1OVSA

Lecb (pa-lii) in complex with core trimannoside
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
114
structure length
114
Chain Sequence
b'ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein LecB
publication title Structural Basis of Carbohydrate Recognition by the Lectin LecB from Pseudomonas aeruginosa
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Sugar binding protein
total genus 19
structure length 114
sequence length 114
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07472 PA-IIL Fucose-binding lectin II (PA-IIL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.400 Mainly Beta Sandwich Jelly Rolls Calcium-mediated lectin 1ovsA00
2WRAA 1GZTA 2VNVA 5D2AA 2JDYA 1W8HA 2BOJA 2CHHA 2JDNA 2JDHA 4CE8A 2XR4A 2VUDA 1UZVA 1OUXA 5A70A 5A3OA 1OURA 2BOIA 2VUCA 2JDUA 2JDMA 1OXCA 5A6ZA 3DCQA 1OVPA 2WR9A 5A6YA 5A6XA 4UT5A 2BV4A 2JDKA 1OVSA 1UQXA 4AOCA 3ZDVA 1W8FA 2JDPA 2BP6A 5A6QA 1OUSA 5HCHA
chains in the Genus database with same CATH superfamily
1EAH3 4QPIB 1UYPA 4Z1VA 1TG7A 2VW2A 4M0NA 2OW4A 2OZJA 3ON7A 4YM2A 1ASJ3 3UKVA 1YEWA 1AYN3 3OYWB 1QWRA 3MF6A 4HPKA 3LA2A 1HRV1 4QX0A 1GLHA 4RL7A 4X8PA 3LF7A 5T5PA 5J7MA 2ZPXA 2RS53 2VAUA 3KT1A 4SBVA 2P3IA 1PO23 4FPYA 3GJBA 5F5AA 5EYXA 1IGOA 2A7AA 3VZLA 1VE0A 1VRH1 1DGWX 3ZO0B 1BEV1 3NO8A 1RUE1 4Q4Y1 1PIV1 4N53B 3ZN4A 5LK7B 1BVVA 5A80A 3WF1A 2VNGA 4GD4A 5A7WA 4A3XA 4AI3A 5FYZA 3LPFA 2GC1A 2XLFA 3IB3A 4JQTA 4R9CA 1NA1A 3H8XA 1IPKA 4JHZA 3RYPA 2ERFA 4H3WA 4QGMA 1W8HA 2J1SA 2RMU1 1GQHA 2QQOA 2VOWA 3O1TA 5JXIA 5A32B 3EMRA 2VUDA 4Q4X2 1SLCA 4NR1A 4DY5A 4NIDA 2FDGA 1ZVFA 3AJYA 1V9U2 1ND2B 1G7YA 1LR5A 3M3IA 1PZ8A 5ABJA 2PHRA 2W47A 1DGRA 1H0BA 2VZRA 2XWJB 1JU3A 2ATFA 3IDEA 5IVYA 5IK8A 1VMFA 2VMGA 3KGZA 4YW7A 5CISA 3KVAA 4Z92B 1QEXA 5J3UA 4KQ7A 2NP0A 3PIJA 1UQXA 5CKQA 2PHLA 4QQ2A 1OH3A 1HV1A 1AYM2 4LO7A 2E53A 5HCHA 4XIOA 4CA9A 3PNAA 4AFCA 3ZXDA 2DCKA 2DUQA 2XJRA 3B3QE 1QJY2 4FO9A 1HQNA 4Q4W2 4AVSA 1HQWA 1EAH1 1RMU2 4AHWA 4FPHA 3POIA 4XEZA 4XBLA 3ROUA 3WUDA 5JUVA 1OLQA 2WAOA 3HQUA 3R4SA 4R8HA 1HLCA 1RYYA 5FZ1A 1AYN1 5FPZA 1S0JA 4QQHA 5CG9A 3MIGA 1MR5A 3D82A 1DLCA 5SV8A 4BMBA 2VCBA 4IV1C 1JZ2A 5GM0A 2YZ4A 1RUD1 2RS51 3N9LA 1KQRA 3VZMA 2WO2A 2VBDA 3S57A 3L2YA 1QU0A 1WMDA 5JI9A 3LDKA 4AFBA 1OMIA 5FXXA 4E2QA 3ZMNA 4EN0A 4CP1A 1ZA4A 3MIBA 5DAXA 1V70A 1EYBA 2B42B 4BU2A 3WDUA 2Z79A 3THCA 1Q5OA 2IXJA 5H9QA 4D7YA 1C8M1 1LHNA 3WF3A 2LRPA 1ZREA 3UKNA 4IEXA 3WP6A 1DDLA 1WBFA 2Q1MA 3FFQA 3J8F3 5JVVA 4MADA 2X29A 3RNSA 4ZU5A 1LECA 4F3JA 3GF6A 1HIXA 3GJAA 2V73A 3ZYIB 2QZ2A 5J48A 4XTPA 1EP0A 1O5UA 2XONA 2JDKA 1W6PB 4OUEA 5HCAA 1YO8A 2Y60A 5C3SA 2WLQA 3V0AB 3IPVB 2HLEA 1GWLA 2J22A 2A6VA 5FZAA 1ZM1A 2VCMA 4Y5SA 2HWB1 3KZ4C 4XE9A 4PCRA 3O14A 2RR12 1OD3A 1YFWA 2VCCA 2AZ5A 5M0TA 5L9BA 3A22A 5F39A 4UW3A 4IEZA 1US2A 3MW4A 1AX2A 2WO3A 4XUQA 4W8JA 3JZVA 5EWSA 3CO2A 1ZZ9A 1H6YA 2BGCA 3NNFA 2OUHA 3POSA 4GMP3 2B9UA 4CEWA 1GQPA 2ZA9A 3TEZA 1Y9GA 1YNAA 1YFUA 4LBQB 2WKKA 3DXUA 4P9IA 3THTA 5KXCA 3SNMA 1R1A1 2WAAA 5FK8A 4P00B 1LHOA 3IAQA 3OPWA 4WVMB 1YIPA 5FYHA 5T5LA 2ZXQA 4QXHA 3ZR6A 4C0HA 2XR4A 4N90A 4QDRA 1FOD3 2OX0A 4RS5B 1OKQA 1V6IA 5H9PA 5BNNB 2CYFA 2DV9A 4MH0E 5C8CC 3WOGA 2P17A 1S0CA 1XNDA 3U0ZA 2JDUA 2QQMA 4PDWA 5FPAA 4FTEA 1CPMA 3DV8A 5JAXA 3X29B 2BZDA 1Y9QA 3MIEA 4AWDA 2ZABA 5CG8A 4KGGA 4AEJA 2YY1A 3K3NA 2KA3A 3OGVA 4Q2FA 4AW7A 4CYDA 5IYYA 4YZ5A 1Q8OA 2FZ2A 1WCSA 2KR2A 1PM4A 3WP5A 3LFIA 4ARXA 4FOYA 4HN1A 4LR4A 3RMXA 2NMNA 3WSOA 3H50A 3NWKA 1Y43B 4W65A 4Z2WA 5CKNA 4N8MA 2JKXA 3ZXKA 4PQQA 5FOBB 4N9IA 4W6WA 1UXXX 1W6QA 4KL1A 4PIZA 4AEDA 1QJU3 2D98A 2PHUA 4AHZA 5DMYA 5HV0A 4OFGA 2CDOA 4NWWA 3ILRA 2E51A 4UFIA 3T4HB 3K75B 2A75A 5LW9A 4LK6A 4IW3A 1CAWB 1K45A 5FYMA 4UOJA 3WXPA 4GZ9A 2WNVC 3AXEA 4QXBA 1O3SA 4FAHA 1RUJ3 4B3NA 3POYA 4GXLA 3UETA 2QCSB 2XQRA 4D7SA 3VBOB 1OI6A 2Z4FA 5F1RA 2GALA 2D43A 1AVBA 4DRVA 5CFCA 4FQZA 2VQAA 4R9DA 3RQ0A 2R061 5J09A 3O1SA 2HEVF 4M00A 2WFF2 1AR91 1AR83 4LHSA 2HH9A 2PQQA 4WVZA 3WNMA 1MEC2 4QPGB 1VBE2 3ZFFA 3PLQA 5LEJA 1VMHA 3PHMA 2RM22 2VW0A 4MGTA 1R082 1CN1A 1I6XA 3FLPA 2JKBA 4KWJA 3AMPA 1FOD1 1RVF3 2C6SA 1IG0A 3DPRC 5FP7A 4FI9A 4HK8A 4EN9B 5A3PA 3VZJA 5BNQA 1PX3A 3WNPA 1Q8VA 1JHJA 4GMP0 5FPVA 2Q8EA 5GZFA 2XVGA 3M2MA 2KD7A 4LBNA 4OMCA 3LEMA 4XF0A 3NSTA 4YARA 4KBBA 5FQ0A 3TEWA 2PAKA 1VBC2 5DN2A 4LHKA 5L36A 1MPXA 2XBO2 2X09A 1LEDA 4ISRA 5A7PA 3ZYRA 4OI0A 4AQTA 2DUPA 3I8TA 2VR4A 1AJOA 3HQXA 4LORA 2QQPA 4HFSA 2EXHA 2CGNA 2ZAHA 3FHAA 1UIKA 2MEV1 1LENA 1ND3C 4TLGA 4UXAA 3I7DA 3SQOA 1KITA 2PAMA 1W3VA 1UU6A 2VUCA 1LEMA 3VD4A 4AGRA 5KHHA 4CU7A 2X5IC 3PVEA 4NPMA 1GZWB 4XBQA 3CMGA 1OQDA 4LXLA 2D7FA 3NAPC 5FUNA 2XG3A 3VN4A 2GP5A 2HWF1 4RGGA 2VMCA 4AVVA 2UWAA 2WZR1 4NIIA 1GFF2 3IIAA 4INDA 1Y3TA 1GZ9A 1CAXB 4F8AA 3RZHA 3FX3A 4FFIA 1UZWA 4O65A 2VC9A 5D8AA 4CDUC 5AC92 2GC0A 4E4ZA 3AKPA 4Q0UA 1WD3A 3OEBA 1JYXA 2QQLA 3IMMA 4Q4X3 1QHDA 3SCGA 5A70A 1UKRA 2WNEA 2H0VA 4I01A 2WA4A 1V9U3 1OQEA 4GB31 3VBFA 4BLIA 1DQ0A 1UY3A 2WR9A 4D7TA 4EJRA 2W1SA 3D0SA 1NOVA 2YU2A 1WW6A 1AR61 5IHRA 1TE1B 4Q0PA 3VZNA 5GJ6A 1APNA 1NCRB 2UYAA 2YMZA 4WVWA 3MZHA 4YGEA 1AYM3 5LASA 1DCSA 3I2KA 1U5XA 2VZ3A 3PUAA 4K40A 1AL0G 4A7KA 1ULEA 5A7NA 1QJY3 2HWD1 4Y5TA 1PK6A 2DBNA 3AKRA 1RMU3 2VGDA 5A7QA 4DFSA 1NA1C 1UKGA 3ZYBA 4D69A 1WWYA 3DGTA 5IFTA 3MPBA 2Y38A 4TTGA 5JZGA 1VBA3 1YUDA 2DFBA 2RS33 4J6GA 2TBVA 1UOBA 1W0OA 2BRTA 2JG8B 2JXAA 2XVLA 4COYA 4ORFA 5KC6A 1PZ7A 1W9SA 2BNNA 5GLZA 4OHYA 2WBKA 1LOEA 5FO9B 5IAVA 1QOSA 1W6NB 1IKPA 1YRZA 2XQXA 3AL5A 4YVWB 5C4WB 5ABJC 4IV3A 2CHHA 4XETA 1LULA 5JR7B 1JYVA 1O3QA 4FP3A 4XC9A 1MQTA 4UAPA 1BEV2 3AYDA 1S2EA 1RUE2 2XXZA 4XUNA 3ATGA 3ILNA 2PELA 2YFUA 1O8PA 1UPIA 1SBEA 1HN0A 5AVAA 2QNKA 3H7YA 4NROA 2KM2A 2RJ2A 2Y8KA 3RWKX 2RV9A 3EBRA 5FV3A 3RI9A 3N7MA 3K51A 5JPMB 1V9U1 3D4KA 1CR7A 1KGYA 3BIEA 3OSDA 5FP9A 2C5DA 1K5JA 5LCWL 4OUMA 1DGRN 1GWKA 3KV5A 3MIDA 3VBRA 5BUVA 2QZ3A 3VBUB 2I45A 4LKDA 1X7NA 5LA2A 5KBFA 2FMYA 1XJAA 1DFQA 2ENRA 1DYKA 3I2DA 4XFAA 1BK1A 2Y6GA 2P37A 3M3OA 1U0AA 3POBA 3WG1A 2RR13 4JRAA 2EAKA 4YW6A 4Q4W1 1QNYA 3VDDA 1N3PA 3OD4A 2ZX4A 5A3OA 4CU9A 3CF6E 3D0JA 2VUJA 4DUWA 4OULA 3KF5A 2IXLA 4CSWA 4DNYA 3Q8FA 2VNOA 3OJBA 2VZQA 3VKFC 1RHI1 2ZX1A 1QH7A 1WMXA 3PMEA 3ZN6B 1OHFA 1A8MA 1W39A 3H3LA 2WZPP 3ZYJB 3M3QA 2KXLA 2ZZJA 4ARYA 3O1PA 1OBNA 3VKNA 2H0BA 2R0HA 3RZKA 3P5BA 1YQ8A 2BUKA 4IGPA 4KBZA 2WS92 3J4UH 3PL0A 4WM7B 5FZLA 5I0RA 3G7DA 2VBPA 1RUD2 1QQP2 5EQUA 4BXFA 1J58A 3EYPA 4FPGA 2W46A 1L7LA 4LOSA 4AEMA 1W3XA 3H3ZA 1VAMA 2IVIB 3SLIA 3M8LA 5JCTA 1QOTA 3GZTB 1UY1A 4CP9B 1POV3 2JDMA 4Y1XA 5AVPA 4CEYB 1ULCA 1UOFA 1UF2C 2AEZA 3KQ4B 4QKBA 3MO4A 4IEYA 4S2DA 3TNPB 2E63A 4BA6A 3ASIA 3ACIA 1JOJA 1JXNA 2JIGA 3WEZA 4Q27A 3O1UA 1GZTA 1F9KA 1H2LA 1W6MB 3KGLA 4KWUA 2FHRA 3AKSA 5JOWA 3V0BB 3URFA 3O12A 3JBG1 3P3PA 4QPIA 3BB6A 4IGOA 3K48A 4WV8A 3WF4A 1KDMA 4Y1ZA 3NNMA 4BXSV 1AX1A 1UXZA 1HV0A 4CEWC 3GCXA 3OYWA 1BYHA 4P5YA 5IVFA 1D7PM 1FMD2 1HB4A 2G9GA 2BWCA 3P1IA 3F95A 4Q0QA 5I93A 1L3JA 3RDIA 1LHVA 3T09A 4CCOA 4L9BA 2RVAA 2WIIB 5FP3A 4YSFA 2O8QA 3V56A 4XTMA 5FZ3A 2A6XA 3UT0A 3FLRA 4LO8A 4A6OA 4N53A 3PU8A 5ERLA 4ONUA 2JE8A 5KHKA 4MZUA 4PJYA 4DPNA 3GHNA 1FNZA 1GV9A 1O4YA 4HBNA 4QU2A 4NIGA 4PDWC 4OI1A 2ZGNA 2QBXA 1JI6A 3B00A 1Q8PA 2WFF3 1IPJA 1OT5A 3E5XA 1MEC3 3ACHA 2FD8A 1XU2A 1BXHA 3MYXA 4GWMA 1S0DA 4XCBA 3VHRA 5A32A 2OQ6A 2RM23 3JCIA 3VKOA 4B7KA 2OXBA 1W06A 1R083 4YGBA 1UMZA 2P3JA 1ND2A 5JMOA 5HV4A 2WWJA 5FYSA 1KD7A 3I2HA 1RXFA 3N7KA 4LNVA 1R1A2 3J26N 4C91A 2GN3A 1ENRA 4GH4B 4AEDC 1OLME 5LEKA 1COV2 1D0HA 1Y7BA 2IVJA 1HW5A 5CFDB 3ZXAC 3VLBB 2JDYA 4BM8A 1H8TB 2DVAA 2LS6A 2WYSA 2UY8A 3GZAA 2JICA 3DXTA 2MHFA 3N35A 3N9OA 5FMDA 3AP7A 4CE8A 4DXRA 3BODA 5B2GB 1DG6A 1H1AA 2Y64A 3ZKYA 2G4IA 1LRHA 4Y26A 5ACA2 1N1TA 1OA2A 2WT0A 4NIHA 1AF9A 4XJUA 1VALA 3RVHA 5CFCC 2F4LA 3VBHB 5BYNA 4IEQA 1WCKA 2X05A 2ZGPA 2E7TA 5DZFA 4XDQA 5F3IA 3ZFFC 3UGHA 3OUJA 1C4RA 3WZ1A 3JU9A 1RUG2 3PUHA 3AYAA 3HN1A 3KWVA 2OUJA 1MZFA 1STMA 3HEIA 4KI5M 2XMLA 4NWVA 2UY9A 1ZZBA 1K42A 2XKOA 1XOYA 4CTEA 2D93A 4G9SB 4ZU7A 2R7EB 3I54A 4CUCA 3AKTA 3H8OA 5AC93 1O59A 1SQ4A 2WFF1 3HNMA 4XF1A 1XNAA 3LDRA 1MEC1 2QQNA 1ULPA 1VBE1 3R4UA 4X6RB 1QKQA 3I2JA 5JSPA 3O1OA 2R062 4LIUA 1HXS2 4J25A 4KU7A 1X9TA 3ZMOA 4LIVA 5F6LB 3ES4A 1AR92 3ME2A 3ZSEA 1CONA 5C9AB 2FMDA 4MYEA 4B29A 2LM3A 4LUKA 5GZEA 1KRIA 1DZTA 4NO4A 3AKQA 3M1HA 2BJSA 1X50A 2BGOA 4OCTA 2J1UA 3THPA 4CPBA 5T50A 3IPVA 3V0AA 1WA6X 3C8XA 3DECA 4XPVA 5CZKA 1W8ZA 