2WWJA

Structure of jmjd2a complexed with inhibitor 10a
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
346
structure length
346
Chain Sequence
b'LNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 4A
publication title Selective inhibitors of the JMJD2 histone demethylases: combined nondenaturing mass spectrometric screening and crystallographic approaches.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 105
structure length 346
sequence length 346
chains with identical sequence B
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2009-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 2wwjA01
2Q8CA 2YBKA 4AAPA 3AVSA 4EZHA 5FY8A 5IVCA 5A7SA 3N9PA 3K2OA 4CCNA 4C8DA 5FZ4A 5A7WB 5FZLA 4E4HA 2YU1A 5IWFA 2XMLA 4HOOA 5K4LA 4TN7A 3LDBA 5FZEA 3PU3A 2W2IA 3PU8A 5FYSA 5FZHA 4D6SA 5IVFA 5FY7A 5A7OA 5F2SA 5FZ6A 2PXJA 4V2WA 5A3TA 5FY9A 5FZGA 2Q8EA 3N9MA 5F3EA 3KVBA 5LY2A 2OQ6A 5A80A 5FXZA 3OPTA 5A7QA 4DO0A 4GD4A 3NJYA 2YU2A 5A7NA 4CSWA 5FZ9A 5A3WA 5FXWA 4QU1A 5FYBA 4URAA 5FWEA 4DIQA 4GJYA 1VRBA 5FZMA 4LIUA 5F39A 5ANQA 5FZ1A 3LD8A 4CUGA 4IGPA 3KV6A 3K3NA 5FYHA 5A7WA 4GAZA 5FYIA 4CCOA 3AVRA 2GP3A 3PUSA 4NUBA 4QX7A 4UF0B 2P5BA 5FP7A 3PUQA 3DXUA 5KR7A 4LITA 2VD7A 3DXTA 3N9OA 4IGOA 5FZ7A 5A7PA 2YBPA 4D6RA 5FZBA 2YBSA 2Q8DA 3KV4A 4GJZA 5FY4A 5FXXA 3K3OA 5FZKA 5FJHA 5FPUA 5LWBA 3U4SA 4LXLA 3AL5A 5A3NA 5F32A 5FZOB 3KV9A 5FZ3A 4QXBA 3U78A 4BXFA 5FPBA 5FZFA 5FXVA 4CCKA 2OQ7A 5FPLA 4LIVA 4V2VA 4Y4RA 3KV5A 5FJKA 4AI9A 3PTRB 4HONA 4UF0A 4BU2A 4CCMA 4QWNA 2WWJA 5FZAA 4ASKA 5FY5A 4IGQA 4D6QA 5FYVA 5ISLA 4EZ4A 3PDQA 2OS2A 4XDPA 5FYCA 3PUAA 5IVYA 5F3CA 5FV3A 5F37A 5FWJA 5LW9A 2XUEA 2GP5A 5FBJA 5FYTA 5FYMA 5F5IA 5IW0A 5FP4A 5FYUA 5A1FA 3N9QA 4XDOA 5FY1A 3AL6A 4Y33A 5FYYA 4CCJA 5F5AA 4Y3OA 5FY0A 5IVVA 3PURA 5E6HA 2WWUA 5F3GA 5F5CA 5FPAA 3UYJA 5IVJA 5FZCA 2OX0A 4QXCA 5CEHA 5FZ0A 4BISA 5F3IA 5FP8A 3N9NA 3OPWA 4QXHA 2OT7A 5FPVA 2XDVA 4QX8A 5F2WA 5IVEA 2YPDA 5FP3A 5FUNA 4CCLA 5A1LA 5IVBA 4EYUA 3KVAA 2XXZA 3RVHA 3ZLIA 5FP9A 5A3PA 5FZDA 3ZPOA 5LY1A 5FYZA 5FZOA 5FUPA 3N9LA 5FZ8A 5FZIA
chains in the Genus database with same CATH superfamily
1QJEA 1WA6X 1SDDB 3E5QA 1LENA 2XLGA 3NW4A 3N4MA 4M3CE 4Q4Y1 3VKMA 3WQBA 3CLPA 1OKQA 3AP4A 2VZOA 5DQ0A 1LKNA 3P1IA 4HKWA 3N7LA 4MSVA 4XCBA 4E2GA 2DU0A 4N43C 1NA1B 2R061 4CXXA 4X6QB 2H0BA 3FMGA 4FOVA 4YW1A 2UU8A 1QNWA 3T08A 5BNPC 2DDUA 3RZHA 4G3YC 4XBLA 1GP5A 1AL23 4JTNA 3ZN6B 4ZZ8A 1POV3 3IMMA 2JDKA 2R32A 1C5HA 1RUJ2 1S2EA 2NZ9A 4XJ8A 4ES9A 4MV2A 5AC93 4MG2A 1XSQA 1UD1A 3GDBA 3M3OA 4AFDA 1X8MA 1RHI1 1H9WA 2ZGOA 3LFIA 4XE9A 2BEOA 2BFUL 3UKTA 1AYN2 3I7DA 1S0GA 4YGCA 2AENA 5JR7B 3HBKA 3UJOA 4P9GA 2GN7A 2W1SA 1TE1B 4IEOA 1O3SA 1V70A 4XVHA 2C26A 3AYDA 1ND3B 1WLCA 1IQAA 1CPNA 4ASMB 4NUBA 2VZVA 2VMDA 3PUQA 1DP0A 1WA4A 1FXZA 2WNEA 1W8FA 3RNSA 4KGGA 3T1MA 1Q43A 3WG1A 2XH6A 5FZBA 3FL7A 3FN9A 4Y22B 2YBSA 2LS6A 1UF2C 2ZBJA 3NNJA 4NHMA 3SNMA 4N8MA 3VBHA 1OUSA 1W6PA 1MS5A 2VTXJ 3NO8A 4KGQA 1SLLA 1W90A 3VD3A 2Y38A 4Z92B 1ZZ6A 4AG4A 2VECA 4QPIC 1BBT3 1W6OB 5EJ1B 3VKFC 1RB8G 2NYYA 3OGJA 4X8NA 3GM8A 4AHXA 2JX9A 4PF1A 1VBD2 1YQ2A 2DVDA 1L7QA 4RSUA 1US3A 2YFZA 2VM9A 5C9AC 1OVSA 1QGLA 2GAUA 2XWBB 3MLLA 2OQ7A 5GLZA 4LIVA 5T5LA 4EQVA 1B35A 5AVAA 4P14A 1DZRA 1HRI1 1LECA 4CCMA 1N1VA 1OF4A 5JXGA 4DXSA 1DDLA 1S2KA 3GHMA 4A6SA 4D6QA 1RMU2 1XNCA 1NE6A 4GKXA 3BN6A 4RA0A 3ZFGB 3O12A 1FV3A 2JKBA 2XONA 1O5UA 5F37A 3WF3A 3ATGA 5CBLA 1S0EA 2HWF1 3GNEA 5IW0A 2FBEA 2VMEA 3S57A 2Y6KA 3M4FA 1F8VA 2TEPA 5JSRA 3POEA 5EJ3A 3JBG3 3SEPA 3B5LB 3ES1A 2QQLA 5TSWA 1H1AA 5ABJA 3WG4A 5BXXA 4BA6A 2HH9A 1H30A 2PHUA 3RFRA 3TWIA 3HEIA 4UYBA 4QGLA 3ZR5A 4QXCA 4CU8A 1K12A 1BEV1 1R093 4IL7A 2EIDA 4Q4W3 4COWA 1RUD3 5FO7B 1TNFA 2CYFA 1RUC2 4DZGA 1GFF2 5A70A 5JAXA 1W8ZA 3T0AA 3RYRA 5KHIA 4QX8A 5K7PA 4ONUA 1ZRDA 2ZHLA 5A3LA 4MX3A 1UNBA 4JC1A 1LOFA 1ULDA 1SZBA 2RM21 3CO2A 4Q26A 3WHUA 4XMIA 5LBEA 2YUEA 4H3WA 2ENRA 1VMHA 5CG8A 1R1ZA 4FO9A 4QPYA 1JH5A 1Y9QA 1FPN3 3OF1A 4TTGA 3IAQA 2ZHMA 4AFBA 1WCQA 2RS31 1ENSA 2V4VA 2VH9A 4URAA 1ONAA 4OUEA 3WP4A 4OHVA 4PDWC 3A23A 3AZWA 2SLIA 2AH2A 4QQPA 4XF9A 4I3PA 2WBKA 5L73A 1UXZA 3I4IA 2XBO3 4KQ7A 1VBE3 3I59A 4CYDA 1DQ1A 5CU1A 3TN92 1K45A 2WO2A 3HR9A 4X8PA 4XAEA 5FYSA 4XUTA 1W04A 4Y1VA 5A3TA 3O1SA 1H1IA 4Q4Y2 3VBUC 2HWD1 4H14A 2A6WA 2JE7A 1KITA 2ZKNA 1RUI3 2R062 2RMU1 5FWEA 2WJSA 4GMP3 1Q8PA 1UW8A 1G86A 3EMRA 2RDSA 1OQEA 2X5IC 3Q8AA 3SITA 1BJQA 3H3UA 4RHV3 1LR5A 4XABA 1VBB3 1X36A 3ZXKA 4UF0B 3WP6A 1RUE3 2XG3A 2HWE3 1JUHA 3P6BA 4Z2WA 1GU3A 3B02A 5CKNA 2RJKA 1RHI2 2BV4A 3TAYA 4EWAA 3DYOA 2QQMA 4PCRA 3H1WA 4CRQA 5C5UA 1QIQA 1ASJ1 1W0OA 2B9VA 4HG6B 4UW4A 3UGHA 3KHBA 3AXDA 5FJHA 3FBMA 1QJU1 4GH4A 3RG0A 2WNUB 3H50A 1FMD3 3WQ0A 2DU1A 2WN3A 4RFRB 3NNMA 2XVLA 2B7YA 5C33A 1AR83 2VY0A 1NQDA 1GUIA 1U5XA 3FHQA 1C8NA 4QX2A 5FZFA 3ZSEA 3ZYFA 5JI9A 3V0BA 5SV8A 5FPLA 2P6HA 2GC0A 4WZFA 4HONA 5CIRA 2CSGA 4GXLA 3WW3A 5K0UB 3LDKA 2RHPA 1WW5A 5HBAA 2CL2A 1S0DA 1LHVA 4Y24A 3FHIB 1HJFA 2LUWA 5ISLA 1YO8A 4XDPA 3NJZA 4R8HA 1N47A 4L0PA 1J3PA 1HIXA 2V09A 2B42B 2F4LA 1JTZX 2GH8A 5FV3A 5FWJA 2Q30A 3OGSA 4YVWB 1UU4A 3B94A 4P5HA 4XF4A 2HBTA 5F5IA 3JCIA 2WFPA 3IKWA 1W2AX 3O7OA 4EE2A 1HRI2 1UZWA 4AWDA 1CAXA 1X9TA 1Y9MA 4A4AA 1SFYA 2RVAA 3DL3A 3MEPA 5FK8A 5FQ0A 1HQWA 2IXKA 4CPBA 5KC6A 1V6JA 3HN3A 4NR1A 3VZLA 5JXHA 4N53C 2O8QA 4BISA 2HWF2 4BMEA 4Q2FA 4LLOA 1BYHA 1EAH1 2RDQA 2WFF1 3I2HA 1KD7A 2R041 1C3HA 3KB5A 1PGW1 4QQOA 5CYYA 5C3PA 4GWJA 1OOPB 1J1LA 2YC4A 3MPPG 2WAAA 5GALA 3LPGA 3NV3A 4PHZA 1CWPA 1GP4A 1GOFA 1QU0A 1P8JA 3WINE 1OD3A 4EYUA 2VW0A 2XXZA 1QQP1 3MFCA 2Y6LA 5IT6A 2D6KA 4ZY9A 2XL9A 3PJQA 4LR4A 5A3PA 1MZ6A 1BEV2 3WD5A 1JYWA 2JG8B 2VMIA 4BOWA 2PAEA 5A32A 3ZFFC 4XPVA 4CP9A 1LNSA 1G9DA 3J8F1 5HPOA 4XACA 5IFPA 1W03A 1T6GC 2R0FA 1VBC1 3AB0A 3RZGA 1E5RA 2P4EA 4UWDA 4CE8A 2RM22 4Q1PA 3SCFA 1W06A 2WLPA 4PIZA 4BPZA 4R4ZA 3D4KA 3LCPA 1H8VA 1CX4A 1BHGA 4GALA 3U4XA 2MNGA 3VBOA 5A33B 1W9TA 2RS32 5H9PA 1MQTB 3ACIA 2HWC3 3S0MA 1EUUA 4O7XA 4XF0A 4XURA 1PO11 5HV0A 5EZWA 1WW6A 1RUF1 2BW8A 4MGZE 3EYPA 5DZEA 3LWCA 2DCZA 3K46A 4IW3A 2G1MA 1YQ5A 2GNMA 4NIAA 1PZ9A 1WBFA 3M3QA 1L7RA 1NCRC 3CJIC 4XJWA 5BUVA 4FOWA 1QOOA 3BGAA 3KT7A 1ZRRA 3NKGA 1GWKA 2HWD2 4OVEA 1REDA 2VC9A 4IETA 4P08A 2JENA 4AHYA 4A6OA 5CFDC 1REEA 1UY2A 1J3RA 3I49A 4FBFA 3BI3A 1BQPA 5A1AA 1ULFA 2RMU2 4C90A 4Y20A 2B5HA 4AF9A 1J84A 5DUVA 5C3RA 4RQPB 4LO6B 3VZOA 1HB1A 3P3PA 5LWBA 4N9HA 1W8WA 3S30A 3TBDA 4OHYA 5C3SA 1JODA 2BNMA 1FAYA 2AEZA 4KBZA 1W3VA 4QPWA 1MS0A 3KV9A 3RWNA 3LKJA 1QEXA 1XOYA 3THTA 4N43B 3VBRB 3AXEA 1YHFA 3VKLA 5D8AC 1I1EA 4W6XA 1MZEA 5BNPB 4GB31 4OUMA 1OT5A 1ASJ2 2BOIA 3LA2A 3PNAA 1QJU2 4MOAA 2E51A 2ORZA 1GYKA 3WHTA 2OZJA 5FR3A 2EXKA 2CDOA 5EYXA 2D6OX 2B45X 3S7EA 2EAKA 1K5MC 4YLZA 5L7OC 2OPKA 1SBDA 1OA4A 1VLNA 3JUUA 4Z07A 1PIV3 2D6MA 5C8CB 1NOVA 2NPIA 2UURA 3ASIA 3I3MA 1STMA 4I09A 3AFGA 2TNFA 4BQ3A 5I8YA 4I01A 2VQUA 4ZS3A 1WLWA 1YJLA 4D0QA 1ENQA 4Y3OA 1JMUB 1GNZA 1NYWA 2PTMA 3POSA 1YWKA 4CXYA 4B1LA 4Q8KA 3ME2A 5FZCA 1W2UA 2R16A 1AF9A 2QQWA 4YFWA 2XLFA 4LHSA 5JVVA 3KHCA 4IERA 4E4SA 1AYN3 2NP0A 3UT0A 1TMF1 3GF6A 4KMQA 3KGLA 1YC61 2ILMA 1CAWB 4LOSA 5ACA1 1TQ5A 1HB2A 3B69A 4HN1A 4XIKA 3VGIA 3E6BA 1RXFA 1VRH1 5FP3A 3THPA 4EN6B 1GOGA 1V9U3 1DIWA 1W6OA 3HAGA 4O65A 4UFJA 5FP9A 3ZYGA 1R081 2SBAA 4BYYA 1U5ZA 4JKKA 1EAH2 2WFF2 2OYZA 2R042 5FZIA 3WF1A 1PGW2 4AI3A 2P3IA 1D7PM 4YM1A 3OGVA 3J7NA 2XJPA 4YYOA 1WW4A 4AEMA 1IPKA 4YZ2A 3K2OA 2DUOA 1DU3D 4QD2A 3MYXA 1QQP2 3K51A 5H9RA 4BZ4A 4UFLA 2WKKA 4U2AA 1HQLA 4FPKA 3ZFGA 2FDKA 4TN7A 2VULA 1F5JA 2XHNA 3PU3A 4M4PA 4HK9A 4YW5A 2PXJA 3IIAA 3J8F2 3OPZA 4TSVA 5LRRA 3H1YA 5F3EA 5LY2A 1YFXA 1W6PB 2B39A 1VBC2 5J36A 2A73B 4JV4A 5IYYA 4E9KA 1RMU3 1MEC3 1S55A 3HOBA 3JU9A 4N7IA 4BMBA 2WQZC 2HBUA 5JZGA 2RE9A 3L9JT 1ULGA 5FMBA 5EXOA 1NX9A 1GWLA 4Z82A 4JQTA 3OBAA 1T6BX 4FQZA 4I2OA 5A7WA 3KV6A 4EJRA 1AR73 1B35B 3BIWE 2BGPA 3PUSA 2P5BA 2VZPA 1E5IA 2CY6A 1PO12 1QF3A 4OZXA 3PUHA 1RUF2 3D82A 3N9OA 1LHNA 3RJ2X 3LE0A 4PQ9A 4YPJA 4NN0A 2XJSA 5F8PA 3ZMOA 3WDWA 4K7JA 5C70A 1UKRA 2E33A 1SCRA 4SLIA 1WCKA 1DYOA 5DDJ1 4LXLA 3NRUA 3Q8EA 4ZHNA 4QM8A 1RUC3 3AL5A 4LA3A 2IVJA 1Q8QA 4IEPA 4NHXA 4PDWB 5FCCA 3LOIA 5CISA 5APAA 4LE4A 3H8RA 3O1MA 2JECA 5FXVA 3QLQA 3Q8CA 3S5QA 1QH6A 1ZRCA 1I3HA 3E5UA 1VB2A 1GZ9A 4YVSA 3BODA 2ZGQA 3ZO0B 4QWNA 3KT1A 4RYDA 3VBUB 3DV8A 3M7AA 3VDBA 3WP5A 3H7YA 1UPSA 1JUIA 3K4DA 2ZEYA 2UY9A 1PVC1 4JGYC 2YV8A 3J9SA 2VO5A 4K1YA 3JD71 2JDPA 4UBHA 4Q0UA 5FTTC 3SH5A 1H1MA 4GB32 3ZYRA 5KWRA 2BPA2 1OH3A 4QX5A 4MUVA 4DEVA 2X5IB 3GHNA 4MADA 3WOGA 4AEDC 4F83A 2BBAA 1W39A 1Z7S3 3OSDA 3IZOA 1POV0 2D3RA 5BNNC 3WZ1A 5HV4A 4Q0SA 3H0OA 5F3GA 1H4GA 4FCAA 4LO7A 1ZYBA 4AI2A 5IVJA 4ISQA 3VDDC 1BK0A 3ACGA 4YZ4A 3W21A 1OXCA 2R063 4XC9A 3ZX7A 3M70A 4LT5A 3I59B 1O8PA 1RUG1 1PZ8A 1OLMA 3A7QA 1M06G 1PMHX 2O0OA 1PM4A 2XKPA 4YVSC 4RR3C 1GKBA 1O91A 4CP0A 1S0JA 4JQRA 4PLNA 1UKGA 1RHI3 1CESA 2WS91 1YLLA 1PVXA 4RS5C 2R49A 2JDYA 5DAQA 3DEMA 3K4ZA 2YHJA 1TMF2 2ZA9A 5EWSA 1CJPA 5ACA2 5I0RA 1C28A 3OGGA 2VUAA 4ZPIA 3L2HA 1CAVA 1VRH2 1LOAA 2JE9A 3MPBA 5J98B 5K0UA 2W0XA 4BB3A 3W5NA 3CL1A 2MPFA 2CWMA 4GWIA 2BZDA 3X29B 5JSPA 2D6PA 1KJRA 4HVOA 1R082 5G05L 4COYA 1CJDA 4DRRA 