1UQXA

Ralstonia solanacearum lectin (rs-iil) in complex with alpha-methylmannoside
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
113
structure length
113
Chain Sequence
AQQGVFTLPANTSFGVTAFANAANTQTIQVLVDNVVKATFTGSGTSDKLLGSQVLNSGSGAIKIQVSVNGKPSDLVSNQTILANKLNFAMVGSEDGTDNDYNDGIAVLNWPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LECTIN
publication title A New Ralstonia Solanacearum High-Affinity Mannose-Binding Lectin Rs-Iil Structurally Resembling the Pseudomonas Aeruginosa Fucose-Specific Lectin Pa-Iil
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 22
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2003-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07472 PA-IIL Fucose-binding lectin II (PA-IIL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.400 Mainly Beta Sandwich Jelly Rolls Calcium-mediated lectin 1uqxA00
5A6ZA 5A6XA 4AOCA 2JDYA 5HCHA 1OVPA 5A6QA 2VUCA 2BP6A 2WR9A 2XR4A 3DCQA 1W8HA 2WRAA 1UZVA 5A6YA 2JDUA 1OURA 1OUSA 1UQXA 1W8FA 5A70A 2JDNA 2JDMA 2JDHA 3ZDVA 4CE8A 1GZTA 2BOJA 2BV4A 2VUDA 1OVSA 2BOIA 2JDKA 2VNVA 5A3OA 1OUXA 2JDPA 1OXCA 4UT5A 5D2AA 2CHHA
chains in the Genus database with same CATH superfamily
5DAVA 3T0AA 1AR61 3NRUA 2HWB3 5FUNA 5FZ0A 3U37A 3IB3A 1SLIA 3VD3A 4U2AA 2ZEWA 3KM5A 4QPWA 1Z78A 4A3XA 4EWDA 1O4ZA 3JD71 3JQXA 4RQPB 2OW4A 3D3AA 1K12A 2VNGA 5D8AC 3RQ0A 2OPWA 3M3OA 3NQHA 4CCDA 3P3PA 4NE9A 3VBRB 3RDIA 4BQ5A 2VQ0A 1UOBA 4QQPA 4W6WA 3R6SA 3LD8A 2NN8A 3SNMA 1JYXA 1G9DA 2J7MA 3FMGA 3WP5A 4A4AA 4CP1A 4HK8A 4IEWA 1X82A 3I2IA 1W8TA 2D40A 1UPSA 1ND3B 1LOFC 1S0EA 3HMYA 4QAWA 2GH8A 4YG3A 1XQNA 4HVRA 2WINB 1PX3A 3LA2A 1DGWX 1TQ5A 4TXWA 2G19A 3DCQA 4OHZA 2GNDA 2V5YA 5DPNA 5GZDA 1VBD2 1V6OA 3PU3A 4Q4W2 4RD7A 4AVBA 3I3BA 1S2BA 4N9IA 1HRI3 2D3RA 5JAXA 1QOOA 3AFKA 4HFSA 2KXLA 3KV5A 3IKWA 1MZFA 1EYBA 2ZEXA 2D6MA 2GNBA 1W8ZA 2NMOA 1WCKA 2LRPA 4XDPA 4I2OA 3S5AA 3MGUA 2BRTA 2H0VA 3UJQA 1JOBA 2E9QA 3OGJA 2C1FA 5JLVA 2HWC2 2H6BA 2YDEA 1OUXA 4UW5A 4LOSA 3HPNA 2HYKA 2ZEZA 4CTEA 3ZYIB 3D8CA 3VHNA 1PIV1 3B5LB 5CFCA 3O1MA 1AR82 2DBNA 2JG9B 1SZBA 2B5HA 2RMU1 4IV3C 4IGQA 4NVPA 3POIA 4QX3A 3TRSB 3QACA 3Q8EA 1TME3 3RI9A 4GB32 3ZR6A 2RDQA 4A3ZA 4YSFA 3ZVXA 3KV6A 4NR1A 3BTAA 5F2SA 3TN91 4AFDA 4GXLA 1RXFA 1R093 2RJLA 5FR3A 5LW9A 3PVOA 4RGAA 4IDZA 2EICA 1NCRC 1AXKA 3A0KA 5G04L 5I0TA 4LJHA 4JHZA 1F15A 4YM3A 1XB9A 4COWA 1JBCA 3W58A 3WY6A 1SACA 4UFMA 5LATA 1D4M2 2W1WA 4AHXA 4A7YA 2A6ZA 5JOZA 3GBGA 1W39A 3Q9OA 3TEZA 2RDNA 1RMU1 1ZRCA 3H9AA 3NNLA 1UMZA 3AMMA 4NHMA 4XURA 3I3MA 3SKVA 1SBDA 1AYN2 4CUGA 4QDSA 5C70A 5C33A 2DCJA 2HLEA 4FAHA 1R64A 1EY2A 1R1A2 1VBA1 1ZRRA 2JB4A 4FP3A 4QPGB 4LKFA 4RR3B 1WW5A 1FYUA 5FBZA 4UFKA 3VUOA 2WFF2 4UXAA 2HKXA 4XTMA 4HVQA 4P9XA 2QQPA 3PVNA 5J37A 5CB7A 1W04A 2EALA 4ZU5A 4HN0A 3TEXA 4V2WA 4DB5A 2P1BA 5CAZA 5J48A 4OHWA 3WW3A 1GUIA 3MIEA 1RUG3 5DAXA 2VTXA 4OFGA 3GYDA 2V4VA 3FFQA 4LA2A 3S7IA 5HV4A 2ORZA 5A3UA 2XUEA 3I59B 3WCSA 2FDKA 1SPPA 4B4QA 2A3YA 4YGCA 5FZCA 2ARXA 2Q8OA 3EBRA 3HQRA 3CJIA 3IIAA 4QHBA 5J7MA 3TWIA 4RHV3 4UF0A 3J7HA 5FY8A 3POJA 4OI2A 3WF3A 1O7FA 1YC61 4H7LA 1OFSA 1BCXA 1RUI2 2D5HA 4YW7A 1EPZA 4FFIA 3V64A 4CP2A 4N9HA 4JQRA 1W6PA 5FZ3A 4FPHA 4ARYA 5FZ6A 3I97A 1F5FA 2BW8A 2JJ6A 2VXJA 1U5ZA 4GMP0 4BMBA 4EZHA 2Y38A 4YLZA 3O14A 1OKQA 4MG2A 1YCIA 3AKSA 4FFFA 1XNAA 3W9AA 1LHVA 1UY0A 2ZA9A 4N53B 1RUF3 5AVPA 3OCPA 3WF0A 5KHJA 4TZDA 1MEC2 5E89A 1RUC3 5J98B 1WMXA 4B8EA 4K1ZA 4NMIA 4Y5TA 5FXXA 3AMPA 5FUIA 3I2KA 1JYTA 4O9EA 3OF1A 4AQSA 4BA6A 1ASJ1 1LOGA 2EAKA 3MZHA 4XQDA 4XF3A 4DZGA 5HV0A 1NAEA 1DQ0A 1SLAA 1WMDA 1R082 1G6NA 5FWJA 5C9AB 1G9CA 4LEJA 1JZ3A 2EXIA 3VZOA 2IWGB 2D5FA 1JHJA 1TVGA 1QNYA 3K3NA 5LASA 5FPUA 1UO9A 4L0PA 1G8WA 3M70A 4BIFA 4CU9A 3HBZA 3KT7A 2ES3A 3ZFFA 4QU1A 2D6LX 4QWNA 2HWE2 2GC3A 4Y1UA 5CKMA 4FTBA 1WA6X 4XETA 5HXVA 3GHMA 3MUY1 2ZPXA 1US3A 4C8DA 1BLZA 2WRAA 2YROA 1MS1A 2IZWA 1CIWA 4FCAA 1VIWB 4UYBA 3NNJA 3THCA 3ACGA 2K9ZA 4GWNA 4D0QA 1VBB1 3DXTA 4LBKA 2WWSA 4CCCA 2QVSB 1OSGA 1W8WA 1GNHA 4BLIA 3KHCA 1ZA7A 3MPPG 4ZXKA 5B2GB 1PZ7A 5BY5A 1GP5A 1DG6A 2GAUA 3DN7A 4W6XA 4E4SA 3HR9A 2WJSA 5F6KA 4MUVA 4XJ8A 5FYIA 4TTGA 2ADDA 1LHOA 2P3KA 1XYNA 2PYTA 1N1VA 1VRH3 2V4AA 3H42B 1VJ2A 4I01A 4AI3A 5FCCA 1NT0A 5E8AA 4YG6A 4IL7A 2ZGUA 2XGXA 4BJ0A 4BM8A 1C8M1 5LBBA 4BWOA 4E2GA 2BBVA 5C6CA 2E6VA 3URFA 1AXZA 4Q1RA 2WS91 3L2HA 4Q29A 4LXLA 1REFA 1S0IA 3NNMA 5LA0A 2JDHA 3RYRA 1PNGA 4FFHA 4EZ4A 3JB8A 2VMCA 4FQ4A 1N3OA 1BHGA 3FHQA 2ZGRA 3I2FA 1AL23 4LUKA 4W4ZA 5FY7A 1RL3A 2WZR2 2DUOA 1O3RA 3LDKA 4AG4A 1QJY3 1H6XA 2WA4A 1W8OA 1JOPA 3MO4A 2ARCA 3NAPA 1V0AA 3HQXA 3T2TA 1NCRB 1DLCA 5A3LA 3E97A 3IDEA 5C8WA 4LBOA 4L99A 2Q30A 3B94A 1D0HA 4TLFA 4E2SA 5D21A 2XVGA 1NYWA 2UY9A 1K5MB 3KCXA 4WVWA 4ES8A 5A80A 2YB7A 4HVOA 4CSWA 1NQDA 4UFJA 5JI7A 3SMHA 3WW2A 2XG3A 4LK7A 2VY0A 1LAJA 2QJVA 2D6OX 3E1F1 4OHVA 4LHKA 1AF9A 2R042 4CDXA 3HOBA 4E4DX 4M4RA 4X8PA 1E5RA 4IESA 3CJIC 1OQEA 4UT5A 4JKMA 1HRI2 4QQ2A 1KJRA 3FUQA 5CVRA 1MVQA 3MYXA 3AYDA 1HJFA 4Q4Y2 2C9KA 1YEWA 3R4SA 2BNNA 2W1UA 5FPZA 5BNQA 1BEV2 4JGYA 2ZGLA 2O8OA 1W9YA 3B9IA 4CCNA 1YFYA 3ECQA 2K2SA 4B7KA 4DY3A 2O0OA 1AHSA 2EAAA 4HKLA 3DYMA 3CDZB 2W5FA 3N9PA 4A2UA 1OMIA 4R9BA 3J4UH 3Q8FA 2PHDA 5FYBA 3AP5A 1YQ6A 2IXKA 1VALA 2LM3A 1J58A 2J1VA 1H8TA 5FMOL 3PTRB 3ZYFA 3M3CA 3NKTA 1W6OB 3I54A 4IEYA 4KI5M 1UAIA 4QXBA 1JU3A 4HSLA 1CPMA 5F9TA 3LPGA 5A6ZA 2VVEA 1VBC3 1CAXB 5A33A 4ES9A 3RMYA 2A1XA 2VULA 1PGW1 3ETQA 3ZFFC 1COV2 1PO23 2QQVA 4LHSA 2QE3A 1XNDA 5FZGA 3UGFA 4IEXA 4RGKA 1O59A 4V1PA 1UY2A 1WZXA 4BISA 3ZYJB 5FYMA 2YBPA 3HVDA 1F5JA 4EN9B 4HXCA 2DURA 2FCUA 4XIKA 1GZWB 4BQXA 2VMHA 4OZOA 1AYN1 4C0BA 3FLRA 3NJXA 2VZ1A 4NRQA 1WUVA 2HWF1 1OKOA 1C1LA 1AL0G 4LO4B 3AZVA 3OUIA 2VQTA 3UNPA 5CG9A 2QUOA 5KHGA 3H1MA 1AUYA 1YFWA 2WO2A 2ZMLA 3POEA 3VD4A 1Q8PA 2VH9A 5ACA1 2X09A 1AXYA 1PO12 2VW1A 2ZKNA 3AC0A 4KWUA 4LULA 5F5AA 2VMGA 2JG8A 2OYZA 3TYJA 1RUH2 3PMSA 4NWWA 1GQPA 4Q4X3 4CEWA 5C3PA 5C8CB 5EIYB 1RXGA 2XJPA 4M4PA 4NHYA 1PM4A 2ORXA 3H3LA 3LQCA 5JI9A 1CJDA 2VZSA 2ZGKA 2CL2A 4LLFA 3CMGA 2ZGMA 5LWBA 4BOWA 4DNYA 1P8JA 5FPXA 1BYHA 3KSCA 3AP4A 4J1XA 4RQPA 1GQHA 2UWCA 2JD9A 1UU5A 1LTEA 1L7RA 2C24A 2W47A 2RS12 3ES1A 1OH4A 4IW3A 2P6CA 2B8MA 4BQ4A 3VBRA 4CPBD 1IQDC 5A3NA 4CXXA 4XUNA 4IXLA 3ZXAC 3NAPC 1FAYA 4QQLA 2DUQA 2AACA 4NAOA 1OA4A 2WQ4A 2UYAA 4YVWA 1DYKA 1MZEA 1ND3A 4GMP3 2A6WA 4EJRA 3VBHB 2XJTA 3ILFA 4Z8BA 1SCSA 4Z07A 1ULPA 5C3QA 4FPFA 1SFYA 4XC9A 3VDBA 5C5UA 2VECA 5GZCA 4BQWA 4RYDA 3VL8A 3MFAA 4P5YA 4YVWB 3B69A 4XTPA 1RUF2 2ENRA 3G7DA 1MQTA 1UD1A 2DUPA 4QPIB 1A78A 1RUC2 4LIVA 4UW4A 1G9AA 1DGRA 1BBT2 2R062 2OVUA 4XFIA 2PHFA 4GZ9A 2PQQA 3USSA 4IV1C 4CDXC 3Q8BA 3E6CC 4UFLA 4HMZA 2XJUA 3NNFA 4AEDB 4AE2A 3AJYA 2QTWB 3P1IA 2BTVC 4LPLA 1H2NA 1MZ5A 2Y64A 3AZZA 2VZUA 4Q8LA 1BK1A 2XHKA 4R4ZA 4K7JA 2DU0A 1JN2P 1RUJ2 1I3HA 1V9U3 2Y6GA 5FZ8A 3OJBA 2JG9A 2N7GA 3ZSKA 2BV4A 5A3WA 3GZTB 1VBE2 3ELNA 3I3DA 5EXOA 1QF3A 3DKWA 1U5IA 2C4XA 4P9WA 1KGYA 2QQKA 3RPQA 2GU9A 3WSOA 5JMCA 5DAWA 2ZMKA 3USUB 5FKCA 1LU1A 2H6CA 2NLRA 4P14A 1Y9QA 1JZ8A 1S0FA 2LTNA 4JRLA 3FX3A 4XJUA 3OYWB 4HBNA 3FFZA 5DUXA 2GSYA 2NYYA 4GH4B 4HANA 2WQ8A 4CCLA 5IK4A 4EN8B 4GKXA 2PHUA 2YC0A 4PJYA 1OURA 2RS32 4PQ9A 4R52A 3OSDA 2XUMA 4UAPA 3ZXDA 3ZX7A 3ACFA 2ARAA 4PIZA 4QKBA 5FYVA 3IBMA 3X29B 3IDBB 3CKHA 1OLRA 4JRAA 2YPJA 2VUDA 1PVC1 1MS5A 2R1DA 5FAXA 2XPJA 5A7QA 3OD4A 2GDFA 3MIGA 1XBFA 3GGLA 3JBG1 2Q4SA 1VBD3 3POSA 4Q4W3 2QQOA 2HWB1 3NV3A 4QPGA 4W6YA 4RR3A 4LR4A 4AHZA 1CX1A 2ZHKA 1QJZA 1C3HA 4K8FA 2CAUA 1AYM2 4OUSA 1NA1B 3ZPOA 1QJY2 4KNCA 2ID4A 1OPMA 5A70A 5BNOB 2MHFA 3LGRA 1HN1A 3AKPA 3NSTA 5FZ1A 2JG8C 3J7MA 3ZYRA 4AVVA 4OYUA 1QJFA 3S0MA 3EYPA 4RFRB 4N90A 3C7OA 2A3WA 1AR83 2FDFA 5EWSA 2AC1A 4AVTA 4JDOA 2ZOEB 3KQRA 1F8VA 4GB33 5J1XA 5FYSA 4HK9A 4HONA 4I0BA 1TE1B 3I59A 3ZFEC 4QQHA 4AI9A 3W21A 3WQBA 3RZZA 4RQPC 2DF7A 1SBFA 3RS6A 5CU1A 2B4KA 3B3QE 3LIGA 1H1AA 5IK5A 1JZ4A 4JTNA 1WW7A 3WG3A 3K51A 3KCCA 1CVNA 4Y1YA 4ZKTB 2P2KA 4N8MA 2OZJA 4MHUA 5FO7B 1D4M3 1G9BA 2RVAA 4YVWC 5BV6A 1ND3C 4D6SA 4N53A 1BMV2 4JC1A 1ND2B 2V09A 4A7KA 4QMAA 3GCXA 2Q1MA 5KHKA 3C7EA 2VCBA 4QXHA 5K0UC 3FZ3A 1GMMA 3ZO0B 4I0WB 5LEJA 3JQWA 1DIWA 2Y6KA 1ZVFA 3S5QA 1D2SA 1R1A3 1TME1 3ITQA 2TNFA 4UBHA 1ZZ7A 4Y1VA 4XMIA 2VMEA 1DHKB 2WFF3 4X8NA 3N7KA 2HWD2 1XE7A 3N9QA 4K21A 1R091 2A5ZA 2JDNA 4BH9A 1W90A 3U4SA 2E51A 5IVEA 3OG2A 2YY1A 4XHXA 1SLLA 1VBC2 2JEMA 2WUHA 1DGWA 1VRBA 1KS4A 2VNVA 3O1SA 1YFUA 2JG9C 1PO22 1T6GC 4XQWA 5EPAA 4P9YA 1NUKA 1TMF2 2WZ8A 