 3OSDA 5A7WA 2OPKA 3KQ4B 4J25A 2ID4A 3NMBA 3DKQA 3VD4A 3BB6A 2E33A 2HWC3 3S6PA 1DGWA 1GZCA 2FCVA 5KR7A 3GCXA 5IHRA 2V4VA 1Q56A 2VTXA 3HT1A 2W9XA 1BMV1 1NE6A 2QNKA 2W0XA 1UKGA 3EQEA 1OBNA 1GV9A 1X8MA 3A4UA 4IUGA 4NHKA 1I6XA 3T4HB 5IFTA 4KGQA 4CRQA 2WRAA 1CWPA 1H4GA 4Z07A 4Q4V2 1POV1 1OT5A 1ND3C 4G9SB 1NY71 2H6CA 1HQNA 4M3CE 2YMZA 5FZFA 1GICA 2ZAAA 3RRDA 5F3CA 3WF1A 3LSDA 1BKZA 4OUSA 3HN1A 2K2SA 1LENA 2QQJA 4GB31 3H0OA 4OFGA 3WP3A 2VM9A 2JE9A 1CPMA 3N9NA 3LFIA 1RUG1 3C7EA 4B7KA 1SFPA 2W3JA 4LLFA 1S2BA 4WM7A 5KBFA 3WQBA 1POV3 1JW6A 1LHNA 3MLLA 1A8DA 4UWDA 2DFCA 3EHKA 4NE9A 3OEAA 2A71A 1JBCA 1AX2A 1PM7A 1VAKA 4NHMA 4AFMA 1A78A 2XJUA 5BNPA 1JODA 5FLHA 2NYYA 5JOWA 5E8AA 3WHUA 4GB33 3HNYM 3BYWA 3N4MA 5FPXA 4XIKA 1QJFA 2D6PA 3K3NA 1R1ZA 1UY1A 1RUG3 2AENA 2GC2A 2ZX1A 3NV3A 3LEKA 3WF3A 1OLMA 3AZVA 1X9PA 2XJTA 3H3LA 4HKWA 2VTFA 5F5QA 1ODNA 4AFAA 2XG3A 5JI9A 1KJRA 4I30A 4CDXA 3ACGA 3M8LA 3MO4A 3I2IA 1L7RA 3WW3A 2VNVA 4Y1XA 4RQPA 5IVYA 5T52A 3WF0A 5A6QA 4F83A 2UWBA 4X6QB 4EN8B 2WFF1 1TEIA 4RR3A 1NCRB 3NNLA 3MIBA 3MW3A 1OKQA 4IEXA 1F2NA 4MXWB 1XNBA 4TYSA 1J3RA 2XONA 1O3RA 1M4WA 3KLSA 3O1OA 5DDJ1 3RSJA 3CU7A 3FUOA 3M70A 2QQPA 2VUDA 5BXXA 3LDRA 5IAXA 1TZOA 3PUHA 4R9CA 3WG3A 2D3SA 2B46X 3I4IA 4AHZA 4IEWA 4URAA 2B9VA 4XBLA 2BU9A 3THPA 2JECA 5FTTC 4M01A 2WFF3 5DG2A 3VZOA 2V73A 1GQPA 1QIQA 2J1UA 2RV9A 1RHI2 4LO6B 3UETA 3AYDA 4P02B 2XQRA 4N90A 1Q8QA 2IVJA 2Y33A 5FP4A 5T5JA 4HVQA 5C9AC 2V4AA 5FYYA 2QQWA 1V6OA 4PIXA 5DDJ3 4PBOA 1LOCA 4PIZA 3MDPA 4N43A 2YXSA 4FAHA 4TLFA 4AK3A 4ZU4A 2AEZA 3AB0A 2WINB 4NPRA 1YJKA 3POIA 4BQWA 1RUF1 1AX1A 3CJIB 3EYPA 4DY5A 2CWSA 3VHRA 1O91A 5ACA1 5BNNA 1KDKA 3R4SA 5A6XA 2ES3A 3VHPA 1G6NA 2X10A 4GULA 5KHKA 2DVFA 3AL6A 3WD5A 3DCQA 2PELA 1PGW2 1DGRN 4IV3C 4XZPA 4D8MA 1AXKA 1QQP1 5C8WA 4HN0A 2XXZA 4JGZA 4YW4A 5B4XA 2WABA 3LCPA 2Q1MA 4XJ8A 3WG1A 2NQYA 4I0BA 2WWUA 3JZVA 3M3QA 1REEA 3NSTA 4AVTA 4YPJA 1QMJA 3T0BA 1MEC3 4LIVA 1RUF3 1VRBA 3TAYA 3PVNA 3VUOA 5ACA3 5T3NA 3ZXGA 4BU2A 1PVC2 3VBRB 3ZN6B 1QF3A 4NVPA 1ZZ9A 1XXNA 5IK7A 1KFXL 2DCYA 4NJ4A 2LTNA 2PTMA 1QQP3 3RGBA 3CZUA 3R0RA 4JKKA 2WWJA 1UOJA 5ERLA 2RS51 1PGSA 4XFAA 4XJAA 1O4ZA 3THDA 1T6GC 3MYXA 4BMEA 1SBFA 4MZUA 4B29A 3IAQA 2K0GA 4CEWC 2VUAA 1WA4A 2WQ4A 2Z42A 4CCJA 4XUPA 5EXOA 5AFBA 3OUJA 2YB7A 2Z2SB 1PK6B 1OMIA 1Y9GA 2TNFA 3HNMA 4YW5A 4V2WA 5F3EA 5FY5A 4MHRA 1ZX5A 3ZR6A 5FZ9A 1FX5A 1W3VA 4YZ5A 2YZ4A 1MQTA 5JZGB 4AVSA 5FKCA 4W6WA 2RS53 1IG3A 3FLTA 1W8NA 2OT7A 5KC6A 1CPNA 1YHFA 2QCSB 3NW4A 4AEDC 1PGL1 2HWE1 4BYYA 1DGWX 1N3PA 3VDCA 1I3HA 1BYHA 5JVVA 1KEXA 2VU9A 2D5HA 3IDEA 2J1AA 4FFHA 3WV6A 2OS2A 1LOFA 3PU3A 1WCSA 5APAA 1CONA 4FQZA 4CDQB 2W1SA 1UU6A 1GNZA 3GGLA 2HWE3 2X29A 3J8F1 3CMGA 4LBQB 2VTXJ 4NHLA 1DCSA 2EXIA 3MPPG 1XE7A 3PMEA 4JX0A 3ROUA 2ZGRA 1HRV1 2VOXA 3POYA 5C3RA 5F7UA 2VMGA 1OH3A 3EBRA 3NJVA 5EZWA 1H2LA 1LR5A 2HWD1 3WNLA 4QXHA 3VBHC 4AF9A 4CCNA 2EIEA 3LFMA 3ZIWA 1IKPA 1DZQA 3HIFA 1ENXA 2UYBA 3J8F3 3HQUA 2HYKA 4YGBA 5A33B 1OSGA 4M3CF 3WW4A 2DUQA 2CU5A 3VKFC 3FZ3A 5IFPA 3POSA 1HRV3 2XLGA 4K6BA 4XUQA 4YG0A 5CFDC 4N53B 1HV0A 2FZ1A 4O7XA 2VVFA 1AYM3 3KWVA 4KNCA 5JI7A 3T1MA 1S0JA 3J7NA 2Q1FA 2ZHKA 2B9UA 2HWD3 3OBZA 2D3PA 2ZMLA 4QPIB 1XBFA 4QQLA 2FMYA 4AXOA 3VBUB 5BPXA 5DAWA 1XPWA 1XQNA 1Z78A 2R32A 3THTA 5ABJC 5H9QA 3BODA 4WV8A 1D2QA 2VUJA 3PMSA 1V6IA 5K0UA 5K8SA 4QX3A 3SMHA 2B45X 1UN1A 2VZ3A 5A32A 1A3KA 3N35A 1S0DA 4RGAA 4IDZA 3FHIB 5BNQA 5A7NA 4GAZA 3NAPB 4FP2A 1W39A 4XUOA 1DZRA 1X36A 5DAPA 3O1PA 5GALA 5J36A 3I2FA 4XJWA 2YROA 3IPVB 4PLOA 4M3CB 4XURA 2CGOA 1QDCA 4UBGA 3VBOA 5C71A 5FPZA 4Z92B 1LNSA 5HI0A 4GKXA 2XJVA 4XJ9A 2WO7A 3KV9A 2JICA 4FSJA 3PUAA 1FPN1 5GZCA 4Y5Z0 4K8FA 4AQ6A 3TN92 4PQ9A 4AQSA 4P9JA 5FPUA 1QGLA 4I09A 1C1LA 2P4EA 1VBD1 2BBVA 3K3OA 1QJU2 4FPYA 1NAEA 1LHOA 5E1RA 5L36A 5LBFA 1KJLA 1WMFA 4Q27A 3VZJA 1GZWB 2XKOA 5L19A 2O8OA 2B4KA 1OFNA 4PIYA 3V0AB 1ASJ1 1PIV2 2LS6A 3DV8A 4CEYC 1FPN3 2YG0A 2VXRA 3RZGA 1BEV1 1RL3A 5FWEA 2UYAA 4Q4Y1 3A0NA 4QPWA 3PUSA 1VBD3 5IK8A 2JDNA 1OOPB 4QM8A 1OF3A 3UESA 3KZ4C 4CA9A 3FC0A 3GJAA 3GZAA 2GP3A 3GALA 3OTFA 2RVAA 5C8CA 4WM8C 1OA4A 1TMF1 2VZOA 3LKJA 5G04L 1ASJ3 1S0EA 1AL21 3HEIA 4QGLA 2VMEA 4FPFA 4CP1A 2CWMA 1MS9A 3AKRA 5J7MA 1BEV3 3ZN5A 1IPSA 2CL2A 4Q4Y3 2FDJA 4LO7A 3WQ0A 2H6BA 1G8WA 5FOBB 2VY0A 2E31A 3AYEA 2GZWA 2X09A 2OZJA 5F37A 3GHMA 4R8HA 1ZZ8A 4QQHA 4QGNA 1F15A 1HKDA 3VBFA 5I8TA 1GWLA 4WBBA 4LOSA 3MPBA 3GNEA 1Z7S1 4NHXA 3H9AA 5A3OA 3V56A 1TMF3 4YW2A 2BQPA 5FZOB 5C70A 2G4IA 3URFA 3R4DB 2ZA9A 3FL7A 5FP3A 1AR81 1SBDA 3PNAA 1ALYA 1UY0A 4FXGB 1XE8A 1UOFA 5KXBA 3DPRB 4C0BA 1U0AA 3GYDA 1OQ1A 1NQJA 1V9U2 3SCFA 4QWNA 4CP9B 1UY2A 4K20A 4E4HA 3BOPA 3AKSA 4BOWA 1VBE1 2BVBA 2BFUL 1Z7S3 5L73A 3UT0A 3UV9A 1JYXA 4A7KA 2BTVC 1PO11 3RNSA 3WG4A 2BYVE 4C1XA 1V6JA 5DMYA 2VULA 1VBA1 3MGUA 2R6QA 1AR83 2ATFA 4H55A 2BEOA 4XHBA 5D21A 1UIJA 2D6NA 3ZR5A 4N8MA 1K42A 3WY6A 2RR11 5J48A 2JDKA 5CNAA 1IHMA 2A6XA 4JGYC 3JU9A 4DS0A 3N7KA 4R9DA 3S7EA 2KD7A 1I1EA 2C6SA 3AMHA 4AFCA 2IXCA 3UNPA 1VBE3 3FLRA 5JPNB 1LOBA 1CAXB 3H50A 2DU0A 1YI7A 2GC0A 2QZ3A 1PO13 4RD7A 4C91A 2WDBA 5HBAA 3ST7A 4Y22B 1D0HA 1CJDA 1NY72 1VBA3 2XUEA 2FHRA 3T2TA 3OD0A 2ZGPA 1UOBA 2YYOA 4LNVA 2ZMNA 1LGBA 2RR13 2DCKA 1TME2 2WT2A 3IMMA 3TYJA 4ISRA 5C9AB 2EAKA 2DCJA 3B94A 1KS5A 3AC0A 3I2GA 3L2HA 3ZYIB 2Q8OA 4HK8A 5LW9A 1CX1A 1F35A 4LT5A 1NA1A 4UOJA 3VGIA 1ZRCA 3OBTA 5FZBA 5CBLA 3WXPA 4CSWA 5FO7B 4NHYA 1CAWB 5FZMA 3BTXA 5FZAA 4R9BA 2QQUA 4AHXA 4ZU7A 1QJY1 4SLIA 3SXWA 3AZYA 5JLVA 4CXXA 3CBNA 4Y1ZA 2GH2A 2GP5A 2W94A 5CG9A 2W2IA 2W68A 3WINE 4CCMA 1JZ2A 4YVWA 5IJRA 3B5LB 4XQ4A 4IV3B 1RUNA 3H1YA 3HR9A 3I2DA 4FOYA 3B3QE 2WNUC 3ZXAC 3KGZA 1PMHX 4KWUA 1FMD1 5H9PA 3SH3A 4ATEA 4QX5A 5KC5A 2VQUA 4GIQA 5FREA 4L92A 1A34A 2RM22 2WS92 2F4PA 4IGQA 3JQXA 2X5IA 4YSFA 1QJY3 2VG9A 4IGOA 3W5MA 4COZA 2WKKA 4HETA 5EP9A 3KV6A 5FYTA 1H2MA 1LCLA 3WW1A 3RQ0A 1GKBA 1UMHA 2ARBA 4AYUA 1WCDJ 3O1MA 4LQRA 5CKQA 4ZXEA 3I7DA 5HCBA 4AAPA 4I02A 2ZJCA 1FMD3 3VLBB 2WR9A 5LY1A 1DLCA 2VMFA 3DXTA 4EN6B 3CJXA 2JE7A 3AYAA 4OI1A 3CJIC 2P5BA 5FYMA 1NUKA 3LDBA 1ZBA2 3MV01 5CKNA 3E5UA 2AREA 4OHWA 4S2FA 5DQ0A 4XFCA 3FX3A 3WQ7A 5AC91 3FMGA 3CIHA 4J6GA 1L7QA 3RI9A 5FZGA 1CR7A 1J59A 2PHLA 