1LOFC

X-ray structure of a biantennary octasaccharide-lectin complex at 2.3 angstroms resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
180
structure length
180
Chain Sequence
TETTSFSITKFGPDQQNLIFQGDGYTTKERLTLTKAVRNTVGRALYSSPIHIWDSKTGNVANFVTSFTFVIDAPNSYNVADGFTFFIAPVDTKPQTGGGYLGVFNSKDYDKTSQTVAVEFDTFYNTAWDPSNGDRHIGIDVNSIKSINTKSWKLQNGKEANVVIAFNAATNVLTVSLTYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lectin
molecule keywords LEGUME ISOLECTIN I (ALPHA CHAIN)
publication title X-ray structure of a biantennary octasaccharide-lectin complex refined at 2.3-A resolution.
pubmed rcsb
total genus 27
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 1993-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1lofC00
2GMMA 3OBTA 1DQ1A 1LOFC 1QDOA 2YMZA 3FLRA 1IS6A 3AK0A 3B3QE 1Q8QA 4YFWA 1LOEA 2NP0A 3CNAA 3MEPA 3N7KA 3APBA 2JKBA 3SH5A 4HL0A 1W6NB 2EXHA 5DZGA 5T5PA 1CJPA 1ONAA 1W6QA 2WLQA 1QDCA 2ZGUA 1LGNA 3ZVXA 5GM0A 1MZ6A 1LCLA 4FPJA 3NV3A 1GZWB 1DQ2A 3SITA 4Y1ZA 3H0OA 5LK5A 1OQ1A 3ZXLA 1KJLA 1S0IA 5GZCA 4XJZA 1V6MA 2JECA 2ZAAA 3GNEA 5GZFA 4M3CE 2DYCA 4F83A 1YI7A 5CBLA 1LU1A 4Y1UA 4YG3A 3BTAA 4Q8KA 2UURA 1LGBA 1F9KA 1WW7A 1V6IA 4YM1A 2P34A 2A3WA 4Y22A 1CVNA 3INAA 1LU2A 1JBCA 3GALA 3OPZA 2ARXA 2EAKA 3IMNA 1LJ7A 4FPYA 1UZYA 3WCSA 1CQ9A 2VW1A 1GKBA 5DUVA 1UL9A 1S0CA 3WVJA 1LOAA 5F5QA 1YRZA 3WDTA 4BQ1A 3N35A 5H9PA 1QMJA 2PHUA 3ZXFA 2ZGOA 5HCFA 1DBNA 1BKZA 4FPOB 4ISQA 1HKDA 4AVSA 2R16A 3WDVA 3WHTA 1FATA 2E53A 4Y20A 4YZ4A 2D6PA 2ZGMA 5H9SA 4R9AA 3ATGA 4R9BA 2WQZC 1UMZA 1MS4A 1DIWA 3HR9A 3KQRA 1MZ5A 5DG1A 3NWKA 1SLIA 3BOPA 2HYKA 1QNWA 3UK9A 4AYUA 2E7QA 1W6QB 3A4UA 3VKNA 1V6KA 2C9AA 2D43A 4YW5A 3WV6A 4DQAA 4OZXA 1S0DA 1SBDA 2A3XA 3V65A 2FMDA 2DUOA 4YZ2A 1OFSA 1DQ5A 1SFYA 1S0BA 1URXA 4Q1PA 5JOXA 2V73A 4GWMA 1N3QA 5T50A 3VUOA 2GALA 4LBMA 1GANA 1Q56A 2D6LX 3PJQA 3AP6A 1G8WA 5IT6A 4Q27A 2A7AA 4UW3A 3ZXJA 2V5YA 3RMXA 3AZZA 1DYKA 1UAIA 5IUQA 5EWSA 1UX6A 2PHRA 4XJ9A 4ATEA 1LHNA 4K1YA 3KM5A 3WUDA 4CTEA 4FPEA 1WLCA 3VKFC 4FOQA 3O5SA 3AYCA 1F31A 2ARBA 3M3EA 4YZ5A 1C4RA 3PVEA 1DQ0A 1D0HA 1W6PB 2R1DA 1GZWA 5KXEA 3ZYPA 5F9TA 4ASMB 1N1VA 1DQ4A 1WLDA 1MS0A 2GDFA 1FNZA 2AGSA 3IN9A 3N3HA 1LHWA 1BXHA 2AH2A 4Y1VA 4WVWA 2GNDA 3OGGA 4YG0A 4PF5A 2OVUA 3PMEA 1MS3A 3MW4A 1H9WA 5GLTA 5H9RA 4BLIA 3OBRA 4Y1YA 2VW0A 1I3HA 1ULDA 1W6MB 3IPVA 1VLNA 1C57A 4XJAA 5CAZA 3C2UA 4YW4A 2GMEA 1CIWA 1JN2P 3B69A 4PBPA 4XHBA 4XZPA 3ZSLA 5FRAA 5JDBA 2LALA 3HMYA 4U36A 1SBEA 3RRDA 4YGEA 5T5OA 2CWSA 2D7FA 2SLIA 4XIKA 2D6KA 3ASIA 4ZXKA 3V0BA 4P9WA 4GKXA 3B00A 1LHVA 1KITA 3USUB 2CYFA 2ZGTA 3FUOA 4GA9A 4LBKA 4GALA 1N1TA 1FNYA 4FPCA 4NOTA 4Q26A 4R9DA 3M3QA 4R9CA 1GSLA 4LBLA 4ZKTB 2DUPA 1U0AA 1GICA 4SLIA 4AGRA 4XILA 1KQRA 1EPWA 1W6OA 1N1YA 4DS0A 3DUIA 5H9QA 1WBFA 1FX5A 1IS4A 4YGDA 4YW1A 4WV8A 1RITA 1VALA 4XDQA 1FAYA 1CESA 4UW6A 1DLLA 1WW6A 1GZ9A 3N7MA 3NV4A 1Q8PA 5T52A 3ZSKA 2D3PA 2OUJA 3AP5A 2UWBA 5CNAA 2DVAA 4Q8LA 1N3PA 5EYXA 1LODA 1Q8VA 5IK7A 2DV9A 1ENQA 1H30A 3RQ0A 1APNA 4FOWA 2WSVA 2DTYA 3OYWB 1C1FA 3UL2A 3PVOA 1SLCA 2WT2A 5DZFA 3IPVB 1ULFA 1YO8A 2ZKNA 2ZGRA 2B7YA 1DQ6A 3D4KA 4AGVA 3AZXA 1AXKA 2ZZJA 3FLPA 3SNMA 1IOAA 4FOYA 1WD3A 4XYXA 1ENSA 1WD4A 2JE9A 3AZWA 1JOJA 3QCWA 1D2SA 3M1HA 2A6XA 3JU9A 1RIRA 1KDKA 1W6PA 3R4SA 3V0BB 2A70A 1N3OA 2A75A 1IS3A 1LENA 3A0NA 2E7TA 1TEIA 3AYEA 4BLJA 2YROA 4FPFA 3RSJA 2PHFA 4Y24A 4AVTA 1MR5A 2CWMA 1S0EA 4P9YA 2CTVA 2I2SA 2XB6C 2WSUA 4TYSA 4DFSA 5GZDA 1KDMA 1MS8A 2D3RA 2P3KA 2YY1A 1DZQA 1G9FA 3R4UA 5EYYA 5T5LA 3WHUA 5DG2A 1LECA 2CY6A 2G4IA 3AX4A 2XG3A 4XOGA 1CPNA 1W6MA 2P3IA 3MW2A 4FVVA 3VKMA 2NMOA 2LTNA 1G9BA 1W6OB 1SBFA 5E8AA 4WZFA 2PHXA 4RL7A 4Y26A 3LCPA 2EALA 2D3SA 2ZMNA 2D6MA 5HCBA 4XXPA 3WLUA 5JOWA 1PZ7A 3IKWA 2WT0A 3WG1A 1WBLA 5KXCA 3WUCA 1FV2A 1ZA4A 1A3KA 2ZGKA 4LBNA 2ZMLA 3ILNA 1N47A 4M3CF 2FHRA 1UZZA 3USUA 5GLWA 1MS1A 2YV8A 1VAMA 2GNBA 4HANA 5SV8A 4TZDA 1V6NA 1JXNA 1W0PA 2Z42A 3DGTA 4P9XA 3PVNA 3POYA 1Q8SA 3ENRA 1AX2A 1G86A 4Y1XA 1YIFA 3POWA 2PELA 4XTPA 2A6ZA 4FPHA 4C1XA 5JVVA 1LULA 1IS5A 2R0HA 1Y7BA 2ZGNA 4FP3A 4K21A 3ZYRA 5GZEA 2Q5TA 2E51A 1SLBA 4GXLA 1ULCA 3ILFA 3VV1A 4Q1RA 3VKLA 3ZSJA 3ZXEA 3BODA 1FYUA 2VW2A 4WVVA 2NM1A 2VH9A 4XBLA 5HCAA 4FOVA 1UN1A 1KJRA 2WJSA 4LBQD 5FREA 1AJKA 1MVEA 2NZ9A 3RS6A 3TAYA 5AVAA 2WKKA 3WG3A 3N36A 4CZSA 2P2KA 3FLTA 1AXYA 4L8QA 2VY0A 5KXBA 1DGLA 3OYWA 1GLHA 2GMPA 4XMIA 2D6NA 3AJYA 1SCRA 1V6JA 1G9DA 4C1WA 2GNMA 3WDWA 1JW6A 1O4YA 1FV3A 3AP4A 3WDXA 3D6EA 3SH4A 2A5ZA 1LOCA 2ENRA 4K20A 3JUUA 1CONA 1Q8OA 2CNAA 4NO4A 2YXSA 4CRQA 1QNYA 3T2TA 3R05A 2AUYA 1NXD1 2P37A 3O0WA 2OUHA 1B09A 2ZHLA 1GNZA 4XJUA 3SLIA 1SLAA 2EF6A 3M2MA 1WW5A 4RA0A 4PCRA 1C1LA 1RINA 3O12A 4YGBA 2EXIA 5DUWA 1QOSA 3BIWE 1AZDA 3UJOA 1W0OA 3T1LA 4XIOA 1WCSA 5E89A 5IK4A 2ZABA 2EXJA 3OY8A 3IM0A 4XHXA 2JDZA 1NLSA 4XE9A 1HQWA 1AJOA 3I4IA 2CL2A 1HLCA 1J1TA 2GNTA 5CA6A 1VAVA 1R1ZA 3NV2A 4Q2FA 2E6VA 2W68A 2WT1A 4BOWA 1GNHA 2ZMKA 3AP7A 3AXDA 1I1EA 3WNXA 3T1MA 1QKQA 5DXDA 1WUVA 2W39A 5GLZA 1G7YA 1SACA 1LOFA 2ZHMA 4FQZA 1A8DA 3ZXKA 1CN1A 2P3JA 1N1SA 5DUXA 3W59A 3SH3A 3NV1A 2DUQA 2RHPA 1CPMA 