1KRIA 1GWKA 5HCFA 4FOWA 1W2AX 5IVBA 4MGSA 2CYFA 1KQRA 1Q43A 1W6QB 3BVCA 4IGPA 4S2HA 3LZZA 5HCHA 3FL7A 5E88A 1VMHA 4P00B 4NIDA 3MLLA 3MDPA 4LOTA 2HYXA 2BYVE 1ULGA 2DU1A 3J9SA 5GZFA 3PHMA 3WVJA 1OUSA 3CU7A 3OOXA 2G9GA 4IV1B 2GMEA 4LHNA 1UQXA 2AH2A 1XRUA 5FMOS 2X53S 5FXWA 1UWWA 3WNOA 4XUOA 5T5LA 4CZSA 3K46A 2BEOA 1AR73 2VVDA 1PHMA 3HWJA 4GJZA 5FMDA 5L7OC 4LKDA 4CU6A 3QBQA 5FKBA 3VV1A 2WC2A 3S30A 4OI4A 4CDUC 4XCAA 3A4UA 3OTFA 3CIHA 1N1YA 3O1TA 1S2EA 4Q4X2 1FT9A 1MEC3 4FT8A 4IV3A 1B35B 1J84A 1GOFA 4U36A 4GD4A 4EWEA 4IERA 3AYAA 1RUG1 3NV4A 4QB6A 5A3TA 3CL1A 4MV2A 4AZZA 4QPGC 2JIGA 4M3CF 1Z0HA 1R083 4RR3C 4KU8A 5L73A 3PUHA 5SV8A 5LY1A 1LGBA 1IPSA 1FX5A 3VD9A 3EHKA 4GWMA 2NP0A 3NJVA 5LEKA 1SEFA 1ZA4A 4ONUA 1RJ8A 1S0DA 1NCRA 5D1IA 3ZKUA 2BGOA 4RHV1 2WYFA 4IEZA 2W08A 1NY71 1FNZA 1HB2A 5E16A 1RUNA 1LEMA 5H9RA 1UNBA 4BQ1A 3NO8A 3UL2A 1K5MA 1LOEA 1O4YA 4LO7A 4QX1A 3TEYA 3FLPA 4WVMB 4OQ9A 4FOYA 1OH3A 5CG8A 5FZOB 5K4LA 5KC5A 2AZ5A 1WLTA 1NXMA 1PMHX 3VBSB 1ALYA 1LGNA 1UW8A 2KR2A 4GWJA 3J8F2 3O1VA 3PUAA 2IFWA 4FTSA 3GZEA 1NZIA 3THTA 4EN6B 5GALA 2RDRA 5DUVA 5FJHA 2JKBA 3LF7A 5KC6A 2WT1A 1J1TA 2VXRA 1JZ6A 2NZ9A 4MX3A 2Q8CA 1Z7S2 3MUZ1 1IS4A 4QGLA 1UZWA 2VTXJ 3AP6A 3FN9A 3HQUA 4NUBA 4XFCA 2YYOA 1XOYA 4AQ2A 4COZA 1O3SA 3KVAA 1EAH2 1MS9A 4NO4A 4OVEA 2QQMA 3AMHA 5DAPA 4N53C 4XW3A 2B9UA 5FDBA 1LULA 1YUDA 1OOPC 5FMCA 2VPVA 3ZSJA 1GNZA 3EO6A 4D94A 3TNPB 4AEJA 1I6XA 1W2TA 1CN1A 1ZRIA 2X5IB 4DO0A 2EXJA 1KS5A 3ZFEB 3LSEA 2WZR3 3I2HA 3E6BA 2JX9A 1W6OA 5C9AC 5GLZA 3CO2A 5DXDA 1QJX2 1ULFA 4MH0E 3D4KA 1IS5A 4H7MA 2LUWA 4XJAA 2Y6LA 1UYYA 3IM0A 4NAMA 1CONA 4MGZE 1CAXA 2ZZJA 1VP6A 1YQ5A 4XILA 1UPIA 5IFTA 1ULOA 4AFMA 3WP6A 2EF6A 1VRH1 2V5DA 1JZ5A 3WNXA 4KMQA 2CY6A 3KV9A 2XHNA 2FMYA 4C91A 3D5OA 1UMHA 3BGAA 1GZWA 4P9IA 4A42A 1OPOA 2DVAA 3HIFA 5K0UB 1HQLA 5K8SA 2R043 4ASLA 4MOAA 4PLMA 3L9JT 5LBEA 3IPVA 5DQ0A 3I8TA 1UYZA 1W99A 4HN1A 4B29A 4KWKA 4ZZ5A 1AL21 1YQ8A 2RJ2A 2W9XA 3FWEA 4CUCA 5JVVA 1DBNA 2YMZA 5IATA 3MFCA 4Q4Y3 4BXSV 5IAXA 3GALA 1QJY1 4YYOA 4ZU7A 2Y26A 1XYOA 1VMFA 1BEV3 4HKOA 5AFEA 2WLQA 5C8CA 2DCTA 3NV1A 3O12A 1LOBA 2ZS6B 1AR92 1E57A 4BPZA 1F31A 5LB6A 3WW4A 2YUEA 1WBLA 1DLLA 2ET1A 2WAOA 2YFZA 2C0ZA 2XBO1 2Q0AA 1S1AA 4NRMA 1CZVA 4PHZA 1KEXA 2GC2A 2PHTA 4R4XA 3KD4A 1QKQA 3ZMNA 2ERFA 2K0GA 2CWMA 3AXDA 1RHI3 3OUJA 3TBDA 1PGL2 1KD7A 3VZMA 4AVCA 4UBGA 4COUA 1FMD1 2Z2SB 4Q0VA 5CEHA 5HPOA 4Y1ZA 2P3YA 3WHUA 1RC6A 4O65A 1K5JA 3FE5A 4URTA 1POV3 2WL1A 3DYPA 1COV3 3WF1A 3VBHA 2WT2A 3PMEA 5L7OB 2RV9A 1VLNA 2RS51 2D44A 3ORJA 5JZGC 3FUOA 2O1QA 1K5MC 4CDUB 1ZZCA 5T5PA 1EV13 2FQPA 1LODA 2ZGNA 3ACIA 5T5JA 1W06A 2XVKA 5FQ0B 2ZGTA 3VD5A 2F17A 2NPIA 3N36A 1BXHA 2PHLA 4ET7A 1IKPA 2ET7A 1RB8G 5DDJ3 4AEDA 1ZM1A 2SBAA 2Q1ZB 4LBQD 5F32A 3H1WA 5LRSA 5FZ9A 2P17A 1PO13 4AFBA 2DFBA 2MEV2 2VNRA 3T0BA 1RUH3 2ZJCA 4LITA 5D2AA 3RGBA 2XOMA 3WR0A 4YM1A 3HNBM 5EZWA 1WMEA 4XDOA 1W2UA 5A6QA 1PO21 1JYCA 4L92A 3RWKX 1ZRDA 3UK9A 2VZVA 4AW7A 2VW2A 4I02A 1O5UA 3U14A 5JOWA 3I49A 4K8RB 3C3VA 3R4UA 4ZXEA 2AEYA 3APBA 1GP6A 5F2WA 3LSDA 3USUA 2WNVC 5I8TA 2PLV2 5CBLA 3DPRC 5JUVA 3I2OA 1FV3A 1DDLA 5H9PA 3OYWA 2DCKA 2E31A 2RS13 5APAA 2WKKA 3WG2A 2SLIA 5IW0A 4QB2A 2Z69A 2DVBA 1RVF2 2PAKA 3I2DA 4XEZA 1L7QA 1O3QA 4BB3A 4P9LA 1N47A 3B01A 1VB4A 1AX2A 4AGVA 5FY4A 4FSJA 1SCRA 2RM22 3KLSA 1AR72 5GLVA 4CUAA 2AREA 4HSJA 3LWCA 2C9AA 4NN0A 4PF5A 2VUCA 3SH4A 2RG4A 2R072 5A1LA 3ZSMA 3TAYA 3WDTA 2VNOA 4FFGA 4J25A 4D8MA 4RGGA 3C2UA 1OI6A 1OOPB 1BBT3 3WP3A 2R063 2R16A 2VCAA 5DUUA 1I1EA 4NIGA 1G9FA 3MV11 4XE9A 5IUQA 3B02A 4ATEA 1LENA 1J3PA 1W3VA 1FPN3 1XE0A 3V0BB 1NA1A 3AMQA 5E6HA 2AENA 4O9GA 5IVYA 4WBBA 4Y20B 3QH7A 4JV4A 4S2GA 2PQSA 1IPJA 5BNOA 4XXAA 1IG3A 1T2XA 4Y4RA 1GOGA 4BMEA 2Y0IA 2WYSA 4CP9B 1GWMA 1RUJ3 4XBNA 1JYVA 3N4MA 3AP9A 3ZPYA 5C8CC 4Y33A 4B4PA 1NE6A 1DQ2A 3BTYA 3OPWA 4K40A 3BB6A 1ZBA3 1I9RA 1PVXA 3O5SA 4GMP1 4AXOA 1VBE3 2YFUA 2YZ4A 1L7LA 3OBRA 2VBPA 1QDCA 4NHKA 5GZGA 1RUE3 2NM1A 5FZFA 2VCMA 4PQQA 3T3YA 2Q1FA 5I93A 4ISRA 1CGPA 1OLME 1UU4A 1XNBA 4AI1A 4DUXA 3NKGA 3VD7A 1JYNA 1CAVB 2GZWA 2KA3A 4PBOA 1QH6A 1Q56A 2QQIA 4XQ4A 1DYPA 3VGIA 3ABZA 1ZZ9A 2CTVA 4QDRA 2VBBA 3T4HB 2UU8A 3CBNA 1LKNA 2WNEA 2RS33 2WWUA 2VZ3A 3ZOIA 3AZXA 3O0XA 2BFUL 3VBHC 3LA3A 3U10A 4AVSA 1Q8OA 2GH2A 4QXKA 1ND2A 4OQ8A 1JXNA 1UF2C 2ADEA 1W2NA 2JDAA 4K1YA 1JZ7A 2JDUA 3JD73 1V9U1 1C4RA 2CWSA 3ALQA 3QCWA 1VE0A 1Y9GA 2OQ6A 3LEIA 3PDQA 4QPIC 3A21A 5LA9A 1N1TA 2DBIA 4DRRA 3LDRA 1H4HA 3E5XA 1SFNA 1JS9A 3GCWA 4ZS2A 5GZEA 4PI2A 5A3PA 5EFUA 3T09A 3WUCA 3H8RA 3SC7X 1H2KA 3PU8A 3TB0A 4AEDC 2D6NA 1AYM3 5CADA 3LEMA 2CGNA 4MHRA 1LCLA 2BGPA 3WG1A 2P4EA 1NXD1 2VCCA 3ZFGB 4BE3A 4NOTA 2X05A 1BQPA 3AVRA 3ROUA 5AVAA 4DUWA 2XR4A 2ZEYA 4F8AA 3M1HA 1QMJA 2J1EA 1WKYA 1VAVA 2JXAA 4QKNA 2HH9A 3ZN5A 3M7AA 4ZZ8A 2XJSA 5JZGB 3BU0A 2HEVF 1CZSA 4LLOA 4QPYA 3GHNA 4J6GA 3R05A 1ZBE2 1CZTA 3SH3A 3VBOB 4GJYA 4E27A 1SDDB 2O14A 4XACA 5FY1A 5CKNA 3AB0A 1VBD1 4Q4W1 5JR2A 4IV1A 2XXZA 1IHMA 5GLTA 3P6BA 5IJRA 3I4IA 4GH4C 1KDMA 5LA1A 1RTVA 2WDBA 3CHXA 4WM8B 4E4ZA 1WLDA 3KQ4B 4OULA 1EP0A 4QD2A 2P6HA 3NV2A 3S57A 2VBDA 3NJZA 5EJZB 2DCYA 4P5HA 2DDUA 2HWC1 4IE4A 5F5IA 3ZLIA 5KWRA 4YGBA 3LFIA 4LT5A 3MEPA 1OF3A 2XQRA 4QM9A 3RZJA 5FP4A 2WA3A 1B35A 4DRVA 1OC1A 3GNEA 3AFGA 1AR81 1QHDA 3LFMA 1O8PA 4XXPA 3THPA 4EQVA 4LK6A 5DAQA 4GB31 2BOIA 3DV8A 1A6CA 4QGMA 1C5HA 1QEXA 2ZZQA 3IAQA 4XJ9A 5LCWL 2LALA 3HNYM 2WNVB 3VDDB 3BUCA 1HN0A 1XJAA 4HETA 4WZFA 4XJZA 3DPRB 1RHI2 2HWD3 1NA1C 3WW1A 1IQAA 1HDKA 1KITA 2RHPA 3OB8A 5DN2A 2PHXA 5FO9B 3PVBB 5BNOC 5DG1A 3M3EA 5AFBA 1HW5A 1N3QA 3P5BA 3T0DA 2WR9A 1S2KA 1SG3A 3DGTA 3VBFB 2L9LA 1PZ9A 1XYPA 4CXYA 1NKGA 2W95A 1TMF3 4DS0A 4WVMA 3ZSLA 3H8UA 1D4M1 1NX9A 3CQOA 1PMJX 3UJOA 4EV0A 5FZOA 3JB4C 3IT8A 1C1FA 5FZMA 3AL5A 4Y1XA 1VBA3 4WVZA 5JCTA 2A6XA 3VBSA 2D98A 2GALA 2LS6A 4QX5A 1EV12 4CXWA 2XLGA 4FVVA 4LIUA 1GZCA 4ARXA 2BQPA 2JE8A 4RA0A 2B9VA 2EA7A 3M3IA 1R1A1 2PFWA 1W0PA 1GSLA 4DPNA 1L3JA 4KQ7A 2WFPA 5DDJ2 3MIDA 4Q0UA 1QOTA 4LO5B 5GJ6A 4NHXA 4KBZA 2WFF1 3AKTA 1W8HA 2WZPP 3ZXFA 3WXPA 1TNFA 1HV1A 2ZMNA 3KMHA 4AI2A 3MIHA 1W9SA 2V73A 1K3IA 1ND2C 3PIJA 5FXZA 2I07B 5FPVA 4CPBA 2C6SA 1GANA 5H9QA 4QM8A 4IEUA 1AZDA 1RUD2 3LCPA 4P08A 4YNIA 3NW4A 2JE9A 1MACA 3WNKA 3ZFEA 1Y3TA 3ZKYA 4MO3M 4K3UA 1KFUL 3OBTA 3SQOA 1GFF2 4BCUA 1AJKA 4IEQA 1LR5A 2G9FA 4MSVA 1GZ9A 5T3NA 2B39A 4QQOA 4M3CE 5EHDA 3LDBA 3BODA 4JGZC 4WM7B 1J3RA 1BVVA 3BCWA 4K20A 4Y5Z0 4CUBA 4Q4V3 4YG0A 1SBEA 1RUI1 5FOBB 5ANQA 3K2OA 4PDWB 4O7XA 4UFIA 1AR71 1K45A 2DVFA 3VZLA 5M0TA 3RMXA 3M4FA 3WLUA 2UYBA 1UKGA 4LBQB 4OZXA 2W52A 5JOYA 5FLJA 3O7OA 5K0UA 1VB2A 1O4TA 3THDA 1W28A 3WNNA 1CX4A 1ENQA 1Q3EA 1MEC1 2ZGSA 3J8F3 5I0SA 5A7WB 2F6BA 3DECA 3HT1A 4RL7A 1E5IA 1DGLA 4FPEA 3UT0A 1JODA 5A6XA 3E6DA 4OCTA 1Z7S3 1HRV2 1R081 2VW0A 3UGGA 5I8SA 1FPN2 5A3MA 3H7YA 1H2LA 1Q8VA 1QQP2 2W0XA 2ZHLA 5A6YA 5FP8A 1EAH3 2RDSA 2YU2A 4E9KA 1Y4WA 2ILMA 4N43C 3U1XA 5C5TA 1W6NB 2WABA 1ZZ6A 3AYEA 1OF4A 4FTEA 2WSVA 2HWE1 4NPLA 1W05A 1WMFA 4Q0QA 1GZTA 1Y7BA 5FZHA 5IWFA 5DUWA 4CYDA 3VKNA 2J1UA 1B35C 3W59A 5AC92 4ZS3A 2FZ2A 1EPWA 1ZBA2 4L8QA 1SLTA 2WBKA 4B3NA 3SLIA 3RYPA 2X8KA 4Q5OA 5DMYA 2WAAA 2CGOA 2RR12 3NNGA 4WZCA 1RUE2 2JB8A 1QJX3 5LY2A 1PK6C 1QJU2 4GULA 2JECA 4JCKA 4EN7B 3HEIA 1US2A 3DL3A 1V00A 3VZJA 2DVGA 4M01A 1I5ZA 4HKWA 1PM7A 3IMNA 1VAKA 4IE5A 4QX2A 5L7OA 5LK5A 5IK8A 4YZ3A 5KXEA 5FY5A 2TEPA 3VHPA 3BOPA 4HZFA 3UETA 5JXJA 3WV6A 5LZ6A 4CDUA 2QQLA 3K75B 2PN5A 1D2QA 3R0RA 5FP3A 5FQ0A 3WNLA 5T5OA 1LHUA 4X6QB 1REDA 2VU9A 3JD72 3VBSC 5IHRA 1X50A 1CAUB 1GYKA 4LBMA 4XYXA 2CGPA 1IS6A 2W91A 1LOCA 3MIFA 4AGGA 4QHZA 1H30A 1NZCA 3EMRA 2I74A 1OD3A 2WZR1 4EWAA 3ME2A 1HX6A 2XJVA 3IZOA 4AAPA 1OQ1A 4QX0A 1QDOA 5EYYA 4CDWC 3VZKA 4X6RB 1OA2A 4NIHA 1HQWA 4YVSB 2JDMA 3D0SA 1AR93 4JDMA 4MXWB 1QWRA 4XF4A 3BIWE 5BNNC 3K4DA 1LJ7A 1UOGA 3I3QA 4UWDA 3OD0A 1PGSA 2G4IA 5BXXA 5FFOC 2BFUS 1S0GA 2IXJA 2YG0A 4IE7A 1X8MA 5HCAA 1RUOA 2XJRA 2JKXA 3O0VA 1V6LA 2X5IC 4RN5A 5BNPB 1UXZA 4EROA 2VO5A 1LECA 5FZ7A 2VMIA 2OS2A 1NLQA 4M0NA 3ES4A 3POFA 2ZX1A 3PIGA 2BP6A 2PTMA 1J3QA 2R041 5F7UA 3DEMA 1SLBA 1IS3A 2WQZC 1HRI1 1NE4A 2VOKA 3EB7A 4KWJA 1YQ2A 2MPFA 3DXUA 2W68A 2A75A 1OBNA 1PIV2 1IPKA 1GWLA 4Q4Y1 1LNSA 2OZ6A 4LE3A 1H1IA 1W8UA 3H8OA 3ATGA 5HI0A 4NIAA 4E8DA 2WNUB 5HBAA 1HJGA 1BEV1 3LEGA 1H4GA 3WHTA 4Y3OA 2EVXA 1DZQA 2QFEA 4B4RA 5A1FA 3VL9A 3HAGA 4COVA 2IVJA 1OOPA 2OXBA 2R49A 2Z79A 5ANNA 5FO8B 1UX6A 3A7QA 2A71A 4XFBA 2VC9A 3AL6A 3T08A 5F3IA 2GNMA 2IVIB 5G05L 3V0BA 5C9AA 2E33A 