1LOFC

X-ray structure of a biantennary octasaccharide-lectin complex at 2.3 angstroms resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
180
structure length
180
Chain Sequence
b'TETTSFSITKFGPDQQNLIFQGDGYTTKERLTLTKAVRNTVGRALYSSPIHIWDSKTGNVANFVTSFTFVIDAPNSYNVADGFTFFIAPVDTKPQTGGGYLGVFNSKDYDKTSQTVAVEFDTFYNTAWDPSNGDRHIGIDVNSIKSINTKSWKLQNGKEANVVIAFNAATNVLTVSLTYP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LEGUME ISOLECTIN I (ALPHA CHAIN)
publication title X-ray structure of a biantennary octasaccharide-lectin complex refined at 2.3-A resolution.
pubmed rcsb
molecule tags Lectin
total genus 27
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 1993-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1lofC00
1KDMA 1Z0HA 3IPVB 3RS6A 3SITA 4DRVA 1WUVA 3ASIA 4YG0A 4ATFA 1VIWB 3POYA 4YZ5A 1S0BA 3INAA 5DZEA 3ZYPA 4PBOA 3N7KA 1LOFA 4PQ9A 3AYAA 1W6QA 1UAIA 3QLQA 4K1YA 4ZXKA 2YMZA 4Q27A 4XJUA 2UWBA 2AGSA 1S0FA 4FPEA 1ULFA 3KM5A 5F9TA 1FV3A 1N47A 1SLTA 2A7AA 2E7QA 2NMOA 1OFSA 3O5SA 2AR6A 2DU1A 3N36A 1KITA 5IK8A 2GNTA 1CQ9A 3M2MA 2B7YA 4UW5A 1UPSA 2PELA 3AXDA 3FFZA 3PJQA 4FVVA 3OGGA 5GLZA 1SACA 2A3WA 3PVEA 4XE9A 4Y22A 2KM2A 5JOWA 1VAVA 2R0FA 2WSVA 3OY8B 4H55A 3WOGA 3ZSLA 2DTWA 4XHBA 1LOGA 3MW3A 2PHFA 3VUOA 4M3CA 1LECA 2ZMLA 3I4IA 3V64A 2DTYA 1BQPA 4NOTA 3ZVXA 1CESA 4YG6A 3BODA 1JBCA 3FLPA 4XJ9A 3SNMA 4ASMB 4FOWA 1IKPA 3AZXA 5GM0A 3POWA 4K21A 4UW3A 3FLTA 5JMCA 3Q9OA 1DQ4A 1WBFA 1MR5A 4AVTA 1DQ0A 4AGVA 1LOBA 3WDWA 4P14A 2H0BA 1NLSA 3N7JA 3PVOA 1CR7A 5AVAA 3ILRA 1MS1A 1W6MA 2JD4A 2R1BA 2AUYA 2A3YA 2ZGUA 4FP2A 1HQWA 1XQNA 4OZXA 1Q8VA 4DFSA 5JDBA 2NYYA 3UK9A 1QKQA 3B01A 4Y22B 3CNAA 1DQ6A 4C1WA 2R1DA 4M3CE 5DG2A 5F5QA 5JOXA 3U4XA 1W6NA 2GALA 2W68A 2ZABA 1RITA 2WJSA 3V0AB 3ZXJA 4ATEA 1DHKB 2VUAA 3O0VA 4JRAA 1MS0A 1W0PA 3JU9A 4YZ4A 3M3QA 4XXPA 5H9QA 1PZ7A 4HL0A 4W65A 4Y1YA 3ZSKA 1W6PB 4BM8A 1CJPA 4YM0A 1LOFC 1AZDA 2GNBA 2E7TA 5E88A 1ULEA 4XDQA 1ULCA 1BXHA 1N1TA 1WD3A 2ZHNA 5GALA 3VKFC 2P3KA 1H9WA 1QU0A 3ZPYA 1WD4A 3H0OA 5H9RA 1YXWA 1I3HA 2D6PA 4WVVA 4AWDA 3N7MA 4XOGA 1CN1A 3USUB 3AYDA 5CA6A 2AENA 1IKQA 1Q8SA 1S0DA 1QOTA 2WLQA 4FQ4A 4Y1XA 5EWSA 4Y20B 2SBAA 4XXAA 4TZDA 1YYNA 1GYKA 3BIWE 2A6WA 1QDCA 1SCRA 1G9DA 3A0KA 4SLIA 3BOPA 3W58A 5T54A 3RQ0A 2GNMA 1V6KA 1HLCA 1R1ZA 2NM1A 2DV9A 5GLTA 2A6VA 1MVEA 2EAKA 3IM0A 4R9DA 4LBKA 1G7YA 1MACA 2ZHMA 4FQZA 4WV8A 2XG3A 1AJKA 3WG2A 4Q8KA 2WNEA 2D44A 1N3QA 3V65A 1V6JA 1AJOA 1UKGA 1UX6A 3RSJA 4U36A 1W6QB 3UJQA 3VKNA 1N1SA 3WLUA 5JLVA 1OQ1A 5GZDA 4R9AA 5DUXA 5T52A 3R05A 2D6OX 1JW6A 2W08A 4Y1ZA 4YW5A 5T55A 1MS3A 5DUUA 4ISRA 3NV3A 1SFYA 1DFQA 2DVDA 3AZZA 5GZGA 4XJ8A 2HYKA 2ZGNA 1Q56A 3WV6A 1SLLA 1QGLA 3HMYA 1MS4A 4NO4A 5BYNA 2LALA 2D6NA 2GNDA 3O0XA 1SBDA 3W59A 4YM1A 3HR9A 3VV1A 3WDUA 1GZCA 1KDKA 2BQPA 3D6EA 3GALA 3R4UA 1U0AA 2AH2A 1WW6A 1JOJA 1W0OA 1PZ8A 1GV9A 2CWSA 1WW7A 4M3CB 1DQ5A 2A70A 4AYUA 1QMJA 1SLAA 5T50A 2CNAA 3IMNA 1GICA 4RL7A 1MS5A 1C57A 4LBNA 2WT1A 3ENRA 2CY6A 1ZM1A 3C2UA 3LCPA 4PF5A 4XIKA 1GNZA 2A71A 2VXRA 2JKBA 5T5JA 3T1MA 4AGGA 2ZAAA 3B3QE 4YW1A 2ERFA 1DYPA 1V00A 2RHPA 4CRQA 1DIWA 3AYEA 1W6MB 4K20A 1V6NA 1VAMA 2D6KA 2EXJA 1G9BA 3FUQA 4BOWA 1GNHA 2GN3A 3PMEA 1A8DA 1ENRA 2P3JA 3ILNA 2JE7A 3M1HA 5IUQA 4FPGA 1B09A 1ENQA 4CTEA 4Z8BA 4YGBA 4XTMA 3N3HA 2UURA 4PBPA 1OKQA 3NWKA 3WDTA 3RRDA 1FNZA 1MS9A 1WW5A 5DZFA 3ZSJA 4AGRA 1W6NB 5IK5A 3VKMA 4YFZA 3AFKA 1LHVA 1JYIA 1LGBA 4GWNA 5GLVA 1V6IA 3UL2A 1FYUA 1GSLA 4FPHA 2WQZC 1KJRA 1FAYA 2CYFA 2ARXA 1RINA 2ARBA 4XJZA 4AVVA 1N1VA 1YIFA 3BTAA 2PHXA 3TB0A 2ZGRA 5DG1A 1J1TA 2ZGMA 3WVJA 5JOZA 3RMYA 4Y1VA 2P34A 1LGNA 1GZWB 2CTVA 2YROA 2NP0A 2PHTA 5KXDA 4DRRA 1C1LA 1F5FA 2JE9A 2R0HA 4XBNA 4HANA 5FREA 2FMDA 4Y24A 1APNA 5EYXA 3MW2A 3OBRA 1GBGA 2A3XA 2VW0A 4XJWA 1AX0A 3AYCA 4ITCA 1ZA4A 1CVNA 2V73A 3SH3A 1Z78A 4LBQD 5FRAA 5CBLA 1FNYA 2P37A 4FOVA 1EPWA 4XZPA 1S1AA 5GZEA 5KXEA 1AXZA 1JUIA 2ZA9A 2G4IA 4YLZA 5GJ6A 1GKBA 2WSUA 2CL2A 1SCSA 2EALA 1N3PA 2YV8A 5T5PA 1UZYA 1G9FA 4LBJA 3AJYA 4FOQA 4XIOA 3MW4A 4ZKTB 3R4SA 3NV1A 5HCAA 1AVBA 4LBMA 3WDYA 1LU2A 3FUOA 1GZWA 1H9PA 1CPNA 1AX2A 4GWMA 3WHUA 1PZ9A 4DPNA 2D6MA 2D3PA 5H9SA 4BLIA 5JVVA 3ZXLA 4AVSA 3WDXA 5GLUA 3SH4A 4KBBA 2YXSA 2EIGA 1BJQA 1FV2A 2GMPA 5GZFA 1S0EA 1ULDA 3WUDA 1UZZA 2ZZJA 1JHNA 1Q8QA 2A6ZA 2GMMA 2ZGOA 2P2KA 3SLIA 1HKDA 2ZHLA 4FPCA 1BZWA 4GA9A 1NXD1 4YFWA 1O4YA 1KJLA 3WUCA 1KRIA 1G86A 1GANA 1N3OA 1O4ZA 2EXKA 2W39A 3IN9A 4WVWA 3WDVA 3DUIA 1HDKA 3D4KA 2ZGTA 3MPPG 2D43A 3WNXA 3T1LA 2NN8A 5CAZA 4YW4A 3FLRA 2DUPA 2ENRA 1QF3A 1LEDA 1H30A 2Z42A 4WZFA 2E6VA 2DUQA 1HQLA 5L73A 2DURA 1DGLA 2ZMNA 4L8QA 1W6OB 3L2YA 2VW1A 1LJ7A 1CIWA 2OW4A 2OVUA 2VU9A 3WZ1A 2EXIA 2WT0A 1WBLA 1DYKA 3AZWA 3GNEA 3M3EA 3NV4A 4YZ1A 1LCLA 3OBTA 5IK4A 3O0WA 5E8AA 1JN2P 5HCFA 3APBA 4XILA 5CB7A 3I8TA 4JCKA 3N7LA 2DU0A 3ZYRA 4FPFA 4K1ZA 1F31A 2A6XA 2AREA 2ZBJA 4U2AA 2GMEA 1FATA 1QNWA 1LTEA 2DVFA 4XYXA 5GZCA 1QOOA 4UW4A 1YO8A 4GALA 3LSEA 1F9KA 4P9WA 1MS8A 4YGDA 1MVQA 2R16A 4Y1UA 4XJAA 1JYCA 3IKWA 2YY1A 3KQRA 5DUVA 1UMZA 1W6OA 4FPLA 3OJBA 3TAYA 3M3CA 4IQPA 2DVGA 2YZ4A 4YZ3A 2I2SA 2ZACA 