1IKPA 1LOBA 4XBQA 1AX0A 1O4ZA 5DUUA 3V64A 1S1AA 5IK5A 1BZWA 1ENRA 2JE7A 2NYYA 5GLUA 5JOZA 1PZ9A 2A6WA 5DZEA 4YM3A 3N7JA 4ATFA 4AWDA 2JJ6A 4P14A 3AYDA 3AP9A 1LHUA 1QOOA 5JLVA 2ZHKA 1S0JA 1ULEA 3N7LA 3QLQA 3WDYA 3I8TA 5JMCA 3ZSMA 2R0FA 5GJ6A 1MVQA 1MACA 1S0FA 1XQNA 1PZ8A 1HQLA 3D5OA 3V0AA 1X50A 2W08A 4MYEA 4BMEA 2AENA 1SLLA 3U4XA 4FPGA 2JD4A 4AVVA 2UU8A 3HN1A 4JCKA 2OW4A 4DRRA 1LHOA 3MPPG 4M3CB 4FPKA 4XTMA 4YZ1A 3RG0A 1QU0A 3WG4A 1G9CA 1UKGA 1KRIA 1UPSA 4XJ8A 1GBGA 1SCSA 3OJBA 1SLTA 1YYNA 2DVDA 1BJQA 3AJZA 2A71A 2GN7A 3OY8B 2W52A 4YW2A 1LGCA 2A6VA 1JYIA 5EXOA 4AGGA 4YFZA 2DWRA 4XMAA 2ZGQA 3VKOA 2DURA 1BYHA 2DVGA 1A78A 3POSA 2R1BA 4BMBA 3UJQA 1GV9A 2R49A 3LSEA 4UW4A 4W65A 2ERFA 1DFQA 4PBOA 5CB7A 2DTWA 2VXRA 4LBJA 1LEDA 1LEMA 1MS5A 1WW4A 1JUIA 3WG2A 1G9AA 1QOTA 4LBQA 4FQ4A 5T54A 3ZPYA 1HDKA 2UWAA 4K1ZA 4YG6A 4U2AA 4Z8BA 4DPNA 1VIWB 5GALA 3B01A 2D6OX 1GYKA 3AYAA 1YXWA 4KBBA 4BPZA 2ES3A 3AFKA 2A3YA 3WDUA 2NN8A 1AXZA 1GZCA 2VU9A 4UW5A 2UWCA 4YM0A 1AF9A 1Z78A 2KM2A 2NMNA 5GLVA 3WOGA 1OKQA 4YZ3A 3TB0A 2AREA 3A0KA 1MS9A 3V0AB 4ISRA 2DVBA 4Y22B 1AVBA 4YM2A 4GWNA 3RMYA 4BM8A 1H9PA 5IK8A 1LTEA 1BQPA 3O0XA 5T5JA 2PHWA 1Z0HA 1W6NA 2ZA9A 4JC1A 3AZYA 2AYHA 2GN3A 2EXKA 1V6LA 1QGLA 4GKYA 2ZBJA 4YW3A 3M3CA 1QF3A 1CR7A 2D44A 2H0BA 1V6OA 2ZGSA 3B9CA 3WZ1A 4ITCA 4JRAA 2DU0A 3AZVA 4IQPA 3M3OA 2TEPA 3LSDA 4I30A 3W58A 1S0GA 2A6YA 2SBAA 2ZGPA 2WNEA 4XJWA 1DYPA 4Y20B 3ILRA 3FUQA 4PQ9A 1ZM1A 3MW3A 2BQPA 3L2YA 4D69A 1LOGA 1LESA 2ZHNA 5GZGA 1IKQA 2DU1A 2EIGA 4LBOA 5BYNA 5T55A 5KXDA 1F5FA 4FPLA 2DVFA 3SISA 3O0VA 4LBQB 4M01A 1JHNA 3AXEA 4XXAA 3WCRA 2PHTA 1AX1A 1JYCA 3FBYA 4FP2A 4H55A 4M3CA 2YZ4A 1WLWA 2AR6A 1DHKB 4YGCA 1ULGA 2ZGLA 2C5DA 4YLZA 4DRVA 5L73A 4M00A 2ZACA 1V00A 5E88A 4XBNA 3Q9OA 3FFZA 5JOYA 2VUAA
chains in the Genus database with same CATH superfamily
3FBMA 2VCBA 5FZMA 1O5LA 5FKCA 1QDOA 2YMZA 3H8XA 2YBKA 4CEYA 2Q1FA 3KV6A 3LDRA 1LOEA 3CNAA 5CFDA 3MLJA 3N7KA 4HT1T 3RFRA 1ZBE2 2MEV3 4PF1A 4XF1A 1IQAA 5I0TA 2RS53 4PI2A 1CJPA 1YI9A 4XF0A 1QDCA 3ZVXA 1LGNA 2WC2A 4CEWA 3ACHA 4BIFA 4RGKA 1PK6C 4URAA 1LCLA 1UO9A 3SITA 1DQ2A 2ADDA 2XL7A 2ZTNA 5LK5A 3IMMA 1HB4A 4NHYA 3W21A 4YNIA 2VZ1A 1FMD3 1PK6A 1V6MA 2JECA 1ZBE1 3GBWA 5A1AA 5LA0A 4CCEA 2GC2A 1ZZ9A 3OUHA 1YI7A 4B7EA 4L11A 4TSVA 4Q8KA 2UURA 3QH7A 4YRDA 2WWJA 2QQVA 5FPAA 3RVHA 4DMIA 4OI4A 2P34A 2WQ8A 3VBHC 3ZFFA 3INAA 3KCXA 4HFSA 1LU2A 4MVTA 3GALA 3OPZA 1NQDA 4BISA 4QQHA 4FPYA 4MGTA 5E6HA 1HX6A 5BNNC 3K4DA 3SEPA 5HBAA 1UL9A 3VBHA 4AFCA 3T30A 4H14A 1LOAA 5F5QA 3U14A 1YRZA 3GHNA 4E27A 5FYBA 4BA6A 3N35A 1U5XA 2FCUA 5FY4A 3LZZA 4V1PA 3ZXFA 4XQWA 4AI9A 4CU7A 1DBNA 2CGOA 4ISQA 1HKDA 2R16A 1T6GC 2XL9A 3WDVA 4YZ4A 4BWOA 3GZEA 1ZBA2 2E63A 2D6PA 5H9SA 3ELNA 2I45A 3ATGA 4QD2A 2WQZC 3U10A 2XHKA 1DIWA 3A22A 1QQP3 3HR9A 5DG1A 4EWDA 3BOPA 1SG3A 5A1LA 3EHKA 4AYUA 1CWPA 2XMLA 3NKGA 2JDHA 5A7WB 4IEQA 4B29A 2VCAA 3OBZA 4IGPA 3UGFA 1ZBA1 3J7HA 1S0DA 4CDQA 1Y9GA 4AI3A 1OFSA 2RR12 4XUTA 3BTYA 1DQ5A 1SFYA 1URXA 4MGKE 5T50A 3OSDA 2GALA 4LBMA 5F5CA 1W2AX 1Q56A 5BV6A 2A73B 1JYVA 1KFUL 3ZR5A 3VBRC 4A7ZA 3LIHA 4LO6B 4S2HA 3WR0A 4AOCA 5ABJA 1KGYA 3MUZ1 1OLMA 3CU7A 2XBO3 2VO5A 3I2HA 5FO7B 1DZRA 4MHUA 2PHRA 3HT2A 2RR11 2P6HA 4K1YA 4KMQA 1WLTA 3RZGA 4AQTA 4UF0B 1GMMA 3OCPA 1PO13 1WLCA 4K9SA 3VKFC 1QJZA 4HVRA 3O5SA 4QQOA 2ARBA 1NA1B 4P5YA 4BDVB 3OF1A 4GAZA 3PVEA 4IXLA 5FZDA 3WP5A 4C91A 1W6PB 1D0HA 4IL7A 4ZZ5A 3A7QA 1GZWA 2PLV3 2VZTA 3HD8B 2K2SA 5FTTC 3VZLA 5KXEA 4J6GA 1O3RA 1XU1A 3VZNA 1WLDA 1AYM3 1MS0A 3QD6A 3D0JA 5FPZA 1CAWA 4CDXC 2JDNA 1FNZA 3FN9A 2G9ZA 3NAPB 4MXWB 4Y1VA 4AEKA 4WVWA 1B35B 4PIXA 1HRV2 1H9WA 1RUI3 1WA4A 3MHZA 3MW4A 4M0HA 2Y38A 4Y1YA 4BLIA 1K5JA 4BE3A 1I5PA 1W6MB 1H2MA 4B4QA 3IPVA 2Z69A 5A33B 2JDMA 4SBVA 5JSOA 1VRH3 1H1AA 1XNKA 1XRUA 4YW4A 5FJKA 1JN2P 3B69A 4PBPA 4B4PA 3BIEA 1OLME 2Y6GA 2ID4A 4XZPA 4BZ4A 3O1UA 2GSYA 3LQCA 3H1WA 1HRV1 2CWSA 3VDAA 2SLIA 3POEA 3ASIA 3KS7A 4ZXKA 3V0BA 1H4HA 2W87A 3E5XA 2ORZA 2TNFA 2ZX3A 4QX5A 4UAPA 1H2KA 2CYFA 5FZ0A 3WXPA 1Z7S2 4GA9A 4Q5OA 5I0UA 3O1PA 4NOTA 5FLHA 4QPYA 3MICA 4MGIE 4LMFA 1UU5A 4Q26A 3BYWA 2QQPA 3DXTA 1M4WA 1GSLA 3G6JB 4O9GA 4ZKTB 4QQLA 3IDAA 4EROA 5CBLA 4QPGC 1EPWA 4CP1A 4OFGA 2WO3A 3SKVA 3VZKA 4OMCA 1Z7S1 3I2DA 4FFGA 2R7EB 4MGYE 4YW1A 5LATA 5LCWL 1VALA 3C7FA 4RGAA 4XDQA 4IE4A 5FV3A 4UW6A 5A6ZA 1WW6A 4QPGA 4XC9A 1GZ9A 3NV4A 4G9SB 4XFGA 4RHV3 5T52A 2OUJA 3AP5A 3E6BA 1PHMA 3MV11 3WNPA 3KCYA 2JE8A 1VBA2 2DVAA 2Y64A 3PIJA 1N3PA 1SQ4A 3ME2A 2YDEA 4COZA 1Q8VA 2XDVA 1H4GA 1RUD3 3GF6A 4AZZA 1PX4A 2YPDA 4ET7A 3BTZA 2WSVA 2DTYA 4V2VA 5C4WC 1C1FA 4JZRA 5HV0A 3FJSA 5FLJA 2WT2A 1HIXA 3BPSA 2WFF3 1CAVA 3RWKX 4LITA 2W1QA 2WNVA 3SNMA 1VBA1 4FOYA 3ZX7A 1J3QA 1ENSA 1WD4A 2UYBA 1R1A2 3VBOA 4A3XA 2ARCA 4RQPA 2N7GA 5DDJ2 1A8MA 3R4SA 4INDA 2A70A 3JBG2 4BQ4A 1LENA 3A23A 2WZ8A 4XF3A 2E7TA 4BLJA 2WZR2 4CXYA 3KZ4C 4OUSA 2PHFA 4Y24A 1W8HA 2B9VA 4Q4W2 2QE3A 1GQHA 3WF2A 1GUIA 1KDMA 2D3RA 2P3KA 1ODNA 1R1A1 1DZQA 2WWUA 4P9GA 5EYYA 5FQ0B 3WHUA 5DG2A 2P6CA 4QU1A 4XFCA 3I3QA 5DDJ1 1CX1A 1CPNA 2P3IA 4LA2A 3JBG1 2NMOA 3ZFGA 3KVAA 1Y9MA 2WZR1 4ORFA 