5IVJA 1VBC1 2R0FA 3B69A 4XF9A 4Q8KA 1NG0A 2XBO1 4XUTA 1UU5A 2DURA 1IS4A 1SZBA 4MX3A 2P6CA 5JXJA 1M06G 4XW3A 5FK7A 2SLIA 3FFZA 2Y26A 4K8FA 3KHCA 1DBNA 1DYOA 1IKQA 2BFUL 1JZ8A 4IDZA 4EQVA 4UFKA 1RB8G 2ZGKA 3MLKA 4DUXA 5J96B 1S2KA 2BNOA 4P9XA 1Z78A 2V4VA 3LCPA 4QXCA 4U36A 2R16A 5D8AC 2YB7A 3UV9A 3ZM8A 4HKLA 2VVEA 1NQDA 4YZ2A 4XYXA 2Z2SB 2HYKA 2MEV2 2ZOEB 1JBCA 3D3AA 4GAZA 2VMFA 5F3EA 4CU6A 2IZWA 1OOPB 4LBQA 4NE9A 4RN5A 3ILFA 5LBFA 2WZEA 2A5ZA 1BHGA 4AGVA 1VRH3 3JB8A 5FMOL 3WP3A 5JDBA 4CCJA 1BEV3 1H1MA 3ZPYA 1RUE3 4Q4Y3 1PIV3 4RS5A 4S2HA 4LK7A 4TSVA 3FZ3A 4E2SA 5BNNA 2WZR2 3NJXA 2K2SA 3S5AA 4AI0A 2D6LX 2K0GA 4CCLA 1CAVB 3ZSLA 1VR3A 2DTWA 3NW4A 1YXWA 4NPLA 1ZZCA 2Z5WA 2Z69A 5BNOB 1U5ZA 4META 3CU7A 2RMU3 4YG6A 5A33B 1BQPA 3D8CA 4LHNA 4YW5A 1QMJA 2IUWA 2YHJA 4B4QA 2QDNA 2VQTA 5FY9A 5BY5A 5JZGC 1I1EA 3LFMA 4J1XA 5TSWA 4GB32 4DXSA 2O1QA 1BZWA 2PHFA 1YI9A 1ZRIA 3U10A 1W8NA 4L2NA 2YGMA 4KG8A 5EHDA 4AG4A 2J1VA 3NNGA 5T5OA 4XOGA 4JC1A 4JDMA 1AR62 4AI1A 4NRQA 3VKLA 1ST8A 4IV3C 2WSVA 3VHPA 2BDRA 2B9VA 1S55A 1CAWA 3KCXA 1BBT1 4PT6A 1MQTC 2QJVA 2PFWA 3MF9A 1H2NA 1QJEA 2BBAA 4NN0A 5K4LA 1W90A 1QGLA 2HWD2 2EXKA 3BPSA 2SBAA 1CD3G 3VBOA 2CGOA 2ZAAA 5JSOA 2XB6C 2J1TA 5EPAA 4TZDA 5JWPA 3ZFGB 2W1WA 2WQZC 3ITQA 5APAA 5A3TA 4RQPB 2WT1A 3H1MA 4QPGA 1RUD3 5DUVA 1WCUA 2RDSA 4LBLA 2F4PA 4NVPA 1OURA 2QQIA 4UBGA 1WUVA 3RWNA 3OUIA 2WYFA 4HSLA 2CL2A 3VBRC 2K9ZA 3AP6A 3SCHA 4ASMB 1KS4A 2JJ6A 1JTZX 1C3HA 2D6MA 1TME2 2GH2A 2EIEA 5JI7A 2K46A 2BVVA 3J7HA 2V4AA 1FXZA 3PMSA 3IKWA 1W9TA 1WLTA 4FPEA 1UX7A 2OPWA 5GKAC 3KT4A 2H6BA 2GMPA 3AJZA 3N36A 5L9RA 3VDDC 3WUCA 5FKBA 4E4SA 2PQSA 1C8M3 2WDBA 1W6OB 2O8OA 5FJKA 4SLIA 1GOHA 2WA3A 1HN1A 1RL3A 1RUC1 3EHKA 1HJFA 1ZA7A 1UN1A 4QMAA 2QVSB 5BXXA 5KXBA 4Y4YA 2PN5A 1SDDB 1W2TA 4K9SA 4BQ5A 3HQRA 1UMIA 4ASLA 4CDQB 1OC1A 1G9FA 1EV11 2OVUA 1ZBA2 2VOVA 4XMAA 5L7OC 2Y6KA 1DU3D 1GU3A 4TLFA 2GMMA 2AACA 2CDPA 1W2UA 2JB8A 4OHZA 4HKWA 4COZA 2YBKA 3B94A 3JUUA 4Q4V2 4BJ0A 2D6PA 3T2PA 1VAVA 3VL9A 4AI2A 4BK4A 1GZWA 2YPDA 4JGYC 4CCKA 5ISLA 4HT1T 4BMEA 4ZKTB 3LZZA 2HWB3 1D4M2 1XNCA 4XMIA 5IUQA 4OQ9A 3VD7A 4BIOA 1O3TA 1RUOA 2CGPA 2NQYA 3AZYA 4EV0A 3S7IA 2PYTA 3EJKA 3RI8A 4OQ8A 3ZKUA 1IPSA 2LW8A 5FY1A 4CDWB 1CAXA 5BV6A 3I2GA 1ZRCA 4MG2A 1GANA 4QDSA 1RUH1 4GA9A 3AZXA 1RHI2 3JD72 3WDXA 4AFDA 2DCTA 2WS91 2FDIA 2B7YA 3QD6A 5I0UA 1QQP1 2IFRA 3TBDA 1NCQB 4QPIC 3U37A 3ZFEB 2NZ9A 1W8UA 1S0IA 4ET7A 2RJKA 2VNRA 2JDPA 3PIGA 5CA6A 5FPUA 1SEFA 1HB3A 1Z0HA 1R1A3 1KEXA 1REFA 1W2NA 4BPZA 4A6SA 3VUOA 1JMUB 3S5QA 4OZXA 4CU8A 2W68A 2ZMLA 2ZHKA 4LKSA 3LE0A 3O0XA 4XXPA 5FLJA 1CQ9A 1C1LA 1EUTA 1NCRA 1H8VA 3AL6A 1CIWA 1DQ1A 1FI2A 4CCDA 3SKJE 4N53C 5C5TA 1J59A 5FWEA 4KWKA 1VBB2 3CJIB 3O1MA 4M0HA 1NXMA 1F8VA 4LBKA 2WINB 4FOWA 4R9AA 1FMD1 3JBG2 2P5BA 1LGBA 1OUSA 4ZXEA 4L97A 1A6CA 1GNZA 1XE0A 3VL8A 1JZ5A 5T55A 5KXDA 2JG8A 4MV2A 3A4UA 2VMHA 3OGGA 1RUG3 1BCXA 5ANQA 4A2UA 4AHYA 3AZVA 5FZGA 1H30A 3MUZ1 2VULA 5FZEA 4XHBA 1U5IA 4HG6B 1ND2C 5FZCA 3MPPG 1MZ6A 1W6NA 2W1QA 4YVWA 5C4WA 1JUHA 2YFZA 2WWUA 1LOCA 1TMF2 3HJRA 3CDZB 1UO9A 1UZZA 3OCPA 4HOOA 4QX2A 5FY8A 2MPFA 4ZU4A 5JR2A 4DUVA 4CUAA 3DYMA 1YLLA 3RZGA 4NHMA 2YC2A 3OF1A 1OVPA 1H1IA 4YRDA 2GN7A 3DKWA 3GHMA 4CUGA 2HJIA 3I4IA 3W5MA 2R063 2GAUA 2XHKA 4XVHA 3WW2A 4E4DX 3G6JB 4LITA 1AR93 2R1BA 4P5HA 4FFGA 2VZUA 4LBJA 2W39A 1GUIA 3C7OA 2GU9A 5FYBA 4F7ZA 2HWC1 1FYUA 1KS5A 3ZVXA 4BHPA 2JDZA 1UOJA 2ZS6B 3VBUA 1COV1 3WW4A 1W9FA 4YPJA 3OY8A 1F15A 4NJ4A 3RJRA 4A3ZA 1IQDC 1GNHA 5FBZA 2VU9A 3WG3A 4YW4A 1XSRA 3CKHA 3I59B 1CIYA 5FAXA 3IDAA 1NLQA 4GIQA 5IFPA 5ACA1 4K7JA 3S0MA 4PLMA 4EWDA 1XSQA 3JXSA 1W8WA 2VECA 3L2HA 4H7LA 4QB1A 3ZN6A 2ARBA 5F8PA 1V6OA 2MEV3 2IWGB 3CQOA 2FZ1A 3HPNA 4N43B 4BQ1A 3CZUA 3OGSA 1UAIA 3RYRA 1RUG1 3LWCA 2XJVA 3I3QA 3NNLA 2C1FA 5FMCA 1I5PA 2ZKLA 4PLOA 4L0PA 3O1VA 3S6PA 1AHSA 1KFUL 3Q8AA 3RSJA 3KHBA 1OFNA 2PHWA 4OMDA 3BKZA 4U2AA 1XXNA 2VVDA 1JYWA 2ZX2A 4L99A 4AVAA 2HWF3 1HDKA 3VDBA 1J83A 2WZR3 1CJPA 2BWAA 2WFPA 3MICA 5FY4A 2JE7A 4FPCA 3T0DA 4CEYA 3H0OA 3WVJA 4EROA 1YCIA 1S4CA 2J1EA 4KNCA 4XJZA 5J98B 2V09A 2ZX0A 5KR7A 2JB4A 2PA7A 1HXS1 2W2IA 5IW0A 3WNXA 5LA0A 3RZMA 4KWLA 1W6MA 1WLCA 2CAVA 3OG2A 3WQBA 3V0BA 3NV1A 5FUPA 2VXJA 4Y4RA 1JZ3A 1QH6A 5CVRA 5T5JA 1S0FA 4Z07A 5IAXA 4NHYA 4GKYA 3WY6A 3NMBA 3VGIA 4GB33 3H8UA 3USUB 1UW8A 2VQUA 3OD0A 3PJQA 1OLRA 1XNTA 1AR63 4Z2AA 4YFWA 4K1ZA 3FHQA 1J3RA 5JIAA 3U14A 3TAYA 4JQRA 1ZX5A 4K6BA 1U12A 1ZZ7A 5BPXA 3ZDSA 2PTMA 1W05A 3OB8A 2HWD3 4RS5C 1ULOA 2D3PA 4A44A 3GYDA 3BYWA 4GULA 5BNNC 4V2WA 4X8NA 2ZGOA 4LQRA 3BOPA 2VJXA 3LPGA 1QJFA 3T1MA 3R05A 3VDAA 5I0TA 3SMHA 4AVBA 4RD7A 5FYVA 4Y24A 2V72A 4D6SA 2XJUA 3O7OA 3RRDA 1QF3A 3H7JA 3GGLA 1FV2A 3T0BA 1S0BA 3TYJA 4DY3A 2H6CA 4UFLA 2YBPA 5T3NA 5A6XA 3E6CC 2QUOA 4Y3OA 1AJKA 4MGKE 5A3UA 2LTNA 3DUIA 1PMHX 1TME3 4IEWA 4QAWA 1EPZA 1HRI2 4ZXKA 4GH4A 4FT8A 1CPNA 3UJOA 4C1XA 1WW4A 5A1LA 2AREA 2CAUA 2RE9A 3W58A 5FZHA 5CFDA 4ZY9A 3ZLIA 4D6RA 1H8TA 2EALA 3M4FA 1UX6A 3I3DA 3ZIXA 3I3MA 1WMFA 3MDPA 4AAPA 4QHBA 3Q9OA 4IERA 3SCFA 2GZWA 3AP4A 2P4EA 4RHV1 2IXIA 3TB0A 2C26A 4MGSA 3VBOC 3HVDA 4IL7A 2D44A 2W0XA 2BBVA 5E16A 3SEEA 1RTVA 4RFT0 5I0SA 1TEIA 1DGWA 1CX1A 4XQDA 4P9LA 3VBHA 1GQGA 3OUHA 2QQKA 1PMIA 3HWJA 4QGNA 4YW3A 1VJ2A 2VD7A 4Z82A 3GBGA 4QPGC 2YROA 3E5QA 4FOVA 1H9PA 3GDBA 2RS12 2VCAA 5B4NA 3BTYA 4YGCA 5I0DA 2CWSA 3B93A 3AC0A 5J36A 5KWRA 4MVTA 4Q4W3 4W4ZA 4Q8LA 4NMIA 4D0QA 2OZ6A 5LB6A 3H9AA 1VAKA 1VB4A 2BW8A 4ISQA 3AYEA 2YYOA 1BBT2 1IG3A 2NN8A 2GNBA 4OI2A 4XAAA 3WW3A 4B1LA 4QXKA 4GWIA 1GSLA 1CZSA 2VPVA 1RHI3 3B02A 3JD73 2XLGA 3MBWA 3SH4A 3ZXLA 5L9VA 2XPJA 2NPIA 5DAVA 1PGL2 2R041 1UPSA 2BV4A 1SLLA 2ZGTA 3U1XA 4AFMA 4BISA 4RGKA 2D5FA 4XQ4A 2AR6A 5C3QA 4QDQA 2Q1FA 5LK5A 4CRQA 3ZYPA 4AHXA 1HB1A 3POGA 3AMHA 2XL9A 2E31A 4OUSA 5C9AA 2OIIA 3PURA 5D21A 1TME1 4LT5A 2ET7A 2I2SA 3U07A 4DMIA 4F83A 5DXDA 1MS1A 2WNUB 4AYUA 4FTBA 1RUF2 3E6DA 3FLTA 4P02B 5IVEA 5GLWA 4CP0A 3JQXA 3SHRA 3N9MA 3K2OA 1PVC1 1SFYA 2RJLA 3AP9A 3LIGA 4RYDA 4YG0A 1S0EA 3P3NA 2ZGLA 1JYNA 2BTVC 1PO11 4JTOA 1DZRA 2CV6A 3PUQA 3VD3A 3OGRA 3O5SA 1XPWA 1YHFA 2NM1A 2XVKA 3ETPA 3S7EA 4ZZ5A 1RUC2 1ACCA 1VP6A 1ZBA1 3JBG3 1QOOA 3EXUA 5F9TA 5FOJB 3MV01 2FDHA 4GQ7A 1YIFA 4Q4V1 1D0GA 1EV12 5A6YA 2JD9A 2MNGA 5LZ6A 5K0UB 1VRBA 2CTVA 1O6UA 3TOJA 1EPWA 2OPKA 3RPQA 3BTZA 1OOPA 4BZ4A 2P3YA 1D4M1 1UD1A 4R4XA 4I09A 5LRRA 5LA1A 1F2NA 2XJSA 4XJWA 3THDA 5F6KA 1OA3A 2QQVA 4K20A 1RJ8A 1TMF3 1X82A 1OXCA 1UYZA 4AEKA 2V5DA 2GC3A 3LDBA 5BNPB 4FP2A 1NCRC 5I8SA 1DIWA 1D2SA 1GP4A 1PHMA 2Y6FA 3HT2A 2JIJA 1ENQA 3JD71 4CCMA 4GWJA 2C9AA 3MW3A 1CAVA 4IE6A 5FZMA 4ZHNA 5KHGA 2VM9A 1KJRA 1LOFA 3IN9A 4XF4A 3U11A 1VBD2 2V5YA 3A23A 1YWKA 5FCCA 1RUH2 3GM8A 5FKCA 3RG0A 5BNOA 5A33A 1XBFA 4DB5A 1UU4A 2ET1A 3HT1A 4IEUA 4DOUA 1LOBA 4A7ZA 4O9GA 4UBHA 2B45X 4JGYA 1LGCA 5CAZA 2VE1A 3AFGA 2BOIA 4XHXA 1OPMA 2BGPA 2JG8C 3FUOA 3HN3A 4QGLA 4ZS2A 1H4GA 1YI7A 1NQJA 4M3CF 4RR3B 3VZOA 1TQ5A 2EICA 4JV4A 1HX6A 2ZX3A 4XFCA 2DFCA 3UL2A 1DZQA 4LLFA 4QD2A 5DDJ1 2A73B 1X9PA 3K4ZA 2E7AA 5JLVA 3I3EA 4YVWC 5C4WC 4LBMA 2WUHA 4XJAA 1H2KA 2IXKA 3O1RA 4LA2A 1VBB1 2EVXA 4CDXB 4HL0A 3T4VA 1WA4A 1V6MA 3KT7A 5D2AA 4BH9A 1RUNA 2UURA 3B7MA 3DYPA 3QBQA 3UGFA 4WBBA 3WT3A 1ULFA 2VZVA 3EB7A 3BTAA 1LGNA 4QPYA 4FFFA 3AZZA 1O91A 4G3YC 4HMZA 3VZKA 3B9IA 3WQ0A 2JECA 2LALA 5F7UA 3ZFGA 4I2OA 5IT6A 4RQPA 4H2AA 3T3YA 4E8DA 2YU1A 4WVVA 5KC5A 4FPJA 3BTXA 3WNLA 4EN6B 2N7GA 4BDVB 4M3CB 3R0RA 5FLIA 2DVGA 1TMF1 3PDQA 1SLTA 3VBUC 4R4ZA 1B35B 2XJPA 4UW5A 1XQNA 2GNDA 2PHXA 2Y34A 3C2UA 3KB5A 4FQ4A 4CXYA 3WV6A 3MEPA 4D6QA 2BFUS 5E8AA 4QHOA 1A78A 3SKVA 2VZSA 3K77A 5CYYA 1LESA 5EIYB 3FL7A 3PJYA 1RUI1 1W6OA 5G04L 1N1SA 1VBE3 2C24A 1AX0A 2CY6A 2W08A 1MS8A 3AM2A 3EQEA 3M7AA 3RZJA 1Q8QA 3RMYA 3ZYHA 4HXCA 5JMCA 2JG9B 4QM9A 5FYUA 3INAA 4CDQA 4XBNA 2CU5A 5A3LA 3W20A 2A70A 1M4WA 5FMOS 3KSCA 2BP6A 2E33A 4BQ4A 2HWC2 5IJRA 4WM8B 4WM7C 3NV4A 2VOTA 4XJ8A 4BOWA 4XFGA 2ID4A 1PMJX 4ITCA 1A34A 3RYKA 1ZBE2 1FV3A 2UWBA 5JPNB 4OHWA 1VBC3 2DVDA 5CIRA 1W99A 5IK7A 1SCRA 1MS0A 1W03A 2XBO3 4Y1UA 1G9AA 3CLPA 5FYTA 4P14A 4FFHA 3IAPA 4I0AA 1DP0A 3AXDA 4M01A 4XZUG 2ETEA 3UESA 5FFOC 4CEYC 4XFIA 2EXJA 3QLQA 2W87A 4CDWA 2ZCWA 1POV0 2TUNA 2ZGUA 1WCDJ 2ZGSA 3TN92 1RC6A 1X36A 3TWIA 1J3QA 1UIJA 3ECQA 2B39A 1ZRRA 2YUEA 3WINE 1YQ2A 2DDUA 3LKJA 1W8FA 1ZRFA 5DAPA 1LB2A 1NCQA 1SBFA 1L7RA 3ZFEA 2Y0OA 5C6CA 3CIHA 3KCYA 3KCCA 4YVSB 3QACA 4LE3A 4LMFA 4QQPA 3LOBA 1US3A 4BQWA 5KXEA 1PZ9A 1WGPA 5EV7A 1HRI3 4DQAA 