3M3OA 2E51A 3D5OA 1G9AA 2P3IA 3B00A 4R9CA 3QCWA 4ISQA 1ENSA 2ZGPA 1Q8PA 1SBEA 1DZQA 2GDFA 1A3KA 2C9AA 3AK0A 3MEPA 1DQ2A 2ZGLA 3OYWA 1QNYA 4PCRA 5CNAA 3RG0A 5T5OA 4YGEA 1S0IA 4YW3A 5E89A 4XHXA 3ZXFA 1RIRA 4YM2A 4CZSA 3WHTA 1IS5A 1YRZA 5EYYA 1AXKA 3V0BA 4XBQA 2A5ZA 2FHRA 3DGTA 4DQAA 1AF9A 2ZKNA 2OUJA 1S0GA 3FBYA 4GKYA 4BQ1A 3IPVA 2EF6A 4D69A 1G9CA 1CONA 1IS4A 2VY0A 3AX4A 1A78A 3AXEA 3AZYA 3B69A 3HN1A 3T2TA 2PHRA 1D0HA 4XBLA 2C5DA 3AP4A 1BYHA 1IS6A 4FPJA 4BMEA 3WG3A 5DXDA 4C1XA 3OPZA 1Y7BA 1DQ1A 1C1FA 4M01A 3ZXEA 4Q1PA 1LHNA 1WLDA 1ONAA 1D2SA 4LBLA 3ZSMA 1JXNA 2D3RA 4BLJA 2ZHKA 1S0CA 4FPYA 1YI7A 1V6MA 2AYHA 2PHWA 1AXYA 1BKZA 1GZ9A 1UL9A 4FPOB 1I1EA 3AJZA 2TEPA 4F83A 1Q8OA 4Q8LA 3AZVA 1LHUA 4XTPA 3OY8A 1WCSA 4M00A 1LOEA 2DWRA 2JJ6A 2ZGQA 2A6YA 5IK7A 5GLWA 1QOSA 5LK5A 5HCBA 3ZXKA 2V5YA 4YM3A 2DUOA 2UWCA 5T5LA 2DYCA 4P9YA 1X50A 2OUHA 1LENA 1WW4A 2VW2A 2CWMA 4FPKA 3JUUA 4UW6A 3A0NA 1G8WA 3POSA 1VALA 3VKOA 2D3SA 4XMAA 4TYSA 5KXCA 5DUWA 3SH5A 1UN1A 1SLCA 2E53A 4Q26A 2NZ9A 5DZGA 2LTNA 4MYEA 3UJOA 1DLLA 1LOCA 2D6LX 3O12A 4JC1A 2DVAA 3WG4A 1LEMA 2ES3A 4GXLA 1LODA 2ZGSA 4RA0A 4XMIA 3WCSA 4YG3A 5SV8A 1SLIA 1S0JA 4Y26A 1KQRA 3NV2A 1MZ6A 4P9XA 2D7FA 3ILFA 1N1YA 2A75A 2ZGKA 5EXOA 4FOYA 2UU8A 3WG1A 1LOAA 5IT6A 4I30A 2ZMKA 2UWAA 2VH9A 4LBQB 3V0AA 2WKKA 2SLIA 1TEIA 2XB6C 2DVBA 3RMXA 1C4RA 3A4UA 4YZ2A 1V6OA 1DBNA 1ULGA 1WLCA 3ATGA 4BMBA 2NMNA 3PVNA 2JECA 2W52A 2PHUA 5KXBA 1IS3A 1LGCA 1W6PA 1WLWA 4YGCA 2GN7A 1IOAA 1LU1A 4YW2A 2R49A 3LSDA 1LHWA 4GKXA 3AP7A 2JDZA 4BPZA 3AP5A 1LULA 3N35A 3VKLA 1MZ5A 3OYWB 2EXHA 1QDOA 1FX5A 3WCRA 1AX1A 4Q2FA 3USUA 5H9PA 2Q5TA 1LESA 3B9CA 1LHOA 4M3CF 4Y20A 4R9BA 1GLHA 3AP6A 1SLBA 3AP9A 1URXA 1SBFA 4FP3A 4LBQA 3SISA 3V0BB 4DS0A 1V6LA 5JOYA 2WT2A 1VLNA 4LBOA 1CPMA 4Q1RA
chains in the Genus database with same CATH superfamily
1KDMA 3GF6A 3HEIA 2XGXA 1WUVA 1VBC3 1POV3 3ASIA 1HXS2 3SHRA 3WW4A 1W3XA 3O1TA 2XJQA 4PJYA 4XUTA 4MHUA 3MBWA 4JKKA 1CGPA 2HWE2 3OB8A 3M8LA 4PBOA 1L7RA 3Q8AA 4PQ9A 4HXCA 4CDXA 3VZKA 5DQ0A 1UF2C 1W6QA 1GP4A 1XYPA 5IAXA 2QDRA 5C33A 5FP4A 4BQ3A 1XNKA 5K0UB 1RUH3 1W2NA 2BGCA 3K3NA 2BFUL 4CP1A 5FY0A 3KM5A 1N47A 3CJIB 3R0RA 4LLOA 5A1AA 2AR6A 2UYAA 4J1WA 4JV4A 3N36A 3O1PA 1HV0A 5IK8A 2B7YA 2PMWB 3LE0A 2X05A 2XHKA 3LIGA 1O5LA 2A3WA 3KSCA 4N7IA 4Y22A 4BK5A 4EJRA 2XVLA 1VAVA 3CL1A 3S7EA 1RUI3 4LR4A 4JGYA 3I2JA 4EYUA 1BK0A 5DABA 2IVIB 2BRTA 4PHZA 1UIKA 2DTWA 3ZYHA 5AVPA 3D82A 4ZS3A 2VZSA 1VAKA 3VBSB 2WBKA 3IIIA 4QMAA 5JZGB 1BQPA 5CKQA 5BNNA 1OUSA 4YG6A 5FXZA 4B29A 4XJ9A 4MHRA 2BYVE 1IKPA 1YFXA 5K4LA 4EROA 4QQHA 3OD0A 1NAEA 1EY2A 4D6RA 4LTAA 4UW3A 4GD4A 2VZRA 3SXWA 1O7FA 2B46X 3ES1A 4P9LA 1MR5A 2Z69A 1QJX1 4AGVA 2XWBB 3LDRA 1PVC1 2VUCA 3N7JA 4HONA 1XJAA 2VMDA 2WAOA 3ILRA 1JTZX 3TN93 4RGGA 3RI9A 1VE0A 3PUHA 4ASKA 5A3UA 2IXJA 4UXAA 1OXCA 5I8SA 4E2QA 3NQHA 1B35B 3D3AA 1DQ6A 3GZAA 3VZMA 5F5QA 5FZOB 4F8AA 3VBOC 3PVBB 4AHWA 2W68A 4XFGA 3ZXJA 2E26A 3ZFFC 1DHKB 2VUAA 3NKTA 4OUMA 4Q4X1 3LPFA 3UESA 3JU9A 1W0PA 4N53C 5FDBA 5H9QA 1MQTC 1PZ7A 2F4PA 4Y1YA 4AI2A 1IQAA 4BM8A 5A33B 1QJY3 2JIGA 4QPWA 4XDQA 3BIEA 4HMZA 3OD4A 1ULCA 1WD3A 3FBMA 1EV11 4IV3B 4QHZA 4YPJA 2P3KA 5C71A 1TQ5A 1WD4A 2W1QA 2D6PA 1BCXA 3PURA 4AWDA 5A7NA 1CN1A 1UXZA 1OA3A 1UO9A 3DYPA 4K8RB 1IKQA 1Q8SA 4FQ4A 1QOTA 1W8ZA 1HRI2 4RR3C 1ACCA 2JICA 3P5BA 4XFIA 1KS5A 3OBZA 2ADDA 1GYKA 3NJXA 4YRDA 4OFGA 1QDCA 4COVA 1O3TA 1QQP1 4L0PA 3BOPA 4BIOA 4XPVA 3MF9A 2GNMA 3LFIA 1HLCA 2DV9A 5GLTA 4DINB 4JTOA 1D4M1 2A6VA 1TNRA 3IM0A 1GR3A 1G7YA 3VD3A 5GKAC 2ORXA 1AJKA 3N9QA 4TSVA 5J48A 1V6JA 3T30A 1UKGA 1RUC2 3RSJA 5LBFA 4NWVA 4A7ZA 2XJVA 3UJQA 5A6XA 1N1SA 4ET7A 2K2SA 1OQ1A 4X8NA 4G3YC 2FDJA 3DL3A 5GZDA 5DUXA 4I2OA 3C7HA 2NPIA 3E97A 2D6OX 4B1LA 2JG9B 3VHPA 3KB5A 1JW6A 5T55A 4COUA 1NY72 4XFHA 4ISRA 1JHJA 2FCTA 3NV3A 4C91A 2DVDA 5GZGA 1YI9A 4H7LA 1C8M2 4NO4A 4TXWA 5F7UA 4LKFA 5F8PA 1LB2A 1BLZA 1KGYA 2WS92 3ACFA 2K46A 4HVRA 2BWAA 1AR91 1QEXA 1SBDA 4XUQA 4AL9A 5L7OB 1QWRA 1OC1A 1W9YA 2PHDA 3EJKA 4BB3A 3D6EA 3JB4C 1DGRN 5DAXA 1WW6A 5FOBB 1JOJA 2ILMA 2CWSA 4M3CB 1W05A 1DQ5A 3FC0A 4FTSA 4CU8A 1SLAA 3WQ0A 4XCBA 1C57A 3TEXA 1OI6A 1POQA 2WT1A 4JQTA 3GBWA 4QGNA 1ZM1A 1LNSA 2X53S 3C2UA 3LCPA 5D8AB 3U07A 2J1SA 2A71A 4L97A 4NHXA 1MEC2 4M4PA 4B7KA 4XFCA 5HCHA 2YHJA 3MLLA 4PF1A 1DYPA 4E4SA 1DIWA 2P3YA 4K20A 1VAMA 4LULA 1CX4A 4CCDA 4FBFA 1AR81 2D6KA 2EXJA 3IDBB 3DEMA 5CFDB 1BHGA 1VBE2 3KV5A 1A8DA 4HZFA 2JE7A 2IXHA 3NJVA 4UWDA 5EIYB 4OYUA 1BBT2 3CBNA 1RUOA 2JD9A 2W5FA 1OKQA 1RHI3 2WNVC 2BNNA 2YC2A 1WW5A 2VZTA 4LEJA 1XU2A 4LA2A 3HNMA 1W6NB 3VD7A 3BCWA 2HWF3 4K9SA 4YFZA 4CEWC 2HWB2 4K6BA 3ACLA 1LGBA 1JYIA 3BPZA 5GLVA 1AL0G 5FMOS 4NIIA 5A3NA 4Q4W2 1C5IA 4CA9A 1VR3A 1VRH3 2WFF1 4MOAA 4BQ4A 1JZ6A 3VBRA 2CYFA 1FAYA 3T08A 3WNKA 3RJ2X 5AC93 2ARXA 2ARBA 4AVVA 4JHTA 1ZZ8A 1YIFA 4QPIA 3FHIB 2QQOA 4WM8B 4W6YA 5HV0A 3WVJA 2KA3A 3FFQA 4D7SA 3RMYA 3J7MA 2C24A 2ZKLA 4M0NA 4INDA 4M4RA 1MPXA 1LGNA 4LA3A 3K4ZA 4PDWB 1QH6A 3BOWA 3IDEA 5FJHA 4QXKA 4AEDC 5BNOA 2NP0A 2X29A 4EN8B 1HQNA 5C8WA 1S55A 1STMA 1NG0A 4HANA 4O61A 5KR7A 1RUD2 3A23A 1S2KA 3S30A 2VZPA 