1LOFC

X-ray structure of a biantennary octasaccharide-lectin complex at 2.3 angstroms resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
180
structure length
180
Chain Sequence
TETTSFSITKFGPDQQNLIFQGDGYTTKERLTLTKAVRNTVGRALYSSPIHIWDSKTGNVANFVTSFTFVIDAPNSYNVADGFTFFIAPVDTKPQTGGGYLGVFNSKDYDKTSQTVAVEFDTFYNTAWDPSNGDRHIGIDVNSIKSINTKSWKLQNGKEANVVIAFNAATNVLTVSLTYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LEGUME ISOLECTIN I (ALPHA CHAIN)
publication title X-ray structure of a biantennary octasaccharide-lectin complex refined at 2.3-A resolution.
pubmed rcsb
molecule tags Lectin
total genus 27
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 1993-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1lofC00
2D6KA 4ASMB 2WT0A 1AX2A 1W6MA 1HKDA 4GWNA 1LOEA 4YZ3A 1G7YA 2OW4A 2YMZA 1LULA 2GNBA 1Q8VA 4XHXA 4Y22B 1DFQA 3NV4A 1SBDA 1B09A 3ZSJA 4PBPA 1V6IA 1HLCA 1JBCA 1JHNA 4ZXKA 1H9WA 3AXDA 2P37A 5DG1A 1WCSA 3WDYA 2GMPA 2JDZA 4ISQA 1CESA 1YRZA 2FMDA 4YFWA 1A8DA 2E7QA 5CB7A 4FVVA 5DG2A 2EXKA 1S0EA 2ZHNA 2PELA 1SCRA 2DVFA 3WG2A 2A6ZA 1Q8QA 2D7FA 3V0AA 1MVEA 2OUJA 1NXD1 2ZGPA 4LBMA 2BQPA 3ZSLA 3IKWA 2A3YA 1QDCA 4LBLA 4GA9A 2VY0A 3RS6A 4UW3A 2WJSA 2JE9A 4BMEA 1W6PA 4P9YA 4XBQA 5T52A 3MEPA 3M1HA 4YGDA 3VUOA 1EPWA 1O4YA 1JN2P 3IPVA 1DGLA 2D3RA 1QKQA 4XJ8A 3WHUA 3WCSA 3AX4A 2GNDA 1MZ5A 3ENRA 1IS3A 1PZ7A 1WUVA 4FOYA 4XTMA 1Y7BA 4CTEA 2LTNA 1AVBA 3OY8A 1FV2A 3ZYPA 1C1LA 4XXPA 1AX0A 3N7JA 3SISA 3D6EA 3FUOA 4YW2A 1G9DA 3OJBA 2YROA 2CNAA 3POYA 4FPKA 3B3QE 3WDTA 5E8AA 2A3XA 3IPVB 1GZWB 3N3HA 5H9SA 5H9QA 4YW4A 4FPGA 2CYFA 5IT6A 1HQLA 1YO8A 3MPPG 3AZWA 5GLWA 4FP2A 1RITA 3O0XA 1LOFC 1W6QB 1ENRA 1Q56A 4FPOB 3A4UA 4XBNA 5EWSA 3V64A 4R9AA 1GKBA 1WBFA 2ARXA 2EALA 2ZHLA 5EYYA 2P3JA 2ZZJA 4UW6A 4XXAA 3WCRA 1UZYA 3SNMA 3UK9A 1GV9A 4GXLA 4XJAA 1YYNA 5JOWA 1LHWA 5GZFA 2YZ4A 2A6WA 2ZGUA 3NV3A 5GLTA 4PBOA 1DYKA 1QGLA 4XIKA 3QCWA 5DUVA 1MS9A 2ES3A 2PHUA 5L73A 1DQ2A 5GM0A 1JXNA 2WSVA 2PHTA 1F9KA 2EIGA 4RL7A 3GNEA 2GNTA 2A6YA 2G4IA 3RMYA 1LENA 1WW4A 1JYCA 1UPSA 5T50A 3MW2A 4AGRA 1QNYA 1WBLA 4FOVA 1AXKA 1VAVA 1LEMA 2YY1A 3JU9A 3WVJA 1DYPA 1U0AA 5EYXA 3RRDA 4JRAA 1V6LA 3SH4A 4FPFA 1F31A 4XE9A 1JOJA 4AVSA 1LOGA 4FOQA 1S0DA 1DQ1A 2W68A 4WVWA 5LK5A 4C1XA 2WKKA 4UW4A 2NZ9A 5DZGA 5KXDA 4K20A 4YW1A 3OYWA 3AZYA 3ZXKA 2VW0A 3VKMA 2P34A 2VW1A 2VW2A 4FQZA 4YG0A 2Z42A 2W08A 2UWAA 4M3CB 4LBKA 1Q8SA 3FLPA 5DUXA 2D6PA 2A7AA 3W58A 4YW3A 3D5OA 4KBBA 4XJZA 1OKQA 1XQNA 4AYUA 4Q8KA 1F5FA 1QDOA 3L2YA 1GZ9A 4NOTA 1V6KA 4L8QA 2GN3A 4M00A 2UWBA 3B9CA 4FPLA 5IUQA 1N3QA 3SH5A 1APNA 5H9RA 4HL0A 1LHNA 2ZKNA 3WV6A 4Y20B 1SACA 3RG0A 4Y1XA 4YM3A 3MW3A 3W59A 4Q1PA 4BLJA 4XJUA 1MS3A 2AENA 4F83A 4DRRA 4IQPA 4ATEA 1MS0A 2D6NA 2P2KA 1N47A 2VXRA 4XBLA 1AJKA 3AYDA 2EXHA 4XHBA 2OVUA 3T1MA 2AGSA 4LBOA 5AVAA 2R0HA 3TAYA 3ATGA 4YZ1A 4GWMA 2DVGA 5JVVA 1IKPA 4LBQA 5T5OA 1G9CA 2W52A 2GMMA 1A3KA 3AYAA 1DQ5A 4ZKTB 2CY6A 3ILNA 3N7KA 2WLQA 2ZGLA 2VUAA 3USUA 1LEDA 3R4UA 3SLIA 4YFZA 1W0OA 3AZZA 1LODA 2JD4A 1UL9A 3AFKA 1W6MB 2DV9A 2UU8A 3ASIA 3NWKA 1JUIA 4YGEA 2SLIA 1UN1A 2ZAAA 3LSDA 5JDBA 3AYEA 2H0BA 2NN8A 1SFYA 3NV1A 3IN9A 1DBNA 1G9FA 5GZEA 4BQ1A 1S0CA 4C1WA 3M2MA 2E6VA 4Y1ZA 3ZXLA 4GKXA 3A0KA 3USUB 3N35A 4D69A 3H0OA 3WOGA 4RA0A 1N1SA 3IM0A 1MR5A 1KRIA 3FUQA 3OBTA 3GALA 3BTAA 2ARBA 5JOYA 3V0AB 1V00A 1MS5A 3WNXA 1C57A 2E7TA 2D44A 1WW6A 2ZGTA 3HMYA 2NYYA 3WG4A 3AP5A 1ULGA 1IS5A 2VU9A 4M01A 1CONA 1FNZA 4Y24A 3ILRA 5DUUA 5GALA 3M3EA 3M3OA 2JJ6A 4FP3A 4MYEA 5CA6A 5FRAA 1WD3A 4NO4A 1LGBA 1V6MA 1MS8A 1W6PB 1QOOA 1DQ6A 1DLLA 3VKFC 3AP9A 1QMJA 2ZA9A 3WDVA 5DUWA 1OQ1A 1ULFA 5GZCA 5BYNA 1S0FA 2D3PA 2EXIA 3HR9A 1DHKB 2AR6A 3OY8B 1WW7A 4CZSA 1OFSA 2AH2A 2PHFA 1SLCA 3I4IA 3SH3A 1RINA 4AGGA 3B00A 2ZHKA 1KJRA 1LGNA 4SLIA 4DRVA 1DQ4A 3T1LA 1GNZA 3NV2A 3QLQA 3IMNA 4YM0A 5IK8A 3AZXA 2A70A 2ZABA 1O4ZA 4DS0A 1ENSA 2XG3A 4Y26A 1CJPA 1HQWA 1UZZA 3UJOA 2ZMLA 5T54A 2D6OX 2GNMA 3PMEA 4P9WA 2D3SA 4YGBA 3WLUA 3N7MA 1UMZA 3MW4A 1KDMA 3ZVXA 4YLZA 2CWMA 2EF6A 1WLWA 3KM5A 1LHUA 3DGTA 3V0BA 2R49A 3AP6A 3C2UA 1I3HA 3WUCA 3DUIA 1I1EA 2NMNA 5IK5A 1ENQA 3LSEA 3FLTA 4YZ5A 1BYHA 1FATA 3POSA 3O0VA 1LU1A 1LOFA 2D43A 1AJOA 1VAMA 1VIWB 1YXWA 1LHVA 3AK0A 4FPJA 3ZXEA 4WV8A 2JE7A 4Z8BA 4Q26A 4FPEA 3WDXA 1GICA 3RSJA 4TZDA 1LECA 1W0PA 2A71A 1G9BA 3V0BB 4Q8LA 4LBNA 1Z0HA 1ZM1A 1Q8OA 3T2TA 3O0WA 1LGCA 3BODA 1KQRA 1QOSA 5GLZA 1NLSA 1WW5A 3JUUA 4LBJA 3AYCA 1ONAA 1AF9A 3BOPA 1D0HA 4Q1RA 2NP0A 4Q27A 3R05A 5T5JA 2E51A 4JCKA 3AP4A 1A78A 1D2SA 1BKZA 1CN1A 3O12A 3WUDA 5KXBA 2DTYA 1JW6A 1SLLA 2DTWA 1LOBA 5GLVA 1SBEA 2XB6C 2ZGNA 3WZ1A 5F9TA 1MS1A 3OYWB 3N36A 1IKQA 5T55A 1S0GA 5JOZA 1SBFA 1Z78A 1CR7A 3ZXFA 1W6NA 4P14A 2CWSA 2P3KA 4YGCA 2Q5TA 4XDQA 1V6JA 2I2SA 2NMOA 4YG6A 1GNHA 4BM8A 1S0BA 3UJQA 5KXEA 2PHXA 4R9CA 1LTEA 1LCLA 1YIFA 4PF5A 1LHOA 1LU2A 1N1YA 1S1AA 3AXEA 2UURA 1W6OA 3AZVA 2A6XA 2TEPA 3PJQA 4YW5A 4Y1UA 4ISRA 1FYUA 1SLIA 1IS6A 2E53A 1WLCA 1GZCA 2AYHA 3Q9OA 2NM1A 1MACA 1Q8PA 1BQPA 4FPYA 4R9DA 5CBLA 2D6LX 4BOWA 5SV8A 2DWRA 1G86A 1CPNA 3POWA 5T5LA 1FV3A 3RQ0A 5IK4A 1VLNA 4OZXA 1ULDA 4UW5A 