2K9ZA 2J1EA 3VD7A 3WF4A 4CCLA 1MS0A 3OGVA 1O7FA 1MZFA 1ENSA 2YPDA 5A3UA 2GNTA 5FMOL 4LKDA 1UXZA 3LGRA 1WW5A 3E5XA 2WNOA 4AEDB 1ZREA 1G9AA 4FTSA 1R1A2 1WLWA 1ZA4A 3VBRC 2BGOA 2F4LA 4QD2A 2YU2A 4XHXA 4DIQA 4TN7A 3L2YA 5AC93 1DYPA 1FV3A 1HB1A 4PDWA 2WC2A 2CGPA 2A6ZA 1C8NA 1ND2A 1X82A 5F1RA 1V6LA 5FZIA 4ZONA 2RJKA 4MSVA 3HAGA 3W21A 4DXZA 2KXLA 2UY8A 5C7GA 2MEV1 4BK4A 5CFCA 1SDDB 5H9SA 3KV4A 2EF6A 4OMDA 1YNAA 2PFWA 1BCXA 3JUUA 3K51A 4AOCA 4BLJA 5JOXA 1BJQA 1RUC1 1PK6C 4Q4X2 3DF0A 1F9KA 4XOGA 3IWZA 2WZEA 3I2KA 4BQXA 3FJSA 2HKXA 2Y6FA 4TZDA 5JZGC 2PN5A 5FQ0A 3W20A 2FDGA 1LECA 2YBKA 1LU2A 1GZ9A 1VAMA 1X8EA 1FNYA 2XLFA 1TNRA 1SCRA 4MGQA 1JOJA 1VRH2 1GMMA 4IV1B 5LA9A 5LY2A 2MEV3 4AAXA 5LCWL 4QXKA 4GJZA 2Z5WA 2D6OX 2HBUA 4QDQA 1RUC3 2RS52 2ZAHA 1J1TA 1AX0A 2VNOA 3K4ZA 2R7EB 5CFDB 3BPZA 2CAVA 2HYXA 2ZGKA 4IE4A 5F3IA 4A6SA 3NL1A 3VD5A 2F6BA 1PNFA 4AEKA 2VECA 5FPBA 2H0BA 4R4XA 1FYUA 2GH8A 4F8AA 1J3PA 4U2AA 1NCQC 2VW0A 2XVKA 2ZKLA 5CU1A 5ABJB 1OLME 4NPMA 4QPYA 4XTPA 1NG0A 4Y4RA 2AZ5A 1OVSA 2ZHNA 1WWYA 4MGIE 3VDDC 4UFKA 3ZXEA 1T6BX 4D69A 2ZEWA 4F7ZA 3KGLA 3CQOA 3HD8B 5IVJA 1K5MC 1PGL2 3IKWA 2DUPA 2JDUA 5CYYA 1X50A 4QX7A 3TEXA 3VKMA 5E89A 3B93A 2W47A 4AEJA 4LBLA 1LGCA 1PVXA 2CAUA 5EYXA 5FXVA 2Z69A 4QPGA 3WDXA 1GZTA 1OH4A 4UFJA 4QB1A 3CHXA 3ZXLA 1JUIA 4N7UA 3RYRA 3SH5A 5IW0A 1ZA7A 4XF0A 3X29B 2W39A 2P3JA 1ZVFA 3EJKA 3POBA 1C4RA 3MLJA 2W46A 2W95A 3B02A 1ZZCA 1RUJ1 1HXS1 2XBO1 3Q8CA 2VCCA 3ZYGA 1UYZA 2XJSA 4COUA 3ZM8A 3UL2A 3ELNA 2C26A 1HB3A 5DZEA 3VD9A 3I8TA 3OD4A 3RFRA 1ZNPA 2RDRA 1LKNA 3IAPA 2TBVA 4HK9A 2PAKA 4WVMB 2XH6A 4XUNA 2WLPA 4JC1A 4EE2A 5DUXA 2VZUA 2RS11 4EWDA 1NLRA 1RUJ3 4CEYB 1HXS3 1OPMA 2BWCA 2OUHA 2WSVA 2XBO3 4MOAA 4B4RA 2QDNA 1QH7A 3H7JA 3CL1A 3I2HA 3USUB 1ENQA 5HCAA 2A6WA 5HXVA 3ASIA 1AHSA 3KB5A 1F4AA 2J42A 1IQAA 5EFUA 3TEWA 1Q8VA 1UKRA 1E5HA 1MS4A 3HBKA 4Z8BA 4QX1A 5CZKA 1DIWA 2RS13 1WLTA 4QX8A 1REDA 1RUH2 4Q4W2 2EA7A 1GP6A 2DTWA 1V00A 2PHFA 1XC6A 4YLZA 2YU1A 1AF9A 4ZPIA 3GXUA 5L9BA 4LK7A 5L7OC 4YM0A 5I93A 1VBB1 1RUD1 1S0FA 3O1UA 1AR72 2XVGA 1NT0A 4XF1A 2D7FA 4Y5TA 1UZYA 1W6QB 4AHYA 1OQDA 4P08A 5K7PA 5CADA 4WVVA 1RB8G 4O61A 1NCRA 2HWB2 3CLPA 3IDAA 4MXWA 1ZRDA 4UAPA 3ZIXA 3LB9A 4ASMB 4JTNA 3GM8A 5EYYA 3ZFFC 3ON7A 1MS3A 1G9FA 1H30A 1QJEA 2JXAA 3MW4A 3N9MA 1GYKA 1OOPC 3C8XA 3PJYA 2XVLA 4K1YA 4RGGA 5LA1A 1NE4A 1RUD3 1VBB3 3U14A 1O8PA 2JENA 3WDUA 3OYWB 2A3YA 1W6PA 3PLQA 3JB8A 4BA6A 2KA3A 4LUKA 2PHWA 1HJFA 4AE2A 1KXGA 1UD1A 4FQ4A 2ZX4A 3T2PA 2KR2A 1ULFA 5A3TA 5HXMA 2LUWA 4NUBA 1F8VA 3AXDA 5FYSA 4YG6A 1GQHA 2YC2A 4BJ0A 3BI3A 3VZLA 5I0SA 4DXRA 4AI1A 5FP7A 4JGYB 4Q1PA 1UW8A 1SPPB 4MGYE 4JHZA 1B35C 4DMIA 3T2OA 4G3YC 2WZR2 2YDEA 3ZFGB 2BWAA 3BTAA 1HB4A 2ENRA 4UYBA 5DUUA 4CPBD 3POJA 1NQDA 1OD5A 1TQ5A 1C8M2 4IEOA 3EXUA 5FYUA 4AG4A 5JIUA 2JB8A 2E6VA 3VV1A
chains in the Genus database with same CATH topology
1OVPA 2BV4A 2WR9A 1W8HA 4CE8A 5A6XA 1UQXA 1OURA 2BP6A 5D2AA 1OVSA 3DCQA 5A6YA 2JDYA 5HCHA 2VNVA 2JDNA 5A3OA 2JDMA 5A6QA 2JDPA 1OUSA 2JDUA 4UT5A 5A70A 1W8FA 2JDKA 2VUCA 2WRAA 1OUXA 1UZVA 2BOIA 4AOCA 1GZTA 2BOJA 2CHHA 5A6ZA 2JDHA 2VUDA 3ZDVA 1OXCA 2XR4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OVP A;  2BV4 A;  2WR9 A;  1W8H A;  4CE8 A;  5A6X A;  1UQX A;  1OUR A;  2BP6 A;  5D2A A;  1OVS A;  3DCQ A;  5A6Y A;  2JDY A;  5HCH A;  2VNV A;  2JDN A;  5A3O A;  2JDM A;  5A6Q A;  2JDP A;  1OUS A;  2JDU A;  4UT5 A;  5A70 A;  1W8F A;  2JDK A;  2VUC A;  2WRA A;  1OUX A;  1UZV A;  2BOI A;  4AOC A;  1GZT A;  2BOJ A;  2CHH A;  5A6Z A;  2JDH A;  2VUD A;  3ZDV A;  1OXC A;  2XR4 A; 
#chains in the Genus database with same CATH topology
 3TEY A;  4E4D X;  1GNY A;  1TMF 2;  3NRU A;  4XVH A;  3DPR C;  1W8W A;  5DAQ A;  4OVE A;  3S5A A;  1AL2 2;  3THC A;  3UKV A;  1H9W A;  2PQS A;  1PZ7 A;  5D8A C;  2G9G A;  4FFG A;  2WZ8 A;  3TRS B;  5JXI A;  5I0R A;  1VAL A;  3WCS A;  3ZN6 A;  3I97 A;  1UL9 A;  1J3Q A;  2VUC A;  1QH6 A;  1H8T B;  3SEP A;  3QAC A;  3PVE A;  4BIF A;  2BFU S;  5GKA C;  2JG8 C;  3JBG 1;  3RG0 A;  3ZXF A;  5C5T A;  4IQP A;  4K40 A;  4LIU A;  1DU3 D;  2DYC A;  4YGD A;  3NNM A;  4QQP A;  4A3X A;  2GN7 A;  2YPJ A;  4DUX A;  2WFP A;  2ARA A;  2WNU B;  3PDQ A;  5DAB A;  4BK5 A;  2ZEY A;  5FY8 A;  5SV8 A;  4A2U A;  1NKG A;  4EN9 B;  1Y7B A;  4AGG A;  1YQC A;  3UKN A;  3O1T A;  5A7W B;  1CAV B;  4LO8 A;  3B9I A;  4Y3O A;  4EN0 A;  2GC3 A;  4ITC A;  3WG2 A;  4LPL A;  1CAU B;  3JBG 3;  2GAU A;  3GCW A;  1JH5 A;  1ULE A;  4JQR A;  1RMU 2;  2R07 1;  2WO1 A;  1IOA A;  2BBA A;  3OF1 A;  5GZE A;  3IDB B;  1OA3 A;  4DQA A;  5KHJ A;  5E88 A;  1ULG A;  4RS5 A;  3BPS A;  4A7Z A;  5A7Q A;  3ZVX A;  3K4A A;  4X6R B;  4DUV A;  1BBT 1;  1MEC 1;  1MVQ A;  1N3Q A;  5SV5 A;  4NOT A;  4GA9 A;  4LKE A;  1D7P M;  2VGD A;  4BIO A;  4UBH A;  3FFQ A;  1S0G A;  4S2H A;  4A3Z A;  2I07 B;  1W2T A;  3WP5 A;  5FZH A;  1FAY A;  2VBD A;  3FN9 A;  5FZ6 A;  1SLT A;  1MS1 A;  2CYF A;  1V6M A;  2R07 3;  3N7L A;  3OPZ A;  4SBV A;  4CDQ A;  1JN2 P;  5C4W A;  4LBQ A;  1JHN A;  5FMD A;  1ULC A;  2XWB B;  4BQY A;  1BBT 3;  1C1F A;  1S4C A;  1LHU A;  1Q3E A;  3N7J A;  3VBS A;  2PLV 2;  4FOV A;  1NLQ A;  4FOQ A;  2P3I A;  2VCM A;  2N7G A;  4IE7 A;  3MFC A;  4BM8 A;  4EN7 B;  5BNP B;  5JPM B;  2QQK A;  3WX5 A;  3VKL A;  1OC1 A;  2DWR A;  2XR4 A;  2QQV A;  3M3E A;  4J1W A;  4ASK A;  1YXW A;  2W1U A;  3T08 A;  1QJY 2;  2EXK A;  4CCE A;  1WZX A;  1AZD A;  2VXJ A;  3WDT A;  5A33 A;  2AYH A;  2DU1 A;  2VOT A;  3BCW A;  3FLP A;  1Q43 A;  3MUZ 1;  4KG8 A;  4OUM A;  3GZT B;  4CDX B;  4NN0 A;  2WO3 A;  4N53 A;  5DN2 A;  5A3N A;  4D7Y A;  1FMD 2;  1HN1 A;  4LO4 B;  1N1V A;  4L99 A;  4RL7 A;  2A6V A;  2VQ0 A;  4CDW C;  1FOD 2;  4N9H A;  4BXF A;  3J7M A;  1MZE A;  1WKY A;  4DFS A;  2JWP A;  3S30 A;  4PCR A;  4RHV 2;  4QPI A;  4BXS V;  1J83 A;  1WCK A;  1IPJ A;  2WNV C;  4GH4 C;  3VBU A;  2BNO A;  2Q5T A;  3V0B A;  4QGM A;  3ZFE C;  1XOY A;  5F3G A;  4NID A;  1R64 A;  2DVG A;  3BIW E;  4QKN A;  3RVH A;  1V70 A;  4W50 A;  2E7A A;  3MW2 A;  1HN0 A;  2YHJ A;  2DUR A;  2E53 A;  1AR6 1;  5F39 A;  4PBP A;  4BCU A;  1CX4 A;  3C3V A;  4M0N A;  3PUI A;  4URT