4BK4A 4JCKA 4RL7A 3ROUA 2Z42A 4YVWA 4QKNA 1DHKB 3PMSA 4UXAA 4AGRA 3MLKA 5EYYA 1UY1A 1C4RA 1KDMA 4K3UA 1V6IA 4R4XA 3RZKA 1A34A 1BMV1 2Y6FA 3IN9A 4EN0A 1IPJA 4FP3A 4Q4X1 1ND2A 5BYNA 4OLLA 4JRAA 5G04L 1PZ7A 1ALYA 2DUPA 2K0GA 3U0ZA 1RJ7A 1HRI3 2FCVA 3V0BB 3OEBA 1FNYA 1RUH1 2PHTA 3I3BA 4FXKB 4W65A 1H4HA 1XRUA 2WO3A 4TLGA 3MIFA 1EPZA 4CA9A 1W9WA 1VALA 5I0SA 4AI0A 2VBBA 1W8HA 2VD7A 4LITA 5CNAA 3O0XA 5FZ7A 3E6CC 5CKMA 1Q8OA 4Q0PA 1ZA4A 2XB6C 2UWBA 3KV4A 3E5XA 3PTYA 4HETA 1XNAA 3MDPA 4Q8LA 4YW7A 5HCBA 3WUDA 5L19A 1QY4A 2GNDA 2W46A 2ZGNA 2IXLA 2WYSA 4P9JA 2ZX4A 1C8M1 5FZOB 1W0PA 1JZ8A 1CAXB 4IEQA 5J3UA 1WCDJ 4P9IA 2AYHA 4OUSA 3U78A 2FQPA 4IEWA 4UOJA 4AQ2A 5FBZA 2C9AA 5FQ0B 4B4QA 1OHFA 3ZR6A 1DYPA 1NKGA 1BEV3 3U1XA 1F4HA 4AVSA 3M3EA 1KJLA 1POQA 5DDJ2 2VOWA 4LO5B 5FMOS 2A75A 4I02A 1VBA3 1YFWA 2RR11 5FYVA 4Z8BA 3WSOA 2BJSA 3OTFA 1N3QA 2A71A 2ZGSA 3E1F1 1GR3A 5A33A 1MQTA 2JWPA 5LW9A 1TME2 5CA6A 5JLVA 4QKDA 3ZN4A 2PQSA 2RM23 5E89A 4JX0A 3H8OA 4EN8B 5FP4A 4A45A 4RGAA 5F5QA 4RFT0 5KBFA 5C3QA 4XDOA 2FDFA 4DEQA 4PIYA 3AP6A 1FOD3 2FDJA 2I45A 4FT8A 3HMYA 5F5AA 2WT0A 1BVP1 4WVWA 4CU9A 2G9ZA 5A32B 4Z2AA 2RS33 4CP9B 3PURA 1W8OA 1PVC2 3VKOA 3RDIA 2W92A 3JD72 1ZBE1 2D7FA 1QKQA 5FPXA 1V6MA 2O8OA 2TBVA 1LODA 2Y60A 5DPNA 3EO6A 5E88A 3N36A 4GMP0 4DUVA 5LA2A 1ST8A 1WMDA 2ZZQA 1UZYA 2YPDA 5FUNA 5KXCA 1DGWA 1EV13 4GWNA 3RSJA 3VBOB 3ACHA 4Y26A 4PBPA 4MGSA 4IV1C 4NRMA 4BE3A 1WLTA 4BK5A 2WNVC 1RL3A 1OLME 4A3XA 3DF0A 4N43A 3AC0A 4EZHA 3AVSA 3J7LA 1MPXA 5DAXA 1RUG2 3LEIA 4LHKA 3U75A 2OKXA 3RYPA 5BNPA 2Y64A 2D5HA 2XJTA 5L7OB 4QKBA 4XHXA 4D69A 1Q8SA 5D21A 5KXBA 4FQ4A 3AKSA 2CAVA 4FFGA 2ZZJA 3ZFEC 5DZGA 2IXJA 2WS92 2VQ0A 3A0KA 2PAMA 3PU8A 4A7ZA 4TZDA 5CAZA 3OJBA 1BZWA 1W2OA 3WUCA 2DVBA 4V2WA 2W9XA 1DGRN 4Y20B 3FHAA 4YM0A 2I07B 4GD4A 1NLQA 1R1A1 4QAWA 5EV7A 2WZPP 3ZDSA 4CUBA 4GA9A 3VHRA 5GLUA 3WNKA 4DOUA 2J42A 1DZTA 1SHWB 2MEV1 5DN2A 5DUWA 3FFZA 1O3RA 1W2NA 3EXUA 3POBA 4CCCA 4XUNA 3T0BA 1NCQC 4CCOA 1APNA 4FPCA 1PNGA 1UY0A 3N35A 2NMNA 3KCXA 1JYXA 5FOBB 3GBWA 3WX5A 1BMV2 5J09A 4ZU7A 4QPIA 1CAWA 5FMDA 1OBNA 4IGOA 2GN3A 1LTEA 4OMDA 4Q4X2 3NWKA 4KU8A 1VB4A 5C9AA 4P02B 4J6GA 3VB9A 2ZHKA 1RUH2 2LM3A 1SEFA 3WDTA 3NV2A 4AEKA 1QJY1 2GNTA 1ZZ9A 1IPSA 2XJUA 1HW5A 2Q0AA 3KGZA 3VDAA 1U0AA 5JSOA 4ASLA 2G9FA 1S0FA 1O4YA 1PMIA 2E32A 5FPBA 3WCSA 1Z78A 4M0NA 4V2VA 4CDQC 1X82A 3TYJA 5FMOL 4R52A 1KGYA 3PTRB 5JXIA 1LHWA 1T2XA 3EHKA 2WFF3 5EFUA 5LK7B 4FAGA 1AR63 2ORXA 4HVRA 2W5FA 3NAPC 1IS5A 1C8M2 1L7LA 2D6LX 2QQIA 3T09A 5BNOC 3PUAA 1RUNA 1AR91 5IFTA 2DVAA 3LA7A 1PNFA 2W3JA 4XBQA 1COV1 2JB8A 4XXPA 3ACFA 5IK4A 5A3OA 5CFCC 1BK1A 2P3YA 4XFBA 4BLJA 5LEKA 2RR12 5JI7A 3J8F3 4JDMA 3ZIWA 1H2LA 4CDUC 1H6YA 5C7GA 4NPLA 1CZVA 1YXWA 3I2DA 3M1HA 5FRAA 2QCSB 4N9IA 1YI9A 1GV9A 3AYAA 4OZOA 4QGMA 5CEHA 2J22A 3Q8FA 2VCBA 3O1OA 1LU1A 4UFKA 1V6LA 3T30A 4R9BA 3T2QA 2W1WA 1V6NA 3QACA 2PHWA 2Z79A 4QXKA 2XDVA 4GULA 4CPBD 5HCAA 5CZKA 5IVBA 3HNBM 3I3QA 2VTXA 1ZZ7A 3O1VA 2K46A 4IE7A 1KS5A 5IAVA 2PHFA 5KXEA 1CZTA 1RUF3 1ZBE2 5FZDA 1RJ8A 4PDWA 3VBSC 2A7AA 2Q1FA 3NV1A 4FFIA 1PGSA 3WQ1A 4HANA 1XYOA 4CZSA 4K21A 4IDZA 1NT0A 2FHRA 5JZGB 5A7SA 4XTMA 3WDXA 1PX4A 1PO23 5A7WB 1OPOA 2VOVA 4KU7A 5CADA 3IIIA 3VBUA 1DZQA 1PK6C 2WLQA 5I8SA 1VJ2A 4HOOA 4Q4V3 1UPIA 4LNVA 5C71A 1PX3A 5FLIA 4KL1A 4B1MA 1IHMA 3OUIA 1R64A 4UW3A 4AEDB 4D3WA 3ST7A 3O0VA 1N1YA 3FLTA 1AL0G 4M00A 4Y5SA 5JMOA 2X5IA 3MLJA 2K9ZA 1HN1A 1D4M3 2YU2A 3EJKA 4UAPA 5F7UA 3VDDB 2H6CA 3O0WA 2OUHA 3D5OA 5J96B 5E8AA 1BXHA 3UETA 1H8TC 5HXMA 2GDFA 2WZR3 1JYCA 4GB33 2QQOA 5ANQA 2VMGA 4EV0A 2W87A 4QDSA 4MVTA 1QHDA 2WABA 1R1A2 4YVSB 5KR7A 4QPGC 3ZN5A 2LW8A 2QDRA 3HT2A 4JVAA 2MEV2 4GKYA 4S2FA 3JQWA 2ZJCA 2Y33A 1LRHA 3D3AA 1MACA 3FBYA 1ZREA 3PJYA 4Q29A 4XFHA 4BM8A 4FTBA 3U37A 1FT9A 3NNGA 4TXWA 1OPMA 2RG4A 2DWRA 1YFUA 3MBWA 1LGCA 2ZOEB 1W2TA 1Y3TA 2VUDA 4M4RA 1NG0A 5AFBA 1ZZBA 5BPXA 1XSRA 1CX1A 3OB8A 4WV8A 2E7AA 2FMDA 4QQ2A 3CBNA 4L99A 1OKOA 3D8CA 3FUQA 4XQWA 1TMF3 3TEWA 1G7YA 3KS7A 1QJY2 1LU2A 3CEWA 5A3UA 3CZUA 1VRH3 1WW7A 5IVYA 3ENRA 4AHZA 3BYWA 4KBBA 4WM8C 2Y26A 2FZ1A 2QUOA 2Q4SA 4DXRA 1SMVA 2ZS6B 1W3XA 1CVNA 1YRZA 2LRPA 2QBXA 4LE3A 4N53A 3HN1A 1GZWA 1TVGA 1CR7A 4OULA 1Q8VA 4DQAA 2OIIA 1I5PA 3HBZA 2XL7A 3RMYA 1AR92 5FPAA 3UKNA 4XFFA 1WGPA 5C4WC 2IVIB 1CIYA 1UOBA 2W95A 1CAVB 1TNRA 1UYYA 2ZGTA 1COV2 2J1TA 2NLRA 3AZYA 5FP8A 3UJQA 5CG9A 4LBKA 2QVSB 4XUPA 4XJZA 3FUOA 1RYYA 3OPWA 4F7ZA 3A0NA 2QTWB 5EJZB 3ZFFA 3I2GA 5I91A 1W28A 3V0AB 3SQOA 4A3ZA 2DTWA 1Z0HA 1ZRFA 2ARBA 1ZA7A 2VNGA 3LEKA 4P00B 3SCGA 1MS9A 5FZOA 3M3IA 4AHWA 3F95A 4D94A 4NPMA 2JG9C 2V72A 3CU7A 5JOZA 5J7MA 3NJVA 4QB6A 2ARXA 4OYUA 1WKYA 5I93A 4HBNA 4KH9A 1ND2B 4MLOA 2PLV3 1FNZA 4CDXC 3RWKX 2WSUA 1UU5A 5DAVA 4PJYA 2BNOA 2D43A 1SFNA 1Q56A 2XMLA 3MIBA 4HN0A 1NLSA 5FZEA 4W8JA 3ZXDA 3RZLA 1LHUA 1JYVA 1A6CA 1POV1 2W47A 2O14A 3HJRA 3A21A 4HZFA 4NWWA 1WMXA 3WVJA 3LSEA 2EXIA 5DXDA 3AP7A 1F31A 3OOXA 3GBFA 1XBFA 2J1UA 4HT1T 4XJAA 5A80A 1UCXA 4OQ9A 1RUOA 1KQRA 1NCRA 3CJIA 2YZ4A 1VPHA 3EQEA 2PHDA 5FPZA 4FSJA 1FV2A 5BNQA 1URXA 1OH4A 2B8MA 1WD3A 5FYBA 1J1TA 5CFDA 3RZZA 4A2UA 2BQPA 4D7YA 4GJYA 4IEZA 5JPMB 1CN1A 1AUYA 1W9YA 3ETQA 1GANA 4CUGA 2DCTA 1S0CA 2E7TA 5LRSA 2EXJA 5GM0A 1LJ7A 4YRDA 2ZEWA 4Q0QA 4QX7A 3S7IA 5J37A 3DXUA 3OYWB 2KD7A 3WR0A 3K77A 3V56A 4D6RA 1GQHA 4MXWB 2Q8DA 4CCDA 4B4PA 3WEZA 1AXKA 4GJZA 3K3OA 1YUDA 3AKQA 3ECQA 5FZKA 4CU7A 3RQ0A 3IB3A 2RJLA 5D8AA 1QJX1 3SISA 1BBT1 2R0HA 4WM7C 3SCHA 2QQJA 4DRVA 2UYBA 2IXIA 1S4CA 2CV6A 4AVTA 2A70A 2ZGPA 2W52A 1QH7A 5L9BA 2Y6JA 2VUJA 2VQTA 2JDZA 4O9GA 1K5MA 4Y4RA 1UU6A 5L7OA 3ZSLA 3M2MA 1HLCA 2C6SA 2X29A 1HB3A 3DGTA 2XQXA 4LBMA 4LEJA 3PUIA 4XOGA 1RUG3 1UMZA 2OS2A 1DGWX 1SPPB 2DVGA 1UYZA 2XJRA 2XOMA 3FC0A 1IKQA 2IFWA 2PMWB 2DFCA 2L9LA 4K6BA 4RN5A 4ES8A 3HNMA 1N1TA 4R9DA 2EVXA 3B9CA 4AOCA 2P2KA 4HPKB 4OFGA 2VNRA 2KXLA 3BIEA 2A3YA 2Y8KA 2W68A 1JZ5A 1O8SA 1MVQA 4XF3A 3ZOIA 4N90A 1ACCA 4E27A 4FPHA 5ANNA 3T3YA 4B3NA 2QFEA 5FOJB 4QKFA 5T5JA 3BTXA 2A6VA 4Q4W1 2GNBA 1RUD1 5B2GB 3GCXA 4XJUA 2B9UA 1XYPA 3H42B 3W20A 4I0BA 4IXLA 3R6SA 1HXS1 1WD4A 5HCFA 1HRV1 1MS1A 4GIQA 5F2WA 2AZ5A 4B7EA 2D98A 1QXRA 3RVHA 3C8XA 5C6CA 2BUKA 4MGQA 3IPVB 2NN8A 2WT1A 3MICA 1GNYA 3ALQA 1W05A 4KI5M 5FUPA 4B4RA 4CDQB 5FBJA 4LKSA 1W9SA 2G4IA 3WT3A 1O4ZA 4Q4X3 5ERLA 5DABA 4NAOA 4AAPA 1GSLA 1GWMA 1RUJ3 3RI8A 4EWEA 4CEWA 1WCUA 2PHXA 1EP0A 4Q0VA 4BLIA 5J1XA 2DBIA 4NIIA 3MGUA 2E9QA 2XBO1 5FZLA 1OSGA 5DMYA 4JGZC 5K8SA 2P3JA 1HJGA 2FDHA 1XNDA 1ENXA 1JOPA 2DV9A 2VNVA 1KXGA 5FZHA 4QPIB 5IVFA 1N1SA 2YY1A 2HKXA 4YM3A 2GU9A 3CDZB 1LCLA 5F6KA 1YNAA 4IE5A 1UQXA 3MFAA 2OQ6A 1D0HA 4QDRA 3ZVXA 5C9AB 4PF5A 5A7NA 1UY3A 4Y1XA 1VAVA 2Y6HA 2DBNA 4A7YA 2DYCA 2J1VA 4C0HA 4GMP1 5LASA 1C1FA 3TNQA 4OHZA 3ZYHA 4AVAA 2RJ2A 4E8DA 4RHV1 4ZXEA 2VZUA 1A8DA 2C24A 3KT4A 2RR13 1VBD3 2VCCA 4QHBA 2WYFA 3BU0A 3NJXA 4FI9A 2VQAA 3FWEA 2BBVA 2VVEA 2EIGA 2QJVA 2VMFA 3CMGA 4MHRA 3VBSB 2ZEXA 3ZYPA 4CEWC 1NA1C 2VE1A 4M01A 1BCXA 4JRLA 4YW2A 5LATA 3G6JB 3KQRA 4CDWC 1LESA 2ZACA 2D3SA 4LPLA 3TEZA 4LQRA 2F6BA 2NMOA 4O9EA 4PQQA 1WUVA 2OVUA 4XW3A 4LBOA 3UGGA 4JGYA 1VR3A 1O5LA 4XFAA 2VGDA 1QJX2 2ZKLA 4E8CA 2CHHA 2CWSA 1BBT2 4FAHA 1XNBA 3ZXFA 3LFMA 1ND3C 3AKTA 3MF9A 4QHZA 3PDQA 4META 4AEDA 2P6CA 1KFXL 3IDCB 2CDPA 3THCA 3DPRC 2AC1A 1SCSA 1OFNA 3KF5A 1UMHA 5BNNA 3I97A 1GOHA 1H8TB 1GQPA 3C7HA 5HI0A 1J59A 2RV9A 2W1QA 4LBJA 3RZMA 3VDDA 4IEVA 3WG2A 2XWJB 3AL6A 5FY1A 3GJAA 5GLTA 3LAGA 4ITCA 5GLWA 4BCUA 4HVQA 2VPVA 2A5ZA 3B9IA 3S6PA 2WA3A 1G9AA 4QPGB 5LK5A 1TME1 4UFMA 1E5HA 1W0NA 1SBEA 1V6OA 2XR4A 3QD6A 4BQXA 3FLPA 3CZJA 3RMXA 4NIGA 2VMCA 2XHKA 4RR3A 2VXJA 3VD5A 3H3ZA 2ID4A 2JDHA 2A1XA 2DUQA 2KM2A 1U5IA 2YFUA 4N7UA 1DG6A 1PHMA 4RS5A 4AGGA 2OT7A 5FPVA 3WV6A 1K5JA 3OBZA 3TEXA 4XJ9A 4BQ5A 1UX6A 1HV0A 1R1A3 4FVVA 1U12A 1OA2A 1AX1A 5LB6A 3TN93 2IUWA 1IQDC 2WA4A 2WC2A 4Q4W2 5FYUA 3VHNA 1RUD2 2D93A 2MEV3 1SLTA 3AP5A 2AGSA 3EBRA 1HXS2 4ZU4A 2WL1A 4S2DA 2GH2A 1HRV2 3C7EA 5FY8A 2UY8A 1Y9GA 5IVCA 4Q4Y3 4CVUA 2ET7A 3RZJA 3SKJE 3CKHA 3SLIA 2P34A 1DLLA 2HWB1 5LEJA 3OG2A 3H7JA 1FYUA 4E4HA 2AEYA 1NAEA 1GQGA 5LZ6A 1SLAA 1NZCA 2C5DA 2Q8EA 4ATEA 2HWC1 1UIKA 1QJY3 3WCRA 4LBLA 2XBO2 1O3QA 5C4WB 1CAUA 4NWVA 1WMFA 2QDNA 3Q8BA 4Q27A 1UMIA 3BALA 4H7MA 4G9SB 3SEEA 4B8EA 4DIQA 4UI9L 1MS4A 1VRBA 4XETA 1JI6A 2VBPA 1KEXA 2QZ3A 1DQ0A 3LD8A 4FTSA 1DQ5A 4ZKTB 3C7OA 4YW4A 2UWAA 1W8NA 1OQ1A 2ZAAA 2VVFA 3BTZA 1UL9A 5FP7A 1UAIA 4YNIA 2ZGKA 5A7PA 4NPRA 1W8UA 4ORFA 1X7NA 1VMFA 1L3JA 4Y1ZA 5JPNB 2DCYA 2CGOA 3V0AA 3FLRA 3W58A 4I0AA 1UYXA 5SV5A 4F3JA 4J25A 2DVFA 1NXD1 1RIRA 2YROA 4RHV2 3ZSKA 2ZMKA 3VD9A 3AMQA 3UGFA 4AEJA 4C1WA 4L97A 3LSDA 1G9FA 1X9PA 3QH6A 4N53B 5FZ3A 5GJ6A 3VL9A 1EUTA 1GZWB 2ZMLA 2PAKA 1UO9A 3F2ZA 4JKLA 4TYSA 3FJSA 2QZ2A 3ETPA 2WINB 1D0GA 2Z2SB 1JYIA 5A6ZA 3EB7A 1H9PA 3GALA 5FZAA 1M4WA 4LO4B 4HSJA 5LBBA 1CD3G 3DYMA 4XFIA 4XQDA 3AYEA 5JOWA 2QKDA 3OEAA 3TOJA 3UESA 5CVRA 2PHLA 3U10A 3WNOA 4M3CA 1PIV1 2E7QA 2Y6GA 3FX3A 3ZFFB 4EROA 4FPFA 2HWF3 3CIHA 1BVVA 2YGLA 4L11A 5A1FA 2IXCA 4TWTA 3KWVA 3N9QA 3WDUA 1ULEA 1UWWA 4DFSA 3GJBA 5JOYA 4QT6A 1F15A 1JS9A 3ZKYA 4INDA 1W6MA 1IS4A 2VZRA 1E57A 1YIFA 2WNUC 3GZEA 1YCIA 2WWUA 3UYJA 4CU6A 1JZ6A 3ORJA 2LALA 1RITA 2OX0A 