2XQXA 5T3NA 3LCPA 1QXRA 1JH5A 5HCBA 1OQEA 3N9LA 2XH6A 2WS91 5A70A 1RUJ1 3M4FA 1ODMA 3H3UA 1I6XA 1OURA 1V70A 4LO5B 5L7OB 2OZ6A 1FV2A 2VECA 1O59A 4LBNA 2VUJA 4B7KA 1SFPA 4B8EA 2ZEXA 2FHRA 1UZZA 3USUA 3OD0A 3LIGA 4AF9A 1XU2A 1CAUB 5FZ8A 5I91A 4WVMA 4Q4Y2 4NWWA 5A1FA 3POYA 1GWLA 1GP5A 1GQPA 1AX2A 1Q8SA 3ENRA 2PELA 3S7IA 2MNGA 4ES9A 1S2KA 1UXZA 2R6QA 5DQ0A 4FP3A 2ZGNA 1HRI3 3WNOA 4CCDA 2AEZA 3N9QA 1SLBA 4Q4Y1 4UT5A 4Y4YA 1S55A 3ILFA 3VV1A 1EAH3 3BODA 1FYUA 1R082 2QQUA 1RL3A 4LHKA 3ZSEA 3PJYA 5B4NA 2FCVA 1KJRA 4Z1VA 5E16A 3AL5A 4GH4C 1MVEA 2NZ9A 3TN93 2WKKA 4N8MA 4P9JA 5LBFA 1GOFA 4YWAA 4NAMA 4L0PA 1DGLA 5FMOS 1E5SA 3UNPA 1AR92 1S4CA 2ORXA 2GC3A 3CO2A 4AHWA 1R081 3BUCA 4NIAA 3Q8FA 4ZZ8A 1NE6A 1POV0 5FZOB 2XWBB 3M7AA 2HWF1 2GNMA 1JW6A 1OA3A 4BK4A 3I97A 5BNPA 3D6EA 3SH4A 2Q4SA 1UCXA 1KXGA 4LK7A 4K20A 2ENRA 4AFAA 5A3PA 5J96B 1NG0A 2C9KA 4I2OA 3E6CC 2I74A 5EV7A 3T2TA 1EPZA 5EQUA 4CCMA 1KS5A 5KBFA 2P37A 3OPWA 4Q4X2 4UFLA 3RGBA 1PMJX 2XJPA 3JZVA 2IFRA 3OGJA 3OUJA 3SLIA 2RS13 3FHIB 4IESA 1AL22 2XJVA 4E8CA 4RA0A 4DY5A 2CAVA 3KV9A 4A41A 1C1LA 2VMCA 3CEWA 3KF5A 2BZDA 4LE4A 2BVVA 1VBE3 4H7MA 4YSFA 3AMQA 4HG6B 1AR82 4AEDA 2EXIA 2XKOA 5DUWA 2IXLA 2WNUC 5LA2A 4UYBA 1WCSA 4XIOA 4AI1A 4QM9A 2LS6A 3CIHA 3OY8A 2JDKA 2YC2A 1NLSA 3PVBB 4XE9A 2RDQA 3NKTA 1AJOA 1RUG3 2JWPA 4IGQA 4QKFA 3WQ0A 4WM8A 1RXGA 5IAXA 1VAVA 1LR5A 1R1ZA 2QDNA 3EBRA 1QXPA 4JV4A 1F2NA 4NPLA 4RN5A 3BPZA 3LA7A 3NNMA 1AR81 3KD4A 3QOPA 5APAA 1YQ6A 4CDUB 2RG4A 1NXMA 3LGRA 2CGNA 1ND2B 2HWB1 4L9BA 5F39A 5CG9A 1QKQA 3ZKYA 5F8PA 2QQKA 5KC5A 1EYBA 4XFBA 3WINE 1G7YA 1U12A 2WYSA 3RYRA 4OHWA 2VTXJ 4YVSA 4GMP1 3SH3A 5ISLA 2JB8A 2ETEA 3NV1A 3LOIA 3C7HA 4QHBA 4Z2AA 2CDOA 3MUY1 4OHYA 1BZWA 5LEJA 1V0AA 3ZKUA 2NYYA 3I49A 2JB4A 5JOZA 1QH6A 4YM3A 4HMZA 4LKDA 4A44A 1X36A 3CF6E 3JXSA 2ZHKA 1S0JA 3N7LA 3QLQA 1AUYA 3CZUA 4W6XA 5JMCA 3C7OA 2F4PA 2R0FA 4UOJA 5GJ6A 3T0BA 5C71A 4EQVA 1HV0A 3LEMA 4HOOA 2PFWA 5FY1A 4OZOA 3ZXGA 1TQ5A 2YFUA 3VN4A 2X5IA 4MYEA 1W28A 1TE1B 4Q0QA 2C4XA 1W04A 1SLLA 2Y6HA 1ALYA 5C3RA 2UU8A 4Q0SA 5J36A 2Y34A 4YZ1A 3WG4A 1G9CA 1HXS1 1KRIA 3AKQA 5FZKA 1GBGA 1SCSA 5JCTA 2BEOA 1BJQA 3BU7A 2GN7A 1RHI3 3WNNA 1DG6A 1AR72 4AGGA 4COWA 1YLLA 3NMBA 2G9FA 3KCCA 1TMF2 2PAEA 3VKOA 2DVGA 1A78A 4S2GA 1DGWX 1HV1A 3EYPA 4R4ZA 1V9U3 2ZXQA 3C8XA 4W6WA 4HSJA 4CEYB 3VHRA 5JZGB 4W65A 4PBOA 2DTWA 4DZGA 1EUTA 1US3A 2BWAA 1LEDA 2Z4FA 4LNVA 3WD5A 1JUIA 4CDWC 1AR71 1AYN3 3N9NA 5KHKA 1QOTA 2XVGA 1TMF1 2B42B 2YU1A 2UWAA 4Q29A 4KG8A 4DPNA 5FY7A 1QJU2 5FOBB 1OF3A 1MQTC 4CDWA 3AB0A 2QNKA 1YXWA 3OGRA 4KBBA 5G05L 5FYIA 4BCUA 2ET1A 4JGYB 3WDUA 2JDAA 1PK6B 4IE6A 4UW5A 2UWCA 3LD8A 5FYSA 4X8PA 4MGQA 2Q8EA 5GLVA 2B45X 5FAXA 3TB0A 2IFWA 3E5QA 2ARAA 4QPWA 1JU4A 5IFPA 1W8OA 1QJU1 4ISRA 3BN6A 1KD7A 1GQGA 1OUXA 2IXHA 2DVBA 3K48A 1IPSA 4KGGA 1W06A 4NMIA 1XC6A 4YM2A 2FDKA 1LB2A 5IK8A 3SCGA 4JC1A 1Z0HA 2IZWA 3THDA 2W92A 4AFMA 3AZYA 2OA2A 4GKYA 5DABA 3M3CA 1QF3A 1CR7A 2H0BA 3VBHB 4E2QA 5FR3A 3PL0A 2WO1A 4V2WA 3WZ1A 3ZM8A 4F7ZA 1FXZA 1ND3B 4IQPA 2TEPA 4NHMA 4JKKA 5BNNB 1S0GA 2ZGPA 4XJWA 2VL4A 4FFFA 2Y6JA 5FUNA 5D1IA 1E57A 2HEWF 1F35A 3MW3A 5FUIA 2CV6A 1JTZX 2VD7A 1OA2A 3AKRA 2OQ6A 1LOGA 2WLPA 3KLSA 1IKQA 4Y4RA 4Z92B 2XJTA 1JYIA 2DVFA 3NJXA 4M01A 3WCRA 4KQ7A 1JYCA 4M3CA 3WT3A 1WLWA 1K5MA 3ETQA 5C9AA 3S0MA 2AR6A 1UD1A 1ZBE3 2F4LA 2XXZA 4I0AA 1ULGA 2C5DA 4DRVA 1EV12 3NNFA 5FBJA 3IZOA 4M00A 2HJIA 2ZACA 1UXXX 2BGCA 3IBMA 3KMHA 1OH4A 2ZX2A 3GCWA 3FFZA 3KT4A 1RUH2 2RS33 4HN0A 1DQ1A 5FPBA 3FLRA 2RMU2 2BJSA 5JSPA 3TWIA 4XF9A 2JG9C 3VBRB 4O7XA 3DPRA 2ATFA 4AQ6A 1EV11 3WP6A 3MEPA 2JKBA 1SDWA 4E4SA 1REEA 1IHMA 1IPKA 2Z5WA 4HL0A 2EXHA 4JX0A 1R092 3HNBM 4AQSA 5C5TA 2VGDA 1DF0A 4MADA 2JG9A 3VZMA 4ES8A 2VTFA 1GZWB 2RMU1 3DYPA 4UWDA 1OQ1A 5EJ3A 1VRBA 3ZXLA 4XEZA 4CCLA 2I07B 5GZCA 2Q1MA 3NW4A 2YB7A 3PNAA 3IDCB 1TME1 2ZAAA 3GNEA 1R091 3AC0A 4M3CE 4E9KA 2W95A 4JHTA 1LU1A 4LE3A 4Y1UA 1F4AA 4UBGA 1ASJ3 4YG3A 5JWPA 1LGBA 4N9IA 2BERA 4CDXB 2EAAA 5I8YA 2D5HA 2RJ2A 1PGW2 3ZYJB 3EQEA 1UY3A 2W1UA 2XLFA 3HPNA 3UKTA 2O1QA 4QQPA 3TNQA 4NROA 2WO2A 3POJA 5K4LA 4NIIA 3L9JT 4RR3A 1YFYA 3H8OA 3DV8A 5FBZA 2VW1A 4D7SA 5DUVA 2ZEYA 3LOBA 3VZJA 3HVDA 1WCDJ 1XPWA 2B39A 4MZUA 4QDSA 4M4PA 4NVPA 5B4XA 5LY2A 3SEEA 4EWAA 5J09A 3H9AA 5J7MA 1QMJA 2ZGOA 4LOTA 5HCFA 2GP5A 1BKZA 1NCQA 2UYAA 4QB1A 4AVSA 1UU4A 2RR13 2E53A 2ADEA 3Q8CA 2BUKA 3LPFA 3RZLA 2WWSA 3D8CA 5FPUA 4R9BA 2H6CA 4P08A 3UV9A 2Q8OA 1NX9A 2OPWA 4LXLA 1J59A 2VG9A 1VB4A 4ARXA 2HYKA 1QNWA 1Y3TA 2R062 2E7QA 1W6QB 3A4UA 1UOFA 4ZXEA 1V6KA 5K0UC 5FP3A 4DQAA 4OZXA 3ZYIB 1SBDA 2FMDA 4QPGB 4OVEA 5A7OA 1K42A 3I54A 5BNOA 1S0BA 3S7EA 1W9TA 3J9SA 5JOXA 4CCKA 1ZZ6A 4GWMA 1CAXB 5K0UA 3VUOA 1QJX2 3U78A 5D8AC 1ZVFA 4B1MA 5C6CA 2R061 3O1SA 2ZPXA 3AP6A 1O5UA 3SMHA 4FI9A 2V5YA 4OHZA 1UMIA 3H7YA 4N43C 5IUQA 2V09A 4AI8A 1UX6A 2XJRA 2BTVC 1CAVB 4ATEA 1NCRC 1X9PA 3WUDA 4CTEA 4R52A 1QJX1 4BK5A 5C4WB 4N43A 5FXWA 1DYOA 2DBNA 1XNDA 3UESA 4YZ5A 3LFMA 1C4RA 5FIXA 4ASLA 2B4KA 5LRSA 2R1DA 3GGLA 2WN3A 3OBAA 3ZN5A 5ACA2 1NLQA 1C5IA 4AI0A 5F9TA 1K45A 1ULOA 2ZX1A 2GDFA 3Q8AA 4N90A 4OHXA 5SV5A 3POGA 