2WWJA

Structure of jmjd2a complexed with inhibitor 10a
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
346
structure length
346
Chain Sequence
LNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 4A
publication title Selective inhibitors of the JMJD2 histone demethylases: combined nondenaturing mass spectrometric screening and crystallographic approaches.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 105
structure length 346
sequence length 346
chains with identical sequence B
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2009-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 2wwjA01
1VRBA 4IGQA 4QXCA 5FZ1A 5FZCA 4CCLA 3PU3A 5K4LA 5A80A 5FYTA 5F3CA 2YBPA 5FZHA 5FZ8A 5A1FA 3AL5A 3N9LA 5FZMA 4BXFA 2OQ7A 2OS2A 2XDVA 3RVHA 4UF0A 5A3WA 2W2IA 5F3GA 5FBJA 4C8DA 2OT7A 4D6SA 5FZ4A 2OX0A 2PXJA 4QWNA 4CCNA 4ASKA 4D6QA 5F5AA 5FPAA 4EYUA 5FZKA 5A7SA 5ANQA 5F5CA 5FP4A 5A7OA 4GD4A 5FWJA 2YBSA 5FPBA 4V2VA 5LW9A 5A7QA 3N9QA 5IVBA 3AVSA 5IVFA 2XMLA 3PUSA 2YU1A 5FZ7A 5FZLA 5FPUA 5F3IA 4QU1A 3OPWA 5F39A 5CEHA 5FY7A 5FYBA 5FY4A 3OPTA 4LITA 5A7WB 3NJYA 5FY5A 4UF0B 4CCKA 5IVJA 3LD8A 5IVEA 5A7PA 5A7WA 3KV9A 4BISA 3KVBA 4QXHA 5FJHA 4NUBA 5KR7A 4Y4RA 5FUPA 3K2OA 5FP9A 4LIUA 3LDBA 3DXUA 2GP3A 3PTRB 5ISLA 2WWUA 3K3OA 3KV4A 5FV3A 4CCOA 3N9PA 2YPDA 5FP8A 2Q8EA 4LXLA 5E6HA 5FXXA 2Q8CA 4CCMA 5FY0A 4QX7A 3PURA 2VD7A 3UYJA 4QX8A 5FYSA 5FXWA 2YU2A 5FP3A 2P5BA 4CCJA 5IVCA 4TN7A 4BU2A 5LWBA 5FUNA 3K3NA 4DO0A 5F32A 5IWFA 5FZ3A 5A3TA 4AI9A 2WWJA 5FP7A 5LY2A 5FY9A 3N9OA 4EZHA 3DXTA 5FYVA 3AL6A 4HONA 3N9MA 4DIQA 3PUAA 4URAA 5A7NA 4CSWA 5FZ6A 2YBKA 5FPVA 5F37A 5F3EA 4IGOA 5FPLA 4D6RA 2GP5A 4XDOA 5F2WA 5IVVA 4IGPA 5FYIA 5LY1A 5FY1A 5F5IA 2OQ6A 4GAZA 4LIVA 5IVYA 4CUGA 4EZ4A 5FYYA 5FZDA 4Y3OA 5IW0A 4E4HA 5A3PA 4QXBA 4GJZA 5FZGA 2Q8DA 3PUQA 5FZ9A 5FZFA 3ZLIA 5FXZA 4XDPA 3KVAA 5FWEA 4GJYA 5FZAA 2XUEA 5F2SA 4AAPA 3N9NA 3PU8A 3ZPOA 5FZOB 3KV6A 5A3NA 5FZ0A 3AVRA 5FYMA 5FXVA 5FZOA 3U78A 5FYHA 3PDQA 5FYCA 5FJKA 5FYZA 3KV5A 5FZEA 2XXZA 5A1LA 5FYUA 5FY8A 4V2WA 4Y33A 5FZIA 3U4SA 5FZBA 4HOOA