5EYXA 5IAVA 1BVP1 3RGBA 1VB4A 1GBGA 2W1SA 3OBRA 4RHV2 4XJWA 3ZFGC 2Z2SB 1Z78A 4EWAA 1YC61 2E32A 2JDYA 3GM8A 3IZOA 3ZXGA 4FOVA 5FYSA 1TME2 3RZKA 1E57A 1NCQA 3UNPA 5GZEA 5KXEA 4DXRA 1AXZA 2C1FA 2RJKA 1AHSA 2YC0A 4QAWA 2WSUA 3HAGA 3TRSB 1IQDC 5T5PA 1WA4A 3DECA 4JDMA 3K2OA 4XIOA 1EUTA 3R4SA 5HCAA 1AVBA 2YBSA 2WIIB 4LBMA 4LHLA 3KVAA 4D7YA 1LU2A 1WCDJ 4MUVA 3FHQA 3EO6A 4PLMA 2BOIA 4QPYA 4GWMA 1PZ9A 1PIV2 3WNLA 4DPNA 2B8MA 2VOWA 5H9SA 4DY3A 1KS4A 1HRV1 1RMU3 2DFCA 5GLUA 2W1WA 3KLSA 3PNAA 2PLV3 4HG6B 4RS5C 3SH4A 3ZFEA 4Q4W1 2EIGA 1BJQA 2GMPA 5FYCA 1WGPA 5GZFA 4KGGA 4LXLA 1ZZ6A 4CCLA 3RYPA 2A6ZA 3NSTA 2ZGOA 4DIQA 4FPCA 2VXJA 1IPSA 3VBUC 1IG3A 3VBHB 1UCXA 3WUCA 4C0BA 3EBRA 1F5JA 2VO5A 1CD3G 3GJAA 1VBA3 4QXCA 1E5HA 1GANA 3H42B 2D5FA 3OCPA 4WVWA 1HDKA 3OUHA 2XJRA 1DGWA 4XFFA 4CEYA 5A7WB 4ZU7A 2QFEA 3WNXA 5CAZA 4JTNA 2GP3A 1LEDA 1NXMA 4MGTA 4OMDA 4NVPA 4RHV1 2ZXQA 5L73A 3TNPB 2ZMNA 2OQ6A 1RUH1 3LB9A 5KWRA 3L2YA 4AAPA 1TME1 1W8UA 3VL9A 4FO9A 4OHYA 2OW4A 2ADEA 3EMRA 2W87A 1HB2A 1W04A 4OI4A 2QBXA 4D3WA 5ACA2 2XLAA 1SQ4A 5E8AA 5C9AA 2D98A 3FN9A 3H1MA 4MZUA 5CB7A 5FZFA 1TZOA 3CU7A 3N7LA 3I2IA 1NA1A 4R4ZA 4XUNA 5F3GA 1R082 4FPFA 2IXLA 3ZXDA 3JBG1 2HEVF 4UBGA 3HQXA 4QB2A 1LTEA 5A1FA 4XYXA 4LHSA 2IFWA 2QVSB 4HPKA 1NZCA 2A73B 2VUJA 2J1UA 1J3RA 4AVAA 1F8VA 3HNBM 4B7EA 1GOHA 4UFHA 2BVVA 2G9FA 1CAXB 4Y1UA 3ZYJB 5L9BA 3IKWA 2WR9A 3ALQA 2VL4A 3MIBA 3MF6A 1UMZA 5CADA 1ND2A 3ZDSA 3NAPA 1R092 3M3CA 4FFHA 3O7OA 3USSA 2I2SA 2Y38A 4E4HA 1PGL2 2YPJA 3D5OA 5D2AA 2DCJA 3S5QA 4OHZA 4ISQA 5F5CA 3MUY1 4Y24A 2XQRA 1W2OA 2C9AA 3AK0A 3I49A 5BV6A 2ZGLA 3RG0A 3I2HA 4PCRA 3TN91 5T5OA 3TOJA 2BTVC 2EVXA 4NIGA 2ZX4A 3VBFC 1HB3A 4BCUA 4YM2A 3WHTA 5EYYA 5FZHA 3KT4A 2HWC3 3VDDC 4AEMA 5L9VA 3H50A 4OI2A 4XBQA 1REFA 3V0BA 2FHRA 2WQ4A 1YNAA 1YQ2A 2BERA 3WY6A 4ARXA 4OI0A 3IPVA 2EF6A 4QKNA 1CONA 3AX4A 3JCIA 5BNPC 2VM9A 3NNJA 4LHNA 4XBLA 1BYHA 1RUF2 2D97A 3BYWA 3H7JA 3IAPA 1ZBE2 4XFBA 5FAXA 3VDCA 3WP4A 3KF5A 3K51A 5G05L 3O1VA 1SDWA 2QKDA 5EP9A 4EN6B 5FWEA 5K8SA 1PMHX 1QJY1 1R081 4M01A 5FP8A 1JH5A 1WCQA 4Q1PA 3D0JA 1WLDA 2PHLA 3I59A 4TLFA 3O1OA 4CDQB 1M06G 5FY7A 3PU3A 3DPRB 4JGZB 4ZU5A 3ZSMA 4AW7A 1QIQA 2XJTA 1VMFA 1JZ7A 1VBB2 4BLJA 2QQPA 2VZ1A 1ZX5A 2JDHA 2JG8B 3OPWA 2AYHA 2RM22 3J8F3 1AXYA 1UL9A 1WWYA 2D93A 1UMIA 4FPOB 4UFIA 3SKJE 3OEAA 4QX2A 4B3NA 5E16A 5FP7A 1Q8OA 4CP9B 4HOOA 4X6RB 1E5RA 4F7ZA 1JU3A 1LHUA 1Q5OA 3OY8A 3U78A 2VMHA 2XDVA 4QDSA 4QB1A 2QQMA 3WNNA 5J1XA 4BQ5A 3WF3A 4WM7B 2ZCWA 5FPZA 1ZNPA 3IDCB 4IEZA 4MGZE 4ZONA 5F6KA 4JDNA 3VD5A 4QPGB 3RZHA 3BKZA 1RVF2 3PHMA 5DDJ3 5A3OA 2BNOA 1QOSA 5LK5A 3ZXKA 2DUOA 2UWCA 4XUPA 5T5LA 3HBKA 1LENA 1AYN3 3LGRA 4UT5A 4UW6A 2XONA 1G8WA 3POSA 4FCAA 1VALA 2D3SA 4HKLA 2X5IC 4CCMA 4UF0B 2BGPA 2ZS6B 1UN1A 1GWKA 1SLCA 4Q0UA 2NZ9A 4Q26A 4MYEA 5DZGA 3UJOA 2VZVA 5ABJB 2R042 4N7UA 2CGNA 3LF7A 4XMIA 2RMU3 5HV4A 1RUF1 4CDUC 3X29B 4GIQA 5FZ7A 1ZBA2 1RUJ3 3NNFA 1VBD2 5LASA 2WNUC 2D7FA 5JPMB 4WZCA 1N1YA 2A75A 4FOYA 1HXS3 1Z7S3 3WG1A 3O14A 1LOAA 4I30A 5JR7B 3ACHA 3W5MA 3AMMA 2WKKA 1W99A 2HWE3 3QH6A 2I74A 2MEV2 3A22A 4YYOA 1AR72 2XKOA 3O1UA 2EIBA 1NYWA 4YZ2A 1CAVA 2UY9A 3PUIA 1DBNA 1XSRA 5BXXA 3ATGA 4JKMA 1U12A 1ZRDA 2JECA 3AMPA 1QJEA 2PHUA 5KXBA 1IS3A 2J1AA 5D21A 4QWNA 4CP2A 2VBBA 4KMQA 5FP9A 3LSDA 1HIXA 1TNFA 3P1IA 5F1RA 5K0UC 3UGHA 1PO12 3KGZA 1O91A 2BJSA 1LULA 3WCRA 3W5NA 3CJIC 2FBEA 2EXHA 4RQPB 4AFMA 2R32A 3USUA 4FXGB 4R8HA 1YQ8A 2FZ2A 4MADA 4Y20A 4R9BA 4IEXA 2ZEZA 3AKTA 4AXOA 5JSOA 4RD7A 1U5IA 4Y5TA 1ASJ2 1RHI1 4L11A 4D7TA 2WT2A 1NUKA 4QKBA 1RB8G 2WO3A 5J7MA 3P3PA 4Y22B 3ZFFA 4FAGA 1BK1A 4Y4RA 4ATFA 1J3PA 4KWLA 5FYIA 4XF1A 5EJZB 1S0BA 3POBA 1CAUB 3SCFA 5DZEA 3VBSC 4LLFA 4QQ2A 5I0RA 1UY0A 3AVSA 4IE0A 4NRMA 5FYTA 1VRH1 1C3HA 5FPVA 5AC91 4AI1A 2V4VA 2VOVA 2YMZA 4LO4B 4XJUA 1YWKA 1RXFA 2AGSA 3LEMA 5C7GA 3BU0A 5K7PA 5JOYA 1AL23 1SLTA 1D2QA 1OURA 2E7QA 1UY2A 3FWEA 4NN0A 3RYKA 3O5SA 4GMP0 3ORJA 4DY5A 4QB6A 2J1VA 4MGIE 4RR3A 2Q8EA 4HETA 2PELA 3AXDA 5GLZA 4FVVA 3N9MA 4DO0A 1EP0A 1LKNA 3MZHA 3ZSEA 4YM1A 3PVEA 4XE9A 1JODA 3IB3A 3T2PA 5JOWA 1B35C 2OZ6A 1BVVA 1QJZA 1CZVA 1NKGA 1PNGA 1UY1A 3K77A 4H55A 4HFSA 2W95A 1US2A 2WZR2 2VD7A 1JU4A 1AR61 3VUOA 1J58A 5CISA 1LECA 1DLCA 5JXIA 3V64A 5F39A 3ZVXA 1CESA 4XFAA 3FLPA 1JZ3A 4A6SA 2MNGA 1NCRB 4P02B 1RUNA 3GBGA 4DXTA 1FPN3 4N43C 3FLTA 1H1AA 2IZWA 1W9TA 1H6YA 2UY8A 3LQCA 1LOBA 3WDWA 1U5XA 2H0BA 1OHFA 1KFUL 2LROA 5JMOA 5FYHA 5A70A 2RDQA 1MS1A 1W6MA 2R1BA 3WF2A 4LO7A 2AUYA 3S7IA 5JI9A 1RMU1 1UD1A 2RJ2A 1ODMA 2ZGUA 5F32A 4FP2A 1HQWA 1XQNA 3OEBA 1Q8VA 2RJLA 3UKNA 2RS32 3WQ1A 1FMD3 4NPMA 1HV1A 1OQEA 1NQDA 5BUVA 1JZ8A 2QJVA 1OF4A 5F5AA 1OD3A 1KFXL 1NX9A 3GZEA 3TNQA 1ST8A 4LKEA 3V0AB 1RUE2 3NNLA 5IVBA 4RYDA 4MXWA 4JRAA 1F4AA 2O0OA 5FZEA 1YJKA 1PHMA 3DCQA 4XXPA 1H0BA 5E6HA 5FFOC 3N4MA 1D7PM 1W6PB 1AZDA 5LA0A 1YIPA 2VTXJ 1UW8A 3VGIA 1BXHA 4XDOA 2BOJA 2ZHNA 1O3QA 3VKFC 2PA7A 3ZPYA 5FY1A 3H0OA 2HBTA 4WVVA 5A7PA 3EYPA 4BIFA 3N7MA 2RS53 4I0WB 4UYBA 5CA6A 1REEA 3C7OA 4QM9A 3NJZA 4QX7A 3I3EA 1TMF1 4LKDA 2WNVA 3KMHA 4XF3A 4EQVA 2HWD3 4DNYA 1YYNA 5FMCA 5FKCA 1G9DA 3A0KA 5L7OC 