3RNSA 1BXHA 2AH2A 1DGRA 5EIYB 2OVUA 2AZ5A 1JODA 3GYDA 4IV3C 4QKBA 1AHSA 5GLTA 4HVQA 3ZFEC 2VW0A 1WKYA 2OS2A 3CBNA 5ACA1 2ZOEB 2XJSA 3AVRA 3ZN6A 4DIQA 3JQWA 2GMEA 3U07A 4HBNA 4IV3A 2XUMA 4Z82A 4AHYA 2IWGB 3VBFC 1RXFA 3UKNA 2WL1A 2X53S 4W4ZA 4U36A 1HJFA 3RRDA 1GP4A 1SFNA 2VNGA 2D7FA 3T2QA 3JCIA 4QX3A 5CKMA 3WSOA 1CX4A 3MV01 2Y33A 3VBFA 4GKXA 1BEV1 2GU9A 1XNBA 1H0BA 4D3WA 5BXXA 2CAUA 1LHVA 1KITA 3USUB 2JEMA 3FUOA 1VMFA 4MOAA 1UWWA 2DCKA 4LBKA 5CFDC 3LA3A 4CXWA 3ABZA 4R9DA 5LBCA 3HBKA 3PUSA 3VGIA 5CFCA 1D2QA 3KWVA 1C28A 4A45A 4CU9A 1VBA3 4UXAA 4CEWC 1U0AA 1GICA 2BVBA 4IV1C 4SLIA 1PO22 3EMRA 5JIAA 5C5UA 1W6OA 3WW3A 2PHDA 2VE1A 3DUIA 3ZMOA 5A32B 3NNGA 2C1FA 4IV1A 1FAYA 3HQUA 5F6KA 2XQRA 1LKNA 1D4M2 3NNLA 4UI9L 4LA3A 3WNKA 1PO21 1R1A3 4DXTA 1YFXA 3RYPA 4LO7A 1E5RA 1O91A 3O1RA 5EYXA 5DDJ3 5IW0A 3ZFFC 3DYOA 3JBG3 1ENQA 1F4HA 1H30A 1G6NA 2XOMA 3POBA 4FOWA 1C5HA 4HPKA 3OG2A 5C8CC 2BNMA 4GH4B 1GWKA 4Q4W3 4HKWA 1D4M1 4RS5A 1VE0A 2CSGA 1DQ6A 3D4KA 5A6QA 3AZXA 1W2UA 2ZZJA 3FLPA 1IOAA 5C8CA 1TVGA 2AACA 1WD3A 5FCCA 1H8TA 3MZHA 4COYA 3LDBA 4ZS3A 3OGSA 1J58A 2V4AA 3M1HA 4CP9B 1RIRA 3TEWA 4IEWA 1XBFA 4MXVA 2VMEA 1YFUA 1N3OA 4Q0UA 5CIRA 3FHAA 2YROA 3I3DA 4AVTA 1I9RA 1FPN2 4URTA 2CWMA 3T09A 2WSUA 4XDPA 3PMSA 1UPIA 2WA4A 4QMAA 1MS8A 1YEWA 5KWRA 1XE0A 2W1WA 2G4IA 3AX4A 2XG3A 5C7GA 1XNAA 4FVVA 4P5HA 1O3SA 4CDQC 5CADA 5K8SA 4Q4Y3 4ZU4A 4NIHA 2DCZA 2RM22 4Z07A 4RL7A 3T3YA 1FPN1 1ZZ7A 1JS9A 1X7NA 4O61A 4XXPA 1QJY2 3CJIA 2X10A 4CSWA 3POFA 4E2SA 5ABJC 4MH0E 3ZYBA 1CD3G 1ZA4A 1A3KA 2ZGKA 4LORA 5GKAC 2WNUB 1EY2A 4PI0A 4FFIA 1DU3D 3LA2A 4M3CF 5L36A 4FAHA 2BYVE 1S2BA 2RM21 1VAMA 2GNBA 3H1YA 4HANA 5SV8A 1R083 1VPHA 1JXNA 2QVSB 1QJY1 3DGTA 4GJZA 3H8RA 3DN7A 4KGQA 1YIFA 1YUDA 4JTOA 5J1XA 4A42A 2G9GA 4KU8A 1LULA 1IS5A 4OMDA 1PGL2 2PXJA 2R0HA 4K21A 4OUMA 1AR93 2PHLA 3MO4A 4XURA 2E51A 2VNOA 1ULCA 5AFEA 1UY1A 3VKLA 2HYXA 4WVVA 3ZDSA 2NM1A 2VH9A 3VHNA 3U4SA 1COV1 3B93A 2VMGA 4AVCA 2TUNA 5AVAA 1PGL1 1XE7A 3MPBA 1AXYA 2VY0A 2WABA 4XFHA 3RDIA 4B1LA 2GMPA 4XMIA 3OUIA 4Q4X3 3WQ7A 2JG8A 3D3AA 3CHXA 2D40A 3H7JA 4XAEA 5KHHA 5AC92 5F1RA 1QY4A 3UETA 1AL23 1OUSA 3GCXA 3RWNA 3O1OA 2J1TA 4XDOA 2RJLA 5FYMA 4ASKA 2JKXA 1YFWA 2V5DA 5I0DA 1AR83 1LOCA 4XF4A 3JUUA 1GU3A 1Q8OA 2CNAA 4CRQA 3VZOA 1QNYA 3R05A 4NPMA 2AUYA 4IEXA 5AC91 2B9UA 1MZFA 3O0WA 1OFNA 3J7MA 3PURA 3LDKA 5IVVA 3B94A 4GMP3 1QJFA 1SLAA 5G04L 2EF6A 3M2MA 3LF7A 4H3WA 3BI3A 3ZDVA 4CUAA 3CJXA 2WA3A 3FWEA 5LASA 1UYXA 1DZTA 1HB3A 2IXCA 4QAWA 3T1LA 5IK4A 3K2OA 1OMIA 2FQPA 2VAUA 1NAEA 2JDZA 1HQWA 3I4IA 2GNTA 2CL2A 1J1TA 1K3IA 2R073 2QQOA 4WM7A 4AAPA 1PGSA 1MQTB 4JGZC 3BOWA 3K3OA 3NV2A 3DECA 3PIGA 5FLIA 4TTGA 5FYHA 4BOWA 4CYDA 4CXXA 5IVYA 3AP7A 2BDRA 3K4AA 2UY8A 2WNVC 4HETA 3MYXA 1XXNA 4JGZA 4LHLA 3TOJA 1SHWB 4QPIA 3VBOC 1HB1A 5KC6A 1SACA 1LOFA 3S6PA 3PUQA 4RQPC 1IG0A 2P3JA 2W1SA 4E4DX 2F6BA 3VBUA 3I59B 3GDBA 5BUVA 1CPMA 3PTYA 5DUUA 1O4ZA 2JE7A 3ACGA 1PZ9A 2A6WA 1XYNA 2Q1ZB 2QQIA 3N7JA 5DAVA 5DZEA 4ATFA 5M0TA 2JJ6A 4P14A 1PIV3 2BOJA 1LHUA 1QOOA 2XJUA 4JDOA 1ULEA 3WDYA 3I8TA 2YU2A 2MEV2 4QQ2A 3UYJA 3Q8EA 4NN0A 4QDRA 4HK8A 1HQLA 3ZFGC 1AR73 3V0AA 1X50A 4NHLA 5L9VA 2WS92 1RUJ2 4FCAA 4LKFA 3U4XA 5FZAA 1RGSA 4YYOA 1FT9A 2VZOA 4PIZA 4Y5Z0 1ZNPA 4M3CB 4ZPIA 4FPKA 3KSCA 1UKGA 2K0GA 2MEV1 5EP9A 3RZJA 5F3GA 1UPSA 1BLZA 4XJ8A 3W5NA 1SLTA 1YYNA 4LEJA 4D6SA 2A71A 4LIVA 4J1WA 4X8NA 2Q8CA 3POIA 3WQ1A 4YW2A 5IVCA 1O6UA 4RD7A 4Y5SA 3R6SA 1NZIA 4EN7B 5A6XA 4QX0A 5FYCA 4A7KA 2DWRA 4XMAA 2UY9A 2DURA 4COVA 1W90A 3POSA 1O3TA 3AMNA 3WF0A 1WA6X 3UJQA 2R49A 3LSEA 4UW4A 4I3PA 2ERFA 2BV4A 2WFPA 4N7UA 4LBJA 5F7UA 3PHMA 3BVCA 5FXZA 1UZ0A 2HH9A 3PU8A 4LQRA 1LAJA 4ARYA 1PVC3 3K77A 1E5HA 1VAKA 2JG9B 2YGLA 3EB7A 4LLFA 4YG6A 1VBD2 4U2AA 4Q0PA 4GIQA 5GALA 2D6OX 2QQMA 3VDDC 2OPKA 4BXSV 2XONA 3AYAA 4ZY9A 4BPZA 4EN9B 3AFKA 2A3YA 3TEYA 1RUOA 1AF9A 1UW8A 2KM2A 2FD8A 4CUBA 5FZ7A 3VDDA 1KS4A 2HWF2 1UYYA 2AREA 3FE5A 3FX3A 1VBD1 3WP4A 5I8TA 4GWNA 4BM8A 1H9PA 3H3ZA 1H8VA 5HV4A 4LR4A 2QUOA 2PHWA 4CP2A 1O7FA 3CL1A 5BNPC 2GN3A 1V6LA 1QGLA 2PMWB 1JHJA 1AR63 2VOKA 2VQ0A 1OH3A 1O4TA 2WINB 4UFKA 3ON7A 3SXWA 1R64A 5IHRA 2JX9A 4ITCA 1F5JA 1Y9QA 4JRAA 2DU0A 3M8LA 3I2KA 4K8FA 2ZAHA 3WW2A 4DXZA 2SBAA 5IFTA 2BNOA 5FMOL 4FO9A 1K12A 1EV13 4PQ9A 1ZM1A 2OT7A 4EN0A 4K3UA 3L2YA 2VMFA 2HWC2 4AEDC 1W9WA 2B5HA 4LBOA 5I93A 5JSRA 3PUHA 1RUH3 3NNJA 1F5FA 5D21A 3JQXA 2LROA 2RMU3 4LBQB 3K75B 1JHNA 3AXEA 4TN7A 4XXAA 2O8OA 2VVDA 2VZQA 3H1MA 2VOVA 4H55A 4EJRA 4WM8C 2WUHA 2CDPA 2HWB2 4TWTA 5LBEA 2ZGLA 5CVRA 1R093 4LOSA 4EZ4A 5L73A 1YQ2A 2HWC1 2VOXA 1RUI2 5IVEA 3MF9A 3KB5A 3WF4A 2PLV1 2JDUA 2VBPA 4ZU7A 1JOBA 5DAQA 3ZYHA 3AFGA 3I2IA 4Q1PA 5JOYA 4XFIA 1AYM1 2R30A 5JXJA 1IS6A 5LY1A 3B3QE 4YVSC 5D8AB 2BP6A 1Q8QA 3UKVA 2Q0AA 4K8RB 5IWFA 5CEHA 1RUI1 2FZ1A 1BVP1 1W6NB 3LB9A 4N43B 1OKOA 4C0BA 2WLQA 2ZGUA 5GM0A 1PNFA 3D82A 2IXIA 1NCRB 1QHDA 4UFIA 3NV3A 2GP3A 2LW8A 3CZJA 4Y1ZA 2WZPP 4CA9A 5C3QA 3WNLA 3TRSB 4W6YA 4GB32 4XJZA 1RJ7A 5FY5A 3URFA 2X5IC 5JAXA 3ECQA 5GZFA 2YFZA 1ZZBA 1X82A 1HXS2 1ZRIA 3BTAA 3WW4A 1JZ7A 4DY3A 5CU1A 3KHBA 1F9KA 4NRMA 4Q4V3 5KHIA 