A;  5FMO S;  4XZU G;  5FLJ A;  1SLA A;  3U37 A;  3ZKU A;  2NZ9 A;  4J1X A;  3AFG A;  3WR0 A;  3NAP A;  5I0U A;  5JCT A;  3ZLI A;  1DGL A;  2ZGM A;  5AC9 2;  1T2X A;  2OYZ A;  2E9Q A;  1H0B A;  1WUV A;  1WBL A;  2WN3 A;  3GZU C;  4M3C A;  4V1P A;  2VL4 A;  1AR9 1;  4P9Y A;  5AVP A;  5DXD A;  4CYD A;  4CDU C;  3PTY A;  5BNO A;  4BIS A;  1R09 2;  1J58 A;  1RC6 A;  5TSW A;  2JJ6 A;  2HWF 2;  1NCQ B;  3ES1 A;  3K77 A;  5FXW A;  3G7D A;  3UGH A;  3HQR A;  1AR6 3;  5FYH A;  4LE4 A;  3BUC A;  1H1A A;  1IGO A;  3HPN A;  3QLQ A;  3ETP A;  3VDD B;  2J1T A;  4XJU A;  1OUR A;  2YGM A;  2QQM A;  2EVX A;  2ZGT A;  1AYM 1;  1K5M B;  1QJX 1;  2VZS A;  1X9T A;  2D6L X;  3I59 B;  3I2O A;  4IV1 C;  1QY4 A;  2RHP A;  3H8R A;  1AR9 3;  4ISQ A;  5LK5 A;  1OUS A;  2PHR A;  5A70 A;  1QU0 A;  2CDP A;  3JD7 2;  1TNF A;  4RYD A;  4E8D A;  4JGZ B;  1GZW A;  1W6M B;  2SBA A;  4LKS A;  3LA7 A;  4YM2 A;  1UZV A;  3MF9 A;  4P9I A;  2AH2 A;  1Y3T A;  3E6B A;  4GJY A;  5EHD A;  4BHP A;  2ZKN A;  4ZKT B;  3V0A A;  1DG6 A;  2W5F A;  5J09 A;  2NN8 A;  2X5I C;  3KVB A;  2XML A;  4FPH A;  4ZZ8 A;  4AI9 A;  2ADE A;  1QJX 3;  2RJ2 A;  1EV1 2;  4Q0U A;  2QE3 A;  2E63 A;  2QVS B;  4M4P A;  5A7S A;  1ZBE 1;  4QKB A;  1Y4W A;  5T54 A;  3SIS A;  4Q0S A;  3SKV A;  4YZ4 A;  3VKO A;  3Q8F A;  3CDZ B;  4K9S A;  5FP9 A;  4B8E A;  1ND3 A;  5DUV A;  5IUQ A;  4GD4 A;  4FI9 A;  3T0D A;  1YQ8 A;  5FR3 A;  2GC1 A;  1ZM1 A;  3ZSL A;  2XJR A;  2R04 3;  5FWJ A;  1COV 3;  1YEW A;  1Y9M A;  3P3P A;  1G86 A;  2Q1Z B;  3PJQ A;  1PO2 1;  2Q8C A;  5C3S A;  1VR3 A;  2HH9 A;  2O8Q A;  3CZJ A;  1XU2 A;  3PVB B;  1JYC A;  1ZBE 3;  2R16 A;  4CUB A;  4AGV A;  3OUI A;  4RFT 0;  5FJH A;  5CG8 A;  4K7J A;  2GN3 A;  3QD6 A;  4PI0 A;  1LU1 A;  3RWN A;  4ES8 A;  1LEM A;  5FZO A;  4CCD A;  2JX9 A;  2K46 A;  2BNM A;  2XUM A;  2QFE A;  5FZE A;  1R08 1;  2QQL A;  1PO2 3;  4PF1 A;  2FDF A;  3NJY A;  4MUV A;  3UYJ A;  1A8M A;  1VBC 2;  4PDW C;  2I74 A;  2VD7 A;  1YI9 A;  2J1R A;  4CU6 A;  2C9A A;  4LHN A;  2CGN A;  4XDP A;  4CP9 A;  2G19 A;  1FNZ A;  2XJP A;  2WBK A;  3LZZ A;  5L7O B;  1UNB A;  1PM4 A;  1ST8 A;  4JTO A;  3S5Q A;  3VD3 A;  4I2O A;  4QXB A;  1ACC A;  2DVD A;  3D3A A;  4CUC A;  3PUQ A;  4GQ7 A;  4QAW A;  2JDH A;  3PTR B;  5FIX A;  4JKL A;  3WT3 A;  2BV4 A;  4WZF A;  1TG7 A;  1R08 3;  1LOG A;  1W9Y A;  3ZDS A;  2BGC A;  4P9G A;  4AGR A;  2W91 A;  1GBG A;  1OKO A;  2V72 A;  3LEI A;  4LE3 A;  1GWK A;  3KD4 A;  3OCP A;  3VZM A;  3GZE A;  5C33 A;  2VBP A;  3LA3 A;  4XBN A;  1EP0 A;  5B2G B;  4Q4V 1;  5FY4 A;  4LK6 A;  3ZFF B;  5AFE A;  5DPN A;  4XAE A;  1SFN A;  5J98 B;  1AJO A;  2P6H A;  4IXL A;  2WAA A;  4LA2 A;  3WP6 A;  4Z82 A;  4B1L A;  4MLO A;  2FCU A;  2H0V A;  4AVB A;  4Z2W A;  2D44 A;  4HVR A;  2BER A;  2XHK A;  4NRM A;  5CEH A;  3AZX A;  3TOJ A;  3K75 B;  2VVE A;  1QHD A;  1VE0 A;  5FYV A;  3WDY A;  4YVS C;  5C9A A;  2E32 A;  2OQ6 A;  4TWT A;  1DQ2 A;  5E16 A;  4KG0 A;  4Q4V 3;  5JWP A;  4CUA A;  4QM9 A;  3APB A;  2MNG A;  4L2N A;  4OUE A;  2OW4 A;  4NII A;  5KXE A;  4LXL A;  1EAH 1;  2YC4 A;  1DQ4 A;  4PF5 A;  4Y24 A;  1W05 A;  4ONU A;  1RUI 2;  4ET7 A;  2IXK A;  1B35 B;  1EUT A;  1UYP A;  1XYN A;  1YIP A;  2ZS6 B;  5JSO A;  5F32 A;  2JG9 C;  4CXY A;  1SDW A;  5A7P A;  3MIC A;  5JR7 B;  3H1M A;  1JU3 A;  1O8S A;  1KRI A;  2VCB A;  2HWC 2;  3BAL A;  3OY8 B;  1EAH 3;  5FK8 A;  4YWA A;  4D7S A;  1LHW A;  3HMY A;  4H2A A;  2XPJ A;  2WII B;  3AKT A;  1IZ3 A;  1F5J A;  1UO9 A;  4QQ2 A;  3ES4 A;  1G9B A;  1GWM A;  5D8A B;  4FCA A;  4AVV A;  5FZ0 A;  1MVE A;  4FPK A;  1Z0H A;  2WT0 A;  3R4U A;  4JVA A;  3KV5 A;  1U5I A;  3MID A;  4LOT A;  2A73 B;  1H2N A;  4BQ4 A;  2DUO A;  4HSL A;  1PX4 A;  4AL9 A;  2JG8 B;  3PL0 A;  3JXS A;  1SQ4 A;  1Y43 B;  3AMM A;  4X8P A;  4XMI A;  3U78 A;  3BVC A;  4AHW A;  1BMV 2;  3B7M A;  2DCZ A;  2RS3 1;  1JZ6 A;  3BU0 A;  1O59 A;  3ACH A;  1UYX A;  1STM A;  2R49 A;  3WNO A;  3ZFG C;  4HON A;  4CEW A;  2IXL A;  3LIG A;  3PVO A;  2X8K A;  3RZH A;  3ZMO A;  2R1D A;  2VMD A;  4PJY A;  2VR4 A;  4CCC A;  3RMY A;  4UXA A;  1W6N A;  2GNB A;  4B4Q A;  3ECQ A;  4AI2 A;  2FDI A;  1S2K A;  3S0M A;  1QWR A;  4LIT A;  4E9K A;  5KHI A;  4CPB A;  2IC1 A;  5BV6 A;  1VLN A;  4GB3 2;  3ZXD A;  3DYM A;  2RS3 3;  2VZQ A;  2WLQ A;  3ILN A;  3MF6 A;  5T5P A;  5HCF A;  1S1A A;  1D4M 1;  4I01 A;  1RUG 2;  1VJ2 A;  4AED A;  3N3H A;  4A6O A;  3RDI A;  2BJS A;  4QU1 A;  1IPK A;  1GP4 A;  2QBX A;  2V5D A;  3KSC A;  4KWL A;  1JYN A;  1N3O A;  1H8T C;  5I0D A;  1HQW A;  1QEX A;  1PGW 1;  4WZC A;  1RXF A;  2ZGN A;  3U07 A;  4QX2 A;  4LBQ D;  3EMR A;  4EZ4 A;  1A6C A;  3RZK A;  4H7L A;  3PIJ A;  3WUC A;  5GLZ A;  5KXC A;  1OHF A;  3A21 A;  5T50 A;  3KT4 A;  4HSJ A;  5JMC A;  5C6C A;  1PZ9 A;  3O0X A;  3OG2 A;  1ULD A;  3WNX A;  3NKT A;  1L7L A;  4Q0Q A;  3III A;  1D4M 3;  4DOU A;  2P17 A;  4XQW A;  1XNK A;  4FP3 A;  1VIW B;  3H3U A;  2AC1 A;  4LBO A;  4QHB A;  1S0B A;  2A7A A;  2Q0A A;  4XMA A;  4RFR B;  4DRR A;  1K45 A;  3U1X A;  4XF3 A;  3ZSJ A;  4HAN A;  3GBF A;  1DQ6 A;  2EAA A;  5EQU A;  4A44 A;  3IT8 A;  4EWA A;  2AAC A;  2P6C A;  4MO3 M;  1PMJ X;  3RZM A;  4CUG A;  5KHG A;  4LKF A;  3S7I A;  3VBH A;  5IAV A;  1UY3 A;  2WFF 2;  2ET7 A;  3Q9O A;  1BVV A;  4W8J A;  1BHG A;  2A5Z A;  4FPE A;  1LHV A;  2UWA A;  3H3Z A;  4IEY A;  3SLI A;  1PVC 3;  4XAC A;  4EYU A;  5DDJ 2;  2HJI A;  3CKH A;  4Y4Y A;  4FO9 A;  3A22 A;  2ZGO A;  5A80 A;  1LED A;  2Y6L A;  1VB4 A;  2LRP A;  3D6E A;  4XIO A;  1WLC A;  5F2S A;  5JIA A;  5CFD A;  1UOG A;  1W8U A;  3BN6 A;  1BK1 A;  1QNY A;  3POG A;  4CDW B;  2JKB A;  2XLA A;  5GJ6 A;  3O1S A;  1RJ8 A;  1W8O A;  2BRT A;  1UMZ A;  1XND A;  3NNF A;  1V6K A;  3U75 A;  3L9J T;  1OF4 A;  3AK0 A;  2WNV B;  3NNG A;  2X53 S;  1K5J A;  4GH4 B;  5F5I A;  1F5F A;  3KCX A;  2IXI A;  3ZFE B;  4WM7 C;  2G9F A;  3AL5 A;  4F3J A;  5ABJ A;  1GNH A;  2WA4 A;  2E26 A;  1LRH A;  5FZ1 A;  4CVU A;  2NLR A;  4IE6 A;  2TEP A;  4L9B A;  4W65 A;  5BNP C;  2ZCW A;  3O0W A;  2RE9 A;  2Y0O A;  1U5Z A;  4YGC A;  3ZMN A;  4AR2 A;  1BBT 2;  3RS6 A;  