1OVSA 4SLIA 3H8OA 5BPXA 3W58A 4CCCA 5T54A 3RQ0A 4CEWA 2HJIA 4AFBA 4E8CA 2R6QA 4BJ0A 3BPSA 4PQQA 2EAAA 1MVEA 2EAKA 3M4FA 2GH8A 1MACA 2EA7A 2YGLA 4FQZA 1UQXA 4LMFA 3LWCA 4XQDA 3J7LA 2WNEA 2D44A 1N3QA 1UX6A 4YVWB 5FZDA 4COWA 4U36A 5I0DA 3T0BA 2JB4A 2JKXA 5T52A 3R05A 3KT1A 3P6BA 5FJKA 1MS3A 1ND3B 1S2BA 2WQ8A 4AEDA 4Z1VA 5JI7A 1SFYA 1W2AX 4PIXA 4XJ8A 4A45A 5C3QA 4E8DA 1BBT3 4HVQA 1QJX2 1SLLA 3HMYA 5CFDC 1PVC2 5BYNA 5JR2A 2LALA 3OOXA 3WQBA 3ZFGA 2B9UA 3O0XA 2J7MA 4A44A 4BXSV 4V2WA 2HWC1 1KDKA 1F4HA 3E6BA 3GALA 2G9GA 1YQ5A 2OPWA 1OQDA 1W0OA 2WABA 4J6GA 3PTYA 4NPLA 2XLFA 4GMP3 3ELNA 3MV01 4OUEA 4GULA 5T50A 5F2SA 4MG2A 3LDBA 4LBNA 5FYUA 3ZX7A 4I09A 3MLJA 2OPKA 2VNRA 3AKSA 1FOD1 4MGYE 4I0BA 4XIKA 4IE6A 1T2XA 2Y60A 4Q4X2 5CYYA 3U4SA 3VBRB 2P6HA 4Q0VA 5KHJA 4AGGA 2VC9A 1ODNA 5A3LA 4MO3M 4WM8C 3POIA 4CRQA 2XBO2 4J25A 3BU7A 4RS5A 3EHKA 4NR1A 3ROUA 4BOWA 5L36A 1GNHA 1GFF2 1H1IA 2GN3A 1EV12 3ILNA 4Q0QA 3ZO0B 1ENQA 4CTEA 2VMFA 2W9XA 4IGQA 3N3HA 3CZUA 3WNOA 3NWKA 3WDTA 3NKGA 1EAH1 4Q5OA 1FNZA 2QQLA 1ZRRA 2J1TA 5LZ6A 3VBUA 3A21A 3E6DA 2AEYA 2C0ZA 5FIXA 3VKMA 1LHVA 3SCHA 3GHNA 1EPZA 5LW9A 1GSLA 2BV4A 1QQP2 3K3OA 3RJRA 3F95A 3I2GA 5KHIA 4IEPA 1NCQB 1TG7A 2VQTA 2F4LA 1W2UA 2FMYA 1COV3 2BWCA 1RINA 3J9SA 1D4M2 3UKTA 2VBPA 1J1LA 1PIV3 4FAHA 1RC6A 5LEJA 4ZPIA 1K5MB 2ZGRA 1OOPB 2VAUA 5JPNB 3VDBA 1J1TA 4YVSA 3B93A 1ZYBA 4CCEA 4Y1VA 4MGQA 1H6XA 2Y6LA 3T4VA 3PIGA 2YROA 4Q0PA 2PHTA 4I0AA 4DRRA 4YSFA 4R52A 1F5FA 1UU4A 5C3RA 2FMDA 4A3XA 2YYOA 2X10A 3Q8CA 2WRAA 1GMMA 2RMU1 1GNYA 2A3XA 1RUG3 3ZFEB 1AX0A 1OSGA 5D1IA 2XUEA 1CVNA 3SH3A 4DOUA 3ZDVA 1PX4A 3RI8A 2P37A 5LWBA 1Z7S1 1S1AA 1DGWX 1R1A1 4Q4V3 1AR92 2IXCA 4N90A 1W90A 2R071 2XBO1 3CQOA 3JZVA 2CL2A 2VVEA 1SCSA 4NROA 2B45X 4XUOA 3VBHC 3ZR5A 2XWJB 3KCYA 4S2FA 1G9FA 1JZ5A 4FOQA 2OT7A 5LRRA 5ANNA 4QGMA 5I8TA 3MW4A 4ZKTB 3HIFA 3TWIA 2IVJA 3WDYA 4P9JA 3CMGA 5HXMA 1H9PA 1DU3D 1K12A 1AX2A 1YUDA 3N9OA 1SG3A 3WHUA 2Y8KA 4RGKA 4BLIA 1DF0A 1RJ7A 2QZ3A 4LITA 5IVJA 2BFUS 3VBFA 4XF0A 5M0TA 1FV2A 4IE7A 4E4DX 1JHNA 1HB4A 3JQXA 1AR82 1H4HA 4JVAA 4UFKA 5C9AB 3H8RA 5LRSA 5EFUA 2D40A 2YPDA 4C90A 4CUCA 1KEXA 1NA1B 4KG0A 1BZWA 3SC7X 1NXD1 4O65A 4AFDA 1O4YA 1REDA 3WDVA 4CDWB 1O4ZA 1VMHA 2EXKA 1XE7A 2W39A 3M70A 3NW4A 3D4KA 4HN0A 4LK7A 5F3EA 1ZRFA 3MPPG 3ZKUA 3RDIA 1VMJA 3T1LA 4FTBA 1BEV3 3FLRA 1VPHA 2DUPA 4E2SA 1QF3A 1XNTA 4GB33 2C4XA 2WYSA 2E6VA 2DUQA 4EWDA 1HQLA 2WFF2 1LR5A 3FJSA 5I8YA 4L8QA 5FP3A 1W06A 1X36A 2WFPA 1CIWA 1OLRA 3QACA 4LQRA 1AL21 1F15A 3M3EA 5IK4A 2XXZA 1LCLA 3OBTA 3LEIA 1VB2A 1V0AA 2EIDA 3APBA 4L92A 3I8TA 4IW3A 4CCNA 5FPUA 1X9TA 5FUPA 4URTA 4XABA 3GDBA 1IHMA 4K1ZA 2AREA 3UETA 3V56A 2ZBJA 4U2AA 2GMEA 3MO4A 5I93A 1FATA 1QNWA 2ARAA 4LO8A 4ES8A 2Q30A 1H2NA 4CCOA 1OD5A 5GZCA 2XJPA 4UW4A 4ES9A 4V1PA 3VD4A 2QQIA 4YGDA 4GB32 1H4GA 2R16A 4P9IA 1JYCA 4IEYA 2YY1A 3KQRA 5DUVA 3THCA 3RVHA 4XAAA 1IGOA 2MPFA 4UFJA 5A6YA 1ENXA 1JOBA 2X5IA 3OJBA 4AEKA 2C6SA 3ME2A 5EHDA 3ECQA 4AQ6A 2ZACA 5IFPA 2HYXA 2P3IA 1UU6A 5JCTA 1ENSA 2QQKA 3PUSA 4CDQC 2VQUA 1DZQA 2EICA 1A3KA 2IUWA 1W9WA 3DPRC 4JGZC 3THDA 4KQ7A 3ZYRA 1XSQA 4CDUA 1A34A 4YGEA 4YW3A 4G4FA 4XHXA 1V9U3 2QUOA 2JG8C 4CZSA 2XPJA 1IS5A 1HRV2 1FMD1 1YRZA 3CIHA 3W9AA 4XQWA 2VR4A 4XAEA 4DQAA 4GAZA 1AF9A 2B39A 5FZKA 2OUJA 1O3RA 3MUZ1 1SPPA 4EN7B 2RV9A 3LA7A 2YDEA 1IS4A 5LCWL 4WM7C 1A78A 4Q0SA 5LB6A 1D0HA 4QPGC 3THTA 2WO2A 3AP4A 2PAEA 3ETQA 1IS6A 1C8NA 2BPA2 2IWGB 5DXDA 3J7HA 2YB7A 5J36A 4C1XA 1VBC2 5CVRA 3TBDA 3WNPA 3GHMA 4HLTA 5K0UA 2GH2A 4OHVA 3GXUA 5A6ZA 4Z82A 2W94A 1K5JA 2P17A 2R043 5CFCA 2D3RA 3MFAA 2W47A 1UKRA 3BGAA 2WC2A 3VZLA 1DGRA 1CZTA 2JDNA 1V6MA 1ZBA3 5EZWA 3OUJA 5ABJC 1BKZA 1GZ9A 1RUH2 2RS11 4EZHA 3AJZA 3POFA 3K46A 4OCTA 5HBAA 1QJU3 4BQXA 2HWD1 3AZVA 1WCSA 4M00A 3LOIA 4HT1T 3NMBA 4AI9A 2IXIA 2RE9A 4A6OA 5C6CA 2DWRA 3WR0A 2PTMA 2BUKA 3EXUA 3C3VA 4LO6B 3IT8A 1OF3A 2V72A 1O8SA 3PU8A 3JBG2 1WZXA 4OVEA 5GLWA 4BA6A 2G19A 2DYCA 2W0XA 3B7MA 1UYXA 1X50A 2OUHA 5L19A 1WW4A 5AFBA 2CWMA 2PAMA 4FPKA 5FZMA 3UV9A 2K0GA 4BE3A 5CU1A 2XLGA 1PO13 1BMV2 2AEZA 4XMAA 3SH5A 2E53A 2J42A 2LTNA 3DYOA 2VUDA 1LOCA 4B8EA 1ZZBA 5J37A 4NHYA 2YFZA 4HVOA 1LEMA 4RQPC 4RA0A 3WCSA 1B35A 5FZ0A 1NZIA 1SLIA 4PT6A 3ACGA 1MZ6A 1NE4A 3PMSA 4P9XA 2WWSA 1VBC1 1POV1 4X6QB 3TN92 5FZOA 3DKQA 3WEZA 1HJFA 2UWAA 5A3PA 4W6XA 4K40A 4B4RA 4LORA 1TEIA 3RMXA 3EQEA 1W0NA 3A4UA 1YQ6A 4WVMA 3BTYA 1V6OA 4KWKA 2BEOA 4N43A 3PVNA 1WCKA 2W52A 1PX3A 5A33A 3POEA 2H6BA 1IOAA 4YW2A 5E1RA 2CDPA 4MSVA 5ISLA 1LHWA 4GKXA 3AP7A 2JDZA 1CIYA 4P5HA 3N9NA 2BU9A 4S2DA 4BPZA 2W3JA 5TSWA 1MZ5A 1QJY2 3ABZA 1QDOA 3OYWB 4Q4Y3 4UFMA 4AQTA 1LESA 2OQ7A 3B9CA 4IDZA 4S2HA 4AI0A 5HI0A 1LRHA 1RJ8A 1LHOA 1RUI1 4M3CF 3L2HA 4ZZ8A 4KI5M 1GLHA 4FSJA 2XH6A 4AQ2A 4FP3A 4RR3B 1QY4A 2Q0AA 3VZJA 1TVGA 3UT0A 4AOCA 2VNVA 3RZJA 1CPMA 4IXLA 1QJFA 1BMV1 1Z0HA 2WN2A 5LA1A 3MIEA 4YG0A 1E5SA 1VIWB 3Q8EA 1GZTA 5C4WA 5C8CA 4B4QA 3INAA 3K75B 1IPKA 4XZUG 3ZXAC 4IL7A 2XJUA 3ZYPA 1CJDA 4LKSA 5KBFA 5DN2A 5HXVA 1NCRC 1H2KA 1UAIA 1COV1 3QLQA 4K1YA 4Q27A 2UWBA 3LDKA 2CAUA 1XXNA 1ULFA 2YBPA 4P5YA 1FV3A 2NMOA 4IV1B 1OFSA 2R063 2CGPA 