2J7MA 1Q5OA 3HQRA 2EIBA 3OYWA 5C8CC 5FO9B 1RXGA 2DCKA 5DG1A 3WNLA 4IV1A 4MXWA 5FKBA 2EXHA 1F35A 5A6YA 2WNVA 4YGBA 4AQTA 5D1IA 1HQNA 4AI1A 3H1MA 4OI0A 4XCAA 3LB9A 2VCMA 4IEXA 5JWPA 3KVAA 1V9U1 2A6XA 3MW3A 1JYTA 4KG0A 3IDEA 4DMIA 2ZX0A 3ZPOA 4AW7A 4TLFA 2YYOA 3H8UA 1NCRB 3CJIB 2CTVA 3C2UA 3KM5A 4IV3A 3UL2A 1WMEA 3ZFEA 2BWCA 4NE9A 5CFDB 2IC1A 3ZSJA 1VIWB 2OZ6A 5H9QA 1SQ4A 5BV6A 2ZX1A 4GZ9A 4HMZA 4BQYA 4XEZA 1SPPA 1YQCA 2VZTA 3ZPYA 2X8KA 1ZZ8A 2BRTA 4H55A 3PL0A 5F2SA 5I0UA 4XTPA 5F9TA 3KCCA 5FY9A 5FZGA 2EICA 2FCUA 4K40A 1OOPC 2HWD3 2VUCA 1NCQA 4HPKA 4C1XA 5D8AB 4AAXA 2HWB2 1MEC1 4HKLA 3UNPA 1RTVA 1C57A 5FO8B 2RMU3 4ET7A 4HLTA 2BGOA 4JZRA 4UBGA 3ILFA 4DXTA 2YG0A 4OI2A 3HQUA 3PVBB 5IK7A 2JG8C 1CPMA 1AR71 2GC3A 3OD0A 5FYIA 3LIGA 1K5MB 3MV01 2WDBA 2HWC2 2RDRA 1AYM1 2GC2A 3M3CA 4IV3C 5T3NA 5JCTA 3WW2A 3DXTA 3GZAA 3WNMA 4JDOA 5DAWA 3ZXGA 5FY4A 4COVA 2Y0IA 1SLCA 1ASJ3 5FK7A 3RPQA 4NRQA 4NHYA 2RS51 1QJU3 3POWA 3D6EA 3IPVA 4CDQA 1WCSA 4Y1YA 1K42A 2VOKA 4Y5TA 4BDVB 2VZ1A 2GALA 3THDA 3VBFC 4BXFA 3NAPA 4UFHA 4E2SA 4Q1RA 2ZGLA 5BNOA 1SFPA 4YG0A 4URTA 4CUAA 1US2A 4ASKA 2ERFA 3M8LA 5JXJA 5KHJA 4IGQA 1OD5A 4MHUA 4AQ6A 1GZCA 5CFCA 1U5YA 1DCSA 4CEYC 2HEWF 3VDCA 2V5DA 2XPJA 4PLMA 2JIJA 2CNAA 4B29A 2V73A 2XUEA 3NVCA 4JAAA 1OA3A 2Y0OA 4NMIA 1OLQA 3NQHA 4UT5A 5FYTA 4CDUA 4DY3A 1YI7A 1ZBA1 3VLBB 2GMMA 2O1QA 4H7LA 3WLUA 5F1RA 1FX5A 1ODNA 2JJ6A 2R1BA 3MW2A 4JDNA 4IQPA 4BIFA 1ZX5A 4RQPC 1Z7S1 4DPNA 2GMEA 5IHRA 4MGTA 2D6NA 3D0JA 2I74A 3I2FA 3SH3A 4AQSA 3QOPA 4LJHA 4LORA 2CU5A 5LBCA 5B4NA 1ODMA 4XMAA 1PIV2 5GLVA 4CEWB 5GKAC 2WZEA 4HKOA 3VBRC 3I2OA 1EAH3 2R043 4HK8A 3RGBA 2GMPA 2CGNA 3VBSA 2ZX3A 2G19A 2ET1A 1TZOA 1XU1A 2Y34A 2AREA 4CDWB 5FLJA 2EAAA 2OW4A 2YB7A 2WO7A 4XZUG 1QQP3 4BWOA 1HN0A 1OQDA 2R6QA 4XIOA 4BQWA 4KWKA 4AFMA 3IWZA 2NQYA 5FZ8A 1BLZA 1OFSA 3ZYJB 1PK6A 2YBKA 5KC5A 3JZVA 3WNPA 2BNNA 4S2GA 3LA3A 2ZGRA 3NV4A 4CCNA 2Z5WA 3N7JA 2JD4A 1VBC3 3PHMA 3KZ4C 3IAPA 4AVBA 4NIDA 3WW4A 1V9U2 1ZZCA 3DPRB 4LHLA 3VN4A 3ZYBA 1J83A 3ZXEA 4AE2A 3AYCA 2YMZA 5DG2A 3RI9A 5FAXA 3VUOA 3WF2A 1H2KA 3LDRA 4LK6A 4OCTA 5FY7A 1JW6A 2IXHA 5FZ6A 1QWRA 2ADDA 3VV1A 5JR2A 4FP2A 1GLHA 1H8TA 1QJX3 4I3GA 4OI4A 3KVBA 3ZM8A 5FXZA 5IUQA 2AACA 4ISRA 4L9BA 2V5YA 4YGDA 2WZ8A 4LA2A 3IMNA 1AVBA 1PO13 4NVPA 3ZYIB 4CSWA 5FZ9A 3E6DA 1KRIA 2CGPA 4B7KA 2C0ZA 2IZWA 4NIHA 3AZXA 4QPGA 3V65A 4LBQA 2BWAA 2P17A 3H3LA 5F39A 3SXWA 4YZ5A 5FZ1A 5IATA 3K3NA 4GAZA 1UXXX 2DURA 5HCHA 1IZ3A 1FI2A 1XJAA 3DCQA 3O5SA 4JGYB 4NHKA 1KDKA 2D5FA 2VAUA 1W6NA 2E26A 1I5ZA 1MEC2 3BPSA 1EY2A 4K9SA 1JXNA 4P9WA 5FXXA 3WDVA 4OI1A 3AJYA 1AR72 2R30A 5BNNB 1O3TA 1V00A 3N7MA 3VD7A 1AYM2 3U07A 5GZGA 2G9GA 2VOTA 3PVOA 3VBHC 2K2SA 3OBTA 3HD8B 1NQJA 3ZXJA 3GXUA 2JEMA 3AK0A 4NAMA 3GBGA 3R05A 3MO4A 3DECA 3U11A 2HEYF 4CCEA 2WUHA 5E1RA 1EPWA 2RS52 1YJKA 1F4AA 4WM8A 4XBNA 1HDKA 3B3QE 4AK3A 3ABZA 5IAXA 1VBA1 2R071 4XAAA 1HXS3 4RR3B 1QXPA 4UFIA 1HRV3 1S0BA 4K1ZA 3TB0A 1B35C 2KA3A 1G9BA 1GNHA 5B4XA 1IG0A 2ES3A 3UK9A 2ZX2A 3BUCA 4RS5B 2AUYA 4LMFA 4R9CA 3I2KA 1W6QA 2YC2A 1WWYA 5C4WA 3LPFA 4CTEA 2A3WA 1FOD1 5FYYA 1PM7A 5E6HA 1GBGA 4COUA 3WNXA 1LAJA 3BOPA 4AL9A 1JOJA 4XFGA 2ZPXA 2FD8A 2D40A 1AHSA 1ZBA2 4DNYA 5A3MA 5FDBA 5IK8A 1JZ3A 5ABJC 4LTAA 1NUKA 5ACA3 3CHXA 4E4DX 3AKPA 1Z7S2 1LOEA 5A6XA 2JG9A 4RD7A 2PN5A 3APBA 3P5BA 1EV11 1JHJA 1UIJA 2B46X 2ZXQA 2JICA 3ZXAC 3BOWA 5HXVA 3T0DA 1YQ6A 4ARXA 4CDXA 1R083 2ETEA 5LY1A 3LOBA 1UZZA 2D3PA 3N9LA 1N3OA 2ZGMA 1CAUB 1G9CA 1MZ5A 2VJXA 3ELNA 2VZ3A 5LA1A 1LOFC 3WP3A 5FZ4A 5T50A 2VW2A 4WVMB 5LCWL 3MIDA 4CP2A 3MF6A 1CONA 2JDMA 2XVGA 1A78A 2OUJA 1XE0A 2RS11 3WXPA 4YARA 3ZKUA 4D6SA 5JUVA 1UOGA 2P3KA 3OUJA 5LBFA 1ULCA 3GZTB 4BQ1A 3SMHA 3U14A 2VVDA 5FUIA 1HV1A 3DKQA 4MZUA 4FTEA 1QJZA 2YXSA 1WLDA 1YFYA 2ZABA 2ZGUA 4UW5A 4A42A 2W08A 1UY4A 2Q1MA 2TUNA 1LGNA 3BPZA 1UOFA 5JDBA 1G6NA 1RVF1 3PLQA 1DQ6A 2ZMNA 3E97A 3OD4A 1DFQA 3AMNA 2QQVA 3AP9A 1NLRA 2EIEA 1D2SA 2D44A 4XDQA 3OY8A 2OPWA 3WG3A 3ZSMA 1J3QA 5FYHA 4C91A 1UOJA 3I8TA 1DYKA 4QM9A 4V1PA 1SDWA 4PIXA 5FFOC 4BQ4A 2WIIB 4C0BA 2DFBA 2N7GA 3QCWA 5IK5A 4WM7A 2QQUA 5I0TA 3HNYM 1OURA 1AL21 5LA0A 4G4FA 5CKQA 4L92A 3QH7A 2AR6A 5AC91 4KNCA 2E31A 2ZAHA 4M3CB 3U4SA 5DDJ3 4W4ZA 3LF7A 2LROA 1MS8A 4LUKA 4MH0E 5I8TA 5H9SA 3W9AA 2FDIA 3WQ7A 1TME3 4GH4C 1VP6A 1AX2A 1W6MB 2ATFA 3HVDA 3KV5A 4NO4A 3CF6E 4NRPA 1ZVFA 3AMPA 1PGL1 2R1DA 2ZEZA 5FLHA 5KHKA 4KWJA 5FY5A 3GZUC 4AYUA 4EN9B 1AR61 3VL8A 1I9RA 4EZ4A 2QNKA 1MVEA 4CP1A 3IDAA 1DLCA 1O6UA 4IV1B 1NZIA 5F3CA 1PVC3 4JHZA 4SBVA 2WNVB 4QX3A 5AVPA 3JD73 1QJFA 2QQNA 1O59A 3GYDA 1NE4A 4OQ8A 1QNYA 3USUA 1V6KA 2HYXA 1AX0A 3OUHA 4XYXA 4CCJA 5M0TA 1VBA2 1O7FA 2R072 1ZNPA 2HYKA 2JD9A 2LTNA 2W39A 4IV3B 4P5YA 4U36A 5IVVA 4BH9A 3MIEA 3HIFA 2B4KA 3ZFEB 3IT8A 3WNNA 5E16A 3BTAA 2HWB3 4LLFA 4AFAA 5GZDA 5KXDA 1JBCA 4F8AA 4YSFA 4Q5OA 1XYNA 4IE0A 2PELA 4HL0A 1YQ8A 1FOD2 2BERA 4QXHA 1JZ4A 3C7GA 3AZZA 3ITQA 3NL1A 3VKNA 5IVEA 2OA2A 2XUMA 1XXNA 2EA7A 2BP6A 4QX0A 3VBFB 4DB5A 2XVKA 1W99A 3DKWA 3LEGA 1QOTA 2C4XA 1NCQB 2WS93 1QDOA 2WWSA 4XXAA 1MS3A 4W50A 3BCWA 3INAA 4JGZA 5J48A 3JBG1 5EIYB 4P9YA 1PO21 4FFFA 4CEYB 1EV12 1UN1A 4NOTA 2YU1A 5F6LB 1R091 4BQ2A 1PMJX 4COZA 1CIWA 4Q4V1 4QX1A 4S2HA 4BIOA 2I2SA 3LDBA 2W2IA 4LUMA 1YIPA 1OUXA 1WZXA 1OC1A 4FXGB 2ARCA 4JKMA 3JQXA 4BHPA 3B93A 2FZ2A 3MZHA 2JB4A 3A22A 1Q3EA 2VU9A 3POFA 4MGYE 1D4M1 3CJXA 4X6RB 4XQ4A 5A3WA 3Q9OA 1UX7A 2J1AA 4M3CF 3LEMA 5FXWA 3RYKA 3SKVA 2WQ4A 3VBOC 1JHNA 4FOYA 4YWAA 3N3HA 2RS12 3NNFA 2VXRA 1FPN1 3B01A 3MUZ1 4ZS2A 1REFA 5FZMA 2WZR1 4LIUA 4IGPA 1LULA 3FE5A 3KF3A 3NAPB 1RUH3 3HT1A 1NA1A 3B7MA 4AVVA 5BNOB 1N3PA 4FFHA 3K4AA 1VBE1 4NHLA 3R4UA 2CAUA 1W9FA 4LBNA 4XUQA 1RVF2 3ZN6A 3IDBB 4XILA 4ARYA 4CDWA 5CFCB 3H8XA 4LHNA 2P37A 3MI8A 3W5MA 5FPUA 3H9AA 3BB6A 3KD4A 1DGLA 4NROA 2FMYA 4LKFA 4CDUB 5F32A 1NY71 1RUI1 1C8M3 3HWJA 4HFSA 1H2MA 5C3OA 1IG3A 3BKZA 1UZ0A 2DTYA 4XHBA 1ND3A 1TG7A 5GZEA 4CCKA 1CQ9A 1AL22 1TEIA 1OI6A 2WO1A 1GZTA 3LIHA 3W59A 3DPRA 4A41A 5AC92 1KS4A 2Q1ZB 2WRAA 1IOAA 1VBB1 2WWJA 4QHOA 4DUXA 1B09A 1RUE1 1S1AA 2HWE1 2XGXA 3RJRA 4Y22A 3QBQA 3VZNA 3KCYA 3O14A 1YYNA 1XB9A 3ILRA 1AJKA 2VMHA 1OF3A 4QDQA 2PHRA 2J1SA 5FYMA 5EPAA 1CGPA 2UYAA 1ULPA 1PGL2 1RINA 4ATFA 5T5PA 4QB1A 3P3NA 1SBFA 1FMD1 4Y33A 4K8FA 2X10A 1AR62 2XKOA 2PFWA 1AR81 1IS6A 2VTFA 2GSYA 3IBMA 1PK6B 1X33A 4WVZA 1H0BA 2JDAA 4XZPA 4OHWA 4MO3M 5I0DA 1ZBE3 3DYPA 3POJA 2F17A 1C5IA 3TRSB 5F3IA 3N9NA 3J7HA 3PIJA 2PYTA 1LOBA 1SG3A 4UW6A 4KG8A 4QQHA 3VHOA 5GZFA 4QU2A 5LA9A 3VBHB 2X09A 2JDUA 4L2NA 1XU2A 2J1EA 3I3DA 4XFCA 3J7MA 3ACLA 4PT6A 1XNKA 2WN2A 4J1WA 1Y7BA 2QQKA 3K48A 3RS6A 1F2NA 3UKVA 4DS0A 1S2BA 1UZVA 4LKEA 2GC1A 2Q8CA 2JKXA 1JN2P 4IEUA 1DQ4A 4YZ1A 2PLV1 4LBQB 4OMCA 4ZONA 3FZ3A 4XF1A 4IESA 1SACA 1ZM1A 1AYM3 2DCJA 2BTVC 2JIGA 3HQXA 1EYBA 5K4LA 3KSCA 5CB7A 1W6NB 4HXCA 3VD4A 2H6BA 4WBBA 4XUOA 3ON7A 3JBG2 4MGIE 5A7OA 2BYVE 2BVVA 4DINB 4MGKE 1F5FA 4LOTA 2RS53 2WR9A 4JTOA 3WDYA 4Y5Z0 3OPTA 1PO22 3VZMA 3ZFGC 1LHOA 1VMJA 2V4AA 3O1RA 3MV11 1D4VB 1R092 1QMJA 2H0VA 2WT2A 2XQRA 3NKTA 4Q4V2 4QU1A 4YG6A 1LEDA 3ZXLA 2IWGB 3BU7A 2BDRA 3LGRA 4LO8A 4P9XA 3O1UA 5ABJB 3T2PA 4FPJA 1VE0A 1DBNA 3USSA 4DXZA 4LK7A 3PVEA 5L36A 4YFZA 3LZZA 4AZZA 2HLEA 5AFEA 5JZGC 4LKDA 1D4M2 4RGGA 4WM8B 3I2IA 4FPYA 1GMMA 2YBPA 2BGCA 1OLRA 5DZFA 2ZHNA 4YGEA 4Z1VA 3S5AA 1FPN2 3JB8A 2WZR2 1W8TA 4YW6A 1E5SA 2MHFA 1ZBA3 1MR5A 2BOJA 3C7FA 1I6XA 2VL4A 1XPWA 3I2JA 4AR2A 3JXSA 2W1UA 2VCAA 1KFUL 1W6QB 3AKRA 3MUY1 1VBE2 2F4PA 1A3KA 2ZTNA 4PLOA 2VNOA 1CZSA 4QXBA 3T2TA 4CXWA 3VZJA 5FREA 2C9KA 5T55A 4PI0A 3NSTA 3SC7X 4AI9A 4AXOA 2OXBA 4UF0A 4WVMA 4BU2A 4M0HA 5D2AA 4HSLA 4RGKA 4KWUA 3J26N 1Y43B 2VZSA 4IUGA 1NY72 1RUI2 1VAKA 1RC6A 4QMAA 4W6YA 3RRDA 3TEYA 5GZCA 3ZDVA 1AR93 2C1FA 3CQOA 4DY5A 1LEMA 4NJ4A 2JG9B 2GP5A 2RDNA 2WNUA 1COV3 1ULOA 3WF0A 3O1PA 4J1XA 4KWLA 1VBB2 1IKPA 4CDXB 2WAOA 4PBOA 1RUE2 4A7KA 2HWE2 3FFQA 5C8CA 5FMCA 1NXMA 4Y1UA 4GQ7A 2EF6A 1AZDA 4ZZ5A 2YDEA 1JYNA 3URFA 4OHXA 4BXSV 3AFKA 1JOBA 3POYA 1YEWA 4WZCA 4IEYA 5FZ0A 3R0RA 1JZ7A 3ZIXA 3G7DA 4YZ3A 4BJ0A 1ENRA 2IFRA 1OVPA 4E4ZA 1FMD2 1K3IA 1UYPA 1XQNA 2VBDA 1RGSA 2W91A 1H2NA 4O61A 4YG3A 1LGBA 3D0SA 1VAMA 4I30A 1AR82 1S0IA 3C3VA 1O4TA 1HKDA 2E53A 4CCLA 3OGRA 2R7EB 3K75B 1GP6A 3L2YA 2Z4FA 1XC6A 4W6WA 3ZLIA 4IE4A 1AJOA 3HPNA 4GH4B 1JZ2A 2D97A 1V0AA 4FPGA 2VG9A 4IE6A 5DUXA 3UV9A 4AGVA 2KR2A 4I0WB 2EALA 1C1LA 2JE8A 1RUJ1 2VR4A 1QXJA 2YGMA 3N9PA 3OY8B 3BTYA 4C8DA 3WY6A 1LOCA 1SLBA 4EWDA 5JIUA 3OBRA 1GICA 2BVBA 2YPJA 5IWFA 1OOPA 1AYN1 5KHGA 3SH4A 4AVCA 3GCWA 1SLIA 3CNAA 3T2OA 5EP9A 1JU4A 4WM7B 3R4SA 4WVVA 5L9RA 4AI8A 5K0UC 3V64A 3POGA 3R4DB 3N9MA 1ZRIA 2VW1A 3I54A 5DUUA 2PLV2 1MZFA 2ZCWA 5A7QA 4DO0A 4CUCA 1IS3A 2JG8A 1DGRA 2WNOA 3AJZA 3IM0A 3NJYA 3PMEA 1LOGA 3T1LA 1F9KA 1X50A 1AXZA 3T4HB 4DUWA 3PIGA 4YVWC 4EN7B 4MXVA 4JHTA 4E2QA 2YC0A 1IGOA 2BFUS 5T52A 1AXYA 2QQPA 4FPEA 3AVRA 2GP3A 4YW3A 5DAPA 2R073 1A8MA 1VBD1 2W94A 3PVNA 1ND2C 1X8EA 4QB2A 5EHDA 2X05A 5JMCA 4PI2A 3GGLA 1DQ2A 2A6ZA 2XJQA 1FATA 3B00A 4FPOB 3VZKA 2WQ8A 4LBQD 4H2AA 3AX4A 2HJIA 4LULA 4A44A 3AZVA 5L9VA 3N7KA 3VBFA 5C8WA 4FPLA 2UWCA 1LB2A 3ES4A 2JXAA 5A3NA 1RMU1 4D7SA 2VOXA 3USUB 2ARAA 3VHPA 2VZQA 1D2QA 5C5TA 3WF4A 4AFCA 3ILNA 1J58A 3NNLA 1HB4A 2Q8OA 4CEYA 5FJKA 1BKZA 3KMHA 1HX6A 4GWMA 4P9LA 5T5OA 4K20A 4D8MA 1QOSA 3DUIA 5JIAA 4ZXKA 2HEVF 1XE8A 4Y4YA 5FYCA 2PQQA 2WSVA 4RQPA 5BY5A 3ZMNA 1WBLA 1XNTA 4MYEA 1XE7A 5A6QA 2X53S 3A4UA 3AM2A 3AMMA 2JDNA 5T54A 3SHRA 3MW4A 2QE3A 5K9YA 2P1BA 3JB4C 4K8RB 5IJRA 2BU9A 1RUC1 3TNPB 2FCTA 1H6XA 2GZWA 4QGNA 3VBRA 3I3EA 2XJVA 1MQTC 2XLAA 3LQCA 3MIHA 3OCPA 5FY0A 4JGZB 5F5CA 3O1TA 1G8WA 2DF7A 4QQLA 3DN7A 5EQUA 3KLSA 4R9AA 1Y4WA 4D7TA 2NM1A 4ZU5A 2A3XA 3NMBA 2PA7A 2RS13 2E6VA 2E63A 3KQ4B 3MHZA 3T4VA 1DF0A 5KHHA 4L8QA 2J1RA 3AMHA 4FOQA 3BVCA 5JOXA 3J4UH 2Q5TA 1OMIA 5FIXA 5A1LA 2ADEA 3MIGA 2FDGA 4YM2A 5FKCA 2A6YA 1QDCA 3TN91 5FYZA 1RVF3 1JU3A 3POIA 3WW1A 2Z69A