4L8Q A;  4COW A;  4MVT A;  1CZT A;  1KDM A;  1MEC 2;  1ZRI A;  3OUH A;  1RUF 2;  4XTM A;  5IVF A;  3OBA A;  2ZOE B;  4XE9 A;  2IWG B;  4C0H A;  3UJO A;  5ACA 2;  1JOB A;  2XL9 A;  2LRO A;  2D40 A;  2JB4 A;  5FZK A;  2W92 A;  1YO8 A;  4JRL A;  2WSU A;  5IK5 A;  5F8P A;  1BVP 1;  4HN1 A;  3WEZ A;  3QBQ A;  2ERF A;  3FUQ A;  1QQP 2;  1ENR A;  4ZU5 A;  4CDU B;  4YZ1 A;  3VN4 A;  2P34 A;  4HLT A;  4CDX C;  4E8C A;  2IUW A;  1NA1 B;  4HPK B;  1RYY A;  3NV2 A;  5FPV A;  2GMP A;  4RQP C;  3UGG A;  3DXU A;  1LOA A;  2EAL A;  4QMA A;  1DQ0 A;  2ZBJ A;  4QX0 A;  4RR3 C;  2JE8 A;  1WW7 A;  3AVS A;  1NX9 A;  4RGK A;  4XFG A;  4OHV A;  1Q8O A;  4JHT A;  2R1B A;  2QQO A;  2VNR A;  2RDQ A;  4NRQ A;  4NWW A;  2DBI A;  4OZX A;  5GLT A;  3WHT A;  4WVM A;  2EID A;  4P14 A;  1ZZB A;  1DYK A;  4K21 A;  1NLS A;  2CDO A;  3UK9 A;  4LBN A;  1W9W A;  1FXZ A;  1LOE A;  2CNA A;  4AEM A;  4CEY A;  2F17 A;  2Z4F A;  4OYU A;  1WBF A;  2X5I B;  4LHK A;  3VDA A;  3USU A;  1P8J A;  3MIH A;  4RSU A;  3NQH A;  5F5A A;  3Q8B A;  4P9X A;  3B69 A;  3HNB M;  1MZ5 A;  3HWJ A;  4UI9 L;  4CE8 A;  3E6D A;  3PU8 A;  5DZG A;  4CU9 A;  1XRU A;  5JXJ A;  3RWK X;  3EO6 A;  4IER A;  3MZH A;  1HJG A;  4N43 C;  1DF0 A;  1N1T A;  4H3W A;  4FOW A;  4ORF A;  4Y26 A;  3SC7 X;  4WM8 A;  5GZD A;  3T3Y A;  2BVV A;  1C28 A;  2HWE 2;  3J9S A;  4QU2 A;  5BNN C;  1QKQ A;  3KCC A;  4K8R B;  1GOF A;  1JHJ A;  1H2K A;  1MAC A;  5FZ8 A;  1WCU A;  2ZGS A;  3O12 A;  5EIY B;  4KL1 A;  1HRI 1;  4H14 A;  5IVV A;  4AWD A;  1AJK A;  4GMP 0;  1W3X A;  4JGZ C;  2ZZQ A;  5BYN A;  5JUV A;  5CVR A;  1Y9Q A;  4KWK A;  1W6Q A;  1H9P A;  2A3W A;  3M4F A;  4B4P A;  3LOI A;  5T55 A;  2FBE A;  3GF6 A;  1GOG A;  4UW3 A;  1YYN A;  4HXC A;  5I8Y A;  3J8F 2;  3IM0 A;  3NJZ A;  2QJV A;  1VAV A;  5GLW A;  1SBE A;  2ZHM A;  4OCT A;  4YG3 A;  4PDW B;  4I0A A;  1W9S A;  1HRV 2;  4Y20 B;  3RJR A;  4IEV A;  4JZR A;  3RZZ A;  1C57 A;  1HRI 3;  1EUU A;  1KIT A;  2A1X A;  5CAZ A;  3INA A;  3OYW A;  5FPA A;  3I49 A;  1ND2 B;  2DVA A;  4AI0 A;  1AYM 2;  1QJX 2;  3TNP B;  1O3Q A;  2HWD 2;  1W99 A;  3AMQ A;  2C9K A;  4UFI A;  1NXD 1;  3BOW A;  3VHO A;  4BQ2 A;  3ORJ A;  1PIV 1;  3KQR A;  2OZ6 A;  4FBF A;  4HKL A;  5AVA A;  3U11 A;  1W6O B;  3K48 A;  5FBZ A;  3LA2 A;  1XSQ A;  1QNW A;  5FYZ A;  4JAA A;  4IE0 A;  3ZPY A;  4R52 A;  2Y34 A;  1BXH A;  1S0C A;  2QTW B;  4JGY A;  1KFU L;  4XJZ A;  5HV0 A;  1OI6 A;  1SPP A;  4IES A;  3I3D A;  1MQT C;  1FAT A;  1O4Y A;  5EWS A;  2WYF A;  5FCC A;  5FUN A;  1GLH A;  1AYN 1;  1HLC A;  1ZBE 2;  3ATG A;  4D6Q A;  1E5R A;  4D94 A;  1G9D A;  1YFW A;  2IFR A;  3ENR A;  1PIV 3;  2CTV A;  5LBC A;  3WNK A;  4OHY A;  2FQP A;  2KM2 A;  2QUO A;  3OB8 A;  4DNY A;  1JYI A;  1QDO A;  4QHO A;  1OQE A;  4L97 A;  1JI6 A;  3J4U H;  3O5S A;  3FE5 A;  4MGS A;  2VQA A;  1LOF C;  4YVS B;  3T09 A;  1YIF A;  1QOO A;  4A42 A;  2IVI B;  3NJX A;  1PMI A;  1PO2 2;  4EV0 A;  4FVV A;  1D4V B;  1D0G A;  2VZP A;  2YY1 A;  1GSL A;  1AYN 3;  3CEW A;  4DPN A;  2BDR A;  1ZZ6 A;  3MFA A;  2XWJ B;  5CA6 A;  3GHN A;  1W2N A;  1UIK A;  4DUW A;  4ZS2 A;  3RPQ A;  3KMH A;  2DVB A;  3VZK A;  1W0O A;  5J96 B;  1JXN A;  2GDF A;  2JG9 B;  4MAD A;  3SNM A;  2PHD A;  5FMB A;  4QKF A;  1MPX A;  1VP6 A;  1W04 A;  3D82 A;  1VB2 A;  1ONA A;  1V9U 1;  2HEV F;  4PLM A;  3W58 A;  1R08 2;  3UJQ A;  2W1W A;  3A23 A;  1C5H A;  2IXH A;  2WNU A;  3KVA A;  2BOJ A;  1FPN 2;  5BUV A;  4LO5 B;  5LB6 A;  4FTE A;  1GQG A;  3RZJ A;  1VBD 2;  1B09 A;  1CAV A;  1HIX A;  4IEU A;  5A7O A;  2A75 A;  2ORZ A;  3J26 N;  1CAU A;  3FHA A;  1RXG A;  2JDA A;  3TWI A;  2PYT A;  4I3G A;  2VOK A;  5JR2 A;  3AKP A;  2QDR A;  4ARY A;  1H8V A;  1V9U 3;  2Y6H A;  3QH6 A;  2DFB A;  4N7I A;  5H9R A;  1JZ7 A;  1ASJ 2;  4UF0 B;  4BH9 A;  4XUT A;  4GKY A;  1UX6 A;  3C2U A;  1BEV 2;  5FO8 B;  2YFZ A;  2OUJ A;  4CZS A;  3N9O A;  4Q4Y 2;  3CJI A;  5FUI A;  2BW8 A;  4BDV B;  3KHB A;  4NPL A;  1DHK B;  1SLI A;  5FKB A;  3N9L A;  5K0U C;  1H1M A;  1TME 1;  3BIE A;  2XJQ A;  1SLC A;  2WA3 A;  2DDU A;  4JRA A;  5EV7 A;  3RYP A;  4YYO A;  1UWW A;  3W59 A;  2VOV A;  4MV2 A;  4OQ8 A;  2LW8 A;  4R4Z A;  4FPL A;  3AM2 A;  5LRR A;  1W0N A;  5EJZ B;  1YCI A;  2Y64 A;  1JU4 A;  5IK4 A;  2IFW A;  4TSV A;  4GMP 1;  1MS8 A;  4BPZ A;  5DUW A;  4CCO A;  2A3X A;  3WW2 A;  1EAH 2;  1DZT A;  1XYO A;  3OOX A;  3VBO C;  2YV8 A;  3LIH A;  3VBR A;  4EJR A;  1TME 3;  1WCQ A;  5C5U A;  2WT1 A;  4GWN A;  1Z7S 2;  5LK7 B;  4A4A A;  1I9R A;  4MG2 A;  4E4S A;  1LOD A;  4XDQ A;  1YWK A;  4CTE A;  3ACL A;  5FO9 B;  4KH9 A;  1AR8 2;  1RUE 1;  2RM2 1;  2WS9 1;  2WO2 A;  3JB4 C;  5F2W A;  1IS6 A;  2P37 A;  1LJ7 A;  4GMP 3;  5LBE A;  4XXA A;  1W9T A;  2VC9 A;  4FPC A;  4C8D A;  4CXW A;  1F4H A;  1PK6 A;  1WMX A;  2ZX0 A;  2ET1 A;  3VKN A;  3UKT A;  4Q5O A;  2JDM A;  3AZZ A;  1VBE 2;  3U4X A;  2FDK A;  4D7T A;  4MYE A;  5GZG A;  5JZG A;  4LMF A;  2FMD A;  1PO1 2;  1SHW B;  1WD3 A;  2Y8K A;  2O14 A;  2ILM A;  2ZEX A;  3P5B A;  1RVF 1;  1APN A;  1DFQ A;  1VBA 2;  2PHX A;  4AQT A;  2W87 A;  1WW4 A;  4Y5S A;  1RUE 3;  2RM2 3;  2WS9 3;  2D93 A;  5FDB A;  4OHX A;  4Z2A A;  3C7O A;  2J1S A;  1ZBA 1;  2RR1 2;  4P5Y A;  3BU7 A;  1BZW A;  4KI5 M;  5FXZ A;  2Q30 A;  2JKX A;  2D3R A;  2R0H A;  3OPW A;  3T2Q A;  2ARC A;  2CY6 A;  4JDM A;  5FFO C;  1WGP A;  1HQL A;  5C8C C;  2RS3 2;  4K1Z A;  1UY4 A;  1W6P B;  3O14 A;  4AI8 A;  4OI0 A;  3WQ1 A;  5FPL A;  2AUY A;  3N9P A;  1H6Y A;  1CN1 A;  2IZW A;  3TBD A;  3DEC A;  1XYP A;  3NNJ A;  1RVF 3;  3AMP A;  2B5H A;  5FYI A;  5LEJ A;  1C5I A;  5FLI A;  2JDP A;  5L9R A;  3BKZ A;  1NZI A;  1ZBA 3;  1QOT A;  1NCQ A;  1CIY A;  2YC0 A;  1R1A 1;  3GBW A;  1NOV A;  3E1F 1;  3HBZ A;  4HBN A;  4WM7 B;  2EXJ A;  4XQD A;  2RMU 1;  4XXP A;  3O1R A;  3IDC B;  2C5D A;  4AVC A;  2NM1 A;  2Y26 A;  3VBF C;  2WUH A;  1KS4 A;  5FY0 A;  3VDD A;  3OGJ A;  4FAG A;  2VW2 A;  2UUR A;  4YW1 A;  1W90 A;  1D4M 2;  3POF A;  1K5M A;  4L0P A;  1W8Z A;  4LOR A;  4M0H A;  2Q8E A;  4OHZ A;  4A7Y A;  5GM0 A;  5FJK A;  5LZ6 A;  3OGS A;  3I59 A;  2VOW A;  3ZO0 B;  4OQ9 