1OVSA

Lecb (pa-lii) in complex with core trimannoside
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
114
structure length
114
Chain Sequence
ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords hypothetical protein LecB
publication title Structural Basis of Carbohydrate Recognition by the Lectin LecB from Pseudomonas aeruginosa
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 19
structure length 114
sequence length 114
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07472 PA-IIL Fucose-binding lectin II (PA-IIL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.400 Mainly Beta Sandwich Jelly Rolls Calcium-mediated lectin 1ovsA00
2VUDA 1UZVA 5D2AA 2JDPA 1OUSA 2BOIA 1W8HA 5A3OA 2BOJA 5A6XA 5A6ZA 1OUXA 5A6QA 2BV4A 1OURA 1GZTA 3DCQA 2VUCA 2XR4A 2JDUA 2JDHA 2JDYA 1OXCA 5A6YA 1W8FA 2BP6A 2JDMA 2VNVA 4UT5A 3ZDVA 1UQXA 2JDKA 5A70A 2WR9A 4CE8A 2JDNA 1OVPA 5HCHA 2CHHA 4AOCA 1OVSA 2WRAA
chains in the Genus database with same CATH superfamily
1JH5A 1ULCA 3CJIC 3T0DA 1Y4WA 5A7WA 4Q8LA 3VZMA 4XBQA 3IMMA 4BMEA 3LD8A 2G4IA 3CEWA 3DKQA 4GKYA 2GU9A 3KHBA 4GJYA 1V9U2 5FO8B 4LMFA 1UZ0A 2VUCA 1IS4A 2WNEA 3DPRB 4JGZA 2CY6A 1JYWA 4FPHA 3T1MA 1UY0A 2W39A 5CB7A 1W0NA 3VD7A 5FQ0B 2XJSA 3NW4A 5JSPA 3VD3A 2R072 4IL7A 3AP9A 1DQ6A 2VCCA 4OULA 3B94A 5DXDA 1FPN3 4KU7A 1NA1B 3E97A 3PVEA 4X6RB 5LBFA 5K0UA 1JODA 1OI6A 3IN9A 5C4WC 5CZKA 3HEIA 1OURA 3ZFGA 1KRIA 3THCA 1WLDA 2A73B 4Y5SA 3OBZA 1C1FA 1EAH3 4D0QA 1RUD2 4HMZA 2W52A 2H0BA 3IDEA 4WVMA 2W0XA 2VZ1A 3H7YA 5FLJA 3NV2A 3AXEA 3LFMA 5HXVA 3SCHA 5KXDA 2C24A 5A32A 1X8MA 2LW8A 4UAPA 1UIKA 1PGL1 4EJRA 4MHRA 3U10A 4LT5A 1ND2A 3E5XA 1ZZ7A 1OF3A 2VR4A 2GSYA 4NAMA 5LASA 2XJRA 3SC7X 2I74A 4TWTA 1ZZ9A 2VZUA 2VY0A 4LBKA 3SCGA 4C90A 1OUXA 1EP0A 4BMBA 4F7ZA 4OI0A 2VTFA 3E5UA 5EQUA 2V5DA 5FZ6A 3RMXA 3OUIA 3ZXFA 5CU1A 3C7GA 4DXRA 4B4QA 1BKZA 1UN1A 2J1TA 2VH9A 3VZJA 1UZWA 4DEQA 4DIQA 5E16A 5DDJ2 3VB9A 3PU3A 2R0HA 4UFMA 1Z7S2 3ZMOA 4D69A 1QJEA 2VW0A 3O1MA 1XOYA 4E8DA 4H2AA 5IT6A 1CD3G 2W92A 4XUTA 4URTA 2VG9A 3DPRC 5JSOA 1GZCA 4CU8A 5KHIA 2EICA 2W1SA 5BYNA 2ZPXA 1UL9A 2R16A 2WZ8A 1TMF3 4AVTA 1QJU3 3WVJA 1HB4A 2ZMNA 4FPLA 1U5IA 2FMYA 4FI9A 3AZYA 1FOD1 3U0ZA 1RUI1 1AR63 1MQTA 2J1AA 3BPSA 3OUJA 5CYYA 1NA1C 1TME2 5IVCA 2P4EA 3VBUB 4NPMA 2GC2A 1W8ZA 4ZONA 1B35B 2G9FA 2YYOA 5JR7B 2UU8A 3GGLA 1RIRA 1DGRN 2QJVA 1PVXA 4OUMA 4QGLA 1IQDC 5SV5A 4META 1QMJA 4IV3B 1V6OA 5JVVA 4WV8A 5LB6A 1F9KA 4E4DX 2A6WA 5LK7B 1HRV3 4WVVA 1NAEA 5APAA 4ASMB 3K4ZA 1WCDJ 5CEHA 2VZSA 1S0GA 3CHXA 4LK6A 1DP0A 2UWCA 3FC0A 4C0HA 4IXLA 4MXWB 4AEKA 4JKKA 2YU2A 1QQP2 3I2DA 4KWJA 2WO3A 3HAGA 3OYWA 2VXRA 1HLCA 4UW3A 3WG3A 1WCKA 3MLKA 4PJYA 2JD9A 4Y4YA 1N3OA 3VBOA 5JCTA 3H8XA 3EMRA 4CP1A 4DY3A 4XJWA 4MO3M 2DBIA 3G6JB 4YZ1A 5BV6A 5E89A 2E7AA 3OD0A 1OA3A 1XNAA 1SQ4A 2XHKA 3APBA 5BNPA 2CHHA 1NCQB 2QTWB 1W3XA 3B93A 4PIZA 3RI8A 2JDPA 3GDBA 3N36A 4Z07A 4JGYA 1HW5A 2WQZC 2WWSA 2BOJA 2ZX2A 4BJ0A 1O4YA 2QQVA 1ODNA 2BNOA 3ATGA 2ET1A 1EV11 2DCKA 4K1YA 1S4CA 2WFF1 1TME1 4HK8A 1VJ2A 4NRQA 1LHVA 3ECQA 4K1ZA 4M3CE 2E26A 3WDYA 4AAXA 3W20A 1RUF3 5FLHA 4Q1RA 1SBFA 1MEC3 3K51A 1S55A 2I45A 2V4VA 4MGZE 2HWD1 4AVVA 5JUVA 5LEKA 1LGCA 1O6UA 3MI8A 4GD4A 4YGCA 5FZAA 4YLZA 1G9CA 1IG0A 3VBUC 4BQXA 1G6NA 1B35C 3C8XA 3O1PA 5J36A 3A21A 2JB8A 1UPSA 4QGNA 3NL1A 3PUSA 4L92A 3ZXJA 3AP6A 3WNNA 2RDNA 3F2ZA 3IM0A 1PGW1 5BNOB 4PT6A 5JSRA 4K21A 2NN8A 3CJIA 2VOKA 4FPGA 2EIEA 5DUWA 1O3TA 3OGSA 4HZFA 1A6CA 5EHDA 4Y33A 4N90A 4XJ9A 5DMYA 4AWDA 4XBNA 2BYVE 1JZ7A 5AVAA 4P9XA 5TSWA 1IQAA 2FZ1A 3ZOIA 2CGOA 1RUH3 3S0MA 5CG8A 4QWNA 4Q4X2 1AR92 2ERFA 3MW4A 3BPZA 4DRVA 1PNGA 2ZS6B 2Y6KA 2Y8KA 5FZHA 3TN93 5JPNB 3CZJA 2HWB2 3I59A 5D8AB 5L9VA 5HCAA 2LALA 1K5JA 1JN2P 4QX1A 4QX7A 4LBNA 3M3QA 4NPLA 2V5YA 4CP2A 1RUNA 3BALA 1K45A 3GZTB 3VDAA 5FYZA 1TNRA 5LCWL 4YVWB 2X05A 1NCQC 4AI8A 2WYSA 1X82A 1KS5A 4LOTA 3N9LA 3VV1A 2WWUA 3UL2A 1IHMA 2BPA2 1CZVA 1YFYA 1F31A 3IPVA 2BBVA 2B9UA 4NROA 4YSFA 3SKJE 4GJZA 2DUOA 3ES4A 5C3OA 4QPWA 5A70A 4MOAA 3M3CA 4QGMA 4HSJA 4OZOA 4MGSA 1W6PA 5LY1A 1POQA 1YQCA 4BLJA 2RM22 4IETA 2VMCA 2CU5A 1LHUA 4YRDA 4EROA 4FAGA 4BIOA 2YBSA 1CAUB 2R49A 3N7KA 3VN4A 4XAAA 1PK6A 2DU1A 1TEIA 1V6MA 2EALA 3KQRA 4AI3A 5A1LA 4LXLA 4HANA 5FY4A 1RUC1 3AYDA 1W8UA 2C9KA 1NZIA 3B3QE 3P3NA 1IPJA 4OHXA 2D6OX 2R7EB 4Q4X1 1Y7BA 3AL5A 3M7AA 4YW6A 3H8UA 4JDNA 1VRH2 2DCJA 4Z92B 1PZ9A 3D8CA 3M3IA 1HRI1 3M2MA 4I01A 4QXCA 2HWB1 4YZ5A 2C4XA 2PHUA 3AFKA 3WQ7A 3WNKA 5AFEA 4W6YA 2VVDA 3ZKYA 2QQJA 2ZEZA 4D7TA 4DOUA 4Z82A 1UYYA 5KWRA 3FHAA 1YQ2A 3AMNA 1XU2A 3V0AA 3WHUA 1PVC2 5J7MA 1VBB2 3DPRA 3JB4C 3S30A 5FAXA 5KHGA 2RS51 4IEZA 2BNMA 2DVGA 1FYUA 5D8AC 5IHRA 1KDKA 4QKBA 3ZSJA 2XUMA 3HQUA 1WLTA 2XG3A 3CNAA 4XQDA 1LKNA 3FZ3A 5E88A 4FPJA 2R042 4BQWA 4QQPA 2ARCA 1D0GA 2WA3A 3ORJA 4YWAA 5FQ0A 1JU4A 1RUG1 4BQ4A 1BZWA 2VULA 4K6BA 4ISQA 4H7MA 4YVWC 3J7MA 3OBRA 2B46X 2B5HA 2OKXA 1SPPA 5CKMA 2WNUA 2R1BA 2RM21 1A34A 2XLGA 4PF5A 3FFZA 5EP9A 2HKXA 1WD4A 1LTEA 4G9SB 4LHKA 4Y20B 3T30A 1CVNA 3ITQA 4Q26A 3U4XA 5IVFA 4AXOA 2VVEA 3NRUA 4V1PA 2W3JA 5T3NA 3RJ2X 3MIEA 1R64A 1V70A 5KXCA 4HT1T 3ZR5A 1FOD3 2ID4A 1RUI3 2PMWB 1SFPA 2WN2A 4XJ8A 5C33A 3K3NA 4GKXA 2BQPA 2EIGA 5SV8A 1CONA 1GWMA 3I3DA 4CVUA 4RYDA 4KH9A 1QY4A 1RVF2 4NHXA 4RHV1 4XQWA 3TEXA 5CG9A 4QU1A 5K9YA 4NJ4A 2PHTA 2VXJA 5GLVA 2IWGB 3HJRA 3ZVXA 4JCKA 2YGMA 5F5IA 2KA3A 1V6IA 2HWF1 2GALA 4JHZA 2C6SA 4CSWA 1PVC1 1JOBA 3N7JA 2BU9A 4FXKB 2OA2A 2PLV2 3NNMA 1JW6A 4UBGA 4IQPA 2VBPA 1AYN1 1O5LA 4K8FA 3PHMA 2CYFA 2PAKA 4QPGA 3GJAA 3HOBA 5GALA 4YG0A 1VRBA 1ULOA 3AVRA 2V73A 4QX2A 4LBJA 3D3AA 2D5HA 1HKDA 4RD7A 4CCJA 1ULEA 5FXVA 3QH7A 5FZ0A 2YDEA 3SISA 3IZOA 3WF4A 3LZZA 5A3UA 2WO7A 1GYKA 3LA7A 3EBRA 1VP6A 4E2QA 1AYM1 4FPYA 4A3ZA 4A45A 4LO5B 1U5XA 5FV3A 2WT1A 3O7OA 5EFUA 4AVSA 3K4DA 3JZVA 1W6MB 1RHI2 1BEV2 4ZXKA 3MV11 3ZFEB 5FPUA 1O8SA 3FBMA 3FLRA 4R9BA 3AXDA 5F3GA 5G04L 2ZACA 3RZLA 5I8SA 3N35A 3A22A 4H7LA 1R082 3P6BA 4HPKB 1EV13 4W6WA 2WFF3 3LEIA 1VE0A 3RS6A 2QDNA 4D7SA 1PZ7A 4U2AA 3Q8AA 1GR3A 4JC1A 3I2OA 5JZGA 2PA7A 5GLWA 3I8TA 4JZRA 4N9HA 1XC6A 1UQXA 3TWIA 4I3PA 2HWD3 2D44A 3WOGA 5FUPA 3B01A 2VZOA 4QHOA 3O1OA 1O3SA 1I5PA 4HN0A 3BI3A 2QKDA 3AZZA 4COWA 3AB0A 5B4XA 2CSGA 5K4LA 3LF7A 1RMU1 1X7NA 1G8WA 2XH6A 5EWSA 5FZ7A 5A80A 1FI2A 3WY6A 5A6ZA 1F8VA 4KU8A 1CAXB 1SLTA 2YUEA 3I3EA 2XBO2 4YZ3A 4AVBA 1W28A 1F5FA 4KWUA 5C71A 3N7LA 1MS3A 3VL8A 3WLUA 1AXZA 4MV2A 4RR3B 5A3NA 4O9GA 1QH6A 1V6LA 2IFWA 2OZJA 3I4IA 3FX3A 4AEJA 5JXHA 1OFSA 2BP6A 4FXGB 2EXJA 5JIAA 4RA0A 2VCAA 4Q29A 3J8F1 4A7YA 4D6SA 1K5MA 3MFCA 2JIJA 4IEYA 4J1WA 1IPSA 3AP7A 4RQPC 4CDWA 1BEV1 3WX5A 3ZN6A 1QJY2 3UYJA 3NNLA 4N7UA 1QJX2 1WUVA 2A3XA 3K46A 3I49A 4MG2A 4QMAA 2GH2A 4FVVA 3LB9A 1DZQA 4FCAA 3MF9A 2GDFA 3NKGA 1MZ5A 2DF7A 4MXVA 1U0AA 4QX5A 4XYXA 3ZFEC 3BCWA 2B9VA 5FZEA 2F4PA 3VUOA 1LRHA 2RV9A 4MYEA 1A8DA 1HB2A 3NJVA 4UFKA 2FDHA 1JTZX 1J59A 4B4RA 1DQ0A 3ILNA 2ZKLA 1JZ5A 1ZZ6A 2WRAA 3W9AA 5IFTA 4YW1A 1VBE2 2XJPA 1AVBA 3MGUA 4PQQA 3PMEA 4XF9A 3VKMA 1YCIA 3DV8A 1WLCA 4C91A 5LBCA 5DZEA 4BLIA 5AFBA 4Y4RA 1YO8A 2Q8OA 2ZGTA 3UK9A 2ZX4A 4EYUA 2QQWA 4JTOA 4PF1A 3SH3A 5HBAA 1VBD1 3Q9OA 1RUC3 5AC92 2FCTA 3SMHA 2P3IA 4FOQA 4GA9A 2X10A 4IE6A 3B5LB 5D8AA 1GNYA 5FO7B 1LAJA 3LKJA 5CFDC 1RL3A 1QXPA 2ZKNA 3FMGA 1KJLA 1J3RA 2QVSB 1HRI3 4GALA 2AZ5A 5FXXA 4YFWA 3KV4A 4CEWC 1AR71 5FZKA 4RR3C 2RS31 1A78A 4NUBA 3HMYA 4Q0PA 2IFRA 1ZRIA 1JUHA 3PL0A 3CMGA 1XQNA 5IVVA 5FY5A 3L2HA 1ENSA 4Q4V2 5J1XA 2RS53 5C5TA 5I0RA 2A75A 1O3QA 2TEPA 5C8CB 1ZRDA 2A1XA 4UI9L 3QBQA 3VBFA 3SQOA 2OX0A 3HBKA 2JDYA 3ES1A 4GMP1 5EPAA 5EZWA 4BM8A 2GN3A 5JOWA 1C1LA 1BJQA 2QQLA 2JG8B 2ZGRA 3HWJA 4QX0A 4HBNA 1RUG3 2QUOA 4HVRA 2WSUA 2C0ZA 5C9AB 3WR0A 1ZBE1 2FDKA 1OVPA 3M1HA 2GMMA 1GOGA 2BWCA 1N1SA 4HN1A 3VBHB 3T4HB 1VBE1 1OMIA 1IGOA 2A70A 4DRRA 1IG3A 4W65A 3WF0A 5JI7A 2WZPP 2G19A 5GLTA 5K8SA 4RS5B 4LTAA 5G05L 4W6XA 2ZZQA 1W6QB 4ASLA 1OKOA 4Z1VA 3PUHA 2JKXA 3I54A 3R4SA 2OUHA 5J09A 1FXZA 1MPXA 3EO6A 2PFWA 4CDXB 2E53A 4QXHA 5FY7A 2HBTA 3MICA 3OGRA 4RHV3 5FUIA 5ISLA 4FFIA 3SEEA 3KZ4C 5KHKA 2ZGQA 1B09A 1D4M2 1PMIA 2ET7A 4YW7A 1WW6A 1OVSA 2A7AA 2B4KA 2HWF3 3GZAA 3R4DB 1W6OA 3VDCA 2JB4A 1DYKA 2WINB 1XYNA 4Q4V1 4R4XA 2IVIB 1OPOA 3WNPA 1GNHA 2ARAA 1AYN3 3MHZA 4L0PA 4CCOA 2B45X 2J1VA 3UGGA 2WUHA 4XETA 2B42B 2BRTA 3ZN4A 1XNDA 1D2SA 4ARYA 1GU3A 1H9WA 4NR1A 4AHYA 5A3WA 2XJUA 1TE1B 4OYUA 2FHRA 2VZRA 4Z2WA 2FDIA 1J83A 5C8CC 3TEYA 3WF2A 3RWKX 4JAAA 1V0AA 1LGNA 1AYM3 5ANQA 