4PF1A 4OHXA 3N9PA 2AC1A 3VBSB 3C7HA 4JRLA 1X8MA 3VBFB 2B46X 3DN7A 3WP4A 2YDEA 1SFNA 3ELNA 3J8F2 4HKOA 2W9XA 4EWEA 4JVAA 5I91A 5GZDA 4XILA 4DXTA 5IK5A 4R52A 1ULGA 1C5IA 1UY0A 2JD4A 2XGXA 4HVOA 4NPRA 4BK5A 2O0OA 1Z7S1 3T2QA 4BB3A 3CJIA 3OGJA 3KM5A 4JGZB 4AOCA 1QJZA 2F17A 2WRAA 4I0WB 1K5MB 4DEVA 5CKMA 2C9KA 5KHIA 1PK6B 3SH5A 4LO5B 1PGW1 1W6PA 1CESA 2FDJA 1KDKA 4IE4A 4IE5A 4Y20B 4COWA 5FPXA 1UY4A 4YW1A 2WJSA 3W59A 3WF2A 4YLZA 4XXAA 4MHUA 1XE7A 5JOYA 1TNFA 5A3WA 3FUQA 4NRPA 4K8RB 4GH4C 1BBT3 1KJLA 4Y33A 4H7MA 4IETA 2JEMA 2XKPA 1QJX1 1POQA 3GNEA 1ZYBA 2ARCA 5CFDC 1NAEA 1TNRA 5JXHA 1H8TC 3SEPA 5FO8B 4NHKA 2YV8A 3LIHA 4AI9A 1XC6A 2NLRA 1ULDA 3AYCA 1CVNA 2DYCA 2G9FA 3KS7A 3KV6A 1O3RA 4PF5A 2BOJA 3IDBB 5HPOA 3LEIA 5AFEA 4QT6A 4PI2A 1SPPB 5FR3A 3DL3A 3PTYA 3B5LB 4GJYA 2FBEA 1GOFA 1SLIA 1HRI1 3E1F1 1W2OA 2F6BA 2AYHA 3C3VA 3VBHC 1PVXA 4GJZA 4WVMA 3I2OA 3VB9A 3MFAA 1GYKA 4LO4B 4LTAA 1RUF3 1RITA 5T54A 1GOGA 4JCKA 2JX9A 3N9NA 1R092 1XNKA 2YPJA 1VB2A 3OPTA 4QWNA 4IESA 5E89A 5FREA 3ZN5A 4DO0A 4D94A 4QX8A 4AQSA 3I59A 2P2KA 2A1XA 2W5FA 4CXXA 3PU3A 2BEOA 2R072 2ZHNA 5I8YA 1RUC3 3U4XA 3WD5A 1XYPA 1QJU2 3DEMA 1UOGA 3ZSMA 3WHTA 4RHV2 4AQ2A 2XJTA 2W1UA 1T6GC 1E5HA 1EV13 1WLWA 3LSDA 4UYBA 1AL21 2A71A 1MACA 3QH6A 2RS11 2ZTNA 4FTSA 2X53S 4E27A 2XDVA 3T0AA 3LB9A 3I49A 3V65A 1WKYA 5C7GA 2BVBA 5C9AC 1DHKB 1IZ3A 1J3PA 1YJKA 3A0KA 1XB9A 5JIUA 4MXWB 3JQWA 1H6XA 1AR82 2Z42A 4CP9A 4IE7A 4QX7A 3I2FA 4ES8A 1PGL1 4JX0A 1GZCA 4ES9A 2HWE1 3I3BA 1F4AA 3MFCA 1RUH3 2D3RA 2WS93 3E97A 5J37A 5ANNA 2R042 1LKNA 3NJYA 1QQP3 2ZKNA 4YZ3A 3UYJA 3WQ1A 4AQ6A 1W0PA 3MLLA 1YC61 4XF3A 1I5ZA 3QCWA 4JAAA 1SMVA 4TXWA 5E6HA 4IV1B 3USUA 1RUF1 5CB7A 3ENRA 3ZOIA 1OOPC 3HAGA 2BERA 2VMEA 3GXUA 2E32A 4NAOA 2JDHA 1BVP1 2WL1A 4DRRA 1PVC2 4AI8A 3BCWA 5EJ1B 3MI8A 4QQOA 1JH5A 1PO12 3ETQA 3MUY1 5FZDA 5E88A 4OHVA 1IS6A 4B4RA 5FXZA 1FMD3 1LOFC 1NX9A 4A45A 2BU9A 5BNOC 5FDBA 2J42A 4HVRA 1W2AX 4KG0A 1G9CA 2VZPA 3KLSA 1V6NA 2B5HA 3OTFA 4G4FA 2ZEYA 1URXA 3GZEA 3WNNA 5FZ7A 4CCEA 1OSGA 1LOAA 5FYCA 4PI0A 2Q30A 2P34A 3CL1A 4FOQA 2BYVE 5HI0A 4ATFA 2OA2A 2J7MA 1UZVA 4XJ9A 1JZ4A 5FZBA 4N7IA 1V0AA 3PVBB 3BN6A 3LSEA 3POFA 4YW2A 4YM3A 5I8TA 1OUXA 4BQ2A 1VBD1 2RHPA 4P08A 3USSA 2QDRA 2QTWB 3PVOA 5K7PA 2G19A 3DCQA 3WF0A 1ZZ8A 1NUKA 3TRSB 3UKTA 5F5IA 2WN2A 2QKDA 5LBBA 3GZUC 2WC2A 1OPOA 1SHWB 3POJA 2EIBA 5F2WA 2VTXA 1YQ5A 3CHXA 2E6VA 4S2GA 5DUUA 3VV1A 1J84A 1AZDA 3MLJA 1L7QA 2Q5TA 4W6XA 3ZFGC 4AE2A 2XL7A 4HANA 3ZX7A 2HWC3 4RQPC 3EO6A 4ASKA 5DG2A 1COV3 5LY1A 1ZBE3 2O14A 1ASJ1 1B09A 5C70A 2WSUA 3R4DB 3ACLA 5FP4A 4TWTA 2EA7A 4IUGA 3HD8B 1LHWA 4E9KA 3FE5A 1VBA2 2RS32 1ODMA 1EUUA 1NE4A 5DDJ2 2X8KA 4L11A 2VTXJ 5DQ0A 2EAAA 1ZRDA 5ACA3 1PO21 3L9JT 4QKFA 5C8CB 4MGYE 1O7FA 5C3RA 4LA3A 2LUWA 4W6YA 4UT5A 3TN93 1O8SA 3Q8CA 2Q4SA 4I30A 1D2QA 1OLMA 5A6QA 3FC0A 4AL9A 4H55A 3VDCA 1GWMA 2B8MA 2QQWA 4MO3M 2P3KA 3V64A 2GMEA 1FNYA 4PIYA 3WDYA 3ACGA 4N7UA 5F3GA 3VD5A 4B8EA 1DQ5A 4OZOA 2ZZQA 3IT8A 5F3CA 3LEKA 1MZ5A 4UW6A 5FZOB 3MHZA 3ST7A 3ALQA 1J1LA 4LBOA 3VHNA 4JDNA 3CEWA 3ACFA 4CDQC 3UNPA 4XUOA 1EY2A 2OS2A 3APBA 3WDTA 4DIQA 1SLAA 1XYNA 4P9JA 5FY5A 4HK9A 2WNUA 1ZNPA 1N47A 2VOKA 1A8DA 3ZXJA 1H2MA 5GLTA 4BE3A 1H9WA 3AMQA 1V6JA 4AZZA 1TVGA 1OD5A 1RXGA 4LHLA 5FYYA 2ZACA 4I3GA 2GC2A 3OBTA 1C8NA 2WNVB 4HVQA 1HXS3 4XQWA 1MS4A 1UMHA 1CGPA 4IQPA 1RUI2 4C90A 1XE8A 1F31A 2JENA 5CNAA 1LU1A 4CDWC 3NVCA 3E6BA 2D3SA 2UU8A 2Y0IA 3D5OA 5HCFA 4QX5A 4OI4A 1YYNA 2Q0AA 3GBFA 1LU2A 4YG3A 1ZBE1 3D6EA 4FPKA 1NCQC 2E9QA 2IXCA 2JWPA 5K0UA 3ZFEC 4O9EA 3ZXEA 4CZSA 1C28A 1FX5A 3FN9A 4Q0VA 3VD9A 1FPN2 1Y4WA 2ZMNA 4L8QA 5FLHA 5FMBA 2D5HA 3DPRB 2YC4A 4BQYA 5H9SA 3WW1A 2ADDA 4Q1PA 3TEXA 5BNPA 1Q3EA 1FAYA 3TN91 2ES3A 2GNMA 4B1MA 4QQLA 2P6HA 1BKZA 3ORJA 2WT2A 4Y1VA 2AGSA 1T2XA 3WNKA 2VL4A 1OF4A 3RGBA 4CP2A 4H14A 5LBCA 2XWBB 2A6YA 4BWOA 1CZTA 1GMMA 1G6NA 1SBDA 3IBMA 3J7NA 3CJIC 4JKKA 4Y22B 5DUXA 4D8MA 4TN7A 1GICA 4ZPIA 1MVQA 1UL9A 1I3HA 4WM7A 2FDKA 4K3UA 1YJLA 2DVBA 4YZ4A 1AUYA 1NE6A 3M3CA 4GALA 2Q1ZB 3C7GA 4Q0SA 5FY7A 1ND3B 5IVVA 4CXWA 2VMIA 3BPZA 1CAUB 4XDOA 3J8F1 3ZYGA 2YC0A 2ZGRA 3C7FA 1N1VA 1R093 1LJ7A 2WABA 3FWEA 4MSVA 4O61A 2X5IB 1UWWA 4RR3A 1UYYA 3OBRA 4URTA 5FZ8A 4UF0B 3OPZA 2WO1A 1YQ6A 1FT9A 1LNSA 5EXOA 4A4AA 4DXZA 3NAPB 1F5FA 2GNTA 2VY0A 2R073 4CDXA 5C8WA 2PLV2 4YYOA 1FATA 5EJZB 4C8DA 2UYBA 5FO7B 3H42B 2ILMA 3KMHA 4RHV3 1IOAA 4PBPA 3NQHA 2OYZA 1AR72 1Z7S2 5GALA 5H9RA 4Q26A 4CDUB 1JZ7A 4E2GA 4XZPA 3LOIA 1K12A 1UY2A 4XFHA 3T08A 3ZYFA 1UZYA 2Q8OA 1SLBA 2AUYA 2XH6A 4QKDA 3UJQA 2W91A 5KHJA 1PGW2 1JHNA 5K8SA 1PGSA 3HMYA 2ZBJA 4M3CA 1DQ2A 3AX4A 4GMP1 2RDQA 2Q8DA 4A41A 2C0ZA 3AK0A 5EZWA 4BLJA 4BQXA 1P8JA 3O0WA 2R6QA 4HPKB 4XACA 4ZONA 5DZGA 1XNBA 1B35A 1KXGA 1JS9A 2ZMKA 3A21A 1YQCA 5LA9A 1VIWB 5FP8A 4QU1A 3KVBA 3FBMA 4FPLA 5FZIA 5LBEA 1D4VB 1MS9A 1QJX2 4PIXA 4RA0A 3FJSA 3N7JA 5A7WB 4AFAA 2IXHA 2R043 2A6WA 5FZFA 5LY2A 1LTEA 2IFWA 4WZCA 1NA1B 1RINA 4NOTA 1W8OA 2HKXA 2VXRA 3GALA 4YGDA 5FIXA 1G8WA 3BOWA 4IXLA 4MGIE 2ARAA 4NRMA 1E5RA 2GDFA 2JG9A 4OYUA 1W04A 4L92A 4JTNA 2VOXA 3SXWA 3I97A 1WMEA 4N43C 1R091 2QFEA 4DZGA 1OH4A 5A7SA 1E5IA 4MGQA 2D40A 1W0NA 4WM8A 5DPNA 1V6KA 4C0BA 5DAQA 1GP6A 2PHDA 3P6BA 5D1IA 1ZZ6A 5ABJB 2ZJCA 1WBLA 2R071 4YM0A 1PVC3 1CJDA 5F2SA 1VMJA 4AAXA 2ORXA 3HR9A 3W9AA 1QJU1 3NL1A 4LJHA 3HNYM 1PO13 1NY71 2HBUA 2FCTA 1HQLA 2RDNA 4JHTA 2DF7A 4XFBA 4YNIA 4QX1A 1ZBA3 2GH8A 4URAA 4CVUA 1N3QA 2R1DA 5FXWA 1RUJ1 4EYUA 1QXJA 2VQ0A 3WG2A 5DZEA 5EJ3A 4LKEA 3AP5A 2B4KA 2JDAA 2R32A 4Q4V3 3ZSJA 1OFSA 1VPHA 4P9GA 2OKXA 1WW5A 2L9LA 1AL22 1SACA 2LROA 1DYPA 1WD4A 3K4AA 1WCQA 1PNFA 4D3WA 1D4M3 4YVSA 4JDOA 5DAWA 1AR81 3CJXA 4X6QB 1JUIA 2BQPA 3PVNA 3RFRA 4MXVA 1UZ0A 4OVEA 3VBSA 1HKDA 1NYWA 2D6OX 3POWA 2GSYA 1G9BA 4HONA 2DU1A 4XDPA 3WHUA 3M70A 3SH3A 3T2OA 1RVF1 1OA4A 1PX4A 2DUOA 2J1RA 1UCXA 2DCYA 3MGUA 4OLLA 1WW7A 3R6SA 1V00A 4COUA 5IATA 2W3JA 2HWE2 3H1YA 1BMV2 3PUIA 4QB6A 5A7OA 4A42A 1YFYA 1H4HA 2VTFA 1F4HA 3HNBM 4JGZA 3M3EA 1JODA 3T1LA 4CUBA 1ODNA 4KU8A 3WLUA 4MUVA 1K5MA 2JDNA 3OEAA 3IDCB 4UFMA 1WZXA 4W50A 3TNQA 5FRAA 1S0GA 1JU4A 1AXZA 3W21A 3NKTA 5DABA 3WDVA 4Y20A 1QXRA 3Q8BA 2G1MA 4LLOA 4PHZA 1BLZA 3B9CA 4I3PA 1G86A 2DWRA 1I9RA 5FYIA 2JE9A 5DDJ3 1SFPA 5C71A 2OQ7A 2Q8CA 1J1TA 1SDWA 1VBB3 1QDCA 2D6NA 4ZS3A 4JKLA 1HRV2 4Z8BA 2QQUA 4KH9A 2VNVA 2WO7A 1MVEA 3MW2A 4HLTA 5SV5A 1GNYA 1MZEA 3VHOA 2VO5A 3LA3A 2DCJA 5E1RA 3O0VA 4Y5Z0 1VRH2 3N3HA 4J1WA 3GCWA 4K21A 3LAGA 5AFBA 3JB4C 1X8EA 4QM8A 5FZ4A 4AVCA 1JOBA 3B01A 3BU7A 1PIV2 4Q4Y2 2WWSA 1RGSA 4ATEA 1IQAA 5GLUA 2WLPA 3NV3A 5FPBA 1SPPA 3FBYA 4UWDA 3GBWA 5G05L 3H8RA 3K4DA 5J1XA 5F37A 2PAEA 3UGGA 4CEWB 2RDRA 4E8CA 4Q4X1 4HZFA 2Y6HA 1HB2A 3J7LA 1QIQA 3A0NA 3RS6A 1VLNA 4GWNA 2RMU2 3H1WA 2IC1A 3N9QA 1GR3A 4CCCA 3ZDVA 3OBZA 4S2FA 5FPLA 4XABA 3S30A 1QDOA 3POEA 4UW4A 3OY8B 4XIKA 1GBGA 1RUI3 5T52A 2HYXA 4ZZ8A 3KQRA 1AYM1 4GKXA 1JYTA 2CSGA 2A6ZA 3TEYA 2C4XA 1IHMA 3ABZA 4EN8B 1TZOA 4PDWB 1QJY1 3PUSA 5JOZA 1LODA 1PNGA 1RMU1 1NLRA 3K46A 3DKQA 2FQPA 4MGZE 1JZ6A 4B4PA 4FBFA 3HBZA 4I02A 2VUAA 4LE4A 2ARXA 2AENA 3IZOA 4LPLA 4Q1RA 4CPBD 5IVBA 1ENSA 3N7LA 1MS5A 1EAH2 1VBA1 2RS31 1FPN3 3BIWE 4FPFA 1E5SA 4IEOA 1U5YA 4YZ1A 4NIAA 1O5LA 1ASJ2 1V6LA 5FTTC 1AYN2 2WNUC 2Y6JA 4Q5OA 1JN2P 4MXWA 3WQ7A 1W6QB 4AEDB 5GZGA 5GZCA 2DCZA 1XYOA 2VG9A 3VKMA 1NXD1 3U4SA 4R9BA 2RS52 4EZHA 1PO22 1REDA 4LOTA 5F5QA 2R49A 4NUBA 5C3PA 4UFJA 3SITA 2E26A 2XJQA 5FZ0A 2CWMA 1AXYA 4EWAA 2TEPA 1JYIA 5A3MA 3HOBA 2PMWB 3BI3A 4FSJA 4E4HA 5CFCB 4FPOB 4LBQD 2A3WA 1GP5A 3A7QA 1W28A 3KF3A 1C8M2 4IV1A 1UNBA 3ZFFB 4DEQA 2WQ8A 1LCLA 2ZEXA 5K0UC 2I07B 5K9YA 3F2ZA 4HETA 4LO6B 4LUMA 3J7MA 5HXVA 4YM1A 1Q8SA 2XLAA 1E57A 4COVA 2ZEWA 3HBKA 4P9YA 3OBAA 2PLV3 4AGGA 4QB2A 1LAJA 3AB0A 4AVTA 2WQ4A 2ZHLA 3HIFA 5FUIA 5F32A 2TNFA 2ZHMA 5BNPC 1R64A 1AR73 1Z7S3 1UYXA 2RR11 2W92A 1NKGA 3CNAA 1BK0A 2VW1A 3IMNA 2YG0A 4FVVA 4XCAA 3W5NA 3K3OA 3ZXFA 3LD8A 5FQ0B 3N4MA 3BVCA 2CNAA 1GKBA 1S1AA 2AEYA 1CX4A 1F35A 2HWB2 3LA7A 5B4XA 3J9SA 4QX3A 5L7OA 5EYYA 1REEA 1SG3A 2W52A 1OF3A 3ZXGA 3KV4A 4NAMA 1FPN1 4UI9L 3BU0A 4A7YA 2PHTA 4XUPA 3UK9A 4BYYA 4RGAA 5FZ6A 3U75A 2Y6LA 1ONAA 3WX5A 5EP9A 2I74A 1C1FA 5FZKA 1PM7A 2VMDA 1QNWA 4WZFA 4RR3C 3AMNA 4FXKB 3QH7A 1HJGA 2OT7A 3KD4A 3ZIWA 1QJX3 1RIRA 2PXJA 3C7EA 1F5JA 3NRUA 1O4ZA 1N3OA 1QXPA 1T6BX 1YFXA 2Y33A 3AFKA 1POV1 2FCUA 3H3UA 4HSJA 4CDXC 1OVSA 1W9YA 2RG4A 3IWZA 1ENXA 2YGLA 3NJVA 5CBLA 3FMGA 4Q29A 1DQ6A 4QPWA 4DS0A 4PQ9A 4TYSA 3MIHA 5D8AB 4V2VA 3WCSA 