1C4RA 1W6OB 1KITA 2DUQA 1C1FA 1CQ9A 2ZACA 4GKYA 4I30A 1YI7A 3O5SA 1LJ7A 4LBQB 5HCBA 3ZXJA 1N1VA 5GZGA 3OGGA 3PVEA 2W39A 1AXZA 4M3CE 5DZEA 1UAIA 3A0NA 3CNAA 1QNWA 2ENRA 2ERFA 5KXCA 2R1DA 3SITA 3WDWA 1CVNA 2ZGRA 3OBRA 2D6MA 1URXA 2ZMNA 3PVNA 4WZFA 4AWDA 4Q2FA 4U36A 4Y1VA 2CL2A 2B7YA 2R0FA 1MZ6A 2A75A 2R1BA 2DVBA 1GANA 3N7LA 4AVTA 1CIWA 1KDKA 5CAZA 2DVAA 3ZYRA 2HYKA 4FPCA 4TYSA 3WG1A 4K1YA 4LBQD 1RIRA 2V73A 4P9XA 2V5YA 1JYIA 1SLAA 1ULEA 4K21A 2ZMKA 4Y1YA 2DUPA 1V6NA 4XMAA 2EXJA 3M3QA 3ZSKA 4U2AA 1V6OA 5T5PA 4ATFA 1GZWA 1AX1A 2DVDA 1KJLA 3ILFA 2JKBA 5JOXA 4YZ4A 5HCAA 3ZPYA 2AREA 1GYKA 4AGVA 5GLUA 1W6QA 2A6VA 3VKLA 4XYXA 4YM2A 1DQ0A 1S0JA 4PCRA 4BLIA 3KQRA 5JLVA 2VH9A 1H9PA 3PVOA 2FHRA 1UKGA 2WNEA 1FNYA 3APBA 3WG3A 1H30A 1LOCA 1G8WA 4DQAA 2ZGSA 3U4XA 2EAKA 5CNAA 1N3OA 1PZ8A 2YV8A 4W65A 2AUYA 2GALA 4XJWA 4BMBA 1SLBA 2DURA 1FAYA 1PZ9A 4R9BA 4DPNA 3VKNA 4XMIA 1TEIA 2WT2A 3HN1A 3OPZA 2LALA 1FX5A 2KM2A 2DUOA 1DIWA 1GSLA 1MS4A 2PHWA 1BJQA 1WLDA 5E88A 4YG3A 5HCFA 4PQ9A 1X50A 5FREA 3AP7A 4XOGA 2PHRA 1ZA4A 5E89A 3UL2A 1HDKA 1G9AA 4K1ZA 4ITCA 1R1ZA 1CPMA 1S0IA 2GMEA 5GZDA 4XTPA 1LESA 1DZQA 2WSUA 2ZHMA 1LOAA 1WD4A 2JECA 3VKOA 1SLTA 2WT1A 4BPZA 2OUHA 2A5ZA 3FFZA 4GALA 4CRQA 1MVQA 2DU0A 5IK7A 3V65A 2ZGOA 4FPHA 1QF3A 4M3CA 4M3CF 3ZSMA 4XJ9A 1N1TA 3LCPA 3WHTA 3BIWE 5EXOA 1J1TA 2ZGQA 3FBYA 1UX6A 1IS4A 2WQZC 2SBAA 5H9PA 3D4KA 4AVVA 1IOAA 4FQ4A 2ZGKA 2YXSA 4XIOA 1AZDA 2P3IA 3I8TA 4Y20A 3TB0A 2ZGMA 2UWCA 2R16A 3M3CA 5DZFA 3RMXA 1BZWA 2A3WA 4XZPA 4YM1A 1GLHA 4H55A 4YZ2A 2C9AA 1BXHA 2C5DA 1AXYA 3VV1A 1SCSA 2GN7A 1W6NB 2RHPA 1GBGA 5JMCA 5F5QA 2DYCA 4WVVA 3AJZA 5DXDA 4JC1A 4XILA 1N3PA 3B69A 2CTVA 4FOWA 4Y22A 1ULCA 1QOTA 3INAA 3FLRA 4HANA 2GDFA 5GJ6A 4DFSA 3B01A 3WDUA 2ZBJA 1VALA 3R4SA 2DU1A 1QU0A 3AJYA
chains in the Genus database with same CATH superfamily
4AG4A 1HKDA 4YZ3A 3RDIA 2WNVB 1GWLA 4CCMA 4ARYA 1LULA 1REFA 4QHZA 1HIXA 1JOBA 1NKGA 1EAH2 1YEWA 2BNOA 2RS11 1YI9A 4XHXA 4Z82A 4LOTA 1DFQA 4KWKA 1SBDA 3O1TA 1B09A 2P5BA 1RUE1 5J7MA 2WDBA 1JBCA 3SEEA 4JGZA 2VZOA 1R1A1 4HVRA 3I54A 3WDYA 1POQA 1UY1A 1CESA 4DUXA 4DXTA 2E7QA 5C4WC 3AKRA 3LFMA 2EXKA 3GBWA 2Y64A 3K4AA 2ZHNA 1SCRA 2DVFA 3GXUA 2AEYA 4NWVA 2W1WA 3I2DA 4J1WA 4LBMA 1YQ5A 4XUNA 1Y4WA 3ZSLA 3O1SA 2QQWA 1UF2C 2XBO2 3IKWA 2B39A 4UFIA 4FSJA 2GC0A 4DUVA 1XSQA 5E1RA 1WCKA 3LDKA 1C5IA 4LKSA 3RS6A 4FBFA 1RUH1 1EUTA 4YGDA 3WNKA 5CFDA 2ZX1A 3KT7A 1O4YA 4N7UA 3IPVA 4XFFA 4YNIA 4GWJA 3WCSA 3AX4A 1RUC2 2ADEA 2MNGA 4FOYA 3UGHA 1XNCA 2J1SA 4RQPC 2O0OA 3ZLIA 4CTEA 1OSGA 2P4EA 2G9GA 3ZYPA 5FO7B 4XXPA 1AX0A 3SISA 5HV4A 3FE5A 4H2AA 2YROA 3CL1A 3OUJA 3B3QE 4Q4W1 5F32A 5CFCC 5FZAA 2A3XA 1BBT2 1UU4A 3IPVB 3AMHA 3NAPB 3NSTA 4QX8A 2CDPA 2RS51 4XUOA 1WMFA 2WN2A 5H9SA 5T3NA 4JX0A 3KD4A 3I3QA 4X8PA 5GLWA 2C24A 1K42A 4FP2A 1RITA 2X05A 3POIA 1NG0A 2Y6HA 4TTGA 3A4UA 1ZBA3 1ZBE3 1DU3D 4QU1A 5F2SA 2VZ1A 2OKXA 3GF6A 2ARXA 1UX7A 3HNYM 2R041 5LB6A 3SMHA 4CEWA 3RZJA 1E5IA 2P3JA 2TBVA 4XXAA 5FTTC 1JYVA 1QJU2 1EAH3 4IE5A 1HN0A 3PMSA 5JIUA 3AM2A 1YYNA 5JOWA 1LHWA 3LF7A 3DEMA 4PQQA 4K8RB 4XIKA 1DYKA 5HCHA 3AB0A 3NNMA 2PHUA 3VBOB 4CCNA 4ONUA 1S55A 1W2TA 4JQRA 4A45A 3RYPA 2IC1A 1NCRB 1F9KA 3NNJA 2EIGA 3T0DA 1YWKA 4QDSA 2G4IA 3RMYA 3I7DA 4CU7A 1XNKA 3MW2A 1A6CA 4XFAA 2WINB 4Q4V3 3UKVA 5DMYA 1RUNA 4X6QB 4CUBA 1LEMA 1E5HA 2YY1A 5BPXA 3RRDA 4JRAA 2XBO3 4BIFA 1Y9QA 3HT1A 4LIVA 2QQMA 1HB2A 3ACLA 1YCIA 5L19A 2RVAA 3ETQA 4LKEA 2W68A 5LK5A 3UGGA 4COZA 4E8DA 1J1LA 2P6CA 4C1XA 1W28A 3AKPA 5A7PA 3TNPB 4K20A 1MEC2 1VMFA 3OYWA 4XACA 3AZYA 2A1XA 4QPGC 1HV0A 1CGPA 1RJ7A 2VW0A 3VKMA 2FDKA 1RUC3 1CAWB 2Z42A 4B1LA 1DZRA 3TWIA 1UYYA 1YQ6A 2VZ3A 4XFBA 4BQWA 1RUF1 2D6PA 4W8JA 3D5OA 4XJZA 3T0BA 1REDA 1XQNA 1TNFA 1WKYA 2VXJA 1F5FA 3E5QA 3ST7A 5A7WA 1LAJA 3T09A 4AR2A 1Z7S2 4AK3A 1XBFA 1OPMA 2VBBA 1BBT3 3KV4A 1KGYA 1T6GC 2UWBA 5IUQA 3UKNA 1OUXA 3PIJA 4HL0A 4QM9A 1LHNA 1O7FA 3OUIA 1GQGA 1VBA1 4Y20B 1JZ2A 4CU6A 5A32B 2FDGA 4Y1XA 1ZZ6A 2D93A 1W03A 1C8M2 5FYUA 3VBHB 2Y0IA 1UO9A 2AENA 5A7WB 4UI9L 3A21A 1RUI2 5FZOA 2D6NA 2CV6A 2P2KA 3MYXA 3UKTA 1AJKA 3KT1A 1AL21 4MUVA 5IAVA 1MQTB 1QJU3 3T1MA 4LBOA 4D7SA 2R0HA 2W46A 1Y9GA 5K8SA 3ATGA 4ZS3A 2W95A 3JCIA 4GWMA 4EN8B 1IKPA 5FCCA 5T5OA 3BGAA 5FMCA 1G9CA 3MIGA 1GWKA 3GHNA 1A3KA 5LATA 1RUD2 1W9WA 5GZFA 1D4VB 2CY6A 1IG0A 3ILNA 3MDPA 4HN0A 2YPDA 3USUA 5FZOB 1PGL2 1H2LA 3R4UA 3SLIA 3ZMOA 4N7IA 4KWUA 4JTNA 2VMEA 1X33A 2UU8A 2DV9A 3C3VA 3NWKA 1JUIA 1RUOA 2SLIA 4OHVA 1UN1A 3LSDA 4TLFA 3AYEA 1RMU2 1UY2A 3CMGA 3DPRB 4O9GA 3NV1A 3U10A 1DGRA 1DG6A 1DBNA 5L9RA 4RR3C 4YSFA 1S0CA 2O1QA 5A3OA 2E6VA 3PUQA 3OPWA 2D98A 4QGNA 3USUB 3HQXA 4M0NA 1MEC3 3ZR6A 4FAHA 2XLGA 5I0DA 2GP3A 2ZEWA 5J96B 1MR5A 4L0PA 5K0UB 3DXTA 3FUQA 4GAZA 5C9AA 3GALA 2VTXJ 1OLMA 4IEPA 2K46A 4GB31 3C7EA 2JXAA 1WW6A 2NYYA 3A22A 3J26N 4PDWC 2DBNA 1CONA 2YYOA 4QKNA 5DUUA 4CCJA 3RJRA 4AI2A 3M3OA 1Z7S3 1OH3A 2JJ6A 3TYJA 3EMRA 5LY1A 1JMUB 3IIIA 2ZJCA 3OPTA 4WZCA 1SDDB 1DLLA 2V09A 5C9AB 2EA7A 5DDJ2 5JMOA 3H8OA 3ECQA 3KGLA 1ZREA 5BNOC 1REEA 2XJVA 2WNUA 2HBTA 1T6BX 2YBPA 4N53A 3IBMA 3OGJA 3BOWA 1C8M3 2ORZA 3HR9A 1OVPA 3OY8B 