4Y20A 1F35A 2TUNA 2IUWA 1RHI1 2W39A 3N9MA 4BDVB 1DZRA 2BWCA 4F3JA 2E63A 3RZLA 5DABA 3T30A 4CP9A 4DEQA 4F83A 2MEV3 3VKMA 5FYZA 4JGZB 2IXLA 3H3ZA 2VQUA 2GP5A 5IVVA 4BZ4A 1RMU2 2Y6HA 4IEPA 3I7DA 1POV1 2Y6JA 4C90A 1COV1 1BJQA 1QY4A 2A3XA 1W9TA 2EIEA 4RS5C 2AR6A 1LESA 2BPA2 5FWEA 2BBAA 2VMDA 1LOAA 2ZACA 1LU2A 1VBA2 3I2JA 3F2ZA 2PLV3 3RVHA 3WQ7A 1HIXA 4OI1A 3LE0A 2XH6A 5F1RA 3WQ0A 1KDKA 2VM9A 1CAVA 4JHTA 4TN7A 1RVF3 4N7UA 2E53A 3WINE 4ITCA 2RJKA 2R7EB 2DTWA 4FXGB 1YNAA 5F5QA 1JI6A 3IAPA 2R32A 5DDJ1 4LO8A 1ONAA 1DF0A 2GN3A 2RM23 5GKAC 5JR7B 3UGHA 2DFCA 3BIEA 1IGOA 3AZYA 1UYXA 2KD7A 1WCUA 2LW8A 1PO11 1S0CA 1X9TA 2QZ3A 2YHJA 3CEWA 2R073 2MNGA 3N9OA 4KH9A 4N43B 1RUH1 3ZSEA 1WD4A 1YJKA 1ULEA 3WEZA 5A32B 1F2NA 2A7AA 3N9LA 5FYCA 2ZCWA 3SH5A 4FPYA 4OLLA 1BKZA 5F6LB 5IVFA 2X10A 4CRQA 3BTXA 4I3GA 2F4PA 4AAXA 1QNWA 4AFAA 3MIBA 2ZGPA 2EIGA 1YQCA 4PLOA 4EYUA 4RSUA 4JVAA 2VUAA 1ZYBA 5EQUA 1PK6B 2OT7A 5FP7A 2V72A 2RS11 3ZFGA 5HXMA 2OUJA 5FYUA 3TOJA 1T6BX 3LOIA 4GQ7A 1JW6A 1UZZA 3DUIA 3HJRA 1BVP1 3UESA 4E4HA 2JIJA 2ETEA 5FZEA 2VOWA 4Q4V2 5FZDA 3ZDSA 2YC2A 3OBZA 2XQXA 4UOJA 4YW4A 3VN4A 5L9VA 5JZGA 4AEKA 3H0OA 3H1YA 4JKKA 1EUTA 3J7NA 4RFT0 2XMLA 4XF1A 3WDUA 1OQDA 4LKSA 3VBOA 5I0DA 1S4CA 4DQAA 4ZY9A 3POBA 1RUF1 5F5CA 5L9BA 4AHWA 4XUTA 2NMNA 1RUC1 4XPVA 1AVBA 4XOGA 3CNAA 3SITA 3WX5A 1BBT1 2R061 1UYPA 4FBFA 1NQJA 4WM8A 2BZDA 5A1AA 3MICA 1D4VB 1UOJA 4YZ4A 2VMFA 4BQ2A 3AVSA 1FPN1 1XU2A 2BOJA 3FJSA 1M06G 4EE2A 4W50A 4CDWB 3U07A 1VMJA 2HBTA 4CEYB 4HLTA 1Q5OA 1RUJ1 3K3OA 4IUGA 2IXHA 1RINA 4HG6B 4YGEA 5BNNB 2IXIA 2X29A 1VBB2 5J36A 4BXFA 2G1MA 1KFXL 3INAA 4BQYA 1QH7A 5JOXA 1GBGA 2XJQA 1ZBA1 5EV7A 1VBE1 3WCRA 3R4DB 2WNVA 3CZUA 3MW3A 4LO6B 1YLLA 1W3XA 3DPRA 4QXCA 1ENRA 1DU3D 4META 1QXJA 2H0BA 3V0AB 1XNKA 1TZOA 4LE4A 2BERA 3KCYA 4LBNA 2Q8DA 4FPOB 1FOD3 1C8M2 1ENSA 1HXS3 1W2OA 3H3UA 3VBFA 1AX1A 3SXWA 1QU0A 5IVJA 1U12A 2RS31 2WS92 3ACLA 4DXSA 5A7SA 2ZTNA 2I45A 2W1SA 3SCHA 4OHYA 3OBAA 4GIQA 3SKJE 1UIKA 1YJLA 4PIYA 3IDAA 1ZBE3 1UY1A 4DOUA 4Q2FA 2LROA 1KXGA 2VOXA 5BPXA 4DMIA 1ST8A 2A70A 4LORA 3P3NA 1OA3A 2CV6A 3H8XA 2D93A 4IQPA 2FD8A 1NCQC 5DG2A 5IVCA 5CFDC 5C3OA 3WF2A 1WBFA 4WV8A 2Q5TA 1CAWB 2XWBB 5EJ3A 3VBUC 4INDA 3WNMA 3ZN6B 4AFCA 2D6KA 4XUQA 1AYM1 5FJKA 3K4ZA 1VPHA 5F39A 3MW2A 2UWAA 4YPJA 4LHLA 5TSWA 4D3WA 4Z82A 4FOQA 4IEOA 2BVBA 3BYWA 3KS7A 1NG0A 2UY8A 3O0WA 1NLSA 3HNMA 3SCFA 2CHHA 4XF9A 4NWVA 1O6UA 1ZNPA 2J1AA 3GZUC 2E7TA 4MGYE 2NQYA 3ZXJA 1LEDA 3GM8A 3K4AA 4TWTA 3KVBA 4UI9L 4OI0A 3WG4A 4RS5B 4CU8A 4DXZA 2FDGA 1MQTB 2KM2A 3O1OA 2J1SA 3M8LA 1JH5A 1LHWA 2GC1A 1AJOA 5C4WB 3KF3A 3KZ4C 4MYEA 4PI0A 4WM7A 3UV9A 2QDNA 1MZ6A 5JPMB 1X9PA 3ZFGC 4B1LA 3JZVA 1HLCA 2P3IA 4PDWA 3RRDA 4XFGA 5B4NA 1VAMA 2P34A 4YW2A 5I0RA 1O8SA 3I2GA 1UZYA 2PAEA 2A6YA 2BNOA 4LBQA 2BWAA 4FPKA 1GNYA 5C71A 3VKOA 2IFRA 3QD6A 5JMOA 1BMV1 3W5NA 2ZXQA 4XAAA 1IG0A 4JDNA 3UKNA 3VBOC 4QPIA 2GMMA 3MLJA 1OHFA 5A7WA 5LRRA 2WZEA 4BYYA 1DQ4A 5LK7B 1MS0A 3GJAA 5FZLA 1MR5A 4F7ZA 2XWJB 2GC0A 1A8DA 5GLWA 2W92A 4WM8C 3EQEA 2XL7A 4A41A 4Y5SA 4DFSA 3Q8AA 4JTOA 1PGW2 1BZWA 3KT4A 2HWD1 4L2NA 3LOBA 4FAGA 1W6NA 3FBMA 3HN3A 5FOJB 5KBFA 5ABJC 5A7NA 5SV5A 1OLQA 1LRHA 1VBC1 5I0UA 1XXNA 3PJYA 1RUD3 2J42A 4FPCA 1GP4A 2HJIA 3IDCB 4GKYA 1TMF1 3RZHA 5FPAA 3RI8A 1ACCA 1V6IA 4CDQB 1GU3A 2HWF2 3CF6E 4P02B 5F3GA 3WDXA 3VDDC 3V56A 3ZDVA 2CAVA 1DQ1A 2C5DA 4QGNA 1XNTA 3VLBB 1PMIA 4NRPA 1WLWA 4PIXA 4LA3A 1TEIA 1G7YA 2CDOA 2F4LA 2JD4A 2OQ7A 1URXA 2IXCA 3ILRA 2WN3A 3LEKA 4GH4A 5FPLA 3WNPA 2Y33A 5ACA2 1ZREA 2PHWA 2DWRA 2ZX0A 4L9BA 2BGCA 2YU1A 2DTYA 3VBFC 3BPZA 3A0NA 4XVHA 3T1LA 3WDYA 5FPBA 4G3YC 3RFRA 2VTFA 4TYSA 1IOAA 1X36A 5KXBA 2VOTA 4AI0A 5F37A 1H9WA 1QGLA 3UKTA 4FPLA 5BUVA 1YXWA 1XPWA 4Q4X1 3ZXEA 1CAUA 2K46A 1UCXA 4HOOA 5HCBA 4DXRA 3RWNA 2C26A 2E7QA 3NJYA 1XU1A 2WLPA 2P37A 3ZYBA 2AUYA 1HRV3 4LTAA 1NLRA 3LAGA 4GALA 1CIYA 1JTZX 4KL1A 1WW6A 2BUKA 1QQP3 4YVSA 3ZXKA 4MXWA 4Z92B 3KT1A 2GP3A 3S6PA 3ZIXA 2W1QA 2WO7A 2BU9A 4BQ3A 4URAA 1A3KA 3D82A 4FXKB 5IK7A 4Q4V1 3GBWA 4YW1A 2FCVA 2ZBJA 2YC4A 3LA7A 1X7NA 3GF6A 3VDAA 3MV01 5AC93 4A45A 3JXSA 1PZ8A 1Q8SA 2JICA 1GOHA 2AGSA 4Q0PA 1DQ6A 1W8FA 4CA9A 1WA4A 5BNPA 3MLKA 3PLQA 2RR13 1X8EA 4TSVA 3GXUA 1QJU3 4KU7A 1SLCA 3ETPA 4P9GA 3J8F1 4Y22B 3T1MA 3C7GA 3MHZA 4WM7C 1NCQB 4JQTA 5D8AB 1O91A 3LPFA 4MVTA 5H9SA 3OGRA 3EJKA 2FDJA 5CFDB 2OX0A 4YM2A 3T2PA 1QXRA 3KHBA 3U0ZA 2JENA 5FREA 1Z7S1 3VBUB 1I5PA 3BI3A 2VZOA 3DF0A 3PURA 4PDWC 3T2QA 4OMCA 3IWZA 2WNUA 3RZMA 1AR63 5FZAA 2BDRA 4GAZA 3KWVA 5CFCC 3MF9A 4A6OA 1EAH1 3UKVA 1W6MB 1MVEA 1YYNA 4WVVA 3OGSA 2Z42A 2CSGA 1VR3A 3AMNA 1D0GA 1QJEA 4D7YA 5FUPA 1TNRA 4K9SA 4Q27A 4NIIA 1POQA 3OY8B 1D7PM 1EUUA 1ODMA 2D97A 2B42B 5LBCA 2D3PA 2P3JA 2TBVA 4FI9A 4HPKB 1ZZBA 3ZYGA 4OMDA 5JSPA 2JDPA 4QHOA 5CYYA 3RG0A 1QJX1 1HKDA 2QQNA 2R0HA 3SISA 3PVEA 1FV2A 4M3CB 2Z4FA 3VZNA 4FPGA 2OPKA 4JGZA 4J1WA 1LGCA 4D6RA 1YIFA 1B09A 5C3RA 4GA9A 4ZHNA 1Y43B 2XKPA 2EIBA 1FOD2 1WD3A 1HXS2 2EIDA 1PVC2 2E26A 2YBSA 4MXVA 4QB1A 5FYTA 4ATFA 1M4WA 4YZ1A 3RNSA 2VJXA 2VE1A 1V6NA 2VUJA 3JBG2 1KJLA 1RYYA 3BOWA 1WCDJ 3K77A 2YBKA 2OKXA 1H2MA 3POWA 2HWB2 4IV3B 1V6JA 1W6QA 4KGQA 4BLJA 1YI9A 2QQJA 4A7ZA 4JZRA 5I8YA 2JDKA 1DYOA 1MS4A 2YV8A 3DYOA 3IN9A 4G4FA 3FC0A 3FHAA 4QKFA 2O8QA 5T50A 4DY5A 2QQWA 4R9CA 3A23A 3WDVA 2QKDA 4MADA 4B1MA 2W46A 5JWPA 4O61A 4PCRA 2HEYF 5FRAA 1PIV3 3KF5A 3POGA 4W8JA 3N3HA 1E5HA 1JHNA 1AX0A 2Y8KA 3CJXA 4AWDA 2RMU3 2XBO3 4N43A 1HB4A 1O3TA 5ABJB 5A32A 5EYXA 1LHNA 1JU4A 1AR91 3HBKA 4IEVA 3G6JB 4OUEA 3C7HA 4R9DA 3VKFC 3U75A 3LIHA 3TN93 3V65A 2ZKLA 5L36A 2OA2A 3BPSA 4A6SA 1ULCA 1FMD3 4BIOA 2FHRA 3AXEA 2A6VA 5FMBA 4C1XA 1UL9A 2VZQA 4S2FA 3FLTA 1PK6A 3PJQA 4DIQA 1RIRA 5FXVA 4Q8KA 3K48A 1JMUB 3BN6A 1PGL1 4N7IA 2RS53 3L2YA 3T2OA 1RJ7A 3SEPA 4YVSC 2P5BA 4M0HA 2YGLA 4DINB 2XLAA 2ZX2A 3BALA 1YHFA 4ORFA 1DCSA 1RMU3 1YI7A 2WT0A 1E5SA 4W65A 1ENXA 1FNYA 2VZTA 4NHLA 2FDHA 3MPBA 1S0BA 4IE0A 4ZONA 3GJBA 3ZR5A 4YWAA 4XIOA 4V2VA 5F3CA 2Y6FA 3F95A 2AEZA 4HL0A 2ATFA 2PA7A 1Y9MA 2D43A 3PUSA 2E7AA 3S7EA 1TME2 1W0NA 1UN1A 1UU6A 5BNPC 2BJSA 5JIAA 5JPNB 4XMAA 4LMFA 4ZU4A 3IMMA 3AX4A 3RZKA 4I09A 5ISLA 1U5YA 3ZN4A 3AM2A 3NL1A 1FATA 5FLHA 3ZYPA 3O1PA 1Q8QA 2QNKA 5J09A 3NVCA 3CZJA 3BKZA 2WIIB 1IZ3A 1R092 1WCSA 3QLQA 4QKDA 2VR4A 1OT5A 3TEWA 2ZGQA 3SEEA 5F3EA 2YGMA 4ASKA 4CDWA 4YGDA 4CEYA 2GNTA 4IE6A 4NPMA 2WWJA 4CCKA 2WNUC 2MEV1 3GBFA 4CCJA 5BNNA 5FP9A 2E32A 1HV0A 2VG9A 3HN1A 4M00A 4SBVA 1IKQA 1UZ0A 2AYHA 3N35A 3WDWA 1QIQA 4AI8A 3TNQA 2RE9A 4AHYA 4D7SA 3N9NA 1APNA 2X5IA 1FI2A 5FYYA 4CCOA 1CQ9A 3AK0A 4XCBA 3V0AA 2OIIA 3IPVB 3ZM8A 3VDCA 4C0HA 2PLV1 4MGTA 4FO9A 2B45X 3LKJA 2DVDA 1XSRA 1OVPA 1RVF1 4PBPA 4XAEA 2B7YA 1JOJA 1WCQA 4HT1T 2DV9A 5FK8A 4XZPA 3UYJA 2XVLA 1GR3A 3FBYA 4QDQA 5GM0A 4AF9A 2RM21 1J83A 3WUDA 3OUHA 2ARBA 4FOVA 3WD5A 2XL9A 4KWLA 1ASJ3 3QOPA 2DYCA 3GZAA 5CFCB 1RUG2 2R071 3B00A 4H14A 1JYIA 1H1MA 2FMDA 4NROA 3U4XA 5JIUA 3ZXLA 3RSJA 4L97A 2GN7A 2JWPA 4LKEA 3D0JA 4XF0A 2Z5WA 4Y26A 4AQ6A 5LA2A 3A22A 3KGZA 1CAWA 1H0BA 3ZN6A 4RHV2 2R6QA 2Q8EA 1NY72 3JCIA 1QXPA 2EXHA 4CU7A 2ZAHA 4CVUA 2WN2A 3E5QA 4YFWA 4YW5A 5IAVA 4Z2WA 1S55A 4A44A 4YM0A 2W87A 3PNAA 1VBB3 3SCGA 1A34A 4R9AA 5KXCA 4G9SB 4PLNA 1TG7A 3O1UA 1OVSA 4RS5A 3H50A 5E1RA 1MS8A 3W20A 3ZMOA 3SHRA 3RJRA 4YZ5A 2QQUA 5CNAA 2DCZA 1H6YA 5C4WA 5FTTC 1OLMA 3N7MA 3B9CA 4B7EA 1O5LA 1W8NA 2WNOA 1PNFA 5DZFA 4AYUA 1HQNA 1A8MA 1U5XA 1YIPA 4XFAA 1YRZA 2GMPA 4ASMB 1SHWB 2CU5A 1V6MA 3BTZA 1C8M3 2VZRA 1R1ZA 2UWBA 2VVFA 4ZPIA 4FP2A 3JU9A 4JGYC 1RITA 4L11A 2WS93 2VAUA 4ISQA 4H2AA 4JX0A 3RJ2X 2Y0OA 2IC1A 3N7LA 2W94A 1AR62 1SMVA 5FK7A 3U78A 3Q8CA 1ODNA 4CCEA 5KXDA 5KHHA 4XABA 2W3JA 3J26N 2Y60A 4LBJA 5F8PA 5JXIA 3KGLA 5K7PA 1H8TC 3PUIA 5A7PA 1DGRN 2WO3A 3HT2A 1SPPB 2VGDA 1DZTA 1UX7A 3J7LA 3CJIB 5T55A 1HB3A 2EXKA 1JUHA 3H7JA 4XBLA 5C3SA 1ZRFA 4UF0B 2OUHA 4E2QA 1STMA 3AZWA 4E8CA 5FV3A 4XJWA 1VRH2 3LB9A 5CA6A 2YXSA 4BHPA 1W6PB 1GV9A 2PMWB 4MGIE 4CEYC 4MLOA 3ZYHA 2JE7A 1UMIA 2VL4A 4XZUG 1DP0A 1FOD1 1HXS1 1OFNA 4H55A 1F4AA 3AKQA 2CDPA 3ZIWA 3MI8A 1W9FA 1CJPA 3VHRA 4CDQA 4CCMA 5IYYA 5I91A 2WSUA 4I30A 2R30A 3O1RA 5BYNA 4K6BA 1ZBE1 1AL22 5J96B 2JDYA 3BU7A 4XFFA 5DZGA 1QOSA 1SFPA 2D3SA 4QT6A 1UKRA 2HWC3 4BK4A 4EN0A 4Z1VA 1UZVA 3WP4A 5KR7A 2BVVA 1C28A 2G9ZA 2HBUA 3JUUA 3PTYA 4IGOA 5FZBA 4XHBA 4D6QA 4UW6A 4CEWC 3W5MA 3ENRA 3ZFFB 3OGGA 3OPZA 5CISA 3M2MA 4FPJA 1REEA 2RMU2 2FZ1A 2XBO2 5A3OA 4YW6A 5FYHA 5JSOA 1MS3A 1YFXA 4PT6A 1RGSA 4AGRA 3AP7A 3TN92 1MPXA 2ZX3A 3E5UA 1WW4A 1FMD2 