1V6IA 2PA7A 5DAWA 3ACFA 3ROUA 3O14A 4Y22A 4QXBA 3ZN6B 2FBEA 4FTEA 1JBCA 4GB31 1O8PA 4IV3B 4LHNA 4UF0A 5I8SA 2ARXA 3ZFEB 1LJ7A 4D6QA 1GKBA 4C0HA 1S0CA 1CGPA 2W0XA 2R063 4N9HA 1B35C 3VBFB 4S2DA 4BQ1A 4D7YA 3G7DA 2VC9A 3UGGA 5FZ3A 5HXVA 4OQ8A 5A3MA 3NAPA 4MXWA 4Y20A 1B35A 1H2LA 4H2AA 2ZGMA 4FT8A 4IERA 4KWKA 1QJX3 2PAKA 5C9AC 1MS4A 3H8UA 2PQQA 4B3NA 3MIEA 4XETA 5CFDB 1W8UA 5A33A 2HWD2 3NWKA 4LUMA 5LB6A 2C26A 2VZ3A 3NQHA 4G3YC 3VKNA 3KT1A 1DP0A 2WFF1 4CEWB 3HJRA 2C9AA 4YW5A 4ZS2A 5FZ9A 1PM7A 3JB4C 1ACCA 4NPRA 1WWYA 2NPIA 2QCSB 4IV1B 1VMJA 2A3XA 2ET7A 2DUOA 1O8SA 5FOJB 5FZIA 4YVWC 3VHPA 4E8DA 1KFXL 1OQDA 2PYTA 4GQ7A 2HWD1 1GANA 3I3BA 2D6LX 5K9YA 4LKSA 2C24A 4HPKB 2A7AA 2YUEA 4Q27A 4A3ZA 4YVWA 4DXRA 5ACA3 3AZZA 1UAIA 2AC1A 2DCYA 4BU2A 3IWZA 4C90A 2PN5A 1OHFA 5EWSA 1YJKA 4NR1A 3VD5A 5FO9B 3MLKA 3ZFFB 1VBC3 4AXOA 1JZ3A 5J37A 3KM5A 4AEMA 3C3VA 1TG7A 3Q8BA 2JICA 1MEC2 3P1IA 4FPEA 5FYUA 4DNYA 2O14A 5C8CB 3AYCA 3M3EA 3LEKA 4AI2A 1JI6A 4AAXA 1DQ0A 1X9TA 3AKPA 3ZYPA 2RDNA 3TYJA 3NJYA 3WF3A 3B5LB 1TZOA 4ASMB 3U11A 2ZZQA 2XHNA 2AGSA 1MEC1 3IN9A 1LHWA 1OBNA 2GNDA 5A7PA 3RJRA 3VB9A 1WMXA 2VBBA 1J83A 2XKPA 3OBRA 4L97A 4XFAA 5H9RA 3VBSC 1SPPA 4QX2A 2Z79A 4WBBA 3RI8A 4BYYA 2EA7A 1K5MC 1KEXA 2CU5A 2LUWA 3KF3A 5CKQA 1CIWA 3VL9A 4XHBA 3VBSA 3ZSLA 4XQDA 5FRAA 2LALA 1OD5A 1SBEA 4YGEA 1W3VA 4QKDA 3TN92 4CDQB 3THCA 3RZHA 1ZRCA 2E32A 4JKLA 5A3OA 4F3JA 5JPMB 3ZO0B 2W3JA 3MF6A 4LTAA 3ZN4A 1SEFA 2YC4A 3B00A 4MLOA 4XW3A 1YQCA 2Y0IA 3DPRC 5ABJB 5JIUA 4JVAA 5JR2A 4CCJA 1N1TA 1D4M3 1FNYA 4FPCA 5FQ0A 5I0RA 3TN91 4E4ZA 4LBLA 3ZOIA 4QX8A 4RFRB 2DUPA 1ZRDA 4AGRA 5J98B 3VDBA 1GOGA 1KQRA 4LHSA 4BQ5A 4XUQA 5D2AA 4A7YA 1TME2 2WBKA 3NVCA 4CVUA 4DS0A 5JMOA 5H9QA 1WBFA 4DOUA 4LK6A 4WV8A 2HEVF 2RVAA 5BPXA 1HQNA 2VZPA 2VZRA 3ZR6A 1DLLA 3S57A 3H3LA 3N7MA 1Q8PA 5L7OA 1H1MA 2GC0A 2QDRA 3PLQA 2D3PA 4HLTA 4DINB 1YNAA 2VMDA 1CAWB 5CNAA 4HSLA 5FY8A 2J1EA 5ANQA 4LUKA 1M06G 3RQ0A 1ZX5A 5L9BA 1APNA 3N9MA 3P3NA 3WNMA 4RR3C 3PVOA 3IT8A 4BHPA 2VUCA 3KV4A 5DZFA 3IPVB 1FPN3 1OLQA 1ULFA 3QACA 5FPVA 2HEYF 5FYYA 4K7JA 5CG8A 2B7YA 2RS11 1ZBA3 1OA4A 1P8JA 1UOGA 1SMVA 4GMP0 3W20A 1W03A 2V4VA 4IEZA 3U0ZA 1F15A 2JE9A 3AZWA 4YARA 2VCMA 3QCWA 1D2SA 3ITQA 1NCQC 1ST8A 3JU9A 4QX1A 4Y33A 3V0BB 2RM23 1D0GA 2A75A 1IS3A 4IW3A 5HXMA 3HEIA 3A0NA 3AYEA 1TEIA 3L2HA 5KHGA 4FPFA 5HCHA 3RSJA 1RUG1 1S0EA 4P9YA 2A1XA 3WP3A 2QKDA 3OTFA 3S30A 1Y43B 4DFSA 2P5BA 3R4UA 2YY1A 1G9FA 4XACA 5T5LA 2CY6A 3NJVA 2BU9A 4EWEA 4CU6A 2BFUS 4XAAA 2LTNA 3CDZB 4JQRA 3JD72 5A7SA 5FZOA 4BQWA 5E8AA 5BNOC 2FDIA 4WZFA 2PHXA 4Y26A 2J1SA 4YPJA 2EALA 4FSJA 2D3SA 2ZMNA 1IZ3A 3AKSA 1NKGA 3T2OA 1C8M2 1RUF2 2D6MA 3HIFA 3WLUA 1J1LA 2W9XA 3IKWA 5FPLA 1WBLA 2O0OA 1GZTA 4XFFA 5KXCA 4OHVA 4J1XA 1HN0A 2ZMLA 5BY5A 2WN2A 3ILNA 1N47A 2J22A 3R0RA 3JD71 1FOD2 4AHZA 2KD7A 1MS1A 3J26N 4MGSA 1W0PA 1C8M1 1RUF1 2Z42A 2QZ2A 4P9XA 3ACLA 2BGPA 2WDBA 1G86A 5F3IA 4Y1XA 5DAXA 3D0SA 2QQNA 2A6ZA 1IGOA 1VBB2 5ERLA 3K3NA 4RSUA 3UT0A 3P6BA 2WNVB 3USSA 5JVVA 3N9OA 1HRV3 3RZZA 3GBFA 3KV5A 3VBOB 1W99A 1FOD1 2RV9A 3R4DB 4AHXA 4MGZE 3SHRA 4RQPB 2VZUA 4EN8B 1TNFA 3O1MA 4Q1RA 3ZSJA 3NSTA 1TNRA 5AC93 3PU3A 2QQWA 4FOVA 4HKOA 1RHI1 1UN1A 1JU3A 1VBB1 2ZEZA 3DKWA 3RS6A 3TAYA 2KA3A 4KH9A 3LAGA 3WG3A 4CZSA 1DGWA 2GH8A 5IVJA 3T0DA 4LT5A 4L8QA 4DXSA 1ND2A 1YC61 4G4FA 2TBVA 4GWJA 3CKHA 3OYWA 2HWE2 3RI9A 1GLHA 1OOPC 4AFDA 2FZ2A 1Z7S3 1BEV2 2YBPA 3ZFGB 1ULPA 2D6NA 2J1RA 4OI0A 1V6JA 1J3RA 4PDWC 4GULA 4X6QB 5JXIA 1OLRA 4HK9A 1O4YA 1EUUA 1OOPA 1FV3A 4KWUA 3WDXA 2EIEA 3SKJE 2HWE1 4PDWA 4DB5A 4KI5M 4QX7A 1T2XA 4HVOA 1CZTA 3KGZA 2J1VA 4META 2YXSA 4NO4A 4PLNA 5CFCC 3TBDA 5DMYA 3FHQA 4WVMB 1Q43A 1UY0A 2OUHA 3OOXA 2ZHLA 1UQXA 3WY6A 1C3HA 2G1MA 4CUCA 2X8KA 1W8WA 1E5IA 1NQJA 4RYDA 3K51A 3O12A 3IAPA 4CU8A 2J1AA 2OYZA 4FAGA 4AG4A 3QH6A 5FMCA 4P00B 1W0OA 5IYYA 5E89A 2ZABA 3I2FA 4XHXA 3IM0A 2JENA 2EIDA 3OGVA 1US2A 2X09A 3NL1A 3VLBB 4O9EA 4AW7A 1W9FA 3N9PA 1JZ8A 2VBDA 2MHFA 3MIDA 2W68A 3OEAA 1IQDC 1GNHA 4YW6A 1NUKA 2ZMKA 4RS5C 3RJ2X 5JZGA 2DF7A 3AXDA 3THTA 3C7GA 4IETA 3WNXA 2ZS6B 3LPGA 2WZR3 2IVIB 5CZKA 1H8TC 1JZ5A 1VJ2A 5J3UA 3V56A 1CN1A 3W59A 1N1SA 5DUXA 5FXXA 1UY4A 4JGYC 2ZKLA 2VJXA 2RHPA 2WS93 4LLOA 1RUJ3 4RGGA 5LA1A 1LOBA 3OB8A 3I3EA 4XBQA 2D97A 4ZONA 3S5QA 5FP9A 2Q30A 1U5ZA 2RS32 3LE0A 5GLUA 4LIUA 5BNPB 4XCAA 4JGYA 4Y5TA 5JLVA 3O7OA 2YYOA 2VMIA 3ZSMA 4X6RB 4UBHA 3AMPA 3ZIWA 3VD4A 5CISA 1C8NA 1MACA 1YCIA 1S0FA 1PZ8A 2P3YA 3BGAA 4IE0A 1EP0A 4C8DA 2VNRA 2W08A 2GZWA 4AE2A 4BMEA 2RS31 4QB6A 2AENA 1WCUA 4M0NA 4XABA 1RMU2 4AVVA 4OULA 3HN1A 4QGLA 3CJIC 3LEIA 5EPAA 4XTMA 1PM4A 4AEDB 1ND3C 3RG0A 3MIGA 2WR9A 5A3LA 1NT0A 2J1UA 2VZSA 1L7LA 3OJBA 3AJZA 1ASJ2 1QWRA 2VMHA 3OY8B 5FWEA 2WYFA 3J8F2 4N53C 5LW9A 2A6VA 1BBT2 1ND3A 1GR3A 2W2IA 4WM8B 5A7QA 1VBD3 4YFZA 4EV0A 3IDBB 1RMU1 1UOJA 5BNNA 4BQ3A 1JZ6A 1L3JA 3GZTB 2R1BA 5CA6A 4BMBA 1GV9A 3GZAA 4N53A 1JYXA 1MPXA 1DFQA 4NJ4A 3E1F1 3RPQA 2VXRA 2JDPA 1ASJ1 1RUNA 1LEMA 3J8F1 2HWF3 4AK3A 3WG2A 1G9AA 1BBT1 1UX7A 1YHFA 1D4VB 5FZ1A 4QHZA 4YVSB 5T54A 1COV2 1XNCA 4K1ZA 5CKNA 4Z8BA 1VIWB 2QJVA 3B01A 5FZGA 1GYKA 