3ZYJB 1OKOA 3KB5A 4GWIA 1RUI3 1TG7A 2ARCA 4AGGA 4LQRA 4AEKA 3LWCA 1KJRA 4IETA 4IV3A 1DQ4A 4I01A 4DXRA 3Q8BA 4BCUA 3NW4A 2RMU2 4QPIC 2CHHA 5FY1A 2Y38A 5FK7A 5IK8A 5IVYA 1E57A 4Y26A 2J22A 3E1F1 1HQWA 1UZZA 1XNBA 5BNNB 4RFT0 1XU1A 4WVMA 1RUD3 2DDUA 4B1MA 1NX9A 1Q5OA 5LRRA 4JGYB 4P9WA 4EZ4A 5A7SA 3GBGA 5BY5A 3MW4A 1HV1A 3B93A 1KDMA 3CKHA 4YLZA 3VBRA 2EF6A 1WLWA 5FYIA 1YJLA 3LIGA 4RGKA 3WW1A 2ZPXA 4IV3B 1XE8A 3CIHA 1STMA 1PX4A 4HVQA 2YPJA 1EPZA 4XCAA 5C7GA 2Q1ZB 4QGMA 4XETA 3ON7A 1BHGA 3M4FA 1RMU3 5C33A 5L7OC 4C8DA 3IIAA 3POSA 4D6RA 4HK9A 1LOFA 4FPJA 1AJOA 5FZ8A 1YXWA 4EJRA 1LHVA 3U0ZA 1W05A 2IFRA 4Q26A 1B35C 3WDXA 2JDAA 4LO4B 5JWPA 3GZTB 1W0PA 2QZ3A 3R6SA 1DZTA 4OHZA 1VBE1 1ZM1A 2BPA2 2ZTNA 3VD3A 1NY72 3WT3A 4LBJA 3BOPA 4KI5M 4GMP1 4F8AA 2NP0A 2XMLA 5JCTA 1DGRN 2Y6JA 3ZFGC 1A78A 2VMFA 4EN7B 1DDLA 1BKZA 3BU7A 3WUDA 4AFMA 3EHKA 5KXBA 3DKQA 4QXBA 1W9TA 1O4TA 2XB6C 3POBA 4CP0A 5FPBA 4UXAA 5CADA 3RWNA 5DDJ3 4OUEA 4COWA 5ANQA 5T55A 5JOZA 2ZEZA 1CR7A 2GH2A 3D3AA 2HWC2 2JG8B 3VL8A 1S2BA 4Q4Y1 4QGLA 4Y5SA 4YGCA 3W21A 3LQCA 3I2GA 4DEVA 5IJRA 1O5LA 2FZ1A 3UJQA 3QACA 4R9CA 4GULA 1LTEA 2XL7A 1LU2A 2RMU3 2UURA 3AZVA 3PUSA 2TEPA 1V9U1 1GFF2 1LRHA 3VBUB 1NA1C 1QXRA 1SLIA 1PO21 1WLCA 2AYHA 3Q9OA 1RHI1 4FPYA 2Q8CA 3HNBM 5ERLA 4PIXA 5T5LA 1FV3A 5L9BA 2J7MA 4E9KA 2WO3A 3WR0A 4RD7A 5HXMA 3WNMA 3ZIWA 4MO3M 1CD3G 2VVDA 3IDCB 2JIGA 5A3PA 1W3VA 2ZACA 4MXVA 2JG9C 3PTYA 1JH5A 2BVVA 1PIV2 5LA2A 3OGGA 1X8MA 4TLGA 1RC6A 1YFXA 4GH4A 3WQ0A 4BU2A 3VDAA 2ENRA 2XJQA 4FI9A 3UETA 2VD7A 1CVNA 3OBRA 1RUJ1 1URXA 2X5IA 4P08A 3PDQA 4HN1A 4CCCA 1NLQA 4E2SA 5A7QA 3J8F1 4META 4YW7A 4NIIA 4G3YC 2DCJA 2DCZA 3WQ7A 5FKBA 2HYKA 5AFEA 4UFHA 4Z1VA 4N43A 2V73A 3MFAA 3VN4A 1J58A 3GJAA 4JTOA 1JYIA 4DEQA 4K21A 1CWPA 1POV3 4IXLA 1F15A 4W6YA 1PGSA 4IE7A 4PIYA 1OFNA 4FXGB 2ZMKA 3OBZA 4PF1A 4Y1YA 1A8MA 1YFYA 4XMAA 5IVEA 1RGSA 3M3QA 1HB1A 2HWC3 3BVCA 1TE1B 1ND2C 4JDOA 1GZWA 5CU1A 2CSGA 3WXPA 4BH9A 4O7XA 1YFUA 3U1XA 4YVWA 1L3JA 5JOXA 4NJ4A 5DN2A 1OOPB 2ZKLA 3I3EA 5FYMA 1W04A 3P1IA 3JB8A 4MGZE 4TXWA 5F8PA 5C8CA 1DQ0A 5FUNA 1PGW2 1J3PA 3B02A 3MUZ1 1RJ8A 3KQRA 2ADDA 4ZZ5A 5JZGB 2VH9A 1H9PA 4OYUA 2Q4SA 4RS5A 1VR3A 3SCGA 5JUVA 2FHRA 3FWEA 4XURA 4YVSA 4URAA 3POEA 1H30A 1LOCA 4AQ2A 3U11A 3ZO0B 4B4RA 3LGRA 4CDQA 3LDBA 2EAKA 2NPIA 5CNAA 4BK4A 2WRAA 2YV8A 4AHXA 1SLBA 4A41A 2DURA 5K7PA 4DPNA 2JICA 4HLTA 4XMIA 1PIV3 1XYPA 2B4KA 2OPWA 3HN1A 2LROA 2LALA 4XQWA 1FX5A 2R6QA 4LO7A 2PHWA 4BQYA 2A73B 5HCFA 2HWD1 5LBFA 4DY3A 4CA9A 1H2MA 3MHZA 3ZFEA 2PHRA 3UL2A 5HBAA 2VTXA 4WM8C 5CISA 2WNOA 1R1ZA 1AYM1 1PM7A 4XUPA 3VKOA 2EIEA 4ZU5A 4GALA 5IK7A 2Q1MA 1PVC1 1QF3A 2W3JA 4I3GA 4M3CA 4OMCA 1KFUL 3THDA 3ZM8A 5J09A 1W2UA 5LK7B 3LCPA 4IESA 3WHTA 3RFRA 5IHRA 3MGUA 2YFUA 4N8MA 1C8NA 1ULOA 1NUKA 4JV4A 3WNNA 3E5XA 1UX6A 2WQZC 1UY0A 4JRLA 5DPNA 2FDHA 3KCCA 3VZLA 1IOAA 2C9KA 4QKDA 3VBFC 3HIFA 4XFIA 1PK6B 1JS9A 3I8TA 2VUDA 5FXZA 1JZ3A 2CAVA 3TB0A 1BEV2 1IHMA 4UWDA 4XW3A 3MBWA 4AEDB 1BZWA 1E5RA 4XZPA 3VDDC 1UXXX 4BA6A 4D94A 4H55A 5I8YA 2BOJA 1BXHA 2C5DA 1AXYA 3VV1A 3ZYHA 4XABA 2GN7A 3UESA 1GBGA 3JQXA 4E4DX 4BQ2A 1JTZX 2OYZA 3OGSA 2DYCA 4WVVA 4AI8A 2C6SA 2VG9A 3VL9A 3B94A 5D2AA 2RDQA 1MZEA 2K2SA 3MV11 3PL0A 4P9GA 4HANA 1OQEA 2QVSB 3PUHA 3R4SA 4RYDA 3P3PA 1P8JA 2VQTA 4QKFA 3POFA 4Z2WA 1CZSA 1ZRRA 2D6KA 5IW0A 4ASMB 1W6MA 4GWNA 1LOEA 2OW4A 2YMZA 5C3OA 5LZ6A 2BNMA 1Q8VA 3DYMA 5ABJC 3O1VA 3LEMA 5FOJB 2O8OA 3LB9A 2F6BA 3LA7A 3HBZA 2F4PA 1GP6A 1HLCA 2XVGA 3J7LA 1XC6A 4JQTA 4KG8A 2P37A 2W94A 4XVHA 1S2EA 3OBAA 4CPBD 1YRZA 4AHZA 4FVVA 5DG2A 3H50A 4PJYA 1XSRA 5JPMB 1JUHA 1XE0A 3OG2A 2OUJA 2Y8KA 4NPMA 3H8RA 3RZMA 2VECA 2FD8A 3AKTA 5DABA 3D8CA 4ZY9A 4FFGA 1QDCA 4GA9A 2QCSB 1VAKA 2XKPA 1ND3C 3J7NA 2JE9A 5F6LB 3DXUA 1OVSA 3WNLA 1W6PA 2DCYA 2ARAA 2H6BA 3K51A 4IEVA 5I8SA 5BNPB 1EPWA 1ACCA 1JN2P 4L99A 4XJ8A 3TN92 1QKQA 3N4MA 1OMIA 1O3TA 2XGXA 1V0AA 1CZVA 2GAUA 3FMGA 3JBG1 5G04L 1PZ7A 4XTMA 1BEV3 2VMGA 2J1AA 5D21A 2LTNA 2MEV3 1FV2A 4CXYA 3O1OA 4ZXEA 2DBIA 3D6EA 1QH7A 2OXBA 3LFIA 4YW2A 2PLV2 2WL1A 1BMV2 4QB6A 1K3IA 1UY3A 3ELNA 5A3WA 4A6SA 4DZGA 3TEWA 5KR7A 1VPHA 3E6CC 3AZWA 4PI2A 3O1RA 5FY7A 3ZR5A 2E31A 2Z79A 4B3NA 3O0XA 3CJIC 2WFPA 1Q56A 2AZ5A 4XBNA 3V64A 4KL1A 1GKBA 1WMEA 4DO0A 1UMHA 1RUE2 2EALA 4UFMA 2WQ4A 1LKNA 3WQ1A 1Q3EA 4CP2A 2XH6A 2W1QA 1J83A 4UW6A 4P02B 3SNMA 1NE4A 1L7QA 4RQPA 1AR72 2JDPA 2GH8A 1GQHA 3NV3A 2PYTA 4M4RA 3WSOA 4BQ4A 5DUVA 2Q8OA 3RGBA 3H3UA 4L11A 3IMMA 4D6QA 1JXNA 3P3NA 5CFCA 2GP5A 4OHWA 4RL7A 1QHDA 3PJYA 1ST8A 1LENA 4IV1B 1JYCA 4GIQA 5T50A 1QNYA 5FPZA 1WBLA 1VAVA 3KS7A 3MIHA 4NROA 3WVJA 5EYXA 1U0AA 2RR11 3WD5A 2YU1A 3SH4A 4F3JA 1LB2A 1JOJA 3K77A 1XNAA 4CCOA 4J25A 4CDXB 1S0DA 1DQ1A 3IWZA 2QDRA 4ZU7A 2X09A 4O9EA 3KLSA 4B8EA 2WKKA 3T08A 1YQCA 5JXIA 3TN93 5LASA 3ZXKA 1AR91 3S5AA 4FQZA 2D97A 4CSWA 5CZKA 2D5FA 4Q4W2 4FTBA 2BFUL 2FDIA 3GYDA 4A2UA 3FLPA 5LW9A 4YW3A 2RS52 4XQ4A 4NIAA 4KBBA 2OX0A 1OKQA 1R081 2PLV3 4CP1A 3L2YA 1RXGA 2J1UA 2RJ2A 1HJGA 1GZ9A 2XDVA 1WMXA 2PAKA 3OD4A 4JKKA 1V6KA 3EXUA 2BFUS 5D8AB 4IE4A 5B4NA 1YQ8A 3VBSB 3S0MA 3SH5A 3DYPA 2B9VA 1SACA 3RG0A 