4AOCA 4NJ4A 5FY9A 1F4HA 1OD5A 2J1TA 3GDBA 3OEAA 4S2DA 5FIXA 3VBRC 1JZ2A 1J59A 4TLGA 3OGVA 2ZX4A 1GICA 2XONA 4UFHA 4AL9A 1V6KA 4UW3A 1POV0 3N7JA 5ERLA 2QDRA 1UXXX 2I2SA 1W0OA 4I0AA 4Y24A 2RS52 1SDWA 1J1LA 5CIRA 1PX4A 1WWYA 1CR7A 3MW4A 4KBBA 5EJ1B 3DKQA 1GKBA 4XUPA 2FDIA 1C57A 4JKLA 3PL0A 5FZ4A 2HEWF 4BK5A 4COYA 4C1WA 1AYN3 1UY3A 2UURA 3ILNA 4MGQA 3NMBA 2J22A 1MQTC 4QU2A 3NWKA 5K9YA 3OPTA 2HWF3 3POYA 2QBXA 3ON7A 5IT6A 2D7FA 5C7GA 3FHIB 1YWKA 4D7TA 1EV11 5C4WC 4Y22A 1ZZ8A 2QZ2A 4BU2A 3HD8B 1GQGA 1NCQA 3I3EA 5D8AA 5ACA3 1X33A 1DFQA 4YARA 4YZ2A 5CFDA 4P9JA 4AQTA 4XDQA 3VBUA 4D69A 2VQAA 3AYCA 4XBQA 5JDBA 3NAPB 4QX8A 1YO8A 4MZUA 1WGPA 5T52A 5IFPA 2YPDA 5CKQA 5J3UA 1BK0A 4OHXA 1W6MA 2XDVA 5FZKA 1LOFA 3MF6A 5DZEA 4KGGA 2QCSB 3WQ1A 1K42A 5FBJA 4YW3A 4Q26A 1CPNA 3EXUA 2ZHNA 3VHOA 2R0FA 5B4XA 2Y34A 3OY8A 1H9PA 5FZIA 4KG8A 3QH6A 3B7MA 1RUD1 4FQZA 4HPKA 1N1SA 2ZAAA 1FXZA 2CNAA 3C8XA 5LBFA 1H8VA 4JAAA 1CESA 1UOFA 4CDXB 4Q1PA 3VKLA 4PF1A 4DUVA 2B46X 1SQ4A 1RUI3 2PELA 4M3CA 4LQRA 2ZGOA 5T54A 4GWIA 2FBEA 5EP9A 3KV4A 1S0JA 2D6PA 4CE8A 2ZHMA 2PXJA 2R1BA 3WF4A 3ACHA 3WT3A 4AK3A 1G86A 1UIJA 1GLHA 2BNMA 4JGYB 1V70A 1OXCA 2VD7A 3ASIA 2XKOA 2FCTA 1DQ5A 3ZXGA 3D6EA 4CP0A 4CDQC 1W03A 4AVAA 1ASJ2 1WLCA 5L19A 2A73B 1CD3G 4I3PA 4YRDA 2PHRA 1F9KA 4IETA 1XSQA 3OEBA 1H8TB 4H3WA 5FLIA 4XFHA 4Y4YA 5L9RA 3WOGA 4LUMA 1CWPA 3MBWA 3RZGA 1C8NA 2J1RA 3RYKA 3KB5A 1HRV1 1W9WA 2HWE3 2VOVA 3WZ1A 3PUQA 1JUIA 4DXTA 2WO1A 3B93A 5A33B 4LNVA 4AR2A 1QQP1 4AEMA 4YFZA 5JXHA 5ABJA 1LB2A 3IIIA 1U0AA 1C5IA 2VZPA 4MGKE 1ZX5A 5GLUA 5KHIA 1NOVA 3CLPA 3U11A 3VB9A 2ZABA 2JDZA 1JYWA 2XB6C 5CZKA 5AC91 1XNCA 5A7OA 3T4VA 2PAMA 1UY4A 4R8HA 4KG0A 4QX7A 5FY0A 5JSRA 1XC6A 4SLIA 1N3PA 3VDDA 4DEVA 2RR11 3AJZA 1RUE1 4NPRA 2W2IA 1QJU1 1XE8A 4Q0SA 3AKRA 3ST7A 2XLFA 4LBLA 3M3QA 1PVC3 1ULDA 1HB1A 2JG8B 4Z2AA 1V9U2 4OUMA 4CEWB 3JBG3 3C7FA 5JXGA
chains in the Genus database with same CATH topology
5A6ZA 5A6XA 4AOCA 2JDYA 5HCHA 1OVPA 5A6QA 2VUCA 2BP6A 2WR9A 2XR4A 3DCQA 1W8HA 2WRAA 1UZVA 5A6YA 2JDUA 1OURA 1OUSA 1UQXA 1W8FA 5A70A 2JDNA 2JDMA 2JDHA 3ZDVA 4CE8A 1GZTA 2BOJA 2BV4A 2VUDA 1OVSA 2BOIA 2JDKA 2VNVA 5A3OA 1OUXA 2JDPA 1OXCA 4UT5A 5D2AA 2CHHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A6Z A;  5A6X A;  4AOC A;  2JDY A;  5HCH A;  1OVP A;  5A6Q A;  2VUC A;  2BP6 A;  2WR9 A;  2XR4 A;  3DCQ A;  1W8H A;  2WRA A;  1UZV A;  5A6Y A;  2JDU A;  1OUR A;  1OUS A;  1UQX A;  1W8F A;  5A70 A;  2JDN A;  2JDM A;  2JDH A;  3ZDV A;  4CE8 A;  1GZT A;  2BOJ A;  2BV4 A;  2VUD A;  1OVS A;  2BOI A;  2JDK A;  2VNV A;  5A3O A;  1OUX A;  2JDP A;  1OXC A;  4UT5 A;  5D2A A;  2CHH A; 
#chains in the Genus database with same CATH topology
 5DAV A;  3T0A A;  1AR6 1;  3NRU A;  2HWB 3;  5FUN A;  5FZ0 A;  3U37 A;  3IB3 A;  1SLI A;  3VD3 A;  4U2A A;  2ZEW A;  3KM5 A;  4QPW A;  1Z78 A;  4A3X A;  4EWD A;  1O4Z A;  3JD7 1;  3JQX A;  4RQP B;  2OW4 A;  3D3A A;  1K12 A;  2VNG A;  5D8A C;  3RQ0 A;  2OPW A;  3M3O A;  3NQH A;  4CCD A;  3P3P A;  4NE9 A;  3VBR B;  3RDI A;  4BQ5 A;  2VQ0 A;  1UOB A;  4QQP A;  4W6W A;  3R6S A;  3LD8 A;  2NN8 A;  3SNM A;  1JYX A;  1G9D A;  2J7M A;  3FMG A;  3WP5 A;  4A4A A;  4CP1 A;  4HK8 A;  4IEW A;  1X82 A;  3I2I A;  1W8T A;  2D40 A;  1UPS A;  1ND3 B;  1LOF C;  1S0E A;  3HMY A;  4QAW A;  2GH8 A;  4YG3 A;  1XQN A;  4HVR A;  2WIN B;  1PX3 A;  3LA2 A;  1DGW X;  1TQ5 A;  4TXW A;  2G19 A;  3DCQ A;  4OHZ A;  2GND A;  2V5Y A;  5DPN A;  5GZD A;  1VBD 2;  1V6O A;  3PU3 A;  4Q4W 2;  4RD7 A;  4AVB A;  3I3B A;  1S2B A;  4N9I A;  1HRI 3;  2D3R A;  5JAX A;  1QOO A;  3AFK A;  4HFS A;  2KXL A;  3KV5 A;  3IKW A;  1MZF A;  1EYB A;  2ZEX A;  2D6M A;  2GNB A;  1W8Z A;  2NMO A;  1WCK A;  2LRP A;  4XDP A;  4I2O A;  3S5A A;  3MGU A;  2BRT A;  2H0V A;  3UJQ A;  1JOB A;  2E9Q A;  3OGJ A;  2C1F A;  5JLV A;  2HWC 2;  2H6B A;  2YDE A;  1OUX A;  4UW5 A;  4LOS A;  3HPN A;  2HYK A;  2ZEZ A;  4CTE A;  3ZYI B;  3D8C A;  3VHN A;  1PIV 1;  3B5L B;  5CFC A;  3O1M A;  1AR8 2;  2DBN A;  2JG9 B;  1SZB A;  2B5H A;  2RMU 1;  4IV3 C;  4IGQ A;  4NVP A;  3POI A;  4QX3 A;  3TRS B;  3QAC A;  3Q8E A;  1TME 3;  3RI9 A;  4GB3 2;  3ZR6 A;  2RDQ A;  4A3Z A;  4YSF A;  3ZVX A;  3KV6 A;  4NR1 A;  3BTA A;  5F2S A;  3TN9 1;  4AFD A;  4GXL A;  1RXF A;  1R09 3;  2RJL A;  5FR3 A;  5LW9 A;  3PVO A;  4RGA A;  4IDZ A;  2EIC A;  1NCR C;  1AXK A;  3A0K A;  5G04 L;  5I0T A;  4LJH A;  4JHZ A;  1F15 A;  4YM3 A;  1XB9 A;  4COW A;  1JBC A;  3W58 A;  3WY6 A;  1SAC A;  4UFM A;  5LAT A;  1D4M 2;  2W1W A;  4AHX A;  4A7Y A;  2A6Z A;  5JOZ A;  3GBG A;  1W39 A;  3Q9O A;  3TEZ A;  2RDN A;  1RMU 1;  1ZRC A;  3H9A A;  3NNL A;  1UMZ A;  3AMM A;  4NHM A;  4XUR A;  3I3M A;  3SKV A;  1SBD A;  1AYN 2;  4CUG A;  4QDS A;  5C70 A;  5C33 A;  2DCJ A;  2HLE A;  4FAH A;  1R64 A;  1EY2 A;  1R1A 2;  1VBA 1;  1ZRR A;  2JB4 A;  4FP3 A;  4QPG B;  4LKF A;  4RR3 B;  1WW5 A;  1FYU A;  5FBZ A;  4UFK A;  3VUO A;  2WFF 2;  4UXA A;  2HKX A;  4XTM A;  4HVQ A;  4P9X A;  2QQP A;  3PVN A;  5J37 A;  5CB7 A;  1W04 A;  2EAL A;  4ZU5 A;  4HN0 A;  3TEX A;  4V2W A;  4DB5 A;  2P1B A;  5CAZ A;  5J48 A;  4OHW A;  3WW3 A;  1GUI A;  3MIE A;  1RUG 3;  5DAX A;  2VTX A;  4OFG A;  3GYD A;  2V4V A;  3FFQ A;  4LA2 A;  3S7I A;  5HV4 A;  2ORZ A;  5A3U A;  2XUE A;  3I59 B;  3WCS A;  2FDK A;  1SPP A;  4B4Q A;  2A3Y A;  4YGC A;  5FZC A;  2ARX A;  2Q8O A;  3EBR A;  3HQR A;  3CJI A;  3IIA A;  4QHB A;  5J7M A;  3TWI A;  4RHV 3;  4UF0 A;  3J7H A;  5FY8 A;  3POJ A;  4OI2 A;  3WF3 A;  1O7F A;  1YC6 1;  4H7L A;  1OFS A;  1BCX A;  1RUI 2;  2D5H A;  4YW7 A;  1EPZ A;  4FFI A;  3V64 A;  4CP2 A;  4N9H A;  4JQR A;  1W6P A;  5FZ3 A;  4FPH A;  4ARY A;  5FZ6 A;  3I97 A;  1F5F A;  2BW8 A;  2JJ6 A;  2VXJ A;  1U5Z A;  4GMP 0;  4BMB A;  4EZH A;  2Y38 A;  4YLZ A;  3O14 A;  1OKQ A;  4MG2 A;  1YCI A;  3AKS A;  4FFF A;  1XNA A;  3W9A A;  1LHV A;  1UY0 A;  2ZA9 A;  4N53 B;  1RUF 3;  5AVP A;  3OCP A;  3WF0 A;  5KHJ A;  4TZD A;  1MEC 2;  5E89 A;  1RUC 3;  5J98 B;  1WMX A;  4B8E A;  4K1Z A;  4NMI A;  4Y5T A;  5FXX A;  3AMP A;  5FUI A;  3I2K A;  1JYT A;  4O9E A;  3OF1 A;  4AQS A;  4BA6 A;  1ASJ 1;  1LOG A;  2EAK A;  3MZH A;  4XQD A;  4XF3 A;  4DZG A;  5HV0 A;  1NAE A;  1DQ0 A;  1SLA A;  1WMD A;  1R08 2;  1G6N A;  5FWJ A;  5C9A B;  1G9C A;  4LEJ A;  1JZ3 A;  2EXI A;  3VZO A;  2IWG B;  2D5F A;  1JHJ A;  1TVG A;  1QNY A;  3K3N A;  5LAS A;  5FPU A;  1UO9 A;  4L0P A;  1G8W A;  3M70 A;  4BIF A;  4CU9 A;  3HBZ A;  3KT7 A;  2ES3 A;  3ZFF A;  4QU1 A;  2D6L X;  4QWN A;  2HWE 2;  2GC3 A;  4Y1U A;  5CKM A;  4FTB A;  1WA6 X;  4XET A;  5HXV A;  3GHM A;  3MUY 1;  2ZPX A;  1US3 A;  4C8D A;  1BLZ A;  2WRA A;  2YRO A;  1MS1 A;  2IZW A;  1CIW A;  4FCA A;  1VIW B;  4UYB A;  3NNJ A;  3THC A;  3ACG A;  2K9Z A;  4GWN A;  4D0Q A;  1VBB 1;  3DXT A;  4LBK A;  2WWS A;  4CCC A;  2QVS B;  1OSG A;  1W8W A;  1GNH A;  4BLI A;  3KHC A;  1ZA7 A;  3MPP G;  4ZXK A;  5B2G B;  1PZ7 A;  5BY5 A;  1GP5 A;  1DG6 A;  2GAU A;  3DN7 A;  4W6X A;  4E4S A;  3HR9 A;  2WJS A;  5F6K A;  4MUV A;  4XJ8 A;  5FYI A;  4TTG A;  2ADD A;  1LHO A;  2P3K A;  1XYN A;  2PYT A;  1N1V A;  1VRH 3;  2V4A A;  3H42 B;  1VJ2 A;  4I01 A;  4AI3 A;  5FCC A;  1NT0 A;  5E8A A;  4YG6 A;  4IL7 A;  2ZGU A;  2XGX A;  4BJ0 A;  4BM8 A;  1C8M 1;  5LBB A;  4BWO A;  4E2G A;  2BBV A;  5C6C A;  2E6V A;  3URF A;  1AXZ A;  4Q1R A;  2WS9 1;  3L2H A;  4Q29 A;  4LXL A;  1REF A;  1S0I A;  3NNM A;  5LA0 A;  2JDH A;  3RYR A;  1PNG A;  4FFH A;  4EZ4 A;  3JB8 A;  2VMC A;  4FQ4 A;  1N3O A;  1BHG A;  3FHQ A;  2ZGR A;  3I2F A;  1AL2 3;  4LUK A;  4W4Z A;  5FY7 A;  1RL3 A;  2WZR 2;  2DUO A;  1O3R A;  3LDK A;  4AG4 A;  1QJY 3;  1H6X A;  2WA4 A;  1W8O A;  1JOP A;  3MO4 A;  2ARC A;  3NAP A;  1V0A A;  3HQX A;  3T2T A;  1NCR B;  1DLC A;  5A3L A;  3E97 A;  3IDE A;  5C8W A;  4LBO A;  4L99 A;  2Q30 A;  3B94 A;  1D0H A;  4TLF A;  4E2S A;  5D21 A;  2XVG A;  1NYW A;  2UY9 A;  1K5M B;  3KCX A;  4WVW A;  4ES8 A;  5A80 A;  2YB7 A;  4HVO A;  4CSW A;  1NQD A;  4UFJ A;  5JI7 A;  3SMH A;  3WW2 A;  2XG3 A;  4LK7 A;  2VY0 A;  1LAJ A;  2QJV A;  2D6O X;  3E1F 1;  4OHV A;  4LHK A;  1AF9 A;  2R04 2;  4CDX A;  3HOB A;  4E4D X;  4M4R A;  4X8P A;  1E5R A;  4IES A;  3CJI C;  1OQE A;  4UT5 A;  4JKM A;  1HRI 2;  4QQ2 A;  1KJR A;  3FUQ A;  5CVR A;  1MVQ A;  3MYX A;  3AYD A;  1HJF A;  4Q4Y 2;  2C9K A;  1YEW A;  3R4S A;  2BNN A;  2W1U A;  5FPZ A;  5BNQ A;  1BEV 2;  4JGY