5GLVA 2XOMA 1W9WA 2WZ8A 3IM0A 2EF6A 3U78A 4AR2A 2WN3A 2FCVA 5EFUA 2XUMA 4AXOA 4XAEA 5A1FA 2XHNA 2PLV1 3WR0A 4O7XA 5A6ZA 2R30A 4P9WA 1QY4A 1B35C 1NZCA 3NV2A 1JOPA 2P1BA 1AR71 1X33A 3LQCA 4FCAA 5C8CA 1NT0A 1LHUA 4XURA 2VZOA 1KFXL 4NHLA 1OKOA 4FAGA 5A3NA 1XRUA 4AK3A 4DINB 4QHZA 3T30A 2DBIA 5JOXA 1AL23 1S2BA 3AVSA 2RS13 3WDWA 4Y1YA 2DVFA 2X10A 3DF0A 3E5UA 1WLDA 5HXMA 3I2IA 5JZGB 2JG9C 5FZOA 4JKMA 5HCBA 4QKNA 4IEVA 3WCRA 2VZ1A 4V1PA 3BUCA 1XU1A 4KGQA 1DGLA 2RM21 4CCNA 4N9HA 4WM8C 1R081 3BALA 1MS3A 1LOGA 5LRSA 3QOPA 4RSUA 2W94A 3FHIB 2HBTA 4BQ3A 3RZLA 3AMMA 1IS5A 2YXSA 2A3YA 1RJ7A 4IV3B 3LGRA 1SCSA 2D97A 2HWE3 5IWFA 2ZEZA 1MQTB 1NLSA 2QQJA 3T2TA 2WNVA 1DF0A 1FOD2 1ALYA 5IK4A 2BPA2 4I0BA 5IVCA 4IGQA 5HBAA 3PTRB 2G9ZA 1Q43A 1Y9MA 3CBNA 3IIIA 5C5UA 2HEYF 2UWCA 1CWPA 3SISA 2FDFA 5DG1A 4NHXA 2NYYA 2HEWF 3ZSKA 2VZTA 3NKGA 4JZRA 2GP3A 2EIGA 1JW6A 5LATA 3Q8EA 5L73A 2DTYA 3ZPOA 5JSRA 4LKFA 1N1YA 4MLOA 4YVSC 1BJQA 3AVRA 1DLLA 3VBRB 4FXGB 2ZGQA 3DPRA 3NNJA 2XUEA 4C1WA 3VBSC 4BCUA 4PBOA 2QE3A 1HRV3 3CZJA 5F5CA 2ORZA 4RFRB 3VBFC 2AH2A 3KV9A 1Q56A 5CADA 1JYCA 5FWJA 4EZ4A 3VDDB 1NY72 4MHRA 5FJHA 4B7EA 1IS3A 1CZVA 4MOAA 3MIFA 5C3OA 3WNOA 4KMQA 4M4PA 2NMOA 5LWBA 1O4TA 2A3XA 1R1ZA 2HWF2 4N43A 2EIDA 4LULA 4Y22A 1RUJ2 4LEJA 3WG4A 5JXGA 4JGZC 5AC91 2EXIA 5FZ9A 2D6KA 4XFFA 1AXKA 4IEPA 5CU1A 3ZR5A 1K5MC 2VVFA 1ND3A 5L7OB 1PK6C 2BNMA 1W8TA 4YFZA 4M3CE 1CAUA 3ES1A 5FBJA 3SC7X 4EE2A 3RZZA 5L19A 2ZGMA 4AF9A 1DQ4A 2X5IA 4HN0A 2VBBA 4JGYB 2WNOA 3OOXA 4UF0A 5DUWA 2ADEA 3NAPA 4BIFA 1BMV1 2YBSA 5CEHA 1C5HA 5FXVA 5FY0A 1VBD3 4YWAA 1RVF2 2DU0A 3DYOA 4UFHA 5A1AA 1A3KA 2VH9A 3MV11 3NJZA 4M4RA 1NZIA 4PLNA 4CDUA 3AZWA 4IE0A 3LEGA 1K3IA 2J1AA 4K1YA 1G9DA 3BGAA 4EN7B 2E7QA 5C33A 1C57A 2W95A 3RJ2X 1OQ1A
chains in the Genus database with same CATH topology
2WRAA 1GZTA 2VNVA 5D2AA 2JDYA 1W8HA 2BOJA 2CHHA 2JDNA 2JDHA 4CE8A 2XR4A 2VUDA 1UZVA 1OUXA 5A70A 5A3OA 1OURA 2BOIA 2VUCA 2JDUA 2JDMA 1OXCA 5A6ZA 3DCQA 1OVPA 2WR9A 5A6YA 5A6XA 4UT5A 2BV4A 2JDKA 1OVSA 1UQXA 4AOCA 3ZDVA 1W8FA 2JDPA 2BP6A 5A6QA 1OUSA 5HCHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WRA A;  1GZT A;  2VNV A;  5D2A A;  2JDY A;  1W8H A;  2BOJ A;  2CHH A;  2JDN A;  2JDH A;  4CE8 A;  2XR4 A;  2VUD A;  1UZV A;  1OUX A;  5A70 A;  5A3O A;  1OUR A;  2BOI A;  2VUC A;  2JDU A;  2JDM A;  1OXC A;  5A6Z A;  3DCQ A;  1OVP A;  2WR9 A;  5A6Y A;  5A6X A;  4UT5 A;  2BV4 A;  2JDK A;  1OVS A;  1UQX A;  4AOC A;  3ZDV A;  1W8F A;  2JDP A;  2BP6 A;  5A6Q A;  1OUS A;  5HCH A; 
#chains in the Genus database with same CATH topology
 1EAH 3;  4QPI B;  1UYP A;  4Z1V A;  1TG7 A;  2VW2 A;  4M0N A;  2OW4 A;  2OZJ A;  3ON7 A;  4YM2 A;  1ASJ 3;  3UKV A;  1YEW A;  1AYN 3;  3OYW B;  1QWR A;  3MF6 A;  4HPK A;  3LA2 A;  1HRV 1;  4QX0 A;  1GLH A;  4RL7 A;  4X8P A;  3LF7 A;  5T5P A;  5J7M A;  2ZPX A;  2RS5 3;  2VAU A;  3KT1 A;  4SBV A;  2P3I A;  1PO2 3;  4FPY A;  3GJB A;  5F5A A;  5EYX A;  1IGO A;  2A7A A;  3VZL A;  1VE0 A;  1VRH 1;  1DGW X;  3ZO0 B;  1BEV 1;  3NO8 A;  1RUE 1;  4Q4Y 1;  1PIV 1;  4N53 B;  3ZN4 A;  5LK7 B;  1BVV A;  5A80 A;  3WF1 A;  2VNG A;  4GD4 A;  5A7W A;  4A3X A;  4AI3 A;  5FYZ A;  3LPF A;  2GC1 A;  2XLF A;  3IB3 A;  4JQT A;  4R9C A;  1NA1 A;  3H8X A;  1IPK A;  4JHZ A;  3RYP A;  2ERF A;  4H3W A;  4QGM A;  1W8H A;  2J1S A;  2RMU 1;  1GQH A;  2QQO A;  2VOW A;  3O1T A;  5JXI A;  5A32 B;  3EMR A;  2VUD A;  4Q4X 2;  1SLC A;  4NR1 A;  4DY5 A;  4NID A;  2FDG A;  1ZVF A;  3AJY A;  1V9U 2;  1ND2 B;  1G7Y A;  1LR5 A;  3M3I A;  1PZ8 A;  5ABJ A;  2PHR A;  2W47 A;  1DGR A;  1H0B A;  2VZR A;  2XWJ B;  1JU3 A;  2ATF A;  3IDE A;  5IVY A;  5IK8 A;  1VMF A;  2VMG A;  3KGZ A;  4YW7 A;  5CIS A;  3KVA A;  4Z92 B;  1QEX A;  5J3U A;  4KQ7 A;  2NP0 A;  3PIJ A;  1UQX A;  5CKQ A;  2PHL A;  4QQ2 A;  1OH3 A;  1HV1 A;  1AYM 2;  4LO7 A;  2E53 A;  5HCH A;  4XIO A;  4CA9 A;  3PNA A;  4AFC A;  3ZXD A;  2DCK A;  2DUQ A;  2XJR A;  3B3Q E;  1QJY 2;  4FO9 A;  1HQN A;  4Q4W 2;  4AVS A;  1HQW A;  1EAH 1;  1RMU 2;  4AHW A;  4FPH A;  3POI A;  4XEZ A;  4XBL A;  3ROU A;  3WUD A;  5JUV A;  1OLQ A;  2WAO A;  3HQU A;  3R4S A;  4R8H A;  1HLC A;  1RYY A;  5FZ1 A;  1AYN 1;  5FPZ A;  1S0J A;  4QQH A;  5CG9 A;  3MIG A;  1MR5 A;  3D82 A;  1DLC A;  5SV8 A;  4BMB A;  2VCB A;  4IV1 C;  1JZ2 A;  5GM0 A;  2YZ4 A;  1RUD 1;  2RS5 1;  3N9L A;  1KQR A;  3VZM A;  2WO2 A;  2VBD A;  3S57 A;  3L2Y A;  1QU0 A;  1WMD A;  5JI9 A;  3LDK A;  4AFB A;  1OMI A;  5FXX A;  4E2Q A;  3ZMN A;  4EN0 A;  4CP1 A;  1ZA4 A;  3MIB A;  5DAX A;  1V70 A;  1EYB A;  2B42 B;  4BU2 A;  3WDU A;  2Z79 A;  3THC A;  1Q5O A;  2IXJ A;  5H9Q A;  4D7Y A;  1C8M 1;  1LHN A;  3WF3 A;  2LRP A;  1ZRE A;  3UKN A;  4IEX A;  3WP6 A;  1DDL A;  1WBF A;  2Q1M A;  3FFQ A;  3J8F 3;  5JVV A;  4MAD A;  2X29 A;  3RNS A;  4ZU5 A;  1LEC A;  4F3J A;  3GF6 A;  1HIX A;  3GJA A;  2V73 A;  3ZYI B;  2QZ2 A;  5J48 A;  4XTP A;  1EP0 A;  1O5U A;  2XON A;  2JDK A;  1W6P B;  4OUE A;  5HCA A;  1YO8 A;  2Y60 A;  5C3S A;  2WLQ A;  3V0A B;  3IPV B;  2HLE A;  1GWL A;  2J22 A;  2A6V A;  5FZA A;  1ZM1 A;  2VCM A;  4Y5S A;  2HWB 1;  3KZ4 C;  4XE9 A;  4PCR A;  3O14 A;  2RR1 2;  1OD3 A;  1YFW A;  2VCC A;  2AZ5 A;  5M0T A;  5L9B A;  3A22 A;  5F39 A;  4UW3 A;  4IEZ A;  1US2 A;  3MW4 A;  1AX2 A;  2WO3 A;  4XUQ A;  4W8J A;  3JZV A;  5EWS A;  3CO2 A;  1ZZ9 A;  1H6Y A;  2BGC A;  3NNF A;  2OUH A;  3POS A;  4GMP 3;  2B9U A;  4CEW A;  1GQP A;  2ZA9 A;  3TEZ A;  1Y9G A;  1YNA A;  1YFU A;  4LBQ B;  2WKK A;  3DXU A;  4P9I A;  3THT A;  5KXC A;  3SNM A;  1R1A 1;  2WAA A;  5FK8 A;  4P00 B;  1LHO A;  3IAQ A;  3OPW A;  4WVM B;  1YIP A;  5FYH A;  5T5L A;  2ZXQ A;  4QXH A;  3ZR6 A;  4C0H A;  2XR4 A;  4N90 A;  4QDR A;  1FOD 3;  2OX0 A;  4RS5 B;  1OKQ A;  1V6I A;  5H9P A;  5BNN B;  2CYF A;  2DV9 A;  4MH0 E;  5C8C C;  3WOG A;  2P17 A;  1S0C A;  1XND A;  3U0Z A;  2JDU A;  2QQM A;  4PDW A;  5FPA A;  4FTE A;  1CPM A;  3DV8 A;  5JAX A;  3X29 B;  2BZD A;  1Y9Q A;  3MIE A;  4AWD A;  2ZAB A;  5CG8 A;  4KGG A;  4AEJ A;  2YY1 A;  3K3N A;  2KA3 A;  3OGV A;  4Q2F A;  4AW7 A;  4CYD A;  5IYY A;  4YZ5 A;  1Q8O A;  2FZ2 A;  1WCS A;  2KR2 A;  1PM4 A;  3WP5 A;  3LFI A;  4ARX A;  4FOY A;  4HN1 A;  4LR4 A;  3RMX A;  2NMN A;  3WSO A;  3H50 A;  3NWK A;  1Y43 B;  4W65 A;  4Z2W A;  5CKN A;  4N8M A;  2JKX A;  3ZXK A;  4PQQ A;  5FOB B;  4N9I A;  4W6W A;  1UXX X;  1W6Q A;  4KL1 A;  4PIZ A;  4AED A;  1QJU 3;  2D98 A;  2PHU A;  4AHZ A;  5DMY A;  5HV0 A;  4OFG A;  2CDO A;  4NWW A;  3ILR A;  2E51 A;  4UFI A;  3T4H B;  3K75 B;  2A75 A;  5LW9 A;  4LK6 A;  4IW3 A;  1CAW B;  1K45 A;  5FYM A;  4UOJ A;  3WXP A;  4GZ9 A;  2WNV C;  3AXE A;  4QXB A;  1O3S A;  4FAH A;  1RUJ 3;  4B3N A;  3POY A;  4GXL A;  3UET A;  2QCS B;  2XQR A;  4D7S A;  3VBO B;  1OI6 A;  2Z4F A;  5F1R A;  2GAL A;  2D43 A;  1AVB A;  4DRV A;  5CFC A;  4FQZ A;  2VQA A;  4R9D A;  3RQ0 A;  2R06 1;  5J09 A;  3O1S A;  2HEV F;  4M00 A;  2WFF 2;  1AR9 1;  1AR8 3;  4LHS A;  2HH9 A;  2PQQ A;  4WVZ A;  3WNM A;  1MEC 2;  4QPG B;  1VBE 2;  3ZFF A;  3PLQ A;  5LEJ A;  1VMH A;  3PHM A;  2RM2 2;  2VW0 A;  4MGT A;  1R08 2;  1CN1 A;  1I6X A;  3FLP A;  2JKB A;  4KWJ A;  3AMP A;  1FOD 1;  1RVF 3;  2C6S A;  1IG0 A;  3DPR C;  5FP7 A;  4FI9 A;  4HK8 A;  4EN9 B;  5A3P A;  3VZJ A;  5BNQ A;  1PX3 A;  3WNP A;  1Q8V A;  1JHJ A;  4GMP 0;  5FPV A;  2Q8E A;  5GZF A;  2XVG A;  3M2M A;  2KD7 A;  4LBN A;  4OMC A;  3LEM A;  4XF0 A;  3NST A;  4YAR A;  4KBB A;  5FQ0 A;  3TEW A;  2PAK A;  1VBC 2;  5DN2 A;  4LHK A;  5L36 A;  1MPX A;  2XBO 2;  2X09 A;  1LED A;  4ISR A;  5A7P A;  3ZYR A;  4OI0 A;  4AQT A;  2DUP A;  3I8T A;  2VR4 A;  1AJO A;  3HQX A;  4LOR A;  2QQP A;  4HFS A;  2EXH A;  2CGN A;  2ZAH A;  3FHA A;  1UIK A;  2MEV 1;  1LEN A;  1ND3 C;  4TLG A;  4UXA A;  3I7D A;  3SQO A;  1KIT A;  2PAM A;  1W3V A;  1UU6 A;  2VUC A;  1LEM A;  3VD4 A;  4AGR A;  5KHH A;  4CU7 A;  2X5I C;  3PVE A;  4NPM A;  1GZW B;  4XBQ A;  3CMG A;  1OQD A;  4LXL A;  2D7F A;  3NAP C;  5FUN A;  2XG3 A;  3VN4 A;  2GP5 A;  2HWF 1;  4RGG A;  2VMC A;  4AVV A;  2UWA A;  2WZR 1;  4NII A;  1GFF 2;  3IIA A;  4IND A;  1Y3T A;  1GZ9 A;  1CAX B;  4F8A A;  3RZH A;  3FX3 A;  4FFI A;  1UZW A;  4O65 A;  2VC9 A;  5D8A A;  4CDU C;  5AC9 2;  2GC0 A;  4E4Z A;  3AKP A;  4Q0U A;  1WD3 A;  3OEB A;  1JYX A;  2QQL A;  3IMM A;  4Q4X 3;  1QHD A;  3SCG A;  5A70 A;  1UKR A;  2WNE A;  2H0V A;  4I01 