3WW2A 1PK6A 2RS33 4W6WA 3M2MA 3CDZB 1UPSA 3OGGA 3T2OA 4CXYA 3ZN5A 3RZMA 5JXHA 5JUVA 2VZQA 5FZ1A 4BQ2A 1H2LA 3LA3A 4OMCA 5L7OA 2I07B 3S0MA 3ZYFA 4CU6A 1ULPA 2RDSA 3WT3A 4DEQA 3WOGA 3K4AA 4QQPA 3ZSLA 1AYM3 1RUG1 4E9KA 3ZMOA 5F3CA 4HKWA 4XHBA 5K9YA 1AUYA 5EQUA 3MW3A 4O9GA 1PO23 2PHFA 2Y26A 4M3CA 2QE3A 3UKVA 2TNFA 3MI8A 2DTYA 4MV2A 2DBNA 4NOTA 3ZPOA 2Q8OA 1JBCA 4ASMB 3BVCA 2ET7A 3AZXA 5A6QA 5GM0A 3POWA 3WX5A 5IYYA 2Y6KA 3JD73 1WBFA 4GH4B 3I2DA 4YW6A 4P14A 5FY5A 5LA9A 2P4EA 2CSGA 3KF3A 3LAGA 2UYBA 3PVOA 2KR2A 2RR13 4OZOA 5CFDA 2A3YA 5KHGA 3VL8A 1S2EA 4DFSA 2BBAA 4HBNA 1J84A 1RYYA 3B01A 1C5HA 4ZY9A 2Y0OA 2ZX3A 3CNAA 3KWVA 1HN0A 1QXPA 4GQ7A 3IIAA 4TLGA 4C1WA 3RYRA 2TBVA 4M3CE 5DG2A 3ZMNA 5JOXA 3VD9A 1P8JA 1W6NA 1O4TA 2GALA 4O9EA 3T09A 1O59A 1DDLA 2GP5A 5DAVA 2JE8A 4ATEA 1H8TC 2ARCA 5IVFA 1RHI2 1MS0A 1PM4A 1ULOA 2YU1A 3M3QA 4ZS2A 4W65A 2CV6A 1X8EA 3J26N 1ZRCA 1CJPA 4YM0A 1LOFC 1PGW2 4YVWC 5E88A 1BEV1 1K45A 4GB31 4QGLA 4WM8A 1VRH2 1H9WA 4UOJA 3IWZA 1JI6A 1XOYA 5H9RA 4LK6A 3ZR6A 3WNMA 5AC92 1I3HA 1XU1A 1ND3C 1PVC3 4IETA 4XOGA 5FZ4A 4DXSA 1UMHA 3AYDA 4XURA 2Y34A 5LBEA 2AENA 2WLQA 4YWAA 5EWSA 4Y1XA 4JQRA 3SCGA 4XXAA 3VHRA 5EJ1B 4RFT0 5JAXA 2VZ3A 2A6WA 2VCMA 1SCRA 5F37A 4OQ8A 5JIUA 3ZFGB 5FZAA 1DZTA 1R1ZA 2PYTA 3MPBA 3OGVA 2O8OA 3K48A 4JAAA 5FMBA 4R9DA 1SDDB 5FUNA 4AFCA 2ZHMA 1YCIA 3V65A 1JOPA 1AJOA 2ATFA 1AR62 2BBVA 4CDXB 4Q4X3 3RPQA 4W50A 4DMIA 1W6QB 2YC4A 3VKNA 3GYDA 3WLUA 4DB5A 5JLVA 1SEFA 3LFMA 3AL5A 3ZYGA 3VBRC 5DUUA 5FK8A 1DFQA 1YFWA 2R30A 3UYJA 2XHNA 3QD6A 5CZKA 2HYKA 2ZGNA 1Q56A 5FLJA 3WV6A 3VBOA 1QGLA 4BWOA 5C5UA 4PI0A 2WUHA 1R64A 2D6NA 3FZ3A 4I01A 1W3VA 2B9VA 4NHKA 4F3JA 3W59A 1PGW1 2HWF1 1OT5A 2JDAA 1RMU2 4JGYB 3HR9A 1XBFA 3E5QA 4I3PA 4N53A 1DG6A 3VV1A 2BQPA 1MQTA 3WDUA 3CJXA 3ZN6A 2AH2A 2PLV2 5JZGC 2IC1A 1H8VA 2WL1A 1UZWA 3J4UH 1GV9A 4IEOA 1WW7A 3VBHA 2VNGA 4KU7A 4AYUA 5FTTC 1PMJX 1O8PA 5BNNB 3H8UA 2CNAA 1WMXA 1GICA 2JDMA 3IMNA 5A32A 1JS9A 1D4M3 5FQ0A 1XB9A 2QQNA 3ENRA 2CY6A 4FFFA 5L9RA 3AB0A 1QH7A 4QDRA 4HN1A 4QU2A 1GNZA 2VXRA 3E6CC 2Y6HA 5T5JA 2JENA 1VBA2 3T1MA 4A4AA 1L7QA 1HB1A 3B3QE 4XW3A 1W8TA 2ERFA 1V00A 5FPAA 1K5MC 1OOPC 5FYBA 3WP3A 3AYEA 5C70A 1V6NA 3FHAA 1UPIA 3PUAA 2G1MA 5FY8A 3OUIA 4YVSB 1W8NA 4NWWA 3QH7A 1ENRA 4FPGA 2OYZA 2JB8A 4YGBA 4Z8BA 2VTFA 3RZLA 4PBPA 2HH9A 1S4CA 4MXVA 5J09A 1W8OA 3RRDA 5IHRA 1MS9A 4QX5A 1QJU1 5DZFA 1GQGA 3F2ZA 3ZSJA 4P9GA 5APAA 1NLRA 4AGRA 4H3WA 1TMF2 3MGUA 5IK5A 4GZ9A 4FFIA 2FZ1A 3S57A 1F2NA 2VTXA 1FYUA 4FPHA 5FZ6A 4RN5A 1CAXA 3ES4A 4MH0E 3ZIXA 3D8CA 4XJZA 5A3MA 1N1VA 2VOKA 4P08A 1L3JA 1MZFA 2VGDA 2W2IA 4IV3C 5J96B 2PHXA 3TB0A 1HRI3 3M3IA 5DMYA 1PM7A 3RZZA 3AMQA 2ZGMA 5JOZA 1XE0A 2PLV1 3PLQA 4OHWA 2VJXA 5C5TA 2CTVA 4AI3A 5J98B 2R0HA 1NOVA 3ST7A 2ZOEB 3I3QA 4W8JA 2VW0A 4IE4A 2FCVA 1ZA4A 2V73A 3AFGA 1RUC3 3DXUA 4LBQD 4QX8A 5FRAA 5C9AC 1T6BX 1VBA1 1CAWA 4XZPA 3O1RA 1EPWA 2BP6A 2AC1A 1UIJA 2LS6A 2ZA9A 3NVCA 2G4IA 1NA1C 1GP6A 1GKBA 2BGOA 2VPVA 3UGGA 5CG9A 2EALA 2HWC2 5I91A 1WMFA 5FZ3A 1UZYA 4CDWC 1UZ0A 1K3IA 5FWJA 2JG9C 1C8M3 1SFNA 5FYVA 3FUOA 1GZWA 3OPTA 1OVPA 5FLIA 1ZZCA 5FZLA 2AZ5A 3KQ4B 2WS93 2D3PA 1J83A 3IBMA 3DPRA 5JVVA 3ZXLA 4LOTA 4AVBA 1XNAA 3WDXA 2CDOA 4TTGA 1FOD2 5ANQA 4FT8A 3URFA 3LPGA 4KBBA 4LT5A 2YXSA 1XYOA 2JG8A 3CLPA 5FBJA 2VECA 4Q4Y1 3C7EA 4ONUA 4UI9L 4HK9A 3R6SA 3H1WA 4ARYA 4CP9A 1UZZA 2ZZJA 4IEWA 5EPAA 2GC1A 3HBZA 1JZ4A 2GMMA 3K4DA 1HKDA 1A6CA 2ZHLA 2OX0A 3J8F2 4GA9A 4WM7A 1GQHA 2PAKA 4QPGA 3MFCA 4Y5Z0 3U1XA 1MEC3 1Y9MA 1EAH2 2Q1MA 3ITQA 4Y5SA 5CEHA 3IN9A 4WVZA 3DUIA 5EV7A 5KHKA 3HVDA 1WMEA 4AI8A 5D8AC 2D43A 1NT0A 1YHFA 4YW4A 1VBE3 4WZFA 4CUAA 2Z42A 1UYPA 2DURA 5B4NA 1DGLA 4D0QA 2QDNA 4UF0A 5FUIA 2GZWA 2JEMA 2ZZQA 3HPNA 2B5HA 2OVUA 2DF7A 2VU9A 2IXKA 1AYN2 2WT0A 2X5IB 3WZ1A 4YZ1A 1Y43B 5ABJA 3NV4A 3MICA 1Q3EA 4H2AA 2VVFA 3O0WA 4RFRB 1JN2P 2A1XA 1XNDA 1J3QA 2HWB3 4JCKA 5FKBA 3BTXA 4Q4W3 2QQJA 4K8FA 4B4PA 2QQVA 1GU3A 3AMNA 3POJA 4CSWA 3TYJA 4QHOA 2DVFA 3B9IA 5FR3A 2JXAA 3CO2A 1AYM1 3CZJA 1QOOA 2RMU2 2ZEXA 4GALA 3B94A 1UU5A 3I7DA 3T3YA 2Y6JA 1UX7A 4XJAA 1Z7S2 1L7LA 1R1A2 1W6OA 3GZUC 3I2FA 3E1F1 2R072 4QPIB 4FPLA 2VBDA 5T3NA 3SKVA 3FE5A 2DVGA 4YZ3A 1RUD3 4IEQA 3JD71 2ZPXA 3HQUA 4LJHA 4PDWC 1G9AA 1G6NA 1CWPA 4XC9A 3NNMA 3QCWA 3J8F1 4RHV3 2ZGPA 3VDAA 5BNOB 3UL2A 5JWPA 2VQ0A 4RQPA 5CNAA 1RTVA 1QNYA 1GWMA 2RR11 1TME3 1NE6A 2FDIA 1S0IA 5JXGA 3ZXFA 5CFCB 1RGSA 3H3UA 4FTEA 4DZGA 2A5ZA 1QXRA 2JIJA 1ZZ7A 3DGTA 4IEVA 2Q8CA 3WXPA 2ZKNA 5DPNA 5LY1A 5DDJ1 1S0GA 3FBYA 3JBG3 4BQ1A 1X82A 3I3DA 4D69A 3U14A 4OULA 2VY0A 3POGA 3AXEA 4ZZ5A 3AZYA 3B69A 4KBZA 2PHRA 2GU9A 4TN7A 1AYN1 3T2TA 1CAUA 2C5DA 1Y9QA 2V09A 5IVEA 1X7NA 4JX0A 4CVUA 4D6QA 4BMEA 1SZBA 1XE8A 3ZLIA 5KC6A 1UYZA 4NRPA 4LE3A 2VZUA 3OPZA 3BUCA 1Y7BA 1C1FA 4TWTA 1JYVA 4C8DA 1LHNA 1OMIA 2ZX1A 3CEWA 2W46A 1FI2A 1D2SA 3DXTA 1T6GC 4Y3OA 3JQWA 2ZHKA 4FPYA 4IESA 2RDRA 3GGLA 1YI7A 1RUJ1 3LEGA 3OGSA 2PHWA 3HN3A 3JB8A 2NLRA 3U75A 2R7EB 1I1EA 1O3SA 3MIGA 2TEPA 4F83A 1HXS1 3HD8B 1AL22 4Q8LA 4PLOA 3CF6E 1LOEA 2QQWA 1GOFA 3H3ZA 3ZN4A 2HWE1 2ZGQA 4DEVA 5BNQA 2O1QA 1ALYA 4WBBA 3VLBB 4DXZA 3Q8BA 