A;  2ZGL A;  2O8O A;  1W9Y A;  3B9I A;  4CCN A;  1YFY A;  3ECQ A;  2K2S A;  4B7K A;  4DY3 A;  2O0O A;  1AHS A;  2EAA A;  4HKL A;  3DYM A;  3CDZ B;  2W5F A;  3N9P A;  4A2U A;  1OMI A;  4R9B A;  3J4U H;  3Q8F A;  2PHD A;  5FYB A;  3AP5 A;  1YQ6 A;  2IXK A;  1VAL A;  2LM3 A;  1J58 A;  2J1V A;  1H8T A;  5FMO L;  3PTR B;  3ZYF A;  3M3C A;  3NKT A;  1W6O B;  3I54 A;  4IEY A;  4KI5 M;  1UAI A;  4QXB A;  1JU3 A;  4HSL A;  1CPM A;  5F9T A;  3LPG A;  5A6Z A;  2VVE A;  1VBC 3;  1CAX B;  5A33 A;  4ES9 A;  3RMY A;  2A1X A;  2VUL A;  1PGW 1;  3ETQ A;  3ZFF C;  1COV 2;  1PO2 3;  2QQV A;  4LHS A;  2QE3 A;  1XND A;  5FZG A;  3UGF A;  4IEX A;  4RGK A;  1O59 A;  4V1P A;  1UY2 A;  1WZX A;  4BIS A;  3ZYJ B;  5FYM A;  2YBP A;  3HVD A;  1F5J A;  4EN9 B;  4HXC A;  2DUR A;  2FCU A;  4XIK A;  1GZW B;  4BQX A;  2VMH A;  4OZO A;  1AYN 1;  4C0B A;  3FLR A;  3NJX A;  2VZ1 A;  4NRQ A;  1WUV A;  2HWF 1;  1OKO A;  1C1L A;  1AL0 G;  4LO4 B;  3AZV A;  3OUI A;  2VQT A;  3UNP A;  5CG9 A;  2QUO A;  5KHG A;  3H1M A;  1AUY A;  1YFW A;  2WO2 A;  2ZML A;  3POE A;  3VD4 A;  1Q8P A;  2VH9 A;  5ACA 1;  2X09 A;  1AXY A;  1PO1 2;  2VW1 A;  2ZKN A;  3AC0 A;  4KWU A;  4LUL A;  5F5A A;  2VMG A;  2JG8 A;  2OYZ A;  3TYJ A;  1RUH 2;  3PMS A;  4NWW A;  1GQP A;  4Q4X 3;  4CEW A;  5C3P A;  5C8C B;  5EIY B;  1RXG A;  2XJP A;  4M4P A;  4NHY A;  1PM4 A;  2ORX A;  3H3L A;  3LQC A;  5JI9 A;  1CJD A;  2VZS A;  2ZGK A;  2CL2 A;  4LLF A;  3CMG A;  2ZGM A;  5LWB A;  4BOW A;  4DNY A;  1P8J A;  5FPX A;  1BYH A;  3KSC A;  3AP4 A;  4J1X A;  4RQP A;  1GQH A;  2UWC A;  2JD9 A;  1UU5 A;  1LTE A;  1L7R A;  2C24 A;  2W47 A;  2RS1 2;  3ES1 A;  1OH4 A;  4IW3 A;  2P6C A;  2B8M A;  4BQ4 A;  3VBR A;  4CPB D;  1IQD C;  5A3N A;  4CXX A;  4XUN A;  4IXL A;  3ZXA C;  3NAP C;  1FAY A;  4QQL A;  2DUQ A;  2AAC A;  4NAO A;  1OA4 A;  2WQ4 A;  2UYA A;  4YVW A;  1DYK A;  1MZE A;  1ND3 A;  4GMP 3;  2A6W A;  4EJR A;  3VBH B;  2XJT A;  3ILF A;  4Z8B A;  1SCS A;  4Z07 A;  1ULP A;  5C3Q A;  4FPF A;  1SFY A;  4XC9 A;  3VDB A;  5C5U A;  2VEC A;  5GZC A;  4BQW A;  4RYD A;  3VL8 A;  3MFA A;  4P5Y A;  4YVW B;  3B69 A;  4XTP A;  1RUF 2;  2ENR A;  3G7D A;  1MQT A;  1UD1 A;  2DUP A;  4QPI B;  1A78 A;  1RUC 2;  4LIV A;  4UW4 A;  1G9A A;  1DGR A;  1BBT 2;  2R06 2;  2OVU A;  4XFI A;  2PHF A;  4GZ9 A;  2PQQ A;  3USS A;  4IV1 C;  4CDX C;  3Q8B A;  3E6C C;  4UFL A;  4HMZ A;  2XJU A;  3NNF A;  4AED B;  4AE2 A;  3AJY A;  2QTW B;  3P1I A;  2BTV C;  4LPL A;  1H2N A;  1MZ5 A;  2Y64 A;  3AZZ A;  2VZU A;  4Q8L A;  1BK1 A;  2XHK A;  4R4Z A;  4K7J A;  2DU0 A;  1JN2 P;  1RUJ 2;  1I3H A;  1V9U 3;  2Y6G A;  5FZ8 A;  3OJB A;  2JG9 A;  2N7G A;  3ZSK A;  2BV4 A;  5A3W A;  3GZT B;  1VBE 2;  3ELN A;  3I3D A;  5EXO A;  1QF3 A;  3DKW A;  1U5I A;  2C4X A;  4P9W A;  1KGY A;  2QQK A;  3RPQ A;  2GU9 A;  3WSO A;  5JMC A;  5DAW A;  2ZMK A;  3USU B;  5FKC A;  1LU1 A;  2H6C A;  2NLR A;  4P14 A;  1Y9Q A;  1JZ8 A;  1S0F A;  2LTN A;  4JRL A;  3FX3 A;  4XJU A;  3OYW B;  4HBN A;  3FFZ A;  5DUX A;  2GSY A;  2NYY A;  4GH4 B;  4HAN A;  2WQ8 A;  4CCL A;  5IK4 A;  4EN8 B;  4GKX A;  2PHU A;  2YC0 A;  4PJY A;  1OUR A;  2RS3 2;  4PQ9 A;  4R52 A;  3OSD A;  2XUM A;  4UAP A;  3ZXD A;  3ZX7 A;  3ACF A;  2ARA A;  4PIZ A;  4QKB A;  5FYV A;  3IBM A;  3X29 B;  3IDB B;  3CKH A;  1OLR A;  4JRA A;  2YPJ A;  2VUD A;  1PVC 1;  1MS5 A;  2R1D A;  5FAX A;  2XPJ A;  5A7Q A;  3OD4 A;  2GDF A;  3MIG A;  1XBF A;  3GGL A;  3JBG 1;  2Q4S A;  1VBD 3;  3POS A;  4Q4W 3;  2QQO A;  2HWB 1;  3NV3 A;  4QPG A;  4W6Y A;  4RR3 A;  4LR4 A;  4AHZ A;  1CX1 A;  2ZHK A;  1QJZ A;  1C3H A;  4K8F A;  2CAU A;  1AYM 2;  4OUS A;  1NA1 B;  3ZPO A;  1QJY 2;  4KNC A;  2ID4 A;  1OPM A;  5A70 A;  5BNO B;  2MHF A;  3LGR A;  1HN1 A;  3AKP A;  3NST A;  5FZ1 A;  2JG8 C;  3J7M A;  3ZYR A;  4AVV A;  4OYU A;  1QJF A;  3S0M A;  3EYP A;  4RFR B;  4N90 A;  3C7O A;  2A3W A;  1AR8 3;  2FDF A;  5EWS A;  2AC1 A;  4AVT A;  4JDO A;  2ZOE B;  3KQR A;  1F8V A;  4GB3 3;  5J1X A;  5FYS A;  4HK9 A;  4HON A;  4I0B A;  1TE1 B;  3I59 A;  3ZFE C;  4QQH A;  4AI9 A;  3W21 A;  3WQB A;  3RZZ A;  4RQP C;  2DF7 A;  1SBF A;  3RS6 A;  5CU1 A;  2B4K A;  3B3Q E;  3LIG A;  1H1A A;  5IK5 A;  1JZ4 A;  4JTN A;  1WW7 A;  3WG3 A;  3K51 A;  3KCC A;  1CVN A;  4Y1Y A;  4ZKT B;  2P2K A;  4N8M A;  2OZJ A;  4MHU A;  5FO7 B;  1D4M 3;  1G9B A;  2RVA A;  4YVW C;  5BV6 A;  1ND3 C;  4D6S A;  4N53 A;  1BMV 2;  4JC1 A;  1ND2 B;  2V09 A;  4A7K A;  4QMA A;  3GCX A;  2Q1M A;  5KHK A;  3C7E A;  2VCB A;  4QXH A;  5K0U C;  3FZ3 A;  1GMM A;  3ZO0 B;  4I0W B;  5LEJ A;  3JQW A;  1DIW A;  2Y6K A;  1ZVF A;  3S5Q A;  1D2S A;  1R1A 3;  1TME 1;  3ITQ A;  2TNF A;  4UBH A;  1ZZ7 A;  4Y1V A;  4XMI A;  2VME A;  1DHK B;  2WFF 3;  4X8N A;  3N7K A;  2HWD 2;  1XE7 A;  3N9Q A;  4K21 A;  1R09 1;  2A5Z A;  2JDN A;  4BH9 A;  1W90 A;  3U4S A;  2E51 A;  5IVE A;  3OG2 A;  2YY1 A;  4XHX A;  1SLL A;  1VBC 2;  2JEM A;  2WUH A;  1DGW A;  1VRB A;  1KS4 A;  2VNV A;  3O1S A;  1YFU A;  2JG9 C;  1PO2 2;  1T6G C;  4XQW A;  5EPA A;  4P9Y A;  1NUK A;  1TMF 2;  2WZ8 A;  1KRI A;  1GWK A;  5HCF A;  4FOW A;  1W2A X;  5IVB A;  4MGS A;  2CYF A;  1KQR A;  1Q43 A;  1W6Q B;  3BVC A;  4IGP A;  4S2H A;  3LZZ A;  5HCH A;  3FL7 A;  5E88 A;  1VMH A;  4P00 B;  4NID A;  3MLL A;  3MDP A;  4LOT A;  2HYX A;  2BYV E;  1ULG A;  2DU1 A;  3J9S A;  5GZF A;  3PHM A;  3WVJ A;  1OUS A;  3CU7 A;  3OOX A;  2G9G A;  4IV1 B;  2GME A;  4LHN A;  1UQX A;  2AH2 A;  1XRU A;  5FMO S;  2X53 S;  5FXW A;  1UWW A;  3WNO A;  4XUO A;  5T5L A;  4CZS A;  3K46 A;  2BEO A;  1AR7 3;  2VVD A;  1PHM A;  3HWJ A;  4GJZ A;  5FMD A;  5L7O C;  4LKD A;  4CU6 A;  3QBQ A;  5FKB A;  3VV1 A;  2WC2 A;  3S30 A;  4OI4 A;  4CDU C;  4XCA A;  3A4U A;  3OTF A;  3CIH A;  1N1Y A;  3O1T A;  1S2E A;  4Q4X 2;  1FT9 A;  1MEC 3;  4FT8 A;  4IV3 A;  1B35 B;  1J84 A;  1GOF A;  4U36 A;  4GD4 A;  4EWE A;  4IER A;  3AYA A;  1RUG 1;  3NV4 A;  4QB6 A;  5A3T A;  3CL1 A;  4MV2 A;  4AZZ A;  4QPG C;  2JIG A;  4M3C F;  1Z0H A;  1R08 3;  4RR3 C;  4KU8 A;  5L73 A;  3PUH A;  5SV8 A;  5LY1 A;  1LGB A;  1IPS A;  1FX5 A;  3VD9 A;  3EHK A;  4GWM A;  2NP0 A;  3NJV A;  5LEK A;  1SEF A;  1ZA4 A;  4ONU A;  1RJ8 A;  1S0D A;  1NCR A;  5D1I A;  3ZKU A;  2BGO A;  4RHV 1;  2WYF A;  4IEZ A;  2W08 A;  1NY7 1;  1FNZ A;  1HB2 A;  5E16 A;  1RUN A;  1LEM A;  5H9R A;  1UNB A;  4BQ1 A;  3NO8 A;  3UL2 A;  1K5M A;  1LOE A;  1O4Y A;  4LO7 A;  4QX1 A;  3TEY A;  3FLP A;  4WVM B;  4OQ9 A;  4FOY A;  1OH3 A;  5CG8 A;  5FZO B;  5K4L A;  5KC5 A;  2AZ5 A;  1WLT A;  1NXM A;  1PMH X;  3VBS B;  1ALY A;  1LGN A;  1UW8 A;  2KR2 A;  4GWJ A;  3J8F 2;  3O1V A;  3PUA A;  2IFW A;  4FTS A;  3GZE A;  1NZI A;  3THT A;  4EN6 B;  5GAL A;  2RDR A;  5DUV A;  5FJH A;  2JKB A;  3LF7 A;  5KC6 A;  2WT1 A;  1J1T A;  2VXR A;  1JZ6 A;  2NZ9 A;  4MX3 A;  2Q8C A;  1Z7S 2;  3MUZ 1;  1IS4 A;  4QGL A;  1UZW A;  2VTX J;  3AP6 A;  3FN9 A;  3HQU A;  4NUB A;  4XFC A;  2YYO A;  1XOY A;  4AQ2 A;  4COZ A;  1O3S A;  3KVA A;  1EAH 2;  1MS9 A;  4NO4 A;  4OVE A;  2QQM A;  3AMH A;  5DAP A;  4N53 C;  4XW3 A;  2B9U A;  5FDB A;  1LUL A;  1YUD A;  1OOP C;  5FMC A;  2VPV A;  3ZSJ A;  1GNZ A;  3EO6 A;  4D94 A;  3TNP B;  4AEJ A;  1I6X A;  1W2T A;  1CN1 A;  1ZRI A;  2X5I B;  4DO0 A;  2EXJ A;  1KS5 A;  3ZFE B;  3LSE A;  2WZR 3;  3I2H A;  3E6B A;  2JX9 A;  1W6O A;  5C9A C;  5GLZ A;  3CO2 A;  5DXD A;  1QJX 2;  1ULF A;  4MH0 E;  3D4K A;  1IS5 A;  4H7M A;  2LUW A;  4XJA A;  2Y6L A;  1UYY A;  3IM0 A;  4NAM A;  1CON A;  4MGZ E;  1CAX A;  2ZZJ A;  1VP6 A;  1YQ5 A;  4XIL A;  1UPI A;  5IFT A;  1ULO A;  4AFM A;  3WP6 A;  2EF6 A;  1VRH 1;  2V5D A;  1JZ5 A;  3WNX A;  4KMQ A;  2CY6 A;  3KV9 A;  2XHN A;  2FMY A;  4C91 A;  3D5O A;  1UMH A;  3BGA A;  1GZW A;  4P9I A;  4A42 A;  1OPO A;  2DVA A;  3HIF A;  5K0U B;  1HQL A;  5K8S A;  2R04 3;  4ASL A;  4MOA A;  4PLM A;  3L9J T;  5LBE A;  3IPV A;  5DQ0 A;  3I8T A;  1UYZ A;  1W99 A;  4HN1 A;  4B29 A;  4KWK A;  4ZZ5 A;  1AL2 1;  1YQ8 A;  2RJ2 A;  2W9X A;  3FWE A;  4CUC A;  5JVV A;  1DBN A;  2YMZ A;  5IAT A;  3MFC A;  4Q4Y 3;  4BXS V;  5IAX A;  3GAL A;  1QJY 1;  4YYO A;  4ZU7 A;  2Y26 A;  1XYO A;  1VMF A;  1BEV 3;  4HKO A;  5AFE A;  2WLQ A;  5C8C A;  2DCT A;  3NV1 A;  3O12 A;  1LOB A;  2ZS6 B;  1AR9 2;  1E57 A;  4BPZ A;  1F31 A;  5LB6 A;  3WW4 A;  2YUE A;  1WBL A;  1DLL A;  2ET1 A;  2WAO A;  2YFZ A;  2C0Z A;  2XBO 1;  2Q0A A;  1S1A A;  