A;  1W2A X;  1M06 G;  2R06 1;  1QOS A;  4BQ3 A;  1CD3 G;  1WW6 A;  1YUD A;  3ZSM A;  1IS5 A;  4XAB A;  1OA2 A;  1W8T A;  1K3I A;  1PZ8 A;  2X05 A;  2C4X A;  1W6M A;  4QXC A;  2QZ2 A;  1GOH A;  3NV4 A;  1R1A 3;  1V0A A;  4YRD A;  3SQO A;  4Q4X 1;  5FZ4 A;  2RMU 3;  2PA7 A;  3MEP A;  4ASL A;  1HX6 A;  2VCA A;  4XF9 A;  1LES A;  3WF2 A;  1KQR A;  4PLN A;  2FCT A;  4D6R A;  2JD9 A;  4YFW A;  4XF4 A;  5JMO A;  4AVA A;  1W03 A;  3H7Y A;  4YZ3 A;  4RQP B;  4BWO A;  4KU8 A;  4AZZ A;  4FPO B;  2R06 3;  5D1I A;  1VRH 1;  4UFM A;  5A3M A;  4RR3 B;  1W06 A;  3WOG A;  1XNC A;  3NKG A;  5FBJ A;  1SMV A;  5FY7 A;  2D43 A;  2TUN A;  2W52 A;  1F31 A;  5FK7 A;  1O3S A;  3KCY A;  3MIE A;  4Q4X 3;  2ZX3 A;  1EPZ A;  2OKX A;  4NMI A;  2C24 A;  1G7Y A;  1JTZ X;  1WMD A;  4XC9 A;  1HW5 A;  4W4Z A;  4BZ4 A;  5A3P A;  3WVJ A;  2AR6 A;  1DYO A;  4MH0 E;  3U4S A;  3ZX7 A;  5KHH A;  1O5U A;  1WA6 X;  3W9A A;  2GNM A;  2VO5 A;  5FRA A;  5IYY A;  5K9Y A;  3AXE A;  1Q5O A;  4JKM A;  5J1X A;  1VRH 3;  1W2O A;  3LD8 A;  2VZ1 A;  3RJ2 X;  4K3U A;  1POQ A;  3ZYH A;  4DB5 A;  4ES9 A;  4P9L A;  3IPV A;  2VMC A;  4C1W A;  3ALQ A;  3TEZ A;  1H4H A;  3KT1 A;  2JEM A;  4Y1Y A;  3OEB A;  3PIG A;  2BGP A;  2RDS A;  1O3T A;  1NA1 C;  3LPG A;  3MI8 A;  4MGZ E;  4Q26 A;  3VDB A;  4RS5 B;  4N43 B;  2PHU A;  3K2O A;  4GWM A;  1C3H A;  1DQ1 A;  1QXP A;  1JMU B;  1JS9 A;  2I2S A;  5CIR A;  4BB3 A;  4EQV A;  4KGG A;  1PX3 A;  1LTE A;  4DEQ A;  5BNN B;  4QKD A;  1N1S A;  2IXJ A;  2ZGU A;  3AJY A;  4XW3 A;  5GLV A;  5L7O A;  2JIJ A;  1OFS A;  2ZAB A;  3AP4 A;  2P3K A;  4YVW C;  4Q0P A;  1LB2 A;  3U10 A;  3RZL A;  4COV A;  1RIR A;  3MHZ A;  1N1Y A;  2OQ7 A;  5C4W B;  3AP6 A;  2R04 1;  4P9W A;  1SAC A;  1COV 1;  3LE0 A;  1J84 A;  4XIL A;  3HT2 A;  2D6K A;  1N47 A;  1MZ6 A;  2MEV 2;  3IMN A;  4MX3 A;  4XET A;  3VBS B;  1VPH A;  4IW3 A;  1HDK A;  4S2D A;  2FD8 A;  3ZFF A;  1AUY A;  3POW A;  1RUC 2;  5FYB A;  1OOP A;  4E2Q A;  2VQT A;  3CNA A;  5FY9 A;  1US3 A;  4OUL A;  4IEP A;  3I2J A;  3ZKY A;  4AI3 A;  5A3L A;  4L11 A;  3S57 A;  1VMF A;  1YFY A;  3KS7 A;  3LOB A;  3WNM A;  4E2G A;  3AVR A;  3LWC A;  2HEY F;  4ZZ5 A;  3M3O A;  3RMX A;  1AVB A;  1CES A;  1URX A;  3M3I A;  5FMC A;  1UCX A;  5EPA A;  2VNG A;  3MBW A;  4RA0 A;  4HVO A;  2B39 A;  4O65 A;  4W6X A;  2ETE A;  1AXZ A;  4G4F A;  3SHR A;  1W0P A;  3F95 A;  2DF7 A;  4FPG A;  5DZF A;  2XB6 C;  3DKW A;  3R05 A;  4KQ7 A;  3LEG A;  1UZZ A;  2DTY A;  4NAM A;  2VPV A;  2QKD A;  2GU9 A;  3RYK A;  3C7F A;  1MQT B;  1XSR A;  5DG1 A;  2CSG A;  5FY1 A;  1B35 A;  2G9Z A;  3FFZ A;  4HOO A;  4OLL A;  3ILF A;  3V0B B;  1QXR A;  2PMW B;  1MS5 A;  1ZYB A;  1IS3 A;  1W28 A;  4NIA A;  1HB2 A;  2Q4S A;  2ZGL A;  3O1V A;  2OPW A;  1RUH 1;  4LBM A;  4OI4 A;  4Q4W 1;  4YZ2 A;  5L9V A;  2P1B A;  1LAJ A;  2VJX A;  2WNE A;  4D6S A;  1BQP A;  1LUL A;  1XE0 A;  3LEM A;  3K46 A;  2Q8D A;  4CCK A;  4DXT A;  4YM3 A;  3OY8 A;  2NPI A;  4DO0 A;  3DPR A;  4HG6 B;  2OII A;  4LTA A;  4E27 A;  1ND2 C;  1AR7 1;  2Y60 A;  2HLE A;  2LM3 A;  2WL1 A;  3I3Q A;  4MGK E;  3VL9 A;  4TTG A;  2WQZ C;  1BLZ A;  2WWS A;  3AJZ A;  4LLO A;  4Q8L A;  2D5F A;  2W1Q A;  3DN7 A;  5D8A A;  3AFK A;  1SZB A;  3ZDV A;  4D0Q A;  2HWB 1;  3LDK A;  1HRI 2;  1I5Z A;  3A0K A;  5FAX A;  3MV1 1;  5BNO B;  5CFC C;  1JZ3 A;  1XU1 A;  1YJL A;  1RUH 3;  4Q4W 3;  5EJ1 B;  5I8S A;  4JQT A;  5FZL A;  1UU5 A;  4BE3 A;  1GFF 2;  1U5X A;  2C0Z A;  3H42 B;  3NVC A;  5T5L A;  4ZHN A;  4XCA A;  5FP8 A;  2JG8 A;  4I3P A;  5B4N A;  4XAA A;  1I5P A;  1U12 A;  4IET A;  5ISL A;  1AR7 3;  1SEF A;  2Y6J A;  4A45 A;  4KWJ A;  2VAU A;  3C7G A;  1S2E A;  1RUJ 2;  4IL7 A;  1CAX A;  1HXS 2;  1X7N A;  3HQX A;  5GZF A;  3ZYR A;  2A70 A;  2XBO 2;  2HWB 3;  4GWJ A;  3NWK A;  2OXB A;  2WQ8 A;  4Y22 A;  3D0S A;  3O0V A;  3PUR A;  5FZD A;  1ZRF A;  1SCS A;  1UX7 A;  1RGS A;  1GAN A;  5BY5 A;  4KU7 A;  4Q2F A;  4ZXK A;  4O9E A;  2O0O A;  1OXC A;  5IWF A;  1GR3 A;  4JDN A;  2DV9 A;  3GJB A;  1JYT A;  4E2S A;  3WDW A;  2QQN A;  4MGT A;  4YAR A;  4R9A A;  2GME A;  2V09 A;  2RS1 2;  3DEM A;  5FUP A;  5HV4 A;  4UW6 A;  1XNT A;  2WZR 1;  2WAO A;  3ACF A;  3ABZ A;  4YM1 A;  3BTZ A;  1CAW A;  5JOZ A;  1EPW A;  3OJB A;  4UFH A;  1SLL A;  1ND3 B;  1C8M 1;  5FV3 A;  3M2M A;  2QQI A;  2RG4 A;  3M3C A;  1AYN 2;  2AGS A;  3KM5 A;  4PQQ A;  5K0U B;  1JZ5 A;  3R6S A;  2XGX A;  3WP4 A;  3E6C C;  3BGA A;  4IV3 A;  3D0J A;  5A32 B;  2UWC A;  4QHZ A;  2EIB A;  2B8M A;  4IND A;  4QQO A;  2R30 A;  1IQD C;  1QXJ A;  4QB6 A;  2WZR 3;  2CV6 A;  1UQX A;  4FXK B;  3HVD A;  3U0Z A;  3WNP A;  4QPG C;  2E7Q A;  3EB7 A;  2OA2 A;  4DEV A;  1C8M 3;  4Q29 A;  4EZH A;  3E5Q A;  4FTB A;  1VBB 2;  1RUD 2;  3VBO B;  1Q8P A;  3I54 A;  3ZXK A;  3GDB A;  5IVC A;  4X8N A;  1JZ4 A;  3IIA A;  1FT9 A;  1ULO A;  1AL2 3;  3SKJ E;  1E5I A;  2XKP A;  1FV2 A;  1CVN A;  1OUX A;  2ARX A;  1L3J A;  4KMQ A;  4LEJ A;  4M00 A;  4XFI A;  1D2S A;  4PI2 A;  1DLL A;  4BQ5 A;  3B9C A;  3WNN A;  3TNQ A;  4XFB A;  1J1L A;  1YLL A;  1US2 A;  3AYC A;  3D8C A;  3VL8 A;  5IVE A;  4P00 B;  1ODM A;  1W8H A;  2YBS A;  1RHI 1;  4V2V A;  3MIG A;  2FDH A;  4CDW A;  4AQ2 A;  4H7M A;  3ACI A;  1GUI A;  3SIT A;  2BZD A;  1RMU 1;  2ZAC A;  2ZGQ A;  2E51 A;  2FZ2 A;  1EYB A;  2VZR A;  2ZEZ A;  2WNV A;  4GH4 A;  4XFH A;  3WLU A;  1JZ8 A;  2YFU A;  4W6Y A;  3IB3 A;  3KF5 A;  4HL0 A;  3ZFE A;  2BNN A;  2OVU A;  2OX0 A;  3K4D A;  2Z79 A;  3DYP A;  4LR4 A;  1UMI A;  1RHI 3;  3OGG A;  1OLQ A;  5JXH A;  2HBT A;  1LGN A;  1S0I A;  5A1A A;  1REF A;  5JOY A;  4LA3 A;  1WD4 A;  2BUK A;  5C8C B;  3IBM A;  2VVD A;  1RMU 3;  1TVG A;  5A1F A;  2RDN A;  5FZC A;  1NXM A;  2MHF A;  2NMN A;  2E7T A;  4UW5 A;  5D2A A;  1HV1 A;  1CQ9 A;  3I3B A;  4JV4 A;  4YW6 A;  3ZPO A;  3T4V A;  4CDU A;  3O7O A;  4KBB A;  3W5N A;  2PLV 1;  3ZYJ B;  1YQ2 A;  4NO4 A;  1CJP A;  4YW7 A;  4DIN B;  5LRS A;  4HPK A;  2L9L A;  1VMJ A;  1PVC 1;  2YUE A;  4UT5 A;  5CB7 A;  3J7H A;  3ZSE A;  4ERO A;  3HOB A;  1DP0 A;  2ZZJ A;  3M1H A;  5A1L A;  5CIS A;  1UZ0 A;  2A6Y A;  4I0W B;  4LHL A;  