1H8TB 3LEMA 3USUA 3AKRA 3KMHA 3H0OA 2WO1A 3POJA 3KD4A 1J3QA 4AHWA 2JG8C 4LORA 1YJLA 2B39A 2ZGSA 4OUEA 5FK8A 3OOXA 4UBHA 5FY0A 5C9AC 1ZREA 1AJKA 4IERA 1W9TA 2DURA 4NO4A 4E4HA 1FAYA 2XWBB 4UF0B 5DPNA 2H6CA 4XZUG 2JE9A 3CQOA 5FUNA 1ZZBA 2W1WA 4H55A 5A7PA 5A3LA 2RDQA 3H1MA 5LY2A 5FJHA 3HR9A 2X5IB 3ZYIB 4MZUA 2D93A 4RS5C 3DKWA 1QOSA 4IDZA 2MEV2 1YYNA 3POFA 1D4M1 1SZBA 4I09A 3W58A 4M3CB 3UT0A 2WSVA 3F95A 2K9ZA 4FPFA 4CDXC 5DUXA 3ZXEA 1ZYBA 1CPNA 3PUQA 2E32A 3MF6A 2FZ2A 1C28A 5A3OA 2Q5TA 3H9AA 1RMU3 3QCWA 5JI9A 5A3PA 4RQPA 4IE4A 5BNQA 2WS91 5IAXA 1MZEA 3DEMA 4NIIA 1UD1A 4I30A 3MPPG 3J7LA 4XFGA 4P5HA 4HXCA 3NQHA 4PI2A 2VOVA 4Y1VA 3TB0A 5ABJB 1ULGA 2WABA 2Y6GA 1NQJA 4QXBA 2B7YA 2HEWF 1UKRA 5DG1A 1C5HA 4CUBA 2Q1FA 1YC61 3FWEA 1WGPA 3NJXA 2RDRA 1SLLA 2VZQA 1POV1 5JOZA 3J8F3 1OLQA 1AX2A 2N7GA 3T2PA 4A41A 5DZGA 1JZ6A 4A7KA 1BEV3 4FPOB 4BXFA 3TNQA 4HPKA 4Q4W2 2W87A 3WNMA 4EN6B 5ACA1 4PDWA 3RSJA 4ZKTB 5I8YA 4CUCA 3DN7A 3KLSA 2A6ZA 1W6NB 2CGNA 2HEVF 3EXUA 1CZTA 4B1MA 1IS5A 1XU1A 3AMMA 5CKNA 2VTXJ 1WW5A 2XMLA 4FO9A 2P37A 3UKTA 1NLSA 3GBFA 5JZGC 3KGZA 2MEV1 3BUCA 3UGFA 5CAZA 4AVCA 2V4AA 4AI9A 2XB6C 1JI6A 4G4FA 2VW1A 3I2KA 3O1TA 1VR3A 4S2DA 3ACGA 4TLGA 4DFSA 1U5ZA 3OCPA 5F6LB 5CFDA 3AKPA 4NHYA 2X5IC 2WNVA 3FBYA 1APNA 2FMDA 1M06G 3VZKA 1RUJ3 4CEWA 4N9IA 2QDRA 5BPXA 3R6SA 1NE4A 2RMU2 1DQ4A 2R061 3EJKA 3GALA 4LIVA 3VKNA 3WF1A 3P1IA 2JJ6A 2ZABA 3HQRA 3PVBB 1MS8A 1NT0A 4HVOA 4K20A 4Y22B 1XSRA 5IVYA 1RUE2 1VBD3 4MADA 4P9WA 2E31A 4PLNA 1QIQA 4EV0A 1O4ZA 4IEQA 2YPDA 5FREA 2ILMA 3VGIA 5C3SA 1HXS1 5L7OC 5C3PA 3PJYA 3Q8EA 1H2MA 4UW5A 5BUVA 2HYXA 2Q8DA 1BMV2 1AR73 1GKBA 1LEMA 2RS33 5HPOA 1UZVA 5DABA 4UFLA 4ZY9A 1O7FA 3UJOA 5ABJC 1X9PA 2R30A 2W95A 1V00A 3JU9A 2FDJA 5EJ3A 3ST7A 3C7EA 3PUIA 1QXRA 1V9U1 3S5QA 4K3UA 5FXZA 4WVZA 3GHMA 5CA6A 3IWZA 5CKQA 2D98A 4LK7A 4GMP3 4HFSA 4HK9A 3VHPA 1UMHA 4RL7A 3O1VA 5JPMB 3B9IA 1W03A 2AEYA 4WM8A 4FP2A 2OUJA 4LLOA 4UT5A 5FBJA 4CCKA 3V65A 1UZZA 2R071 1ZBE3 5GM0A 1GZWB 4NVPA 1XYPA 1S0JA 3B7MA 4UW6A 4EN9B 4XFCA 1J84A 3WQBA 2MHFA 1MVQA 5IWFA 4XF0A 4YGBA 3ZYBA 3DGTA 3W59A 2WC2A 2Z5WA 4PLMA 3WDXA 5JOYA 4KG8A 5IJRA 4TZDA 1RUD1 4YVSA 1GNZA 3KCCA 3WZ1A 4M0HA 2NM1A 5FP9A 3I97A 1LHNA 5EYYA 4LITA 3USSA 2A6XA 4MHUA 2VBDA 4A42A 1O59A 1QHDA 1ENXA 4M00A 4GIQA 1Z0HA 1ENRA 2PELA 1QOOA 4GWNA 4BU2A 2W9XA 1BMV1 3ZKUA 1OLRA 2X09A 5FRAA 5DAPA 4CP9A 1N1TA 3E5QA 3LA3A 3HNBM 1AL23 1HX6A 5C8CA 1XRUA 5EYXA 3WUDA 3GBGA 3KWVA 1DG6A 4Q2FA 3GF6A 4LUKA 2Q8EA 3ZSEA 2BVVA 2VMIA 3KM5A 1GZTA 5FYSA 1ZRCA 4BQ1A 3PURA 5F2WA 4OQ8A 4MGTA 3AKSA 2X29A 5DDJ1 4Q0UA 5H9QA 4XXPA 3SNMA 1Z7S1 1CWPA 1R1A2 4QQLA 1FV3A 1VBA2 4B3NA 1WCQA 2ZX1A 2WDBA 2WR9A 3POYA 1LOFA 1UOGA 1Q43A 4XDQA 5FP7A 3A0KA 4AEDB 4RS5A 2RJLA 3WT3A 1W8WA 2XHNA 2GH8A 3FJSA 4A44A 4CPBA 2W47A 1T6BX 1O5UA 4FT8A 2BOIA 2W46A 1SFNA 3O0VA 1SBDA 1CZSA 4ZXEA 2VQUA 1YXWA 2A71A 1WWYA 2Y33A 1NLRA 3K4AA 1UIJA 4HLTA 4XABA 4PBOA 2D3SA 3GZUC 4P9YA 1OBNA 1NY72 2JECA 3AZWA 1K42A 2AGSA 3AMQA 4XIKA 4KNCA 2NLRA 4IW3A 1DQ5A 1D4M3 2JE8A 4FPKA 5BXXA 3RZJA 5FYUA 3ON7A 3DUIA 4XURA 5DAVA 4E2SA 4NRPA 2JKBA 5JAXA 3U75A 1P8JA 3BOWA 1FATA 3GCXA 3BIEA 1H30A 2Z69A 2GMPA 1MACA 1ZRFA 1Y9QA 4LBQB 4E4ZA 2J7MA 1SLAA 1E57A 1LOCA 2WS93 5FZGA 1QQP1 4H3WA 2WT2A 2F4LA 4NWWA 4IV3C 4YZ4A 4IGOA 3KCYA 2WWJA 1AR82 3I2HA 3WDWA 3ZXKA 1RYYA 3DYPA 5FWEA 2CTVA 1R1A1 5A6YA 2VQAA 3DXTA 5FDBA 2X8KA 2XJVA 2RR13 3ENRA 3WXPA 4CP0A 4IEWA 1XE8A 3ZXDA 4JKMA 2HWE2 3PUAA 4CU7A 3V0BB 5FCCA 1WKYA 2YC0A 2PHWA 1UF2C 3JCIA 3NAPB 1POV3 2A3WA 1OOPB 1WCSA 3K77A 3ZYHA 4BPZA 2ZGLA 5FPVA 4M0NA 1XNBA 4UF0A 1NCRB 2IXIA 1O4TA 1PO22 3ACIA 4AGGA 1DZRA 1RJ7A 5I0TA 4DXTA 5ACA3 1O3RA 1FT9A 4B7KA 5HV4A 4FFHA 4PI0A 4LKEA 4AEDC 1OT5A 2AH2A 3BOPA 4AF9A 4BH9A 5LW9A 3IIIA 2RHPA 1CIWA 1C8M2 4UYBA 1NY71 5C4WA 4I02A 1FV2A 1PO12 1JOJA 1YRZA 4ET7A 2MEV3 1H4HA 3NNFA 1LODA 1ODMA 5FZDA 2D6NA 4CE8A 1UNBA 1QJFA 2BERA 2HWC2 2P2KA 2Y6LA 4GB32 3FFQA 1AZDA 1ZRRA 2WLPA 2ZCWA 3FLTA 2VMGA 3JD72 4CXXA 5EIYB 1KITA 1J3PA 2EF6A 3C2UA 3K48A 5L7OA 2NMOA 1LHWA 1CESA 3LDBA 1K12A 1S0BA 1X50A 4X8PA 1XXNA 2IC1A 2WZEA 1MS5A 2R063 2VNGA 4LE3A 2GNDA 5FZMA 1KFUL 3JBG2 5FY1A 1DHKB 4C1WA 1BVVA 4MGQA 1KJRA 4XCBA 2R1DA 4BE3A 4M4RA 2X53S 1GICA 3KVBA 4WM7B 4WVWA 2AENA 2JDMA 3C7OA 1ZBA2 4QKNA 4XFFA 1AR91 2BUKA 4Y1XA 3OEAA 5FWJA 1RB8G 3I7DA 4BZ4A 3TRSB 3HT1A 5BNOC 3LOBA 2QQNA 3T1LA 4DZGA 1Q56A 5CIRA 4GWMA 1HXS3 1RGSA 5FR3A 3ETQA 3MUZ1 1NX9A 4LPLA 4ARXA 5T5PA 5FMOS 2CWMA 3J4UH 2DTYA 4MH0E 3AFGA 3ZIWA 1VBC2 1PO21 1KD7A 2ZHLA 3KT4A 3U14A 4FTBA 4NWVA 1DLCA 5F32A 5FO9B 1OC1A 5FPAA 1UCXA 4UWDA 3K3OA 1ZX5A 3A0NA 5LA2A 1S0FA 4LA2A 1V9U3 2ZGNA 4C0BA 4LBMA 1IKPA 3H1YA 3NAPC 3U37A 4LR4A 4NN0A 2OQ7A 1JYVA 4QDQA 4AE2A 4CU6A 1GQHA 1RITA 2ZJCA 2JWPA 4YGEA 2P17A 4I0BA 1NCRC 2BZDA 5CVRA 5FJKA 4COZA 2VU9A 1GOHA 3EHKA 4FFGA 3UKNA 5LA1A 1UY3A 2G1MA 2BGOA 2YXSA 2JDKA 3GZEA 1NA1A 5IUQA 4K7JA 1DGLA 2Q30A 2R073 2Z42A 2ZGKA 3ABZA 2IXKA 3HQXA 3PTRB 4YM2A 5FP3A 5IVJA 3JD71 2XOMA 2GN7A 3H3UA 3WUCA 1HV0A 4RN5A 1HB1A 3WNOA 3W5MA 2LTNA 5FYTA 1EPZA 4XVHA 3NJYA 2K46A 1ZZCA 1WA4A 1XNCA 2GMEA 3HPNA 3CO2A 3JBG1 4LHLA 4I0AA 5LK5A 1JZ3A 3AKQA 4JRAA 1BK0A 1RUD3 1WBFA 2WAAA 5I0DA 1OXCA 3WG4A 1ZBA1 3K2OA 4NRMA 1CIYA 3V64A 5KBFA 4TYSA 1IPKA 2DFCA 5CFCB 2ENRA 1VRH1 1XE0A 3ME2A 2J1EA 2QZ3A 3KV5A 4BHPA 4YM1A 1JUIA 4DS0A 1REFA 1ZA4A 3RMYA 4BYYA 1Q8SA 4OUSA 4QAWA 2UWAA 1EPWA 4A4AA 4WM7C 2YBKA 3I2IA 4QD2A 3MLLA 1VBB1 3PLQA 1BBT2 4O61A 1LULA 2FCVA 4P08A 3VZLA 3O0XA 2PYTA 3VD5A 5LEJA 1LU2A 4YM0A 5CISA 3ACFA 2WZR2 4XDPA 2XJQA 4AFBA 5JR2A 1BQPA 2R041 4E8CA 4XTPA 4AYUA 4K40A 4Q4Y2 4BQ2A 4QKFA 5DDJ3 2KD7A 1Z7S3 3MO4A 2FBEA 5L9RA 3WP3A 3H8RA 1QWRA 1ND3B 3CBNA 3N9MA 4ZS3A 3VHRA 5J96B 5FZ8A 1KFXL 4N43B 5JMOA 2YY1A 1VMJA 2QZ2A 4N53B 2JEMA 3SLIA 4HOOA 2W91A 4D6RA 1X9TA 5FY8A 4FTEA 3O1RA 3WW1A 4AEMA 2IVJA 3M3OA 3W5NA 3WSOA 1E5HA 1Q8PA 1UYXA 5FMBA 4BK4A 1ASJ2 4AQ6A 5IATA 1RUOA 2P6CA 1F2NA 2Z4FA 2UWBA 4CEYB 3VBUA 4AGRA 4CDUB 1B35A 4GH4B 1GQPA 2VQ0A 3MYXA 3IMNA 4I0WB 1TME3 2Q1ZB 1QOTA 2NQYA 3NV1A 4IESA 3D6EA 4QHZA 1RVF1 1JHJA 3MPBA 1N3PA 2W68A 4LULA 4AK3A 1R092 3AYAA 5KXEA 1CAWB 4INDA 2UYAA 2D6MA 2DYCA 4IV3A 2XDVA 3HVDA 4PLOA 3WF3A 1IOAA 3BODA 1I5ZA 2P5BA 4FSJA 5C8WA 4L97A 4WZFA 3OEBA 5FZ3A 1EUTA 3OD4A 4XTMA 3MW3A 4X8NA 4E2GA 3OPZA 4MXWA 1BBT1 2XVGA 4TLFA 2PLV1 3ZXGA 5CFCC 2CV6A 5FY9A 2VMHA 3K75B 3SEPA 1QH7A 4Y1UA 3SH4A 5A7WB 1DU3D 4CCDA 2YG0A 4ISRA 4RGGA 1QQP3 1FNYA 3O5SA 4Q4Y1 3KF5A 1Q8OA 4LO4B 4JGZB 2RE9A 1MS4A 1GZ9A 2W08A 1NCQA 1IS3A 2D40A 5F7UA 4B29A 2VZ3A 1YQ8A 4A2UA 1UU4A 3KS7A 1IS6A 1H1IA 3CJXA 4P14A 3ZX7A 1FPN2 5GZCA 2YC2A 3AVSA 4NIGA 5GLZA 1RHI1 2BFUS 2Y0IA 3RYRA 1F5JA 5HCBA 1LESA 1ND3C 1GMMA 1UWWA 2J1UA 2VMEA 2DCZA 1QXJA 2PHFA 3KF3A 3LSDA 3N9QA 2A6YA 3BYWA 1R081 4N43C 4QPIB 1RJ8A 2PHRA 4N53C 2ZTNA 1EAH2 4HL0A 1JBCA 2ZX3A 2XVLA 3AKTA 3ZFGB 3PNAA 1YFXA 1WW7A 4LEJA 5DQ0A 1UO9A 4WVMB 2VM9A 1DQ1A 2VVFA 3RYPA 3GM8A 3HT2A 4XW3A 4CDUC 4AZZA 2C1FA 4ZU4A 4CDQB 4CZSA 4D94A 3VDBA 3T09A 2SLIA 3KT1A 3LOIA 5A32B 1PM7A 4D8MA 1ZVFA 1WMDA 1GP5A 1WMFA 5KHHA 2DUQA 2VBBA 5E1RA 5D2AA 4JQRA 5BNOA 1ND2B 1OUSA 1Y9MA 2JG9B 2YB7A 3HNMA 4IE7A 3C7HA 3ELNA 2VNOA 3HN1A 2XBO1 1JZ2A 1N1VA 4COUA 3I3BA 3MZHA 2ZMKA 4NHMA 1AL0G 2UURA 4OQ9A 3RNSA 4AHZA 4EWEA 3JXSA 5ANNA 2AC1A 2D6LX 4OMCA 3V0BA 5C7GA 1EY2A 2Q1MA 4UXAA 3AP5A 4EQVA 2RS12 3WCRA 2DWRA 3DYOA 4Q4X3 4RGKA 1AR93 5E8AA 1NLQA 4P9GA 3WQ1A 3ZXLA 1LCLA 1Q8VA 5GZGA 1FPN1 3PMSA 2P1BA 1NCRA 4HONA 4OMDA 1QJZA 2HWB3 2PHLA 2WNOA 4XC9A 3RZGA 2E9QA 2WA4A 5FOJB 1QJY1 4JGZC 1UAIA 2BNNA 1QJX1 1SG3A 1TMF2 1W04A 4K8RB 4SLIA 4YVWA 3RG0A 1QJU2 1DCSA 3LEGA 3MFAA 4GULA 1DLLA 2YPJA 4NAOA 5F5AA 1AR62 2VOXA 2EA7A 3FE5A 2VUAA 3RDIA 3RZKA 2XLFA 3X29B 2ES3A 2AEZA 2V72A 1MQTB 2ZGUA 3NJZA 4YW4A 5J98B 3KV9A 4QPIC 1UPIA 2WQ4A 4XF3A 5K0UC 1XBFA 1UXZA 1GFF2 3EQEA 3GXUA 1QDCA 4IE5A 2UY8A 2GC0A 5A7OA 1CAUA 3ZFGC 1W2AX 3UESA 2RM23 5FZBA 1HRV2 2ZMLA 2JDZA 4GAZA 4XFBA 1UU6A 4LBLA 1N3QA 2HJIA 4JKLA 4XE9A 1Y3TA 4QDRA 4CDQC 3LPFA 1VALA 2D5FA 3AYEA 5DAWA 3RZHA 2VECA 4DUVA 3LQCA 5KXBA 3LCPA 3JB8A 5F5QA 2L9LA 3KHCA 2XWJB 2R6QA 4ASKA 1SMVA 5AC91 1ND2C 5JWPA 2JG9C 4M01A 4XJAA 1CX1A 2D43A 2RS11 2Q8CA 1OD3A 1W2TA 3OYWB 4Q8KA 1WCUA 1VAVA 1VRH3 2IXHA 3B00A 3VBOB 5L9BA 5FPBA 1LHOA 5FK7A 2ZGPA 1FMD2 1WBLA 5HCHA 2YU1A 4W8JA 2WO2A 4KI5M 4WBBA 3GHNA 5I8TA 5BNPB 1G9AA 1DGWA 1ULDA 3LDRA 1QJU1 4LKSA 2GP3A 3UNPA 1PVC3 4HSLA 1VBB3 1AR61 4HETA 4XEZA 4R52A 4DINB 2OIIA 4JGYB 1MZFA 