chains in the Genus database with same CATH topology
2Q8CA 2YBKA 4AAPA 3AVSA 4EZHA 5FY8A 5IVCA 5A7SA 3N9PA 3K2OA 4CCNA 4C8DA 5FZ4A 5A7WB 5FZLA 4E4HA 2YU1A 5IWFA 2XMLA 4HOOA 5K4LA 4TN7A 3LDBA 5FZEA 3PU3A 2W2IA 3PU8A 5FYSA 5FZHA 4D6SA 5IVFA 5FY7A 5A7OA 5F2SA 5FZ6A 2PXJA 4V2WA 5A3TA 5FY9A 5FZGA 2Q8EA 3N9MA 5F3EA 3KVBA 5LY2A 2OQ6A 5A80A 5FXZA 3OPTA 5A7QA 4DO0A 4GD4A 3NJYA 2YU2A 5A7NA 4CSWA 5FZ9A 5A3WA 5FXWA 4QU1A 5FYBA 4URAA 5FWEA 4DIQA 4GJYA 1VRBA 5FZMA 4LIUA 5F39A 5ANQA 5FZ1A 3LD8A 4CUGA 4IGPA 3KV6A 3K3NA 5FYHA 5A7WA 4GAZA 5FYIA 4CCOA 3AVRA 2GP3A 3PUSA 4NUBA 4QX7A 4UF0B 2P5BA 5FP7A 3PUQA 3DXUA 5KR7A 4LITA 2VD7A 3DXTA 3N9OA 4IGOA 5FZ7A 5A7PA 2YBPA 4D6RA 5FZBA 2YBSA 2Q8DA 3KV4A 4GJZA 5FY4A 5FXXA 3K3OA 5FZKA 5FJHA 5FPUA 5LWBA 3U4SA 4LXLA 3AL5A 5A3NA 5F32A 5FZOB 3KV9A 5FZ3A 4QXBA 3U78A 4BXFA 5FPBA 5FZFA 5FXVA 4CCKA 2OQ7A 5FPLA 4LIVA 4V2VA 4Y4RA 3KV5A 5FJKA 4AI9A 3PTRB 4HONA 4UF0A 4BU2A 4CCMA 4QWNA 2WWJA 5FZAA 4ASKA 5FY5A 4IGQA 4D6QA 5FYVA 5ISLA 4EZ4A 3PDQA 2OS2A 4XDPA 5FYCA 3PUAA 5IVYA 5F3CA 5FV3A 5F37A 5FWJA 5LW9A 2XUEA 2GP5A 5FBJA 5FYTA 5FYMA 5F5IA 5IW0A 5FP4A 5FYUA 5A1FA 3N9QA 4XDOA 5FY1A 3AL6A 4Y33A 5FYYA 4CCJA 5F5AA 4Y3OA 5FY0A 5IVVA 3PURA 5E6HA 2WWUA 5F3GA 5F5CA 5FPAA 3UYJA 5IVJA 5FZCA 2OX0A 4QXCA 5CEHA 5FZ0A 4BISA 5F3IA 5FP8A 3N9NA 3OPWA 4QXHA 2OT7A 5FPVA 2XDVA 4QX8A 5F2WA 5IVEA 2YPDA 5FP3A 5FUNA 4CCLA 5A1LA 5IVBA 4EYUA 3KVAA 2XXZA 3RVHA 3ZLIA 5FP9A 5A3PA 5FZDA 3ZPOA 5LY1A 5FYZA 5FZOA 5FUPA 3N9LA 5FZ8A 5FZIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q8C A;  2YBK A;  4AAP A;  3AVS A;  4EZH A;  5FY8 A;  5IVC A;  5A7S A;  3N9P A;  3K2O A;  4CCN A;  4C8D A;  5FZ4 A;  5A7W B;  5FZL A;  4E4H A;  2YU1 A;  5IWF A;  2XML A;  4HOO A;  5K4L A;  4TN7 A;  3LDB A;  5FZE A;  3PU3 A;  2W2I A;  3PU8 A;  5FYS A;  5FZH A;  4D6S A;  5IVF A;  5FY7 A;  5A7O A;  5F2S A;  5FZ6 A;  2PXJ A;  4V2W A;  5A3T A;  5FY9 A;  5FZG A;  2Q8E A;  3N9M A;  5F3E A;  3KVB A;  5LY2 A;  2OQ6 A;  5A80 A;  5FXZ A;  3OPT A;  5A7Q A;  4DO0 A;  4GD4 A;  3NJY A;  2YU2 A;  5A7N A;  4CSW A;  5FZ9 A;  5A3W A;  5FXW A;  4QU1 A;  5FYB A;  4URA A;  5FWE A;  4DIQ A;  4GJY A;  1VRB A;  5FZM A;  4LIU A;  5F39 A;  5ANQ A;  5FZ1 A;  3LD8 A;  4CUG A;  4IGP A;  3KV6 A;  3K3N A;  5FYH A;  5A7W A;  4GAZ A;  5FYI A;  4CCO A;  3AVR A;  2GP3 A;  3PUS A;  4NUB A;  4QX7 A;  4UF0 B;  2P5B A;  5FP7 A;  3PUQ A;  3DXU A;  5KR7 A;  4LIT A;  2VD7 A;  3DXT A;  3N9O A;  4IGO A;  5FZ7 A;  5A7P A;  2YBP A;  4D6R A;  5FZB A;  2YBS A;  2Q8D A;  3KV4 A;  4GJZ A;  5FY4 A;  5FXX A;  3K3O A;  5FZK A;  5FJH A;  5FPU A;  5LWB A;  3U4S A;  4LXL A;  3AL5 A;  5A3N A;  5F32 A;  5FZO B;  3KV9 A;  5FZ3 A;  4QXB A;  3U78 A;  4BXF A;  5FPB A;  5FZF A;  5FXV A;  4CCK A;  2OQ7 A;  5FPL A;  4LIV A;  4V2V A;  4Y4R A;  3KV5 A;  5FJK A;  4AI9 A;  3PTR B;  4HON A;  4UF0 A;  4BU2 A;  4CCM A;  4QWN A;  2WWJ A;  5FZA A;  4ASK A;  5FY5 A;  4IGQ A;  4D6Q A;  5FYV A;  5ISL A;  4EZ4 A;  3PDQ A;  2OS2 A;  4XDP A;  5FYC A;  3PUA A;  5IVY A;  5F3C A;  5FV3 A;  5F37 A;  5FWJ A;  5LW9 A;  2XUE A;  2GP5 A;  5FBJ A;  5FYT A;  5FYM A;  5F5I A;  5IW0 A;  5FP4 A;  5FYU A;  5A1F A;  3N9Q A;  4XDO A;  5FY1 A;  3AL6 A;  4Y33 A;  5FYY A;  4CCJ A;  5F5A A;  4Y3O A;  5FY0 A;  5IVV A;  3PUR A;  5E6H A;  2WWU A;  5F3G A;  5F5C A;  5FPA A;  3UYJ A;  5IVJ A;  5FZC A;  2OX0 A;  4QXC A;  5CEH A;  5FZ0 A;  4BIS A;  5F3I A;  5FP8 A;  3N9N A;  3OPW A;  4QXH A;  2OT7 A;  5FPV A;  2XDV A;  4QX8 A;  5F2W A;  5IVE A;  2YPD A;  5FP3 A;  5FUN A;  4CCL A;  5A1L A;  5IVB A;  4EYU A;  3KVA A;  2XXZ A;  3RVH A;  3ZLI A;  5FP9 A;  5A3P A;  5FZD A;  3ZPO A;  5LY1 A;  5FYZ A;  5FZO A;  5FUP A;  3N9L A;  5FZ8 A;  5FZI A; 
#chains in the Genus database with same CATH topology
 1QJE A;  1WA6 X;  1SDD B;  3E5Q A;  1LEN A;  2XLG A;  3NW4 A;  3N4M A;  4M3C E;  4Q4Y 1;  3VKM A;  3WQB A;  3CLP A;  1OKQ A;  3AP4 A;  2VZO A;  5DQ0 A;  1LKN A;  3P1I A;  4HKW A;  3N7L A;  4MSV A;  4XCB A;  4E2G A;  2DU0 A;  4N43 C;  1NA1 B;  2R06 1;  4CXX A;  4X6Q B;  2H0B A;  3FMG A;  4FOV A;  4YW1 A;  2UU8 A;  1QNW A;  3T08 A;  5BNP C;  2DDU A;  3RZH A;  4G3Y C;  4XBL A;  1GP5 A;  1AL2 3;  4JTN A;  3ZN6 B;  4ZZ8 A;  1POV 3;  3IMM A;  2JDK A;  2R32 A;  1C5H A;  1RUJ 2;  1S2E A;  2NZ9 A;  4XJ8 A;  4ES9 A;  4MV2 A;  5AC9 3;  4MG2 A;  1XSQ A;  1UD1 A;  3GDB A;  3M3O A;  4AFD A;  1X8M A;  1RHI 1;  1H9W A;  2ZGO A;  3LFI A;  4XE9 A;  2BEO A;  2BFU L;  3UKT A;  1AYN 2;  3I7D A;  1S0G A;  4YGC A;  2AEN A;  5JR7 B;  3HBK A;  3UJO A;  4P9G A;  2GN7 A;  2W1S A;  1TE1 B;  4IEO A;  1O3S A;  1V70 A;  4XVH A;  2C26 A;  3AYD A;  1ND3 B;  1WLC A;  1IQA A;  1CPN A;  4ASM B;  4NUB A;  2VZV A;  2VMD A;  3PUQ A;  1DP0 A;  1WA4 A;  1FXZ A;  2WNE A;  1W8F A;  3RNS A;  4KGG A;  3T1M A;  1Q43 A;  3WG1 A;  2XH6 A;  5FZB A;  3FL7 A;  3FN9 A;  4Y22 B;  2YBS A;  2LS6 A;  1UF2 C;  2ZBJ A;  3NNJ A;  4NHM A;  3SNM A;  4N8M A;  3VBH A;  1OUS A;  1W6P A;  1MS5 A;  2VTX J;  3NO8 A;  4KGQ A;  1SLL A;  1W90 A;  3VD3 A;  2Y38 A;  4Z92 B;  1ZZ6 A;  4AG4 A;  2VEC A;  4QPI C;  1BBT 3;  1W6O B;  5EJ1 B;  3VKF C;  1RB8 G;  2NYY A;  3OGJ A;  4X8N A;  3GM8 A;  4AHX A;  2JX9 A;  4PF1 A;  1VBD 2;  1YQ2 A;  2DVD A;  1L7Q A;  4RSU A;  1US3 A;  2YFZ A;  2VM9 A;  5C9A C;  1OVS A;  1QGL A;  2GAU A;  2XWB B;  3MLL A;  2OQ7 A;  5GLZ A;  4LIV A;  5T5L A;  4EQV A;  1B35 A;  5AVA A;  4P14 A;  1DZR A;  1HRI 1;  1LEC A;  4CCM A;  1N1V A;  1OF4 A;  5JXG A;  4DXS A;  1DDL A;  1S2K A;  3GHM A;  4A6S A;  4D6Q A;  1RMU 2;  1XNC A;  1NE6 A;  4GKX A;  3BN6 A;  4RA0 A;  3ZFG B;  3O12 A;  1FV3 A;  2JKB A;  2XON A;  1O5U A;  5F37 A;  3WF3 A;  3ATG A;  5CBL A;  1S0E A;  2HWF 1;  3GNE A;  5IW0 A;  2FBE A;  2VME A;  3S57 A;  2Y6K A;  3M4F A;  1F8V A;  2TEP A;  5JSR A;  3POE A;  5EJ3 A;  3JBG 3;  3SEP A;  3B5L B;  3ES1 A;  2QQL A;  5TSW A;  1H1A A;  5ABJ A;  3WG4 A;  5BXX A;  4BA6 A;  2HH9 A;  1H30 A;  2PHU A;  3RFR A;  3TWI A;  3HEI A;  4UYB A;  4QGL A;  3ZR5 A;  4QXC A;  4CU8 A;  1K12 A;  1BEV 1;  1R09 3;  4IL7 A;  2EID A;  4Q4W 3;  4COW A;  1RUD 3;  5FO7 B;  1TNF A;  2CYF A;  1RUC 2;  4DZG A;  1GFF 2;  5A70 A;  5JAX A;  1W8Z A;  3T0A A;  3RYR A;  5KHI A;  4QX8 A;  5K7P A;  4ONU A;  1ZRD A;  2ZHL A;  5A3L A;  4MX3 A;  1UNB A;  4JC1 A;  1LOF A;  1ULD A;  1SZB A;  2RM2 1;  3CO2 A;  4Q26 A;  3WHU A;  4XMI A;  5LBE A;  2YUE A;  4H3W A;  2ENR A;  1VMH A;  5CG8 A;  1R1Z A;  4FO9 A;  4QPY A;  1JH5 A;  1Y9Q A;  1FPN 3;  3OF1 A;  4TTG A;  3IAQ A;  2ZHM A;  4AFB A;  1WCQ A;  2RS3 1;  1ENS A;  2V4V A;  2VH9 A;  4URA A;  1ONA A;  4OUE A;  3WP4 A;  4OHV A;  4PDW C;  3A23 A;  3AZW A;  2SLI A;  2AH2 A;  4QQP A;  4XF9 A;  4I3P A;  2WBK A;  5L73 A;  1UXZ A;  3I4I A;  2XBO 3;  4KQ7 A;  1VBE 3;  3I59 A;  4CYD A;  1DQ1 A;  5CU1 A;  3TN9 2;  1K45 A;  2WO2 A;  3HR9 A;  4X8P A;  4XAE A;  5FYS A;  4XUT A;  1W04 A;  4Y1V A;  5A3T A;  3O1S A;  1H1I A;  4Q4Y 2;  3VBU C;  2HWD 1;  4H14 A;  2A6W A;  2JE7 A;  1KIT A;  2ZKN A;  1RUI 3;  2R06 2;  2RMU 1;  5FWE A;  2WJS A;  4GMP 3;  1Q8P A;  1UW8 A;  1G86 A;  3EMR A;  2RDS A;  1OQE A;  2X5I C;  3Q8A A;  3SIT A;  1BJQ A;  3H3U A;  4RHV 3;  1LR5 A;  4XAB A;  1VBB 3;  1X36 A;  3ZXK A;  4UF0 B;  3WP6 A;  1RUE 3;  2XG3 A;  2HWE 3;  1JUH A;  3P6B A;  4Z2W A;  1GU3 A;  3B02 A;  5CKN A;  2RJK A;  1RHI 2;  2BV4 A;  3TAY A;  4EWA A;  3DYO A;  2QQM A;  4PCR A;  3H1W A;  4CRQ A;  5C5U A;  1QIQ A;  1ASJ 1;  1W0O A;  2B9V A;  4HG6 B;  4UW4 A;  3UGH A;  3KHB A;  3AXD A;  5FJH A;  3FBM A;  1QJU 1;  4GH4 A;  3RG0 A;  2WNU B;  3H50 A;  1FMD 3;  3WQ0 A;  2DU1 A;  2WN3 A;  4RFR B;  3NNM A;  2XVL A;  2B7Y A;  5C33 A;  1AR8 3;  2VY0 A;  1NQD A;  1GUI A;  1U5X A;  3FHQ A;  1C8N A;  4QX2 A;  5FZF A;  3ZSE A;  3ZYF A;  5JI9 A;  3V0B A;  5SV8 A;  5FPL A;  2P6H A;  2GC0 A;  4WZF A;  4HON A;  5CIR A;  2CSG A;  4GXL A;  3WW3 A;  5K0U B;  3LDK A;  2RHP A;  1WW5 A;  5HBA A;  2CL2 A;  1S0D A;  1LHV A;  4Y24 A;  3FHI B;  1HJF A;  2LUW A;  5ISL A;  1YO8 A;  4XDP A;  3NJZ A;  4R8H A;  1N47 A;  4L0P A;  1J3P A;  1HIX A;  2V09 A;  2B42 B;  2F4L A;  1JTZ X;  2GH8 A;  5FV3 A;  5FWJ A;  2Q30 A;  3OGS A;  4YVW B;  1UU4 A;  3B94 A;  4P5H A;  4XF4 A;  2HBT A;  5F5I A;  3JCI A;  2WFP A;  3IKW A;  1W2A X;  3O7O A;  4EE2 A;  1HRI 2;  1UZW A;  4AWD A;  1CAX A;  1X9T A;  1Y9M A;  4A4A A;  1SFY A;  2RVA A;  3DL3 A;  3MEP A;  5FK8 A;  5FQ0 A;  1HQW A;  2IXK A;  4CPB A;  5KC6 