2ZTN A;  3VBF B;  5JDB A;  2Y6G A;  1NCR C;  3M7A A;  3Q8A A;  2J1V A;  3AP9 A;  3UGF A;  1SLB A;  3D5O A;  2WN2 A;  5IVB A;  3V65 A;  4B3N A;  4IV1 A;  1OVP A;  1YC6 1;  2V5Y A;  2PLV 3;  3JBG 2;  3LQC A;  1CZV A;  1EY2 A;  4BMB A;  1YQ5 A;  1IS4 A;  3D4K A;  1WLD A;  4FT8 A;  4CU8 A;  1FOD 1;  1O4T A;  1RUE 2;  1CIW A;  2VMI A;  4IE5 A;  2GND A;  3AP5 A;  3AX4 A;  1V6N A;  3P3N A;  3VHN A;  4HT1 T;  4RHV 1;  3AZW A;  4Z1V A;  4FFF A;  4HKO A;  3ITQ A;  4QDS A;  1W8F A;  4Q1R A;  4RN5 A;  2XHN A;  2BPA 2;  1VMH A;  4HMZ A;  2D98 A;  5LA0 A;  1DQ5 A;  1JUH A;  4XYX A;  4YGE A;  1GP5 A;  5IAT A;  3A7Q A;  3KT7 A;  2EIC A;  5I0T A;  1E5S A;  4IEZ A;  2PQQ A;  5LWB A;  2PAM A;  4QDR A;  1RVF 2;  5DAV A;  2Y6K A;  1UXX X;  2R07 2;  2B7Y A;  3E97 A;  1FOD 3;  3B00 A;  5LAT A;  4CEW B;  1H6X A;  1U5Y A;  2UY9 A;  4NRP A;  4RHV 3;  5GLU A;  3AMN A;  1NZC A;  4LUL A;  1RJ7 A;  5G05 L;  1XJA A;  1W6N B;  5HCH A;  1KGY A;  2O1Q A;  2RJL A;  1R09 1;  3OGR A;  2XOM A;  4U36 A;  5F6K A;  5JXG A;  5A3W A;  1XNA A;  2PHT A;  3H8X A;  2HWF 1;  1DBN A;  3ILR A;  3QH7 A;  2UU8 A;  2VZV A;  5I91 A;  5KXD A;  4O9G A;  2EXH A;  1WME A;  4KBZ A;  3FWE A;  2JIG A;  3IN9 A;  2XQX A;  3F2Z A;  2LAL A;  2HEW F;  4QB2 A;  1UAI A;  5E6H A;  3TB0 A;  3G6J B;  2C1F A;  4NWV A;  4GZ9 A;  2RMU 2;  4E4Z A;  4Y20 A;  4YFZ A;  3WUD A;  3MUY 1;  1GU3 A;  3LAG A;  3H8O A;  2PAE A;  3JD7 1;  1R09 3;  2ADD A;  4HFS A;  4OI2 A;  3ZSK A;  3Q8E A;  4COY A;  5J3U A;  2JDY A;  2HWF 3;  3DUI A;  5LA2 A;  2VW1 A;  1UU4 A;  4YVW B;  4A41 A;  5K4L A;  2R06 2;  3T30 A;  3SEE A;  2WZP P;  3T1L A;  3AP7 A;  1UPI A;  3AKQ A;  4PT6 A;  1W6O A;  3P1I A;  2Y38 A;  3USS A;  3H8U A;  4LHS A;  1EV1 1;  4XEZ A;  5EJ3 A;  3LPF A;  4MXV A;  1RTV A;  2AEY A;  3HN3 A;  3N36 A;  4YNI A;  5F9T A;  2J22 A;  2CHH A;  2ZX2 A;  2VZT A;  4C90 A;  4AFB A;  3SH4 A;  3WZ1 A;  3JD7 3;  4GWI A;  4Y33 A;  2D6M A;  1YFX A;  3ZOI A;  4LJH A;  4FPJ A;  5IT6 A;  3JQW A;  1POV 0;  4EWE A;  1TE1 B;  1Q8S A;  2VE1 A;  3KHC A;  3JCI A;  3C7H A;  3VBH B;  1SG3 A;  2BP6 A;  2VMH A;  2WJS A;  1KD7 A;  1NYW A;  4RS5 C;  3IZO A;  5CKM A;  4ATF A;  3WSO A;  2D97 A;  2Y0I A;  4UW4 A;  2EIG A;  1H1I A;  1EV1 3;  3RI8 A;  3B01 A;  5FZ7 A;  2DCT A;  3OPT A;  4QT6 A;  4YVS A;  1QJZ A;  2SLI A;  1JYW A;  3I3E A;  1UF2 C;  2GSY A;  3CF6 E;  1AR6 2;  4DY3 A;  2ZXQ A;  5ANQ A;  1FI2 A;  2ZHL A;  4NIH A;  1RIN A;  4GXL A;  4D3W A;  1JOP A;  1SFY A;  2MPF A;  3POE A;  2I45 A;  4CDQ C;  1O6U A;  4LUM A;  5A6Z A;  5C4W C;  2J7M A;  2PXJ A;  4BLI A;  3NO8 A;  1OD3 A;  1AR9 2;  3DGT A;  5FYC A;  1VBC 1;  2JG9 A;  2ZPX A;  4IEQ A;  3VBS C;  1YRZ A;  3TN9 1;  3V64 A;  1XB9 A;  1UYY A;  1O5L A;  1ZZ7 A;  4FFI A;  1PNG A;  3N9Q A;  1DGR A;  1QJU 1;  3PHM A;  3H1W A;  4CP2 A;  5FXX A;  3MIF A;  1X33 A;  4B7E A;  3WDV A;  1OPO A;  5KWR A;  2ORX A;  4XPV A;  2JDZ A;  3CO2 A;  2NMO A;  4CU7 A;  3FBY A;  5DAX A;  4Y1V A;  1E57 A;  1W2U A;  5FOJ B;  1VBC 3;  4DXS A;  4M4R A;  1ZRR A;  3LF7 A;  5CFC B;  4OMC A;  5HPO A;  1K12 A;  3TN9 3;  4N53 C;  3ETQ A;  4Q0V A;  2R04 2;  3HJR A;  3DL3 A;  4NAO A;  1COV 2;  4ZS3 A;  4UF0 A;  3VZN A;  1OLR A;  1MR5 A;  1QJU 3;  5JSP A;  4HZF A;  1UZW A;  3J7L A;  4QPI C;  3T0A A;  5A6Y A;  1DDL A;  4GAL A;  1RUO A;  5FQ0 B;  3VBU C;  5C3P A;  4TLG A;  5LEK A;  4DRV A;  1IKQ A;  2XDV A;  4WVZ A;  2ZMK A;  3ZFG A;  3MLK A;  1CZS A;  4AW7 A;  4JDO A;  3I3M A;  3ME2 A;  3ZYP A;  5C3O A;  4N9I A;  2XL7 A;  3P6B A;  4Y1U A;  3FHQ A;  2VBB A;  1BK0 A;  4OZO A;  3LSE A;  2YGL A;  3QOP A;  4XDO A;  3KF3 A;  4YW3 A;  1S55 A;  5LBB A;  4P5H A;  3SCH A;  3ZYF A;  1YFU A;  5JSR A;  3QCW A;  3SCG A;  4NIG A;  1CGP A;  1G9C A;  3NAP C;  4NR1 A;  1RUI 1;  3FBM A;  4LBK A;  3NV1 A;  3OBR A;  1W9F A;  5F5C A;  3VB9 A;  4CP0 A;  3ZXJ A;  2DBN A;  2B42 B;  4S2G A;  4BQ1 A;  2NP0 A;  5BNO C;  5LAS A;  5J37 A;  5F6L B;  4XCB A;  2VH9 A;  5FZ3 A;  1H8T A;  2WYS A;  3BTY A;  5C3Q A;  5M0T A;  2HWC 1;  3WCR A;  2W08 A;  4IGP A;  4WM8 B;  1PHM A;  2P2K A;  3DYO A;  1AL0 G;  4TXW A;  1RIT A;  2GAL A;  2G1M A;  2YBP A;  4UFL A;  4AFD A;  4ARX A;  3ZYB A;  4JCK A;  4DZG A;  4MHU A;  5ANN A;  2BOI A;  1RUI 3;  2P3Y A;  3GBG A;  4ZY9 A;  1YQ6 A;  4B1M A;  4NRO A;  1AXY A;  2JD4 A;  4XFF A;  1JYV A;  1IG0 A;  1ULP A;  4MET A;  4WVW A;  4XBQ A;  5JAX A;  4Q8K A;  3N7M A;  5T5O A;  1UPS A;  4QPG B;  2GMM A;  4LBJ A;  4PHZ A;  3ZN4 A;  2R0F A;  3OSD A;  5A7W A;  2OPK A;  3KQ4 B;  4J25 A;  2ID4 A;  3NMB A;  3DKQ A;  3VD4 A;  3BB6 A;  2E33 A;  2HWC 3;  3S6P A;  1DGW A;  1GZC A;  2FCV A;  5KR7 A;  3GCX A;  5IHR A;  2V4V A;  1Q56 A;  2VTX A;  3HT1 A;  2W9X A;  1BMV 1;  1NE6 A;  2QNK A;  2W0X A;  1UKG A;  3EQE A;  1OBN A;  1GV9 A;  1X8M A;  3A4U A;  4IUG A;  4NHK A;  1I6X A;  3T4H B;  5IFT A;  4KGQ A;  4CRQ A;  2WRA A;  1CWP A;  1H4G A;  4Z07 A;  4Q4V 2;  1POV 1;  1OT5 A;  1ND3 C;  4G9S B;  1NY7 1;  2H6C A;  1HQN A;  4M3C E;  2YMZ A;  5FZF A;  1GIC A;  2ZAA A;  3RRD A;  5F3C A;  3WF1 A;  3LSD A;  1BKZ A;  4OUS A;  3HN1 A;  2K2S A;  1LEN A;  2QQJ A;  4GB3 1;  3H0O A;  4OFG A;  3WP3 A;  2VM9 A;  2JE9 A;  1CPM A;  3N9N A;  3LFI A;  1RUG 1;  3C7E A;  4B7K A;  1SFP A;  2W3J A;  4LLF A;  1S2B A;  4WM7 A;  5KBF A;  3WQB A;  1POV 3;  1JW6 A;  1LHN A;  3MLL A;  1A8D A;  4UWD A;  2DFC A;  3EHK A;  4NE9 A;  3OEA A;  2A71 A;  1JBC A;  1AX2 A;  1PM7 A;  1VAK A;  4NHM A;  4AFM A;  1A78 A;  2XJU A;  5BNP A;  1JOD A;  5FLH A;  2NYY A;  5JOW A;  5E8A A;  3WHU A;  4GB3 3;  3HNY M;  3BYW A;  3N4M A;  5FPX A;  4XIK A;  1QJF A;  2D6P A;  3K3N A;  1R1Z A;  1UY1 A;  1RUG 3;  2AEN A;  2GC2 A;  2ZX1 A;  3NV3 A;  3LEK A;  3WF3 A;  1OLM A;  3AZV A;  1X9P A;  2XJT A;  3H3L A;  4HKW A;  2VTF A;  5F5Q A;  1ODN A;  4AFA A;  2XG3 A;  5JI9 A;  1KJR A;  4I30 A;  4CDX A;  3ACG A;  3M8L A;  3MO4 A;  3I2I A;  1L7R A;  3WW3 A;  2VNV A;  4Y1X A;  4RQP A;  5IVY A;  5T52 A;  3WF0 A;  5A6Q A;  4F83 A;  2UWB A;  4X6Q B;  4EN8 B;  2WFF 1;  1TEI A;  4RR3 A;  1NCR B;  3NNL A;  3MIB A;  3MW3 A;  1OKQ A;  4IEX A;  1F2N A;  4MXW B;  1XNB A;  4TYS A;  1J3R A;  2XON A;  1O3R A;  1M4W A;  3KLS A;  3O1O A;  5DDJ 1;  3RSJ A;  3CU7 A;  3FUO A;  3M70 A;  2QQP A;  2VUD A;  5BXX A;  3LDR A;  5IAX A;  1TZO A;  3PUH A;  4R9C A;  3WG3 A;  2D3S A;  2B46 X;  3I4I A;  4AHZ A;  4IEW A;  4URA A;  2B9V A;  4XBL A;  2BU9 A;  3THP A;  2JEC A;  5FTT C;  4M01 A;  2WFF 3;  5DG2 A;  3VZO A;  2V73 A;  1GQP A;  1QIQ A;  2J1U A;  2RV9 A;  1RHI 2;  4LO6 B;  3UET A;  3AYD A;  4P02 B;  2XQR A;  4N90 A;  1Q8Q A;  2IVJ A;  2Y33 A;  5FP4 A;  5T5J A;  4HVQ A;  5C9A C;  2V4A A;  5FYY A;  2QQW A;  1V6O A;  4PIX A;  5DDJ 3;  4PBO A;  1LOC A;  4PIZ A;  3MDP A;  4N43 A;  2YXS A;  4FAH A;  4TLF A;  4AK3 A;  4ZU4 A;  2AEZ A;  3AB0 A;  2WIN B;  4NPR A;  1YJK A;  3POI A;  4BQW A;  1RUF 1;  1AX1 A;  3CJI B;  3EYP A;  4DY5 A;  2CWS A;  3VHR A;  1O91 A;  5ACA 1;  5BNN A;  1KDK A;  3R4S A;  5A6X A;  2ES3 A;  3VHP A;  1G6N A;  2X10 A;  4GUL A;  5KHK A;  2DVF A;  3AL6 A;  3WD5 A;  3DCQ A;  2PEL A;  1PGW 2;  1DGR N;  4IV3 C;  4XZP A;  4D8M A;  1AXK A;  1QQP 1;  5C8W A;  4HN0 A;  2XXZ A;  4JGZ A;  4YW4 A;  5B4X A;  2WAB A;  3LCP A;  2Q1M A;  4XJ8 A;  3WG1 A;  2NQY A;  4I0B A;  2WWU A;  3JZV A;  3M3Q A;  1REE A;  3NST A;  4AVT A;  4YPJ A;  1QMJ A;  3T0B A;  1MEC 3;  4LIV A;  1RUF 3;  1VRB A;  3TAY A;  3PVN A;  3VUO A;  5ACA 3;  5T3N A;  3ZXG A;  4BU2 A;  1PVC 2;  3VBR B;  3ZN6 B;  1QF3 A;  4NVP A;  1ZZ9 A;  1XXN A;  5IK7 A;  1KFX L;  2DCY A;  4NJ4 A;  2LTN A;  2PTM A;  1QQP 3;  3RGB A;  3CZU A;  3R0R A;  4JKK A;  2WWJ A;  1UOJ A;  5ERL A;  2RS5 1;  1PGS A;  4XFA A;  4XJA A;  1O4Z A;  3THD A;  1T6G C;  3MYX A;  4BME A;  1SBF A;  4MZU A;  4B29 A;  3IAQ A;  2K0G A;  4CEW C;  2VUA A;  1WA4 A;  2WQ4 A;  2Z42 A;  4CCJ A;  4XUP A;  5EXO A;  5AFB A;  3OUJ A;  2YB7 A;  2Z2S B;  1PK6 B;  1OMI A;  1Y9G A;  2TNF A;  3HNM A;  4YW5 A;  4V2W A;  5F3E A;  5FY5 A;  4MHR A;  1ZX5 A;  3ZR6 A;  5FZ9 A;  1FX5 A;  1W3V A;  4YZ5 A;  2YZ4 A;  1MQT A;  5JZG B;  4AVS A;  5FKC A;  4W6W A;  2RS5 3;  1IG3 A;  3FLT A;  1W8N A;  2OT7 A;  5KC6 A;  1CPN A;  1YHF A;  2QCS B;  3NW4 A;  4AED C;  1PGL 1;  2HWE 1;  4BYY A;  1DGW X;  1N3P A;  3VDC A;  1I3H A;  1BYH A;  5JVV A;  1KEX A;  2VU9 A;  2D5H A;  3IDE A;  2J1A A;  4FFH A;  3WV6 A;  2OS2 A;  1LOF A;  3PU3 A;  1WCS A;  5APA A;  1CON A;  4FQZ A;  4CDQ B;  2W1S A;  1UU6 A;  1GNZ A;  3GGL A;  2HWE 3;  2X29 A;  3J8F 1;  3CMG A;  4LBQ B;  2VTX J;  4NHL A;  1DCS A;  2EXI A;  3MPP G;  1XE7 A;  3PME A;  4JX0 A;  3ROU A;  2ZGR A;  1HRV 1;  2VOX A;  3POY A;  5C3R A;  5F7U A;  2VMG A;  1OH3 A;  3EBR A;  3NJV A;  5EZW A;  1H2L A;  1LR5 A;  2HWD 1;  3WNL A;  4QXH A;  3VBH C;  4AF9 A;  4CCN A;  2EIE A;  3LFM A;  3ZIW A;  1IKP A;  1DZQ A;  3HIF A;  1ENX A;  2UYB A;  3J8F 3;  3HQU A;  2HYK A;  4YGB A;  5A33 B;  1OSG A;  4M3C F;  3WW4 A;  2DUQ A;  2CU5 A;  3VKF C;  3FZ3 A;  5IFP A;  3POS A;  1HRV 3;  2XLG A;  4K6B A;  4XUQ A;  4YG0 A;  5CFD C;  4N53 B;  1HV0 A;  2FZ1 A;  4O7X A;  2VVF A;  1AYM 3;  3KWV A;  4KNC A;  5JI7 A;  3T1M A;  1S0J A;  3J7N A;  2Q1F A;  2ZHK A;  2B9U A;  2HWD 3;  3OBZ A;  2D3P A;  2ZML A;  4QPI B;  1XBF A;  4QQL A;  2FMY A;  4AXO A;  3VBU B;  5BPX A;  5DAW A;  1XPW A;  1XQN A;  1Z78 A;  2R32 A;  3THT A;  5ABJ C;  5H9Q A;  3BOD A;  4WV8 A;  1D2Q A;  2VUJ A;  3PMS A;  1V6I A;  5K0U A;  5K8S A;  4QX3 A;  3SMH A;  2B45 X;  1UN1 A;  2VZ3 A;  5A32 A;  1A3K A;  3N35 A;  1S0D A;  4RGA A;  4IDZ A;  3FHI B;  5BNQ A;  5A7N A;  4GAZ A;  3NAP B;  4FP2 A;  1W39 A;  4XUO A;  1DZR A;  1X36 A;  5DAP A;  3O1P A;  5GAL A;  5J36 A;  3I2F A;  4XJW A;  2YRO A;  3IPV B;  4PLO A;  4M3C B;  4XUR A;  2CGO A;  1QDC A;  4UBG A;  3VBO A;  5C71 A;  5FPZ A;  4Z92 B;  1LNS A;  5HI0 A;  4GKX A;  2XJV A;  4XJ9 A;  2WO7 A;  3KV9 A;  2JIC A;  4FSJ A;  3PUA A;  1FPN 1;  5GZC A;  4Y5Z 0;  4K8F A;  4AQ6 A;  3TN9 2;  4PQ9 A;  4AQS A;  4P9J A;  5FPU A;  1QGL A;  4I09 A;  1C1L A;  2P4E A;  1VBD 1;  2BBV A;  3K3O A;  1QJU 2;  4FPY A;  1NAE A;  1LHO A;  5E1R A;  5L36 A;  5LBF A;  1KJL A;  1WMF A;  4Q27 A;  3VZJ A;  1GZW B;  2XKO A;  5L19 A;  2O8O A;  2B4K A;  1OFN A;  4PIY A;  3V0A B;  1ASJ 1;  1PIV 2;  2LS6 A;  3DV8 A;  4CEY C;  1FPN 3;  2YG0 A;  2VXR A;  3RZG A;  1BEV 1;  1RL3 A;  5FWE A;  2UYA A;  4Q4Y 1;  3A0N A;  4QPW A;  3PUS A;  1VBD 3;  5IK8 A;  2JDN A;  1OOP B;  4QM8 A;  1OF3 A;  3UES A;  3KZ4 C;  4CA9 A;  3FC0 A;  3GJA A;  3GZA A;  2GP3 A;  3GAL A;  3OTF A;  2RVA A;  5C8C A;  4WM8 C;  1OA4 A;  1TMF 1;  2VZO A;  3LKJ A;  5G04 L;  1ASJ 3;  1S0E A;  1AL2 1;  3HEI A;  4QGL A;  2VME A;  4FPF A;  4CP1 A;  2CWM A;  1MS9 A;  3AKR A;  5J7M A;  1BEV 3;  3ZN5 A;  1IPS A;  2CL2 A;  4Q4Y 3;  2FDJ A;  4LO7 A;  3WQ0 A;  2H6B A;  1G8W A;  5FOB B;  2VY0 A;  2E31 A;  3AYE A;  2GZW A;  2X09 A;  2OZJ A;  5F37 A;  3GHM A;  4R8H A;  1ZZ8 A;  4QQH A;  4QGN A;  1F15 A;  1HKD A;  3VBF A;  5I8T A;  1GWL A;  4WBB A;  4LOS A;  3MPB A;  3GNE A;  1Z7S 1;  4NHX A;  3H9A A;  5A3O A;  3V56 A;  1TMF 3;  4YW2 A;  2BQP A;  5FZO B;  5C70 A;  2G4I A;  3URF A;  3R4D B;  2ZA9 A;  3FL7 A;  5FP3 A;  1AR8 1;  1SBD A;  3PNA A;  1ALY A;  1UY0 A;  4FXG B;  1XE8 A;  1UOF A;  5KXB A;  3DPR B;  4C0B A;  1U0A A;  3GYD A;  1OQ1 A;  1NQJ A;  1V9U 2;  3SCF A;  4QWN A;  4CP9 B;  1UY2 A;  4K20 A;  4E4H A;  3BOP A;  3AKS A;  4BOW A;  1VBE 1;  2BVB A;  2BFU L;  1Z7S 3;  5L73 A;  3UT0 A;  3UV9 A;  1JYX A;  4A7K A;  2BTV C;  1PO1 1;  3RNS A;  3WG4 A;  2BYV E;  4C1X A;  1V6J A;  5DMY A;  2VUL A;  1VBA 1;  3MGU A;  2R6Q A;  1AR8 3;  2ATF A;  4H55 A;  2BEO A;  4XHB A;  5D21 A;  1UIJ A;  2D6N A;  3ZR5 A;  4N8M A;  1K42 A;  3WY6 A;  2RR1 1;  5J48 A;  2JDK A;  5CNA A;  1IHM A;  2A6X A;  4JGY C;  3JU9 A;  4DS0 A;  3N7K A;  4R9D A;  3S7E A;  2KD7 A;  1I1E A;  2C6S A;  3AMH A;  4AFC A;  2IXC A;  3UNP A;  1VBE 3;  3FLR A;  5JPN B;  1LOB A;  1CAX B;  3H50 A;  2DU0 A;  1YI7 A;  2GC0 A;  2QZ3 A;  1PO1 3;  4RD7 A;  4C91 A;  2WDB A;  5HBA A;  3ST7 A;  4Y22 B;  1D0H A;  1CJD A;  1NY7 2;  1VBA 3;  2XUE A;  2FHR A;  3T2T A;  3OD0 A;  2ZGP A;  1UOB A;  2YYO A;  4LNV A;  2ZMN A;  1LGB A;  2RR1 3;  2DCK A;  1TME 2;  2WT2 A;  3IMM A;  3TYJ A;  