4NRM A;  1CZV A;  4PHZ A;  1KEX A;  2GC2 A;  2PHT A;  4R4X A;  3KD4 A;  1QKQ A;  3ZMN A;  2ERF A;  2K0G A;  2CWM A;  3AXD A;  1RHI 3;  3OUJ A;  3TBD A;  1PGL 2;  1KD7 A;  3VZM A;  4AVC A;  4UBG A;  4COU A;  1FMD 1;  2Z2S B;  4Q0V A;  5CEH A;  5HPO A;  4Y1Z A;  2P3Y A;  3WHU A;  1RC6 A;  4O65 A;  1K5J A;  3FE5 A;  4URT A;  1POV 3;  2WL1 A;  3DYP A;  1COV 3;  3WF1 A;  3VBH A;  2WT2 A;  3PME A;  5L7O B;  2RV9 A;  1VLN A;  2RS5 1;  2D44 A;  3ORJ A;  5JZG C;  3FUO A;  2O1Q A;  1K5M C;  4CDU B;  1ZZC A;  5T5P A;  1EV1 3;  2FQP A;  1LOD A;  2ZGN A;  3ACI A;  5T5J A;  1W06 A;  2XVK A;  5FQ0 B;  2ZGT A;  3VD5 A;  2F17 A;  2NPI A;  3N36 A;  1BXH A;  2PHL A;  4ET7 A;  1IKP A;  2ET7 A;  1RB8 G;  5DDJ 3;  4AED A;  1ZM1 A;  2SBA A;  2Q1Z B;  4LBQ D;  5F32 A;  3H1W A;  5LRS A;  5FZ9 A;  2P17 A;  1PO1 3;  4AFB A;  2DFB A;  2MEV 2;  2VNR A;  3T0B A;  1RUH 3;  2ZJC A;  4LIT A;  5D2A A;  3RGB A;  2XOM A;  3WR0 A;  4YM1 A;  3HNB M;  5EZW A;  1WME A;  4XDO A;  1W2U A;  5A6Q A;  1PO2 1;  1JYC A;  4L92 A;  3RWK X;  1ZRD A;  3UK9 A;  2VZV A;  4AW7 A;  2VW2 A;  4I02 A;  1O5U A;  3U14 A;  5JOW A;  3I49 A;  4K8R B;  3C3V A;  3R4U A;  4ZXE A;  2AEY A;  3APB A;  1GP6 A;  5F2W A;  3LSD A;  3USU A;  2WNV C;  5I8T A;  2PLV 2;  5CBL A;  3DPR C;  5JUV A;  3I2O A;  1FV3 A;  1DDL A;  5H9P A;  3OYW A;  2DCK A;  2E31 A;  2RS1 3;  5APA A;  2WKK A;  3WG2 A;  2SLI A;  5IW0 A;  4QB2 A;  2Z69 A;  2DVB A;  1RVF 2;  2PAK A;  3I2D A;  4XEZ A;  1L7Q A;  1O3Q A;  4BB3 A;  4P9L A;  1N47 A;  3B01 A;  1VB4 A;  1AX2 A;  4AGV A;  5FY4 A;  4FSJ A;  1SCR A;  2RM2 2;  3KLS A;  1AR7 2;  5GLV A;  4CUA A;  2ARE A;  4HSJ A;  3LWC A;  2C9A A;  4NN0 A;  4PF5 A;  2VUC A;  3SH4 A;  2RG4 A;  2R07 2;  5A1L A;  3ZSM A;  3TAY A;  3WDT A;  2VNO A;  4FFG A;  4J25 A;  4D8M A;  4RGG A;  3C2U A;  1OI6 A;  1OOP B;  1BBT 3;  3WP3 A;  2R06 3;  2R16 A;  2VCA A;  5DUU A;  1I1E A;  4NIG A;  1G9F A;  3MV1 1;  4XE9 A;  5IUQ A;  3B02 A;  4ATE A;  1LEN A;  1J3P A;  1W3V A;  1FPN 3;  1XE0 A;  3V0B B;  1NA1 A;  3AMQ A;  5E6H A;  2AEN A;  4O9G A;  5IVY A;  4WBB A;  4Y20 B;  3QH7 A;  4JV4 A;  4S2G A;  2PQS A;  1IPJ A;  5BNO A;  4XXA A;  1IG3 A;  1T2X A;  4Y4R A;  1GOG A;  4BME A;  2Y0I A;  2WYS A;  4CP9 B;  1GWM A;  1RUJ 3;  4XBN A;  1JYV A;  3N4M A;  3AP9 A;  3ZPY A;  5C8C C;  4Y33 A;  4B4P A;  1NE6 A;  1DQ2 A;  3BTY A;  3OPW A;  4K40 A;  3BB6 A;  1ZBA 3;  1I9R A;  1PVX A;  3O5S A;  4GMP 1;  4AXO A;  1VBE 3;  2YFU A;  2YZ4 A;  1L7L A;  3OBR A;  2VBP A;  1QDC A;  4NHK A;  5GZG A;  1RUE 3;  2NM1 A;  5FZF A;  2VCM A;  4PQQ A;  3T3Y A;  2Q1F A;  5I93 A;  4ISR A;  1CGP A;  1OLM E;  1UU4 A;  1XNB A;  4AI1 A;  4DUX A;  3NKG A;  3VD7 A;  1JYN A;  1CAV B;  2GZW A;  2KA3 A;  4PBO A;  1QH6 A;  1Q56 A;  2QQI A;  4XQ4 A;  1DYP A;  3VGI A;  3ABZ A;  1ZZ9 A;  2CTV A;  4QDR A;  2VBB A;  3T4H B;  2UU8 A;  3CBN A;  1LKN A;  2WNE A;  2RS3 3;  2WWU A;  2VZ3 A;  3ZOI A;  3AZX A;  3O0X A;  2BFU L;  3VBH C;  3LA3 A;  3U10 A;  4AVS A;  1Q8O A;  2GH2 A;  4QXK A;  1ND2 A;  4OQ8 A;  1JXN A;  1UF2 C;  2ADE A;  1W2N A;  2JDA A;  4K1Y A;  1JZ7 A;  2JDU A;  3JD7 3;  1V9U 1;  1C4R A;  2CWS A;  3ALQ A;  3QCW A;  1VE0 A;  1Y9G A;  2OQ6 A;  3LEI A;  3PDQ A;  4QPI C;  3A21 A;  5LA9 A;  1N1T A;  2DBI A;  4DRR A;  3LDR A;  1H4H A;  3E5X A;  1SFN A;  1JS9 A;  3GCW A;  4ZS2 A;  5GZE A;  4PI2 A;  5A3P A;  5EFU A;  3T09 A;  3WUC A;  3H8R A;  3SC7 X;  1H2K A;  3PU8 A;  3TB0 A;  4AED C;  2D6N A;  1AYM 3;  5CAD A;  3LEM A;  2CGN A;  4MHR A;  1LCL A;  2BGP A;  3WG1 A;  2P4E A;  1NXD 1;  2VCC A;  3ZFG B;  4BE3 A;  4NOT A;  2X05 A;  1BQP A;  3AVR A;  3ROU A;  5AVA A;  4DUW A;  2XR4 A;  2ZEY A;  4F8A A;  3M1H A;  1QMJ A;  2J1E A;  1WKY A;  1VAV A;  2JXA A;  4QKN A;  2HH9 A;  3ZN5 A;  3M7A A;  4ZZ8 A;  2XJS A;  5JZG B;  3BU0 A;  2HEV F;  1CZS A;  4LLO A;  4QPY A;  3GHN A;  4J6G A;  3R05 A;  1ZBE 2;  1CZT A;  3SH3 A;  3VBO B;  4GJY A;  4E27 A;  1SDD B;  2O14 A;  4XAC A;  5FY1 A;  5CKN A;  3AB0 A;  1VBD 1;  4Q4W 1;  5JR2 A;  4IV1 A;  2XXZ A;  1IHM A;  5GLT A;  3P6B A;  5IJR A;  3I4I A;  4GH4 C;  1KDM A;  5LA1 A;  1RTV A;  2WDB A;  3CHX A;  4WM8 B;  4E4Z A;  1WLD A;  3KQ4 B;  4OUL A;  1EP0 A;  4QD2 A;  2P6H A;  3NV2 A;  3S57 A;  2VBD A;  3NJZ A;  5EJZ B;  2DCY A;  4P5H A;  2DDU A;  2HWC 1;  4IE4 A;  5F5I A;  3ZLI A;  5KWR A;  4YGB A;  3LFI A;  4LT5 A;  3MEP A;  1OF3 A;  2XQR A;  4QM9 A;  3RZJ A;  5FP4 A;  2WA3 A;  1B35 A;  4DRV A;  1OC1 A;  3GNE A;  3AFG A;  1AR8 1;  1QHD A;  3LFM A;  1O8P A;  4XXP A;  3THP A;  4EQV A;  4LK6 A;  5DAQ A;  4GB3 1;  2BOI A;  3DV8 A;  1A6C A;  4QGM A;  1C5H A;  1QEX A;  2ZZQ A;  3IAQ A;  4XJ9 A;  5LCW L;  2LAL A;  3HNY M;  2WNV B;  3VDD B;  3BUC A;  1HN0 A;  1XJA A;  4HET A;  4WZF A;  4XJZ A;  3DPR B;  1RHI 2;  2HWD 3;  1NA1 C;  3WW1 A;  1IQA A;  1HDK A;  1KIT A;  2RHP A;  3OB8 A;  5DN2 A;  2PHX A;  5FO9 B;  3PVB B;  5BNO C;  5DG1 A;  3M3E A;  5AFB A;  1HW5 A;  1N3Q A;  3P5B A;  3T0D A;  2WR9 A;  1S2K A;  1SG3 A;  3DGT A;  3VBF B;  2L9L A;  1PZ9 A;  1XYP A;  4CXY A;  1NKG A;  2W95 A;  1TMF 3;  4DS0 A;  4WVM A;  3ZSL A;  3H8U A;  1D4M 1;  1NX9 A;  3CQO A;  1PMJ X;  3UJO A;  4EV0 A;  5FZO A;  3JB4 C;  3IT8 A;  1C1F A;  5FZM A;  3AL5 A;  4Y1X A;  1VBA 3;  4WVZ A;  5JCT A;  2A6X A;  3VBS A;  2D98 A;  2GAL A;  2LS6 A;  4QX5 A;  1EV1 2;  4CXW A;  2XLG A;  4FVV A;  4LIU A;  1GZC A;  4ARX A;  2BQP A;  2JE8 A;  4RA0 A;  2B9V A;  2EA7 A;  3M3I A;  1R1A 1;  2PFW A;  1W0P A;  1GSL A;  4DPN A;  1L3J A;  4KQ7 A;  2WFP A;  5DDJ 2;  3MID A;  4Q0U A;  1QOT A;  4LO5 B;  5GJ6 A;  4NHX A;  4KBZ A;  2WFF 1;  3AKT A;  1W8H A;  2WZP P;  3ZXF A;  3WXP A;  1TNF A;  1HV1 A;  2ZMN A;  3KMH A;  4AI2 A;  3MIH A;  1W9S A;  2V73 A;  1K3I A;  1ND2 C;  3PIJ A;  5FXZ A;  2I07 B;  5FPV A;  4CPB A;  2C6S A;  1GAN A;  5H9Q A;  4QM8 A;  4IEU A;  1AZD A;  1RUD 2;  3LCP A;  4P08 A;  4YNI A;  3NW4 A;  2JE9 A;  1MAC A;  3WNK A;  3ZFE A;  1Y3T A;  3ZKY A;  4MO3 M;  4K3U A;  1KFU L;  3OBT A;  3SQO A;  1GFF 2;  4BCU A;  1AJK A;  4IEQ A;  1LR5 A;  2G9F A;  4MSV A;  1GZ9 A;  5T3N A;  2B39 A;  4QQO A;  4M3C E;  5EHD A;  3LDB A;  3BOD A;  4JGZ C;  4WM7 B;  1J3R A;  1BVV A;  3BCW A;  4K20 A;  4Y5Z 0;  4CUB A;  4Q4V 3;  4YG0 A;  1SBE A;  1RUI 1;  5FOB B;  5ANQ A;  3K2O A;  4PDW B;  4O7X A;  4UFI A;  1AR7 1;  1K45 A;  2DVF A;  3VZL A;  5M0T A;  3RMX A;  3M4F A;  3WLU A;  2UYB A;  1UKG A;  4LBQ B;  4OZX A;  2W52 A;  5JOY A;  5FLJ A;  3O7O A;  5K0U A;  1VB2 A;  1O4T A;  3THD A;  1W28 A;  3WNN A;  1CX4 A;  1ENQ A;  1Q3E A;  1MEC 1;  2ZGS A;  3J8F 3;  5I0S A;  5A7W B;  2F6B A;  3DEC A;  3HT1 A;  4RL7 A;  1E5I A;  1DGL A;  4FPE A;  3UT0 A;  1JOD A;  5A6X A;  3E6D A;  4OCT A;  1Z7S 3;  1HRV 2;  1R08 1;  2VW0 A;  3UGG A;  5I8S A;  1FPN 2;  5A3M A;  3H7Y A;  1H2L A;  1Q8V A;  1QQP 2;  2W0X A;  2ZHL A;  5A6Y A;  5FP8 A;  1EAH 3;  2RDS A;  2YU2 A;  4E9K A;  1Y4W A;  2ILM A;  4N43 C;  3U1X A;  5C5T A;  1W6N B;  2WAB A;  1ZZ6 A;  3AYE A;  1OF4 A;  4FTE A;  2WSV A;  2HWE 1;  4NPL A;  1W05 A;  1WMF A;  4Q0Q A;  1GZT A;  1Y7B A;  5FZH A;  5IWF A;  5DUW A;  4CYD A;  3VKN A;  2J1U A;  1B35 C;  3W59 A;  5AC9 2;  4ZS3 A;  2FZ2 A;  1EPW A;  1ZBA 2;  4L8Q A;  1SLT A;  2WBK A;  4B3N A;  3SLI A;  3RYP A;  2X8K A;  4Q5O A;  5DMY A;  2WAA A;  2CGO A;  2RR1 2;  3NNG A;  4WZC A;  1RUE 2;  2JB8 A;  1QJX 3;  5LY2 A;  1PK6 C;  1QJU 2;  4GUL A;  2JEC A;  4JCK A;  4EN7 B;  3HEI A;  1US2 A;  3DL3 A;  1V00 A;  3VZJ A;  2DVG A;  4M01 A;  1I5Z A;  4HKW A;  1PM7 A;  3IMN A;  1VAK A;  4IE5 A;  4QX2 A;  5L7O A;  5LK5 A;  5IK8 A;  4YZ3 A;  5KXE A;  5FY5 A;  2TEP A;  3VHP A;  3BOP A;  4HZF A;  3UET A;  5JXJ A;  3WV6 A;  5LZ6 A;  4CDU A;  2QQL A;  3K75 B;  2PN5 A;  1D2Q A;  3R0R A;  5FP3 A;  5FQ0 A;  3WNL A;  5T5O A;  1LHU A;  4X6Q B;  1RED A;  2VU9 A;  3JD7 2;  3VBS C;  5IHR A;  1X50 A;  1CAU B;  1GYK A;  4LBM A;  4XYX A;  2CGP A;  1IS6 A;  2W91 A;  1LOC A;  3MIF A;  4AGG A;  4QHZ A;  1H30 A;  1NZC A;  3EMR A;  2I74 A;  1OD3 A;  2WZR 1;  4EWA A;  3ME2 A;  1HX6 A;  2XJV A;  3IZO A;  4AAP A;  1OQ1 A;  4QX0 A;  1QDO A;  5EYY A;  4CDW C;  3VZK A;  4X6R B;  1OA2 A;  4NIH A;  1HQW A;  4YVS B;  2JDM A;  3D0S A;  1AR9 3;  4JDM A;  4MXW B;  1QWR A;  4XF4 A;  3BIW E;  5BNN C;  3K4D A;  1LJ7 A;  1UOG A;  3I3Q A;  4UWD A;  3OD0 A;  1PGS A;  2G4I A;  5BXX A;  5FFO C;  2BFU S;  1S0G A;  2IXJ A;  2YG0 A;  4IE7 A;  