3C7EA 4PHZA 2J42A 4QM8A 4OQ9A 3SC7X 5LWBA 1GZCA 2PTMA 5L19A 2VU9A 5FFOC 1RVF2 2VNVA 2Q8DA 2NMNA 1YWKA 4MUVA 3ZIXA 1RUE2 1J84A 4XUPA 5C70A 1OPOA 1MS9A 1IPJA 3A0KA 5FY0A 4NAOA 2JG8C 2X5IB 4JQTA 4Y22B 1AVBA 3VBRA 2IXKA 3RMYA 2DFCA 1ZYBA 5FYTA 2XVLA 1BQPA 2GH2A 5T5JA 2ZA9A 1POV1 1RVF1 1XB9A 3E97A 4QT6A 2HWC3 1RUE1 4HZFA 2D44A 2W94A 1WMFA 2ZGSA 2BW8A 2BGOA 3AZVA 3M3OA 2Y6KA 3LSDA 4GZ9A 4I30A 2BNNA 5FP4A 2HWB3 4IE5A 4IE7A 4Y20B 1UYPA 4AR2A 3ILRA 1NE4A 2R042 3FUQA 5IATA 1PMIA 1ENXA 5FDBA 4HONA 4CDXA 1YQ5A 3AM2A 1LESA 2B46X 2ZHNA 5GZGA 2DU1A 2EIGA 2NLRA 3KT7A 1S2EA 5BYNA 3T2PA 1OPMA 4EN6B 5KXDA 1WGPA 4QGNA 1PNGA 4FPLA 3SISA 2EICA 1D7PM 3O0VA 2YG0A 1XNTA 4CCCA 1YJLA 4IEPA 5C9AB 3I2JA 4UFJA 4KNCA 4FP2A 4I01A 4NE9A 5K7PA 2R041 5JUVA 4WM7C 1NZCA 4K40A 1DHKB 1RUC2 3VDCA 3ZYFA 4CDWB 4MHRA 2X05A 2K46A 1JUHA 1XJAA 4W50A 1W8NA 3Q9OA 2VUAA 5FO8B 1VR3A 4IGOA 2GMMA 4QPIC 3OBTA 4YVWB 5A3NA 1LOFC 5JPNB 1GNYA 3AK0A 3SQOA 3DEMA 2DDUA 4GB33 5EJZB 4YFWA 1H6XA 1RUC1 3VBUC 4W8JA 2NP0A 3KHCA 3F2ZA 3I2GA 1OVPA 2WZEA 1BK1A 3APBA 1LRHA 1HXS3 1RTVA 3SH5A 4MG2A 5DZGA 5T5PA 1ONAA 1W6QA 5FP8A 2VTXA 4LKEA 1F8VA 1NYWA 5EJ1B 4NHXA 4GJYA 5FXVA 1MZ6A 1YQ8A 2Y60A 1REFA 3DL3A 4FPJA 4E4HA 3AVSA 3H0OA 5F6LB 1KJLA 1S0IA 3KQ4B 1CAXA 1W8FA 4QXHA 2H6BA 2XJQA 3MI8A 5FZFA 3AKTA 4F83A 3FFQA 2DYCA 3J7NA 2Y8KA 2RS52 5DAPA 4COUA 1WW7A 3TEXA 1SPPB 2WQ4A 2XUEA 4MV2A 4OUEA 2DCJA 2BBAA 4YM1A 5FUPA 1RJ8A 1TMF3 2A3WA 1ZRFA 1CVNA 4JTNA 2OX0A 5C4WA 2EAKA 2VULA 3IMNA 3VBSB 1A6CA 1UZYA 1W0NA 4NRPA 3WCSA 1CQ9A 1FMD2 2W5FA 1K5MB 3VD7A 5J48A 2HWD3 3NJZA 5IJRA 2RS51 3WVJA 2W91A 5F3CA 4K6BA 1CZVA 3LKJA 3IIIA 3WDTA 2XLAA 3GHMA 4CP0A 5H9PA 1X33A 5EFUA 4ZU5A 5JI7A 2PHUA 2QZ3A 4FPOB 1QIQA 4IEUA 1QJU3 4UFHA 5TSWA 3WHTA 1FATA 1UIKA 1OSGA 4R9AA 1FMD1 2DBIA 2VR4A 3PUAA 1UMZA 2Y26A 5F2SA 1O3QA 3KQRA 1DDLA 3DPRB 1MZ5A 1UF2C 3W9AA 1SLIA 5DN2A 4MX3A 3WF1A 1HW5A 5FZLA 3UK9A 1GOHA 1BCXA 4BJ0A 4Z2WA 5IVFA 3RZKA 3T4HB 1NY72 2D43A 3GXUA 2ZX4A 4Q4W1 3WV6A 1NLRA 1UNBA 3K46A 3PTRB 4KU7A 3HBZA 3V65A 4JDMA 4YZ2A 1WMEA 1MEC3 2VQAA 2BBVA 2V73A 3E5UA 1N3QA 3HNMA 2FDGA 5JR7B 2OZJA 1QQP2 3PJQA 1G8WA 3LFIA 5IT6A 3GJBA 1NY71 4UW3A 3ZXJA 2VPVA 3RMXA 5F3EA 4S2FA 1DYKA 4FXKB 1W8TA 3ORJA 4XJ9A 5JI9A 2V72A 4XUOA 3S5AA 1LHNA 4AEJA 4AL9A 2PQSA 3PDQA 2VQUA 4RR3B 3DCQA 4FOQA 1QQP1 3H50A 4TLGA 1F31A 4GWIA 4B4RA 3ETPA 2Y6LA 5A32A 4L2NA 5A3UA 3THPA 4A6SA 2C6SA 1WCKA 1WMDA 2XR4A 3BCWA 5E1RA 3ST7A 1N1VA 2XBO2 1DQ4A 1T6BX 4NUBA 2WNOA 3MBWA 1NCQB 4KG0A 3N3HA 3F95A 4D8MA 3OGGA 4YG0A 5LK7B 4PF5A 3VHOA 2FDFA 3PMEA 1MS3A 1RYYA 1PO12 3I3MA 1POQA 3AMMA 1I3HA 1ULDA 1W9SA 4GH4A 2X29A 1VLNA 1C57A 2XBO1 4XJAA 5F32A 1PMHX 5CAZA 2K9ZA 2PLV2 3C2UA 4D94A 2E26A 5FZBA 1L7RA 4YW7A 1AYM2 4LPLA 5C8WA 5JDBA 3HMYA 5FMDA 2XVKA 5T5OA 1PO11 4CP9A 5IVBA 5BNOB 4XIKA 4HKLA 2D6KA 1TME3 1AR91 4P9WA 4JAAA 2ZJCA 3ZLIA 5C33A 4NHKA 5K0UB 2BPA2 2C0ZA 4N7IA 4QDQA 2L9LA 2NQYA 5LBBA 4JDNA 5B2GB 2ZGTA 3M70A 2E33A 1DCSA 3EJKA 3LWCA 3HNYM 3P3PA 4GALA 4BIOA 4EZHA 1VRH2 3O1VA 1W2NA 4QKNA 5IAVA 3WEZA 3M3QA 3MGUA 4R9CA 2LRPA 4LO8A 1UYZA 2QQLA 4IEYA 5ANNA 4HXCA 3O1TA 3ES1A 4I0BA 4XILA 2RJKA 1XYOA 2D98A 1N1YA 1FX5A 1IS4A 5KR7A 5C3OA 2O8QA 4YGDA 5A7WA 4Q4X1 4NIDA 1RITA 1VRH1 4WZCA 2DFBA 1CESA 5EZWA 4D0QA 1AL21 3B9IA 3ZSKA 1VMHA 2WNUA 4O65A 4DUWA 2UWBA 2MPFA 5FP7A 5FY9A 1VP6A 4NWVA 4NIGA 2GAUA 4Q8LA 1LODA 3DXUA 5IK7A 2DV9A 1OXCA 2JD9A 1XYPA 4NRQA 4FTBA 3OYWB 4KWLA 3UL2A 1QEXA 3OEBA 1JYTA 1SLCA 5A3TA 1NA1C 3CLPA 4LULA 1YO8A 1ZA7A 2ZKNA 4DUXA 2ZGRA 3QBQA 4EE2A 5AFBA 5JXHA 3KVBA 4AGVA 1AXKA 4CCNA 4QU2A 1UMHA 4RHV2 2R072 3U1XA 4IDZA 1YIPA 4XYXA 1OOPB 1NA1A 1JOJA 1LNSA 2A6XA 1KDKA 1W6PA 3JD73 3NAPC 1RUD2 4PDWB 4CUGA 3CMGA 2B8MA 1C8M3 1RUF3 2FCTA 3H42B 2RE9A 3GJAA 5C3PA 1MR5A 2WFF2 4D6RA 2CTVA 2I2SA 2XB6C 4RHV1 2R071 4CPBD 4TYSA 1MZEA 5GZDA 1Y4WA 1AL0G 2IC1A 5CFCB 4P02B 1GP6A 1LECA 2KXLA 1UKRA 5A7NA 1RUD1 4I3GA 1W6MA 3MW2A 4XOGA 4AVBA 1FOD3 1JZ2A 4FTSA 3VKMA 2RDRA 1G9BA 4CE8A 1PIV2 1W6OB 2XWJB 1SBFA 2OIIA 3BB6A 2EVXA 1HJGA 3U75A 4Y3OA 5C3SA 1RB8G 4L92A 1PZ7A 5JOWA 3JB8A 1VBB3 2WT0A 3W5MA 5FKBA 3WG1A 3WUCA 4DO0A 2Y0OA 4DEQA 4A6OA 1PIV1 2ILMA 2P4EA 4DEVA 5GLWA 2YV8A 1Q5OA 2F17A 2XGXA 3GZUC 5EHDA 4JHZA 5F5AA 1V6NA 2WAOA 4FXGB 4TZDA 1HN1A 1UZVA 1X8EA 2QFEA 2Y6FA 3PVNA 4AQ2A 4QHOA 4IUGA 3RYKA 3J4UH 3POWA 4BB3A 2FDHA 4RS5B 4XTPA 4FPHA 1UU6A 4C1XA 4QWNA 1CIYA 4TXWA 3RZMA 3MLLA 1H8TB 1Y7BA 1UY2A 3ZYRA 2HWE3 5GZEA 4OI2A 2IUWA 2Q5TA 5I0SA 4MO3M 1BEV3 3ZMNA 2Z2SB 2XLGA 4GXLA 5HI0A 3WX5A 1JZ4A 5FK8A 3ZXEA 1Q3EA 2VW2A 3WQBA 4XBLA 1ZZ8A 5LRRA 3MFCA 5HCAA 1MQTA 2WJSA 4LBQD 5FREA 1AJKA 1VB2A 1PVC2 3N36A 4FFHA 2P2KA 4QXCA 3FLTA 3IB3A 3ZXDA 1QXJA 4I02A 1GFF2 1HB2A 2AEYA 5KXBA 1OC1A 1J3PA 5JXGA 1HRI2 4PLMA 5F37A 3AJYA 1SCRA 4R8HA 1G9DA 1EAH2 1GWMA 3I59A 1STMA 1XOYA 4C1WA 3WDWA 2HLEA 4J25A 1PVC1 3CJIB 1UZWA 2VVEA 3AP4A 1PO23 1OT5A 2YPJA 2A5ZA 1OD3A 4LO4B 1HRI1 1JOPA 1CONA 2EIBA 3GBGA 5F2WA 4N53B 1EAH1 1NXD1 3HQRA 5FPXA 4QGMA 1B09A 1PX3A 1JMUB 1W2TA 1GNZA 3LEGA 4XJUA 3UGHA 1AR62 4HN1A 2OXBA 2ZCWA 1WW5A 4R4XA 4UFMA 4PCRA 5FMBA 3N4MA 3WW1A 3K4ZA 1RINA 