4ISR A;  5C9A B;  2EAK A;  2DCJ A;  3B94 A;  1KS5 A;  3AC0 A;  3I2G A;  3L2H A;  3ZYI B;  2Q8O A;  4HK8 A;  5LW9 A;  1CX1 A;  1F35 A;  4LT5 A;  1NA1 A;  4UOJ A;  3VGI A;  1ZRC A;  3OBT A;  5FZB A;  5CBL A;  3WXP A;  4CSW A;  5FO7 B;  4NHY A;  1CAW B;  5FZM A;  3BTX A;  5FZA A;  4R9B A;  2QQU A;  4AHX A;  4ZU7 A;  1QJY 1;  4SLI A;  3SXW A;  3AZY A;  5JLV A;  4CXX A;  3CBN A;  4Y1Z A;  2GH2 A;  2GP5 A;  2W94 A;  5CG9 A;  2W2I A;  2W68 A;  3WIN E;  4CCM A;  1JZ2 A;  4YVW A;  5IJR A;  3B5L B;  4XQ4 A;  4IV3 B;  1RUN A;  3H1Y A;  3HR9 A;  3I2D A;  4FOY A;  3B3Q E;  2WNU C;  3ZXA C;  3KGZ A;  1PMH X;  4KWU A;  1FMD 1;  5H9P A;  3SH3 A;  4ATE A;  4QX5 A;  5KC5 A;  2VQU A;  4GIQ A;  5FRE A;  4L92 A;  1A34 A;  2RM2 2;  2WS9 2;  2F4P A;  4IGQ A;  3JQX A;  2X5I A;  4YSF A;  1QJY 3;  2VG9 A;  4IGO A;  3W5M A;  4COZ A;  2WKK A;  4HET A;  5EP9 A;  3KV6 A;  5FYT A;  1H2M A;  1LCL A;  3WW1 A;  3RQ0 A;  1GKB A;  1UMH A;  2ARB A;  4AYU A;  1WCD J;  3O1M A;  4LQR A;  5CKQ A;  4ZXE A;  3I7D A;  5HCB A;  4AAP A;  4I02 A;  2ZJC A;  1FMD 3;  3VLB B;  2WR9 A;  5LY1 A;  1DLC A;  2VMF A;  3DXT A;  4EN6 B;  3CJX A;  2JE7 A;  3AYA A;  4OI1 A;  3CJI C;  2P5B A;  5FYM A;  1NUK A;  3LDB A;  1ZBA 2;  3MV0 1;  5CKN A;  3E5U A;  2ARE A;  4OHW A;  4S2F A;  5DQ0 A;  4XFC A;  3FX3 A;  3WQ7 A;  5AC9 1;  3FMG A;  3CIH A;  4J6G A;  1L7Q A;  3RI9 A;  5FZG A;  1CR7 A;  1J59 A;  2PHL A;  2K9Z A;  2J1E A;  3VD7 A;  3WF4 A;  4CCL A;  1MS0 A;  3OGV A;  1O7F A;  1MZF A;  1ENS A;  2YPD A;  5A3U A;  2GNT A;  5FMO L;  4LKD A;  1UXZ A;  3LGR A;  1WW5 A;  3E5X A;  2WNO A;  4AED B;  1ZRE A;  1G9A A;  4FTS A;  1R1A 2;  1WLW A;  1ZA4 A;  3VBR C;  2BGO A;  2F4L A;  4QD2 A;  2YU2 A;  4XHX A;  4DIQ A;  4TN7 A;  3L2Y A;  5AC9 3;  1DYP A;  1FV3 A;  1HB1 A;  4PDW A;  2WC2 A;  2CGP A;  2A6Z A;  1C8N A;  1ND2 A;  1X82 A;  5F1R A;  1V6L A;  5FZI A;  4ZON A;  2RJK A;  4MSV A;  3HAG A;  3W21 A;  4DXZ A;  2KXL A;  2UY8 A;  5C7G A;  2MEV 1;  4BK4 A;  5CFC A;  1SDD B;  5H9S A;  3KV4 A;  2EF6 A;  4OMD A;  1YNA A;  2PFW A;  1BCX A;  3JUU A;  3K51 A;  4AOC A;  4BLJ A;  5JOX A;  1BJQ A;  1RUC 1;  1PK6 C;  4Q4X 2;  3DF0 A;  1F9K A;  4XOG A;  3IWZ A;  2WZE A;  3I2K A;  4BQX A;  3FJS A;  2HKX A;  2Y6F A;  4TZD A;  5JZG C;  2PN5 A;  5FQ0 A;  3W20 A;  2FDG A;  1LEC A;  2YBK A;  1LU2 A;  1GZ9 A;  1VAM A;  1X8E A;  1FNY A;  2XLF A;  1TNR A;  1SCR A;  4MGQ A;  1JOJ A;  1VRH 2;  1GMM A;  4IV1 B;  5LA9 A;  5LY2 A;  2MEV 3;  4AAX A;  5LCW L;  4QXK A;  4GJZ A;  2Z5W A;  2D6O X;  2HBU A;  4QDQ A;  1RUC 3;  2RS5 2;  2ZAH A;  1J1T A;  1AX0 A;  2VNO A;  3K4Z A;  2R7E B;  5CFD B;  3BPZ A;  2CAV A;  2HYX A;  2ZGK A;  4IE4 A;  5F3I A;  4A6S A;  3NL1 A;  3VD5 A;  2F6B A;  1PNF A;  4AEK A;  2VEC A;  5FPB A;  2H0B A;  4R4X A;  1FYU A;  2GH8 A;  4F8A A;  1J3P A;  4U2A A;  1NCQ C;  2VW0 A;  2XVK A;  2ZKL A;  5CU1 A;  5ABJ B;  1OLM E;  4NPM A;  4QPY A;  4XTP A;  1NG0 A;  4Y4R A;  2AZ5 A;  1OVS A;  2ZHN A;  1WWY A;  4MGI E;  3VDD C;  4UFK A;  3ZXE A;  1T6B X;  4D69 A;  2ZEW A;  4F7Z A;  3KGL A;  3CQO A;  3HD8 B;  5IVJ A;  1K5M C;  1PGL 2;  3IKW A;  2DUP A;  2JDU A;  5CYY A;  1X50 A;  4QX7 A;  3TEX A;  3VKM A;  5E89 A;  3B93 A;  2W47 A;  4AEJ A;  4LBL A;  1LGC A;  1PVX A;  2CAU A;  5EYX A;  5FXV A;  2Z69 A;  4QPG A;  3WDX A;  1GZT A;  1OH4 A;  4UFJ A;  4QB1 A;  3CHX A;  3ZXL A;  1JUI A;  4N7U A;  3RYR A;  3SH5 A;  5IW0 A;  1ZA7 A;  4XF0 A;  3X29 B;  2W39 A;  2P3J A;  1ZVF A;  3EJK A;  3POB A;  1C4R A;  3MLJ A;  2W46 A;  2W95 A;  3B02 A;  1ZZC A;  1RUJ 1;  1HXS 1;  2XBO 1;  3Q8C A;  2VCC A;  3ZYG A;  1UYZ A;  2XJS A;  4COU A;  3ZM8 A;  3UL2 A;  3ELN A;  2C26 A;  1HB3 A;  5DZE A;  3VD9 A;  3I8T A;  3OD4 A;  3RFR A;  1ZNP A;  2RDR A;  1LKN A;  3IAP A;  2TBV A;  4HK9 A;  2PAK A;  4WVM B;  2XH6 A;  4XUN A;  2WLP A;  4JC1 A;  4EE2 A;  5DUX A;  2VZU A;  2RS1 1;  4EWD A;  1NLR A;  1RUJ 3;  4CEY B;  1HXS 3;  1OPM A;  2BWC A;  2OUH A;  2WSV A;  2XBO 3;  4MOA A;  4B4R A;  2QDN A;  1QH7 A;  3H7J A;  3CL1 A;  3I2H A;  3USU B;  1ENQ A;  5HCA A;  2A6W A;  5HXV A;  3ASI A;  1AHS A;  3KB5 A;  1F4A A;  2J42 A;  1IQA A;  5EFU A;  3TEW A;  1Q8V A;  1UKR A;  1E5H A;  1MS4 A;  3HBK A;  4Z8B A;  4QX1 A;  5CZK A;  1DIW A;  2RS1 3;  1WLT A;  4QX8 A;  1RED A;  1RUH 2;  4Q4W 2;  2EA7 A;  1GP6 A;  2DTW A;  1V00 A;  2PHF A;  1XC6 A;  4YLZ A;  2YU1 A;  1AF9 A;  4ZPI A;  3GXU A;  5L9B A;  4LK7 A;  5L7O C;  4YM0 A;  5I93 A;  1VBB 1;  1RUD 1;  1S0F A;  3O1U A;  1AR7 2;  2XVG A;  1NT0 A;  4XF1 A;  2D7F A;  4Y5T A;  1UZY A;  1W6Q B;  4AHY A;  1OQD A;  4P08 A;  5K7P A;  5CAD A;  4WVV A;  1RB8 G;  4O61 A;  1NCR A;  2HWB 2;  3CLP A;  3IDA A;  4MXW A;  1ZRD A;  4UAP A;  3ZIX A;  3LB9 A;  4ASM B;  4JTN A;  3GM8 A;  5EYY A;  3ZFF C;  3ON7 A;  1MS3 A;  1G9F A;  1H30 A;  1QJE A;  2JXA A;  3MW4 A;  3N9M A;  1GYK A;  1OOP C;  3C8X A;  3PJY A;  2XVL A;  4K1Y A;  4RGG A;  5LA1 A;  1NE4 A;  1RUD 3;  1VBB 3;  3U14 A;  1O8P A;  2JEN A;  3WDU A;  3OYW B;  2A3Y A;  1W6P A;  3PLQ A;  3JB8 A;  4BA6 A;  2KA3 A;  4LUK A;  2PHW A;  1HJF A;  4AE2 A;  1KXG A;  1UD1 A;  4FQ4 A;  2ZX4 A;  3T2P A;  2KR2 A;  1ULF A;  5A3T A;  5HXM A;  2LUW A;  4NUB A;  1F8V A;  3AXD A;  5FYS A;  4YG6 A;  1GQH A;  2YC2 A;  4BJ0 A;  3BI3 A;  3VZL A;  5I0S A;  4DXR A;  4AI1 A;  5FP7 A;  4JGY B;  4Q1P A;  1UW8 A;  1SPP B;  4MGY E;  4JHZ A;  1B35 C;  4DMI A;  3T2O A;  4G3Y C;  2WZR 2;  2YDE A;  3ZFG B;  2BWA A;  3BTA A;  1HB4 A;  2ENR A;  4UYB A;  5DUU A;  4CPB D;  3POJ A;  1NQD A;  1OD5 A;  1TQ5 A;  1C8M 2;  4IEO A;  3EXU A;  5FYU A;  4AG4 A;  5JIU A;  2JB8 A;  2E6V A;  3VV1 A; 
#chains in the Genus database with same CATH homology
 1OVP A;  2BV4 A;  2WR9 A;  1W8H A;  4CE8 A;  5A6X A;  1UQX A;  1OUR A;  2BP6 A;  5D2A A;  1OVS A;  3DCQ A;  5A6Y A;  2JDY A;  5HCH A;  2VNV A;  2JDN A;  5A3O A;  2JDM A;  5A6Q A;  2JDP A;  1OUS A;  2JDU A;  4UT5 A;  5A70 A;  1W8F A;  2JDK A;  2VUC A;  2WRA A;  1OUX A;  1UZV A;  2BOI A;  4AOC A;  1GZT A;  2BOJ A;  2CHH A;  5A6Z A;  2JDH A;  2VUD A;  3ZDV A;  1OXC A;  2XR4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...