3G7DA 3IDBB 2HWE1 2UY8A 4JDMA 3T2QA 4Q1PA 1O3SA 4XJUA 4XUTA 3PURA 3U78A 3RZGA 1MS3A 4IW3A 1NLRA 4DRRA 4IQPA 4ATEA 1RUE3 3FHAA 1O91A 2VXRA 4QPGA 2YU2A 4XBLA 4LR4A 3WW3A 2JIJA 1R091 1OA4A 4OFGA 5F6KA 2EXHA 2HEYF 1DF0A 2OVUA 3N9PA 4XEZA 3VD4A 1GP5A 2C26A 1AR82 3TAYA 1C3HA 1AR73 5A33B 5JVVA 2BJSA 5FV3A 5CG9A 1UIKA 2W52A 2GMMA 4MLOA 5FXWA 1PMHX 1D2QA 2UYBA 5FYSA 5FZ6A 2R071 4WM7B 3MV01 3TNQA 1D7PM 2RDSA 2W5FA 2QQLA 2VCBA 1LEDA 1WA4A 3BB6A 3ASIA 4LTAA 1QXPA 4PT6A 4UBHA 2LUWA 5SV5A 3SCHA 4A7YA 3B9IA 2IFWA 3OEBA 5FZKA 1G9FA 4IE0A 1ZA7A 5C3PA 3WP5A 2VJXA 3POGA 4JGZB 1IZ3A 1XPWA 1VB4A 3IM0A 3HVDA 2XQRA 3J7HA 3MICA 1DP0A 3BTAA 2ARBA 5JOYA 4Q4W3 2VOKA 3D0JA 4HG6B 4Y3OA 5FOBB 3RYKA 2WA3A 2EVXA 2RS53 4RGGA 1U12A 2VU9A 3DL3A 3I59A 3FC0A 4K3UA 4M01A 3M3EA 3ZXGA 3ZFFC 5FZGA 1SHWB 1Y3TA 2BGPA 4OVEA 4CEYA 4NO4A 2J42A 4QX7A 1MS8A 1PMIA 3IDAA 5CEHA 5IATA 3LZZA 5CFDB 1UZWA 4CCDA 3SHRA 5F5IA 4H3WA 2IXLA 2MPFA 2ZA9A 3WDVA 3TRSB 3ACFA 5GZCA 5FWJA 1S0FA 1AL22 4RR3A 2LS6A 4CP9A 2X53S 4AVAA 3FFQA 3OTFA 1WW7A 3ZYGA 1W2AX 2PHFA 3I4IA 1UIJA 4M0HA 4QQHA 3SH3A 4CEYB 4EWEA 1NQDA 1PMJX 1QJFA 2WFF3 1LGNA 1XOYA 4OI2A 2VQ0A 4DRVA 4EWAA 3T1LA 3T3YA 1O8PA 3Q8FA 1AR83 3AZXA 2A70A 4IGPA 2ZABA 2QFEA 4Q0VA 3HAGA 3K4ZA 3UJOA 4CP9B 1K5MC 3M70A 4PDWA 2JDMA 3IDEA 4KMQA 4V2VA 5T54A 3H1MA 1XXNA 3N7MA 2CWMA 2VOXA 4MOAA 1XB9A 4CEWB 4EQVA 1X9PA 4QDQA 3AP6A 1GNYA 2JWPA 3DUIA 1ZZ9A 3DECA 4IUGA 4YPJA 3ZYFA 5BNOA 5JSRA 5IK5A 1ENQA 1X8EA 1XYOA 2XHNA 3FLTA 3LSEA 4MV2A 1FOD1 1ASJ1 3NKTA 1LU1A 4G4FA 3LDRA 1VAMA 1VIWB 3DV8A 4CDWC 1KEXA 2JE7A 5FMDA 4FPEA 3K46A 2FDJA 4GB32 4MHRA 2QQOA 3RSJA 1OH4A 3TEZA 1RB8G 1ZBA1 1LECA 3MLKA 5K9YA 2VZUA 2QBXA 4QX1A 3KGZA 4LBNA 4OUMA 4L97A 3O0WA 5IVBA 3BODA 1WW5A 2G9ZA 2OPKA 3AYCA 1AF9A 4B29A 3BIEA 5FY9A 1H1IA 2I45A 1X7NA 1W99A 2PFWA 3X29B 2DTYA 4E2GA 2DTWA 1UOJA 1OLQA 2DCKA 2WNVC 3MO4A 4XAAA 3NMBA 4BB3A 3WZ1A 4CCEA 5F9TA 1VMJA 3HT2A 3OYWB 2XJSA 4D7YA 1GWMA 3I2FA 1IKQA 2R061 3VLBB 4AI0A 3AMQA 4LHSA 5DAVA 5FR3A 3QD6A 5L7OA 4YYOA 4Q4V1 3D0SA 4A3XA 3ZXFA 1AL23 4P14A 1HQNA 4Q0QA 2NLRA 1JZ7A 5EHDA 1B35A 2Q5TA 1V6JA 2P3YA 3BYWA 4BM8A 5A6XA 1QJX1 1JYWA 2GU9A 5C8WA 1U5ZA 4HVOA 2ZXQA 4P9LA 1LCLA 3J4UH 5LRSA 1N1YA 4HZFA 3RZHA 4CPBA 3AXEA 4QB1A 4A42A 4EN6B 4TWTA 1GOHA 3BTZA 2A6XA 3UV9A 5ACA2 3I3MA 3ZFGA 4ISRA 1IQAA 4LJHA 1FYUA 4H14A 3AKSA 1M4WA 3VHRA 3OOXA 4BWOA 2DWRA 4ORFA 1CPNA 5EZWA 5HV0A 4K7JA 5IK4A 1VLNA 4W50A 5A7NA 2RV9A 2W9XA 5J1XA 1KITA 3AVSA 3KHBA 4I30A 5FYHA 5HCBA 3O5SA 2E32A 1LJ7A 5EP9A 3ZXJA 1N1VA 4XZUG 4AF9A 1RVF1 1VBE2 5L36A 3AMNA 5GZGA 3HNMA 2ZX0A 3NAPC 4GB33 3A0NA 3CNAA 2ERFA 1IPJA 1YNAA 2R1DA 5I0UA 3SITA 3WDWA 2J1EA 2QQNA 2D6MA 2HKXA 2ZMNA 4AWDA 5KHKA 4ET7A 4Y1VA 2CL2A 5FY4A 1AYN2 5LA9A 2YGMA 1MZ6A 1QJU1 2R1BA 2DVBA 2RS31 1CAXA 4AI3A 1KDKA 2NQYA 4JKMA 4N9IA 3ZYRA 3T4VA 4FPCA 3WP3A 1JZ5A 3S57A 4K1YA 4XQDA 4LBQD 1OUSA 2ZS6B 4P9XA 2XR4A 2PHLA 2V5YA 1SLAA 1ULEA 4D6SA 4Q4Y2 4Y5TA 3RZLA 2Y6FA 2JX9A 2YC2A 4MXWA 3RNSA 3EQEA 2IXIA 3ZDVA 1GOGA 5FY0A 3VBOC 4FAGA 1CAXB 4MGSA 2JG9A 3AL5A 4C0BA 3CDZB 4JVAA 1IPSA 1H0BA 3IAPA 5FFOC 1NCRC 1V6OA 3ZSKA 1HJFA 2P17A 2QTWB 3ZYIB 4IEYA 4NIHA 3MIBA 1KJLA 2GC1A 4AFAA 2JKBA 1V9U2 5AVPA 5HCAA 1LR5A 4DOUA 1GYKA 1PO22 1W6QA 4LNVA 3VKLA 2LM3A 3TOJA 5FZFA 3WQBA 4PCRA 1KD7A 2V5DA 4OLLA 2VNOA 2WNUB 1TME1 3LEKA 4NAMA 2WO7A 4LXLA 4N53B 4QT6A 5ACA3 5FIXA 1JZ6A 5HXVA 3PUIA 3I3BA 4IE6A 1OD5A 2YG0A 4NPLA 4CDUA 5JI7A 3APBA 5C3SA 1D4M1 1H6XA 5CVRA 2WZR1 4MGQA 4G9SB 2VC9A 1N3OA 2ET7A 4KG0A 4UOJA 4W65A 3OGVA 1SDWA 2GALA 4Q0PA 4KWJA 1PZ9A 2ZCWA 5BXXA 2FCTA 3P6BA 3H3ZA 3ZXAC 1VBE3 1F5JA 1ND2A 1RUJ2 2WT2A 4FFIA 5E16A 5FYYA 3VZKA 1UU5A 2KM2A 4WVMB 1DIWA 3MF9A 4CDUB 1C8M1 3J8F2 4IEWA 4S2DA 3VDCA 4ZPIA 1WLDA 2VMCA 5FWEA 3VBRB 5J3UA 4QD2A 1R64A 4BHPA 5FREA 4P9JA 2VOWA 5FLHA 3T2PA 1AYN3 2QE3A 1QJZA 2OIIA 4K1ZA 4LO6B 4QX0A 3VBHC 2QNKA 4OQ9A 4BZ4A 1CPMA 5GZDA 1LESA 1DZQA 2WSUA 5LA0A 1LOAA 4W6WA 3U37A 1SLTA 1UOBA 2OUHA 3W5NA 3FFZA 1H8VA 1MQTC 5L9VA 3V65A 3FN9A 2VNGA 4FTSA 4Q4Y3 1PGL1 4E27A 3I2OA 3BALA 3SC7X 5A1AA 2V72A 3N9LA 3E97A 3O1PA 3A7QA 1OT5A 2BW8A 3FZ3A 5EXOA 1PX3A 1J1TA 4CUAA 1RTVA 2BZDA 4O65A 2JD9A 4NIGA 2Y6KA 1SEFA 2SBAA 2BYVE 5LY2A 4IEXA 4EE2A 3F2ZA 2XLAA 1UKRA 2ZGKA 2E9QA 2YXSA 1V9U3 3FJSA 2P3IA 2KD7A 1OI6A 1UQXA 1JU4A 3BCWA 4QX2A 1PO23 4LEJA 2ZGMA 3DPRC 2UWCA 2G19A 5DZFA 4WM8A 4Q5OA 4YM1A 2IZWA 1AR61 1Y9MA 4P5YA 3C8XA 4QM8A 4LT5A 2FDFA 1W90A 1SPPA 1NCQA 1QJY2 5JMCA 3FHIB 5D1IA 4COYA 4ARXA 2XWBB 2LRPA 5K0UC 3B5LB 2OQ6A 4K6BA 1N3PA 3B69A 5JAXA 2CTVA 2D5HA 4FOWA 4QHOA 2HBUA 1ULCA 3H7YA 1QOTA 3WW4A 5BUVA 4KU7A 5FMBA 3B01A 3WDUA 2RM21 5F37A 2ZBJA 3QH7A 5DDJ1 2WS91 1WMDA 2VMHA 4GMP0 1NCQB 1RUJ3 1YLLA 1A34A 3VBFA 1RXFA 3J8F3 2WWJA 1QQP1 1G7YA 5C9AC 3HWJA 3J9SA 5CIRA 2GNBA 1AYM2 4OULA 4XPVA 3EYPA 4J1XA 1NOVA 3LE0A 2CGPA 1UW8A 3DKWA 4QQOA 3ZSJA 3VDDA 5LEKA 1WZXA 4PBPA 4NR1A 1V6IA 4IEQA 4LK7A 1PVC2 1JHNA 1NAEA 3KF5A 4MX3A 4ZXKA 4BQXA 1H9WA 5DG1A 2GMPA 2JDZA 2QZ2A 1FPN1 1HXS1 1A8DA 2W47A 5FK8A 5FYCA 2R30A 5CB7A 1YIPA 1S0EA 3WG2A 2PELA 4GH4B 5F2WA 2A6ZA 4HPKA 3G6JB 3U75A 3V0AA 1YQ2A 1MVEA 