1X8M A;  5HCA A;  1RUO A;  2XJR A;  2JKX A;  3O0V A;  1V6L A;  2X5I C;  4RN5 A;  5BNP B;  1UXZ A;  4ERO A;  2VO5 A;  1LEC A;  5FZ7 A;  2VMI A;  2OS2 A;  1NLQ A;  4M0N A;  3ES4 A;  3POF A;  2ZX1 A;  3PIG A;  2BP6 A;  2PTM A;  1J3Q A;  2R04 1;  5F7U A;  3DEM A;  1SLB A;  1IS3 A;  2WQZ C;  1HRI 1;  1NE4 A;  2VOK A;  3EB7 A;  4KWJ A;  1YQ2 A;  2MPF A;  3DXU A;  2W68 A;  2A75 A;  1OBN A;  1PIV 2;  1IPK A;  1GWL A;  4Q4Y 1;  1LNS A;  2OZ6 A;  4LE3 A;  1H1I A;  1W8U A;  3H8O A;  3ATG A;  5HI0 A;  4NIA A;  4E8D A;  2WNU B;  5HBA A;  1HJG A;  1BEV 1;  3LEG A;  1H4G A;  3WHT A;  4Y3O A;  2EVX A;  1DZQ A;  2QFE A;  4B4R A;  5A1F A;  3VL9 A;  3HAG A;  4COV A;  2IVJ A;  1OOP A;  2OXB A;  2R49 A;  2Z79 A;  5ANN A;  5FO8 B;  1UX6 A;  3A7Q A;  2A71 A;  4XFB A;  2VC9 A;  3AL6 A;  3T08 A;  5F3I A;  2GNM A;  2IVI B;  5G05 L;  3V0B A;  5C9A A;  2E33 A;  4Y20 A;  1F35 A;  2TUN A;  2IUW A;  1RHI 1;  2W39 A;  3N9M A;  4BDV B;  1DZR A;  2BWC A;  4F3J A;  2E63 A;  3RZL A;  5DAB A;  3T30 A;  4CP9 A;  4DEQ A;  4F83 A;  2MEV 3;  3VKM A;  5FYZ A;  4JGZ B;  2IXL A;  3H3Z A;  2VQU A;  2GP5 A;  5IVV A;  4BZ4 A;  1RMU 2;  2Y6H A;  4IEP A;  3I7D A;  1POV 1;  2Y6J A;  4C90 A;  1COV 1;  1BJQ A;  1QY4 A;  2A3X A;  1W9T A;  2EIE A;  4RS5 C;  2AR6 A;  1LES A;  2BPA 2;  5FWE A;  2BBA A;  2VMD A;  1LOA A;  2ZAC A;  1LU2 A;  1VBA 2;  3I2J A;  3F2Z A;  2PLV 3;  3RVH A;  3WQ7 A;  1HIX A;  4OI1 A;  3LE0 A;  2XH6 A;  5F1R A;  3WQ0 A;  1KDK A;  2VM9 A;  1CAV A;  4JHT A;  4TN7 A;  1RVF 3;  4N7U A;  2E53 A;  3WIN E;  4ITC A;  2RJK A;  2R7E B;  2DTW A;  4FXG B;  1YNA A;  5F5Q A;  1JI6 A;  3IAP A;  2R32 A;  5DDJ 1;  4LO8 A;  1ONA A;  1DF0 A;  2GN3 A;  2RM2 3;  5GKA C;  5JR7 B;  3UGH A;  2DFC A;  3BIE A;  1IGO A;  3AZY A;  1UYX A;  2KD7 A;  1WCU A;  2LW8 A;  1PO1 1;  1S0C A;  1X9T A;  2QZ3 A;  2YHJ A;  3CEW A;  2R07 3;  2MNG A;  3N9O A;  4KH9 A;  4N43 B;  1RUH 1;  3ZSE A;  1WD4 A;  1YJK A;  1ULE A;  3WEZ A;  5A32 B;  1F2N A;  2A7A A;  3N9L A;  5FYC A;  2ZCW A;  3SH5 A;  4FPY A;  4OLL A;  1BKZ A;  5F6L B;  5IVF A;  2X10 A;  4CRQ A;  3BTX A;  4I3G A;  2F4P A;  4AAX A;  1QNW A;  4AFA A;  3MIB A;  2ZGP A;  2EIG A;  1YQC A;  4PLO A;  4EYU A;  4RSU A;  4JVA A;  2VUA A;  1ZYB A;  5EQU A;  1PK6 B;  2OT7 A;  5FP7 A;  2V72 A;  2RS1 1;  3ZFG A;  5HXM A;  2OUJ A;  5FYU A;  3TOJ A;  1T6B X;  3LOI A;  4GQ7 A;  1JW6 A;  1UZZ A;  3DUI A;  3HJR A;  1BVP 1;  3UES A;  4E4H A;  2JIJ A;  2ETE A;  5FZE A;  2VOW A;  4Q4V 2;  5FZD A;  3ZDS A;  2YC2 A;  3OBZ A;  2XQX A;  4UOJ A;  4YW4 A;  3VN4 A;  5L9V A;  5JZG A;  4AEK A;  3H0O A;  3H1Y A;  4JKK A;  1EUT A;  3J7N A;  4RFT 0;  2XML A;  4XF1 A;  3WDU A;  1OQD A;  4LKS A;  3VBO A;  5I0D A;  1S4C A;  4DQA A;  4ZY9 A;  3POB A;  1RUF 1;  5F5C A;  5L9B A;  4AHW A;  4XUT A;  2NMN A;  1RUC 1;  4XPV A;  1AVB A;  4XOG A;  3CNA A;  3SIT A;  3WX5 A;  1BBT 1;  2R06 1;  1UYP A;  4FBF A;  1NQJ A;  4WM8 A;  2BZD A;  5A1A A;  3MIC A;  1D4V B;  1UOJ A;  4YZ4 A;  2VMF A;  4BQ2 A;  3AVS A;  1FPN 1;  1XU2 A;  2BOJ A;  3FJS A;  1M06 G;  4EE2 A;  4W50 A;  4CDW B;  3U07 A;  1VMJ A;  2HBT A;  4CEY B;  4HLT A;  1Q5O A;  1RUJ 1;  3K3O A;  4IUG A;  2IXH A;  1RIN A;  4HG6 B;  4YGE A;  5BNN B;  2IXI A;  2X29 A;  1VBB 2;  5J36 A;  4BXF A;  2G1M A;  1KFX L;  3INA A;  4BQY A;  1QH7 A;  5JOX A;  1GBG A;  2XJQ A;  1ZBA 1;  5EV7 A;  1VBE 1;  3WCR A;  3R4D B;  2WNV A;  3CZU A;  3MW3 A;  4LO6 B;  1YLL A;  1W3X A;  3DPR A;  4QXC A;  1ENR A;  1DU3 D;  4MET A;  1QXJ A;  2H0B A;  3V0A B;  1XNK A;  1TZO A;  4LE4 A;  2BER A;  3KCY A;  4LBN A;  2Q8D A;  4FPO B;  1FOD 3;  1C8M 2;  1ENS A;  1HXS 3;  1W2O A;  3H3U A;  3VBF A;  1AX1 A;  3SXW A;  1QU0 A;  5IVJ A;  1U12 A;  2RS3 1;  2WS9 2;  3ACL A;  4DXS A;  5A7S A;  2ZTN A;  2I45 A;  2W1S A;  3SCH A;  4OHY A;  3OBA A;  4GIQ A;  3SKJ E;  1UIK A;  1YJL A;  4PIY A;  3IDA A;  1ZBE 3;  1UY1 A;  4DOU A;  4Q2F A;  2LRO A;  1KXG A;  2VOX A;  5BPX A;  4DMI A;  1ST8 A;  2A70 A;  4LOR A;  3P3N A;  1OA3 A;  2CV6 A;  3H8X A;  2D93 A;  4IQP A;  2FD8 A;  1NCQ C;  5DG2 A;  5IVC A;  5CFD C;  5C3O A;  3WF2 A;  1WBF A;  4WV8 A;  2Q5T A;  1CAW B;  2XWB B;  5EJ3 A;  3VBU C;  4IND A;  3WNM A;  3ZN6 B;  4AFC A;  2D6K A;  4XUQ A;  1AYM 1;  5FJK A;  3K4Z A;  1VPH A;  5F39 A;  3MW2 A;  2UWA A;  4YPJ A;  4LHL A;  5TSW A;  4D3W A;  4Z82 A;  4FOQ A;  4IEO A;  2BVB A;  3BYW A;  3KS7 A;  1NG0 A;  2UY8 A;  3O0W A;  1NLS A;  3HNM A;  3SCF A;  2CHH A;  4XF9 A;  4NWV A;  1O6U A;  1ZNP A;  2J1A A;  3GZU C;  2E7T A;  4MGY E;  2NQY A;  3ZXJ A;  1LED A;  3GM8 A;  3K4A A;  4TWT A;  3KVB A;  4UI9 L;  4OI0 A;  3WG4 A;  4RS5 B;  4CU8 A;  4DXZ A;  2FDG A;  1MQT B;  2KM2 A;  3O1O A;  2J1S A;  3M8L A;  1JH5 A;  1LHW A;  2GC1 A;  1AJO A;  5C4W B;  3KF3 A;  3KZ4 C;  4MYE A;  4PI0 A;  4WM7 A;  3UV9 A;  2QDN A;  1MZ6 A;  5JPM B;  1X9P A;  3ZFG C;  4B1L A;  3JZV A;  1HLC A;  2P3I A;  4PDW A;  3RRD A;  4XFG A;  5B4N A;  1VAM A;  2P34 A;  4YW2 A;  5I0R A;  1O8S A;  3I2G A;  1UZY A;  2PAE A;  2A6Y A;  2BNO A;  4LBQ A;  2BWA A;  4FPK A;  1GNY A;  5C71 A;  3VKO A;  2IFR A;  3QD6 A;  5JMO A;  1BMV 1;  3W5N A;  2ZXQ A;  4XAA A;  1IG0 A;  4JDN A;  3UKN A;  3VBO C;  4QPI A;  2GMM A;  3MLJ A;  1OHF A;  5A7W A;  5LRR A;  2WZE A;  4BYY A;  1DQ4 A;  5LK7 B;  1MS0 A;  3GJA A;  5FZL A;  1MR5 A;  4F7Z A;  2XWJ B;  2GC0 A;  1A8D A;  5GLW A;  2W92 A;  4WM8 C;  3EQE A;  2XL7 A;  4A41 A;  4Y5S A;  4DFS A;  3Q8A A;  4JTO A;  1PGW 2;  1BZW A;  3KT4 A;  2HWD 1;  4L2N A;  3LOB A;  4FAG A;  1W6N A;  3FBM A;  3HN3 A;  5FOJ B;  5KBF A;  5ABJ C;  5A7N A;  5SV5 A;  1OLQ A;  1LRH A;  1VBC 1;  5I0U A;  1XXN A;  3PJY A;  1RUD 3;  2J42 A;  4FPC A;  1GP4 A;  2HJI A;  3IDC B;  4GKY A;  1TMF 1;  3RZH A;  5FPA A;  3RI8 A;  1ACC A;  1V6I A;  4CDQ B;  1GU3 A;  2HWF 2;  3CF6 E;  4P02 B;  5F3G A;  3WDX A;  3VDD C;  3V56 A;  3ZDV A;  2CAV A;  1DQ1 A;  2C5D A;  4QGN A;  1XNT A;  3VLB B;  1PMI A;  4NRP A;  1WLW A;  4PIX A;  4LA3 A;  1TEI A;  1G7Y A;  2CDO A;  2F4L A;  2JD4 A;  2OQ7 A;  1URX A;  2IXC A;  3ILR A;  2WN3 A;  3LEK A;  4GH4 A;  5FPL A;  3WNP A;  2Y33 A;  5ACA 2;  1ZRE A;  2PHW A;  2DWR A;  2ZX0 A;  4L9B A;  2BGC A;  2YU1 A;  2DTY A;  3VBF C;  3BPZ A;  3A0N A;  4XVH A;  3T1L A;  3WDY A;  5FPB A;  4G3Y C;  3RFR A;  2VTF A;  4TYS A;  1IOA A;  1X36 A;  5KXB A;  2VOT A;  4AI0 A;  5F37 A;  1H9W A;  1QGL A;  3UKT A;  4FPL A;  5BUV A;  1YXW A;  1XPW A;  4Q4X 1;  3ZXE A;  1CAU A;  2K46 A;  1UCX A;  4HOO A;  5HCB A;  4DXR A;  3RWN A;  2C26 A;  2E7Q A;  3NJY A;  1XU1 A;  2WLP A;  2P37 A;  3ZYB A;  2AUY A;  1HRV 3;  4LTA A;  1NLR A;  3LAG A;  4GAL A;  1CIY A;  1JTZ X;  4KL1 A;  1WW6 A;  2BUK A;  1QQP 3;  4YVS A;  3ZXK A;  4MXW A;  4Z92 B;  3KT1 A;  2GP3 A;  3S6P A;  3ZIX A;  2W1Q A;  2WO7 A;  2BU9 A;  4BQ3 A;  4URA A;  1A3K A;  3D82 A;  4FXK B;  5IK7 A;  4Q4V 1;  3GBW A;  4YW1 A;  2FCV A;  2ZBJ A;  2YC4 A;  3LA7 A;  1X7N A;  3GF6 A;  3VDA A;  3MV0 1;  5AC9 3;  4A45 A;  3JXS A;  1PZ8 A;  1Q8S A;  2JIC A;  1GOH A;  2AGS A;  4Q0P A;  1DQ6 A;  1W8F A;  4CA9 A;  1WA4 A;  5BNP A;  3MLK A;  3PLQ A;  2RR1 3;  1X8E A;  4TSV A;  3GXU A;  1QJU 3;  4KU7 A;  1SLC A;  3ETP A;  4P9G A;  3J8F 1;  4Y22 B;  3T1M A;  3C7G A;  3MHZ A;  4WM7 C;  1NCQ B;  4JQT A;  5D8A B;  1O91 A;  3LPF A;  4MVT A;  5H9S A;  3OGR A;  3EJK A;  2FDJ A;  5CFD B;  2OX0 A;  4YM2 A;  3T2P A;  1QXR A;  3KHB A;  3U0Z A;  2JEN A;  5FRE A;  1Z7S 1;  3VBU B;  1I5P A;  3BI3 A;  2VZO A;  3DF0 A;  3PUR A;  4PDW C;  3T2Q A;  4OMC A;  3IWZ A;  2WNU A;  3RZM A;  1AR6 3;  5FZA A;  2BDR A;  4GAZ A;  3KWV A;  5CFC C;  3MF9 A;  4A6O A;  1EAH 1;  3UKV A;  1W6M B;  1MVE A;  1YYN A;  4WVV A;  3OGS A;  2Z42 A;  2CSG A;  1VR3 A;  3AMN A;  1D0G A;  1QJE A;  4D7Y A;  5FUP A;  1TNR A;  4K9S A;  4Q27 A;  4NII A;  1POQ A;  3OY8 B;  1D7P M;  1EUU A;  1ODM A;  2D97 A;  2B42 B;  5LBC A;  2D3P A;  2P3J A;  2TBV A;  4FI9 A;  4HPK B;  1ZZB A;  3ZYG A;  4OMD A;  5JSP A;  2JDP A;  4QHO A;  5CYY A;  3RG0 A;  1QJX 1;  1HKD A;  2QQN A;  2R0H A;  3SIS A;  3PVE A;  1FV2 A;  4M3C B;  2Z4F A;  3VZN A;  4FPG A;  2OPK A;  4JGZ A;  4J1W A;  1LGC A;  4D6R A;  1YIF A;  1B09 A;  5C3R A;  4GA9 A;  4ZHN A;  1Y43 B;  2XKP A;  2EIB A;  1FOD 2;  1WD3 A;  1HXS 2;  2EID A;  1PVC 2;  2E26 A;  2YBS A;  4MXV A;  4QB1 A;  5FYT A;  4ATF A;  1M4W A;  4YZ1 A;  3RNS A;  2VJX A;  2VE1 A;  1V6N A;  2VUJ A;  3JBG 2;  1KJL A;  1RYY