A;  1V6J A;  3HN3 A;  4NR1 A;  3VZL A;  5JXH A;  4N53 C;  2O8Q A;  4BIS A;  2HWF 2;  4BME A;  4Q2F A;  4LLO A;  1BYH A;  1EAH 1;  2RDQ A;  2WFF 1;  3I2H A;  1KD7 A;  2R04 1;  1C3H A;  3KB5 A;  1PGW 1;  4QQO A;  5CYY A;  5C3P A;  4GWJ A;  1OOP B;  1J1L A;  2YC4 A;  3MPP G;  2WAA A;  5GAL A;  3LPG A;  3NV3 A;  4PHZ A;  1CWP A;  1GP4 A;  1GOF A;  1QU0 A;  1P8J A;  3WIN E;  1OD3 A;  4EYU A;  2VW0 A;  2XXZ A;  1QQP 1;  3MFC A;  2Y6L A;  5IT6 A;  2D6K A;  4ZY9 A;  2XL9 A;  3PJQ A;  4LR4 A;  5A3P A;  1MZ6 A;  1BEV 2;  3WD5 A;  1JYW A;  2JG8 B;  2VMI A;  4BOW A;  2PAE A;  5A32 A;  3ZFF C;  4XPV A;  4CP9 A;  1LNS A;  1G9D A;  3J8F 1;  5HPO A;  4XAC A;  5IFP A;  1W03 A;  1T6G C;  2R0F A;  1VBC 1;  3AB0 A;  3RZG A;  1E5R A;  2P4E A;  4UWD A;  4CE8 A;  2RM2 2;  4Q1P A;  3SCF A;  1W06 A;  2WLP A;  4PIZ A;  4BPZ A;  4R4Z A;  3D4K A;  3LCP A;  1H8V A;  1CX4 A;  1BHG A;  4GAL A;  3U4X A;  2MNG A;  3VBO A;  5A33 B;  1W9T A;  2RS3 2;  5H9P A;  1MQT B;  3ACI A;  2HWC 3;  3S0M A;  1EUU A;  4O7X A;  4XF0 A;  4XUR A;  1PO1 1;  5HV0 A;  5EZW A;  1WW6 A;  1RUF 1;  2BW8 A;  4MGZ E;  3EYP A;  5DZE A;  3LWC A;  2DCZ A;  3K46 A;  4IW3 A;  2G1M A;  1YQ5 A;  2GNM A;  4NIA A;  1PZ9 A;  1WBF A;  3M3Q A;  1L7R A;  1NCR C;  3CJI C;  4XJW A;  5BUV A;  4FOW A;  1QOO A;  3BGA A;  3KT7 A;  1ZRR A;  3NKG A;  1GWK A;  2HWD 2;  4OVE A;  1RED A;  2VC9 A;  4IET A;  4P08 A;  2JEN A;  4AHY A;  4A6O A;  5CFD C;  1REE A;  1UY2 A;  1J3R A;  3I49 A;  4FBF A;  3BI3 A;  1BQP A;  5A1A A;  1ULF A;  2RMU 2;  4C90 A;  4Y20 A;  2B5H A;  4AF9 A;  1J84 A;  5DUV A;  5C3R A;  4RQP B;  4LO6 B;  3VZO A;  1HB1 A;  3P3P A;  5LWB A;  4N9H A;  1W8W A;  3S30 A;  3TBD A;  4OHY A;  5C3S A;  1JOD A;  2BNM A;  1FAY A;  2AEZ A;  4KBZ A;  1W3V A;  4QPW A;  1MS0 A;  3KV9 A;  3RWN A;  3LKJ A;  1QEX A;  1XOY A;  3THT A;  4N43 B;  3VBR B;  3AXE A;  1YHF A;  3VKL A;  5D8A C;  1I1E A;  4W6X A;  1MZE A;  5BNP B;  4GB3 1;  4OUM A;  1OT5 A;  1ASJ 2;  2BOI A;  3LA2 A;  3PNA A;  1QJU 2;  4MOA A;  2E51 A;  2ORZ A;  1GYK A;  3WHT A;  2OZJ A;  5FR3 A;  2EXK A;  2CDO A;  5EYX A;  2D6O X;  2B45 X;  3S7E A;  2EAK A;  1K5M C;  4YLZ A;  5L7O C;  2OPK A;  1SBD A;  1OA4 A;  1VLN A;  3JUU A;  4Z07 A;  1PIV 3;  2D6M A;  5C8C B;  1NOV A;  2NPI A;  2UUR A;  3ASI A;  3I3M A;  1STM A;  4I09 A;  3AFG A;  2TNF A;  4BQ3 A;  5I8Y A;  4I01 A;  2VQU A;  4ZS3 A;  1WLW A;  1YJL A;  4D0Q A;  1ENQ A;  4Y3O A;  1JMU B;  1GNZ A;  1NYW A;  2PTM A;  3POS A;  1YWK A;  4CXY A;  4B1L A;  4Q8K A;  3ME2 A;  5FZC A;  1W2U A;  2R16 A;  1AF9 A;  2QQW A;  4YFW A;  2XLF A;  4LHS A;  5JVV A;  3KHC A;  4IER A;  4E4S A;  1AYN 3;  2NP0 A;  3UT0 A;  1TMF 1;  3GF6 A;  4KMQ A;  3KGL A;  1YC6 1;  2ILM A;  1CAW B;  4LOS A;  5ACA 1;  1TQ5 A;  1HB2 A;  3B69 A;  4HN1 A;  4XIK A;  3VGI A;  3E6B A;  1RXF A;  1VRH 1;  5FP3 A;  3THP A;  4EN6 B;  1GOG A;  1V9U 3;  1DIW A;  1W6O A;  3HAG A;  4O65 A;  4UFJ A;  5FP9 A;  3ZYG A;  1R08 1;  2SBA A;  4BYY A;  1U5Z A;  4JKK A;  1EAH 2;  2WFF 2;  2OYZ A;  2R04 2;  5FZI A;  3WF1 A;  1PGW 2;  4AI3 A;  2P3I A;  1D7P M;  4YM1 A;  3OGV A;  3J7N A;  2XJP A;  4YYO A;  1WW4 A;  4AEM A;  1IPK A;  4YZ2 A;  3K2O A;  2DUO A;  1DU3 D;  4QD2 A;  3MYX A;  1QQP 2;  3K51 A;  5H9R A;  4BZ4 A;  4UFL A;  2WKK A;  4U2A A;  1HQL A;  4FPK A;  3ZFG A;  2FDK A;  4TN7 A;  2VUL A;  1F5J A;  2XHN A;  3PU3 A;  4M4P A;  4HK9 A;  4YW5 A;  2PXJ A;  3IIA A;  3J8F 2;  3OPZ A;  4TSV A;  5LRR A;  3H1Y A;  5F3E A;  5LY2 A;  1YFX A;  1W6P B;  2B39 A;  1VBC 2;  5J36 A;  2A73 B;  4JV4 A;  5IYY A;  4E9K A;  1RMU 3;  1MEC 3;  1S55 A;  3HOB A;  3JU9 A;  4N7I A;  4BMB A;  2WQZ C;  2HBU A;  5JZG A;  2RE9 A;  3L9J T;  1ULG A;  5FMB A;  5EXO A;  1NX9 A;  1GWL A;  4Z82 A;  4JQT A;  3OBA A;  1T6B X;  4FQZ A;  4I2O A;  5A7W A;  3KV6 A;  4EJR A;  1AR7 3;  1B35 B;  3BIW E;  2BGP A;  3PUS A;  2P5B A;  2VZP A;  1E5I A;  2CY6 A;  1PO1 2;  1QF3 A;  4OZX A;  3PUH A;  1RUF 2;  3D82 A;  3N9O A;  1LHN A;  3RJ2 X;  3LE0 A;  4PQ9 A;  4YPJ A;  4NN0 A;  2XJS A;  5F8P A;  3ZMO A;  3WDW A;  4K7J A;  5C70 A;  1UKR A;  2E33 A;  1SCR A;  4SLI A;  1WCK A;  1DYO A;  5DDJ 1;  4LXL A;  3NRU A;  3Q8E A;  4ZHN A;  4QM8 A;  1RUC 3;  3AL5 A;  4LA3 A;  2IVJ A;  1Q8Q A;  4IEP A;  4NHX A;  4PDW B;  5FCC A;  3LOI A;  5CIS A;  5APA A;  4LE4 A;  3H8R A;  3O1M A;  2JEC A;  5FXV A;  3QLQ A;  3Q8C A;  3S5Q A;  1QH6 A;  1ZRC A;  1I3H A;  3E5U A;  1VB2 A;  1GZ9 A;  4YVS A;  3BOD A;  2ZGQ A;  3ZO0 B;  4QWN A;  3KT1 A;  4RYD A;  3VBU B;  3DV8 A;  3M7A A;  3VDB A;  3WP5 A;  3H7Y A;  1UPS A;  1JUI A;  3K4D A;  2ZEY A;  2UY9 A;  1PVC 1;  4JGY C;  2YV8 A;  3J9S A;  2VO5 A;  4K1Y A;  3JD7 1;  2JDP A;  4UBH A;  4Q0U A;  5FTT C;  3SH5 A;  1H1M A;  4GB3 2;  3ZYR A;  5KWR A;  2BPA 2;  1OH3 A;  4QX5 A;  4MUV A;  4DEV A;  2X5I B;  3GHN A;  4MAD A;  3WOG A;  4AED C;  4F83 A;  2BBA A;  1W39 A;  1Z7S 3;  3OSD A;  3IZO A;  1POV 0;  2D3R A;  5BNN C;  3WZ1 A;  5HV4 A;  4Q0S A;  3H0O A;  5F3G A;  1H4G A;  4FCA A;  4LO7 A;  1ZYB A;  4AI2 A;  5IVJ A;  4ISQ A;  3VDD C;  1BK0 A;  3ACG A;  4YZ4 A;  3W21 A;  1OXC A;  2R06 3;  4XC9 A;  3ZX7 A;  3M70 A;  4LT5 A;  3I59 B;  1O8P A;  1RUG 1;  1PZ8 A;  1OLM A;  3A7Q A;  1M06 G;  1PMH X;  2O0O A;  1PM4 A;  2XKP A;  4YVS C;  4RR3 C;  1GKB A;  1O91 A;  4CP0 A;  1S0J A;  4JQR A;  4PLN A;  1UKG A;  1RHI 3;  1CES A;  2WS9 1;  1YLL A;  1PVX A;  4RS5 C;  2R49 A;  2JDY A;  5DAQ A;  3DEM A;  3K4Z A;  2YHJ A;  1TMF 2;  2ZA9 A;  5EWS A;  1CJP A;  5ACA 2;  5I0R A;  1C28 A;  3OGG A;  2VUA A;  4ZPI A;  3L2H A;  1CAV A;  1VRH 2;  1LOA A;  2JE9 A;  3MPB A;  5J98 B;  5K0U A;  2W0X A;  4BB3 A;  3W5N A;  3CL1 A;  2MPF A;  2CWM A;  4GWI A;  2BZD A;  3X29 B;  5JSP A;  2D6P A;  1KJR A;  4HVO A;  1R08 2;  5G05 L;  4COY A;  1CJD A;  4DRR A;  4BK4 A;  4JCK A;  4RL7 A;  3ROU A;  2Z42 A;  4YVW A;  4QKN A;  1DHK B;  3PMS A;  4UXA A;  4AGR A;  3MLK A;  5EYY A;  1UY1 A;  1C4R A;  1KDM A;  4K3U A;  1V6I A;  4R4X A;  3RZK A;  1A34 A;  1BMV 1;  2Y6F A;  3IN9 A;  4EN0 A;  1IPJ A;  4FP3 A;  4Q4X 1;  1ND2 A;  5BYN A;  4OLL A;  4JRA A;  5G04 L;  1PZ7 A;  1ALY A;  2DUP A;  2K0G A;  3U0Z A;  1RJ7 A;  1HRI 3;  2FCV A;  3V0B B;  3OEB A;  1FNY A;  1RUH 1;  2PHT A;  3I3B A;  4FXK B;  4W65 A;  1H4H A;  1XRU A;  2WO3 A;  4TLG A;  3MIF A;  1EPZ A;  4CA9 A;  1W9W A;  1VAL A;  5I0S A;  4AI0 A;  2VBB A;  1W8H A;  2VD7 A;  4LIT A;  5CNA A;  3O0X A;  5FZ7 A;  3E6C C;  5CKM A;  1Q8O A;  4Q0P A;  1ZA4 A;  2XB6 C;  2UWB A;  3KV4 A;  3E5X A;  3PTY A;  4HET A;  1XNA A;  3MDP A;  4Q8L A;  4YW7 A;  5HCB A;  3WUD A;  5L19 A;  1QY4 A;  2GND A;  2W46 A;  2ZGN A;  2IXL A;  2WYS A;  4P9J A;  2ZX4 A;  1C8M 1;  5FZO B;  1W0P A;  1JZ8 A;  1CAX B;  4IEQ A;  5J3U A;  1WCD J;  4P9I A;  2AYH A;  4OUS A;  3U78 A;  2FQP A;  4IEW A;  4UOJ A;  4AQ2 A;  5FBZ A;  2C9A A;  5FQ0 B;  4B4Q A;  1OHF A;  3ZR6 A;  1DYP A;  1NKG A;  1BEV 3;  3U1X A;  1F4H A;  4AVS A;  3M3E A;  1KJL A;  1POQ A;  5DDJ 2;  2VOW A;  4LO5 B;  5FMO S;  2A75 A;  4I02 A;  1VBA 3;  1YFW A;  2RR1 1;  5FYV A;  4Z8B A;  3WSO A;  2BJS A;  3OTF A;  1N3Q A;  2A71 A;  2ZGS A;  3E1F 1;  1GR3 A;  5A33 A;  1MQT A;  2JWP A;  5LW9 A;  1TME 2;  5CA6 A;  5JLV A;  4QKD A;  3ZN4 A;  2PQS A;  2RM2 3;  5E89 A;  4JX0 A;  3H8O A;  4EN8 B;  5FP4 A;  4A45 A;  4RGA A;  5F5Q A;  4RFT 0;  5KBF A;  5C3Q A;  4XDO A;  2FDF A;  4DEQ A;  4PIY A;  3AP6 A;  1FOD 3;  2FDJ A;  2I45 A;  4FT8 A;  3HMY A;  5F5A A;  2WT0 A;  1BVP 1;  4WVW A;  4CU9 A;  2G9Z A;  5A32 B;  4Z2A A;  2RS3 3;  4CP9 B;  3PUR A;  1W8O A;  1PVC 2;  3VKO A;  3RDI A;  2W92 A;  3JD7 2;  1ZBE 1;  2D7F A;  1QKQ A;  5FPX A;  1V6M A;  2O8O A;  2TBV A;  1LOD A;  2Y60 A;  5DPN A;  3EO6 A;  5E88 A;  3N36 A;  4GMP 0;  4DUV A;  5LA2 A;  1ST8 A;  1WMD A;  2ZZQ A;  1UZY A;  2YPD A;  5FUN A;  5KXC A;  1DGW A;  1EV1 3;  4GWN A;  3RSJ A;  3VBO B;  3ACH A;  4Y26 A;  4PBP A;  4MGS A;  4IV1 C;  4NRM A;  4BE3 A;  1WLT A;  4BK5 A;  2WNV C;  1RL3 A;  1OLM E;  4A3X A;  3DF0 A;  4N43 A;  3AC0 A;  4EZH A;  3AVS A;  3J7L A;  1MPX A;  5DAX A;  1RUG 2;  3LEI A;  4LHK A;  3U75 A;  2OKX A;  3RYP A;  5BNP A;  2Y64 A;  2D5H A;  2XJT A;  5L7O B;  4QKB A;  4XHX A;  4D69 A;  1Q8S A;  5D21 A;  5KXB A;  4FQ4 A;  3AKS A;  2CAV A;  4FFG A;  2ZZJ A;  3ZFE C;  5DZG A;  2IXJ A;  2WS9 2;  2VQ0 A;  3A0K A;  2PAM A;  3PU8 A;  4A7Z A;  4TZD A;  5CAZ A;  3OJB A;  1BZW A;  1W2O A;  3WUC A;  2DVB A;  4V2W A;  2W9X A;  1DGR N;  4Y20 B;  3FHA A;  4YM0 A;  2I07 B;  4GD4 A;  1NLQ A;  1R1A 1;  4QAW A;  5EV7 A;  2WZP P;  3ZDS A;  4CUB A;  4GA9 A;  3VHR A;  5GLU A;  3WNK A;  4DOU A;  2J42 A;  1DZT A;  1SHW B;  2MEV 1;  5DN2 A;  5DUW A;  3FFZ A;  1O3R A;  1W2N A;  3EXU A;  3POB A;  4CCC A;  4XUN A;  3T0B A;  1NCQ C;  4CCO A;  1APN A;  4FPC A;  1PNG A;  1UY0 A;  3N35 A;  2NMN A;  3KCX A;  1JYX A;  5FOB B;  3GBW A;  3WX5 A;  1BMV 2;  5J09 A;  4ZU7 A;  4QPI A;  1CAW A;  5FMD A;  1OBN A;  4IGO A;  2GN3 A;  1LTE A;  4OMD A;  4Q4X 2;  3NWK A;  4KU8 A;  1VB4 A;  5C9A A;  4P02 B;  4J6G A;  3VB9 A;  2ZHK A;  1RUH 2;  2LM3 A;  1SEF A;  3WDT A;  3NV2 A;  4AEK A;  1QJY 