A;  2WA4 A;  1V9U 3;  1OQE A;  4GB3 1;  3VBF A;  4BLI A;  1DQ0 A;  1UY3 A;  2WR9 A;  4D7T A;  4EJR A;  2W1S A;  3D0S A;  1NOV A;  2YU2 A;  1WW6 A;  1AR6 1;  5IHR A;  1TE1 B;  4Q0P A;  3VZN A;  5GJ6 A;  1APN A;  1NCR B;  2UYA A;  2YMZ A;  4WVW A;  3MZH A;  4YGE A;  1AYM 3;  5LAS A;  1DCS A;  3I2K A;  1U5X A;  2VZ3 A;  3PUA A;  4K40 A;  1AL0 G;  4A7K A;  1ULE A;  5A7N A;  1QJY 3;  2HWD 1;  4Y5T A;  1PK6 A;  2DBN A;  3AKR A;  1RMU 3;  2VGD A;  5A7Q A;  4DFS A;  1NA1 C;  1UKG A;  3ZYB A;  4D69 A;  1WWY A;  3DGT A;  5IFT A;  3MPB A;  2Y38 A;  4TTG A;  5JZG A;  1VBA 3;  1YUD A;  2DFB A;  2RS3 3;  4J6G A;  2TBV A;  1UOB A;  1W0O A;  2BRT A;  2JG8 B;  2JXA A;  2XVL A;  4COY A;  4ORF A;  5KC6 A;  1PZ7 A;  1W9S A;  2BNN A;  5GLZ A;  4OHY A;  2WBK A;  1LOE A;  5FO9 B;  5IAV A;  1QOS A;  1W6N B;  1IKP A;  1YRZ A;  2XQX A;  3AL5 A;  4YVW B;  5C4W B;  5ABJ C;  4IV3 A;  2CHH A;  4XET A;  1LUL A;  5JR7 B;  1JYV A;  1O3Q A;  4FP3 A;  4XC9 A;  1MQT A;  4UAP A;  1BEV 2;  3AYD A;  1S2E A;  1RUE 2;  2XXZ A;  4XUN A;  3ATG A;  3ILN A;  2PEL A;  2YFU A;  1O8P A;  1UPI A;  1SBE A;  1HN0 A;  5AVA A;  2QNK A;  3H7Y A;  4NRO A;  2KM2 A;  2RJ2 A;  2Y8K A;  3RWK X;  2RV9 A;  3EBR A;  5FV3 A;  3RI9 A;  3N7M A;  3K51 A;  5JPM B;  1V9U 1;  3D4K A;  1CR7 A;  1KGY A;  3BIE A;  3OSD A;  5FP9 A;  2C5D A;  1K5J A;  5LCW L;  4OUM A;  1DGR N;  1GWK A;  3KV5 A;  3MID A;  3VBR A;  5BUV A;  2QZ3 A;  3VBU B;  2I45 A;  4LKD A;  1X7N A;  5LA2 A;  5KBF A;  2FMY A;  1XJA A;  1DFQ A;  2ENR A;  1DYK A;  3I2D A;  4XFA A;  1BK1 A;  2Y6G A;  2P37 A;  3M3O A;  1U0A A;  3POB A;  3WG1 A;  2RR1 3;  4JRA A;  2EAK A;  4YW6 A;  4Q4W 1;  1QNY A;  3VDD A;  1N3P A;  3OD4 A;  2ZX4 A;  5A3O A;  4CU9 A;  3CF6 E;  3D0J A;  2VUJ A;  4DUW A;  4OUL A;  3KF5 A;  2IXL A;  4CSW A;  4DNY A;  3Q8F A;  2VNO A;  3OJB A;  2VZQ A;  3VKF C;  1RHI 1;  2ZX1 A;  1QH7 A;  1WMX A;  3PME A;  3ZN6 B;  1OHF A;  1A8M A;  1W39 A;  3H3L A;  2WZP P;  3ZYJ B;  3M3Q A;  2KXL A;  2ZZJ A;  4ARY A;  3O1P A;  1OBN A;  3VKN A;  2H0B A;  2R0H A;  3RZK A;  3P5B A;  1YQ8 A;  2BUK A;  4IGP A;  4KBZ A;  2WS9 2;  3J4U H;  3PL0 A;  4WM7 B;  5FZL A;  5I0R A;  3G7D A;  2VBP A;  1RUD 2;  1QQP 2;  5EQU A;  4BXF A;  1J58 A;  3EYP A;  4FPG A;  2W46 A;  1L7L A;  4LOS A;  4AEM A;  1W3X A;  3H3Z A;  1VAM A;  2IVI B;  3SLI A;  3M8L A;  5JCT A;  1QOT A;  3GZT B;  1UY1 A;  4CP9 B;  1POV 3;  2JDM A;  4Y1X A;  5AVP A;  4CEY B;  1ULC A;  1UOF A;  1UF2 C;  2AEZ A;  3KQ4 B;  4QKB A;  3MO4 A;  4IEY A;  4S2D A;  3TNP B;  2E63 A;  4BA6 A;  3ASI A;  3ACI A;  1JOJ A;  1JXN A;  2JIG A;  3WEZ A;  4Q27 A;  3O1U A;  1GZT A;  1F9K A;  1H2L A;  1W6M B;  3KGL A;  4KWU A;  2FHR A;  3AKS A;  5JOW A;  3V0B B;  3URF A;  3O12 A;  3JBG 1;  3P3P A;  4QPI A;  3BB6 A;  4IGO A;  3K48 A;  4WV8 A;  3WF4 A;  1KDM A;  4Y1Z A;  3NNM A;  4BXS V;  1AX1 A;  1UXZ A;  1HV0 A;  4CEW C;  3GCX A;  3OYW A;  1BYH A;  4P5Y A;  5IVF A;  1D7P M;  1FMD 2;  1HB4 A;  2G9G A;  2BWC A;  3P1I A;  3F95 A;  4Q0Q A;  5I93 A;  1L3J A;  3RDI A;  1LHV A;  3T09 A;  4CCO A;  4L9B A;  2RVA A;  2WII B;  5FP3 A;  4YSF A;  2O8Q A;  3V56 A;  4XTM A;  5FZ3 A;  2A6X A;  3UT0 A;  3FLR A;  4LO8 A;  4A6O A;  4N53 A;  3PU8 A;  5ERL A;  4ONU A;  2JE8 A;  5KHK A;  4MZU A;  4PJY A;  4DPN A;  3GHN A;  1FNZ A;  1GV9 A;  1O4Y A;  4HBN A;  4QU2 A;  4NIG A;  4PDW C;  4OI1 A;  2ZGN A;  2QBX A;  1JI6 A;  3B00 A;  1Q8P A;  2WFF 3;  1IPJ A;  1OT5 A;  3E5X A;  1MEC 3;  3ACH A;  2FD8 A;  1XU2 A;  1BXH A;  3MYX A;  4GWM A;  1S0D A;  4XCB A;  3VHR A;  5A32 A;  2OQ6 A;  2RM2 3;  3JCI A;  3VKO A;  4B7K A;  2OXB A;  1W06 A;  1R08 3;  4YGB A;  1UMZ A;  2P3J A;  1ND2 A;  5JMO A;  5HV4 A;  2WWJ A;  5FYS A;  1KD7 A;  3I2H A;  1RXF A;  3N7K A;  4LNV A;  1R1A 2;  3J26 N;  4C91 A;  2GN3 A;  1ENR A;  4GH4 B;  4AED C;  1OLM E;  5LEK A;  1COV 2;  1D0H A;  1Y7B A;  2IVJ A;  1HW5 A;  5CFD B;  3ZXA C;  3VLB B;  2JDY A;  4BM8 A;  1H8T B;  2DVA A;  2LS6 A;  2WYS A;  2UY8 A;  3GZA A;  2JIC A;  3DXT A;  2MHF A;  3N35 A;  3N9O A;  5FMD A;  3AP7 A;  4CE8 A;  4DXR A;  3BOD A;  5B2G B;  1DG6 A;  1H1A A;  2Y64 A;  3ZKY A;  2G4I A;  1LRH A;  4Y26 A;  5ACA 2;  1N1T A;  1OA2 A;  2WT0 A;  4NIH A;  1AF9 A;  4XJU A;  1VAL A;  3RVH A;  5CFC C;  2F4L A;  3VBH B;  5BYN A;  4IEQ A;  1WCK A;  2X05 A;  2ZGP A;  2E7T A;  5DZF A;  4XDQ A;  5F3I A;  3ZFF C;  3UGH A;  3OUJ A;  1C4R A;  3WZ1 A;  3JU9 A;  1RUG 2;  3PUH A;  3AYA A;  3HN1 A;  3KWV A;  2OUJ A;  1MZF A;  1STM A;  3HEI A;  4KI5 M;  2XML A;  4NWV A;  2UY9 A;  1ZZB A;  1K42 A;  2XKO A;  1XOY A;  4CTE A;  2D93 A;  4G9S B;  4ZU7 A;  2R7E B;  3I54 A;  4CUC A;  3AKT A;  3H8O A;  5AC9 3;  1O59 A;  1SQ4 A;  2WFF 1;  3HNM A;  4XF1 A;  1XNA A;  3LDR A;  1MEC 1;  2QQN A;  1ULP A;  1VBE 1;  3R4U A;  4X6R B;  1QKQ A;  3I2J A;  5JSP A;  3O1O A;  2R06 2;  4LIU A;  1HXS 2;  4J25 A;  4KU7 A;  1X9T A;  3ZMO A;  4LIV A;  5F6L B;  3ES4 A;  1AR9 2;  3ME2 A;  3ZSE A;  1CON A;  5C9A B;  2FMD A;  4MYE A;  4B29 A;  2LM3 A;  4LUK A;  5GZE A;  1KRI A;  1DZT A;  4NO4 A;  3AKQ A;  3M1H A;  2BJS A;  1X50 A;  2BGO A;  4OCT A;  2J1U A;  3THP A;  4CPB A;  5T50 A;  3IPV A;  3V0A A;  1WA6 X;  3C8X A;  3DEC A;  4XPV A;  5CZK A;  1W8Z A;  5IVJ A;  1VBC 1;  2R0F A;  3B69 A;  4XF9 A;  4Q8K A;  1NG0 A;  2XBO 1;  4XUT A;  1UU5 A;  2DUR A;  1IS4 A;  1SZB A;  4MX3 A;  2P6C A;  5JXJ A;  1M06 G;  4XW3 A;  5FK7 A;  2SLI A;  3FFZ A;  2Y26 A;  4K8F A;  3KHC A;  1DBN A;  1DYO A;  1IKQ A;  2BFU L;  1JZ8 A;  4IDZ A;  4EQV A;  4UFK A;  1RB8 G;  2ZGK A;  3MLK A;  4DUX A;  5J96 B;  1S2K A;  2BNO A;  4P9X A;  1Z78 A;  2V4V A;  3LCP A;  4QXC A;  4U36 A;  2R16 A;  5D8A C;  2YB7 A;  3UV9 A;  3ZM8 A;  4HKL A;  2VVE A;  1NQD A;  4YZ2 A;  4XYX A;  2Z2S B;  2HYK A;  2MEV 2;  2ZOE B;  1JBC A;  3D3A A;  4GAZ A;  2VMF A;  5F3E A;  4CU6 A;  2IZW A;  1OOP B;  4LBQ A;  4NE9 A;  4RN5 A;  3ILF A;  5LBF A;  2WZE A;  2A5Z A;  1BHG A;  4AGV A;  1VRH 3;  3JB8 A;  5FMO L;  3WP3 A;  5JDB A;  4CCJ A;  1BEV 3;  1H1M A;  3ZPY A;  1RUE 3;  4Q4Y 3;  1PIV 3;  4RS5 A;  4S2H A;  4LK7 A;  4TSV A;  3FZ3 A;  4E2S A;  5BNN A;  2WZR 2;  3NJX A;  2K2S A;  3S5A A;  4AI0 A;  2D6L X;  2K0G A;  4CCL A;  1CAV B;  3ZSL A;  1VR3 A;  2DTW A;  3NW4 A;  1YXW A;  4NPL A;  1ZZC A;  2Z5W A;  2Z69 A;  5BNO B;  1U5Z A;  4MET A;  3CU7 A;  2RMU 3;  4YG6 A;  5A33 B;  1BQP A;  3D8C A;  4LHN A;  4YW5 A;  1QMJ A;  2IUW A;  2YHJ A;  4B4Q A;  2QDN A;  2VQT A;  5FY9 A;  5BY5 A;  5JZG C;  1I1E A;  3LFM A;  4J1X A;  5TSW A;  4GB3 2;  4DXS A;  2O1Q A;  1BZW A;  2PHF A;  1YI9 A;  1ZRI A;  3U10 A;  1W8N A;  4L2N A;  2YGM A;  4KG8 A;  5EHD A;  4AG4 A;  2J1V A;  3NNG A;  5T5O A;  4XOG A;  4JC1 A;  4JDM A;  1AR6 2;  4AI1 A;  4NRQ A;  3VKL A;  1ST8 A;  4IV3 C;  2WSV A;  3VHP A;  2BDR A;  2B9V A;  1S55 A;  1CAW A;  3KCX A;  1BBT 1;  4PT6 A;  1MQT C;  2QJV A;  2PFW A;  3MF9 A;  1H2N A;  1QJE A;  2BBA A;  4NN0 A;  5K4L A;  1W90 A;  1QGL A;  2HWD 2;  2EXK A;  3BPS A;  2SBA A;  1CD3 G;  3VBO A;  2CGO A;  2ZAA A;  5JSO A;  2XB6 C;  2J1T A;  5EPA A;  4TZD A;  5JWP A;  3ZFG B;  2W1W A;  2WQZ C;  3ITQ A;  5APA A;  5A3T A;  4RQP B;  2WT1 A;  3H1M A;  4QPG A;  1RUD 3;  5DUV A;  1WCU A;  2RDS A;  4LBL A;  2F4P A;  4NVP A;  1OUR A;  2QQI A;  4UBG A;  1WUV A;  3RWN A;  3OUI A;  2WYF A;  4HSL A;  2CL2 A;  3VBR C;  2K9Z A;  3AP6 A;  3SCH A;  4ASM B;  1KS4 A;  2JJ6 A;  1JTZ X;  1C3H A;  2D6M A;  1TME 2;  2GH2 A;  2EIE A;  5JI7 A;  2K46 A;  2BVV A;  3J7H A;  2V4A A;  1FXZ A;  3PMS A;  3IKW A;  1W9T A;  1WLT A;  4FPE A;  1UX7 A;  2OPW A;  5GKA C;  3KT4 A;  2H6B A;  2GMP A;  3AJZ A;  3N36 A;  5L9R A;  3VDD C;  3WUC A;  5FKB A;  4E4S A;  2PQS A;  1C8M 3;  2WDB A;  1W6O B;  2O8O A;  5FJK A;  4SLI A;  1GOH A;  2WA3 A;  1HN1 A;  1RL3 A;  1RUC 1;  3EHK A;  1HJF A;  1ZA7 A;  1UN1 A;  4QMA A;  2QVS B;  5BXX A;  5KXB A;  4Y4Y A;  2PN5 A;  1SDD B;  1W2T A;  4K9S A;  4BQ5 A;  3HQR A;  1UMI A;  4ASL A;  4CDQ B;  1OC1 A;  1G9F A;  1EV1 1;  2OVU A;  1ZBA 2;  2VOV A;  4XMA A;  5L7O C;  2Y6K A;  1DU3 D;  1GU3 A;  4TLF A;  2GMM A;  2AAC A;  2CDP A;  1W2U A;  2JB8 A;  4OHZ A;  4HKW A;  4COZ A;  2YBK A;  3B94 A;  3JUU A;  4Q4V 2;  4BJ0 A;  2D6P A;  3T2P A;  1VAV A;  3VL9 A;  4AI2 A;  4BK4 A;  1GZW A;  2YPD A;  4JGY C;  4CCK A;  5ISL A;  4HT1 T;  4BME A;  4ZKT B;  3LZZ A;  2HWB 3;  1D4M 2;  1XNC A;  4XMI A;  5IUQ A;  4OQ9 