1CAUA 1NXD1 1TMF1 2ZGPA 3VHNA 5BNNC 2XQXA 4JHZA 4EV0A 2X5IB 4O61A 4MHUA 3T4HB 4JGYC 4HKLA 2VAUA 2VY0A 3KV9A 4LUKA 1S2KA 2JDYA 1WWYA 4EYUA 3LOBA 1W06A 4P9YA 4XBQA 5T52A 3MEPA 3M1HA 2BNNA 4IV3C 3VUOA 5M0TA 4N43B 2D3RA 5ABJA 3WHUA 3WF2A 5CKMA 2GNDA 1VBC1 3UNPA 1O3RA 1WUVA 5EPAA 3ACGA 2RG4A 4MGTA 1UNBA 1Y7BA 2JENA 3VZMA 4EN9B 1C1LA 1NY71 1G9DA 2Y34A 3POYA 2CNAA 4AHWA 3E5UA 1QJY3 3WDTA 3S7EA 5E8AA 5AC91 3N3HA 1GZWB 2IVJA 4FPGA 4NIDA 5IT6A 1HQLA 1YO8A 3MPPG 4YVWB 4E4HA 4AQ6A 1LOFC 5C8CB 1ENRA 1EV12 2WO2A 5EWSA 1ND3A 5JXHA 3WEZA 1D0GA 1WBFA 4C0HA 4QAWA 4L2NA 5A6ZA 2BRTA 2ZHLA 4RS5B 2B46X 2HWB1 4LA2A 5KHJA 2ZZJA 1AYM3 4YVSB 5FUIA 4AQTA 1EP0A 1UZYA 1OA3A 3GCWA 1GV9A 5FZ9A 4XJAA 4CDQB 3H8UA 4PBOA 2JG8C 2YFZA 3ZN6A 4NE9A 1PVC3 2ES3A 1IG3A 2WR9A 5L73A 1DQ2A 1M06G 3USSA 5FYTA 5GM0A 3SCFA 5FXXA 2WSVA 4LUMA 2PHTA 4YW6A 4XDPA 3KF3A 5IAXA 2GNTA 4P5HA 2VNVA 1WW4A 1UPSA 1OLME 1QXJA 2Z69A 3SQOA 1ZRDA 1XU2A 2L9LA 3JU9A 1EY2A 1V6LA 2JDNA 3CJXA 3HBKA 3ZFEB 3CJIA 4FPFA 1F31A 3VBUC 4FOQA 5LEJA 3JBG2 1W0NA 2WZ8A 5GKAC 1VBB1 2WAOA 2WWSA 2NZ9A 3WX5A 1H8TA 1E5SA 3OCPA 4AAPA 4AFCA 2P34A 4YG0A 1W2NA 3U07A 2W08A 3LPFA 1JOPA 4M3CB 3RZZA 3ZX7A 4A4AA 4DB5A 3M3IA 3MIDA 2A7AA 3H1WA 3W58A 2YBKA 4A44A 4UFLA 1U5IA 4RHV1 4Q8KA 3CBNA 4NN0A 1QDOA 5KHGA 5A1LA 5B4XA 1H8TB 3ME2A 4XFCA 3GCXA 2GN3A 4M00A 3B9CA 4FPLA 1N3QA 2E7AA 2TUNA 1JZ4A 5H9RA 3N9NA 2WBKA 2VOVA 2B45X 2VZSA 2BGOA 3GZUC 1UZ0A 4GJYA 4XCBA 2Q8DA 4YM3A 3W59A 1EV13 5EIYB 4BLJA 1HB4A 5C5UA 2B42B 4F83A 2HWF1 4HONA 1Q43A 1SFNA 4I0BA 4LA3A 3I49A 1J3RA 1OHFA 2IVIB 4HSJA 1FMD2 1TNRA 2AGSA 5ISLA 2IXCA 2BV4A 3KVBA 2DVGA 4Q29A 4AEJA 2YC0A 3IZOA 4LBQA 4YZ1A 1W8FA 5BNQA 3F95A 3KHCA 2FBEA 3AYAA 2WUHA 1VBD2 4NRPA 2XUMA 3U4SA 3R4DB 1F2NA 2ZGLA 2RR12 2VUAA 2YHJA 1OOPC 3AZZA 1LODA 4OUSA 4RGAA 4AL9A 3AFKA 1W6MB 1WGPA 3WP4A 1K45A 1GMMA 4PI0A 5A80A 4AW7A 1HRV1 4CVUA 5JDBA 4ES9A 2H0BA 2PHDA 2VUCA 2NN8A 4KBZA 1SFYA 4MGYE 4C90A 3IN9A 5JZGC 1AR92 5EV7A 4BQ1A 2IXKA 3JBG3 4C1WA 3M2MA 5FZHA 2VR4A 4Y1ZA 3HJRA 4GKXA 3N35A 4I0WB 1VMHA 4UF0A 3H0OA 3WOGA 2W87A 3SXWA 3FHQA 5KBFA 4NWWA 1WCDJ 2QQJA 1R082 3OBTA 5FJHA 3VZNA 1ALYA 1V00A 1GOFA 4MGKE 1JZ8A 2E7TA 3WG4A 2D44A 4OCTA 3AP5A 1IS5A 1FNZA 4Y24A 4EROA 3ILRA 5GALA 5CA6A 2QJVA 4MYEA 2XJUA 2W92A 3HD8B 1WD3A 1EYBA 2FMYA 4EWDA 1NT0A 2HWE2 2XONA 5C4WA 5A3UA 1W6PB 5FQ0A 1DQ6A 2E33A 2GSYA 3C7OA 3NJXA 4UT5A 1HRI2 3MI8A 3RWKX 1ULFA 2JB8A 3WINE 5BYNA 5FZBA 4HSLA 1ZX5A 2XJRA 2X8KA 5FO9B 2ZX3A 4DMIA 2AR6A 2Z4FA 2WLPA 2CAUA 2O8QA 4R8HA 2QQPA 2AH2A 1OFSA 1BLZA 2RS12 2X10A 1RINA 3RJ2X 5C4WB 2ZHKA 1NZIA 1OF3A 1DGWA 3JD71 3MZHA 1DCSA 1FMD3 2R072 3NV2A 4QPYA 3QLQA 3IMNA 4Z07A 4S2GA 5A3MA 2CGNA 4FTEA 1O4ZA 4DS0A 1ENSA 1R1A2 5KC6A 2B8MA 3W9AA 5FZ4A 2HJIA 1VBD3 2XPJA 3S30A 3PMEA 2D3SA 5J37A 3ZFFA 3WLUA 1UMZA 2MEV1 3JQWA 4BQ5A 1PK6C 2RR13 1US3A 3BTXA 3ZN4A 3DGTA 4I3PA 4QKBA 2R49A 2DFCA 2VL4A 4CCLA 3WUCA 4LK6A 4AEDC 1I1EA 1I9RA 2WYFA 2NMNA 1WCQA 4PLMA 5FY5A 2Q8EA 4AEMA 5F5CA 5FY8A 3EJKA 4AHYA 5A6QA 4RQPB 1BYHA 1RUH2 1AR93 1VRH1 3O0VA 2D43A 3AK0A 3TEXA 1UOGA 3ZXEA 2AEZA 4Z8BA 3MUY1 1YFWA 5FYBA 2XWJB 1GICA 3A23A 5CFCB 1F4AA 2HYXA 4CU9A 1COV1 1R083 2OS2A 3T2TA 2HH9A 2EAAA 1LGCA 2LW8A 3BKZA 1NLSA 4C91A 1GR3A 3KV5A 3H3LA 1ONAA 4Q1RA 1K5MA 5IFPA 5T5JA 3R05A 5FAXA 2E51A 5KC5A 2BGCA 4NHXA 2E26A 3O12A 1CJDA 2F17A 1SLLA 4HK8A 1BK1A 2QQIA 3T2OA 2HWE3 1H6YA 3O14A 5IFTA 3PHMA 4NMIA 1MS1A 3BU0A 1OC1A 1JU3A 3OF1A 1W8OA 3L9JT 4GQ7A 2RE9A 4Y4YA 2WQ8A 2Z5WA 3IB3A 3KZ4C 1SBFA 1DGWX 1HRI3 1HW5A 4KGGA 4R4ZA 4FXKB 1HX6A 1W6NA 3MFCA 1RUG1 2R042 4IEZA 4CDWA 2CWSA 1QEXA 2P3KA 5A3TA 1NYWA 3K2OA 4XDQA 2I2SA 2NMOA 1NXMA 1OLRA 4PLOA 1GNHA 2RS13 3NJYA 2FQPA 1PHMA 1S0BA 2YDEA 2PHXA 3RPQA 5FPLA 2B9UA 4BXSV 1YIFA 2R073 3C7HA 1LHOA 4Q4X1 2EICA 1R1A3 1W6OA 4QWNA 4Y33A 4D0QA 4YW5A 2XVLA 3NQHA 3PU8A 5JPNB 4QXHA 1IS6A 2E53A 2VBDA 3RI9A 2WNVA 5BNPC 5CBLA 2NM1A 1Q8PA 3ZN5A 1BQPA 4R9DA 2D6LX 4UFJA 1FOD2 4ZONA 2WN3A 4DINB 1ASJ2 3AKQA 4XF9A 1G86A 3POWA 4QPGB 2VE1A 4OZXA 3PVBB 4V2WA 1C4RA 2VO5A 4MG2A 2RDRA 1W6OB 1HN1A 2JDKA 3VGIA 1K12A 4LE4A 2DUQA 1C1FA 5AFBA 1EUUA 1RUH3 4AE2A 3UGFA 3LEGA 5F3IA 4LULA 3M7AA 3PVEA 2W39A 1AXZA 1SFPA 4M3CE 5DZEA 1QIQA 1UAIA 2Q1FA 1QNWA 5KXCA 1PO11 2BDRA 3PTRB 5FZ3A 4CCKA 2ZGRA 2QQKA 5IVVA 1RUF2 3WW2A 2WC2A 5JR2A 4EN0A 3D82A 4Q2FA 4U36A 2R0FA 3OGRA 2A75A 4LOSA 1GANA 2JB4A 1ULPA 1AR71 1CIWA 4KWLA 1H4GA 2I74A 3I2KA 2R062 4AVBA 5FMOL 4DXZA 3I97A 3U14A 2UY9A 2ID4A 3MPBA 4BDVB 4TSVA 4Q4V2 3FL7A 1VBA2 4ZHNA 4YARA 4Q0SA 2WIIB 4QXCA 2QDNA 3H1YA 3K3OA 2BBVA 2F4LA 2CU5A 2DUPA 5FMOS 2WAAA 1QJX2 1V6NA 1AHSA 2R043 3JXSA 4U2AA 5T5PA 4AZZA 5CG8A 3NAPA 3I59B 2Y6LA 3H9AA 4AAXA 4IV1C 1AX1A 4SBVA 3CZUA 1OD3A 5FZMA 5EJ1B 2BEOA 4HKOA 1AL0G 4H7LA 4NRMA 2A6VA 3C7FA 3CZJA 4XYXA 1S0JA 3LKJA 4YM2A 1UYZA 5FDBA 1UU6A 4LPLA 3B7MA 4CDXC 2R7EB 1UZVA 3CLPA 3JB4C 5JLVA 5F39A 1IPKA 1CAVA 1I5ZA 1K5JA 2ZX4A 4RR3B 3PVOA 2VM9A 3O1MA 1W2OA 5LWBA 2PAMA 1FNYA 4FFHA 3WG3A 1FOD3 1G8WA 1ASJ3 5FYVA 5DAPA 2ZGSA 4DQAA 3U4XA 1RVF2 5KHIA 4FCAA 2VZPA 2XVKA 3VBOA 4EZHA 2AUYA 2ZZQA 4OHXA 1FAYA 1L7LA 2C1FA 1OQDA 4I0AA 