1;  2GNT A;  1ZZ9 A;  1IPS A;  2XJU A;  1HW5 A;  2Q0A A;  3KGZ A;  3VDA A;  1U0A A;  5JSO A;  4ASL A;  2G9F A;  1S0F A;  1O4Y A;  1PMI A;  2E32 A;  5FPB A;  3WCS A;  1Z78 A;  4M0N A;  4V2V A;  4CDQ C;  1X82 A;  3TYJ A;  5FMO L;  4R52 A;  1KGY A;  3PTR B;  5JXI A;  1LHW A;  1T2X A;  3EHK A;  2WFF 3;  5EFU A;  5LK7 B;  4FAG A;  1AR6 3;  2ORX A;  4HVR A;  2W5F A;  3NAP C;  1IS5 A;  1C8M 2;  1L7L A;  2D6L X;  2QQI A;  3T09 A;  5BNO C;  3PUA A;  1RUN A;  1AR9 1;  5IFT A;  2DVA A;  3LA7 A;  1PNF A;  2W3J A;  4XBQ A;  1COV 1;  2JB8 A;  4XXP A;  3ACF A;  5IK4 A;  5A3O A;  5CFC C;  1BK1 A;  2P3Y A;  4XFB A;  4BLJ A;  5LEK A;  2RR1 2;  5JI7 A;  3J8F 3;  4JDM A;  3ZIW A;  1H2L A;  4CDU C;  1H6Y A;  5C7G A;  4NPL A;  1CZV A;  1YXW A;  3I2D A;  3M1H A;  5FRA A;  2QCS B;  4N9I A;  1YI9 A;  1GV9 A;  3AYA A;  4OZO A;  4QGM A;  5CEH A;  2J22 A;  3Q8F A;  2VCB A;  3O1O A;  1LU1 A;  4UFK A;  1V6L A;  3T30 A;  4R9B A;  3T2Q A;  2W1W A;  1V6N A;  3QAC A;  2PHW A;  2Z79 A;  4QXK A;  2XDV A;  4GUL A;  4CPB D;  5HCA A;  5CZK A;  5IVB A;  3HNB M;  3I3Q A;  2VTX A;  1ZZ7 A;  3O1V A;  2K46 A;  4IE7 A;  1KS5 A;  5IAV A;  2PHF A;  5KXE A;  1CZT A;  1RUF 3;  1ZBE 2;  5FZD A;  1RJ8 A;  4PDW A;  3VBS C;  2A7A A;  2Q1F A;  3NV1 A;  4FFI A;  1PGS A;  3WQ1 A;  4HAN A;  1XYO A;  4CZS A;  4K21 A;  4IDZ A;  1NT0 A;  2FHR A;  5JZG B;  5A7S A;  4XTM A;  3WDX A;  1PX4 A;  1PO2 3;  5A7W B;  1OPO A;  2VOV A;  4KU7 A;  5CAD A;  3III A;  3VBU A;  1DZQ A;  1PK6 C;  2WLQ A;  5I8S A;  1VJ2 A;  4HOO A;  4Q4V 3;  1UPI A;  4LNV A;  5C71 A;  1PX3 A;  5FLI A;  4KL1 A;  4B1M A;  1IHM A;  3OUI A;  1R64 A;  4UW3 A;  4AED B;  4D3W A;  3ST7 A;  3O0V A;  1N1Y A;  3FLT A;  1AL0 G;  4M00 A;  4Y5S A;  5JMO A;  2X5I A;  3MLJ A;  2K9Z A;  1HN1 A;  1D4M 3;  2YU2 A;  3EJK A;  4UAP A;  5F7U A;  3VDD B;  2H6C A;  3O0W A;  2OUH A;  3D5O A;  5J96 B;  5E8A A;  1BXH A;  3UET A;  1H8T C;  5HXM A;  2GDF A;  2WZR 3;  1JYC A;  4GB3 3;  2QQO A;  5ANQ A;  2VMG A;  4EV0 A;  2W87 A;  4QDS A;  4MVT A;  1QHD A;  2WAB A;  1R1A 2;  4YVS B;  5KR7 A;  4QPG C;  3ZN5 A;  2LW8 A;  2QDR A;  3HT2 A;  4JVA A;  2MEV 2;  4GKY A;  4S2F A;  3JQW A;  2ZJC A;  2Y33 A;  1LRH A;  3D3A A;  1MAC A;  3FBY A;  1ZRE A;  3PJY A;  4Q29 A;  4XFH A;  4BM8 A;  4FTB A;  3U37 A;  1FT9 A;  3NNG A;  4TXW A;  1OPM A;  2RG4 A;  2DWR A;  1YFU A;  3MBW A;  1LGC A;  2ZOE B;  1W2T A;  1Y3T A;  2VUD A;  4M4R A;  1NG0 A;  5AFB A;  1ZZB A;  5BPX A;  1XSR A;  1CX1 A;  3OB8 A;  4WV8 A;  2E7A A;  2FMD A;  4QQ2 A;  3CBN A;  4L99 A;  1OKO A;  3D8C A;  3FUQ A;  4XQW A;  1TMF 3;  3TEW A;  1G7Y A;  3KS7 A;  1QJY 2;  1LU2 A;  3CEW A;  5A3U A;  3CZU A;  1VRH 3;  1WW7 A;  5IVY A;  3ENR A;  4AHZ A;  3BYW A;  4KBB A;  4WM8 C;  2Y26 A;  2FZ1 A;  2QUO A;  2Q4S A;  4DXR A;  1SMV A;  2ZS6 B;  1W3X A;  1CVN A;  1YRZ A;  2LRP A;  2QBX A;  4LE3 A;  4N53 A;  3HN1 A;  1GZW A;  1TVG A;  1CR7 A;  4OUL A;  1Q8V A;  4DQA A;  2OII A;  1I5P A;  3HBZ A;  2XL7 A;  3RMY A;  1AR9 2;  5FPA A;  3UKN A;  4XFF A;  1WGP A;  5C4W C;  2IVI B;  1CIY A;  1UOB A;  2W95 A;  1CAV B;  1TNR A;  1UYY A;  2ZGT A;  1COV 2;  2J1T A;  2NLR A;  3AZY A;  5FP8 A;  3UJQ A;  5CG9 A;  4LBK A;  2QVS B;  4XUP A;  4XJZ A;  3FUO A;  1RYY A;  3OPW A;  4F7Z A;  3A0N A;  2QTW B;  5EJZ B;  3ZFF A;  3I2G A;  5I91 A;  1W28 A;  3V0A B;  3SQO A;  4A3Z A;  2DTW A;  1Z0H A;  1ZRF A;  2ARB A;  1ZA7 A;  2VNG A;  3LEK A;  4P00 B;  3SCG A;  1MS9 A;  5FZO A;  3M3I A;  4AHW A;  3F95 A;  4D94 A;  4NPM A;  2JG9 C;  2V72 A;  3CU7 A;  5JOZ A;  5J7M A;  3NJV A;  4QB6 A;  2ARX A;  4OYU A;  1WKY A;  5I93 A;  4HBN A;  4KH9 A;  1ND2 B;  4MLO A;  2PLV 3;  1FNZ A;  4CDX C;  3RWK X;  2WSU A;  1UU5 A;  5DAV A;  4PJY A;  2BNO A;  2D43 A;  1SFN A;  1Q56 A;  2XML A;  3MIB A;  4HN0 A;  1NLS A;  5FZE A;  4W8J A;  3ZXD A;  3RZL A;  1LHU A;  1JYV A;  1A6C A;  1POV 1;  2W47 A;  2O14 A;  3HJR A;  3A21 A;  4HZF A;  4NWW A;  1WMX A;  3WVJ A;  3LSE A;  2EXI A;  5DXD A;  3AP7 A;  1F31 A;  3OOX A;  3GBF A;  1XBF A;  2J1U A;  4HT1 T;  4XJA A;  5A80 A;  1UCX A;  4OQ9 A;  1RUO A;  1KQR A;  1NCR A;  3CJI A;  2YZ4 A;  1VPH A;  3EQE A;  2PHD A;  5FPZ A;  4FSJ A;  1FV2 A;  5BNQ A;  1URX A;  1OH4 A;  2B8M A;  1WD3 A;  5FYB A;  1J1T A;  5CFD A;  3RZZ A;  4A2U A;  2BQP A;  4D7Y A;  4GJY A;  4IEZ A;  5JPM B;  1CN1 A;  1AUY A;  1W9Y A;  3ETQ A;  1GAN A;  4CUG A;  2DCT A;  1S0C A;  2E7T A;  5LRS A;  2EXJ A;  5GM0 A;  1LJ7 A;  4YRD A;  2ZEW A;  4Q0Q A;  4QX7 A;  3S7I A;  5J37 A;  3DXU A;  3OYW B;  2KD7 A;  3WR0 A;  3K77 A;  3V56 A;  4D6R A;  1GQH A;  4MXW B;  2Q8D A;  4CCD A;  4B4P A;  3WEZ A;  1AXK A;  4GJZ A;  3K3O A;  1YUD A;  3AKQ A;  3ECQ A;  5FZK A;  4CU7 A;  3RQ0 A;  3IB3 A;  2RJL A;  5D8A A;  1QJX 1;  3SIS A;  1BBT 1;  2R0H A;  4WM7 C;  3SCH A;  2QQJ A;  4DRV A;  2UYB A;  2IXI A;  1S4C A;  2CV6 A;  4AVT A;  2A70 A;  2ZGP A;  2W52 A;  1QH7 A;  5L9B A;  2Y6J A;  2VUJ A;  2VQT A;  2JDZ A;  4O9G A;  1K5M A;  4Y4R A;  1UU6 A;  5L7O A;  3ZSL A;  3M2M A;  1HLC A;  2C6S A;  2X29 A;  1HB3 A;  3DGT A;  2XQX A;  4LBM A;  4LEJ A;  3PUI A;  4XOG A;  1RUG 3;  1UMZ A;  2OS2 A;  1DGW X;  1SPP B;  2DVG A;  1UYZ A;  2XJR A;  2XOM A;  3FC0 A;  1IKQ A;  2IFW A;  2PMW B;  2DFC A;  2L9L A;  4K6B A;  4RN5 A;  4ES8 A;  3HNM A;  1N1T A;  4R9D A;  2EVX A;  3B9C A;  4AOC A;  2P2K A;  4HPK B;  4OFG A;  2VNR A;  2KXL A;  3BIE A;  2A3Y A;  2Y8K A;  2W68 A;  1JZ5 A;  1O8S A;  1MVQ A;  4XF3 A;  3ZOI A;  4N90 A;  1ACC A;  4E27 A;  4FPH A;  5ANN A;  3T3Y A;  4B3N A;  2QFE A;  5FOJ B;  4QKF A;  5T5J A;  3BTX A;  2A6V A;  4Q4W 1;  2GNB A;  1RUD 1;  5B2G B;  3GCX A;  4XJU A;  2B9U A;  1XYP A;  3H42 B;  3W20 A;  4I0B A;  4IXL A;  3R6S A;  1HXS 1;  1WD4 A;  5HCF A;  1HRV 1;  1MS1 A;  4GIQ A;  5F2W A;  2AZ5 A;  4B7E A;  2D98 A;  1QXR A;  3RVH A;  3C8X A;  5C6C A;  2BUK A;  4MGQ A;  3IPV B;  2NN8 A;  2WT1 A;  3MIC A;  1GNY A;  3ALQ A;  1W05 A;  4KI5 M;  5FUP A;  4B4R A;  4CDQ B;  5FBJ A;  4LKS A;  1W9S A;  2G4I A;  3WT3 A;  1O4Z A;  4Q4X 3;  5ERL A;  5DAB A;  4NAO A;  4AAP A;  1GSL A;  1GWM A;  1RUJ 3;  3RI8 A;  4EWE A;  4CEW A;  1WCU A;  2PHX A;  1EP0 A;  4Q0V A;  4BLI A;  5J1X A;  2DBI A;  4NII A;  3MGU A;  2E9Q A;  2XBO 1;  5FZL A;  1OSG A;  5DMY A;  4JGZ C;  5K8S A;  2P3J A;  1HJG A;  2FDH A;  1XND A;  1ENX A;  1JOP A;  2DV9 A;  2VNV A;  1KXG A;  5FZH A;  4QPI B;  5IVF A;  1N1S A;  2YY1 A;  2HKX A;  4YM3 A;  2GU9 A;  3CDZ B;  1LCL A;  5F6K A;  1YNA A;  4IE5 A;  1UQX A;  3MFA A;  2OQ6 A;  1D0H A;  4QDR A;  3ZVX A;  5C9A B;  4PF5 A;  5A7N A;  1UY3 A;  4Y1X A;  1VAV A;  2Y6H A;  2DBN A;  4A7Y A;  2DYC A;  2J1V A;  4C0H A;  4GMP 1;  5LAS A;  1C1F A;  3TNQ A;  4OHZ A;  3ZYH A;  4AVA A;  2RJ2 A;  4E8D A;  4RHV 1;  4ZXE A;  2VZU A;  1A8D A;  2C24 A;  3KT4 A;  2RR1 3;  1VBD 3;  2VCC A;  4QHB A;  2WYF A;  3BU0 A;  3NJX A;  4FI9 A;  2VQA A;  3FWE A;  2BBV A;  2VVE A;  2EIG A;  2QJV A;  2VMF A;  3CMG A;  4MHR A;  3VBS B;  2ZEX A;  3ZYP A;  4CEW C;  1NA1 C;  2VE1 A;  4M01 A;  1BCX A;  4JRL A;  4YW2 A;  5LAT A;  3G6J B;  3KQR A;  4CDW C;  1LES A;  2ZAC A;  2D3S A;  4LPL A;  3TEZ A;  4LQR A;  2F6B A;  2NMO A;  4O9E A;  4PQQ A;  1WUV A;  2OVU A;  4XW3 A;  4LBO A;  3UGG A;  4JGY A;  1VR3 A;  1O5L A;  4XFA A;  2VGD A;  1QJX 2;  2ZKL A;  4E8C A;  2CHH A;  2CWS A;  1BBT 2;  4FAH A;  1XNB A;  3ZXF A;  3LFM A;  1ND3 C;  3AKT A;  3MF9 A;  4QHZ A;  3PDQ A;  4MET A;  4AED A;  2P6C A;  1KFX L;  3IDC B;  2CDP A;  3THC A;  3DPR C;  2AC1 A;  1SCS A;  1OFN A;  3KF5 A;  1UMH A;  5BNN A;  3I97 A;  1GOH A;  1H8T B;  1GQP A;  3C7H A;  5HI0 A;  1J59 A;  2RV9 A;  2W1Q A;  4LBJ A;  3RZM A;  3VDD A;  4IEV A;  3WG2 A;  2XWJ B;  3AL6 A;  5FY1 A;  3GJA A;  5GLT A;  3LAG A;  4ITC A;  5GLW A;  4BCU A;  4HVQ A;  2VPV A;  2A5Z A;  3B9I A;  3S6P A;  2WA3 A;  1G9A A;  4QPG B;  5LK5 A;  1TME 1;  4UFM A;  1E5H A;  1W0N A;  1SBE A;  1V6O A;  2XR4 A;  3QD6 A;  4BQX A;  3FLP A;  3CZJ A;  3RMX A;  4NIG A;  2VMC A;  2XHK A;  4RR3 A;  2VXJ A;  3VD5 A;  3H3Z A;  2ID4 A;  2JDH A;  2A1X A;  2DUQ A;  2KM2 A;  1U5I A;  2YFU A;  4N7U A;  1DG6 A;  1PHM A;  4RS5 A;  4AGG A;  2OT7 A;  5FPV A;  3WV6 A;  1K5J A;  3OBZ A;  3TEX A;  4XJ9 A;  4BQ5 A;  1UX6 A;  1HV0 A;  1R1A 3;  4FVV A;  1U12 A;  1OA2 A;  1AX1 A;  5LB6 A;  3TN9 3;  2IUW A;  1IQD C;  2WA4 A;  2WC2 A;  4Q4W 2;  5FYU A;  3VHN A;  1RUD 2;  2D93 A;  2MEV 3;  1SLT A;  3AP5 A;  2AGS A;  3EBR A;  1HXS 2;  4ZU4 A;  2WL1 A;  4S2D A;  2GH2 A;  1HRV 2;  3C7E A;  5FY8 A;  2UY8 A;  1Y9G A;  5IVC A;  4Q4Y 3;  4CVU A;  2ET7 A;  3RZJ A;  3SKJ E;  3CKH A;  3SLI A;  2P34 A;  1DLL A;  2HWB 1;  5LEJ A;  3OG2 A;  3H7J A;  1FYU A;  4E4H A;  2AEY A;  1NAE A;  1GQG A;  5LZ6 A;  1SLA A;  1NZC A;  2C5D A;  2Q8E A;  4ATE A;  2HWC 1;  1UIK A;  1QJY 3;  3WCR A;  4LBL A;  2XBO 2;  1O3Q A;  5C4W B;  1CAU A;  4NWV A;  1WMF A;  2QDN A;  3Q8B A;  4Q27 A;  1UMI A;  3BAL A;  4H7M A;  4G9S B;  3SEE A;  4B8E A;  4DIQ A;  4UI9 L;  1MS4 A;  1VRB A;  4XET A;  1JI6 A;  2VBP A;  1KEX A;  2QZ3 A;  1DQ0 A;  3LD8 A;  4FTS A;  1DQ5 A;  4ZKT B;  3C7O A;  4YW4 A;  2UWA A;  1W8N A;  