4BWOA 2QQPA 1MS0A 4DY5A 1O91A 2D3RA 4GQ7A 4QPYA 2BEOA 4R8HA 2GZWA 2W1UA 2R043 1S2EA 2HBUA 1RUF2 2NPIA 3HIFA 2LROA 5FYBA 3CLPA 4Q1PA 1MEC2 2KXLA 4AGVA 3POSA 4YNIA 5L36A 2VW2A 3E6BA 5JXIA 4Y20A 1JOPA 4LQRA 2XXZA 5FPZA 2CAUA 2Y0OA 3BKZA 4DQAA 1H1MA 3VHOA 3D4KA 1VIWB 4C8DA 5FYHA 1NUKA 4E4SA 4IGPA 1H2NA 5GZDA 5F5CA 2IXCA 5C5UA 1LNSA 3VBHC 2ZBJA 1JS9A 2JXAA 3IAPA 3N3HA 4FAHA 3ZLIA 5J48A 5A3TA 3BTXA 5FP8A 3CJIB 5LBBA 4L11A 2TBVA 2Y60A 1YFWA 1RUH2 1RVF3 3DECA 4LLFA 1AUYA 4UFIA 2QE3A 1OQEA 4CCNA 3IDCB 3ZPYA 1STMA 3MEPA 1JMUB 1NKGA 3BU7A 3POBA 3BTZA 4XF4A 1NOVA 2NP0A 1UW8A 2WLQA 1FMD1 3TN92 4O7XA 2CNAA 1HJGA 1AXKA 4FOWA 3PIJA 1ZNPA 5A1AA 2P34A 1PGL2 2VUDA 1ULFA 1DQ2A 3T0BA 2PLV3 3OGGA 3QD6A 3WEZA 4WZCA 2D3PA 2DV9A 3QLQA 4NPRA 1VPHA 1L7RA 1QNYA 3OY8B 5F8PA 3CZUA 3WNXA 1H6XA 3P5BA 1UX7A 2W1QA 2OZ6A 1XB9A 1RUF1 3PU8A 4N53A 1OD5A 3I2JA 1COV2 4JGYC 3IPVB 3VL9A 5A1FA 2P3YA 1W39A 3KGLA 1CQ9A 1W6MA 2VTXA 1US3A 3POWA 3R05A 3ZFEA 4CCCA 1OLMA 3QH6A 1UOFA 3THDA 2IUWA 1JXNA 2VC9A 1H9PA 1RHI3 1W6PB 2OPKA 5FP4A 4F8AA 5F3EA 4CCLA 2QQOA 2WJSA 1UY2A 2G9GA 3NWKA 4CYDA 2OT7A 3ALQA 1R083 2DTWA 4C1XA 4ZHNA 1H8TC 4XQ4A 1PK6B 2NZ9A 4DNYA 4XHXA 1GV9A 1YLLA 5GKAC 1JYTA 4TXWA 4LA3A 1QU0A 1F15A 4KQ7A 4UW4A 2Y6HA 2ZHNA 3FUOA 2EXIA 2DVDA 2EIDA 5T5OA 2SBAA 4R9AA 4RFT0 2PQQA 5KC6A 1L7QA 1FX5A 2RVAA 3AC0A 5JXGA 1PM4A 4MVTA 4QB6A 1CAXA 3TBDA 4XDOA 1W8HA 3QOPA 3VZNA 5F9TA 1X8EA 2ZHMA 3V0AB 4RR3A 2XBO3 4X6QB 5LATA 3E6CC 2HLEA 3NVCA 1VLNA 5HV0A 1QEXA 4OHZA 1Q8QA 1W9SA 1S2KA 3BVCA 1JZ4A 1WD3A 1AX0A 2GP5A 1COV1 2ZOEB 1JYNA 2CAVA 2DU0A 2Z79A 3IAQA 4JDMA 4OI2A 2FDGA 1DDLA 4QX3A 1SCSA 2OQ6A 1XJAA 2FQPA 4FFFA 3NSTA 5H9SA 2R0FA 3S5AA 3POGA 5FYMA 3H42B 4QPIA 2C9AA 4DO0A 4DXSA 2PHXA 3VD4A 4OI4A 1H1AA 1SPPB 2ZX0A 2WNUB 4Q4W1 1QJY3 1GSLA 3N4MA 4CCMA 1KQRA 1QJX3 3IB3A 3KB5A 1CJDA 3ZPOA 1AXYA 4ATEA 3O1SA 1XNKA 1JU3A 3LAGA 5M0TA 1FOD2 2XQXA 1RUI2 3DCQA 1DYOA 4B1LA 1UOBA 4G3YC 4HG6B 4CDQA 3O14A 2O8QA 1QGLA 2QNKA 4DPNA 1HV1A 2R32A 4AFCA 3S57A 5F2SA 1UMIA 3HNYM 4D6QA 2FD8A 4UFJA 1KGYA 3MIDA 1L3JA 2JG9A 4NIHA 2JDNA 2ZGMA 3BGAA 1PK6C 3MIFA 1CGPA 4YFZA 1E5SA 1HQWA 4YZ2A 2YV8A 2Y38A 2Y6JA 2ZAAA 1UZYA 3LWCA 4QM9A 5EJ1B 1V6JA 1VBE3 5T55A 5IK7A 2BGCA 3MIGA 5HCFA 4OHYA 3OUHA 4QQ2A 4KGGA 3VZOA 2I2SA 2RMU1 5BNNB 3KSCA 1DFQA 2NMNA 3H50A 1SDDB 3O12A 2J22A 5FKBA 1GP6A 3BIWE 3H3ZA 1RUE1 3LIGA 5LRRA 1S1AA 4CTEA 2CGPA 4FQ4A 4IEVA 5AC93 4QPGB 1VMHA 3LEKA 2RS13 3TNPB 1A8MA 3WDVA 4A6SA 3S6PA 1F35A 3R4UA 4M4PA 1LB2A 1GBGA 3DXUA 4L2NA 3I2GA 2WL1A 1BYHA 3N9PA 4ATFA 4QHBA 3AMHA 4R9DA 4BIFA 2O14A 2ATFA 2AUYA 1W8OA 3M3EA 4JDOA 4FOYA 5FPLA 1NQDA 3NV4A 2ZAHA 3WQ0A 4AHXA 5DAQA 1J1LA 3T2QA 1DYPA 1VAKA 4Q4V3 1U5YA 4XFAA 1EV12 4MSVA 5T5JA 1LGBA 1HB3A 2WFF2 3PDQA 4Y3OA 5L73A 3WDTA 5IVBA 2JG8A 2D6KA 4ZZ5A 3KVAA 1ACCA 1UXXX 3WINE 1D0HA 2WNUC 2OYZA 4D7YA 4NIDA 5C9AA 1JYXA 1X36A 2OXBA 5F39A 3J7NA 1TG7A 3P3PA 3VBHA 1S0IA 2ARXA 4NIAA 1HQLA 4OFGA 4L9BA 5JZGB 2HWD2 1UMZA 3FHQA 1PX4A 1W06A 3LIHA 4OI1A 5FPXA 3QACA 5CNAA 4Q5OA 5F6KA 4P9JA 3U07A 1TQ5A 3RQ0A 4AL9A 5IK8A 4JQTA 4O9EA 1W6QA 5H9RA 3ZFFB 5IAVA 1C57A 5A6XA 4ONUA 1QKQA 1DF0A 3JQWA 5AVPA 5K0UB 4Z2AA 4CDXA 3LA2A 1PGW2 2VZVA 2XL7A 3MBWA 3RZZA 3THTA 3VD9A 2RDSA 4U36A 3VKOA 5CBLA 1YUDA 3CU7A 3CDZB 3H8OA 1CJPA 5BNNC 1JZ8A 1WLWA 1LJ7A 3T0AA 2F6BA 5IK5A 4AW7A 4IEOA 3IBMA 3S7IA 2RJKA 4KWKA 3E1F1 1EYBA 2GC1A 1FMD3 3ZSMA 1ONAA 3GYDA 1SCRA 4IV1B 2VNRA 1Y43B 3AJZA 4Y5TA 4CA9A 4QPGC 3RVHA 5K7PA 1K5MB 3H7JA 4HKLA 2XUEA 4PQ9A 4KBBA 3TOJA 4CDWB 2W2IA 4OZXA 1SACA 2QCSB 2YGLA 3ZN6B 1CX4A 5JMCA 4SBVA 3ASIA 5FKCA 1AHSA 5IK4A 2CWSA 2YC4A 2I07B 3EB7A 1NYWA 1ALYA 1OFNA 4XAEA 2JDUA 5DUVA 1TVGA 5FFOC 5FZOB 2RJ2A 4W50A 1AX1A 1W05A 2LUWA 3ACHA 4CXYA 4YG3A 1YI7A 1C3HA 1VBA1 2WT0A 4LO8A 5C70A 1G86A 1H8TA 2Q0AA 4YYOA 1CN1A 1K3IA 2FCUA 4R4ZA 1KXGA 5FYYA 5GJ6A 1NZCA 3FN9A 4FPEA 1CR7A 3UV9A 4ES9A 2B8MA 5LRSA 2QBXA 3ZYRA 4BK5A 1C5IA 4V2VA 4R9CA 3ZN5A 2YZ4A 3ZYPA 5IYYA 1UY1A 2C5DA 2GNTA 1BVP1 1Z78A 2EAAA 4B4PA 3TYJA 4FP3A 3DL3A 1W0PA 2X5IA 1PGSA 4COVA 3A7QA 4P00B 3ZFFC 1RUC2 2ORZA 2AR6A 3B02A 4YARA 2VUJA 4A6OA 2AYHA 3T2TA 1VAMA 2JIGA 4M3CA 2HH9A 3O0WA 5D21A 4EN7B 3ZR6A 5FYIA 2O0OA 4ES8A 1GQGA 2D6PA 1HRI2 3D0SA 2E51A 3URFA 2QFEA 2XGXA 3M8LA 4NE9A 1GWLA 4XF1A 1LEDA 2XPJA 2MNGA 1W90A 1BK1A 1OHFA 2OPWA 4LOSA 1VB2A 1YHFA 4FPCA 2Z2SB 4XMAA 2JICA 2VCMA 3J7HA 4NHKA 3OY8A 5T50A 1YIFA 3OSDA 5A6QA 1S0EA 5CADA 3FLPA 2PHDA 2RS52 3NV3A 4LJHA 3VLBB 1NE6A 1T6GC 2QQIA 2O1QA 4IV1C 3D82A 2A6VA 3AM2A 1AR81 5ABJA 5JOXA 2D97A 4XMIA 2UY9A 1K5MC 1ZZ8A 4J1XA 4XFHA 1W2NA 4YG6A 3VBFB 4CDWC 2DVAA 5EXOA 4ZZ8A 1RUG2 1COV3 3T3YA 3R0RA 2HWE1 1DGRA 1KS4A 1W9YA 1IZ3A 5GZFA 5LA0A 5E6HA 2IZWA 5B4NA 2DVFA 1CPMA 3MV01 5H9PA 3SKVA 2E7QA 1QF3A 1YQ6A 2Y64A 4AQTA 3VDDB 1W6NA 4Q4W3 1XPWA 3KQ4B 2ZEYA 1LOAA 3SITA 2J1RA 3WNLA 5FYVA 4ORFA 3W21A 4PIYA 4XACA 3Q8CA 4XXAA 4CUAA 4IEPA 2Y26A 3WCSA 3ZXAC 4LE4A 1H6YA 1C8M1 1OOPC 2BTVC 4O65A 1PO11 4NOTA 1PX3A 2YFUA 3T4VA 4RHV2 2IXLA 4XIOA 3RGBA 2VZTA 2WKKA 4XOGA 3GNEA 1S0CA 1DIWA 3INAA 2GNBA 4ZU5A 2HWC1 4GB31 3DYMA 5IW0A 1URXA 1H2KA 3IDBB 5DN2A 1E5IA 2HWF2 3NMBA 4QXKA 5I91A 4ZS2A 2H0VA 1VMFA 2JD4A 5LZ6A 5A3MA 3POIA 1J1TA 1WZXA 4MX3A 2GNMA 1QDOA 4XPVA 3VKFC 4Y22A 1W6OB 2BW8A 1AYN2 2RMU3 3SH5A 1US2A 3I3MA 4I3GA 5IFPA 2VQTA 2Y34A 2XR4A 4QU2A 2YROA 1RUE3 4L8QA 1GP4A 1VB4A 4OHWA 3ZYFA 1AYM2 4GXLA 2XQRA 1DBNA 4OVEA 4BOWA 4JX0A 4QQOA 3VBFC 4IUGA 1VBC1 1RINA 4GWIA 2LRPA 3USUB 1SLCA 1G7YA 3AYCA 1C8NA 1DGWX 1OH4A 1YNAA 3CF6E 2CDPA 3NNGA 3RWNA 2BV4A 1CAVB 4AAPA 4QB2A 4XZPA 3UKVA 1OF4A 2E33A 1Q5OA 1N1YA 2E63A 1M4WA 2TUNA 3CKHA 2BWAA 4ITCA 3VBRB 3ZYGA 2HEYF 4BCUA 1GWKA 5JXJA 2DUPA 3NNJA 4XUQA 1I1EA 3CL1A 4DXZA 1R1ZA 3UJQA 1H8VA 1S0DA 3NKTA 3OGJA 1RXFA 4GZ9A 4V2WA 3VDDC 3ZSLA 1MS9A 5HI0A 1T2XA 1GZWA 2UYBA 4Q0VA 4KG0A 5EJZB 5FZFA 4LKFA 3A23A 3O1UA 3U11A 4K9SA 3VBSB 4B7EA 2TNFA 3LE0A 5C6CA 4Q0SA 1O8PA 3WG2A 4AOCA 4CPBD 2V09A 5BNNA 1W8TA 5DZFA 1PZ8A 5GZEA 4CXWA 1E5RA 1A3KA 1SHWB 3RZMA 1OA2A 4XBLA 1YI9A 3RFRA 4KBZA 4MGYE 1GOFA 2Q4SA 4P9IA 1RMU2 5DG2A 3CIHA 4IGQA 4Y1ZA 4TN7A 3WW4A 2DBNA 1W9WA 3MDPA 2DCYA 4MLOA 5T5LA 4AR2A 1SEFA 4J6GA 3ACLA 5FZ4A 1LOBA 1XE7A 1REEA 4RQPB 3WD5A 3RPQA 3AJYA 4QB1A 3MIBA 4MGKE 1PIV2 3N7MA 5FLIA 1UY4A 3GJBA 5B2GB 5EV7A 3G7DA 5FMOL 1XYOA 1G9DA 2EXHA 5FZLA 4PIXA 1H0BA 3J8F2 3POEA 2XL9A 2DVBA 4GWJA 3TEZA 3PJQA 4LKDA 1W8NA 2VL4A 3H3LA 1I9RA 4BA6A 5FXWA 4NHLA 2VO5A 5T54A 2XLAA 4P9LA 2O8OA 1S2BA 4YW3A 2PN5A 1OQ1A 2LS6A 4JV4A 1D2QA 2KR2A 2OVUA 5HXMA 2DFBA 5BY5A 4DEVA 1G9FA 2NYYA 3C3VA 4S2FA 2WZR1 3RYKA 4KMQA 1WW4A 4PDWB 3DF0A 3WP6A 1UX6A 2OW4A 3PVNA 3WHTA 4MGIE 2JENA 3PTYA 2K0GA 3OTFA 2VZPA 1GANA 4XJZA 2MPFA 1R1A3 3RRDA 2IXJA 3WV6A 1VBA3 4AEDA 2WN3A 3ZFFA 1YQ5A 3LGRA 3IT8A 3VBRC 3LFIA 4AI0A 2VMFA 1AJOA 1OSGA 1LOGA 2VMDA 3U1XA 1MVEA 4FTSA 3SXWA 4Y26A 4HKOA 1RUJ2 1ASJ1 4Y5Z0 2W94A 3ZM8A 2LM3A 5A7SA 3ZIXA 5CFDB 5KR7A 2BDRA 3VBSC 2JX9A 1NXD1 1NXMA 2WNVB 1MS1A 5DUUA 1UU5A 4OHVA 3ZMNA 1U12A 1SLIA 3BU0A 4CEWB 3E6DA 1D4VB 5F37A 1F4HA 3OGVA 2JDHA 1PIV1 1VBD2 2VJXA 2YMZA 3HN3A 2BGPA 2D7FA 3AMPA 4QT6A 3ILFA 1R091 4QM8A 2YFZA 4XJUA 4Y24A 4BISA 5C3RA 5J3UA 2G9ZA 3BN6A 4Q0QA 4IV1A 1NG0A 5A33A 2BBAA 1OPMA 2ADDA 4GMP0 4CEYC 3SCFA 3ROUA 2JDAA 1UYPA 4GH4C 2HYKA 2A3YA 3T08A 4CCEA 3TEWA 4LNVA 3NO8A 1AR72 4P5YA 3VHNA 3WP4A 2RS32 1FNZA 4LBQA 4OCTA 1HN0A 1ULPA 4F83A 3OB8A 4XILA 5FZOA 2ZEWA 1WMXA 2PTMA 5IVEA 2KM2A 3AZXA 3M4FA 1UOJA 2QQMA 2WYFA 4Q27A 1UKGA 2PQSA 4AQSA 1YFUA 2GC3A 4COYA 4LO6B 1AR83 3ZO0B 3ETPA 4DMIA 4CRQA 4E27A 3JQXA 4DUWA 3LPGA 1J58A 3S7EA 5FOBB 1JYCA 5DAXA 3TAYA 2F17A 1EUUA 2VD7A 1ZA7A 3NAPA 4QQHA 3HBZA 1OOPA 5L19A 3U4SA 2HWE3 3PIGA 3OBAA 1ZBE2 4J25A 4PDWC 3KT7A 4WM8B 2JE7A 1MR5A 1SFYA 3WP5A 4AFAA 4LUMA 4BB3A 1QNWA 4QX8A 1RUJ1 3M70A 2BVBA 4P02B 2J42A 2ORXA 3T2OA 2ZZJA 4CU9A 5ERLA 2YBPA 1PO23 3WW3A 1LENA 4PBPA 1EAH1 3OPTA 4S2HA 4Y1YA 4F3JA 4D3WA 1HN1A 4JVAA 1L7LA 1SBEA 4RSUA 1C8M3 3AP4A 4FOVA 4YPJA 4JHTA 1PO13 4YVSB 5JLVA 4PHZA 1OH3A 2VNVA 1HDKA 2WNVC 3OPWA 2GAUA 1GLHA 4B8EA 3SHRA 2HWC3 4GB33 4AI2A 2ARBA 4LHNA 3BTAA 4LO7A 1W3VA 2Y6FA 4URAA 1BXHA 4DB5A 1ZM1A 1AL22 3FL7A 2XVKA 3JD73 2XKOA 4A3XA 3AX4A 2EVXA 4FBFA 5F3CA 4BXSV 4CP9B 3U78A 4AI1A 5LA9A 1PMHX 2VCBA 3IDAA 2J1SA 3N9OA 3J26N 4PCRA 5FMCA 5GLUA 4EN8B 5JIUA 4WM7A 5JDBA 4YM3A 3JBG3 4BQYA 4HVQA 4AFDA 4CUGA 3UETA 1PNFA 4AVAA 1YEWA 4ZU7A 1JHNA 1I3HA 4S2GA 1OA4A 1YWKA 1ZBA3 3LSEA 4XHBA 5I93A 3IKWA 2PXJA 4N7IA 3RJRA 2BFUL 2AACA 