3GM8A 1RC6A 4YGBA 5L7OC 4PIYA 1QOSA 2E31A 3BIWE 1AZDA 2VUDA 2JIJA 3UJOA 5FWJA 3KGLA 2ZEWA 1BMV2 2EXJA 1A34A 4CCOA 3M3IA 1AR61 4IEVA 1ZREA 1HLCA 3ALQA 2WAAA 2RS12 1SZBA 4XQ4A 4Q2FA 2E6VA 3MFAA 1ZRRA 2WT1A 3T0AA 4A2UA 5HPOA 3IIAA 4BXFA 4IEOA 2YHJA 1VBE2 3PUIA 5FZEA 1CAUA 1I1EA 3T1MA 1W8ZA 4LJHA 3MDPA 1H6YA 1WUVA 5DXDA 4KBZA 2W39A 5GLZA 1BMV1 5FYVA 3HQXA 3BKZA 3DYMA 1H1IA 2ZHMA 3FL7A 1A8DA 4FQZA 3ZXKA 5LZ6A 2JG8B 3DF0A 4XCBA 3BU0A 5A80A 4CPBA 1QJEA 2DUQA 1RUG2 2RDSA 2VQTA 1RUH1 3B7MA 3NRUA 1IKPA 3V64A 4DUVA 1AX0A 3B02A 4OCTA 4BH9A 1S1AA 4TLFA 4I09A 5IK5A 1WZXA 1ENRA 1RMU3 1REDA 1VBE1 2JXAA 2P1BA 1DGRN 5F5IA 3OPTA 4QXKA 5FJHA 4AFBA 4AWDA 3AYDA 3AP9A 2KR2A 5AVPA 2WRAA 4WVZA 2CGPA 3HN3A 3TEZA 2H0VA 4KL1A 1QJY3 4H7LA 1MVQA 3J8F3 1QH7A 1XQNA 3X29B 2OQ7A 1BBT3 3D5OA 2W47A 2YBSA 3DKQA 4JRLA 5FZ4A 3MIHA 4QB2A 4OI1A 2LM3A 4L99A 5A6YA 2WIIB 1FI2A 3ACIA 3HAGA 3P5BA 4FPGA 2D5FA 3AL6A 3MIFA 4FBFA 2JD4A 3BALA 3EXUA 1ZZCA 4JCKA 2OW4A 4PJYA 4DRRA 1NOVA 1CZSA 1LHOA 3MPPG 5FK7A 1X8MA 1QU0A 3VL8A 2R32A 2VXJA 4F8AA 3T4VA 1PGW1 2DVDA 1BK0A 2W52A 4A4AA 2DCTA 4Q4V2 1COV3 1LGCA 2BOIA 5EXOA 4RFT0 3U37A 4WM7B 2BWCA 2ZGQA 3NO8A 1IG3A 1BYHA 4OLLA 2OKXA 4ZHNA 1UOBA 4ONUA 5KHJA 2BFUL 3EO6A 1POV3 5CB7A 1RVF3 4AVAA 4JGZB 1SDDB 4MSVA 1RUE3 4QPIB 4Q4V1 1MS5A 1WW4A 2VVFA 3J7LA 2XPJA 1H2NA 3OD4A 5L9RA 4LBQA 1RHI2 4FQ4A 3ZPYA 4M4RA 3VBUB 1HDKA 3ZPOA 2E7AA 3IDEA 2VOWA 4XUNA 4XBNA 2ES3A 1V9U2 2NN8A 1AXZA 1BVVA 2IXJA 4JKMA 4CDUC 2WO7A 4YM0A 5FZ6A 1Z78A 1ND2C 1OF4A 4XVHA 4XZUG 1BHGA 2HKXA 2FMYA 3T08A 1L7QA 3WOGA 1OKQA 4YZ3A 1XSRA 4PLOA 1AYN2 1W3XA 2J7MA 4CDUA 3V0AB 1DLCA 1U5IA 3E6DA 3FC0A 2ZX0A 1XE8A 5D8AA 3VD9A 4PT6A 4GD4A 5FZHA 2VCCA 1V9U1 2CHHA 1LTEA 4I0WB 2PAMA 2R043 3O0XA 5LA9A 1W6NA 2YGMA 3FZ3A 2AYHA 2EXKA 2IVJA 4YW3A 2ZBJA 1W05A 1NCRA 2E9QA 1AYN1 1V6OA 3ZXAC 3TNPB 3B9CA 2QTWB 4OYUA 2QQJA 1WCQA 5BNQA 1JYNA 5LEKA 1W39A 1OVSA 2BRTA 2YC0A 2FDJA 2VZVA 3HOBA 4XPVA 1W9YA 3W58A 2A6YA 3I2OA 2WNEA 3ES4A 1DYPA 1VBC2 3A21A 1RUC3 3HT1A 3I7DA 1I5ZA 2JIGA 1XSQA 3VD3A 3IAQA 2P17A 2BQPA 2HBUA 4D69A 3FMGA 2W46A 5T55A 3SCFA 5A3WA 1W2OA 5FYZA 4P9LA 3ZYGA 3SCHA 2QBXA 4KWJA 4BQ2A 4E2GA 4BQXA 3BTXA 3ZFEA 2G19A 1CJDA 2PHTA 1VBC1 1AX1A 3FBYA 5DPNA 2YZ4A 1U5YA 2JDYA 1PVXA 3MIBA 4PQQA 1JYWA 3AMHA 3CQOA 4YGCA 1OI6A 4YLZA 4P9IA 4BQYA 2GC1A 2VM9A 5CYYA 4CEYC 5FZCA 4Q0VA 5JZGC 2D93A 3HWJA 4EYUA 1V00A 4D7TA 5E88A 3VDDB 1UIJA 2HBTA 2VOTA
chains in the Genus database with same CATH topology
3FBMA 1O5LA 1QDOA 2YMZA 4CEYA 1LOEA 3CNAA 5CFDA 3MLJA 3N7KA 4HT1T 1ZBE2 2MEV3 4XF1A 1IQAA 5I0TA 2RS53 1CJPA 1YI9A 4XF0A 1QDCA 3ZVXA 1LGNA 2WC2A 4CEWA 4BIFA 1PK6C 1LCLA 3SITA 1DQ2A 2XL7A 2ZTNA 5LK5A 4YNIA 1FMD3 1PK6A 1V6MA 2JECA 1ZBE1 3GBWA 2GC2A 1ZZ9A 1YI7A 4B7EA 4L11A 4TSVA 4Q8KA 2UURA 3QH7A 4YRDA 4DMIA 4OI4A 2P34A 3VBHC 3ZFFA 3INAA 3KCXA 4HFSA 1LU2A 4MVTA 3GALA 3OPZA 1NQDA 4QQHA 4FPYA 1HX6A 5BNNC 5HBAA 1UL9A 3VBHA 4AFCA 4H14A 1LOAA 5F5QA 1YRZA 3GHNA 4E27A 4BA6A 3N35A 1U5XA 3LZZA 4V1PA 3ZXFA 4XQWA 1DBNA 2CGOA 4ISQA 1HKDA 2R16A 1T6GC 2XL9A 3WDVA 4YZ4A 4BWOA 1ZBA2 2E63A 2D6PA 5H9SA 3ELNA 2I45A 3ATGA 4QD2A 2WQZC 3U10A 2XHKA 1DIWA 3HR9A 1QQP3 5DG1A 4EWDA 3BOPA 3EHKA 4AYUA 3NKGA 4IEQA 4B29A 1ZBA1 1S0DA 4CDQA 4AI3A 1OFSA 2RR12 1DQ5A 1SFYA 1URXA 4MGKE 5T50A 2GALA 4LBMA 1Q56A 5BV6A 2A73B 1KFUL 4A7ZA 3VBRC 4LO6B 4S2HA 3WR0A 5ABJA 3CU7A 2XBO3 5FO7B 1DZRA 2PHRA 3HT2A 2RR11 4K1YA 1WLTA 4AQTA 4K9SA 3OCPA 1PO13 1WLCA 3VKFC 1QJZA 4HVRA 3O5SA 4QQOA 2ARBA 1NA1B 3OF1A 3PVEA 4IXLA 3WP5A 4C91A 1W6PB 1D0HA 4IL7A 1GZWA 2PLV3 3HD8B 5FTTC 2K2SA 3VZLA 5KXEA 1O3RA 4J6GA 1XU1A 3VZNA 1WLDA 1AYM3 1MS0A 3QD6A 3D0JA 5FPZA 1CAWA 4CDXC 1FNZA 3NAPB 4MXWB 4Y1VA 4AEKA 4WVWA 1B35B 4PIXA 1HRV2 1H9WA 1RUI3 1WA4A 3MW4A 4M0HA 4Y1YA 2Y38A 4BLIA 4BE3A 1W6MB 1H2MA 4B4QA 3IPVA 2Z69A 5A33B 4SBVA 5JSOA 1VRH3 1H1AA 1XNKA 1XRUA 4YW4A 1JN2P 3B69A 4PBPA 4B4PA 4XZPA 4BZ4A 2GSYA 3H1WA 1HRV1 2CWSA 2SLIA 3ASIA 3KS7A 4ZXKA 3V0BA 1H4HA 3E5XA 2TNFA 2ZX3A 4QX5A 1H2KA 2CYFA 3WXPA 1Z7S2 4GA9A 5I0UA 4NOTA 5FLHA 4QPYA 3MICA 4MGIE 4Q26A 1UU5A 2QQPA 1M4WA 1GSLA 3G6JB 4O9GA 4ZKTB 4QQLA 4QPGC 1EPWA 4CP1A 4OFGA 3VZKA 1Z7S1 3I2DA 4MGYE 4YW1A 1VALA 4RGAA 4XDQA 4UW6A 1WW6A 4QPGA 1GZ9A 3NV4A 4G9SB 4XFGA 4RHV3 5T52A 2OUJA 3AP5A 3E6BA 1PHMA 3KCYA 1VBA2 2DVAA 1N3PA 1SQ4A 3ME2A 2YDEA 4COZA 1Q8VA 1H4GA 1RUD3 3GF6A 2WSVA 2DTYA 5C4WC 1C1FA 3FJSA 5FLJA 2WT2A 1HIXA 2WFF3 1CAVA 2WNVA 3SNMA 1VBA1 4FOYA 3ZX7A 1J3QA 1ENSA 1WD4A 2UYBA 1R1A2 3VBOA 4A3XA 4RQPA 2N7GA 5DDJ2 1A8MA 3R4SA 4INDA 2A70A 3JBG2 1LENA 4XF3A 2E7TA 4BLJA 2WZR2 3KZ4C 4OUSA 2PHFA 4Y24A 4Q4W2 2QE3A 1GQHA 4P9GA 1KDMA 2D3RA 2P3KA 1R1A1 5FQ0B 1DZQA 3WHUA 5EYYA 5F9TA 5DG2A 4XFCA 5DDJ1 1CPNA 2P3IA 4LA2A 3JBG1 2NMOA 3ZFGA 2WZR1 4ORFA 5T3NA 3LCPA 1QXRA 1JH5A 5HCBA 1OQEA 2XH6A 2WS91 1RUJ1 3M4FA 3H3UA 1I6XA 4LO5B 1V70A 5L7OB 2OZ6A 1FV2A 2VECA 4LBNA 2VUJA 4B7KA 4B8EA 2FHRA 1UZZA 3USUA 3OD0A 4AF9A 1XU2A 1CAUB 5I91A 4WVMA 4Q4Y2 4NWWA 3POYA 1Q8SA 3ENRA 1AX2A 2PELA 3S7IA 2MNGA 4ES9A 1S2KA 2R6QA 4FP3A 2ZGNA 1HRI3 4Q4Y1 1SLBA 4Y4YA 1S55A 3ILFA 3VV1A 1EAH3 3BODA 1FYUA 1R082 1RL3A 