1OQ1 A;  2ZAA A;  2VVF A;  3BTZ A;  1UL9 A;  5FP7 A;  1UAI A;  4YNI A;  2ZGK A;  5A7P A;  4NPR A;  1W8U A;  4ORF A;  1X7N A;  1VMF A;  1L3J A;  4Y1Z A;  5JPN B;  2DCY A;  2CGO A;  3V0A A;  3FLR A;  3W58 A;  4I0A A;  1UYX A;  5SV5 A;  4F3J A;  4J25 A;  2DVF A;  1NXD 1;  1RIR A;  2YRO A;  4RHV 2;  3ZSK A;  2ZMK A;  3VD9 A;  3AMQ A;  3UGF A;  4AEJ A;  4C1W A;  4L97 A;  3LSD A;  1G9F A;  1X9P A;  3QH6 A;  4N53 B;  5FZ3 A;  5GJ6 A;  3VL9 A;  1EUT A;  1GZW B;  2ZML A;  2PAK A;  1UO9 A;  3F2Z A;  4JKL A;  4TYS A;  3FJS A;  2QZ2 A;  3ETP A;  2WIN B;  1D0G A;  2Z2S B;  1JYI A;  5A6Z A;  3EB7 A;  1H9P A;  3GAL A;  5FZA A;  1M4W A;  4LO4 B;  4HSJ A;  5LBB A;  1CD3 G;  3DYM A;  4XFI A;  4XQD A;  3AYE A;  5JOW A;  2QKD A;  3OEA A;  3TOJ A;  3UES A;  5CVR A;  2PHL A;  3U10 A;  3WNO A;  4M3C A;  1PIV 1;  2E7Q A;  2Y6G A;  3FX3 A;  3ZFF B;  4ERO A;  4FPF A;  2HWF 3;  3CIH A;  1BVV A;  2YGL A;  4L11 A;  5A1F A;  2IXC A;  4TWT A;  3KWV A;  3N9Q A;  3WDU A;  1ULE A;  1UWW A;  4DFS A;  3GJB A;  5JOY A;  4QT6 A;  1F15 A;  1JS9 A;  3ZKY A;  4IND A;  1W6M A;  1IS4 A;  2VZR A;  1E57 A;  1YIF A;  2WNU C;  3GZE A;  1YCI A;  2WWU A;  3UYJ A;  4CU6 A;  1JZ6 A;  3ORJ A;  2LAL A;  1RIT A;  2OX0 A;  2J7M A;  1Q5O A;  3HQR A;  2EIB A;  3OYW A;  5C8C C;  5FO9 B;  1RXG A;  2DCK A;  5DG1 A;  3WNL A;  4IV1 A;  4MXW A;  5FKB A;  2EXH A;  1F35 A;  5A6Y A;  2WNV A;  4YGB A;  4AQT A;  5D1I A;  1HQN A;  4AI1 A;  3H1M A;  4OI0 A;  4XCA A;  3LB9 A;  2VCM A;  4IEX A;  5JWP A;  3KVA A;  1V9U 1;  2A6X A;  3MW3 A;  1JYT A;  4KG0 A;  3IDE A;  4DMI A;  2ZX0 A;  3ZPO A;  4AW7 A;  4TLF A;  2YYO A;  3H8U A;  1NCR B;  3CJI B;  2CTV A;  3C2U A;  3KM5 A;  4IV3 A;  3UL2 A;  1WME A;  3ZFE A;  2BWC A;  4NE9 A;  5CFD B;  2IC1 A;  3ZSJ A;  1VIW B;  2OZ6 A;  5H9Q A;  1SQ4 A;  5BV6 A;  2ZX1 A;  4GZ9 A;  4HMZ A;  4BQY A;  4XEZ A;  1SPP A;  1YQC A;  2VZT A;  3ZPY A;  2X8K A;  1ZZ8 A;  2BRT A;  4H55 A;  3PL0 A;  5F2S A;  5I0U A;  4XTP A;  5F9T A;  3KCC A;  5FY9 A;  5FZG A;  2EIC A;  2FCU A;  4K40 A;  1OOP C;  2HWD 3;  2VUC A;  1NCQ A;  4HPK A;  4C1X A;  5D8A B;  4AAX A;  2HWB 2;  1MEC 1;  4HKL A;  3UNP A;  1RTV A;  1C57 A;  5FO8 B;  2RMU 3;  4ET7 A;  4HLT A;  2BGO A;  4JZR A;  4UBG A;  3ILF A;  4DXT A;  2YG0 A;  4OI2 A;  3HQU A;  3PVB B;  5IK7 A;  2JG8 C;  1CPM A;  1AR7 1;  2GC3 A;  3OD0 A;  5FYI A;  3LIG A;  1K5M B;  3MV0 1;  2WDB A;  2HWC 2;  2RDR A;  1AYM 1;  2GC2 A;  3M3C A;  4IV3 C;  5T3N A;  5JCT A;  3WW2 A;  3DXT A;  3GZA A;  3WNM A;  4JDO A;  5DAW A;  3ZXG A;  5FY4 A;  4COV A;  2Y0I A;  1SLC A;  1ASJ 3;  5FK7 A;  3RPQ A;  4NRQ A;  4NHY A;  2RS5 1;  1QJU 3;  3POW A;  3D6E A;  3IPV A;  4CDQ A;  1WCS A;  4Y1Y A;  1K42 A;  2VOK A;  4Y5T A;  4BDV B;  2VZ1 A;  2GAL A;  3THD A;  3VBF C;  4BXF A;  3NAP A;  4UFH A;  4E2S A;  4Q1R A;  2ZGL A;  5BNO A;  1SFP A;  4YG0 A;  4URT A;  4CUA A;  1US2 A;  4ASK A;  2ERF A;  3M8L A;  5JXJ A;  5KHJ A;  4IGQ A;  1OD5 A;  4MHU A;  4AQ6 A;  1GZC A;  5CFC A;  1U5Y A;  1DCS A;  4CEY C;  2HEW F;  3VDC A;  2V5D A;  2XPJ A;  4PLM A;  2JIJ A;  2CNA A;  4B29 A;  2V73 A;  2XUE A;  3NVC A;  4JAA A;  1OA3 A;  2Y0O A;  4NMI A;  1OLQ A;  3NQH A;  4UT5 A;  5FYT A;  4CDU A;  4DY3 A;  1YI7 A;  1ZBA 1;  3VLB B;  2GMM A;  2O1Q A;  4H7L A;  3WLU A;  5F1R A;  1FX5 A;  1ODN A;  2JJ6 A;  2R1B A;  3MW2 A;  4JDN A;  4IQP A;  4BIF A;  1ZX5 A;  4RQP C;  1Z7S 1;  4DPN A;  2GME A;  5IHR A;  4MGT A;  2D6N A;  3D0J A;  2I74 A;  3I2F A;  3SH3 A;  4AQS A;  3QOP A;  4LJH A;  4LOR A;  2CU5 A;  5LBC A;  5B4N A;  1ODM A;  4XMA A;  1PIV 2;  5GLV A;  4CEW B;  5GKA C;  2WZE A;  4HKO A;  3VBR C;  3I2O A;  1EAH 3;  2R04 3;  4HK8 A;  3RGB A;  2GMP A;  2CGN A;  3VBS A;  2ZX3 A;  2G19 A;  2ET1 A;  1TZO A;  1XU1 A;  2Y34 A;  2ARE A;  4CDW B;  5FLJ A;  2EAA A;  2OW4 A;  2YB7 A;  2WO7 A;  4XZU G;  1QQP 3;  4BWO A;  1HN0 A;  1OQD A;  2R6Q A;  4XIO A;  4BQW A;  4KWK A;  4AFM A;  3IWZ A;  2NQY A;  5FZ8 A;  1BLZ A;  1OFS A;  3ZYJ B;  1PK6 A;  2YBK A;  5KC5 A;  3JZV A;  3WNP A;  2BNN A;  4S2G A;  3LA3 A;  2ZGR A;  3NV4 A;  4CCN A;  2Z5W A;  3N7J A;  2JD4 A;  1VBC 3;  3PHM A;  3KZ4 C;  3IAP A;  4AVB A;  4NID A;  3WW4 A;  1V9U 2;  1ZZC A;  3DPR B;  4LHL A;  3VN4 A;  3ZYB A;  1J83 A;  3ZXE A;  4AE2 A;  3AYC A;  2YMZ A;  5DG2 A;  3RI9 A;  5FAX A;  3VUO A;  3WF2 A;  1H2K A;  3LDR A;  4LK6 A;  4OCT A;  5FY7 A;  1JW6 A;  2IXH A;  5FZ6 A;  1QWR A;  2ADD A;  3VV1 A;  5JR2 A;  4FP2 A;  1GLH A;  1H8T A;  1QJX 3;  4I3G A;  4OI4 A;  3KVB A;  3ZM8 A;  5FXZ A;  5IUQ A;  2AAC A;  4ISR A;  4L9B A;  2V5Y A;  4YGD A;  2WZ8 A;  4LA2 A;  3IMN A;  1AVB A;  1PO1 3;  4NVP A;  3ZYI B;  4CSW A;  5FZ9 A;  3E6D A;  1KRI A;  2CGP A;  4B7K A;  2C0Z A;  2IZW A;  4NIH A;  3AZX A;  4QPG A;  3V65 A;  4LBQ A;  2BWA A;  2P17 A;  3H3L A;  5F39 A;  3SXW A;  4YZ5 A;  5FZ1 A;  5IAT A;  3K3N A;  4GAZ A;  1UXX X;  2DUR A;  5HCH A;  1IZ3 A;  1FI2 A;  1XJA A;  3DCQ A;  3O5S A;  4JGY B;  4NHK A;  1KDK A;  2D5F A;  2VAU A;  1W6N A;  2E26 A;  1I5Z A;  1MEC 2;  3BPS A;  1EY2 A;  4K9S A;  1JXN A;  4P9W A;  5FXX A;  3WDV A;  4OI1 A;  3AJY A;  1AR7 2;  2R30 A;  5BNN B;  1O3T A;  1V00 A;  3N7M A;  3VD7 A;  1AYM 2;  3U07 A;  5GZG A;  2G9G A;  2VOT A;  3PVO A;  3VBH C;  2K2S A;  3OBT A;  3HD8 B;  1NQJ A;  3ZXJ A;  3GXU A;  2JEM A;  3AK0 A;  4NAM A;  3GBG A;  3R05 A;  3MO4 A;  3DEC A;  3U11 A;  2HEY F;  4CCE A;  2WUH A;  5E1R A;  1EPW A;  2RS5 2;  1YJK A;  1F4A A;  4WM8 A;  4XBN A;  1HDK A;  3B3Q E;  4AK3 A;  3ABZ A;  5IAX A;  1VBA 1;  2R07 1;  4XAA A;  1HXS 3;  4RR3 B;  1QXP A;  4UFI A;  1HRV 3;  1S0B A;  4K1Z A;  3TB0 A;  1B35 C;  2KA3 A;  1G9B A;  1GNH A;  5B4X A;  1IG0 A;  2ES3 A;  3UK9 A;  2ZX2 A;  3BUC A;  4RS5 B;  2AUY A;  4LMF A;  4R9C A;  3I2K A;  1W6Q A;  2YC2 A;  1WWY A;  5C4W A;  3LPF A;  4CTE A;  2A3W A;  1FOD 1;  5FYY A;  1PM7 A;  5E6H A;  1GBG A;  4COU A;  3WNX A;  1LAJ A;  3BOP A;  4AL9 A;  1JOJ A;  4XFG A;  2ZPX A;  2FD8 A;  2D40 A;  1AHS A;  1ZBA 2;  4DNY A;  5A3M A;  5FDB A;  5IK8 A;  1JZ3 A;  5ABJ C;  4LTA A;  1NUK A;  5ACA 3;  3CHX A;  4E4D X;  3AKP A;  1Z7S 2;  1LOE A;  5A6X A;  2JG9 A;  4RD7 A;  2PN5 A;  3APB A;  3P5B A;  1EV1 1;  1JHJ A;  1UIJ A;  2B46 X;  2ZXQ A;  2JIC A;  3ZXA C;  3BOW A;  5HXV A;  3T0D A;  1YQ6 A;  4ARX A;  4CDX A;  1R08 3;  2ETE A;  5LY1 A;  3LOB A;  1UZZ A;  2D3P A;  3N9L A;  1N3O A;  2ZGM A;  1CAU B;  1G9C A;  1MZ5 A;  2VJX A;  3ELN A;  2VZ3 A;  5LA1 A;  1LOF C;  3WP3 A;  5FZ4 A;  5T50 A;  2VW2 A;  4WVM B;  5LCW L;  3MID A;  4CP2 A;  3MF6 A;  1CON A;  2JDM A;  2XVG A;  1A78 A;  2OUJ A;  1XE0 A;  2RS1 1;  3WXP A;  4YAR A;  3ZKU A;  4D6S A;  5JUV A;  1UOG A;  2P3K A;  3OUJ A;  5LBF A;  1ULC A;  3GZT B;  4BQ1 A;  3SMH A;  3U14 A;  2VVD A;  5FUI A;  1HV1 A;  3DKQ A;  4MZU A;  4FTE A;  1QJZ A;  2YXS A;  1WLD A;  1YFY A;  2ZAB A;  2ZGU A;  4UW5 A;  4A42 A;  2W08 A;  1UY4 A;  2Q1M A;  2TUN A;  1LGN A;  3BPZ A;  1UOF A;  5JDB A;  1G6N A;  1RVF 1;  3PLQ A;  1DQ6 A;  2ZMN A;  3E97 A;  3OD4 A;  1DFQ A;  3AMN A;  2QQV A;  3AP9 A;  1NLR A;  2EIE A;  1D2S A;  2D44 A;  4XDQ A;  3OY8 A;  2OPW A;  3WG3 A;  3ZSM A;  1J3Q A;  5FYH A;  4C91 A;  1UOJ A;  3I8T A;  1DYK A;  4QM9 A;  4V1P A;  1SDW A;  4PIX A;  5FFO C;  4BQ4 A;  2WII B;  4C0B A;  2DFB A;  2N7G A;  3QCW A;  5IK5 A;  4WM7 A;  2QQU A;  5I0T A;  3HNY M;  1OUR A;  1AL2 1;  5LA0 A;  4G4F A;  5CKQ A;  4L92 A;  3QH7 A;  2AR6 A;  5AC9 1;  4KNC A;  2E31 A;  2ZAH A;  4M3C B;  3U4S A;  5DDJ 3;  4W4Z A;  3LF7 A;  2LRO A;  1MS8 A;  4LUK A;  4MH0 E;  5I8T A;  5H9S A;  3W9A A;  2FDI A;  3WQ7 A;  1TME 3;  4GH4 C;  1VP6 A;  1AX2 A;  1W6M B;  2ATF A;  3HVD A;  3KV5 A;  4NO4 A;  3CF6 E;  4NRP A;  1ZVF A;  3AMP A;  1PGL 1;  2R1D A;  2ZEZ A;  5FLH A;  5KHK A;  4KWJ A;  5FY5 A;  3GZU C;  4AYU A;  4EN9 B;  1AR6 1;  3VL8 A;  1I9R A;  4EZ4 A;  2QNK A;  1MVE A;  4CP1 A;  3IDA A;  1DLC A;  1O6U A;  4IV1 B;  1NZI A;  5F3C A;  1PVC 3;  4JHZ A;  4SBV A;  2WNV B;  4QX3 A;  5AVP A;  3JD7 3;  1QJF A;  2QQN A;  1O59 A;  3GYD A;  1NE4 A;  4OQ8 A;  1QNY A;  3USU A;  1V6K A;  2HYX A;  1AX0 A;  3OUH A;  4XYX A;  4CCJ A;  5M0T A;  1VBA 2;  1O7F A;  2R07 2;  1ZNP A;  2HYK A;  2JD9 A;  2LTN A;  2W39 A;  4IV3 B;  4P5Y A;  4U36 A;  5IVV A;  4BH9 A;  3MIE A;  3HIF A;  2B4K A;  3ZFE B;  3IT8 A;  3WNN A;  5E16 A;  3BTA A;  2HWB 3;  4LLF A;  4AFA A;  5GZD A;  5KXD A;  1JBC A;  4F8A A;  4YSF A;  4Q5O A;  1XYN A;  4IE0 A;  2PEL A;  4HL0 A;  1YQ8 A;  1FOD 2;  2BER A;  4QXH A;  1JZ4 A;  3C7G A;  3AZZ A;  3ITQ A;  3NL1 A;  3VKN A;  5IVE A;  2OA2 A;  2XUM A;  1XXN A;  2EA7 A;  2BP6 A;  4QX0 A;  3VBF B;  4DB5 A;  2XVK A;  1W99 A;  3DKW A;  3LEG A;  1QOT A;  2C4X A;  1NCQ B;  2WS9 3;  1QDO A;  2WWS A;  4XXA A;  1MS3 A;  4W50 A;  3BCW A;  3INA A;  4JGZ A;  5J48 A;  3JBG 1;  5EIY B;  4P9Y A;  1PO2 1;  4FFF A;  4CEY B;  1EV1 2;  1UN1 A;  4NOT A;  2YU1 A;  5F6L B;  1R09 1;  4BQ2 A;  1PMJ X;  4COZ A;  1CIW A;  4Q4V 1;  4QX1 A;  4S2H A;  4BIO A;  2I2S A;  3LDB A;  2W2I A;  4LUM A;  1YIP A;  1OUX A;  1WZX A;  1OC1 A;  4FXG B;  2ARC A;  4JKM A;  3JQX A;  4BHP A;  3B93 A;  2FZ2 