3WW2A 1BLZA 4M3CF 2VGDA 3VDDA 1HIXA 1DZTA 4ZPIA 1H4GA 4N8MA 5I0UA 2EIBA 3FUQA 5FZCA 1BCXA 1GUIA 2ZA9A 3KCXA 1TMF1 3IIAA 3MIHA 4RGAA 4A7ZA 1VBC3 1W2OA 5FBZA 2WBKA 3GBWA 5J37A 1KDMA 2VOTA 4YGDA 4TSVA 4EN0A 5A7NA 4WM8C 3MLJA 3D5OA 4IEUA 2AREA 1PMJX 4YW2A 3RI9A 4BQ5A 1N47A 2A5ZA 2XJTA 1RC6A 4JRLA 4AFMA 5FYCA 3V56A 4LHSA 2ZGOA 1G9BA 3H1WA 1RXGA 3BB6A 2VAUA 2WIIB 5KHJA 2P6HA 4W4ZA 4MUVA 1WMEA 1H2LA 1ENQA 1XNTA 1AL21 1OKQA 1RTVA 1BHGA 1HRV1 3MW2A 2QQKA 3OJBA 3PVOA 4H14A 4IE0A 4YVSC 1W0OA 1MQTC 1V6KA 4XFIA 4I2OA 2H6BA 1LOEA 1POV0 2QQUA 5KC5A 1ST8A 1SDWA 3I2FA 4YW5A 5FZ9A 4LBOA 4XCAA 5I0SA 3ZSKA 2WS92 3FHIB 4JTNA 5FZ1A 4QKDA 1Y9GA 3OG2A 3HD8B 2EXKA 1D7PM 5CFCA 2XKPA 2YHJA 3WDUA 3ILRA 4UFHA 3L9JT 3AL6A 1W8FA 5F1RA 3J9SA 3EYPA 3N9NA 2RR12 3D0JA 5FMDA 1LR5A 2WFPA 2P3KA 4QDSA 5FIXA 2ADEA 2ETEA 5A7QA 4XUOA 1OLME 1X33A 5FZIA 4HKWA 1CAVA 5LWBA 1C4RA 1UYZA 2C26A 3B9CA 4KGQA 1F4AA 4EZ4A 2OS2A 3VBRA 1BBT3 2RG4A 3I59B 3ZDSA 4RFRB 3ZYJB 4Z8BA 5ACA2 2EAKA 3VBOC 4EWAA 1REDA 2E7TA 4LIUA 3THPA 4EE2A 3Q8BA 4DUXA 2PAMA 2WZR3 3OBTA 4IEXA 4E9KA 1LOFC 4XUNA 1ND3A 1W2UA 3AZVA 1MZ6A 1KEXA 3A4UA 4Q4Y3 3VBSA 4N43A 5BNPC 4NMIA 2ZHKA 1MEC1 3GCWA 4OLLA 4BQ3A 2ZXQA 5C4WB 2E6VA 1W9FA 1HJFA 3L2YA 5C3QA 1HQNA 1TZOA 2W5FA 1YJKA 4AG4A 2CL2A 5D1IA 4CEYA 3BTYA 5LBEA 3KV6A 2FDFA 4CDUA 4TTGA 4GH4A 4XUPA 1ASJ3 5FTTC 1PHMA 1XSQA 4BDVB 3B69A 1W99A 3VKLA 2K2SA 2R062 4EWDA 2P3JA 1OQDA 1V6NA 5L7OB 3OF1A 5T52A 2CDOA 1IKQA 2VE1A 2ZEXA 3I3QA 1CAWA 1SLBA 3C7FA 3MUY1 1YIPA 2RR11 1RUH1 1PIV3 2VOWA 2WQ8A 5F3IA 2VPVA 1LECA 3UGHA 4AQ2A 1I6XA 1R093 2DCTA 3WG1A 3JUUA 2BJSA 3Q8FA 4KWLA 4UOJA 3ZDVA 4EZHA 5A33B 1JYIA 1TNFA 1Q3EA 4KL1A 4L99A 3TN91 1HXS2 2DDUA 4LBQD 2WAOA 3LDKA 1AF9A 2PAEA 1LU1A 2XONA 3AK0A 4FQZA 1WA6X
chains in the Genus database with same CATH topology
2VUDA 1UZVA 5D2AA 2JDPA 1OUSA 2BOIA 1W8HA 5A3OA 2BOJA 5A6XA 5A6ZA 1OUXA 5A6QA 2BV4A 1OURA 1GZTA 3DCQA 2VUCA 2XR4A 2JDUA 2JDHA 2JDYA 1OXCA 5A6YA 1W8FA 2BP6A 2JDMA 2VNVA 4UT5A 3ZDVA 1UQXA 2JDKA 5A70A 2WR9A 4CE8A 2JDNA 1OVPA 5HCHA 2CHHA 4AOCA 1OVSA 2WRAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VUD A;  1UZV A;  5D2A A;  2JDP A;  1OUS A;  2BOI A;  1W8H A;  5A3O A;  2BOJ A;  5A6X A;  5A6Z A;  1OUX A;  5A6Q A;  2BV4 A;  1OUR A;  1GZT A;  3DCQ A;  2VUC A;  2XR4 A;  2JDU A;  2JDH A;  2JDY A;  1OXC A;  5A6Y A;  1W8F A;  2BP6 A;  2JDM A;  2VNV A;  4UT5 A;  3ZDV A;  1UQX A;  2JDK A;  5A70 A;  2WR9 A;  4CE8 A;  2JDN A;  1OVP A;  5HCH A;  2CHH A;  4AOC A;  1OVS A;  2WRA A; 
#chains in the Genus database with same CATH topology
 1JH5 A;  1ULC A;  3CJI C;  3T0D A;  1Y4W A;  5A7W A;  4Q8L A;  3VZM A;  4XBQ A;  3IMM A;  4BME A;  3LD8 A;  2G4I A;  3CEW A;  3DKQ A;  4GKY A;  2GU9 A;  3KHB A;  4GJY A;  1V9U 2;  5FO8 B;  4LMF A;  1UZ0 A;  2VUC A;  1IS4 A;  2WNE A;  3DPR B;  4JGZ A;  2CY6 A;  1JYW A;  4FPH A;  3T1M A;  1UY0 A;  2W39 A;  5CB7 A;  1W0N A;  3VD7 A;  5FQ0 B;  2XJS A;  3NW4 A;  5JSP A;  3VD3 A;  2R07 2;  4IL7 A;  3AP9 A;  1DQ6 A;  2VCC A;  4OUL A;  3B94 A;  5DXD A;  1FPN 3;  4KU7 A;  1NA1 B;  3E97 A;  3PVE A;  4X6R B;  5LBF A;  5K0U A;  1JOD A;  1OI6 A;  3IN9 A;  5C4W C;  5CZK A;  3HEI A;  1OUR A;  3ZFG A;  1KRI A;  3THC A;  1WLD A;  2A73 B;  4Y5S A;  3OBZ A;  1C1F A;  1EAH 3;  4D0Q A;  1RUD 2;  4HMZ A;  2W52 A;  2H0B A;  3IDE A;  4WVM A;  2W0X A;  2VZ1 A;  3H7Y A;  5FLJ A;  3NV2 A;  3AXE A;  3LFM A;  5HXV A;  3SCH A;  5KXD A;  2C24 A;  5A32 A;  1X8M A;  2LW8 A;  4UAP A;  1UIK A;  1PGL 1;  4EJR A;  4MHR A;  3U10 A;  4LT5 A;  1ND2 A;  3E5X A;  1ZZ7 A;  1OF3 A;  2VR4 A;  2GSY A;  4NAM A;  5LAS A;  2XJR A;  3SC7 X;  2I74 A;  4TWT A;  1ZZ9 A;  2VZU A;  2VY0 A;  4LBK A;  3SCG A;  4C90 A;  1OUX A;  1EP0 A;  4BMB A;  4F7Z A;  4OI0 A;  2VTF A;  3E5U A;  5EQU A;  2V5D A;  5FZ6 A;  3RMX A;  3OUI A;  3ZXF A;  5CU1 A;  3C7G A;  4DXR A;  4B4Q A;  1BKZ A;  1UN1 A;  2J1T A;  2VH9 A;  3VZJ A;  1UZW A;  4DEQ A;  4DIQ A;  5E16 A;  5DDJ 2;  3VB9 A;  3PU3 A;  2R0H A;  4UFM A;  1Z7S 2;  3ZMO A;  4D69 A;  1QJE A;  2VW0 A;  3O1M A;  1XOY A;  4E8D A;  4H2A A;  5IT6 A;  1CD3 G;  2W92 A;  4XUT A;  4URT A;  2VG9 A;  3DPR C;  5JSO A;  1GZC A;  4CU8 A;  5KHI A;  2EIC A;  2W1S A;  5BYN A;  2ZPX A;  1UL9 A;  2R16 A;  2WZ8 A;  1TMF 3;  4AVT A;  1QJU 3;  3WVJ A;  1HB4 A;  2ZMN A;  4FPL A;  1U5I A;  2FMY A;  4FI9 A;  3AZY A;  1FOD 1;  3U0Z A;  1RUI 1;  1AR6 3;  1MQT A;  2J1A A;  3BPS A;  3OUJ A;  5CYY A;  1NA1 C;  1TME 2;  5IVC A;  2P4E A;  3VBU B;  4NPM A;  2GC2 A;  1W8Z A;  4ZON A;  1B35 B;  2G9F A;  2YYO A;  5JR7 B;  2UU8 A;  3GGL A;  1RIR A;  1DGR N;  2QJV A;  1PVX A;  4OUM A;  4QGL A;  1IQD C;  5SV5 A;  4MET A;  1QMJ A;  4IV3 B;  1V6O A;  5JVV A;  4WV8 A;  5LB6 A;  1F9K A;  4E4D X;  2A6W A;  5LK7 B;  1HRV 3;  4WVV A;  1NAE A;  5APA A;  4ASM B;  3K4Z A;  1WCD J;  5CEH A;  2VZS A;  1S0G A;  3CHX A;  4LK6 A;  1DP0 A;  2UWC A;  3FC0 A;  4C0H A;  4IXL A;  4MXW B;  4AEK A;  4JKK A;  2YU2 A;  1QQP 2;  3I2D A;  4KWJ A;  2WO3 A;  3HAG A;  3OYW A;  2VXR A;  1HLC A;  4UW3 A;  3WG3 A;  1WCK A;  3MLK A;  4PJY A;  2JD9 A;  4Y4Y A;  1N3O A;  3VBO A;  5JCT A;  3H8X A;  3EMR A;  4CP1 A;  4DY3 A;  4XJW A;  4MO3 M;  2DBI A;  3G6J B;  4YZ1 A;  5BV6 A;  5E89 A;  2E7A A;  3OD0 A;  1OA3 A;  1XNA A;  1SQ4 A;  2XHK A;  3APB A;  5BNP A;  2CHH A;  1NCQ B;  2QTW B;  1W3X A;  3B93 A;  4PIZ A;  3RI8 A;  2JDP A;  3GDB A;  3N36 A;  4Z07 A;  4JGY A;  1HW5 A;  2WQZ C;  2WWS A;  2BOJ A;  2ZX2 A;  4BJ0 A;  1O4Y A;  2QQV A;  1ODN A;  2BNO A;  3ATG A;  2ET1 A;  1EV1 1;  2DCK A;  4K1Y A;  1S4C A;  2WFF 1;  1TME 1;  4HK8 A;  1VJ2 A;  4NRQ A;  1LHV A;  3ECQ A;  4K1Z A;  4M3C E;  2E26 A;  3WDY A;  4AAX A;  3W20 A;  1RUF 3;  5FLH A;  4Q1R A;  1SBF A;  1MEC 3;  3K51 A;  1S55 A;  2I45 A;  2V4V A;  4MGZ E;  2HWD 1;  4AVV A;  5JUV A;  5LEK A;  1LGC A;  1O6U A;  3MI8 A;  4GD4 A;  4YGC A;  5FZA A;  4YLZ A;  1G9C A;  1IG0 A;  3VBU C;  4BQX A;  1G6N A;  1B35 C;  3C8X A;  3O1P A;  5J36 A;  3A21 A;  2JB8 A;  1UPS A;  4QGN A;  3NL1 A;  3PUS A;  4L92 A;  3ZXJ A;  3AP6 A;  3WNN A;  2RDN A;  3F2Z A;  3IM0 A;  1PGW 1;  5BNO B;  4PT6 A;  5JSR A;  4K21 A;  2NN8 A;  3CJI A;  2VOK A;  4FPG A;  2EIE A;  5DUW A;  1O3T A;  3OGS A;  4HZF A;  1A6C A;  5EHD A;  4Y33 A;  4N90 A;  4XJ9 A;  5DMY A;  4AWD A;  4XBN A;  2BYV E;  1JZ7 A;  5AVA A;  4P9X A;  5TSW A;  1IQA A;  2FZ1 A;  3ZOI A;  2CGO A;  1RUH 3;  3S0M A;  5CG8 A;  4QWN A;  4Q4X 2;  1AR9 2;  2ERF A;  3MW4 A;  3BPZ A;  4DRV A;  1PNG A;  2ZS6 B;  2Y6K A;  2Y8K A;  5FZH A;  3TN9 3;  5JPN B;  3CZJ A;  2HWB 2;  3I59 A;  5D8A B;  5L9V A;  5HCA A;  2LAL A;  1K5J A;  1JN2 P;  4QX1 A;  4QX7 A;  4LBN A;  3M3Q A;  4NPL A;  2V5Y A;  4CP2 A;  1RUN A;  3BAL A;  1K45 A;  3GZT B;  3VDA A;  5FYZ A;  1TNR A;  5LCW L;  4YVW B;  2X05 A;  1NCQ C;  4AI8 A;  2WYS A;  1X82 A;  1KS5 A;  4LOT A;  3N9L A;  3VV1 A;  2WWU A;  3UL2 A;  1IHM A;  2BPA 2;  1CZV A;  1YFY A;  1F31 A;  3IPV A;  2BBV A;  2B9U A;  4NRO A;  4YSF A;  3SKJ E;  4GJZ A;  2DUO A;  3ES4 A;  5C3O A;  4QPW A;  5A70 A;  4MOA A;  3M3C A;  4QGM A;  4HSJ A;  4OZO A;  4MGS A;  1W6P A;  5LY1 A;  1POQ A;  1YQC A;  4BLJ A;  2RM2 2;  4IET A;  2VMC A;  2CU5 A;  1LHU A;  4YRD A;  4ERO A;  4FAG A;  4BIO A;  2YBS A;  1CAU B;  2R49 A;  3N7K A;  3VN4 A;  4XAA A;  1PK6 A;  2DU1 A;  1TEI A;  1V6M A;  2EAL A;  3KQR A;  4AI3 A;  5A1L A;  4LXL A;  4HAN A;  5FY4 A;  1RUC 1;  3AYD A;  1W8U A;  2C9K A;  1NZI A;  3B3Q E;  3P3N A;  1IPJ A;  4OHX A;  2D6O X;  2R7E B;  4Q4X 1;  1Y7B A;  3AL5 A;  3M7A A;  4YW6 A;  3H8U A;  4JDN A;  1VRH 2;  2DCJ A;  4Z92 B;  1PZ9 A;  3D8C A;  3M3I A;  1HRI 1;  3M2M A;  4I01 A;  4QXC A;  2HWB 1;  4YZ5 A;  2C4X A;  2PHU A;  3AFK A;  3WQ7 A;  3WNK A;  5AFE A;  4W6Y A;  2VVD A;  3ZKY A;  2QQJ A;  2ZEZ A;  4D7T A;  4DOU A;  4Z82 A;  1UYY A;  5KWR A;  3FHA A;  1YQ2 A;  3AMN A;  1XU2 A;  3V0A A;  3WHU A;  1PVC 2;  5J7M A;  1VBB 2;  3DPR A;  3JB4 C;  3S30 A;  5FAX A;  5KHG A;  2RS5 1;  4IEZ A;  2BNM A;  2DVG A;  1FYU A;  5D8A C;  5IHR A;  1KDK A;  4QKB A;  3ZSJ A;  2XUM A;  3HQU A;  1WLT A;  2XG3 A;  3CNA A;  4XQD A;  1LKN A;  3FZ3 A;  5E88 A;  4FPJ A;  2R04 2;  4BQW A;  4QQP A;  2ARC A;  1D0G A;  2WA3 A;  3ORJ A;  4YWA A;  5FQ0 A;  1JU4 A;  1RUG 1;  4BQ4 A;  1BZW A;  2VUL A;  4K6B A;  4ISQ A;  4H7M A;  4YVW C;  3J7M A;  3OBR A;  2B46 X;  2B5H A;  2OKX A;  1SPP A;  5CKM A;  2WNU A;  2R1B