2BWCA 4QDRA 1CAVB 1NCRA 1H2KA 1TEIA 3OD0A 2D40A 3OPZA 4PDWB 3FX3A 2VUJA 2DUOA 1GSLA 4FT8A 2YC4A 5D8AC 5A3NA 1BJQA 3VBSC 4XF1A 5E88A 2RS32 5FLIA 5C5TA 2QQVA 4QHBA 3CO2A 5FP3A 2Q30A 1OA2A 1RUF3 1ZBE1 4KU8A 2K0GA 5E89A 3ES1A 1ZA4A 2VTFA 2WFF1 3K75B 4YWAA 1WCUA 1OXCA 5BNOB 4QPIA 3Q8CA 1AR81 5EJZB 4QU2A 2GMEA 4WVZA 1EAH1 4XTPA 1IQDC 3WF3A 2R063 2VMIA 2ZHMA 2VQAA 4QB2A 1O8SA 1F35A 4TN7A 2DU0A 1SMVA 2BUKA 1OURA 1CAWA 1VBA3 4XF0A 2ZGOA 4FPHA 4DXSA 4M3CF 3S6PA 3FBMA 4XDOA 3ZSMA 1OPOA 4XJ9A 4AFDA 1N1TA 1BVP1 2ZOEB 1KFXL 4URTA 2EIDA 1QJX3 1OF4A 4QPIB 2N7GA 4HXCA 3HQUA 4WM7C 2ZGQA 2JE8A 4LHNA 3CHXA 5EJ3A 2VVEA 2J1VA 3D4KA 3THPA 3AMMA 4UAPA 2XBO1 5JXGA 4XC9A 2XLFA 4K9SA 4XIOA 1TME2 4QQPA 5LBEA 4Y20A 2E63A 3ZKUA 5A32A 2R16A 2A3WA 3VBHA 1W8ZA 1D4M2 4YZ2A 3H8XA 5L7OB 5HI0A 3HQRA 4BJ0A 4OI4A 5FP8A 4JGZC 2WZR2 1RUC1 3TBDA 4AI9A 3OB8A 2RHPA 5F5QA 1MQTA 3O7OA 1PNGA 3AJZA 1B35B 1C28A 5DXDA 3GGLA 4LLFA 1MPXA 5FO8B 4LITA 1OBNA 1RVF3 2VNRA 3E6DA 4Y22A 3INAA 2GDFA 5GJ6A 4AFBA 2VBPA 1MZFA 3HPNA 1BBT1 3POJA 1VP6A 5FPUA 2DU1A 1TQ5A 2FCVA 3H42B 4NHKA 4ZZ8A 3ZYBA 3GHMA 3ZFGB 1QU0A 3AJYA 4RFRB 2WT0A 1AX2A 3WNPA 2DCTA 2RS33 2FZ2A 5CFDC 1UYPA 4HMZA 3SKVA 3I2JA 4Y22B 3URFA 3DPRA 3NV4A 3N9QA 1JHJA 4P00B 1J59A 4L9BA 1VB2A 3I2HA 4HFSA 5EFUA 2GC2A 3AXDA 4HKWA 1WCSA 3ZIXA 4ISQA 4XUQA 5DAQA 2FMDA 4YFWA 4CEYC 1NA1A 2PA7A 4JDNA 4ES8A 3KCXA 5BV6A 4NVPA 1UOFA 5K0UA 4Z2AA 3KV6A 4R4XA 2WA4A 5FBJA 2D7FA 1Q8QA 4Y5Z0 5FZ7A 3BN6A 2XJPA 2WO1A 4MSVA 3THTA 2BQPA 2VZTA 4LKFA 1NZCA 1W8UA 2KR2A 1QY4A 2A3YA 3RYRA 4LBLA 3ZPOA 4UW3A 1V70A 2WJSA 4AQSA 4ASLA 1NA1B 4BMEA 3NNFA 4Z92B 2WZPP 4CEWC 5APAA 1AR62 2BWAA 3J7MA 1S4CA 5F1RA 5IVFA 1DGLA 1TME3 4A7ZA 1MZ5A 1JYXA 3ENRA 1IS3A 2KA3A 3ACHA 1MEC1 5FLJA 5JR7B 1AVBA 1D4M3 1X9TA 2PTMA 3NL1A 1SZBA 3KT4A 3N7JA 3OY8A 4MXWB 1RHI2 1JYTA 3FUOA 2WZR3 3VB9A 3OJBA 4KQ7A 1ZZCA 2JG9B 2WABA 4FPKA 2W0XA 4CXXA 2RM22 4M4PA 4GD4A 3I3DA 4N90A 5H9QA 2WS92 5DAXA 1L7RA 4YW4A 2CYFA 2YBSA 4LHKA 5BNNA 4HETA 3KQ4B 1Z7S1 3LIHA 4XFGA 1HB3A 1QH6A 3CEWA 1W6QB 3OEAA 4DIQA 1QQP2 3R0RA 4JGYA 3NNGA 4FPOB 2VCAA 2ZX2A 4R9AA 4BQ3A 5JI9A 2XHKA 5C6CA 3ZMNA 5CKQA 5EYYA 2YUEA 4NHLA 3WCRA 4GMP3 3AFGA 3UK9A 4GXLA 2JDHA 1FPN2 1DLCA 1HXS2 1XNDA 1RUI1 2XXZA 2A6WA 2YZ4A 2ZGUA 5F5AA 5FP9A 5FZ1A 1QGLA 5GLTA 3QCWA 4CU8A 1MS9A 1W8NA 1NQJA 1QJEA 2WWUA 1LNSA 5LBBA 1TMF2 5KHHA 1PVXA 5ACA1 3GNEA 1ND2B 2A6YA 3KWVA 3M8LA 2GC3A 1RUD1 4AGRA 2IWGB 1ZRFA 3EB7A 4FOVA 1AXKA 1DYPA 3O1UA 2OZJA 3UYJA 1UYXA 2CDOA 2IXJA 4XE9A 4AVSA 1LOGA 2ETEA 4BE3A 1VBC2 2JKXA 4WVWA 2Y26A 3WP6A 3HEIA 4UW4A 5DZGA 3VDBA 5KXDA 2BP6A 4YW1A 1RMU1 1AR63 1XE7A 2QUOA 2PQSA 5C3QA 2VW1A 2VW2A 3IT8A 2PAEA 2UWAA 2P1BA 3PIGA 4UYBA 5AC92 4LBKA 1Q8SA 2AACA 2JG8A 3Q8EA 5DUXA 2Y33A 4D7TA 3BUCA 4PIZA 1RHI3 4AYUA 1I6XA 3PLQA 1AYN1 4XFHA 5KWRA 3KMHA 2BTVC 2J1TA 1ZZ8A 4NOTA 2RM23 4L8QA 2VOTA 2OQ7A 4XF3A 2WS93 3I2IA 1APNA 4N9HA 2DF7A 2ZKNA 4NAOA 1SG3A 3WV6A 3LPGA 2OZ6A 4IERA 4WBBA 3GBFA 4AVCA 3AC0A 3VBUA 1QQP3 2HWB2 3MW3A 3OSDA 1GQPA 3SEPA 4WM8B 4IEOA 2HWD2 3MF6A 4E4SA 3DF0A 4RN5A 5FPXA 1JODA 1QWRA 1SPPB 4OI1A 2Y60A 1MS0A 3WF1A 5A70A 1N47A 5J48A 2BERA 3NNLA 4I2OA 1KS4A 1UXZA 3AYDA 5I0RA 4XHBA 5FXVA 3T0AA 5AVAA 2YGLA 1FPN3 1HXS3 4DNYA 2HEVF 4NRQA 1CX1A 4XAEA 5I93A 4IDZA 1X82A 4KH9A 3MLJA 1W39A 1DQ5A 4LLOA 4ZKTB 1TMF3 3N7KA 3VD7A 2WLQA 2RMU1 3CU7A 3RI8A 2BVBA 2I07B 4YFZA 1W0OA 2XKOA 5FKCA 2JD4A 1FT9A 1FXZA 2FCUA 3VBFB 1UL9A 3ZOIA 2WYSA 4YGEA 2PXJA 4GZ9A 1VBB2 2ZAAA 1GUIA 2WNUC 5F7UA 4N53C 3K4DA 2P6HA 5ANNA 1CX4A 3VDDB 5GZEA 3PUAA 1VBC3 5FZLA 1H2NA 3ZXLA 2H6CA 3A0KA 2R32A 4D69A 3ACIA 4CUCA 4H7MA 4RA0A 1N1SA 5DAWA 1UD1A 4QX3A 1KRIA 1DYOA 4FFFA 5A1FA 4RHV2 2W1SA 3DCQA 4HPKB 3V0AB 5AC93 4K40A 1CAUB 1F8VA 2X29A 1MS5A 3Q8AA 3WNXA 3W5MA 1C57A 2ZGTA 3C7GA 3E6BA 3HMYA 1BK0A 4B7KA 3BI3A 1ULGA 4QQ2A 4CDUC 4W6XA 4FP3A 1YC61 2PMWB 3LOIA 1W8HA 1OOPA 5FRAA 3VBRC 4QQLA 4CXWA 1LGBA 1V6MA 1QOOA 5FZ0A 5IVCA 4YRDA 4S2FA 2V4AA 1O5UA 2HWF2 3AP9A 1QMJA 4JKLA 5FYZA 5LBCA 3VKFC 5ABJB 4MGIE 5DUWA 1OQ1A 4LIUA 5J98B 1CZTA 5JSOA 5JZGA 5JIAA 2HWB3 3RVHA 2D3PA 1O3QA 2EXIA 1XRUA 2XUEA 5F3GA 1H1MA 1DHKB 1POV1 2GZWA 2HWD3 4COVA 1X36A 4CZSA 1SLCA 1TZOA 1VJ2A 3JZVA 3GM8A 1ZRCA 3B00A 4SLIA 2HWC1 5F3EA 4LHLA 2ZEYA 1GNZA 4YM0A 1YJKA 4W4ZA 1W3XA 1W9SA 3VHOA 3VZOA 2XG3A 3KCYA 1CJPA 1RYYA 2ZMLA 2RDNA 5K4LA 2D6OX 2GNMA 4A6OA 4YGBA 3AMPA 1RL3A 3ZVXA 1HRV2 1ND3B 2WZEA 3IAQA 3NKGA 5FJKA 3KM5A 3WF0A 3WY6A 1GZTA 1LHUA 1XJAA 4UFKA 1ZVFA 1UMIA 1C5HA 1QJY1 5TSWA 3V0BA 1ODNA 3TEYA 3C2UA 1I3HA 1Y43B 1VBB3 4B7EA 3K3NA 4FO9A 4YZ5A 2VQUA 3ES4A 1FATA 4BIOA 4CYDA 3ZN6B 4B4PA 1VE0A 4ZS2A 3LAGA 4WV8A 1TVGA 4Y4RA 4X6RB 2CGOA 1T2XA 5E6HA 5I8TA 4TZDA 1JI6A 2VZVA 4NHYA 2ILMA 2A71A 5DQ0A 1G9BA 3V0BB 2ET1A 4OZOA 1PIV1 1Z0HA 3DN7A 1Q8OA 3CQOA 4Q8LA 4RHV3 4XF4A 5FZEA 1KQRA 1QOSA 5FPVA 2ORXA 1G6NA 5GLZA 4AXOA 3JUUA 5C71A 4OI0A 2QKDA 1D0HA 2TNFA 3BPSA 4Q27A 1NCQC 5FP7A 4JCKA 4OHYA 3AP4A 3ORJA 1POV0 3CJIB 1D2SA 4L92A 2VPVA 1CN1A 1PK6A 4QX5A 1JW6A 3PNAA 1LOBA 5GLVA 4OMDA 3ROUA 2Y6GA 4LO8A 1SBEA 4LKDA 2ZGNA 5LA1A 4LMFA 4IEUA 4AEDA 3N36A 2VVFA 2HWF3 