4LHKA 3ZSEA 3PJYA 1KJRA 4Z1VA 5E16A 4GH4C 1MVEA 2NZ9A 3TN93 2WKKA 4P9JA 1DGLA 5FMOS 1AR92 2GC3A 3CO2A 4AHWA 1R081 1NE6A 1POV0 2XWBB 3M7AA 2HWF1 2GNMA 1JW6A 1OA3A 5BNPA 3D6EA 3SH4A 2Q4SA 1UCXA 1KXGA 4K20A 2ENRA 4AFAA 5J96B 1NG0A 4I2OA 3E6CC 2I74A 5EV7A 3T2TA 1EPZA 1KS5A 5KBFA 2P37A 4Q4X2 2XJPA 3JZVA 2IFRA 3OGJA 3SLIA 2RS13 3FHIB 4IESA 1AL22 2XJVA 4RA0A 4DY5A 2CAVA 1C1LA 3CEWA 4LE4A 4YSFA 2BVVA 1VBE3 4H7MA 3AMQA 1AR82 4AEDA 2EXIA 2XKOA 5DUWA 2IXLA 2WNUC 4XIOA 1WCSA 4AI1A 4QM9A 3OY8A 1NLSA 3PVBB 4XE9A 3NKTA 3WQ0A 1AJOA 1RUG3 4WM8A 1VAVA 1LR5A 1R1ZA 2QDNA 3EBRA 1QXPA 4JV4A 1F2NA 3BPZA 3LA7A 3QOPA 1AR81 3KD4A 4CDUB 1NXMA 3LGRA 2CGNA 1ND2B 2HWB1 4L9BA 5CG9A 1QKQA 5KC5A 1EYBA 4XFBA 3WINE 1G7YA 1U12A 3RYRA 4OHWA 4YVSA 4GMP1 3SH3A 2ETEA 3NV1A 3LOIA 4QHBA 4OHYA 1BZWA 5LEJA 2NYYA 5JOZA 1QH6A 4YM3A 4HMZA 1X36A 3CF6E 2ZHKA 1S0JA 3N7LA 3QLQA 1AUYA 4W6XA 5JMCA 2F4PA 2R0FA 5GJ6A 1HV0A 2PFWA 3ZXGA 1TQ5A 3VN4A 2X5IA 4MYEA 1TE1B 4Q0QA 1SLLA 1ALYA 2UU8A 4Q0SA 5J36A 4YZ1A 3WG4A 1G9CA 1HXS1 1KRIA 3AKQA 1GBGA 1SCSA 5JCTA 2BEOA 1BJQA 3BU7A 2GN7A 1RHI3 1DG6A 1AR72 4AGGA 4COWA 1YLLA 2G9FA 3KCCA 1TMF2 2PAEA 3VKOA 2DVGA 1A78A 4S2GA 1DGWX 1HV1A 4R4ZA 4W6WA 1V9U3 4CEYB 4HSJA 3VHRA 5JZGB 4W65A 4PBOA 2DTWA 4DZGA 2BWAA 1LEDA 4LNVA 3WD5A 1JUIA 4CDWC 1AR71 1AYN3 5KHKA 1QOTA 2XVGA 1TMF1 2B42B 2UWAA 4Q29A 4KG8A 4DPNA 1QJU2 5FOBB 1MQTC 4CDWA 3AB0A 2QNKA 1YXWA 4KBBA 4BCUA 2ET1A 4JGYB 3WDUA 1PK6B 4UW5A 2UWCA 4X8PA 5GLVA 2B45X 5FAXA 3TB0A 2IFWA 3E5QA 1QJU1 4ISRA 1KD7A 1GQGA 2IXHA 3K48A 2DVBA 4KGGA 4YM2A 1LB2A 5IK8A 3SCGA 4JC1A 1Z0HA 2IZWA 4AFMA 3AZYA 2OA2A 4GKYA 3M3CA 1QF3A 1CR7A 2H0BA 3VBHB 4E2QA 3WZ1A 4F7ZA 1FXZA 1ND3B 4IQPA 2TEPA 4NHMA 5BNNB 1S0GA 2ZGPA 4XJWA 5D1IA 1E57A 2HEWF 3MW3A 2CV6A 1JTZX 1OA2A 3AKRA 1LOGA 2WLPA 3KLSA 1IKQA 4Z92B 2XJTA 2DVFA 4M01A 3WCRA 4KQ7A 1JYCA 4M3CA 3WT3A 1WLWA 1K5MA 3ETQA 3S0MA 2AR6A 1UD1A 1ZBE3 4I0AA 1ULGA 2C5DA 4DRVA 1EV12 4M00A 2HJIA 2ZACA 2BGCA 3IBMA 3KMHA 2ZX2A 3FFZA 3KT4A 1RUH2 2RS33 4HN0A 1DQ1A 3FLRA 2RMU2 5JSPA 3TWIA 4XF9A 2JG9C 3VBRB 3DPRA 2ATFA 4AQ6A 1EV11 3WP6A 3MEPA 2JKBA 1SDWA 4E4SA 1REEA 1IHMA 1IPKA 2Z5WA 4HL0A 2EXHA 4AQSA 1R092 2VGDA 1DF0A 2JG9A 3VZMA 4ES8A 1GZWB 2RMU1 5EJ3A 1OQ1A 3ZXLA 4XEZA 2I07B 5GZCA 2Q1MA 3NW4A 3PNAA 3IDCB 1TME1 2ZAAA 3GNEA 1R091 4M3CE 4E9KA 4EROA 5CBLA 4LE3A 1LU1A 4Y1UA 4UBGA 1ASJ3 4YG3A 1LGBA 4N9IA 5I8YA 4CDXB 2EAAA 2D5HA 1PGW2 3ZYJB 3EQEA 3UKTA 2XLFA 2O1QA 4QQPA 3TNQA 3L9JT 4RR3A 1YFYA 3DV8A 5FBZA 2VW1A 4D7SA 5DUVA 3LOBA 3VZJA 1WCDJ 2B39A 4MZUA 4EWAA 4NVPA 5J7MA 5J09A 3H9AA 1QMJA 2ZGOA 5HCFA 1BKZA 1NCQA 2UYAA 4AVSA 1UU4A 2RR13 2E53A 2BUKA 2WWSA 3D8CA 4R9BA 2H6CA 3UV9A 2Q8OA 1J59A 2VG9A 1VB4A 2HYKA 1QNWA 1Y3TA 2R062 2E7QA 1W6QB 3A4UA 1V6KA 5K0UC 4DQAA 4OZXA 3ZYIB 1SBDA 2FMDA 4QPGB 4OVEA 3I54A 5BNOA 1S0BA 3S7EA 3J9SA 5JOXA 1ZZ6A 4GWMA 1CAXB 5K0UA 3VUOA 1QJX2 5D8AC 1ZVFA 5C6CA 2R061 2ZPXA 3AP6A 1O5UA 3SMHA 2V5YA 4OHZA 3H7YA 4N43C 5IUQA 2V09A 4AI8A 1UX6A 2XJRA 2BTVC 1CAVB 4ATEA 1NCRC 3WUDA 4CTEA 4R52A 1QJX1 5C4WB 4N43A 1XNDA 4YZ5A 4ASLA 1C4RA 5LRSA 2R1DA 3ZN5A 5ACA2 1C5IA 4AI0A 2ZX1A 2GDFA 4N90A 4OHXA 5SV5A 3RNSA 1BXHA 2AH2A 1DGRA 2OVUA 2AZ5A 3GYDA 4IV3C 4HVQA 1AHSA 5GLTA 3ZFEC 2VW0A 5ACA1 2ZOEB 2XJSA 3ZN6A 3JQWA 2GMEA 3U07A 4HBNA 4IV3A 2XUMA 4Z82A 4AHYA 2IWGB 3VBFC 3UKNA 2WL1A 2X53S 4U36A 3RRDA 1SFNA 2VNGA 2D7FA 3JCIA 1CX4A 3VBFA 4GKXA 1BEV1 2GU9A 1XNBA 1H0BA 4D3WA 5BXXA 2CAUA 1LHVA 1KITA 3USUB 2JEMA 3FUOA 2DCKA 4LBKA 5CFDC 3LA3A 4R9DA 3VGIA 5CFCA 1D2QA 4CEWC 1C28A 1VBA3 4UXAA 1U0AA 1GICA 2BVBA 4IV1C 4SLIA 1PO22 5JIAA 1W6OA 3WW3A 2PHDA 3DUIA 3ZMOA 5A32B 2C1FA 4IV1A 1FAYA 5F6KA 1LKNA 1D4M2 4LA3A 1PO21 1R1A3 1YFXA 3RYPA 4LO7A 1O91A 5EYXA 5DDJ3 3ZFFC 3JBG3 1ENQA 1H30A 4HPKA 1G6NA 4FOWA 1C5HA 5C8CC 2BNMA 4GH4B 4Q4W3 4HKWA 1D4M1 4RS5A 1DQ6A 3D4KA 3AZXA 1W2UA 2ZZJA 3FLPA 1IOAA 5C8CA 1WD3A 5FCCA 1H8TA 3MZHA 4COYA 1J58A 3M1HA 1RIRA 4IEWA 4MXVA 1YFUA 1N3OA 4Q0UA 5CIRA 2YROA 4AVTA 1I9RA 1FPN2 4URTA 2CWMA 2WSUA 3PMSA 1UPIA 2WA4A 4QMAA 1MS8A 5KWRA 2G4IA 3AX4A 2XG3A 4FVVA 4P5HA 1O3SA 4CDQC 5CADA 5K8SA 4Q4Y3 4ZU4A 2DCZA 2RM22 4Z07A 4RL7A 1FPN1 1ZZ7A 1X7NA 4XXPA 1QJY2 3CJIA 4E2SA 5ABJC 4MH0E 1CD3G 1ZA4A 1A3KA 2ZGKA 5GKAC 2WNUB 1EY2A 1DU3D 3LA2A 4M3CF 5L36A 4FAHA 2BYVE 1S2BA 2RM21 1VAMA 2GNBA 3H1YA 4HANA 5SV8A 1R083 1JXNA 2QVSB 1QJY1 3DGTA 3DN7A 4KGQA 1YIFA 1YUDA 4JTOA 2G9GA 4KU8A 1LULA 1IS5A 1PGL2 2R0HA 4K21A 4OUMA 1AR93 2PHLA 2E51A 2VNOA 1ULCA 5AFEA 3VKLA 4WVVA 3ZDSA 2NM1A 2VH9A 3VHNA 1COV1 3B93A 2VMGA 4AVCA 2TUNA 5AVAA 1PGL1 1XE7A 3MPBA 1AXYA 2VY0A 4XFHA 3RDIA 2GMPA 4XMIA 4Q4X3 3WQ7A 2JG8A 2D40A 3H7JA 5KHHA 5AC92 5F1RA 1QY4A 1AL23 3RWNA 2RJLA 1YFWA 1AR83 1LOCA 4XF4A 3JUUA 1Q8OA 2CNAA 4CRQA 3VZOA 1QNYA 3R05A 2AUYA 4IEXA 5AC91 2B9UA 1MZFA 3O0WA 1OFNA 3B94A 4GMP3 1SLAA 2EF6A 3M2MA 4H3WA 3CJXA 2WA3A 3FWEA 2IXCA 1DZTA 3T1LA 5IK4A 1OMIA 2FQPA 2JDZA 1HQWA 3I4IA 2CL2A 2GNTA 1J1TA 2R073 5CA6A 4WM7A 1PGSA 1MQTB 4JGZC 3BOWA 5FLIA 3NV2A 4BOWA 4CYDA 3AP7A 2UY8A 2WNVC 4HETA 3MYXA 1XXNA 4JGZA 4LHLA 3TOJA 4QPIA 3VBOC 5KC6A 1SACA 1LOFA 3S6PA 4RQPC 2P3JA 4E4DX 2F6BA