A;  3BOW A;  1WCD J;  3K77 A;  2YBK A;  2OKX A;  1H2M A;  3POW A;  2HWB 2;  4IV3 B;  1V6J A;  1W6Q A;  4KGQ A;  4BLJ A;  1YI9 A;  2QQJ A;  4A7Z A;  4JZR A;  5I8Y A;  2JDK A;  1DYO A;  1MS4 A;  2YV8 A;  3DYO A;  3IN9 A;  4G4F A;  3FC0 A;  3FHA A;  4QKF A;  2O8Q A;  5T50 A;  4DY5 A;  2QQW A;  4R9C A;  3A23 A;  3WDV A;  2QKD A;  4MAD A;  4B1M A;  2W46 A;  5JWP A;  4O61 A;  4PCR A;  2HEY F;  5FRA A;  1PIV 3;  3KF5 A;  3POG A;  4W8J A;  3N3H A;  1E5H A;  1JHN A;  1AX0 A;  2Y8K A;  3CJX A;  4AWD A;  2RMU 3;  2XBO 3;  4N43 A;  1HB4 A;  1O3T A;  5ABJ B;  5A32 A;  5EYX A;  1LHN A;  1JU4 A;  1AR9 1;  3HBK A;  4IEV A;  3G6J B;  4OUE A;  3C7H A;  4R9D A;  3VKF C;  3U75 A;  3LIH A;  3TN9 3;  3V65 A;  2ZKL A;  5L36 A;  2OA2 A;  3BPS A;  4A6S A;  1ULC A;  1FMD 3;  4BIO A;  2FHR A;  3AXE A;  2A6V A;  5FMB A;  4C1X A;  1UL9 A;  2VZQ A;  4S2F A;  3FLT A;  1PK6 A;  3PJQ A;  4DIQ A;  1RIR A;  5FXV A;  4Q8K A;  3K48 A;  1JMU B;  3BN6 A;  1PGL 1;  4N7I A;  2RS5 3;  3L2Y A;  3T2O A;  1RJ7 A;  3SEP A;  4YVS C;  2P5B A;  4M0H A;  2YGL A;  4DIN B;  2XLA A;  2ZX2 A;  3BAL A;  1YHF A;  4ORF A;  1DCS A;  1RMU 3;  1YI7 A;  2WT0 A;  1E5S A;  4W65 A;  1ENX A;  1FNY A;  2VZT A;  4NHL A;  2FDH A;  3MPB A;  1S0B A;  4IE0 A;  4ZON A;  3GJB A;  3ZR5 A;  4YWA A;  4XIO A;  4V2V A;  5F3C A;  2Y6F A;  3F95 A;  2AEZ A;  4HL0 A;  2ATF A;  2PA7 A;  1Y9M A;  2D43 A;  3PUS A;  2E7A A;  3S7E A;  1TME 2;  1W0N A;  1UN1 A;  1UU6 A;  5BNP C;  2BJS A;  5JIA A;  5JPN B;  4XMA A;  4LMF A;  4ZU4 A;  3IMM A;  3AX4 A;  3RZK A;  4I09 A;  5ISL A;  1U5Y A;  3ZN4 A;  3AM2 A;  3NL1 A;  1FAT A;  5FLH A;  3ZYP A;  3O1P A;  1Q8Q A;  2QNK A;  5J09 A;  3NVC A;  3CZJ A;  3BKZ A;  2WII B;  1IZ3 A;  1R09 2;  1WCS A;  3QLQ A;  4QKD A;  2VR4 A;  1OT5 A;  3TEW A;  2ZGQ A;  3SEE A;  5F3E A;  2YGM A;  4ASK A;  4CDW A;  4YGD A;  4CEY A;  2GNT A;  4IE6 A;  4NPM A;  2WWJ A;  4CCK A;  2WNU C;  2MEV 1;  3GBF A;  4CCJ A;  5BNN A;  5FP9 A;  2E32 A;  1HV0 A;  2VG9 A;  3HN1 A;  4M00 A;  4SBV A;  1IKQ A;  1UZ0 A;  2AYH A;  3N35 A;  3WDW A;  1QIQ A;  4AI8 A;  3TNQ A;  2RE9 A;  4AHY A;  4D7S A;  3N9N A;  1APN A;  2X5I A;  1FI2 A;  5FYY A;  4CCO A;  1CQ9 A;  3AK0 A;  4XCB A;  3V0A A;  2OII A;  3IPV B;  3ZM8 A;  3VDC A;  4C0H A;  2PLV 1;  4MGT A;  4FO9 A;  2B45 X;  3LKJ A;  2DVD A;  1XSR A;  1OVP A;  1RVF 1;  4PBP A;  4XAE A;  2B7Y A;  1JOJ A;  1WCQ A;  4HT1 T;  2DV9 A;  5FK8 A;  4XZP A;  3UYJ A;  2XVL A;  1GR3 A;  3FBY A;  4QDQ A;  5GM0 A;  4AF9 A;  2RM2 1;  1J83 A;  3WUD A;  3OUH A;  2ARB A;  4FOV A;  3WD5 A;  2XL9 A;  4KWL A;  1ASJ 3;  3QOP A;  2DYC A;  3GZA A;  5CFC B;  1RUG 2;  2R07 1;  3B00 A;  4H14 A;  1JYI A;  1H1M A;  2FMD A;  4NRO A;  3U4X A;  5JIU A;  3ZXL A;  3RSJ A;  4L97 A;  2GN7 A;  2JWP A;  4LKE A;  3D0J A;  4XF0 A;  2Z5W A;  4Y26 A;  4AQ6 A;  5LA2 A;  3A22 A;  3KGZ A;  1CAW A;  1H0B A;  3ZN6 A;  4RHV 2;  2R6Q A;  2Q8E A;  1NY7 2;  3JCI A;  1QXP A;  2EXH A;  4CU7 A;  2ZAH A;  4CVU A;  2WN2 A;  3E5Q A;  4YFW A;  4YW5 A;  5IAV A;  4Z2W A;  1S55 A;  4A44 A;  4YM0 A;  2W87 A;  3PNA A;  1VBB 3;  3SCG A;  1A34 A;  4R9A A;  5KXC A;  4G9S B;  4PLN A;  1TG7 A;  3O1U A;  1OVS A;  4RS5 A;  3H50 A;  5E1R A;  1MS8 A;  3W20 A;  3ZMO A;  3SHR A;  3RJR A;  4YZ5 A;  2QQU A;  5CNA A;  2DCZ A;  1H6Y A;  5C4W A;  5FTT C;  1OLM A;  3N7M A;  3B9C A;  4B7E A;  1O5L A;  1W8N A;  2WNO A;  1PNF A;  5DZF A;  4AYU A;  1HQN A;  1A8M A;  1U5X A;  1YIP A;  4XFA A;  1YRZ A;  2GMP A;  4ASM B;  1SHW B;  2CU5 A;  1V6M A;  3BTZ A;  1C8M 3;  2VZR A;  1R1Z A;  2UWB A;  2VVF A;  4ZPI A;  4FP2 A;  3JU9 A;  4JGY C;  1RIT A;  4L11 A;  2WS9 3;  2VAU A;  4ISQ A;  4H2A A;  4JX0 A;  3RJ2 X;  2Y0O A;  2IC1 A;  3N7L A;  2W94 A;  1AR6 2;  1SMV A;  5FK7 A;  3U78 A;  3Q8C A;  1ODN A;  4CCE A;  5KXD A;  5KHH A;  4XAB A;  2W3J A;  3J26 N;  2Y60 A;  4LBJ A;  5F8P A;  5JXI A;  3KGL A;  5K7P A;  1H8T C;  3PUI A;  5A7P A;  1DGR N;  2WO3 A;  3HT2 A;  1SPP B;  2VGD A;  1DZT A;  1UX7 A;  3J7L A;  3CJI B;  5T55 A;  1HB3 A;  2EXK A;  1JUH A;  3H7J A;  4XBL A;  5C3S A;  1ZRF A;  4UF0 B;  2OUH A;  4E2Q A;  1STM A;  3AZW A;  4E8C A;  5FV3 A;  4XJW A;  1VRH 2;  3LB9 A;  5CA6 A;  2YXS A;  4BHP A;  1W6P B;  1GV9 A;  2PMW B;  4MGI E;  4CEY C;  4MLO A;  3ZYH A;  2JE7 A;  1UMI A;  2VL4 A;  4XZU G;  1DP0 A;  1FOD 1;  1HXS 1;  1OFN A;  4H55 A;  1F4A A;  3AKQ A;  2CDP A;  3ZIW A;  3MI8 A;  1W9F A;  1CJP A;  3VHR A;  4CDQ A;  4CCM A;  5IYY A;  5I91 A;  2WSU A;  4I30 A;  2R30 A;  3O1R A;  5BYN A;  4K6B A;  1ZBE 1;  1AL2 2;  5J96 B;  2JDY A;  3BU7 A;  4XFF A;  5DZG A;  1QOS A;  1SFP A;  2D3S A;  4QT6 A;  1UKR A;  2HWC 3;  4BK4 A;  4EN0 A;  4Z1V A;  1UZV A;  3WP4 A;  5KR7 A;  2BVV A;  1C28 A;  2G9Z A;  2HBU A;  3JUU A;  3PTY A;  4IGO A;  5FZB A;  4XHB A;  4D6Q A;  4UW6 A;  4CEW C;  3W5M A;  3ENR A;  3ZFF B;  3OGG A;  3OPZ A;  5CIS A;  3M2M A;  4FPJ A;  1REE A;  2RMU 2;  2FZ1 A;  2XBO 2;  5A3O A;  4YW6 A;  5FYH A;  5JSO A;  1MS3 A;  1YFX A;  4PT6 A;  1RGS A;  4AGR A;  3AP7 A;  3TN9 2;  1MPX A;  2ZX3 A;  3E5U A;  1WW4 A;  1FMD 2;  4AOC A;  4NJ4 A;  5FY9 A;  1F4H A;  1OD5 A;  2J1T A;  3GDB A;  3OEA A;  4S2D A;  5FIX A;  3VBR C;  1JZ2 A;  1J59 A;  4TLG A;  3OGV A;  2ZX4 A;  1GIC A;  2XON A;  4UFH A;  4AL9 A;  1V6K A;  4UW3 A;  1POV 0;  3N7J A;  5ERL A;  2QDR A;  1UXX X;  2I2S A;  1W0O A;  4I0A A;  4Y24 A;  2RS5 2;  1SDW A;  1J1L A;  5CIR A;  1PX4 A;  1WWY A;  1CR7 A;  3MW4 A;  4KBB A;  5EJ1 B;  3DKQ A;  1GKB A;  4XUP A;  2FDI A;  1C57 A;  4JKL A;  3PL0 A;  5FZ4 A;  2HEW F;  4BK5 A;  4COY A;  4C1W A;  1AYN 3;  1UY3 A;  2UUR A;  3ILN A;  4MGQ A;  3NMB A;  2J22 A;  1MQT C;  4QU2 A;  3NWK A;  5K9Y A;  3OPT A;  2HWF 3;  3POY A;  2QBX A;  3ON7 A;  5IT6 A;  2D7F A;  5C7G A;  3FHI B;  1YWK A;  4D7T A;  1EV1 1;  5C4W C;  4Y22 A;  1ZZ8 A;  2QZ2 A;  4BU2 A;  3HD8 B;  1GQG A;  1NCQ A;  3I3E A;  5D8A A;  5ACA 3;  1X33 A;  1DFQ A;  4YAR A;  4YZ2 A;  5CFD A;  4P9J A;  4AQT A;  4XDQ A;  3VBU A;  4D69 A;  2VQA A;  3AYC A;  4XBQ A;  5JDB A;  3NAP B;  4QX8 A;  1YO8 A;  4MZU A;  1WGP A;  5T52 A;  5IFP A;  2YPD A;  5CKQ A;  5J3U A;  1BK0 A;  4OHX A;  1W6M A;  2XDV A;  5FZK A;  1LOF A;  3MF6 A;  5DZE A;  4KGG A;  2QCS B;  3WQ1 A;  1K42 A;  5FBJ A;  4YW3 A;  4Q26 A;  1CPN A;  3EXU A;  2ZHN A;  3VHO A;  2R0F A;  5B4X A;  2Y34 A;  3OY8 A;  1H9P A;  5FZI A;  4KG8 A;  3QH6 A;  3B7M A;  1RUD 1;  4FQZ A;  4HPK A;  1N1S A;  2ZAA A;  1FXZ A;  2CNA A;  3C8X A;  5LBF A;  1H8V A;  4JAA A;  1CES A;  1UOF A;  4CDX B;  4Q1P A;  3VKL A;  4PF1 A;  4DUV A;  2B46 X;  1SQ4 A;  1RUI 3;  2PEL A;  4M3C A;  4LQR A;  2ZGO A;  5T54 A;  4GWI A;  2FBE A;  5EP9 A;  3KV4 A;  1S0J A;  2D6P A;  4CE8 A;  2ZHM A;  2PXJ A;  2R1B A;  3WF4 A;  3ACH A;  3WT3 A;  4AK3 A;  1G86 A;  1UIJ A;  1GLH A;  2BNM A;  4JGY B;  1V70 A;  1OXC A;  2VD7 A;  3ASI A;  2XKO A;  2FCT A;  1DQ5 A;  3ZXG A;  3D6E A;  4CP0 A;  4CDQ C;  1W03 A;  4AVA A;  1ASJ 2;  1WLC A;  5L19 A;  2A73 B;  1CD3 G;  4I3P A;  4YRD A;  2PHR A;  1F9K A;  4IET A;  1XSQ A;  3OEB A;  1H8T B;  4H3W A;  5FLI A;  4XFH A;  4Y4Y A;  5L9R A;  3WOG A;  4LUM A;  1CWP A;  3MBW A;  3RZG A;  1C8N A;  2J1R A;  3RYK A;  3KB5 A;  1HRV 1;  1W9W A;  2HWE 3;  2VOV A;  3WZ1 A;  3PUQ A;  1JUI A;  4DXT A;  2WO1 A;  3B93 A;  5A33 B;  4LNV A;  4AR2 A;  1QQP 1;  4AEM A;  4YFZ A;  5JXH A;  5ABJ A;  1LB2 A;  3III A;  1U0A A;  1C5I A;  2VZP A;  4MGK E;  1ZX5 A;  5GLU A;  5KHI A;  1NOV A;  3CLP A;  3U11 A;  3VB9 A;  2ZAB A;  2JDZ A;  1JYW A;  2XB6 C;  5CZK A;  5AC9 1;  1XNC A;  5A7O A;  3T4V A;  2PAM A;  1UY4 A;  4R8H A;  4KG0 A;  4QX7 A;  5FY0 A;  5JSR A;  1XC6 A;  4SLI A;  1N3P A;  3VDD A;  4DEV A;  2RR1 1;  3AJZ A;  1RUE 1;  4NPR A;  2W2I A;  1QJU 1;  1XE8 A;  4Q0S A;  3AKR A;  3ST7 A;  2XLF A;  4LBL A;  3M3Q A;  1PVC 3;  1ULD A;  1HB1 A;  2JG8 B;  4Z2A A;  1V9U 2;  4OUM A;  4CEW B;  3JBG 3;  3C7F A;  5JXG A; 
#chains in the Genus database with same CATH homology
 5A6Z A;  5A6X A;  4AOC A;  2JDY A;  5HCH A;  1OVP A;  5A6Q A;  2VUC A;  2BP6 A;  2WR9 A;  2XR4 A;  3DCQ A;  1W8H A;  2WRA A;  1UZV A;  5A6Y A;  2JDU A;  1OUR A;  1OUS A;  1UQX A;  1W8F A;  5A70 A;  2JDN A;  2JDM A;  2JDH A;  3ZDV A;  4CE8 A;  1GZT A;  2BOJ A;  2BV4 A;  2VUD A;  1OVS A;  2BOI A;  2JDK A;  2VNV A;  5A3O A;  1OUX A;  2JDP A;  1OXC A;  4UT5 A;  5D2A A;  2CHH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...