A;  2RM2 1;  1A34 A;  2XLG A;  4PF5 A;  3FFZ A;  5EP9 A;  2HKX A;  1WD4 A;  1LTE A;  4G9S B;  4LHK A;  4Y20 B;  3T30 A;  1CVN A;  3ITQ A;  4Q26 A;  3U4X A;  5IVF A;  4AXO A;  2VVE A;  3NRU A;  4V1P A;  2W3J A;  5T3N A;  3RJ2 X;  3MIE A;  1R64 A;  1V70 A;  5KXC A;  4HT1 T;  3ZR5 A;  1FOD 3;  2ID4 A;  1RUI 3;  2PMW B;  1SFP A;  2WN2 A;  4XJ8 A;  5C33 A;  3K3N A;  4GKX A;  2BQP A;  2EIG A;  5SV8 A;  1CON A;  1GWM A;  3I3D A;  4CVU A;  4RYD A;  4KH9 A;  1QY4 A;  1RVF 2;  4NHX A;  4RHV 1;  4XQW A;  3TEX A;  5CG9 A;  4QU1 A;  5K9Y A;  4NJ4 A;  2PHT A;  2VXJ A;  5GLV A;  2IWG B;  3HJR A;  3ZVX A;  4JCK A;  2YGM A;  5F5I A;  2KA3 A;  1V6I A;  2HWF 1;  2GAL A;  4JHZ A;  2C6S A;  4CSW A;  1PVC 1;  1JOB A;  3N7J A;  2BU9 A;  4FXK B;  2OA2 A;  2PLV 2;  3NNM A;  1JW6 A;  4UBG A;  4IQP A;  2VBP A;  1AYN 1;  1O5L A;  4K8F A;  3PHM A;  2CYF A;  2PAK A;  4QPG A;  3GJA A;  3HOB A;  5GAL A;  4YG0 A;  1VRB A;  1ULO A;  3AVR A;  2V73 A;  4QX2 A;  4LBJ A;  3D3A A;  2D5H A;  1HKD A;  4RD7 A;  4CCJ A;  1ULE A;  5FXV A;  3QH7 A;  5FZ0 A;  2YDE A;  3SIS A;  3IZO A;  3WF4 A;  3LZZ A;  5A3U A;  2WO7 A;  1GYK A;  3LA7 A;  3EBR A;  1VP6 A;  4E2Q A;  1AYM 1;  4FPY A;  4A3Z A;  4A45 A;  4LO5 B;  1U5X A;  5FV3 A;  2WT1 A;  3O7O A;  5EFU A;  4AVS A;  3K4D A;  3JZV A;  1W6M B;  1RHI 2;  1BEV 2;  4ZXK A;  3MV1 1;  3ZFE B;  5FPU A;  1O8S A;  3FBM A;  3FLR A;  4R9B A;  3AXD A;  5F3G A;  5G04 L;  2ZAC A;  3RZL A;  5I8S A;  3N35 A;  3A22 A;  4H7L A;  1R08 2;  3P6B A;  4HPK B;  1EV1 3;  4W6W A;  2WFF 3;  3LEI A;  1VE0 A;  3RS6 A;  2QDN A;  4D7S A;  1PZ7 A;  4U2A A;  3Q8A A;  1GR3 A;  4JC1 A;  3I2O A;  5JZG A;  2PA7 A;  5GLW A;  3I8T A;  4JZR A;  4N9H A;  1XC6 A;  1UQX A;  3TWI A;  4I3P A;  2HWD 3;  2D44 A;  3WOG A;  5FUP A;  3B01 A;  2VZO A;  4QHO A;  3O1O A;  1O3S A;  1I5P A;  4HN0 A;  3BI3 A;  2QKD A;  3AZZ A;  4COW A;  3AB0 A;  5B4X A;  2CSG A;  5K4L A;  3LF7 A;  1RMU 1;  1X7N A;  1G8W A;  2XH6 A;  5EWS A;  5FZ7 A;  5A80 A;  1FI2 A;  3WY6 A;  5A6Z A;  1F8V A;  4KU8 A;  1CAX B;  1SLT A;  2YUE A;  3I3E A;  2XBO 2;  4YZ3 A;  4AVB A;  1W28 A;  1F5F A;  4KWU A;  5C71 A;  3N7L A;  1MS3 A;  3VL8 A;  3WLU A;  1AXZ A;  4MV2 A;  4RR3 B;  5A3N A;  4O9G A;  1QH6 A;  1V6L A;  2IFW A;  2OZJ A;  3I4I A;  3FX3 A;  4AEJ A;  5JXH A;  1OFS A;  2BP6 A;  4FXG B;  2EXJ A;  5JIA A;  4RA0 A;  2VCA A;  4Q29 A;  3J8F 1;  4A7Y A;  4D6S A;  1K5M A;  3MFC A;  2JIJ A;  4IEY A;  4J1W A;  1IPS A;  3AP7 A;  4RQP C;  4CDW A;  1BEV 1;  3WX5 A;  3ZN6 A;  1QJY 2;  3UYJ A;  3NNL A;  4N7U A;  1QJX 2;  1WUV A;  2A3X A;  3K46 A;  3I49 A;  4MG2 A;  4QMA A;  2GH2 A;  4FVV A;  3LB9 A;  1DZQ A;  4FCA A;  3MF9 A;  2GDF A;  3NKG A;  1MZ5 A;  2DF7 A;  4MXV A;  1U0A A;  4QX5 A;  4XYX A;  3ZFE C;  3BCW A;  2B9V A;  5FZE A;  2F4P A;  3VUO A;  1LRH A;  2RV9 A;  4MYE A;  1A8D A;  1HB2 A;  3NJV A;  4UFK A;  2FDH A;  1JTZ X;  1J59 A;  4B4R A;  1DQ0 A;  3ILN A;  2ZKL A;  1JZ5 A;  1ZZ6 A;  2WRA A;  3W9A A;  5IFT A;  4YW1 A;  1VBE 2;  2XJP A;  1AVB A;  3MGU A;  4PQQ A;  3PME A;  4XF9 A;  3VKM A;  1YCI A;  3DV8 A;  1WLC A;  4C91 A;  5LBC A;  5DZE A;  4BLI A;  5AFB A;  4Y4R A;  1YO8 A;  2Q8O A;  2ZGT A;  3UK9 A;  2ZX4 A;  4EYU A;  2QQW A;  4JTO A;  4PF1 A;  3SH3 A;  5HBA A;  1VBD 1;  3Q9O A;  1RUC 3;  5AC9 2;  2FCT A;  3SMH A;  2P3I A;  4FOQ A;  4GA9 A;  2X10 A;  4IE6 A;  3B5L B;  5D8A A;  1GNY A;  5FO7 B;  1LAJ A;  3LKJ A;  5CFD C;  1RL3 A;  1QXP A;  2ZKN A;  3FMG A;  1KJL A;  1J3R A;  2QVS B;  1HRI 3;  4GAL A;  2AZ5 A;  5FXX A;  4YFW A;  3KV4 A;  4CEW C;  1AR7 1;  5FZK A;  4RR3 C;  2RS3 1;  1A78 A;  4NUB A;  3HMY A;  4Q0P A;  2IFR A;  1ZRI A;  1JUH A;  3PL0 A;  3CMG A;  1XQN A;  5IVV A;  5FY5 A;  3L2H A;  1ENS A;  4Q4V 2;  5J1X A;  2RS5 3;  5C5T A;  5I0R A;  2A75 A;  1O3Q A;  2TEP A;  5C8C B;  1ZRD A;  2A1X A;  4UI9 L;  3QBQ A;  3VBF A;  3SQO A;  2OX0 A;  3HBK A;  2JDY A;  3ES1 A;  4GMP 1;  5EPA A;  5EZW A;  4BM8 A;  2GN3 A;  5JOW A;  1C1L A;  1BJQ A;  2QQL A;  2JG8 B;  2ZGR A;  3HWJ A;  4QX0 A;  4HBN A;  1RUG 3;  2QUO A;  4HVR A;  2WSU A;  2C0Z A;  5C9A B;  3WR0 A;  1ZBE 1;  2FDK A;  1OVP A;  3M1H A;  2GMM A;  1GOG A;  2BWC A;  1N1S A;  4HN1 A;  3VBH B;  3T4H B;  1VBE 1;  1OMI A;  1IGO A;  2A70 A;  4DRR A;  1IG3 A;  4W65 A;  3WF0 A;  5JI7 A;  2WZP P;  2G19 A;  5GLT A;  5K8S A;  4RS5 B;  4LTA A;  5G05 L;  4W6X A;  2ZZQ A;  1W6Q B;  4ASL A;  1OKO A;  4Z1V A;  3PUH A;  2JKX A;  3I54 A;  3R4S A;  2OUH A;  5J09 A;  1FXZ A;  1MPX A;  3EO6 A;  2PFW A;  4CDX B;  2E53 A;  4QXH A;  5FY7 A;  2HBT A;  3MIC A;  3OGR A;  4RHV 3;  5FUI A;  5ISL A;  4FFI A;  3SEE A;  3KZ4 C;  5KHK A;  2ZGQ A;  1B09 A;  1D4M 2;  1PMI A;  2ET7 A;  4YW7 A;  1WW6 A;  1OVS A;  2A7A A;  2B4K A;  2HWF 3;  3GZA A;  3R4D B;  1W6O A;  3VDC A;  2JB4 A;  1DYK A;  2WIN B;  1XYN A;  4Q4V 1;  4R4X A;  2IVI B;  1OPO A;  3WNP A;  1GNH A;  2ARA A;  1AYN 3;  3MHZ A;  4L0P A;  4CCO A;  2B45 X;  2J1V A;  3UGG A;  2WUH A;  4XET A;  2B42 B;  2BRT A;  3ZN4 A;  1XND A;  1D2S A;  4ARY A;  1GU3 A;  1H9W A;  4NR1 A;  4AHY A;  5A3W A;  2XJU A;  1TE1 B;  4OYU A;  2FHR A;  2VZR A;  4Z2W A;  2FDI A;  1J83 A;  5C8C C;  3TEY A;  3WF2 A;  3RWK X;  4JAA A;  1V0A A;  1LGN A;  1AYM 3;  5ANQ A;  1H8T B;  3LEM A;  3USU A;  3AKR A;  3KMH A;  3H0O A;  2WO1 A;  3POJ A;  3KD4 A;  1J3Q A;  4AHW A;  2JG8 C;  4LOR A;  1YJL A;  2B39 A;  2ZGS A;  4OUE A;  5FK8 A;  3OOX A;  4UBH A;  5FY0 A;  5C9A C;  1ZRE A;  1AJK A;  4IER A;  1W9T A;  2DUR A;  4NO4 A;  4E4H A;  1FAY A;  2XWB B;  4UF0 B;  5DPN A;  2H6C A;  4XZU G;  2JE9 A;  3CQO A;  5FUN A;  1ZZB A;  2W1W A;  4H55 A;  5A7P A;  5A3L A;  2RDQ A;  3H1M A;  5LY2 A;  5FJH A;  3HR9 A;  2X5I B;  3ZYI B;  4MZU A;  2D93 A;  4RS5 C;  3DKW A;  1QOS A;  4IDZ A;  2MEV 2;  1YYN A;  3POF A;  1D4M 1;  1SZB A;  4I09 A;  3W58 A;  4M3C B;  3UT0 A;  2WSV A;  3F95 A;  2K9Z A;  4FPF A;  4CDX C;  5DUX A;  3ZXE A;  1ZYB A;  1CPN A;  3PUQ A;  2E32 A;  3MF6 A;  2FZ2 A;  1C28 A;  5A3O A;  2Q5T A;  3H9A A;  1RMU 3;  3QCW A;  5JI9 A;  5A3P A;  4RQP A;  4IE4 A;  5BNQ A;  2WS9 1;  5IAX A;  1MZE A;  3DEM A;  4NII A;  1UD1 A;  4I30 A;  3MPP G;  3J7L A;  4XFG A;  4P5H A;  4HXC A;  3NQH A;  4PI2 A;  2VOV A;  4Y1V A;  3TB0 A;  5ABJ B;  1ULG A;  2WAB A;  2Y6G A;  1NQJ A;  4QXB A;  2B7Y A;  2HEW F;  1UKR A;  5DG1 A;  1C5H A;  4CUB A;  2Q1F A;  1YC6 1;  3FWE A;  1WGP A;  3NJX A;  2RDR A;  1SLL A;  2VZQ A;  1POV 1;  5JOZ A;  3J8F 3;  1OLQ A;  1AX2 A;  2N7G A;  3T2P A;  4A41 A;  5DZG A;  1JZ6 A;  4A7K A;  1BEV 3;  4FPO B;  4BXF A;  3TNQ A;  4HPK A;  4Q4W 2;  2W87 A;  3WNM A;  4EN6 B;  5ACA 1;  4PDW A;  3RSJ A;  4ZKT B;  5I8Y A;  4CUC A;  3DN7 A;  3KLS A;  2A6Z A;  1W6N B;  2CGN A;  2HEV F;  3EXU A;  1CZT A;  4B1M A;  1IS5 A;  1XU1 A;  3AMM A;  5CKN A;  2VTX J;  1WW5 A;  2XML A;  4FO9 A;  2P37 A;  3UKT A;  1NLS A;  3GBF A;  5JZG C;  3KGZ A;  2MEV 1;  3BUC A;  3UGF A;  5CAZ A;  4AVC A;  2V4A A;  4AI9 A;  2XB6 C;  1JI6 A;  4G4F A;  2VW1 A;  3I2K A;  3O1T A;  1VR3 A;  4S2D A;  3ACG A;  4TLG A;  4DFS A;  1U5Z A;  3OCP A;  5F6L B;  5CFD A;  3AKP A;  4NHY A;  2X5I C;  2WNV A;  3FBY A;  1APN A;  2FMD A;  1M06 G;  3VZK A;  1RUJ 3;  4CEW A;  4N9I A;  2QDR A;  5BPX A;  3R6S A;  1NE4 A;  2RMU 2;  1DQ4 A;  2R06 1;  3EJK A;  3GAL A;  4LIV A;  3VKN A;  3WF1 A;  3P1I A;  2JJ6 A;  2ZAB A;  3HQR A;  3PVB B;  1MS8 A;  1NT0 A;  4HVO A;  4K20 A;  4Y22 B;  1XSR A;  5IVY A;  1RUE 2;  1VBD 3;  4MAD A;  4P9W A;  2E31 A;  4PLN A;  1QIQ A;  4EV0 A;  1O4Z A;  4IEQ A;  2YPD A;  5FRE A;  2ILM A;  3VGI A;  5C3S A;  1HXS 1;  5L7O C;  5C3P A;  3PJY A;  3Q8E A;  1H2M A;  4UW5 A;  5BUV A;  2HYX A;  2Q8D A;  1BMV 2;  1AR7 3;  1GKB A;  1LEM A;  2RS3 3;  5HPO A;  1UZV A;  5DAB A;  4UFL A;  4ZY9 A;  1O7F A;  3UJO A;  5ABJ C;  1X9P A;  2R30 A;  2W95 A;  1V00 A;  3JU9 A;  2FDJ A;  5EJ3 A;  3ST7 A;  3C7E A;  3PUI A;  1QXR A;  1V9U 1;  3S5Q A;  4K3U A;  5FXZ A;  4WVZ A;  3GHM A;  5CA6 A;  3IWZ A;  5CKQ A;  2D98 A;  4LK7 A;  4GMP 3;  4HFS A;  4HK9 A;  3VHP A;  1UMH A;  4RL7 A;  3O1V A;  5JPM B;  3B9I A;  1W03 A;  2AEY A;  4WM8 A;  4FP2 A;  2OUJ A;  4LLO A;  4UT5 A;  5FBJ A;  4CCK A;  3V65 A;  1UZZ A;  2R07 1;  1ZBE 3;  5GM0 A;  1GZW B;  4NVP A;  1XYP A;  1S0J A;  3B7M A;  4UW6 A;  4EN9 B;  4XFC A;  1J84 A;  3WQB A;  2MHF A;  1MVQ A;  5IWF A;  4XF0 A;  4YGB A;  3ZYB A;  3DGT A;  3W59 A;  