A;  3MZH A;  2JB4 A;  3A22 A;  1Q3E A;  2VU9 A;  3POF A;  4MGY E;  1D4M 1;  3CJX A;  4X6R B;  4XQ4 A;  5A3W A;  3Q9O A;  1UX7 A;  2J1A A;  4M3C F;  3LEM A;  5FXW A;  3RYK A;  3SKV A;  2WQ4 A;  3VBO C;  1JHN A;  4FOY A;  4YWA A;  3N3H A;  2RS1 2;  3NNF A;  2VXR A;  1FPN 1;  3B01 A;  3MUZ 1;  4ZS2 A;  1REF A;  5FZM A;  2WZR 1;  4LIU A;  4IGP A;  1LUL A;  3FE5 A;  3KF3 A;  3NAP B;  1RUH 3;  3HT1 A;  1NA1 A;  3B7M A;  4AVV A;  5BNO B;  1N3P A;  4FFH A;  3K4A A;  1VBE 1;  4NHL A;  3R4U A;  2CAU A;  1W9F A;  4LBN A;  4XUQ A;  1RVF 2;  3ZN6 A;  3IDB B;  4XIL A;  4ARY A;  4CDW A;  5CFC B;  3H8X A;  4LHN A;  2P37 A;  3MI8 A;  3W5M A;  5FPU A;  3H9A A;  3BB6 A;  3KD4 A;  1DGL A;  4NRO A;  2FMY A;  4LKF A;  4CDU B;  5F32 A;  1NY7 1;  1RUI 1;  1C8M 3;  3HWJ A;  4HFS A;  1H2M A;  5C3O A;  1IG3 A;  3BKZ A;  1UZ0 A;  2DTY A;  4XHB A;  1ND3 A;  1TG7 A;  5GZE A;  4CCK A;  1CQ9 A;  1AL2 2;  1TEI A;  1OI6 A;  2WO1 A;  1GZT A;  3LIH A;  3W59 A;  3DPR A;  4A41 A;  5AC9 2;  1KS4 A;  2Q1Z B;  2WRA A;  1IOA A;  1VBB 1;  2WWJ A;  4QHO A;  4DUX A;  1B09 A;  1RUE 1;  1S1A A;  2HWE 1;  2XGX A;  3RJR A;  4Y22 A;  3QBQ A;  3VZN A;  3KCY A;  3O14 A;  1YYN A;  1XB9 A;  3ILR A;  1AJK A;  2VMH A;  1OF3 A;  4QDQ A;  2PHR A;  2J1S A;  5FYM A;  5EPA A;  1CGP A;  2UYA A;  1ULP A;  1PGL 2;  1RIN A;  4ATF A;  5T5P A;  4QB1 A;  3P3N A;  1SBF A;  1FMD 1;  4Y33 A;  4K8F A;  2X10 A;  1AR6 2;  2XKO A;  2PFW A;  1AR8 1;  1IS6 A;  2VTF A;  2GSY A;  3IBM A;  1PK6 B;  1X33 A;  4WVZ A;  1H0B A;  2JDA A;  4XZP A;  4OHW A;  4MO3 M;  5I0D A;  1ZBE 3;  3DYP A;  3POJ A;  2F17 A;  1C5I A;  3TRS B;  5F3I A;  3N9N A;  3J7H A;  3PIJ A;  2PYT A;  1LOB A;  1SG3 A;  4UW6 A;  4KG8 A;  4QQH A;  3VHO A;  5GZF A;  4QU2 A;  5LA9 A;  3VBH B;  2X09 A;  2JDU A;  4L2N A;  1XU2 A;  2J1E A;  3I3D A;  4XFC A;  3J7M A;  3ACL A;  4PT6 A;  1XNK A;  2WN2 A;  4J1W A;  1Y7B A;  2QQK A;  3K48 A;  3RS6 A;  1F2N A;  3UKV A;  4DS0 A;  1S2B A;  1UZV A;  4LKE A;  2GC1 A;  2Q8C A;  2JKX A;  1JN2 P;  4IEU A;  1DQ4 A;  4YZ1 A;  2PLV 1;  4LBQ B;  4OMC A;  4ZON A;  3FZ3 A;  4XF1 A;  4IES A;  1SAC A;  1ZM1 A;  1AYM 3;  2DCJ A;  2BTV C;  2JIG A;  3HQX A;  1EYB A;  5K4L A;  3KSC A;  5CB7 A;  1W6N B;  4HXC A;  3VD4 A;  2H6B A;  4WBB A;  4XUO A;  3ON7 A;  3JBG 2;  4MGI E;  5A7O A;  2BYV E;  2BVV A;  4DIN B;  4MGK E;  1F5F A;  4LOT A;  2RS5 3;  2WR9 A;  4JTO A;  3WDY A;  4Y5Z 0;  3OPT A;  1PO2 2;  3VZM A;  3ZFG C;  1LHO A;  1VMJ A;  2V4A A;  3O1R A;  3MV1 1;  1D4V B;  1R09 2;  1QMJ A;  2H0V A;  2WT2 A;  2XQR A;  3NKT A;  4Q4V 2;  4QU1 A;  4YG6 A;  1LED A;  3ZXL A;  2IWG B;  3BU7 A;  2BDR A;  3LGR A;  4LO8 A;  4P9X A;  3O1U A;  5ABJ B;  3T2P A;  4FPJ A;  1VE0 A;  1DBN A;  3USS A;  4DXZ A;  4LK7 A;  3PVE A;  5L36 A;  4YFZ A;  3LZZ A;  4AZZ A;  2HLE A;  5AFE A;  5JZG C;  4LKD A;  1D4M 2;  4RGG A;  4WM8 B;  3I2I A;  4FPY A;  1GMM A;  2YBP A;  2BGC A;  1OLR A;  5DZF A;  2ZHN A;  4YGE A;  4Z1V A;  3S5A A;  1FPN 2;  3JB8 A;  2WZR 2;  1W8T A;  4YW6 A;  1E5S A;  2MHF A;  1ZBA 3;  1MR5 A;  2BOJ A;  3C7F A;  1I6X A;  2VL4 A;  1XPW A;  3I2J A;  4AR2 A;  3JXS A;  2W1U A;  2VCA A;  1KFU L;  1W6Q B;  3AKR A;  3MUY 1;  1VBE 2;  2F4P A;  1A3K A;  2ZTN A;  4PLO A;  2VNO A;  1CZS A;  4QXB A;  3T2T A;  4CXW A;  3VZJ A;  5FRE A;  2C9K A;  5T55 A;  4PI0 A;  3NST A;  3SC7 X;  4AI9 A;  4AXO A;  2OXB A;  4UF0 A;  4WVM A;  4BU2 A;  4M0H A;  5D2A A;  4HSL A;  4RGK A;  4KWU A;  3J26 N;  1Y43 B;  2VZS A;  4IUG A;  1NY7 2;  1RUI 2;  1VAK A;  1RC6 A;  4QMA A;  4W6Y A;  3RRD A;  3TEY A;  5GZC A;  3ZDV A;  1AR9 3;  2C1F A;  3CQO A;  4DY5 A;  1LEM A;  4NJ4 A;  2JG9 B;  2GP5 A;  2RDN A;  2WNU A;  1COV 3;  1ULO A;  3WF0 A;  3O1P A;  4J1X A;  4KWL A;  1VBB 2;  1IKP A;  4CDX B;  2WAO A;  4PBO A;  1RUE 2;  4A7K A;  2HWE 2;  3FFQ A;  5C8C A;  5FMC A;  1NXM A;  4Y1U A;  4GQ7 A;  2EF6 A;  1AZD A;  4ZZ5 A;  2YDE A;  1JYN A;  3URF A;  4OHX A;  4BXS V;  3AFK A;  1JOB A;  3POY A;  1YEW A;  4WZC A;  4IEY A;  5FZ0 A;  3R0R A;  1JZ7 A;  3ZIX A;  3G7D A;  4YZ3 A;  4BJ0 A;  1ENR A;  2IFR A;  1OVP A;  4E4Z A;  1FMD 2;  1K3I A;  1UYP A;  1XQN A;  2VBD A;  1RGS A;  2W91 A;  1H2N A;  4O61 A;  4YG3 A;  1LGB A;  3D0S A;  1VAM A;  4I30 A;  1AR8 2;  1S0I A;  3C3V A;  1O4T A;  1HKD A;  2E53 A;  4CCL A;  3OGR A;  2R7E B;  3K75 B;  1GP6 A;  3L2Y A;  2Z4F A;  1XC6 A;  4W6W A;  3ZLI A;  4IE4 A;  1AJO A;  3HPN A;  4GH4 B;  1JZ2 A;  2D97 A;  1V0A A;  4FPG A;  2VG9 A;  4IE6 A;  5DUX A;  3UV9 A;  4AGV A;  2KR2 A;  4I0W B;  2EAL A;  1C1L A;  2JE8 A;  1RUJ 1;  2VR4 A;  1QXJ A;  2YGM A;  3N9P A;  3OY8 B;  3BTY A;  4C8D A;  3WY6 A;  1LOC A;  1SLB A;  4EWD A;  5JIU A;  3OBR A;  1GIC A;  2BVB A;  2YPJ A;  5IWF A;  1OOP A;  1AYN 1;  5KHG A;  3SH4 A;  4AVC A;  3GCW A;  1SLI A;  3CNA A;  3T2O A;  5EP9 A;  1JU4 A;  4WM7 B;  3R4S A;  4WVV A;  5L9R A;  4AI8 A;  5K0U C;  3V64 A;  3POG A;  3R4D B;  3N9M A;  1ZRI A;  2VW1 A;  3I54 A;  5DUU A;  2PLV 2;  1MZF A;  2ZCW A;  5A7Q A;  4DO0 A;  4CUC A;  1IS3 A;  2JG8 A;  1DGR A;  2WNO A;  3AJZ A;  3IM0 A;  3NJY A;  3PME A;  1LOG A;  3T1L A;  1F9K A;  1X50 A;  1AXZ A;  3T4H B;  4DUW A;  3PIG A;  4YVW C;  4EN7 B;  4MXV A;  4JHT A;  4E2Q A;  2YC0 A;  1IGO A;  2BFU S;  5T52 A;  1AXY A;  2QQP A;  4FPE A;  3AVR A;  2GP3 A;  4YW3 A;  5DAP A;  2R07 3;  1A8M A;  1VBD 1;  2W94 A;  3PVN A;  1ND2 C;  1X8E A;  4QB2 A;  5EHD A;  2X05 A;  5JMC A;  4PI2 A;  3GGL A;  1DQ2 A;  2A6Z A;  2XJQ A;  1FAT A;  3B00 A;  4FPO B;  3VZK A;  2WQ8 A;  4LBQ D;  4H2A A;  3AX4 A;  2HJI A;  4LUL A;  4A44 A;  3AZV A;  5L9V A;  3N7K A;  3VBF A;  5C8W A;  4FPL A;  2UWC A;  1LB2 A;  3ES4 A;  2JXA A;  5A3N A;  1RMU 1;  4D7S A;  2VOX A;  3USU B;  2ARA A;  3VHP A;  2VZQ A;  1D2Q A;  5C5T A;  3WF4 A;  4AFC A;  3ILN A;  1J58 A;  3NNL A;  1HB4 A;  2Q8O A;  4CEY A;  5FJK A;  1BKZ A;  3KMH A;  1HX6 A;  4GWM A;  4P9L A;  5T5O A;  4K20 A;  4D8M A;  1QOS A;  3DUI A;  5JIA A;  4ZXK A;  2HEV F;  1XE8 A;  4Y4Y A;  5FYC A;  2PQQ A;  2WSV A;  4RQP A;  5BY5 A;  3ZMN A;  1WBL A;  1XNT A;  4MYE A;  1XE7 A;  5A6Q A;  2X53 S;  3A4U A;  3AM2 A;  3AMM A;  2JDN A;  5T54 A;  3SHR A;  3MW4 A;  2QE3 A;  5K9Y A;  2P1B A;  3JB4 C;  4K8R B;  5IJR A;  2BU9 A;  1RUC 1;  3TNP B;  2FCT A;  1H6X A;  2GZW A;  4QGN A;  3VBR A;  3I3E A;  2XJV A;  1MQT C;  2XLA A;  3LQC A;  3MIH A;  3OCP A;  5FY0 A;  4JGZ B;  5F5C A;  3O1T A;  1G8W A;  2DF7 A;  4QQL A;  3DN7 A;  5EQU A;  3KLS A;  4R9A A;  1Y4W A;  4D7T A;  2NM1 A;  4ZU5 A;  2A3X A;  3NMB A;  2PA7 A;  2RS1 3;  2E6V A;  2E63 A;  3KQ4 B;  3MHZ A;  3T4V A;  1DF0 A;  5KHH A;  4L8Q A;  2J1R A;  3AMH A;  4FOQ A;  3BVC A;  5JOX A;  3J4U H;  2Q5T A;  1OMI A;  5FIX A;  5A1L A;  2ADE A;  3MIG A;  2FDG A;  4YM2 A;  5FKC A;  2A6Y A;  1QDC A;  3TN9 1;  5FYZ A;  1RVF 3;  1JU3 A;  3POI A;  3WW1 A;  2Z69 A; 
#chains in the Genus database with same CATH homology
 2Q8C A;  2YBK A;  4AAP A;  3AVS A;  4EZH A;  5FY8 A;  5IVC A;  5A7S A;  3N9P A;  3K2O A;  4CCN A;  4C8D A;  5FZ4 A;  5A7W B;  5FZL A;  4E4H A;  2YU1 A;  5IWF A;  2XML A;  4HOO A;  5K4L A;  4TN7 A;  3LDB A;  5FZE A;  3PU3 A;  2W2I A;  3PU8 A;  5FYS A;  5FZH A;  4D6S A;  5IVF A;  5FY7 A;  5A7O A;  5F2S A;  5FZ6 A;  2PXJ A;  4V2W A;  5A3T A;  5FY9 A;  5FZG A;  2Q8E A;  3N9M A;  5F3E A;  3KVB A;  5LY2 A;  2OQ6 A;  5A80 A;  5FXZ A;  3OPT A;  5A7Q A;  4DO0 A;  4GD4 A;  3NJY A;  2YU2 A;  5A7N A;  4CSW A;  5FZ9 A;  5A3W A;  5FXW A;  4QU1 A;  5FYB A;  4URA A;  5FWE A;  4DIQ A;  4GJY A;  1VRB A;  5FZM A;  4LIU A;  5F39 A;  5ANQ A;  5FZ1 A;  3LD8 A;  4CUG A;  4IGP A;  3KV6 A;  3K3N A;  5FYH A;  5A7W A;  4GAZ A;  5FYI A;  4CCO A;  3AVR A;  2GP3 A;  3PUS A;  4NUB A;  4QX7 A;  4UF0 B;  2P5B A;  5FP7 A;  3PUQ A;  3DXU A;  5KR7 A;  4LIT A;  2VD7 A;  3DXT A;  3N9O A;  4IGO A;  5FZ7 A;  5A7P A;  2YBP A;  4D6R A;  5FZB A;  2YBS A;  2Q8D A;  3KV4 A;  4GJZ A;  5FY4 A;  5FXX A;  3K3O A;  5FZK A;  5FJH A;  5FPU A;  5LWB A;  3U4S A;  4LXL A;  3AL5 A;  5A3N A;  5F32 A;  5FZO B;  3KV9 A;  5FZ3 A;  4QXB A;  3U78 A;  4BXF A;  5FPB A;  5FZF A;  5FXV A;  4CCK A;  2OQ7 A;  5FPL A;  4LIV A;  4V2V A;  4Y4R A;  3KV5 A;  5FJK A;  4AI9 A;  3PTR B;  4HON A;  4UF0 A;  4BU2 A;  4CCM A;  4QWN A;  2WWJ A;  5FZA A;  4ASK A;  5FY5 A;  4IGQ A;  4D6Q A;  5FYV A;  5ISL A;  4EZ4 A;  3PDQ A;  2OS2 A;  4XDP A;  5FYC A;  3PUA A;  5IVY A;  5F3C A;  5FV3 A;  5F37 A;  5FWJ A;  5LW9 A;  2XUE A;  2GP5 A;  5FBJ A;  5FYT A;  5FYM A;  5F5I A;  5IW0 A;  5FP4 A;  5FYU A;  5A1F A;  3N9Q A;  4XDO A;  5FY1 A;  3AL6 A;  4Y33 A;  5FYY A;  4CCJ A;  5F5A A;  4Y3O A;  5FY0 A;  5IVV A;  3PUR A;  5E6H A;  2WWU A;  5F3G A;  5F5C A;  5FPA A;  3UYJ A;  5IVJ A;  5FZC A;  2OX0 A;  4QXC A;  5CEH A;  5FZ0 A;  4BIS A;  5F3I A;  5FP8 A;  3N9N A;  3OPW A;  4QXH A;  2OT7 A;  5FPV A;  2XDV A;  4QX8 A;  5F2W A;  5IVE A;  2YPD A;  5FP3 A;  5FUN A;  4CCL A;  5A1L A;  5IVB A;  4EYU A;  3KVA A;  2XXZ A;  3RVH A;  3ZLI A;  5FP9 A;  5A3P A;  5FZD A;  3ZPO A;  5LY1 A;  5FYZ A;  5FZO A;  5FUP A;  3N9L A;  5FZ8 A;  5FZI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...