5AFEA 1HJGA 4D94A 4I3GA 3G6JB 4IE5A 4BXFA 4CEYB 2E7AA 4N9IA 1NCRA 1XNBA 2E31A 3H9AA 3I2KA 3MV11 4P9YA 4X8PA 3T4HB 1OLQA 4EZ4A 2VW2A 2Q4SA 3JUUA 5ACA3 4LO5B 3A0NA 4WVMB 3VZNA 1I5PA 3ACIA 3HJRA 3HQRA 4COYA 2PXJA 4JZRA 4N43B 1GOGA 5FMDA 4JHZA 4RSUA 5A3TA 4R4XA 1R083 4EN9B 3VDDA 2LUWA 1FPN2 3O12A 3AVRA 4JC1A 1UZVA 4KG8A 4CXWA 4GJZA 1IPJA 2ES3A 2XOMA 2ZTNA 1LODA 2P6CA 4GXLA 4KH9A 1OA4A 4YG3A 5IVYA 2W92A 5SV8A 2W1UA 3WF4A 1S0JA 4Y26A 4CUBA 3I3MA 3T2QA 1KQRA 5BNPA 4K3UA 1OPMA 1OH4A 4QHBA 5FYZA 2WWJA 3GJBA 5FMOL 3WQ7A 2ZEYA 1O6UA 4HPKB 5IT6A 5FZIA 2OIIA 1MZEA 2VH9A 3V0AA 3W21A 3JXSA 1FMD2 1R093 1WCUA 2SLIA 2XB6C 2DVBA 3OG2A 5A7SA 4DUVA 2C26A 5IATA 3I54A 5A7OA 1ULGA 2JDPA 3VHNA 1WLCA 3HT2A 4W4ZA 2NMNA 5C4WB 1LGCA 1W6PA 1ND2B 1D4VB 1WLWA 5C8CB 3NAPB 4D6SA 3J7NA 4YGCA 2GN7A 2C9KA 1LU1A 2B42B 5I0UA 2R49A 2W91A 4XACA 3AP5A 4XF4A 3FMGA 3KGLA 1O5UA 4IV1C 5H9PA 1W8FA 2Q5TA 2ZX0A 3U10A 1OH3A 5FYMA 4SBVA 1TE1B 2GAUA 1PK6B 1K42A 3AP9A 4LBQA 3SISA 3V0BB 4CCKA 1RUF3 4DS0A 1JUHA 1V6LA 1ZBE3 3WF1A 4C0HA 4ZXEA 3C7GA 2RS52 1PVXA 4LBOA 5IVCA 3SITA 3IPVB 1H8TA 2RS12 3RS6A 4DRVA 2YGMA 3H7YA 4H14A 3ZIWA 1LAJA 5I0TA 3POYA 4Z07A 2HWD2 4UBHA 5FZBA 4QX0A 4BDVB 4YZ5A 4AVCA 4AZZA 1FPN1 5FV3A 5FXXA 1GWLA 3N7KA 4ZU4A 1LOFA 4CU9A 4YVWA 3VN4A 1VBB3 1EYBA 3AYAA 3LEKA 3TEZA 4ZXKA 1X9PA 2RM23 3RNSA 3SEEA 3I59B 1S0FA 3RWNA 1ZREA 4FPEA 3D0SA 1HRI1 2HLEA 4GH4C 5LBCA 5F9TA 1ND3A 2A7AA 4DUWA 1UOBA 2WNUA 4YW7A 3MIDA 2DU1A 4NRQA 1KITA 2XMLA 2GNTA 1CQ9A 5LK7B 3BI3A 1W9FA 4UW5A 1IZ3A 3FFZA 3PJQA 2QNKA 1I6XA 2DCZA 4G9SB 2JWPA 1RVF3 1SACA 1FT9A 2KM2A 2R0FA 2WSVA 3OF1A 3OY8B 1I9RA 5B4XA 5DAQA 3NO8A 3S6PA 1HN1A 3UGFA 4AG4A 1LOGA 1RUC1 1RXGA 3WD5A 2ZMLA 3I4IA 3HNYM 3SNMA 4GWIA 3BODA 2VE1A 4FOWA 4NAMA 4Z2AA 1NY71 2GC0A 4K21A 1OFNA 2QCSB 3CJIA 1XC6A 5IVVA 5JMCA 3Q9OA 4PIZA 1DQ4A 1C8M1 4NPRA 1DQ0A 4AVTA 4OQ9A 4E27A 4META 1NLSA 3AC0A 2RS51 3T0AA 3H8XA 1VBD3 3KV6A 5F6LB 3O1MA 2WS91 1CR7A 5AVAA 3B5LB 2JD4A 4LPLA 4LOSA 5IW0A 4AQSA 1D0GA 2JDKA 5DAWA 1VJ2A 5LATA 4OZXA 5JDBA 5CIRA 2NYYA 5FY9A 1QKQA 1UOGA 3UK9A 5J3UA 2MEV3 1AR73 3MHZA 4CP0A 3VBSA 5A80A 3WF0A 2R1DA 4A7YA 5JZGA 4COZA 3N9PA 1KXGA 4IUGA 4XQ4A 3U4XA 1JYTA 2E9QA 1RUI2 4BQWA 2ZABA 1RITA 2VQAA 2WJSA 2VCAA 3C8XA 2YUEA 4Q29A 5FO8B 1YJLA 2GC3A 2WAAA 1UOJA 3O0VA 2XL9A 2DBIA 1AR63 1Y4WA 4YZ4A 1CAVB 1MEC1 2FDGA 2NQYA 3KHCA 3AM2A 4HL0A 4XCAA 3ZSKA 3PDQA 2WZ8A 2X09A 5JXJA 3VB9A 1KD7A 5JSRA 2YFUA 1WLTA 2E7TA 2GNBA 1ULEA 3P3NA 4IGOA 4CDXC 1JYWA 2Z4FA 1VBE1 1N1TA 1K5MA 2CGOA 1OOPA 2OS2A 4FFGA 2F6BA 3Q8FA 5GALA 1QU0A 4NUBA 3AKRA 1BBT1 4MVTA 1YXWA 1COV2 1ASJ3 4PIYA 1XNCA 3USUB 2WO7A 1S0DA 4Y20B 4E2GA 2N7GA 2SBAA 4KGQA 2I45A 1JMUB 4TZDA 2HWB1 4K7JA 3BIWE 5FXWA 4NHLA 3VBOB 3ETPA 3PL0A 4GMP1 3RFRA 4JGYC 2TUNA 1V6KA 2XVGA 3ZFFB 2NM1A 3ZM8A 2GC2A 5C3SA 5FPBA 4AHZA 1U5YA 4N53B 3NNGA 4LBKA 4P00B 4CE8A 1MQTB 3MLKA 5FLHA 4WV8A 3ZN6B 1RUG2 2XG3A 3WG2A 4Q8KA 2WA3A 5BNNC 3PJYA 1H1MA 2RDNA 4IV3A 4LIUA 3LOBA 4BK4A 4Q4V2 5A32B 4R9AA 5FQ0B 4NAOA 4Y1ZA 2W08A 3OGRA 4YW5A 1ZA7A 1RUD1 4QT6A 2V5DA 3KVBA 3AZZA 4MLOA 2WZEA 1RL3A 2WZR3 2DFBA 3BB6A 1MS4A 1WMDA 1YFUA 4YVSC 3PIJA 3BN6A 1W2TA 2GNDA 2XUMA 1UY4A 4QDQA 4YARA 1TMF3 5HPOA 4M0HA 1GZCA 2X8KA 4IGPA 3R4UA 2BZDA 4BH9A 1U0AA 2VMGA 1PZ8A 1Y9GA 4FXKB 2A70A 1QMJA 2DCYA 2YBKA 2YG0A 1UY3A 4CDWA 2BDRA 1MS5A 2H0VA 4RL7A 2Z79A 5CKNA 1PIV1 4QX3A 3NL1A 2JG9A 2ZJCA 4LUMA 4PF5A 2OKXA 1GQPA 4URAA 5KC5A 2JKBA 4DUXA 1OUXA 2V4AA 3E5UA 3BTZA 4QKFA 3A7QA 2ZAAA 3I97A 4YW1A 4LE4A 2RHPA 2YU2A 2VOXA 4N8MA 4NMIA 3SMHA 3TEYA 5FZGA 1W6MB 5FXVA 2VMEA 5LBBA 4A7KA 1BEV2 1G9BA 4XVHA 3DV8A 1X33A 3FUQA 1M4WA 1ZZ9A 3KHBA 1E5IA 2J22A 2OXBA 1SMVA 2P3JA 2RVAA 3M1HA 3PMEA 5IUQA 3U37A 1B09A 1RUE3 4AAXA 3DYMA 2LRPA 4XTMA 1UWWA 4AF9A 2UURA 2XJSA 3O1SA 1YLLA 3I2OA 3EB7A 4Q4V1 4AK3A 4NIHA 4OHXA 1DZRA 1OA2A 5A7QA 4N9HA 2GSYA 3AFKA 3PUQA 4GWNA 2HKXA 3R4DB 1V6IA 4MXWB 5D8AA 1CAWB 2WQZC 1YEWA 1KJRA 5FZ9A 1VP6A 5LA2A 1F35A 4CPBD 3BTAA 4AE2A 4OI1A 5ACA1 3ON7A 5DG1A 2WZPP 1FOD3 2DCTA 1QXJA 4BZ4A 2P34A 1GZWB 3S5AA 5KXDA 1C1LA 2DDUA 4QXBA 2JE9A 2Y33A 1X8MA 4HSJA 4XBNA 1XPWA 3L9JT 2OA2A 3H1YA 2WNVB 5FREA 2VVDA 1C28A 5LY2A 1APNA 1YFYA 2QZ2A 3MW2A 3U0ZA 2O14A 4LIVA 2O8QA 4EE2A 3AYCA 2OZJA 4ITCA 4QX1A 5FO7B 4CEWB 5CBLA 1FNYA 1EAH3 1J59A 5FBZA 3KCXA 1JZ2A 4ASLA 1JUIA 1V9U2 2BVBA 4BU2A 4YLZA 5GJ6A 2HWF2 1UXXX 3MDPA 1R091 1N3PA 3IMMA 3OGJA 2Q1FA 2YV8A 3OSDA 3QBQA 3RWKX 3THPA 1GP5A 4LBJA 2WN3A 3AJYA 4D8MA 2Y6GA 4ZHNA 4BQYA 1PGL1 3WINE 3M7AA 2H6CA 3NV1A 1UYYA 2DCKA 1QJX3 4AEJA 4PDWA 1CPNA 2RG4A 2D6MA 3LIHA 4PLNA 4CYDA 4AEDB 4AVSA 3GBFA 2AACA 5I0SA 4MX3A 3HOBA 4A42A 4NHMA 2VCCA 4CCJA 2KXLA 3PTRB 1CZSA 1H2MA 3KD4A 3WP6A 4LHKA 1S0EA 1ULDA 2WWUA 5ERLA 2VMIA 3WUDA 2FCUA 4MGKE 3CHXA 1Q8QA 4QD2A 3RZGA 2HEWF 2WA4A 3DKWA 2D5HA 2FDHA 2P2KA 4NIDA 2PQQA 3H3LA 1ZBE1 5FPLA 3AKPA 3SLIA 5KHHA 4YFWA 1KJLA 3VHOA 1KRIA 5EJ3A 3E5XA 4Z2WA 1G86A 4OLLA 1N3OA 1QJU2 2ZX2A 2BNMA 1R1A3 4QQOA 2FDKA 2R073 2XBO3 2ZGTA 4AR2A 3GZTB 4YNIA 2NN8A 2P5BA 2WNOA 4QU1A 1VBB1 2ET1A 2ENRA 1H30A 4V2VA 1EV13 2ZAHA 1OPOA 2WO1A 2QTWB 2RM21 2VMCA 4QPIC 