A;  3VD7 A;  4BIO A;  1O3T A;  1RUO A;  2CGP A;  2NQY A;  3AZY A;  4EV0 A;  3S7I A;  2PYT A;  3EJK A;  3RI8 A;  4OQ8 A;  3ZKU A;  1IPS A;  2LW8 A;  5FY1 A;  4CDW B;  1CAX A;  5BV6 A;  3I2G A;  1ZRC A;  4MG2 A;  1GAN A;  4QDS A;  1RUH 1;  4GA9 A;  3AZX A;  1RHI 2;  3JD7 2;  3WDX A;  4AFD A;  2DCT A;  2WS9 1;  2FDI A;  2B7Y A;  3QD6 A;  5I0U A;  1QQP 1;  2IFR A;  3TBD A;  1NCQ B;  4QPI C;  3U37 A;  3ZFE B;  2NZ9 A;  1W8U A;  1S0I A;  4ET7 A;  2RJK A;  2VNR A;  2JDP A;  3PIG A;  5CA6 A;  5FPU A;  1SEF A;  1HB3 A;  1Z0H A;  1R1A 3;  1KEX A;  1REF A;  1W2N A;  4BPZ A;  4A6S A;  3VUO A;  1JMU B;  3S5Q A;  4OZX A;  4CU8 A;  2W68 A;  2ZML A;  2ZHK A;  4LKS A;  3LE0 A;  3O0X A;  4XXP A;  5FLJ A;  1CQ9 A;  1C1L A;  1EUT A;  1NCR A;  1H8V A;  3AL6 A;  1CIW A;  1DQ1 A;  1FI2 A;  4CCD A;  3SKJ E;  4N53 C;  5C5T A;  1J59 A;  5FWE A;  4KWK A;  1VBB 2;  3CJI B;  3O1M A;  4M0H A;  1NXM A;  1F8V A;  4LBK A;  2WIN B;  4FOW A;  4R9A A;  1FMD 1;  3JBG 2;  2P5B A;  1LGB A;  1OUS A;  4ZXE A;  4L97 A;  1A6C A;  1GNZ A;  1XE0 A;  3VL8 A;  1JZ5 A;  5T55 A;  5KXD A;  2JG8 A;  4MV2 A;  3A4U A;  2VMH A;  3OGG A;  1RUG 3;  1BCX A;  5ANQ A;  4A2U A;  4AHY A;  3AZV A;  5FZG A;  1H30 A;  3MUZ 1;  2VUL A;  5FZE A;  4XHB A;  1U5I A;  4HG6 B;  1ND2 C;  5FZC A;  3MPP G;  1MZ6 A;  1W6N A;  2W1Q A;  4YVW A;  5C4W A;  1JUH A;  2YFZ A;  2WWU A;  1LOC A;  1TMF 2;  3HJR A;  3CDZ B;  1UO9 A;  1UZZ A;  3OCP A;  4HOO A;  4QX2 A;  5FY8 A;  2MPF A;  4ZU4 A;  5JR2 A;  4DUV A;  4CUA A;  3DYM A;  1YLL A;  3RZG A;  4NHM A;  2YC2 A;  3OF1 A;  1OVP A;  1H1I A;  4YRD A;  2GN7 A;  3DKW A;  3GHM A;  4CUG A;  2HJI A;  3I4I A;  3W5M A;  2R06 3;  2GAU A;  2XHK A;  4XVH A;  3WW2 A;  4E4D X;  3G6J B;  4LIT A;  1AR9 3;  2R1B A;  4P5H A;  4FFG A;  2VZU A;  4LBJ A;  2W39 A;  1GUI A;  3C7O A;  2GU9 A;  5FYB A;  4F7Z A;  2HWC 1;  1FYU A;  1KS5 A;  3ZVX A;  4BHP A;  2JDZ A;  1UOJ A;  2ZS6 B;  3VBU A;  1COV 1;  3WW4 A;  1W9F A;  4YPJ A;  3OY8 A;  1F15 A;  4NJ4 A;  3RJR A;  4A3Z A;  1IQD C;  1GNH A;  5FBZ A;  2VU9 A;  3WG3 A;  4YW4 A;  1XSR A;  3CKH A;  3I59 B;  1CIY A;  5FAX A;  3IDA A;  1NLQ A;  4GIQ A;  5IFP A;  5ACA 1;  4K7J A;  3S0M A;  4PLM A;  4EWD A;  1XSQ A;  3JXS A;  1W8W A;  2VEC A;  3L2H A;  4H7L A;  4QB1 A;  3ZN6 A;  2ARB A;  5F8P A;  1V6O A;  2MEV 3;  2IWG B;  3CQO A;  2FZ1 A;  3HPN A;  4N43 B;  4BQ1 A;  3CZU A;  3OGS A;  1UAI A;  3RYR A;  1RUG 1;  3LWC A;  2XJV A;  3I3Q A;  3NNL A;  2C1F A;  5FMC A;  1I5P A;  2ZKL A;  4PLO A;  4L0P A;  3O1V A;  3S6P A;  1AHS A;  1KFU L;  3Q8A A;  3RSJ A;  3KHB A;  1OFN A;  2PHW A;  4OMD A;  3BKZ A;  4U2A A;  1XXN A;  2VVD A;  1JYW A;  2ZX2 A;  4L99 A;  4AVA A;  2HWF 3;  1HDK A;  3VDB A;  1J83 A;  2WZR 3;  1CJP A;  2BWA A;  2WFP A;  3MIC A;  5FY4 A;  2JE7 A;  4FPC A;  3T0D A;  4CEY A;  3H0O A;  3WVJ A;  4ERO A;  1YCI A;  1S4C A;  2J1E A;  4KNC A;  4XJZ A;  5J98 B;  2V09 A;  2ZX0 A;  5KR7 A;  2JB4 A;  2PA7 A;  1HXS 1;  2W2I A;  5IW0 A;  3WNX A;  5LA0 A;  3RZM A;  4KWL A;  1W6M A;  1WLC A;  2CAV A;  3OG2 A;  3WQB A;  3V0B A;  3NV1 A;  5FUP A;  2VXJ A;  4Y4R A;  1JZ3 A;  1QH6 A;  5CVR A;  5T5J A;  1S0F A;  4Z07 A;  5IAX A;  4NHY A;  4GKY A;  3WY6 A;  3NMB A;  3VGI A;  4GB3 3;  3H8U A;  3USU B;  1UW8 A;  2VQU A;  3OD0 A;  3PJQ A;  1OLR A;  1XNT A;  1AR6 3;  4Z2A A;  4YFW A;  4K1Z A;  3FHQ A;  1J3R A;  5JIA A;  3U14 A;  3TAY A;  4JQR A;  1ZX5 A;  4K6B A;  1U12 A;  1ZZ7 A;  5BPX A;  3ZDS A;  2PTM A;  1W05 A;  3OB8 A;  2HWD 3;  4RS5 C;  1ULO A;  2D3P A;  4A44 A;  3GYD A;  3BYW A;  4GUL A;  5BNN C;  4V2W A;  4X8N A;  2ZGO A;  4LQR A;  3BOP A;  2VJX A;  3LPG A;  1QJF A;  3T1M A;  3R05 A;  3VDA A;  5I0T A;  3SMH A;  4AVB A;  4RD7 A;  5FYV A;  4Y24 A;  2V72 A;  4D6S A;  2XJU A;  3O7O A;  3RRD A;  1QF3 A;  3H7J A;  3GGL A;  1FV2 A;  3T0B A;  1S0B A;  3TYJ A;  4DY3 A;  2H6C A;  4UFL A;  2YBP A;  5T3N A;  5A6X A;  3E6C C;  2QUO A;  4Y3O A;  1AJK A;  4MGK E;  5A3U A;  2LTN A;  3DUI A;  1PMH X;  1TME 3;  4IEW A;  4QAW A;  1EPZ A;  1HRI 2;  4ZXK A;  4GH4 A;  4FT8 A;  1CPN A;  3UJO A;  4C1X A;  1WW4 A;  5A1L A;  2ARE A;  2CAU A;  2RE9 A;  3W58 A;  5FZH A;  5CFD A;  4ZY9 A;  3ZLI A;  4D6R A;  1H8T A;  2EAL A;  3M4F A;  1UX6 A;  3I3D A;  3ZIX A;  3I3M A;  1WMF A;  3MDP A;  4AAP A;  4QHB A;  3Q9O A;  4IER A;  3SCF A;  2GZW A;  3AP4 A;  2P4E A;  4RHV 1;  2IXI A;  3TB0 A;  2C26 A;  4MGS A;  3VBO C;  3HVD A;  4IL7 A;  2D44 A;  2W0X A;  2BBV A;  5E16 A;  3SEE A;  1RTV A;  4RFT 0;  5I0S A;  1TEI A;  1DGW A;  1CX1 A;  4XQD A;  4P9L A;  3VBH A;  1GQG A;  3OUH A;  2QQK A;  1PMI A;  3HWJ A;  4QGN A;  4YW3 A;  1VJ2 A;  2VD7 A;  4Z82 A;  3GBG A;  4QPG C;  2YRO A;  3E5Q A;  4FOV A;  1H9P A;  3GDB A;  2RS1 2;  2VCA A;  5B4N A;  3BTY A;  4YGC A;  5I0D A;  2CWS A;  3B93 A;  3AC0 A;  5J36 A;  5KWR A;  4MVT A;  4Q4W 3;  4W4Z A;  4Q8L A;  4NMI A;  4D0Q A;  2OZ6 A;  5LB6 A;  3H9A A;  1VAK A;  1VB4 A;  2BW8 A;  4ISQ A;  3AYE A;  2YYO A;  1BBT 2;  1IG3 A;  2NN8 A;  2GNB A;  4OI2 A;  4XAA A;  3WW3 A;  4B1L A;  4QXK A;  4GWI A;  1GSL A;  1CZS A;  2VPV A;  1RHI 3;  3B02 A;  3JD7 3;  2XLG A;  3MBW A;  3SH4 A;  3ZXL A;  5L9V A;  2XPJ A;  2NPI A;  5DAV A;  1PGL 2;  2R04 1;  1UPS A;  2BV4 A;  1SLL A;  2ZGT A;  3U1X A;  4AFM A;  4BIS A;  4RGK A;  2D5F A;  4XQ4 A;  2AR6 A;  5C3Q A;  4QDQ A;  2Q1F A;  5LK5 A;  4CRQ A;  3ZYP A;  4AHX A;  1HB1 A;  3POG A;  3AMH A;  2XL9 A;  2E31 A;  4OUS A;  5C9A A;  2OII A;  3PUR A;  5D21 A;  1TME 1;  4LT5 A;  2ET7 A;  2I2S A;  3U07 A;  4DMI A;  4F83 A;  5DXD A;  1MS1 A;  2WNU B;  4AYU A;  4FTB A;  1RUF 2;  3E6D A;  3FLT A;  4P02 B;  5IVE A;  5GLW A;  4CP0 A;  3JQX A;  3SHR A;  3N9M A;  3K2O A;  1PVC 1;  1SFY A;  2RJL A;  3AP9 A;  3LIG A;  4RYD A;  4YG0 A;  1S0E A;  3P3N A;  2ZGL A;  1JYN A;  2BTV C;  1PO1 1;  4JTO A;  1DZR A;  2CV6 A;  3PUQ A;  3VD3 A;  3OGR A;  3O5S A;  1XPW A;  1YHF A;  2NM1 A;  2XVK A;  3ETP A;  3S7E A;  4ZZ5 A;  1RUC 2;  1ACC A;  1VP6 A;  1ZBA 1;  3JBG 3;  1QOO A;  3EXU A;  5F9T A;  5FOJ B;  3MV0 1;  2FDH A;  4GQ7 A;  1YIF A;  4Q4V 1;  1D0G A;  1EV1 2;  5A6Y A;  2JD9 A;  2MNG A;  5LZ6 A;  5K0U B;  1VRB A;  2CTV A;  1O6U A;  3TOJ A;  1EPW A;  2OPK A;  3RPQ A;  3BTZ A;  1OOP A;  4BZ4 A;  2P3Y A;  1D4M 1;  1UD1 A;  4R4X A;  4I09 A;  5LRR A;  5LA1 A;  1F2N A;  2XJS A;  4XJW A;  3THD A;  5F6K A;  1OA3 A;  2QQV A;  4K20 A;  1RJ8 A;  1TMF 3;  1X82 A;  1OXC A;  1UYZ A;  4AEK A;  2V5D A;  2GC3 A;  3LDB A;  5BNP B;  4FP2 A;  1NCR C;  5I8S A;  1DIW A;  1D2S A;  1GP4 A;  1PHM A;  2Y6F A;  3HT2 A;  2JIJ A;  1ENQ A;  3JD7 1;  4CCM A;  4GWJ A;  2C9A A;  3MW3 A;  1CAV A;  4IE6 A;  5FZM A;  4ZHN A;  5KHG A;  2VM9 A;  1KJR A;  1LOF A;  3IN9 A;  4XF4 A;  3U11 A;  1VBD 2;  2V5Y A;  3A23 A;  1YWK A;  5FCC A;  1RUH 2;  3GM8 A;  5FKC A;  3RG0 A;  5BNO A;  5A33 A;  1XBF A;  4DB5 A;  1UU4 A;  2ET1 A;  3HT1 A;  4IEU A;  4DOU A;  1LOB A;  4A7Z A;  4O9G A;  4UBH A;  2B45 X;  4JGY A;  1LGC A;  5CAZ A;  2VE1 A;  3AFG A;  2BOI A;  4XHX A;  1OPM A;  2BGP A;  2JG8 C;  3FUO A;  3HN3 A;  4QGL A;  4ZS2 A;  1H4G A;  1YI7 A;  1NQJ A;  4M3C F;  4RR3 B;  3VZO A;  1TQ5 A;  2EIC A;  4JV4 A;  1HX6 A;  2ZX3 A;  4XFC A;  2DFC A;  3UL2 A;  1DZQ A;  4LLF A;  4QD2 A;  5DDJ 1;  2A73 B;  1X9P A;  3K4Z A;  2E7A A;  5JLV A;  3I3E A;  4YVW C;  5C4W C;  4LBM A;  2WUH A;  4XJA A;  1H2K A;  2IXK A;  3O1R A;  4LA2 A;  1VBB 1;  2EVX A;  4CDX B;  4HL0 A;  3T4V A;  1WA4 A;  1V6M A;  3KT7 A;  5D2A A;  4BH9 A;  1RUN A;  2UUR A;  3B7M A;  3DYP A;  3QBQ A;  3UGF A;  4WBB A;  3WT3 A;  1ULF A;  2VZV A;  3EB7 A;  3BTA A;  1LGN A;  4QPY A;  4FFF A;  3AZZ A;  1O91 A;  4G3Y C;  4HMZ A;  3VZK A;  3B9I A;  3WQ0 A;  2JEC A;  2LAL A;  5F7U A;  3ZFG A;  4I2O A;  5IT6 A;  4RQP A;  4H2A A;  3T3Y A;  4E8D A;  2YU1 A;  4WVV A;  5KC5 A;  4FPJ A;  3BTX A;  3WNL A;  4EN6 B;  2N7G A;  4BDV B;  4M3C B;  3R0R A;  5FLI A;  2DVG A;  1TMF 1;  3PDQ A;  1SLT A;  3VBU C;  4R4Z A;  1B35 B;  2XJP A;  4UW5 A;  1XQN A;  2GND A;  2PHX A;  2Y34 A;  3C2U A;  3KB5 A;  4FQ4 A;  4CXY A;  3WV6 A;  3MEP A;  4D6Q A;  2BFU S;  5E8A A;  4QHO A;  1A78 A;  3SKV A;  2VZS A;  3K77 A;  5CYY A;  1LES A;  5EIY B;  3FL7 A;  3PJY A;  1RUI 1;  1W6O A;  5G04 L;  1N1S A;  1VBE 3;  2C24 A;  1AX0 A;  2CY6 A;  2W08 A;  1MS8 A;  3AM2 A;  3EQE A;  3M7A A;  3RZJ A;  1Q8Q A;  3RMY A;  3ZYH A;  4HXC A;  5JMC A;  2JG9 B;  