2WC2 A;  2Z5W A;  4PLM A;  3WDX A;  5JOY A;  4KG8 A;  5IJR A;  4TZD A;  1RUD 1;  4YVS A;  1GNZ A;  3KCC A;  3WZ1 A;  4M0H A;  2NM1 A;  5FP9 A;  3I97 A;  1LHN A;  5EYY A;  4LIT A;  3USS A;  2A6X A;  4MHU A;  2VBD A;  4A42 A;  1O59 A;  1QHD A;  1ENX A;  4M00 A;  4GIQ A;  1Z0H A;  1ENR A;  2PEL A;  1QOO A;  4GWN A;  4BU2 A;  2W9X A;  1BMV 1;  3ZKU A;  1OLR A;  2X09 A;  5FRA A;  5DAP A;  4CP9 A;  1N1T A;  3E5Q A;  3LA3 A;  3HNB M;  1AL2 3;  1HX6 A;  5C8C A;  1XRU A;  5EYX A;  3WUD A;  3GBG A;  3KWV A;  1DG6 A;  4Q2F A;  3GF6 A;  4LUK A;  2Q8E A;  3ZSE A;  2BVV A;  2VMI A;  3KM5 A;  1GZT A;  5FYS A;  1ZRC A;  4BQ1 A;  3PUR A;  5F2W A;  4OQ8 A;  4MGT A;  3AKS A;  2X29 A;  5DDJ 1;  4Q0U A;  5H9Q A;  4XXP A;  3SNM A;  1Z7S 1;  1CWP A;  1R1A 2;  4QQL A;  1FV3 A;  1VBA 2;  4B3N A;  1WCQ A;  2ZX1 A;  2WDB A;  2WR9 A;  3POY A;  1LOF A;  1UOG A;  1Q43 A;  4XDQ A;  5FP7 A;  3A0K A;  4AED B;  4RS5 A;  2RJL A;  3WT3 A;  1W8W A;  2XHN A;  2GH8 A;  3FJS A;  4A44 A;  4CPB A;  2W47 A;  1T6B X;  1O5U A;  4FT8 A;  2BOI A;  2W46 A;  1SFN A;  3O0V A;  1SBD A;  1CZS A;  4ZXE A;  2VQU A;  1YXW A;  2A71 A;  1WWY A;  2Y33 A;  1NLR A;  3K4A A;  1UIJ A;  4HLT A;  4XAB A;  4PBO A;  2D3S A;  3GZU C;  4P9Y A;  1OBN A;  1NY7 2;  2JEC A;  3AZW A;  1K42 A;  2AGS A;  3AMQ A;  4XIK A;  4KNC A;  2NLR A;  4IW3 A;  1DQ5 A;  1D4M 3;  2JE8 A;  4FPK A;  5BXX A;  3RZJ A;  5FYU A;  3ON7 A;  3DUI A;  4XUR A;  5DAV A;  4E2S A;  4NRP A;  2JKB A;  5JAX A;  3U75 A;  1P8J A;  3BOW A;  1FAT A;  3GCX A;  3BIE A;  1H30 A;  2Z69 A;  2GMP A;  1MAC A;  1ZRF A;  1Y9Q A;  4LBQ B;  4E4Z A;  2J7M A;  1SLA A;  1E57 A;  1LOC A;  2WS9 3;  5FZG A;  1QQP 1;  4H3W A;  2WT2 A;  2F4L A;  4NWW A;  4IV3 C;  4YZ4 A;  4IGO A;  3KCY A;  2WWJ A;  1AR8 2;  3I2H A;  3WDW A;  3ZXK A;  1RYY A;  3DYP A;  5FWE A;  2CTV A;  1R1A 1;  5A6Y A;  2VQA A;  3DXT A;  5FDB A;  2X8K A;  2XJV A;  2RR1 3;  3ENR A;  3WXP A;  4CP0 A;  4IEW A;  1XE8 A;  3ZXD A;  4JKM A;  2HWE 2;  3PUA A;  4CU7 A;  3V0B B;  5FCC A;  1WKY A;  2YC0 A;  2PHW A;  1UF2 C;  3JCI A;  3NAP B;  1POV 3;  2A3W A;  1OOP B;  1WCS A;  3K77 A;  3ZYH A;  4BPZ A;  2ZGL A;  5FPV A;  4M0N A;  1XNB A;  4UF0 A;  1NCR B;  2IXI A;  1O4T A;  1PO2 2;  3ACI A;  4AGG A;  1DZR A;  1RJ7 A;  5I0T A;  4DXT A;  5ACA 3;  1O3R A;  1FT9 A;  4B7K A;  5HV4 A;  4FFH A;  4PI0 A;  4LKE A;  4AED C;  1OT5 A;  2AH2 A;  3BOP A;  4AF9 A;  4BH9 A;  5LW9 A;  3III A;  2RHP A;  1CIW A;  1C8M 2;  4UYB A;  1NY7 1;  5C4W A;  4I02 A;  1FV2 A;  1PO1 2;  1JOJ A;  1YRZ A;  4ET7 A;  2MEV 3;  1H4H A;  3NNF A;  1LOD A;  1ODM A;  5FZD A;  2D6N A;  4CE8 A;  1UNB A;  1QJF A;  2BER A;  2HWC 2;  2P2K A;  2Y6L A;  4GB3 2;  3FFQ A;  1AZD A;  1ZRR A;  2WLP A;  2ZCW A;  3FLT A;  2VMG A;  3JD7 2;  4CXX A;  5EIY B;  1KIT A;  1J3P A;  2EF6 A;  3C2U A;  3K48 A;  5L7O A;  2NMO A;  1LHW A;  1CES A;  3LDB A;  1K12 A;  1S0B A;  1X50 A;  4X8P A;  1XXN A;  2IC1 A;  2WZE A;  1MS5 A;  2R06 3;  2VNG A;  4LE3 A;  2GND A;  5FZM A;  1KFU L;  3JBG 2;  5FY1 A;  1DHK B;  4C1W A;  1BVV A;  4MGQ A;  1KJR A;  4XCB A;  2R1D A;  4BE3 A;  4M4R A;  2X53 S;  1GIC A;  3KVB A;  4WM7 B;  4WVW A;  2AEN A;  2JDM A;  3C7O A;  1ZBA 2;  4QKN A;  4XFF A;  1AR9 1;  2BUK A;  4Y1X A;  3OEA A;  5FWJ A;  1RB8 G;  3I7D A;  4BZ4 A;  3TRS B;  3HT1 A;  5BNO C;  3LOB A;  2QQN A;  3T1L A;  4DZG A;  1Q56 A;  5CIR A;  4GWM A;  1HXS 3;  1RGS A;  5FR3 A;  3ETQ A;  3MUZ 1;  1NX9 A;  4LPL A;  4ARX A;  5T5P A;  5FMO S;  2CWM A;  3J4U H;  2DTY A;  4MH0 E;  3AFG A;  3ZIW A;  1VBC 2;  1PO2 1;  1KD7 A;  2ZHL A;  3KT4 A;  3U14 A;  4FTB A;  4NWV A;  1DLC A;  5F32 A;  5FO9 B;  1OC1 A;  5FPA A;  1UCX A;  4UWD A;  3K3O A;  1ZX5 A;  3A0N A;  5LA2 A;  1S0F A;  4LA2 A;  1V9U 3;  2ZGN A;  4C0B A;  4LBM A;  1IKP A;  3H1Y A;  3NAP C;  3U37 A;  4LR4 A;  4NN0 A;  2OQ7 A;  1JYV A;  4QDQ A;  4AE2 A;  4CU6 A;  1GQH A;  1RIT A;  2ZJC A;  2JWP A;  4YGE A;  2P17 A;  4I0B A;  1NCR C;  2BZD A;  5CVR A;  5FJK A;  4COZ A;  2VU9 A;  1GOH A;  3EHK A;  4FFG A;  3UKN A;  5LA1 A;  1UY3 A;  2G1M A;  2BGO A;  2YXS A;  2JDK A;  3GZE A;  1NA1 A;  5IUQ A;  4K7J A;  1DGL A;  2Q30 A;  2R07 3;  2Z42 A;  2ZGK A;  3ABZ A;  2IXK A;  3HQX A;  3PTR B;  4YM2 A;  5FP3 A;  5IVJ A;  3JD7 1;  2XOM A;  2GN7 A;  3H3U A;  3WUC A;  1HV0 A;  4RN5 A;  1HB1 A;  3WNO A;  3W5M A;  2LTN A;  5FYT A;  1EPZ A;  4XVH A;  3NJY A;  2K46 A;  1ZZC A;  1WA4 A;  1XNC A;  2GME A;  3HPN A;  3CO2 A;  3JBG 1;  4LHL A;  4I0A A;  5LK5 A;  1JZ3 A;  3AKQ A;  4JRA A;  1BK0 A;  1RUD 3;  1WBF A;  2WAA A;  5I0D A;  1OXC A;  3WG4 A;  1ZBA 1;  3K2O A;  4NRM A;  1CIY A;  3V64 A;  5KBF A;  4TYS A;  1IPK A;  2DFC A;  5CFC B;  2ENR A;  1VRH 1;  1XE0 A;  3ME2 A;  2J1E A;  2QZ3 A;  3KV5 A;  4BHP A;  4YM1 A;  1JUI A;  4DS0 A;  1REF A;  1ZA4 A;  3RMY A;  4BYY A;  1Q8S A;  4OUS A;  4QAW A;  2UWA A;  1EPW A;  4A4A A;  4WM7 C;  2YBK A;  3I2I A;  4QD2 A;  3MLL A;  1VBB 1;  3PLQ A;  1BBT 2;  4O61 A;  1LUL A;  2FCV A;  4P08 A;  3VZL A;  3O0X A;  2PYT A;  3VD5 A;  5LEJ A;  1LU2 A;  4YM0 A;  5CIS A;  3ACF A;  2WZR 2;  4XDP A;  2XJQ A;  4AFB A;  5JR2 A;  1BQP A;  2R04 1;  4E8C A;  4XTP A;  4AYU A;  4K40 A;  4Q4Y 2;  4BQ2 A;  4QKF A;  5DDJ 3;  2KD7 A;  1Z7S 3;  3MO4 A;  2FBE A;  5L9R A;  3WP3 A;  3H8R A;  1QWR A;  1ND3 B;  3CBN A;  3N9M A;  4ZS3 A;  3VHR A;  5J96 B;  5FZ8 A;  1KFX L;  4N43 B;  5JMO A;  2YY1 A;  1VMJ A;  2QZ2 A;  4N53 B;  2JEM A;  3SLI A;  4HOO A;  2W91 A;  4D6R A;  1X9T A;  5FY8 A;  4FTE A;  3O1R A;  3WW1 A;  4AEM A;  2IVJ A;  3M3O A;  3W5N A;  3WSO A;  1E5H A;  1Q8P A;  1UYX A;  5FMB A;  4BK4 A;  1ASJ 2;  4AQ6 A;  5IAT A;  1RUO A;  2P6C A;  1F2N A;  2Z4F A;  2UWB A;  4CEY B;  3VBU A;  4AGR A;  4CDU B;  1B35 A;  4GH4 B;  1GQP A;  2VQ0 A;  3MYX A;  3IMN A;  4I0W B;  1TME 3;  2Q1Z B;  1QOT A;  2NQY A;  3NV1 A;  4IES A;  3D6E A;  4QHZ A;  1RVF 1;  1JHJ A;  3MPB A;  1N3P A;  2W68 A;  4LUL A;  4AK3 A;  1R09 2;  3AYA A;  5KXE A;  1CAW B;  4IND A;  2UYA A;  2D6M A;  2DYC A;  4IV3 A;  2XDV A;  3HVD A;  4PLO A;  3WF3 A;  1IOA A;  3BOD A;  1I5Z A;  2P5B A;  4FSJ A;  5C8W A;  4L97 A;  4WZF A;  3OEB A;  5FZ3 A;  1EUT A;  3OD4 A;  4XTM A;  3MW3 A;  4X8N A;  4E2G A;  3OPZ A;  4MXW A;  1BBT 1;  2XVG A;  4TLF A;  2PLV 1;  3ZXG A;  5CFC C;  2CV6 A;  5FY9 A;  2VMH A;  3K75 B;  3SEP A;  1QH7 A;  4Y1U A;  3SH4 A;  5A7W B;  1DU3 D;  4CCD A;  2YG0 A;  4ISR A;  4RGG A;  1QQP 3;  1FNY A;  3O5S A;  4Q4Y 1;  3KF5 A;  1Q8O A;  4LO4 B;  4JGZ B;  2RE9 A;  1MS4 A;  1GZ9 A;  2W08 A;  1NCQ A;  1IS3 A;  2D40 A;  5F7U A;  4B29 A;  2VZ3 A;  1YQ8 A;  4A2U A;  1UU4 A;  3KS7 A;  1IS6 A;  1H1I A;  3CJX A;  4P14 A;  3ZX7 A;  1FPN 2;  5GZC A;  2YC2 A;  3AVS A;  4NIG A;  5GLZ A;  1RHI 1;  2BFU S;  2Y0I A;  3RYR A;  1F5J A;  5HCB A;  1LES A;  1ND3 C;  1GMM A;  1UWW A;  2J1U A;  2VME A;  2DCZ A;  1QXJ A;  2PHF A;  3KF3 A;  3LSD A;  3N9Q A;  2A6Y A;  3BYW A;  1R08 1;  4N43 C;  4QPI B;  1RJ8 A;  2PHR A;  4N53 C;  2ZTN A;  1EAH 2;  4HL0 A;  1JBC A;  2ZX3 A;  2XVL A;  3AKT A;  3ZFG B;  3PNA A;  1YFX A;  1WW7 A;  4LEJ A;  5DQ0 A;  1UO9 A;  4WVM B;  2VM9 A;  1DQ1 A;  2VVF A;  3RYP A;  3GM8 A;  3HT2 A;  4XW3 A;  4CDU C;  4AZZ A;  2C1F A;  4ZU4 A;  4CDQ B;  4CZS A;  4D94 A;  3VDB A;  3T09 A;  2SLI A;  3KT1 A;  3LOI A;  5A32 B;  1PM7 A;  4D8M A;  1ZVF A;  1WMD A;  1GP5 A;  1WMF A;  5KHH A;  2DUQ A;  2VBB A;  5E1R A;  5D2A A;  4JQR A;  5BNO A;  1ND2 B;  1OUS A;  1Y9M A;  2JG9 B;  2YB7 A;  3HNM A;  4IE7 A;  3C7H A;  3ELN A;  2VNO A;  3HN1 A;  2XBO 1;  1JZ2 A;  1N1V A;  4COU A;  3I3B A;  3MZH A;  2ZMK A;  4NHM A;  1AL0 G;  2UUR A;  4OQ9 A;  3RNS A;  4AHZ A;  4EWE A;  3JXS A;  5ANN A;  2AC1 A;  2D6L X;  4OMC A;  3V0B A;  5C7G A;  1EY2 A;  2Q1M A;  4UXA A;  3AP5 A;  4EQV A;  2RS1 2;  3WCR A;  2DWR A;  3DYO A;  4Q4X 3;  4RGK A;  1AR9 3;  5E8A A;  1NLQ A;  4P9G A;  3WQ1 A;  3ZXL A;  1LCL A;  1Q8V A;  5GZG A;  1FPN 1;  3PMS A;  2P1B A;  1NCR A;  4HON A;  4OMD A;  1QJZ A;  2HWB 3;  2PHL A;  2WNO A;  4XC9 A;  3RZG A;  2E9Q A;  2WA4 A;  5FOJ B;  1QJY 1;  4JGZ C;  1UAI A;  2BNN A;  1QJX 1;  1SG3 A;  1TMF 2;  1W04 A;  4K8R B;  4SLI A;  4YVW A;  3RG0 A;  1QJU 2;  1DCS A;  3LEG A;  3MFA A;  4GUL A;  1DLL A;  2YPJ A;  4NAO A;  5F5A A;  1AR6 2;  2VOX A;  2EA7 A;  3FE5 A;  2VUA A;  3RDI A;  3RZK A;  2XLF A;  3X29 B;  2ES3 A;  2AEZ A;  2V72 A;  1MQT B;  2ZGU A;  3NJZ A;  4YW4 A;  5J98 B;  3KV9 A;  4QPI C;  1UPI A;  2WQ4 A;  4XF3 A;  5K0U C;  1XBF A;  1UXZ A;  1GFF 2;  3EQE A;  3GXU A;  1QDC A;  4IE5 A;  2UY8 A;  2GC0 A;  5A7O A;  1CAU A;  3ZFG C;  1W2A X;  3UES A;  2RM2 3;  5FZB A;  1HRV 2;  2ZML A;  2JDZ A;  4GAZ A;  4XFB A;  1UU6 A;  4LBL A;  1N3Q A;  2HJI A;  4JKL A;  4XE9 A;  1Y3T A;  4QDR A;  4CDQ C;  3LPF A;  1VAL A;  2D5F A;  3AYE A;  5DAW A;  3RZH A;  2VEC A;  4DUV A;  3LQC A;  5KXB A;  3LCP A;  3JB8 A;  5F5Q A;  2L9L A;  3KHC A;  2XWJ B;  2R6Q A;  4ASK A;  1SMV A;  5AC9 1;  1ND2 C;  5JWP A;  2JG9 C;  4M01 A;  4XJA A;  1CX1 A;  2D43 A;  2RS1 1;  2Q8C A;  1OD3 A;  1W2T A;  3OYW B;  4Q8K A;  1WCU A;  1VAV A;  1VRH 3;  2IXH A;  3B00 A;  3VBO B;  5L9B A;  5FPB A;  1LHO A;  5FK7 A;  2ZGP A;  1FMD 2;  1WBL A;  5HCH A;  2YU1 A;  4W8J A;  2WO2 A;  4KI5 M;  4WBB A;  3GHN A;  5I8T A;  5BNP B;  1G9A A;  1DGW A;  1ULD A;  3LDR A;  1QJU 1;  4LKS A;  2GP3 A;  3UNP A;  1PVC 3;  4HSL A;  1VBB 3;  1AR6 1;  4HET A;  4XEZ A;  4R52 A;  4DIN B;  2OII A;  4JGY B;  1MZF A;  4BWO A;  2QQP A;  1MS0 A;  4DY5 A;  1O91 A;  2D3R A;  4GQ7 A;  4QPY A;  2BEO A;  4R8H A;  2GZW A;  2W1U A;  2R04 3;  1S2E A;  2HBU A;  1RUF 2;  2NPI A;  3HIF A;  2LRO A;  5FYB A;  3CLP A;  4Q1P A;  1MEC 2;  2KXL A;  4AGV A;  3POS A;  4YNI A;  5L36 A;  2VW2 A;  3E6B A;  5JXI A;  4Y20 A;  1JOP A;  4LQR A;  2XXZ A;  5FPZ A;  2CAU A;  2Y0O A;  3BKZ A;  4DQA A;  1H1M A;  3VHO A;  3D4K A;  1VIW B;  4C8D A;  5FYH A;  1NUK A;  4E4S A;  4IGP A;  1H2N A;  5GZD A;  5F5C A;  2IXC A;  5C5U A;  1LNS A;  3VBH C;  2ZBJ A;  1JS9 A;  2JXA A;  3IAP A;  3N3H A;  4FAH A;  3ZLI A;  5J48 A;  5A3T A;  3BTX A;  5FP8 A;  3CJI B;  5LBB A;  4L11 A;  2TBV A;  2Y60 A;  1YFW A;  1RUH 2;  1RVF 3;  3DEC A;  4LLF A;  1AUY A;  4UFI A;  2QE3 A;  1OQE A;  4CCN A;  3IDC B;  3ZPY A;  1STM A;  3MEP A;  1JMU B;  1NKG A;  3BU7 A;  3POB A;  3BTZ A;  4XF4 A;  1NOV A;  2NP0 A;  1UW8 A;  2WLQ A;  1FMD 1;  3TN9 2;  4O7X A;  2CNA A;  1HJG A;  1AXK A;  4FOW A;  3PIJ A;  1ZNP A;  5A1A A;  2P34 A;  1PGL 2;  2VUD A;  1ULF A;  1DQ2 A;  3T0B A;  2PLV 3;  3OGG A;  3QD6 A;  3WEZ A;  4WZC A;  2D3P A;  2DV9 A;  3QLQ A;  4NPR A;  1VPH A;  1L7R A;  1QNY A;  3OY8 B;  5F8P A;  3CZU A;  3WNX A;  1H6X A;  3P5B A;  1UX7 A;  2W1Q A;  2OZ6 A;  1XB9 A;  1RUF 1;  3PU8 A;  4N53 A;  1OD5 A;  3I2J A;  1COV 2;  4JGY C;  3IPV B;  3VL9 A;  5A1F A;  2P3Y A;  1W39 A;  3KGL A;  1CQ9 A;  1W6M A;  2VTX A;  1US3 A;  3POW A;  3R05 A;  3ZFE A;  4CCC A;  1OLM A;  3QH6 A;  1UOF A;  3THD A;  2IUW A;  1JXN A;  2VC9 A;  1H9P A;  1RHI 3;  1W6P B;  2OPK A;  5FP4 A;  4F8A A;  5F3E A;  4CCL A;  2QQO A;  2WJS A;  1UY2 A;  2G9G A;  3NWK A;  4CYD A;  2OT7 A;  3ALQ A;  1R08 3;  2DTW A;  4C1X A;  4ZHN A;  1H8T C;  4XQ4 A;  1PK6 B;  2NZ9 A;  4DNY A;  4XHX A;  1GV9 A;  1YLL A;  5GKA C;  1JYT A;  4TXW A;  4LA3 A;  1QU0 A;  1F15 A;  4KQ7 A;  4UW4 A;  2Y6H A;  2ZHN A;  3FUO A;  2EXI A;  2DVD A;  2EID A;  5T5O A;  2SBA A;  4R9A A;  4RFT 0;  2PQQ A;  5KC6 A;  1L7Q A;  1FX5 A;  2RVA A;  3AC0 A;  5JXG A;  1PM4 A;  4MVT A;  4QB6 A;  1CAX A;  3TBD A;  4XDO A;  1W8H A;  3QOP A;  3VZN A;  5F9T A;  1X8E A;  2ZHM A;  3V0A B;  4RR3 A;  2XBO 3;  4X6Q B;  5LAT A;  3E6C C;  2HLE A;  3NVC A;  1VLN A;  5HV0 A;  1QEX A;  4OHZ A;  1Q8Q A;  1W9S A;  1S2K A;  3BVC A;  1JZ4 A;  1WD3 A;  1AX0 A;  2GP5 A;  1COV 1;  2ZOE B;  1JYN A;  2CAV A;  2DU0 A;  2Z79 A;  3IAQ A;  4JDM A;  4OI2 A;  2FDG A;  1DDL A;  4QX3 A;  1SCS A;  2OQ6 A;  1XJA A;  2FQP A;  4FFF A;  3NST A;  5H9S A;  2R0F A;  3S5A A;  3POG A;  5FYM A;  3H42 B;  4QPI A;  2C9A A;  4DO0 A;  4DXS A;  2PHX A;  3VD4 A;  4OI4 A;  1H1A A;  1SPP B;  2ZX0 A;  2WNU B;  4Q4W 1;  1QJY 3;  1GSL A;  3N4M A;  4CCM A;  1KQR A;  1QJX 3;  3IB3 A;  3KB5 A;  1CJD A;  3ZPO A;  1AXY A;  4ATE A;  3O1S A;  1XNK A;  1JU3 A;  3LAG A;  5M0T A;  1FOD 2;  2XQX A;  1RUI 2;  3DCQ A;  1DYO A;  4B1L A;  1UOB A;  4G3Y C;  4HG6 B;  4CDQ A;  3O14 A;  2O8Q A;  1QGL A;  2QNK A;  4DPN A;  1HV1 A;  2R32 A;  4AFC A;  3S57 A;  5F2S A;  1UMI A;  3HNY M;  4D6Q A;  2FD8 A;  4UFJ A;  1KGY A;  3MID A;  1L3J A;  2JG9 A;  4NIH A;  2JDN A;  2ZGM A;  3BGA A;  1PK6 C;  3MIF A;  1CGP A;  4YFZ A;  1E5S A;  1HQW A;  4YZ2 A;  2YV8 A;  2Y38 A;  2Y6J A;  2ZAA A;  1UZY A;  3LWC A;  4QM9 A;  5EJ1 B;  1V6J A;  1VBE 3;  5T55 A;  5IK7 A;  2BGC A;  3MIG A;  5HCF A;  4OHY A;  3OUH A;  4QQ2 A;  4KGG A;  3VZO A;  2I2S A;  2RMU 1;  5BNN B;  3KSC A;  1DFQ A;  2NMN A;  3H50 A;  1SDD B;  3O12 A;  2J22 A;  5FKB A;  1GP6 A;  3BIW E;  3H3Z A;  1RUE 1;  3LIG A;  5LRR A;  1S1A A;  4CTE A;  2CGP A;  4FQ4 A;  4IEV A;  5AC9 3;  4QPG B;  1VMH A;  3LEK A;  2RS1 3;  3TNP B;  1A8M A;  3WDV A;  4A6S A;  3S6P A;  1F35 A;  3R4U A;  4M4P A;  1LB2 A;  1GBG A;  3DXU A;  4L2N A;  3I2G A;  2WL1 A;  1BYH A;  3N9P A;  4ATF A;  4QHB A;  3AMH A;  4R9D A;  4BIF A;  2O14 A;  2ATF A;  2AUY A;  1W8O A;  3M3E A;  4JDO A;  4FOY A;  5FPL A;  1NQD A;  3NV4 A;  2ZAH A;  3WQ0 A;  4AHX A;  5DAQ A;  1J1L A;  3T2Q A;  1DYP A;  1VAK A;  4Q4V 3;  1U5Y A;  4XFA A;  1EV1 2;  4MSV A;  5T5J A;  1LGB A;  1HB3 A;  2WFF 2;  3PDQ A;  4Y3O A;  5L73 A;  3WDT A;  5IVB A;  2JG8 A;  2D6K A;  4ZZ5 A;  3KVA A;  1ACC A;  1UXX X;  3WIN E;  1D0H A;  2WNU C;  2OYZ A;  4D7Y A;  4NID A;  5C9A A;  1JYX A;  1X36 A;  2OXB A;  5F39 A;  3J7N A;  1TG7 A;  3P3P A;  3VBH A;  1S0I A;  2ARX A;  4NIA A;  1HQL A;  4OFG A;  4L9B A;  5JZG B;  2HWD 2;  1UMZ A;  3FHQ A;  1PX4 A;  1W06 A;  3LIH A;  4OI1 A;  5FPX A;  3QAC A;  5CNA A;  4Q5O A;  5F6K A;  4P9J A;  3U07 A;  1TQ5 A;  3RQ0 A;  4AL9 A;  5IK8 A;  4JQT A;  4O9E A;  1W6Q A;  5H9R A;  3ZFF B;  5IAV A;  1C57 A;  5A6X A;  4ONU A;  1QKQ A;  1DF0 A;  3JQW A;  5AVP A;  5K0U B;  4Z2A A;  4CDX A;  3LA2 A;  1PGW 2;  2VZV A;  2XL7 A;  3MBW A;  3RZZ A;  3THT A;  3VD9 A;  2RDS A;  4U36 A;  3VKO A;  5CBL A;  1YUD A;  3CU7 A;  3CDZ B;  3H8O A;  1CJP A;  5BNN C;  1JZ8 A;  1WLW A;  1LJ7 A;  3T0A A;  2F6B A;  5IK5 A;  4AW7 A;  4IEO A;  3IBM A;  3S7I A;  2RJK A;  4KWK A;  3E1F 1;  1EYB A;  2GC1 A;  1FMD 3;  3ZSM A;  1ONA A;  3GYD A;  1SCR A;  4IV1 B;  2VNR A;  1Y43 B;  3AJZ A;  4Y5T A;  4CA9 A;  4QPG C;  3RVH A;  5K7P A;  1K5M B;  3H7J A;  4HKL A;  2XUE A;  4PQ9 A;  4KBB A;  3TOJ A;  4CDW B;  2W2I A;  4OZX A;  1SAC A;  2QCS B;  2YGL A;  3ZN6 B;  1CX4 A;  5JMC A;  4SBV A;  3ASI A;  5FKC A;  1AHS A;  5IK4 A;  2CWS A;  2YC4 A;  2I07 B;  3EB7 A;  1NYW A;  1ALY A;  1OFN A;  4XAE A;  2JDU A;  5DUV A;  1TVG A;  5FFO C;  5FZO B;  2RJ2 A;  4W50 A;  1AX1 A;  1W05 A;  2LUW A;  3ACH A;  4CXY A;  4YG3 A;  1YI7 A;  1C3H A;  1VBA 1;  2WT0 A;  4LO8 A;  5C70 A;  1G86 A;  1H8T A;  2Q0A A;  4YYO A;  1CN1 A;  1K3I A;  2FCU A;  4R4Z A;  1KXG A;  5FYY A;  5GJ6 A;  1NZC A;  3FN9 A;  4FPE A;  1CR7 A;  3UV9 A;  4ES9 A;  2B8M A;  5LRS A;  2QBX A;  3ZYR A;  4BK5 A;  1C5I A;  4V2V A;  4R9C A;  3ZN5 A;  2YZ4 A;  3ZYP A;  5IYY A;  1UY1 A;  2C5D A;  2GNT A;  1BVP 1;  1Z78 A;  2EAA A;  4B4P A;  3TYJ A;  4FP3 A;  3DL3 A;  1W0P A;  2X5I A;  1PGS A;  4COV A;  3A7Q A;  4P00 B;  3ZFF C;  1RUC 2;  2ORZ A;  2AR6 A;  3B02 A;  4YAR A;  2VUJ A;  4A6O A;  2AYH A;  3T2T A;  1VAM A;  2JIG A;  4M3C A;  2HH9 A;  3O0W A;  5D21 A;  4EN7 B;  3ZR6 A;  5FYI A;  2O0O A;  4ES8 A;  1GQG A;  2D6P A;  1HRI 2;  3D0S A;  2E51 A;  3URF A;  2QFE A;  2XGX A;  3M8L A;  4NE9 A;  1GWL A;  4XF1 A;  1LED A;  2XPJ A;  2MNG A;  1W90 A;  1BK1 A;  1OHF A;  2OPW A;  4LOS A;  1VB2 A;  1YHF A;  4FPC A;  2Z2S B;  4XMA A;  2JIC A;  2VCM A;  3J7H A;  4NHK A;  3OY8 A;  5T50 A;  1YIF A;  3OSD A;  5A6Q A;  1S0E A;  5CAD A;  3FLP A;  2PHD A;  2RS5 2;  3NV3 A;  4LJH A;  3VLB B;  1NE6 A;  1T6G C;  2QQI A;  2O1Q A;  4IV1 C;  3D82 A;  2A6V A;  3AM2 A;  1AR8 1;  5ABJ A;  5JOX A;  2D97 A;  4XMI A;  2UY9 A;  1K5M C;  1ZZ8 A;  4J1X A;  4XFH A;  1W2N A;  4YG6 A;  3VBF B;  4CDW C;  2DVA A;  5EXO A;  4ZZ8 A;  1RUG 2;  1COV 3;  3T3Y A;  3R0R A;  2HWE 1;  1DGR A;  1KS4 A;  1W9Y A;  1IZ3 A;  5GZF A;  5LA0 A;  5E6H A;  2IZW A;  5B4N A;  2DVF A;  1CPM A;  3MV0 1;  5H9P A;  3SKV A;  2E7Q A;  1QF3 A;  1YQ6 A;  2Y64 A;  4AQT A;  3VDD B;  1W6N A;  4Q4W 3;  1XPW A;  3KQ4 B;  2ZEY A;  1LOA A;  3SIT A;  2J1R A;  3WNL A;  5FYV A;  4ORF A;  3W21 A;  4PIY A;  4XAC A;  3Q8C A;  4XXA A;  4CUA A;  4IEP A;  2Y26 A;  3WCS A;  3ZXA C;  4LE4 A;  1H6Y A;  1C8M 1;  1OOP C;  