4MZUA 4KNCA 1S0GA 4AOCA 3N9MA 1Z78A 5I0TA 2C4XA 2HLEA 3DYOA 3AVRA 4BXFA 1AUYA 2VGDA 3JD72 1YHFA 3KVAA 3LA3A 4NUBA 4YG6A 2Z2SB 4GH4C 3QBQA 5KXEA 5FPAA 5IWFA 4D8MA 3RZKA 4HT1T 4PF5A 2H0VA 1US2A 2MEV2 2X5IC 1U5XA 1S1AA 3PJQA 2VZRA 1BVVA 4Y1UA 1H4HA 1J3QA 1GZCA 1HRV3 2BOIA 2OA2A 1MACA 1PGW1 4HBNA 4N43C 4BOWA 3MLLA 5SV8A 4CUGA 1VRH2 3RQ0A 5C70A 4NPRA 5FZCA 1JYNA 3BPZA 2W1UA 1ULDA 4UW5A 3GJBA 4I09A 2RJLA 3H7JA 3NO8A 1CQ9A 4I02A 4GKYA 4IL7A 1W9YA 1COV2 1J84A 1YI7A 2JDUA 4LBQB 4MH0E 4J6GA 1UCXA 2PN5A 4HOOA 1EV11 5CKNA 4QPWA 3NJZA 4INDA 4UBGA 3KSCA 4YVWC 2PQQA 2MHFA 3PVNA 3LD8A 3GDBA 4WZFA 3ZSEA 4JZRA 1UWWA 2B7YA 4E2QA 4DUWA 5C8CC 5G05L 3N7LA 5JSPA 5I0SA 4AVTA 3VZJA 5CAZA 2DVAA 4TYSA 3WG1A 4RS5C 5BNPA 1RIRA 4LE3A 4YVSC 3HN3A 4COUA 5B2GB 1RUG2 3NJVA 4UF0B 1ZZ7A 3ZDSA 3HOBA 4BK5A 4CDQC 5F3CA 3ITQA 4E8CA 5IYYA 2EXJA 3JD73 5HPOA 4RSUA 1R092 3V56A 3ETPA 4ATFA 1ZYBA 4Q4X2 3P5BA 4CE8A 3L2HA 2DVDA 3W20A 4P9IA 1ODMA 3ILFA 1SQ4A 3QOPA 5A6YA 4YZ4A 5IVJA 1ZNPA 4DY5A 3ZPYA 4BISA 2AREA 4AGVA 5GLUA 5FQ0B 3ZFEC 5EQUA 4LORA 1XNTA 2XL9A 4BLIA 4A3ZA 2B5HA 2VCCA 2V4VA 1I5PA 2VULA 4S2HA 5C3RA 1BEV1 4BYYA 1UKGA 2BBAA 2WNEA 1VRH3 1UPIA 3UT0A 2OT7A 3CF6E 4K8FA 1NE6A 4MADA 2W2IA 1XYNA 3VHPA 1PZ8A 1PM4A 3N9OA 4PLNA 4X8NA 3EO6A 3GZEA 4XJWA 2UYAA 4BMBA 1W8WA 4R9BA 5J36A 1PO12 2Y0OA 3LA2A 1VRBA 1COV3 3NRUA 4IGOA 2K9ZA 3VKNA 3EBRA 3VD5A 3LEIA 3WNOA 1H8TC 3VD9A 2JEMA 1MS4A 2VMDA 4IV1A 1O59A 3ALQA 3ZFFB 4YG3A 3QH6A 5FZDA 4B4QA 4PQ9A 1X50A 2QQUA 2HEWF 1FI2A 3ZKYA 1ZRIA 2EIBA 3AP7A 4XOGA 5A7OA 1G9AA 1HDKA 5LCWL 4CDXA 1FMD1 1KS5A 4ITCA 4JHTA 1S0IA 5FP4A 2ZAHA 4D3WA 2O14A 3S5QA 1WD4A 3ABZA 2JECA 4NHMA 2BU9A 2WT1A 4BPZA 5JXJA 2A5ZA 4CRQA 1KXGA 1MVQA 1VBD1 1IGOA 2VCMA 5FZIA 1RUG3 3WF4A 4AI1A 1PNFA 3K48A 3PU3A 5FBZA 2AC1A 1H1AA 2G9FA 4F7ZA 1BCXA 1O6UA 3BIWE 2ATFA 1WA6X 2YB7A 4QXKA 3S7IA 3FBYA 3NVCA 1IS4A 1K5MB 3AL6A 1R093 5H9PA 1F4HA 4Q4X3 5D8AA 3ZXDA 4AVVA 4ASKA 4LO5B 3VBSA 1YUDA 2C0ZA 4FQ4A 2KXLA 2Q0AA 2IUWA 4IGQA 1AZDA 4PHZA 3T30A 1ENXA 1GU3A 1CIYA 1WLTA 1ZZBA 2DFBA 2G1MA 2ZEXA 3M3CA 4R52A 3RMXA 5A3LA 2VZQA 3SKJE 1GLHA 3TN91 3BTYA 3MIEA 4MVTA 2C9AA 4OQ8A 3MIFA 3GZAA 1SCSA 2RJKA 2IXHA 4V1PA 1W6NB 5I91A 1W9FA 4CDWB 2W91A 1GP4A 5FUPA 4JC1A 4XILA 5A33A 4QMAA 4ZU4A 2PLV1 2J1RA 2XOMA 1BMV1 4A7KA 3FLRA 5CYYA 1UY4A 4GJZA 4KGQA 4DFSA 4Q0UA 2XJTA 1VALA 4WM7A 1PO13 4JAAA 1W8TA 4E4ZA 1HRI1 3OUHA 1ZBE2 1ZBA2 1U5YA 3THCA 2WFF2
chains in the Genus database with same CATH topology
4AG4A 1HKDA 4YZ3A 3RDIA 2WNVB 1LULA 1REFA 1HIXA 1EAH2 2BNOA 2RS11 4XHXA 1YI9A 4Z82A 1DFQA 4KWKA 1SBDA 1B09A 1RUE1 5J7MA 1JBCA 4JGZA 1R1A1 4HVRA 3I54A 3WDYA 1CESA 2E7QA 5C4WC 3AKRA 2EXKA 3GBWA 2ZHNA 1SCRA 2DVFA 4NWVA 3I2DA 4J1WA 4LBMA 3ZSLA 2XBO2 1UF2C 3IKWA 2B39A 4FSJA 2GC0A 5E1RA 1WCKA 1C5IA 3RS6A 4FBFA 1RUH1 4YGDA 5CFDA 2ZX1A 3KT7A 1O4YA 4N7UA 3IPVA 4XFFA 4YNIA 3WCSA 3AX4A 1RUC2 2MNGA 4FOYA 1XNCA 4RQPC 2O0OA 4CTEA 1OSGA 2G9GA 3ZYPA 5FO7B 4XXPA 1AX0A 3SISA 3FE5A 2YROA 3CL1A 3B3QE 4Q4W1 5CFCC 2A3XA 1BBT2 1UU4A 3IPVB 3AMHA 3NAPB 3NSTA 5H9SA 2RS51 1WMFA 5T3NA 3KD4A 4X8PA 5GLWA 4FP2A 1RITA 1NG0A 3A4UA 1ZBA3 1ZBE3 1DU3D 3GF6A 2ARXA 3SMHA 4CEWA 2R041 2P3JA 2TBVA 4XXAA 5FTTC 1QJU2 1EAH3 3PMSA 5JIUA 3AM2A 1YYNA 5JOWA 1LHWA 4XIKA 1DYKA 3AB0A 3VBOB 2PHUA 4ONUA 1S55A 4JQRA 3RYPA 2IC1A 1NCRB 1F9KA 2EIGA 1YWKA 2G4IA 3RMYA 3I7DA 1XNKA 3MW2A 1A6CA 4XFAA 2WINB 4Q4V3 3UKVA 4X6QB 1LEMA 2YY1A 5BPXA 3RRDA 4JRAA 2XBO3 4BIFA 1Y9QA 3HT1A 3ACLA 1YCIA 5L19A 3ETQA 4COZA 2W68A 5LK5A 1J1LA 4C1XA 3AKPA 3TNPB 4K20A 1MEC2 3OYWA 1CGPA 3AZYA 4QPGC 1HV0A 1RJ7A 2VW0A 3VKMA 1RUC3 1CAWB 2Z42A 1DZRA 3TWIA 4XFBA 1RUF1 2D6PA 3D5OA 4XJZA 1REDA 1XQNA 1TNFA 3ST7A 3E5QA 1F5FA 1Z7S2 4AK3A 1OPMA 1BBT3 1T6GC 2UWBA 5IUQA 3UKNA 4HL0A 4QM9A 1LHNA 1O7FA 1GQGA 1VBA1 4Y20B 5A32B 4Y1XA 1ZZ6A 2D93A 1C8M2 3VBHB 2Y0IA 2AENA 1RUI2 2D6NA 2CV6A 2P2KA 3MYXA 3UKTA 1AJKA 3KT1A 1AL21 4MUVA 1MQTB 1QJU3 3T1MA 4LBOA 4D7SA 2R0HA 5K8SA 3ATGA 3JCIA 4GWMA 4EN8B 1IKPA 5FCCA 5T5OA 1G9CA 3MIGA 3GHNA 1A3KA 1RUD2 1D4VB 2CY6A 3ILNA 3MDPA 4HN0A 3USUA 1PGL2 1H2LA 3R4UA 3SLIA 3ZMOA 4N7IA 4JTNA 1X33A 2UU8A 2DV9A 3C3VA 3NWKA 1JUIA 1RUOA 2SLIA 4OHVA 1UN1A 3LSDA 4TLFA 3AYEA 1RMU2 4O9GA 3DPRB 3NV1A 3U10A 1DGRA 1DG6A 1DBNA 4RR3C 4YSFA 1S0CA 2O1QA 2E6VA 2D98A 4QGNA 3USUB 3HQXA 4M0NA 1MEC3 4FAHA 2XLGA 5J96B 1MR5A 5K0UB 3FUQA 5C9AA 3GALA 4IEPA 4GB31 2JXAA 1WW6A 2NYYA 3J26N 4PDWC 5DUUA 1CONA 2YYOA 3RJRA 4AI2A 3M3OA 1Z7S3 2JJ6A 3TYJA 2ZJCA 4WZCA 1DLLA 2V09A 5C9AB 2EA7A 5DDJ2 3ECQA 3KGLA 1ZREA 5BNOC 1REEA 2XJVA 2WNUA 4N53A 3IBMA 3OGJA 3BOWA 1C8M3 3HR9A 3OY8B 3ZYJB 3KB5A 1RUI3 4AGGA 4AEKA 3LWCA 1KJRA 4IETA 4IV3A 1DQ4A 4I01A 4BCUA 3NW4A 2RMU2 4QPIC 5IK8A 2Y38A 1E57A 4Y26A 5BNNB 1HQWA 1UZZA 1XNBA 4RFT0 1XU1A 4WVMA 1RUD3 1Q5OA 5LRRA 4JGYB 4P9WA 5BY5A 3GBGA 3MW4A 1HV1A 3B93A 1KDMA 4YLZA 3VBRA 2EF6A 1WLWA 1YJLA 3WW1A 2ZPXA 4IV3B 1XE8A 4HVQA 2YPJA 1EPZA 2Q1ZB 4QGMA 4XETA 3M4FA 5L7OC 1RMU3 5C33A 3IIAA 3POSA 4HK9A 1LOFA 4FPJA 1AJOA 3U0ZA 1YXWA 4EJRA 1LHVA 2IFRA 4Q26A 1B35C 3WDXA 4LO4B 5JWPA 3GZTB 1W0PA 2QZ3A 3R6SA 1DZTA 4OHZA 1VBE1 1ZM1A 2BPA2 