4QM9 A;  5FYU A;  3INA A;  4CDQ A;  4XBN A;  2CU5 A;  5A3L A;  3W20 A;  2A70 A;  1M4W A;  5FMO S;  3KSC A;  2BP6 A;  2E33 A;  4BQ4 A;  2HWC 2;  5IJR A;  4WM8 B;  4WM7 C;  3NV4 A;  2VOT A;  4XJ8 A;  4BOW A;  4XFG A;  2ID4 A;  1PMJ X;  4ITC A;  1A34 A;  3RYK A;  1ZBE 2;  1FV3 A;  2UWB A;  5JPN B;  4OHW A;  1VBC 3;  2DVD A;  5CIR A;  1W99 A;  5IK7 A;  1SCR A;  1MS0 A;  1W03 A;  2XBO 3;  4Y1U A;  1G9A A;  3CLP A;  5FYT A;  4P14 A;  4FFH A;  3IAP A;  4I0A A;  1DP0 A;  3AXD A;  4M01 A;  4XZU G;  2ETE A;  3UES A;  5FFO C;  4CEY C;  4XFI A;  2EXJ A;  3QLQ A;  2W87 A;  4CDW A;  2ZCW A;  1POV 0;  2TUN A;  2ZGU A;  1WCD J;  2ZGS A;  3TN9 2;  1RC6 A;  1X36 A;  3TWI A;  1J3Q A;  1UIJ A;  3ECQ A;  2B39 A;  1ZRR A;  2YUE A;  3WIN E;  1YQ2 A;  2DDU A;  3LKJ A;  1W8F A;  1ZRF A;  5DAP A;  1LB2 A;  1NCQ A;  1SBF A;  1L7R A;  3ZFE A;  2Y0O A;  5C6C A;  3CIH A;  3KCY A;  3KCC A;  4YVS B;  3QAC A;  4LE3 A;  4LMF A;  4QQP A;  3LOB A;  1US3 A;  4BQW A;  5KXE A;  1PZ9 A;  1WGP A;  5EV7 A;  1HRI 3;  4DQA A;  4PF1 A;  4OHX A;  3N9P A;  2AC1 A;  3VBS B;  3C7H A;  4JRL A;  1X8M A;  3VBF B;  2B46 X;  3DN7 A;  3WP4 A;  2YDE A;  1SFN A;  3ELN A;  3J8F 2;  4HKO A;  2W9X A;  4EWE A;  4JVA A;  5I91 A;  5GZD A;  4XIL A;  4DXT A;  5IK5 A;  4R52 A;  1ULG A;  1C5I A;  1UY0 A;  2JD4 A;  2XGX A;  4HVO A;  4NPR A;  4BK5 A;  2O0O A;  1Z7S 1;  3T2Q A;  4BB3 A;  3CJI A;  3OGJ A;  3KM5 A;  4JGZ B;  4AOC A;  1QJZ A;  2F17 A;  2WRA A;  4I0W B;  1K5M B;  4DEV A;  5CKM A;  2C9K A;  5KHI A;  1PK6 B;  3SH5 A;  4LO5 B;  1PGW 1;  1W6P A;  1CES A;  2FDJ A;  1KDK A;  4IE4 A;  4IE5 A;  4Y20 B;  4COW A;  5FPX A;  1UY4 A;  4YW1 A;  2WJS A;  3W59 A;  3WF2 A;  4YLZ A;  4XXA A;  4MHU A;  1XE7 A;  5JOY A;  1TNF A;  5A3W A;  3FUQ A;  4NRP A;  4K8R B;  4GH4 C;  1BBT 3;  1KJL A;  4Y33 A;  4H7M A;  4IET A;  2JEM A;  2XKP A;  1QJX 1;  1POQ A;  3GNE A;  1ZYB A;  2ARC A;  5CFD C;  1NAE A;  1TNR A;  5JXH A;  1H8T C;  3SEP A;  5FO8 B;  4NHK A;  2YV8 A;  3LIH A;  4AI9 A;  1XC6 A;  2NLR A;  1ULD A;  3AYC A;  1CVN A;  2DYC A;  2G9F A;  3KS7 A;  3KV6 A;  1O3R A;  4PF5 A;  2BOJ A;  3IDB B;  5HPO A;  3LEI A;  5AFE A;  4QT6 A;  4PI2 A;  1SPP B;  5FR3 A;  3DL3 A;  3PTY A;  3B5L B;  4GJY A;  2FBE A;  1GOF A;  1SLI A;  1HRI 1;  3E1F 1;  1W2O A;  2F6B A;  2AYH A;  3C3V A;  3VBH C;  1PVX A;  4GJZ A;  4WVM A;  3I2O A;  3VB9 A;  3MFA A;  1GYK A;  4LO4 B;  4LTA A;  1RUF 3;  1RIT A;  5T54 A;  1GOG A;  4JCK A;  2JX9 A;  3N9N A;  1R09 2;  1XNK A;  2YPJ A;  1VB2 A;  3OPT A;  4QWN A;  4IES A;  5E89 A;  5FRE A;  3ZN5 A;  4DO0 A;  4D94 A;  4QX8 A;  4AQS A;  3I59 A;  2P2K A;  2A1X A;  2W5F A;  4CXX A;  3PU3 A;  2BEO A;  2R07 2;  2ZHN A;  5I8Y A;  1RUC 3;  3U4X A;  3WD5 A;  1XYP A;  1QJU 2;  3DEM A;  1UOG A;  3ZSM A;  3WHT A;  4RHV 2;  4AQ2 A;  2XJT A;  2W1U A;  1T6G C;  1E5H A;  1EV1 3;  1WLW A;  3LSD A;  4UYB A;  1AL2 1;  2A71 A;  1MAC A;  3QH6 A;  2RS1 1;  2ZTN A;  4FTS A;  2X53 S;  4E27 A;  2XDV A;  3T0A A;  3LB9 A;  3I49 A;  3V65 A;  1WKY A;  5C7G A;  2BVB A;  5C9A C;  1DHK B;  1IZ3 A;  1J3P A;  1YJK A;  3A0K A;  1XB9 A;  5JIU A;  4MXW B;  3JQW A;  1H6X A;  1AR8 2;  2Z42 A;  4CP9 A;  4IE7 A;  4QX7 A;  3I2F A;  4ES8 A;  1PGL 1;  4JX0 A;  1GZC A;  4ES9 A;  2HWE 1;  3I3B A;  1F4A A;  3MFC A;  1RUH 3;  2D3R A;  2WS9 3;  3E97 A;  5J37 A;  5ANN A;  2R04 2;  1LKN A;  3NJY A;  1QQP 3;  2ZKN A;  4YZ3 A;  3UYJ A;  3WQ1 A;  4AQ6 A;  1W0P A;  3MLL A;  1YC6 1;  4XF3 A;  1I5Z A;  3QCW A;  4JAA A;  1SMV A;  4TXW A;  5E6H A;  4IV1 B;  3USU A;  1RUF 1;  5CB7 A;  3ENR A;  3ZOI A;  1OOP C;  3HAG A;  2BER A;  2VME A;  3GXU A;  2E32 A;  4NAO A;  2JDH A;  1BVP 1;  2WL1 A;  4DRR A;  1PVC 2;  4AI8 A;  3BCW A;  5EJ1 B;  3MI8 A;  4QQO A;  1JH5 A;  1PO1 2;  3ETQ A;  3MUY 1;  5FZD A;  5E88 A;  4OHV A;  1IS6 A;  4B4R A;  5FXZ A;  1FMD 3;  1LOF C;  1NX9 A;  4A45 A;  2BU9 A;  5BNO C;  5FDB A;  2J42 A;  4HVR A;  1W2A X;  4KG0 A;  1G9C A;  2VZP A;  3KLS A;  1V6N A;  2B5H A;  3OTF A;  4G4F A;  2ZEY A;  1URX A;  3GZE A;  3WNN A;  5FZ7 A;  4CCE A;  1OSG A;  1LOA A;  5FYC A;  4PI0 A;  2Q30 A;  2P34 A;  3CL1 A;  4FOQ A;  2BYV E;  5HI0 A;  4ATF A;  2OA2 A;  2J7M A;  1UZV A;  4XJ9 A;  1JZ4 A;  5FZB A;  4N7I A;  1V0A A;  3PVB B;  3BN6 A;  3LSE A;  3POF A;  4YW2 A;  4YM3 A;  5I8T A;  1OUX A;  4BQ2 A;  1VBD 1;  2RHP A;  4P08 A;  3USS A;  2QDR A;  2QTW B;  3PVO A;  5K7P A;  2G19 A;  3DCQ A;  3WF0 A;  1ZZ8 A;  1NUK A;  3TRS B;  3UKT A;  5F5I A;  2WN2 A;  2QKD A;  5LBB A;  3GZU C;  2WC2 A;  1OPO A;  1SHW B;  3POJ A;  2EIB A;  5F2W A;  2VTX A;  1YQ5 A;  3CHX A;  2E6V A;  4S2G A;  5DUU A;  3VV1 A;  1J84 A;  1AZD A;  3MLJ A;  1L7Q A;  2Q5T A;  4W6X A;  3ZFG C;  4AE2 A;  2XL7 A;  4HAN A;  3ZX7 A;  2HWC 3;  4RQP C;  3EO6 A;  4ASK A;  5DG2 A;  1COV 3;  5LY1 A;  1ZBE 3;  2O14 A;  1ASJ 1;  1B09 A;  5C70 A;  2WSU A;  3R4D B;  3ACL A;  5FP4 A;  4TWT A;  2EA7 A;  4IUG A;  3HD8 B;  1LHW A;  4E9K A;  3FE5 A;  1VBA 2;  2RS3 2;  1ODM A;  1EUU A;  1NE4 A;  5DDJ 2;  2X8K A;  4L11 A;  2VTX J;  5DQ0 A;  2EAA A;  1ZRD A;  5ACA 3;  1PO2 1;  3L9J T;  4QKF A;  5C8C B;  4MGY E;  1O7F A;  5C3R A;  4LA3 A;  2LUW A;  4W6Y A;  4UT5 A;  3TN9 3;  1O8S A;  3Q8C A;  2Q4S A;  4I30 A;  1D2Q A;  1OLM A;  5A6Q A;  3FC0 A;  4AL9 A;  4H55 A;  3VDC A;  1GWM A;  2B8M A;  2QQW A;  4MO3 M;  2P3K A;  3V64 A;  2GME A;  1FNY A;  4PIY A;  3WDY A;  3ACG A;  4N7U A;  5F3G A;  3VD5 A;  4B8E A;  1DQ5 A;  4OZO A;  2ZZQ A;  3IT8 A;  5F3C A;  3LEK A;  1MZ5 A;  4UW6 A;  5FZO B;  3MHZ A;  3ST7 A;  3ALQ A;  1J1L A;  4LBO A;  3VHN A;  4JDN A;  3CEW A;  3ACF A;  4CDQ C;  3UNP A;  4XUO A;  1EY2 A;  2OS2 A;  3APB A;  3WDT A;  4DIQ A;  1SLA A;  1XYN A;  4P9J A;  5FY5 A;  4HK9 A;  2WNU A;  1ZNP A;  1N47 A;  2VOK A;  1A8D A;  3ZXJ A;  1H2M A;  5GLT A;  4BE3 A;  1H9W A;  3AMQ A;  1V6J A;  4AZZ A;  1TVG A;  1OD5 A;  1RXG A;  4LHL A;  5FYY A;  2ZAC A;  4I3G A;  2GC2 A;  3OBT A;  1C8N A;  2WNV B;  4HVQ A;  1HXS 3;  4XQW A;  1MS4 A;  1UMH A;  1CGP A;  4IQP A;  1RUI 2;  4C90 A;  1XE8 A;  1F31 A;  2JEN A;  5CNA A;  1LU1 A;  4CDW C;  3NVC A;  3E6B A;  2D3S A;  2UU8 A;  2Y0I A;  3D5O A;  5HCF A;  4QX5 A;  4OI4 A;  1YYN A;  2Q0A A;  3GBF A;  1LU2 A;  4YG3 A;  1ZBE 1;  3D6E A;  4FPK A;  1NCQ C;  2E9Q A;  2IXC A;  2JWP A;  5K0U A;  3ZFE C;  4O9E A;  3ZXE A;  4CZS A;  1C28 A;  1FX5 A;  3FN9 A;  4Q0V A;  3VD9 A;  1FPN 2;  1Y4W A;  2ZMN A;  4L8Q A;  5FLH A;  5FMB A;  2D5H A;  3DPR B;  2YC4 A;  4BQY A;  5H9S A;  3WW1 A;  2ADD A;  4Q1P A;  3TEX A;  5BNP A;  1Q3E A;  1FAY A;  3TN9 1;  2ES3 A;  2GNM A;  4B1M A;  4QQL A;  2P6H A;  1BKZ A;  3ORJ A;  2WT2 A;  4Y1V A;  2AGS A;  1T2X A;  3WNK A;  2VL4 A;  1OF4 A;  3RGB A;  4CP2 A;  4H14 A;  5LBC A;  2XWB B;  2A6Y A;  4BWO A;  1CZT A;  1GMM A;  1G6N A;  1SBD A;  3IBM A;  3J7N A;  3CJI C;  4JKK A;  4Y22 B;  5DUX A;  4D8M A;  4TN7 A;  1GIC A;  4ZPI A;  1MVQ A;  1UL9 A;  1I3H A;  4WM7 A;  2FDK A;  4K3U A;  1YJL A;  2DVB A;  4YZ4 A;  1AUY A;  1NE6 A;  3M3C A;  4GAL A;  2Q1Z B;  3C7G A;  4Q0S A;  5FY7 A;  1ND3 B;  5IVV A;  4CXW A;  2VMI A;  3BPZ A;  1CAU B;  4XDO A;  3J8F 1;  3ZYG A;  2YC0 A;  2ZGR A;  3C7F A;  1N1V A;  1R09 3;  1LJ7 A;  2WAB A;  3FWE A;  4MSV A;  4O61 A;  2X5I B;  1UWW A;  4RR3 A;  1UYY A;  3OBR A;  4URT A;  5FZ8 A;  4UF0 B;  3OPZ A;  2WO1 A;  1YQ6 A;  1FT9 A;  1LNS A;  5EXO A;  4A4A A;  4DXZ A;  3NAP B;  1F5F A;  2GNT A;  2VY0 A;  2R07 3;  4CDX A;  5C8W A;  2PLV 2;  4YYO A;  1FAT A;  5EJZ B;  4C8D A;  2UYB A;  5FO7 B;  3H42 B;  2ILM A;  3KMH A;  4RHV 3;  1IOA A;  4PBP A;  3NQH A;  2OYZ A;  1AR7 2;  1Z7S 2;  5GAL A;  5H9R A;  4Q26 A;  4CDU B;  1JZ7 A;  4E2G A;  4XZP A;  3LOI A;  1K12 A;  1UY2 A;  4XFH A;  3T08 A;  3ZYF A;  1UZY A;  2Q8O A;  1SLB A;  2AUY A;  2XH6 A;  4QKD A;  3UJQ A;  2W91 A;  5KHJ A;  1PGW 2;  1JHN A;  5K8S A;  1PGS A;  3HMY A;  2ZBJ A;  4M3C A;  1DQ2 A;  3AX4 A;  4GMP 1;  2RDQ A;  2Q8D A;  4A41 A;  2C0Z A;  3AK0 A;  5EZW A;  4BLJ A;  4BQX A;  1P8J A;  3O0W A;  2R6Q A;  4HPK B;  4XAC A;  4ZON A;  5DZG A;  1XNB A;  1B35 A;  1KXG A;  1JS9 A;  2ZMK A;  3A21 A;  1YQC A;  5LA9 A;  1VIW B;  5FP8 A;  4QU1 A;  3KVB A;  3FBM A;  4FPL A;  5FZI A;  5LBE A;  1D4V B;  1MS9 A;  1QJX 2;  4PIX A;  4RA0 A;  3FJS A;  3N7J A;  5A7W B;  4AFA A;  2IXH A;  2R04 3;  2A6W A;  5FZF A;  5LY2 A;  1LTE A;  2IFW A;  4WZC A;  1NA1 B;  1RIN A;  4NOT A;  