5SV5A 3FL7A 1W6OB 4Z92B 3IDAA 2VW1A 4QKDA 5IFTA 1LJ7A 4RS5B 2EXIA 3AZWA 1WBLA 1DYKA 1V9U1 1WKYA 2VG9A 3G7DA 3GNEA 3KCCA 4PI2A 4EN0A 3B02A 4L9BA 2MHFA 5HCFA 4XILA 5BNOC 1JYNA 1W8HA 3MIFA 2DU0A 1QQP3 2KD7A 1F31A 1RVF1 2A6XA 4NJ4A 5CKMA 5FYYA 3ZYBA 5CFCC 2QQUA 3HWJA 3C7FA 3KZ4C 3VBUB 5F5IA 2JDUA 4I02A 4A3ZA 1U5ZA 4EWEA 1DYOA 5FCCA 1UOFA 1W8WA 5A7WA 1YO8A 3BALA 4B1MA 1NCQC 5JIAA 3LSEA 1F9KA 4P9WA 1MS8A 1MVQA 2CHHA 1HW5A 4JRLA 2P1BA 4A41A 5A3WA 4KU8A 4NE9A 3TAYA 4HKOA 4S2GA 4IQPA 3AKQA 2PFWA 2R041 2VULA 2PN5A 2YZ4A 3M3OA 4O7XA 2ETEA 2E51A 3B00A 3DN7A 3HT1A 4R9CA 4CU7A 1POV0 1ZBA1 2B4KA 1XYNA 5B2GB 2L9LA 1VBD1 1Q8PA 1SBEA 2GDFA 3FX3A 3MEPA 5IWFA 3OYWA 1DQ2A 5FY4A 3LD8A 4HSLA 2BW8A 2WLPA 4QXHA 5E89A 1AR93 3WW1A 3KV4A 1RIRA 3ZFEC 1IG0A 1AXKA 4UFLA 1ZRIA 2MEV1 3NRUA 1AR71 1PGSA 3MYXA 1OLMA 4GJYA 1JYXA 3LA2A 4Q4Y2 4CXXA 5DAPA 4A2UA 1G9CA 2HEYF 4GKYA 5FOJB 4H7MA 1OBNA 4HK8A 1DP0A 4KWJA 1YQCA 5LEKA 3HN1A 2LW8A 4IERA 1NQJA 3VZOA 4FPJA 1OKOA 3WG3A 3GCWA 3WSOA 1PO11 4CEYC 5C3OA 3LZZA 1XRUA 1DQ1A 3N9LA 5FO9B 2ORZA 3ZXEA 2CAVA 2WINB 2Q8DA 5A1LA 1ONAA 3MIHA 1NLQA 4LBLA 1PMIA 2XKPA 3WW3A 3ZYIB 1AR83 4IV1A 1JXNA 2WDBA 1W28A 1S0CA 3GCXA 2FD8A 3VBFB 1ASJ1 4OUSA 4BISA 1A8MA 3TEWA 2XVKA 4J1XA 3VDDB 1OLME 4AHYA 1CX1A 1SHWB 4E4ZA 2Q1ZB 3KT7A 4L2NA 4XF9A 2E33A 4L99A 2R062 4XTPA 4Y33A 2PQSA 2WYFA 3WP5A 4GWJA 2JJ6A 3U11A 2A6YA 3SQOA 3I3BA 2JX9A 5BNPB 2F17A 3AMHA 4FI9A 4IEUA 2WFF3 3NJYA 2E63A 1EUUA 5IK7A 4YM3A 4KWUA 5HCBA 2V5YA 2IFRA 3LKJA 1AYM2 1US3A 2XQXA 5JSPA 4CDQA 4UAPA 2J1RA 4JGZA 1PO22 3ZKYA 5C4WC 4LNVA 1ND2C 4GH4A 5C8CC 3VKOA 3NAPC 2ZEWA 4Y4YA 3KS7A 4TYSA 5KXCA 5DUWA 1W9SA 1GUIA 1DLLA 2D6LX 2Y64A 2DVAA 4JDOA 2Y0IA 3WG4A 3JD72 4XEZA 5F3IA 2WZR1 2ZGSA 5F2WA 3OBAA 1FXZA 5CG8A 2K9ZA 3NV2A 4RGAA 3ILFA 1PK6C 2ZGKA 2RS13 2RR12 4JKLA 5EXOA 4MGSA 2UU8A 4CUGA 2Y6FA 1UNBA 4QM8A 1V70A 5IJRA 2ZMKA 2HBUA 4LBQB 4XETA 5FZCA 2LM3A 4NIAA 4LUKA 3DF0A 1C4RA 3IAQA 2VOTA 1VRBA 3W20A 1H8TB 4ORFA 3CKHA 1I5ZA 3QOPA 5DDJ2 4CPBA 4BMBA 3OTFA 5FZ8A 2EIEA 1QHDA 1W39A 5FPXA 2FQPA 2VCBA 1HX6A 3SEPA 2XR4A 2R061 3AL6A 2CU5A 3ZOIA 4AFAA 2RS31 1HRV3 3KV9A 5G04L 1W03A 4AHXA 1WA6X 3T0DA 3N35A 3VKLA 1FX5A 5BY5A 1AX1A 4Q2FA 4BHPA 4XDPA 4CDUB 4QQLA 2ID4A 5FK7A 2G9ZA 2WNUB 1SFPA 4BYYA 1Y3TA 3AP6A 1SLBA 4KNCA 4EV0A 1RUE1 1SBFA 1URXA 4KL1A 2FDFA 1DCSA 2Z5WA 1Q43A 1PNFA 1ZVFA 1PO21 2VZOA 5C3PA 2VNOA 1RUJ2 2J1EA 1VLNA 1SPPB 2XL7A 4Q1RA
chains in the Genus database with same CATH topology
1KDMA 3GF6A 2XGXA 1WUVA 1VBC3 1POV3 3ASIA 1HXS2 3SHRA 3WW4A 2XJQA 4PJYA 1CGPA 2HWE2 4PBOA 3M8LA 4PQ9A 4CDXA 3VZKA 1UF2C 1W6QA 1XYPA 2QDRA 5C33A 1XNKA 5K0UB 1RUH3 2BGCA 4CP1A 2BFUL 3KM5A 1N47A 3CJIB 3R0RA 4LLOA 2AR6A 2UYAA 4J1WA 4JV4A 3N36A 1HV0A 5IK8A 2B7YA 2XHKA 1O5LA 2A3WA 3KSCA 4N7IA 4Y22A 4EJRA 2XVLA 1VAVA 3CL1A 3S7EA 1RUI3 4LR4A 4JGYA 1UIKA 2DTWA 5AVPA 3D82A 1VAKA 3VBSB 4QMAA 5JZGB 1BQPA 5BNNA 4YG6A 4B29A 4XJ9A 2BYVE 1IKPA 1YFXA 4EROA 4QQHA 3OD0A 1EY2A 4LTAA 4UW3A 3SXWA 1O7FA 2B46X 3ES1A 4P9LA 1MR5A 2Z69A 1QJX1 4AGVA 2XWBB 1PVC1 3N7JA 3ILRA 1JTZX 3TN93 4RGGA 3RI9A 2IXJA 4UXAA 5I8SA 4E2QA 1B35B 1DQ6A 3GZAA 3VZMA 5F5QA 4F8AA 3VBOC 3PVBB 4AHWA 2W68A 4XFGA 3ZXJA 3ZFFC 1DHKB 2VUAA 3NKTA 4OUMA 4Q4X1 3JU9A 1W0PA 4N53C 5FDBA 5H9QA 1MQTC 1PZ7A 2F4PA 4Y1YA 4AI2A 1IQAA 4BM8A 5A33B 1QJY3 4XDQA 4HMZA 3OD4A 1ULCA 1WD3A 3FBMA 1EV11 4IV3B 2P3KA 1TQ5A 1WD4A 2D6PA 1BCXA 4AWDA 1CN1A 1OA3A 1IKQA 1Q8SA 4FQ4A 1QOTA 4RR3C 1HRI2 2JICA 4XFIA 1KS5A 1GYKA 4YRDA 4OFGA 1QDCA 4COVA 1O3TA 1QQP1 3BOPA 4BIOA 4XPVA 3MF9A 2GNMA 1HLCA 2DV9A 5GLTA 4DINB 4JTOA 1D4M1 2A6VA 1TNRA 3IM0A 1GR3A 1G7YA 5GKAC 1AJKA 4TSVA 5J48A 1V6JA 1UKGA 1RUC2 3RSJA 4NWVA 4A7ZA 2XJVA 3UJQA 1N1SA 2K2SA 1OQ1A 4X8NA 4G3YC 5GZDA 3DL3A 4I2OA 5DUXA 2NPIA 3E97A 2D6OX 2JG9B 3VHPA 3KB5A 1JW6A 5T55A 4COUA 1NY72 4XFHA 4ISRA 3NV3A 4C91A 2DVDA 5GZGA 1YI9A 4H7LA 1C8M2 4NO4A 1LB2A 2WS92 4HVRA 5L7OB 2BWAA 1AR91 1SBDA 1QWRA 3EJKA 2PHDA 3D6EA 3JB4C 1DGRN 1WW6A 5FOBB 1JOJA 2ILMA 2CWSA 4M3CB 1DQ5A 3FC0A 1SLAA 3WQ0A 1C57A 1OI6A 2WT1A 3GBWA 4QGNA 1ZM1A 2X53S 3C2UA 3LCPA 5D8AB 3U07A 2A71A 4L97A 4B7KA 1MEC2 4XFCA 2YHJA 3MLLA 1DYPA 4E4SA 1DIWA 4K20A 1VAMA 4LULA 1CX4A 5CFDB 4FBFA 1AR81 2D6KA 2EXJA 3IDBB 1VBE2 1A8DA 4HZFA 2JE7A 2IXHA 1BBT2 1RUOA 1OKQA 1RHI3 2WNVC 2BNNA 1WW5A 4LEJA 1XU2A 4LA2A 1W6NB 3BCWA 2HWF3 4K9SA 4YFZA 4CEWC 2HWB2 4K6BA 3ACLA 1LGBA 1JYIA 3BPZA 5GLVA 1AL0G 5FMOS 4Q4W2 1C5IA 1VR3A 1VRH3 2WFF1 3VBRA 2CYFA 1FAYA 5AC93 3RJ2X 2ARXA 2ARBA 4AVVA 1ZZ8A 1YIFA 4QPIA 3FHIB 4WM8B 4W6YA 3WVJA 2KA3A 3FFQA 4D7SA 3RMYA 2ZKLA 4M0NA 4INDA 1LGNA 4LA3A 4PDWB 1QH6A 3BOWA 3IDEA 5BNOA 4QXKA 4AEDC 2NP0A 2X29A 4EN8B 1HQNA 5C8WA 1S55A 1NG0A 4HANA 1RUD2 1S2KA 3S30A 5EYXA 1BVP1 1VB4A 1GBGA 3OBRA 4RHV2 4XJWA 3ZFGC 2Z2SB 1Z78A 4EWAA 3ZXGA 4FOVA 1TME2 1E57A 1NCQA 5GZEA 5KXEA 1AXZA 2YC0A 2C1FA 1AHSA 2RJKA 2WSUA 3HAGA 3TRSB 5T5PA 1WA4A 4JDMA 4XIOA 3R4SA 5HCAA 1AVBA 4LBMA 2WIIB 4D7YA 4LHLA 1LU2A 1WCDJ 4MUVA 3EO6A 4PLMA 4QPYA 4GWMA 1PZ9A 1PIV2 4DPNA 2B8MA 2VOWA 5H9SA 4DY3A 1KS4A 1HRV1 1RMU3 2DFCA 5GLUA 3KLSA 3PNAA 2PLV3 3SH4A 4RS5C 3ZFEA 4Q4W1 