2ZTNA 1NY72 3WT3A 4LBJA 3BOPA 4GMP1 4F8AA 2NP0A 5JCTA 1DGRN 3ZFGC 1A78A 4EN7B 1DDLA 1BKZA 3BU7A 3WUDA 4AFMA 3EHKA 5KXBA 1O4TA 2XB6C 4CP0A 4UXAA 5CADA 3RWNA 5DDJ3 4COWA 5T55A 5JOZA 1CR7A 2GH2A 2HWC2 2JG8B 3VL8A 1S2BA 4Q4Y1 4QGLA 4YGCA 1O5LA 2FZ1A 3UJQA 3QACA 4R9CA 4GULA 1LTEA 2XL7A 1LU2A 2RMU3 2UURA 3AZVA 2TEPA 1V9U1 1GFF2 1LRHA 3VBUB 1NA1C 1QXRA 1SLIA 1PO21 1WLCA 2AYHA 3Q9OA 1RHI1 4FPYA 4PIXA 5T5LA 1FV3A 4E9KA 3WR0A 4RD7A 3ZIWA 1CD3G 2VVDA 3IDCB 2ZACA 4MXVA 2JG9C 3PTYA 1JH5A 2BVVA 1PIV2 3OGGA 1X8MA 1RC6A 1YFXA 4GH4A 3WQ0A 2ENRA 2XJQA 1CVNA 3OBRA 1RUJ1 1URXA 2X5IA 4HN1A 4E2SA 3J8F1 4META 4G3YC 2DCJA 2DCZA 3WQ7A 2HYKA 5AFEA 4Z1VA 4N43A 2V73A 3MFAA 3VN4A 1J58A 4JTOA 1JYIA 4K21A 1POV3 4IXLA 4W6YA 1PGSA 4PIYA 1OFNA 4FXGB 2ZMKA 4Y1YA 1A8MA 1YFYA 4XMAA 1RGSA 3M3QA 2HWC3 1TE1B 1ND2C 4JDOA 1GZWA 5CU1A 3WXPA 4BH9A 1YFUA 4YVWA 1L3JA 5JOXA 1OOPB 2ZKLA 3JB8A 4MGZE 5C8CA 1DQ0A 1PGW2 1J3PA 3B02A 1RJ8A 3KQRA 5JZGB 2VH9A 1H9PA 2Q4SA 4RS5A 1VR3A 3SCGA 2FHRA 3FWEA 4YVSA 1H30A 1LOCA 4AQ2A 3U11A 3ZO0B 4B4RA 3LGRA 4CDQA 2EAKA 2NPIA 5CNAA 2YV8A 4AHXA 1SLBA 2DURA 5K7PA 4DPNA 2JICA 4HLTA 4XMIA 1PIV3 1XYPA 4XQWA 3HN1A 2LALA 1FX5A 2R6QA 4LO7A 2PHWA 2A73B 5HCFA 2HWD1 4DY3A 1H2MA 3ZFEA 2PHRA 3UL2A 5HBAA 4WM8C 1R1ZA 1AYM1 1PM7A 3VKOA 4ZU5A 4GALA 5IK7A 2Q1MA 1PVC1 1QF3A 4I3GA 4M3CA 1KFUL 5J09A 1W2UA 5LK7B 3LCPA 4IESA 3WHTA 3MGUA 1C8NA 4JV4A 3E5XA 1UX6A 2WQZC 4JRLA 3KCCA 3VZLA 1IOAA 3VBFC 3HIFA 4XFIA 1PK6B 3I8TA 2CAVA 3TB0A 1BEV2 1IHMA 4XW3A 4AEDB 1BZWA 4XZPA 3VDDC 4BA6A 4D94A 4H55A 5I8YA 1BXHA 2C5DA 1AXYA 3VV1A 2GN7A 1GBGA 3JQXA 4E4DX 1JTZX 2OYZA 2DYCA 4WVVA 4AI8A 2VG9A 3VL9A 3B94A 1MZEA 2K2SA 4P9GA 4HANA 1OQEA 2QVSB 3R4SA 3P3PA 4Z2WA 1ZRRA 2D6KA 4ASMB 1W6MA 4GWNA 1LOEA 2OW4A 2YMZA 2BNMA 1Q8VA 5ABJC 5FOJB 2O8OA 3LB9A 2F6BA 3LA7A 3HBZA 2F4PA 1HLCA 2XVGA 4KG8A 2P37A 1YRZA 4AHZA 4FVVA 5DG2A 3H50A 4PJYA 5JPMB 1JUHA 2OUJA 2VECA 3AKTA 3D8CA 1QDCA 4GA9A 2QCSB 1VAKA 2XKPA 1ND3C 5F6LB 2JE9A 1W6PA 2DCYA 3K51A 2H6BA 4IEVA 5I8SA 5BNPB 5L36A 1EPWA 4L99A 1JN2P 4XJ8A 3TN92 3N4MA 1QKQA 1OMIA 1O3TA 2XGXA 2GAUA 3FMGA 3JBG1 1PZ7A 4XTMA 1BEV3 2VMGA 2LTNA 2MEV3 1FV2A 3D6EA 1QH7A 4YW2A 2PLV2 2WL1A 1BMV2 3ELNA 4DZGA 3E6CC 3AZWA 2Z79A 4B3NA 3O0XA 3CJIC 2WFPA 1Q56A 2AZ5A 4XBNA 3V64A 4KL1A 1GKBA 1WMEA 1RUE2 2EALA 2WQ4A 1LKNA 3WQ1A 1Q3EA 4CP2A 2XH6A 4UW6A 3SNMA 1NE4A 4RQPA 1AR72 2GH8A 1GQHA 3NV3A 2PYTA 5DUVA 2Q8OA 3H3UA 4L11A 1JXNA 3P3NA 5CFCA 4OHWA 4RL7A 1QHDA 3PJYA 1LENA 4IV1B 1JYCA 4GIQA 5T50A 1QNYA 5FPZA 1WBLA 1VAVA 3KS7A 3MIHA 3WVJA 5EYXA 1U0AA 2RR11 3WD5A 3SH4A 4F3JA 1LB2A 1JOJA 4CDXB 1S0DA 1DQ1A 3IWZA 2QDRA 4ZU7A 4O9EA 3KLSA 4B8EA 2WKKA 3TN93 3ZXKA 1AR91 4FQZA 2D97A 2D5FA 4Q4W2 4FTBA 2BFUL 3GYDA 4A2UA 3FLPA 4YW3A 2RS52 4XQ4A 4KBBA 1OKQA 1R081 2PLV3 4CP1A 3L2YA 1GZ9A 2PAKA 3OD4A 1V6KA 3EXUA 2BFUS 5D8AB 3VBSB 3S0MA 3SH5A 1SACA 3RG0A 3G7DA 3IDBB 2HWE1 2UY8A 4JDMA 1O3SA 4Q1PA 4XJUA 1MS3A 1NLRA 4DRRA 4IQPA 4ATEA 1RUE3 1O91A 2VXRA 4QPGA 4XBLA 4LR4A 3WW3A 1R091 1OA4A 4OFGA 5F6KA 2EXHA 2HEYF 1DF0A 2OVUA 4XEZA 1AR82 3TAYA 1C3HA 1AR73 5A33B 5JVVA 5CG9A 1UIKA 2W52A 2GMMA 4MLOA 1D2QA 2UYBA 2R071 4WM7B 3TNQA 1LEDA 1WA4A 3BB6A 3ASIA 4LTAA 1QXPA 4UBHA 2LUWA 5SV5A 3SCHA 4A7YA 3B9IA 2IFWA 1G9FA 3WP5A 4JGZB 1IZ3A 1VB4A 3IM0A 3MICA 3BTAA 2ARBA 5JOYA 4Q4W3 2VOKA 3D0JA 5FOBB 3RYKA 2WA3A 2EVXA 2RS53 4RGGA 1U12A 2VU9A 3DL3A 3I59A 3FC0A 4K3UA 4M01A 3M3EA 3ZXGA 3ZFFC 1Y3TA 4OVEA 4CEYA 4NO4A 1MS8A 1PMIA 3LZZA 5CFDB 3SHRA 4H3WA 2IXLA 2MPFA 2ZA9A 3WDVA 3TRSB 5GZCA 1S0FA 1AL22 4RR3A 2X53S 4AVAA 3FFQA 3OTFA 1WW7A 3ZYGA 2PHFA 3I4IA 1UIJA 4M0HA 4QQHA 3SH3A 4CEYB 4EWEA 1NQDA 2WFF3 1LGNA 4OI2A 4DRVA 2VQ0A 4EWAA 3T1LA 1AR83 3AZXA 2A70A 2ZABA 2QFEA 4Q0VA 3HAGA 3UJOA 1K5MC 3M70A 4PDWA 5T54A 3IDEA 3H1MA 1XXNA 3N7MA 2CWMA 2VOXA 4CEWB 3AP6A 3DUIA 1ZZ9A 5BNOA 5JSRA 5IK5A 1ENQA 1X8EA 1XYOA 3LSEA 3FLTA 4MV2A 1FOD1 1ASJ1 3NKTA 1LU1A 4G4FA 1VAMA 1VIWB 3DV8A 4CDWC 2JE7A 4FPEA 4GB32 3RSJA 1RB8G 1ZBA1 1LECA 3MLKA 5K9YA 3KGZA 4LBNA 4OUMA 4L97A 3O0WA 3BODA 1WW5A 2OPKA 3AYCA 1AF9A 4B29A 1H1IA 2I45A 1X7NA 2PFWA 3X29B 2DTYA 4E2GA 2DTWA 2DCKA 1OLQA 2WNVC 3WZ1A 5F9TA 3HT2A 3OYWB 2XJSA 4D7YA 4AI0A 1IKQA 2R061 3VLBB 3AMQA 3QD6A 5L7OA 4YYOA 4Q4V1 3D0SA 4A3XA 3ZXFA 1AL23 4P14A 1HQNA 4Q0QA 2NLRA 1B35A 2Q5TA 1V6JA 4BM8A 1QJX1 2GU9A 5C8WA 1U5ZA 4HVOA 4P9LA 1LCLA 3J4UH 5LRSA 1N1YA 4HZFA 3AXEA 4EN6B 4TWTA 2A6XA 3UV9A 5ACA2 3ZFGA 4ISRA 1IQAA 1FYUA 4H14A 3AKSA 1M4WA 3VHRA 4BWOA 2DWRA 4ORFA 1CPNA 5EZWA 4K7JA 5IK4A 1VLNA 1KITA 4I30A 5HCBA 3O5SA 1LJ7A 3ZXJA 4AF9A 1N1VA 1RVF1 1VBE2 3AMNA 5GZGA 2ZX0A 3NAPC 4GB33 3A0NA 3CNAA 2ERFA 1IPJA 1YNAA 2R1DA 5I0UA 3SITA 3WDWA 2D6MA 2HKXA 2ZMNA 4AWDA 5KHKA 4Y1VA 2CL2A 1AYN2 2YGMA 1MZ6A 1QJU1 2R1BA 2DVBA 2RS31 1CAXA 4AI3A 1KDKA 2NQYA 4N9IA 3ZYRA 4FPCA 3WP3A 4K1YA 4XQDA 4LBQD 4P9XA 2ZS6B 2PHLA 2V5YA 1SLAA 1ULEA 4Q4Y2 2JX9A 4MXWA 3RNSA 3EQEA 2IXIA 3VBOC 4FAGA 1CAXB 2JG9A 4C0BA 4JVAA 5FFOC 1H0BA 3ZSKA 1NCRC 1V6OA 2P17A 3ZYIB 4IEYA 3MIBA 1KJLA 2GC1A 4AFAA 2JKBA 1V9U2 5AVPA 5HCAA 1LR5A 4DOUA 1GYKA 1PO22 1W6QA 4LNVA 3VKLA 2LM3A 3TOJA 4PCRA 1KD7A 4OLLA