2BTV C;  4O65 A;  1PO1 1;  4NOT A;  1PX3 A;  2YFU A;  3T4V A;  4RHV 2;  2IXL A;  4XIO A;  3RGB A;  2VZT A;  2WKK A;  4XOG A;  3GNE A;  1S0C A;  1DIW A;  3INA A;  2GNB A;  4ZU5 A;  2HWC 1;  4GB3 1;  3DYM A;  5IW0 A;  1URX A;  1H2K A;  3IDB B;  5DN2 A;  1E5I A;  2HWF 2;  3NMB A;  4QXK A;  5I91 A;  4ZS2 A;  2H0V A;  1VMF A;  2JD4 A;  5LZ6 A;  5A3M A;  3POI A;  1J1T A;  1WZX A;  4MX3 A;  2GNM A;  1QDO A;  4XPV A;  3VKF C;  4Y22 A;  1W6O B;  2BW8 A;  1AYN 2;  2RMU 3;  3SH5 A;  1US2 A;  3I3M A;  4I3G A;  5IFP A;  2VQT A;  2Y34 A;  2XR4 A;  4QU2 A;  2YRO A;  1RUE 3;  4L8Q A;  1GP4 A;  1VB4 A;  4OHW A;  3ZYF A;  1AYM 2;  4GXL A;  2XQR A;  1DBN A;  4OVE A;  4BOW A;  4JX0 A;  4QQO A;  3VBF C;  4IUG A;  1VBC 1;  1RIN A;  4GWI A;  2LRP A;  3USU B;  1SLC A;  1G7Y A;  3AYC A;  1C8N A;  1DGW X;  1OH4 A;  1YNA A;  3CF6 E;  2CDP A;  3NNG A;  3RWN A;  2BV4 A;  1CAV B;  4AAP A;  4QB2 A;  4XZP A;  3UKV A;  1OF4 A;  2E33 A;  1Q5O A;  1N1Y A;  2E63 A;  1M4W A;  2TUN A;  3CKH A;  2BWA A;  4ITC A;  3VBR B;  3ZYG A;  2HEY F;  4BCU A;  1GWK A;  5JXJ A;  2DUP A;  3NNJ A;  4XUQ A;  1I1E A;  3CL1 A;  4DXZ A;  1R1Z A;  3UJQ A;  1H8V A;  1S0D A;  3NKT A;  3OGJ A;  1RXF A;  4GZ9 A;  4V2W A;  3VDD C;  3ZSL A;  1MS9 A;  5HI0 A;  1T2X A;  1GZW A;  2UYB A;  4Q0V A;  4KG0 A;  5EJZ B;  5FZF A;  4LKF A;  3A23 A;  3O1U A;  3U11 A;  4K9S A;  3VBS B;  4B7E A;  2TNF A;  3LE0 A;  5C6C A;  4Q0S A;  1O8P A;  3WG2 A;  4AOC A;  4CPB D;  2V09 A;  5BNN A;  1W8T A;  5DZF A;  1PZ8 A;  5GZE A;  4CXW A;  1E5R A;  1A3K A;  1SHW B;  3RZM A;  1OA2 A;  4XBL A;  1YI9 A;  3RFR A;  4KBZ A;  4MGY E;  1GOF A;  2Q4S A;  4P9I A;  1RMU 2;  5DG2 A;  3CIH A;  4IGQ A;  4Y1Z A;  4TN7 A;  3WW4 A;  2DBN A;  1W9W A;  3MDP A;  2DCY A;  4MLO A;  5T5L A;  4AR2 A;  1SEF A;  4J6G A;  3ACL A;  5FZ4 A;  1LOB A;  1XE7 A;  1REE A;  4RQP B;  3WD5 A;  3RPQ A;  3AJY A;  4QB1 A;  3MIB A;  4MGK E;  1PIV 2;  3N7M A;  5FLI A;  1UY4 A;  3GJB A;  5B2G B;  5EV7 A;  3G7D A;  5FMO L;  1XYO A;  1G9D A;  2EXH A;  5FZL A;  4PIX A;  1H0B A;  3J8F 2;  3POE A;  2XL9 A;  2DVB A;  4GWJ A;  3TEZ A;  3PJQ A;  4LKD A;  1W8N A;  2VL4 A;  3H3L A;  1I9R A;  4BA6 A;  5FXW A;  4NHL A;  2VO5 A;  5T54 A;  2XLA A;  4P9L A;  2O8O A;  1S2B A;  4YW3 A;  2PN5 A;  1OQ1 A;  2LS6 A;  4JV4 A;  1D2Q A;  2KR2 A;  2OVU A;  5HXM A;  2DFB A;  5BY5 A;  4DEV A;  1G9F A;  2NYY A;  3C3V A;  4S2F A;  2WZR 1;  3RYK A;  4KMQ A;  1WW4 A;  4PDW B;  3DF0 A;  3WP6 A;  1UX6 A;  2OW4 A;  3PVN A;  3WHT A;  4MGI E;  2JEN A;  3PTY A;  2K0G A;  3OTF A;  2VZP A;  1GAN A;  4XJZ A;  2MPF A;  1R1A 3;  3RRD A;  2IXJ A;  3WV6 A;  1VBA 3;  4AED A;  2WN3 A;  3ZFF A;  1YQ5 A;  3LGR A;  3IT8 A;  3VBR C;  3LFI A;  4AI0 A;  2VMF A;  1AJO A;  1OSG A;  1LOG A;  2VMD A;  3U1X A;  1MVE A;  4FTS A;  3SXW A;  4Y26 A;  4HKO A;  1RUJ 2;  1ASJ 1;  4Y5Z 0;  2W94 A;  3ZM8 A;  2LM3 A;  5A7S A;  3ZIX A;  5CFD B;  5KR7 A;  2BDR A;  3VBS C;  2JX9 A;  1NXD 1;  1NXM A;  2WNV B;  1MS1 A;  5DUU A;  1UU5 A;  4OHV A;  3ZMN A;  1U12 A;  1SLI A;  3BU0 A;  4CEW B;  3E6D A;  1D4V B;  5F37 A;  1F4H A;  3OGV A;  2JDH A;  1PIV 1;  1VBD 2;  2VJX A;  2YMZ A;  3HN3 A;  2BGP A;  2D7F A;  3AMP A;  4QT6 A;  3ILF A;  1R09 1;  4QM8 A;  2YFZ A;  4XJU A;  4Y24 A;  4BIS A;  5C3R A;  5J3U A;  2G9Z A;  3BN6 A;  4Q0Q A;  4IV1 A;  1NG0 A;  5A33 A;  2BBA A;  1OPM A;  2ADD A;  4GMP 0;  4CEY C;  3SCF A;  3ROU A;  2JDA A;  1UYP A;  4GH4 C;  2HYK A;  2A3Y A;  3T08 A;  4CCE A;  3TEW A;  4LNV A;  3NO8 A;  1AR7 2;  4P5Y A;  3VHN A;  3WP4 A;  2RS3 2;  1FNZ A;  4LBQ A;  4OCT A;  1HN0 A;  1ULP A;  4F83 A;  3OB8 A;  4XIL A;  5FZO A;  2ZEW A;  1WMX A;  2PTM A;  5IVE A;  2KM2 A;  3AZX A;  3M4F A;  1UOJ A;  2QQM A;  2WYF A;  4Q27 A;  1UKG A;  2PQS A;  4AQS A;  1YFU A;  2GC3 A;  4COY A;  4LO6 B;  1AR8 3;  3ZO0 B;  3ETP A;  4DMI A;  4CRQ A;  4E27 A;  3JQX A;  4DUW A;  3LPG A;  1J58 A;  3S7E A;  5FOB B;  1JYC A;  5DAX A;  3TAY A;  2F17 A;  1EUU A;  2VD7 A;  1ZA7 A;  3NAP A;  4QQH A;  3HBZ A;  1OOP A;  5L19 A;  3U4S A;  2HWE 3;  3PIG A;  3OBA A;  1ZBE 2;  4J25 A;  4PDW C;  3KT7 A;  4WM8 B;  2JE7 A;  1MR5 A;  1SFY A;  3WP5 A;  4AFA A;  4LUM A;  4BB3 A;  1QNW A;  4QX8 A;  1RUJ 1;  3M70 A;  2BVB A;  4P02 B;  2J42 A;  2ORX A;  3T2O A;  2ZZJ A;  4CU9 A;  5ERL A;  2YBP A;  1PO2 3;  3WW3 A;  1LEN A;  4PBP A;  1EAH 1;  3OPT A;  4S2H A;  4Y1Y A;  4F3J A;  4D3W A;  1HN1 A;  4JVA A;  1L7L A;  1SBE A;  4RSU A;  1C8M 3;  3AP4 A;  4FOV A;  4YPJ A;  4JHT A;  1PO1 3;  4YVS B;  5JLV A;  4PHZ A;  1OH3 A;  2VNV A;  1HDK A;  2WNV C;  3OPW A;  2GAU A;  1GLH A;  4B8E A;  3SHR A;  2HWC 3;  4GB3 3;  4AI2 A;  2ARB A;  4LHN A;  3BTA A;  4LO7 A;  1W3V A;  2Y6F A;  4URA A;  1BXH A;  4DB5 A;  1ZM1 A;  1AL2 2;  3FL7 A;  2XVK A;  3JD7 3;  2XKO A;  4A3X A;  3AX4 A;  2EVX A;  4FBF A;  5F3C A;  4BXS V;  4CP9 B;  3U78 A;  4AI1 A;  5LA9 A;  1PMH X;  2VCB A;  3IDA A;  2J1S A;  3N9O A;  3J26 N;  4PCR A;  5FMC A;  5GLU A;  4EN8 B;  5JIU A;  4WM7 A;  5JDB A;  4YM3 A;  3JBG 3;  4BQY A;  4HVQ A;  4AFD A;  4CUG A;  3UET A;  1PNF A;  4AVA A;  1YEW A;  4ZU7 A;  1JHN A;  1I3H A;  4S2G A;  1OA4 A;  1YWK A;  1ZBA 3;  3LSE A;  4XHB A;  5I93 A;  3IKW A;  2PXJ A;  4N7I A;  3RJR A;  2BFU L;  2AAC A;  3WW2 A;  1BLZ A;  4M3C F;  2VGD A;  3VDD A;  1HIX A;  1DZT A;  4ZPI A;  1H4G A;  4N8M A;  5I0U A;  2EIB A;  3FUQ A;  5FZC A;  1BCX A;  1GUI A;  2ZA9 A;  3KCX A;  1TMF 1;  3IIA A;  3MIH A;  4RGA A;  4A7Z A;  1VBC 3;  1W2O A;  5FBZ A;  2WBK A;  3GBW A;  5J37 A;  1KDM A;  2VOT A;  4YGD A;  4TSV A;  4EN0 A;  5A7N A;  4WM8 C;  3MLJ A;  3D5O A;  4IEU A;  2ARE A;  1PMJ X;  4YW2 A;  3RI9 A;  4BQ5 A;  1N47 A;  2A5Z A;  2XJT A;  1RC6 A;  4JRL A;  4AFM A;  5FYC A;  3V56 A;  4LHS A;  2ZGO A;  1G9B A;  3H1W A;  1RXG A;  3BB6 A;  2VAU A;  2WII B;  5KHJ A;  2P6H A;  4W4Z A;  4MUV A;  1WME A;  1H2L A;  1ENQ A;  1XNT A;  1AL2 1;  1OKQ A;  1RTV A;  1BHG A;  1HRV 1;  3MW2 A;  2QQK A;  3OJB A;  3PVO A;  4H14 A;  4IE0 A;  4YVS C;  1W0O A;  1MQT C;  1V6K A;  4XFI A;  4I2O A;  2H6B A;  1LOE A;  1POV 0;  2QQU A;  5KC5 A;  1ST8 A;  1SDW A;  3I2F A;  4YW5 A;  5FZ9 A;  4LBO A;  4XCA A;  5I0S A;  3ZSK A;  2WS9 2;  3FHI B;  4JTN A;  5FZ1 A;  4QKD A;  1Y9G A;  3OG2 A;  3HD8 B;  2EXK A;  1D7P M;  5CFC A;  2XKP A;  2YHJ A;  3WDU A;  3ILR A;  4UFH A;  3L9J T;  3AL6 A;  1W8F A;  5F1R A;  3J9S A;  3EYP A;  3N9N A;  2RR1 2;  3D0J A;  5FMD A;  1LR5 A;  2WFP A;  2P3K A;  4QDS A;  5FIX A;  2ADE A;  2ETE A;  5A7Q A;  4XUO A;  1OLM E;  1X33 A;  5FZI A;  4HKW A;  1CAV A;  5LWB A;  1C4R A;  1UYZ A;  2C26 A;  3B9C A;  4KGQ A;  1F4A A;  4EZ4 A;  2OS2 A;  3VBR A;  1BBT 3;  2RG4 A;  3I59 B;  3ZDS A;  4RFR B;  3ZYJ B;  4Z8B A;  5ACA 2;  2EAK A;  3VBO C;  4EWA A;  1RED A;  2E7T A;  4LIU A;  3THP A;  4EE2 A;  3Q8B A;  4DUX A;  2PAM A;  2WZR 3;  3OBT A;  4IEX A;  4E9K A;  1LOF C;  4XUN A;  1ND3 A;  1W2U A;  3AZV A;  1MZ6 A;  1KEX A;  3A4U A;  4Q4Y 3;  3VBS A;  4N43 A;  5BNP C;  4NMI A;  2ZHK A;  1MEC 1;  3GCW A;  4OLL A;  4BQ3 A;  2ZXQ A;  5C4W B;  2E6V A;  1W9F A;  1HJF A;  3L2Y A;  5C3Q A;  1HQN A;  1TZO A;  2W5F A;  1YJK A;  4AG4 A;  2CL2 A;  5D1I A;  4CEY A;  3BTY A;  5LBE A;  3KV6 A;  2FDF A;  4CDU A;  4TTG A;  4GH4 A;  4XUP A;  1ASJ 3;  5FTT C;  1PHM A;  1XSQ A;  4BDV B;  3B69 A;  1W99 A;  3VKL A;  2K2S A;  2R06 2;  4EWD A;  2P3J A;  1OQD A;  1V6N A;  5L7O B;  3OF1 A;  5T52 A;  2CDO A;  1IKQ A;  2VE1 A;  2ZEX A;  3I3Q A;  1CAW A;  1SLB A;  3C7F A;  3MUY 1;  1YIP A;  2RR1 1;  1RUH 1;  1PIV 3;  2VOW A;  2WQ8 A;  5F3I A;  2VPV A;  1LEC A;  3UGH A;  4AQ2 A;  1I6X A;  1R09 3;  2DCT A;  3WG1 A;  3JUU A;  2BJS A;  3Q8F A;  4KWL A;  4UOJ A;  3ZDV A;  4EZH A;  5A33 B;  1JYI A;  1TNF A;  1Q3E A;  4KL1 A;  4L99 A;  3TN9 1;  1HXS 2;  2DDU A;  4LBQ D;  2WAO A;  3LDK A;  1AF9 A;  2PAE A;  1LU1 A;  2XON A;  3AK0 A;  4FQZ A;  1WA6 X; 
#chains in the Genus database with same CATH homology
 2VUD A;  1UZV A;  5D2A A;  2JDP A;  1OUS A;  2BOI A;  1W8H A;  5A3O A;  2BOJ A;  5A6X A;  5A6Z A;  1OUX A;  5A6Q A;  2BV4 A;  1OUR A;  1GZT A;  3DCQ A;  2VUC A;  2XR4 A;  2JDU A;  2JDH A;  2JDY A;  1OXC A;  5A6Y A;  1W8F A;  2BP6 A;  2JDM A;  2VNV A;  4UT5 A;  3ZDV A;  1UQX A;  2JDK A;  5A70 A;  2WR9 A;  4CE8 A;  2JDN A;  1OVP A;  5HCH A;  2CHH A;  4AOC A;  1OVS A;  2WRA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...