2EIGA 1BJQA 2GMPA 1WGPA 5GZFA 4KGGA 1ZZ6A 3RYPA 2A6ZA 3NSTA 2ZGOA 4FPCA 3VBUC 3WUCA 3VBHB 1UCXA 4C0BA 3EBRA 1F5JA 1CD3G 1VBA3 1GANA 2D5FA 3OCPA 4WVWA 1HDKA 2XJRA 1DGWA 4XFFA 4CEYA 4ZU7A 2QFEA 3WNXA 5CAZA 4JTNA 1LEDA 1NXMA 4NVPA 4RHV1 5L73A 3TNPB 2ZMNA 1RUH1 3LB9A 5KWRA 3L2YA 1TME1 3VL9A 4FO9A 4OHYA 2OW4A 4OI4A 4D3WA 5ACA2 2XLAA 1SQ4A 5E8AA 5C9AA 2D98A 3H1MA 4MZUA 5CB7A 3CU7A 3N7LA 1NA1A 4R4ZA 1R082 4FPFA 2IXLA 3ZXDA 3JBG1 2HEVF 4UBGA 3HQXA 1LTEA 4XYXA 2IFWA 2QVSB 4HPKA 1NZCA 2A73B 2VUJA 1J3RA 4AVAA 1F8VA 4B7EA 2BVVA 2G9FA 1CAXB 4Y1UA 3ZYJB 3IKWA 3ALQA 3MIBA 3MF6A 1UMZA 5CADA 1ND2A 3ZDSA 3NAPA 1R092 3M3CA 3O7OA 3USSA 2I2SA 2Y38A 1PGL2 2YPJA 3D5OA 2DCJA 4OHZA 4ISQA 4Y24A 3AK0A 2C9AA 5BV6A 2ZGLA 3RG0A 4PCRA 3TN91 5T5OA 3TOJA 2BTVC 2EVXA 2ZX4A 3VBFC 4BCUA 4YM2A 3WHTA 5EYYA 3KT4A 2HWC3 3VDDC 4AEMA 3H50A 4OI2A 4XBQA 1REFA 3V0BA 2FHRA 2WQ4A 1YNAA 3WY6A 4OI0A 3IPVA 2EF6A 1CONA 3AX4A 3JCIA 5BNPC 4LHNA 4XBLA 1BYHA 1RUF2 2D97A 4XFBA 3H7JA 1ZBE2 5FAXA 3WP4A 3K51A 1SDWA 2QKDA 4EN6B 5K8SA 1QJY1 1R081 4M01A 1JH5A 4Q1PA 3D0JA 1WLDA 2PHLA 3I59A 4TLFA 1M06G 4CDQB 3DPRB 4JGZB 4ZU5A 3ZSMA 4AW7A 2XJTA 1VBB2 4BLJA 2QQPA 1ZX5A 2JG8B 2AYHA 2RM22 3J8F3 1AXYA 1UL9A 2D93A 4FPOB 4B3NA 4FTSA 5E16A 1Q8OA 4X6RB 4F7ZA 1LHUA 1Q5OA 3OY8A 2VMHA 4WM7B 2ZCWA 5FPZA 1ZNPA 3IDCB 4IEZA 4MGZE 5F6KA 4JDNA 4QPGB 1RVF2 3PHMA 5DDJ3 2BNOA 1QOSA 5LK5A 3ZXKA 2DUOA 2UWCA 5T5LA 1LENA 1AYN3 3LGRA 4UW6A 1G8WA 3POSA 4FCAA 1VALA 2D3SA 4HKLA 2X5IC 2ZS6B 1UN1A 1SLCA 4Q0UA 4Q26A 2NZ9A 5DZGA 4MYEA 3UJOA 5ABJB 2R042 4N7UA 2CGNA 4XMIA 2RMU3 1RUF1 4CDUC 3X29B 4GIQA 1ZBA2 1RUJ3 1VBD2 2WNUC 2D7FA 5JPMB 4WZCA 1N1YA 2A75A 4FOYA 1HXS3 1Z7S3 3WG1A 3O14A 1LOAA 4I30A 3AMMA 2WKKA 2HWE3 3QH6A 2I74A 2MEV2 4YYOA 1AR72 2XKOA 1NYWA 4YZ2A 1CAVA 2UY9A 1DBNA 5BXXA 3ATGA 1U12A 1ZRDA 2JECA 3AMPA 2PHUA 5KXBA 1IS3A 4CP2A 3LSDA 1HIXA 1TNFA 5K0UC 1PO12 3KGZA 1O91A 3WCRA 1LULA 3CJIC 2FBEA 2EXHA 4RQPB 4AFMA 2R32A 3USUA 4FXGB 4R8HA 2FZ2A 4Y20A 4R9BA 4IEXA 3AKTA 4AXOA 5JSOA 4RD7A 1U5IA 1ASJ2 1RHI1 4L11A 4D7TA 2WT2A 1RB8G 5J7MA 3P3PA 4Y22B 3ZFFA 4FAGA 1BK1A 4ATFA 1J3PA 4KWLA 4XF1A 1S0BA 3SCFA 1CAUB 5DZEA 3VBSC 4LLFA 4QQ2A 5I0RA 1VRH1 1C3HA 5AC91 4AI1A 2VOVA 2YMZA 4LO4B 4XJUA 1YWKA 2AGSA 5K7PA 5JOYA 1AL23 1SLTA 1D2QA 2E7QA 4NN0A 3RYKA 3FWEA 3O5SA 4GMP0 4DY5A 4MGIE 4RR3A 4HETA 2PELA 3AXDA 5GLZA 4FVVA 3MZHA 1EP0A 1LKNA 3ZSEA 3PVEA 4XE9A 5JOWA 1B35C 2OZ6A 1BVVA 1QJZA 1PNGA 4HFSA 4H55A 2WZR2 1AR61 3VUOA 1J58A 1LECA 3V64A 3ZVXA 1CESA 4XFAA 3FLPA 2MNGA 1NCRB 1RUNA 3GBGA 1FPN3 4N43C 3FLTA 1H1AA 2IZWA 2UY8A 1LOBA 3WDWA 1U5XA 2H0BA 1OHFA 1KFUL 1MS1A 1W6MA 2R1BA 4LO7A 2AUYA 3S7IA 5JI9A 1RMU1 1UD1A 2ZGUA 4FP2A 1HQWA 1XQNA 3WQ1A 1Q8VA 2RJLA 3UKNA 2RS32 1FMD3 1HV1A 1OQEA 1NQDA 5BUVA 2QJVA 1KFXL 3TNQA 3V0AB 1RUE2 4MXWA 4JRAA 2O0OA 1YJKA 1PHMA 4XXPA 1H0BA 5FFOC 3N4MA 1W6PB 1AZDA 1YIPA 1UW8A 3VGIA 1BXHA 2ZHNA 1O3QA 3VKFC 2PA7A 3ZPYA 3H0OA 4WVVA 4BIFA 3N7MA 2RS53 4I0WB 5CA6A 1REEA 4QM9A 3NJZA 1TMF1 2WNVA 3KMHA 4XF3A 2HWD3 4DNYA 1YYNA 1G9DA 3A0KA 5L7OC 4SLIA 5BPXA 3W58A 5T54A 3RQ0A 4CEWA 2HJIA 4AFBA 2R6QA 2EAAA 1MVEA 2EAKA 3M4FA 2GH8A 1MACA 2EA7A 2YGLA 4FQZA 3LWCA 4XQDA 2WNEA 2D44A 1N3QA 1UX6A 4YVWB 4COWA 4U36A 5T52A 3R05A 3KT1A 1MS3A 1ND3B 1S2BA 4AEDA 4Z1VA 5JI7A 1SFYA 4PIXA 4XJ8A 1BBT3 4HVQA 1QJX2 1SLLA 3HMYA 5CFDC 1PVC2 5BYNA 2LALA 3ZFGA 2B9UA 3O0XA 2HWC1 1KDKA 3E6BA 3GALA 2G9GA 1OQDA 1W0OA 4J6GA 3PTYA 2XLFA 4GMP3 3ELNA 5T50A 4GULA 4LBNA 3ZX7A 4I09A 3MLJA 2OPKA 2VNRA 3AKSA 1FOD1 4MGYE 4I0BA 4XIKA 4Q4X2 3VBRB 4Q0VA 5KHJA 4AGGA 5A3LA 4WM8C 4CRQA 2XBO2 3BU7A 4RS5A 3EHKA 4NR1A 3ROUA 4BOWA 5L36A 1GNHA 1GFF2 1H1IA 2GN3A 1EV12 3ILNA 4Q0QA 3ZO0B 1ENQA 4CTEA 3N3HA 3NWKA 3WDTA 3NKGA 1EAH1 1FNZA 1ZRRA 3VBUA 3E6DA 2C0ZA 3VKMA 1LHVA 3SCHA 3GHNA 1EPZA 1GSLA 3RJRA 1QQP2 5KHIA 4IEPA 1NCQB 2FMYA 1W2UA 1COV3 2BWCA 1RINA 3J9SA 1D4M2 3UKTA 1J1LA 1PIV3 4FAHA 1RC6A 5LEJA 1K5MB 2ZGRA 1OOPB 5JPNB 1J1TA 4YVSA 3B93A 1ZYBA 4Y1VA 2YROA 4Q0PA 2PHTA 4I0AA 4DRRA 4YSFA 4R52A 1F5FA 1UU4A 2FMDA 4A3XA 2YYOA 2RMU1 2A3XA 1RUG3 3ZFEB 1AX0A 1OSGA 5D1IA 1CVNA 3SH3A 4DOUA 3RI8A 2P37A 1Z7S1 1S1AA 1DGWX 1R1A1 4Q4V3 1AR92 2IXCA 4N90A 2R071 2XBO1 3JZVA 2CL2A 2VVEA 1SCSA 3VBHC 2B45X 2XWJB 3KCYA 4S2FA 1G9FA 4FOQA 5LRRA 4QGMA 5I8TA 3MW4A 4ZKTB 3HIFA 3TWIA 3WDYA 4P9JA 1H9PA 1DU3D 1AX2A 1YUDA 3WHUA 4BLIA 1DF0A 1RJ7A 2QZ3A 2BFUS 3VBFA 4XF0A 1FV2A 4E4DX 1JHNA 4JVAA 3JQXA 1AR82 1H4HA 5C9AB 5LRSA 5EFUA 2D40A 4C90A 1NA1B 4KG0A 1BZWA 4AFDA 1NXD1 1O4YA 1REDA 3WDVA 4CDWB 1O4ZA 2EXKA 2W39A 1XE7A 3M70A 3NW4A 4HN0A 3D4KA 5J09A 1ZRFA 3MPPG 3RDIA 3T1LA 4FTBA 1BEV3 3FLRA 2DUPA 4E2SA 1QF3A 4GB33 2E6VA 2DUQA 4EWDA 1HQLA 2WFF2 1LR5A 3FJSA 5I8YA 4L8QA 1X36A 2WFPA 1CIWA 1OLRA 3QACA 1AL21 3M3EA 5IK4A 1LCLA 3OBTA 1VB2A 3APBA 4L92A 3I8TA 4URTA 1IHMA 4K1ZA 2AREA 3V56A 2ZBJA 4U2AA 2GMEA 5I93A 1FATA 1QNWA 4LO8A 4ES8A 2Q30A 1H2NA 1OD5A 5GZCA 2XJPA 4UW4A 4ES9A 4V1PA 4YGDA 1H4GA 2R16A 4P9IA 1JYCA 4IEYA 2YY1A 3KQRA 5DUVA 1IGOA 2MPFA 1ENXA 2X5IA 3OJBA 4AEKA 3ME2A 3ECQA 4AQ6A 2ZACA 2P3IA 1UU6A 5JCTA 1ENSA 4CDQC 1DZQA 3DPRC 1A3KA 4JGZC 3ZYRA 4KQ7A