1W8O A;  2HKX A;  2VXR A;  3GAL A;  4YGD A;  5FIX A;  1G8W A;  3BOW A;  4IXL A;  4MGI E;  2ARA A;  4NRM A;  1E5R A;  2GDF A;  2JG9 A;  4OYU A;  1W04 A;  4L92 A;  4JTN A;  2VOX A;  3SXW A;  3I97 A;  1WME A;  4N43 C;  1R09 1;  2QFE A;  4DZG A;  1OH4 A;  5A7S A;  1E5I A;  4MGQ A;  2D40 A;  1W0N A;  4WM8 A;  5DPN A;  1V6K A;  4C0B A;  5DAQ A;  1GP6 A;  2PHD A;  3P6B A;  5D1I A;  1ZZ6 A;  5ABJ B;  2ZJC A;  1WBL A;  2R07 1;  4YM0 A;  1PVC 3;  1CJD A;  5F2S A;  1VMJ A;  4AAX A;  2ORX A;  3HR9 A;  3W9A A;  1QJU 1;  3NL1 A;  4LJH A;  3HNY M;  1PO1 3;  1NY7 1;  2HBU A;  2FCT A;  1HQL A;  2RDN A;  4JHT A;  2DF7 A;  4XFB A;  4YNI A;  4QX1 A;  1ZBA 3;  2GH8 A;  4URA A;  4CVU A;  1N3Q A;  2R1D A;  5FXW A;  1RUJ 1;  4EYU A;  1QXJ A;  2VQ0 A;  3WG2 A;  5DZE A;  5EJ3 A;  4LKE A;  3AP5 A;  2B4K A;  2JDA A;  2R32 A;  4Q4V 3;  3ZSJ A;  1OFS A;  1VPH A;  4P9G A;  2OKX A;  1WW5 A;  2L9L A;  1AL2 2;  1SAC A;  2LRO A;  1DYP A;  1WD4 A;  3K4A A;  1WCQ A;  1PNF A;  4D3W A;  1D4M 3;  4YVS A;  4JDO A;  5DAW A;  1AR8 1;  3CJX A;  4X6Q B;  1JUI A;  2BQP A;  3PVN A;  3RFR A;  4MXV A;  1UZ0 A;  4OVE A;  3VBS A;  1HKD A;  1NYW A;  2D6O X;  3POW A;  2GSY A;  1G9B A;  4HON A;  2DU1 A;  4XDP A;  3WHU A;  3M70 A;  3SH3 A;  3T2O A;  1RVF 1;  1OA4 A;  1PX4 A;  2DUO A;  2J1R A;  1UCX A;  2DCY A;  3MGU A;  4OLL A;  1WW7 A;  3R6S A;  1V00 A;  4COU A;  5IAT A;  2W3J A;  2HWE 2;  3H1Y A;  1BMV 2;  3PUI A;  4QB6 A;  5A7O A;  4A42 A;  1YFY A;  1H4H A;  2VTF A;  1F4H A;  3HNB M;  4JGZ A;  3M3E A;  1JOD A;  3T1L A;  4CUB A;  1ODN A;  4KU8 A;  3WLU A;  4MUV A;  1K5M A;  2JDN A;  3OEA A;  3IDC B;  4UFM A;  1WZX A;  4W50 A;  3TNQ A;  5FRA A;  1S0G A;  1JU4 A;  1AXZ A;  3W21 A;  3NKT A;  5DAB A;  3WDV A;  4Y20 A;  1QXR A;  3Q8B A;  2G1M A;  4LLO A;  4PHZ A;  1BLZ A;  3B9C A;  4I3P A;  1G86 A;  2DWR A;  1I9R A;  5FYI A;  2JE9 A;  5DDJ 3;  1SFP A;  5C71 A;  2OQ7 A;  2Q8C A;  1J1T A;  1SDW A;  1VBB 3;  1QDC A;  2D6N A;  4ZS3 A;  4JKL A;  1HRV 2;  4Z8B A;  2QQU A;  4KH9 A;  2VNV A;  2WO7 A;  1MVE A;  3MW2 A;  4HLT A;  5SV5 A;  1GNY A;  1MZE A;  3VHO A;  2VO5 A;  3LA3 A;  2DCJ A;  5E1R A;  3O0V A;  4Y5Z 0;  1VRH 2;  3N3H A;  4J1W A;  3GCW A;  4K21 A;  3LAG A;  5AFB A;  3JB4 C;  1X8E A;  4QM8 A;  5FZ4 A;  4AVC A;  1JOB A;  3B01 A;  3BU7 A;  1PIV 2;  4Q4Y 2;  2WWS A;  1RGS A;  4ATE A;  1IQA A;  5GLU A;  2WLP A;  3NV3 A;  5FPB A;  1SPP A;  3FBY A;  4UWD A;  3GBW A;  5G05 L;  3H8R A;  3K4D A;  5J1X A;  5F37 A;  2PAE A;  3UGG A;  4CEW B;  2RDR A;  4E8C A;  4Q4X 1;  4HZF A;  2Y6H A;  1HB2 A;  3J7L A;  1QIQ A;  3A0N A;  3RS6 A;  1VLN A;  4GWN A;  2RMU 2;  3H1W A;  2IC1 A;  3N9Q A;  1GR3 A;  4CCC A;  3ZDV A;  3OBZ A;  4S2F A;  5FPL A;  4XAB A;  3S30 A;  1QDO A;  3POE A;  4UW4 A;  3OY8 B;  4XIK A;  1GBG A;  1RUI 3;  5T52 A;  2HYX A;  4ZZ8 A;  3KQR A;  1AYM 1;  4GKX A;  1JYT A;  2CSG A;  2A6Z A;  3TEY A;  2C4X A;  1IHM A;  3ABZ A;  4EN8 B;  1TZO A;  4PDW B;  1QJY 1;  3PUS A;  5JOZ A;  1LOD A;  1PNG A;  1RMU 1;  1NLR A;  3K46 A;  3DKQ A;  2FQP A;  4MGZ E;  1JZ6 A;  4B4P A;  4FBF A;  3HBZ A;  4I02 A;  2VUA A;  4LE4 A;  2ARX A;  2AEN A;  3IZO A;  4LPL A;  4Q1R A;  4CPB D;  5IVB A;  1ENS A;  3N7L A;  1MS5 A;  1EAH 2;  1VBA 1;  2RS3 1;  1FPN 3;  3BIW E;  4FPF A;  1E5S A;  4IEO A;  1U5Y A;  4YZ1 A;  4NIA A;  1O5L A;  1ASJ 2;  1V6L A;  5FTT C;  1AYN 2;  2WNU C;  2Y6J A;  4Q5O A;  1JN2 P;  4MXW A;  3WQ7 A;  1W6Q B;  4AED B;  5GZG A;  5GZC A;  2DCZ A;  1XYO A;  2VG9 A;  3VKM A;  1NXD 1;  3U4S A;  4R9B A;  2RS5 2;  4EZH A;  1PO2 2;  1RED A;  4LOT A;  5F5Q A;  2R49 A;  4NUB A;  5C3P A;  4UFJ A;  3SIT A;  2E26 A;  2XJQ A;  5FZ0 A;  2CWM A;  1AXY A;  4EWA A;  2TEP A;  1JYI A;  5A3M A;  3HOB A;  2PMW B;  3BI3 A;  4FSJ A;  4E4H A;  5CFC B;  4FPO B;  4LBQ D;  2A3W A;  1GP5 A;  3A7Q A;  1W28 A;  3KF3 A;  1C8M 2;  4IV1 A;  1UNB A;  3ZFF B;  4DEQ A;  2WQ8 A;  1LCL A;  2ZEX A;  5K0U C;  2I07 B;  5K9Y A;  3F2Z A;  4HET A;  4LO6 B;  4LUM A;  3J7M A;  5HXV A;  4YM1 A;  1Q8S A;  2XLA A;  1E57 A;  4COV A;  2ZEW A;  3HBK A;  4P9Y A;  3OBA A;  2PLV 3;  4AGG A;  4QB2 A;  1LAJ A;  3AB0 A;  4AVT A;  2WQ4 A;  2ZHL A;  3HIF A;  5FUI A;  5F32 A;  2TNF A;  2ZHM A;  5BNP C;  1R64 A;  1AR7 3;  1Z7S 3;  1UYX A;  2RR1 1;  2W92 A;  1NKG A;  3CNA A;  1BK0 A;  2VW1 A;  3IMN A;  2YG0 A;  4FVV A;  4XCA A;  3W5N A;  3K3O A;  3ZXF A;  3LD8 A;  5FQ0 B;  3N4M A;  3BVC A;  2CNA A;  1GKB A;  1S1A A;  2AEY A;  1CX4 A;  1F35 A;  2HWB 2;  3LA7 A;  5B4X A;  3J9S A;  4QX3 A;  5L7O A;  5EYY A;  1REE A;  1SG3 A;  2W52 A;  1OF3 A;  3ZXG A;  3KV4 A;  4NAM A;  1FPN 1;  4UI9 L;  3BU0 A;  4A7Y A;  2PHT A;  4XUP A;  3UK9 A;  4BYY A;  4RGA A;  5FZ6 A;  3U75 A;  2Y6L A;  1ONA A;  3WX5 A;  5EP9 A;  2I74 A;  1C1F A;  5FZK A;  1PM7 A;  2VMD A;  1QNW A;  4WZF A;  4RR3 C;  3AMN A;  4FXK B;  3QH7 A;  1HJG A;  2OT7 A;  3KD4 A;  3ZIW A;  1QJX 3;  1RIR A;  2PXJ A;  3C7E A;  1F5J A;  3NRU A;  1O4Z A;  1N3O A;  1QXP A;  1T6B X;  1YFX A;  2Y33 A;  3AFK A;  1POV 1;  2FCU A;  3H3U A;  4HSJ A;  4CDX C;  1OVS A;  1W9Y A;  2RG4 A;  3IWZ A;  1ENX A;  2YGL A;  3NJV A;  5CBL A;  3FMG A;  4Q29 A;  1DQ6 A;  4QPW A;  4DS0 A;  4PQ9 A;  4TYS A;  3MIH A;  5D8A B;  4V2V A;  3WCS A;  5GLV A;  2XOM A;  1W9W A;  2WZ8 A;  3IM0 A;  2EF6 A;  3U78 A;  4AR2 A;  2WN3 A;  2FCV A;  5EFU A;  2XUM A;  4AXO A;  4XAE A;  5A1F A;  2XHN A;  2PLV 1;  3WR0 A;  4O7X A;  5A6Z A;  2R30 A;  4P9W A;  1QY4 A;  1B35 C;  1NZC A;  3NV2 A;  1JOP A;  2P1B A;  1AR7 1;  1X33 A;  3LQC A;  4FCA A;  5C8C A;  1NT0 A;  1LHU A;  4XUR A;  2VZO A;  1KFX L;  4NHL A;  1OKO A;  4FAG A;  5A3N A;  1XRU A;  4AK3 A;  4DIN B;  4QHZ A;  3T30 A;  2DBI A;  5JOX A;  1AL2 3;  1S2B A;  3AVS A;  2RS1 3;  3WDW A;  4Y1Y A;  2DVF A;  2X10 A;  3DF0 A;  3E5U A;  1WLD A;  5HXM A;  3I2I A;  5JZG B;  2JG9 C;  5FZO A;  4JKM A;  5HCB A;  4QKN A;  4IEV A;  3WCR A;  2VZ1 A;  4V1P A;  3BUC A;  1XU1 A;  4KGQ A;  1DGL A;  2RM2 1;  4CCN A;  4N9H A;  4WM8 C;  1R08 1;  3BAL A;  1MS3 A;  1LOG A;  5LRS A;  3QOP A;  4RSU A;  2W94 A;  3FHI B;  2HBT A;  4BQ3 A;  3RZL A;  3AMM A;  1IS5 A;  2YXS A;  2A3Y A;  1RJ7 A;  4IV3 B;  3LGR A;  1SCS A;  2D97 A;  2HWE 3;  5IWF A;  2ZEZ A;  1MQT B;  1NLS A;  2QQJ A;  3T2T A;  2WNV A;  1DF0 A;  1FOD 2;  1ALY A;  5IK4 A;  2BPA 2;  4I0B A;  5IVC A;  4IGQ A;  5HBA A;  3PTR B;  2G9Z A;  1Q43 A;  1Y9M A;  3CBN A;  3III A;  5C5U A;  2HEY F;  2UWC A;  1CWP A;  3SIS A;  2FDF A;  5DG1 A;  4NHX A;  2NYY A;  2HEW F;  3ZSK A;  2VZT A;  3NKG A;  4JZR A;  2GP3 A;  2EIG A;  1JW6 A;  5LAT A;  3Q8E A;  5L73 A;  2DTY A;  3ZPO A;  5JSR A;  4LKF A;  1N1Y A;  4MLO A;  4YVS C;  1BJQ A;  3AVR A;  1DLL A;  3VBR B;  4FXG B;  2ZGQ A;  3DPR A;  3NNJ A;  2XUE A;  4C1W A;  3VBS C;  4BCU A;  4PBO A;  2QE3 A;  1HRV 3;  3CZJ A;  5F5C A;  2ORZ A;  4RFR B;  3VBF C;  2AH2 A;  3KV9 A;  1Q56 A;  5CAD A;  1JYC A;  5FWJ A;  4EZ4 A;  3VDD B;  1NY7 2;  4MHR A;  5FJH A;  4B7E A;  1IS3 A;  1CZV A;  4MOA A;  3MIF A;  5C3O A;  3WNO A;  4KMQ A;  4M4P A;  2NMO A;  5LWB A;  1O4T A;  2A3X A;  1R1Z A;  2HWF 2;  4N43 A;  2EID A;  4LUL A;  4Y22 A;  1RUJ 2;  4LEJ A;  3WG4 A;  5JXG A;  4JGZ C;  5AC9 1;  2EXI A;  5FZ9 A;  2D6K A;  4XFF A;  1AXK A;  4IEP A;  5CU1 A;  3ZR5 A;  1K5M C;  2VVF A;  1ND3 A;  5L7O B;  1PK6 C;  2BNM A;  1W8T A;  4YFZ A;  4M3C E;  1CAU A;  3ES1 A;  5FBJ A;  3SC7 X;  4EE2 A;  3RZZ A;  5L19 A;  2ZGM A;  4AF9 A;  1DQ4 A;  2X5I A;  4HN0 A;  2VBB A;  4JGY B;  2WNO A;  3OOX A;  4UF0 A;  5DUW A;  2ADE A;  3NAP A;  4BIF A;  1BMV 1;  2YBS A;  5CEH A;  1C5H A;  5FXV A;  5FY0 A;  1VBD 3;  4YWA A;  1RVF 2;  2DU0 A;  3DYO A;  4UFH A;  5A1A A;  1A3K A;  2VH9 A;  3MV1 1;  3NJZ A;  4M4R A;  1NZI A;  4PLN A;  4CDU A;  3AZW A;  4IE0 A;  3LEG A;  1K3I A;  2J1A A;  4K1Y A;  1G9D A;  3BGA A;  4EN7 B;  2E7Q A;  5C33 A;  1C57 A;  2W95 A;  3RJ2 X;  1OQ1 A; 
#chains in the Genus database with same CATH homology
 2WRA A;  1GZT A;  2VNV A;  5D2A A;  2JDY A;  1W8H A;  2BOJ A;  2CHH A;  2JDN A;  2JDH A;  4CE8 A;  2XR4 A;  2VUD A;  1UZV A;  1OUX A;  5A70 A;  5A3O A;  1OUR A;  2BOI A;  2VUC A;  2JDU A;  2JDM A;  1OXC A;  5A6Z A;  3DCQ A;  1OVP A;  2WR9 A;  5A6Y A;  5A6X A;  4UT5 A;  2BV4 A;  2JDK A;  1OVS A;  1UQX A;  4AOC A;  3ZDV A;  1W8F A;  2JDP A;  2BP6 A;  5A6Q A;  1OUS A;  5HCH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...