chains in the Genus database with same CATH superfamily
3GBGA 3DECA 4IGQA 3AJZA 3KHCA 4IDZA 2HWE2 3UGHA 1WW5A 1W6PB 1ZNPA 3WNOA 3O1PA 2ARCA 5F3CA 3VHRA 4A4AA 3SH5A 1POV1 4Y22B 1WA6X 3AL5A 3N9LA 1VAVA 1TMF2 3WW4A 3RVHA 2WC2A 1N1TA 3LOIA 1S0IA 4XF0A 4Y26A 5IATA 1AL23 1JOPA 1RUG2 1UY1A 2ZAHA 4JHTA 4ZS2A 5K0UA 5L7OC 2WNVC 3VDBA 2OX0A 1ULEA 1QY4A 2VUDA 2WAOA 4WM8A 1OT5A 4MXWA 3BYWA 3ZYRA 2WJSA 2A73B 4GMP1 3RQ0A 4NVPA 3UGGA 1FOD1 3PNAA 1CAUA 4GD4A 3VBFB 1A34A 1PVC3 3M3QA 4DPNA 1BMV1 1ONAA 3JQWA 2C5DA 1ZVFA 4XUQA 4RQPA 5F3IA 1AX1A 4KL1A 2G1MA 3RMXA 3VGIA 1CGPA 1O7FA 1QDCA 2PAKA 4LITA 5C7GA 1AXYA 1RVF2 1UF2C 1WCSA 2CY6A 4M3CF 2UWCA 3ZN6B 1F8VA 5HXMA 1HXS1 3CO2A 1QOTA 4AFCA 2JDYA 1AYN1 1O5UA 1POV0 5A33A 1RHI1 3MGUA 4KWJA 2AEZA 4CDXC 1NA1A 1X9TA 4QDSA 3ROUA 2XBO2 3BOWA 4R9DA 4XILA 3SC7X 2YXSA 1H30A 3J8F3 2VOVA 3OUIA 5DMYA 4L99A 4CDUA 3PMEA 4QX8A 5ABJC 5CZKA 1XBFA 4GMP0 5L9BA 5DDJ1 3RZGA 2ZKLA 1SPPB 3RZHA 2YYOA 5L73A 4BM8A 1NLSA 2J1EA 5F8PA 5BY5A 3GCXA 1S0EA 2GC3A 1YLLA 4MH0E 2GC2A 2OUJA 1KDMA 2R061 2VMIA 4YYOA 2GZWA 2LTNA 3T1MA 2UY9A 5FY9A 3I59A 1CPMA 4CZSA 2XR4A 2OPKA 2ZZQA 2IUWA 1S2EA 1UAIA 1ULPA 2W0XA 2VW1A 3OEBA 4HLTA 2HWD3 5FO9B 2CYFA 4L0PA 4PT6A 1SDDB 3WDYA 2FDJA 2JICA 2GP5A 2D5HA 1L7RA 2YDEA 1PO22 1C8NA 4R4ZA 4OHWA 2IWGB 5DUXA 1VBE2 1O59A 5G05L 2A70A 3AB0A 4HANA 4HKLA 2FBEA 3PLQA 3VBUB 1MZ5A 4BQ2A 1R1A1 2ZEXA 4EWDA 3W5NA 4QXBA 4J1WA 3WY6A 3K48A 3S0MA 3LFMA 2PLV3 3WG4A 2X05A 2WL1A 2YC4A 4LE4A 4MGZE 1QXPA 2D97A 1GP5A 1CN1A 3NO8A 2XJRA 5E16A 4HL0A 1VBD1 4XJUA 2Q0AA 4NIHA 1H4GA 3POGA 4RGGA 1NXMA 1H6YA 2DVFA 4LBLA 3POFA 3WOGA 3I2GA 5FPZA 4DUWA 5FZEA 2PHWA 1OLME 4QPYA 3ZIXA 2WT2A 1AXKA 1LULA 1UCXA 2A71A 4MOAA 4BB3A 1XJAA 4QPGB 2WO3A 3GCWA 3VBOB 4M01A 1BYHA 1OH4A 2IFWA 4D94A 4OUMA 1U5YA 1NY72 3N7KA 1RUC2 4MG2A 5LA1A 1W6NB 3HIFA 3DV8A 4KBBA 4YFWA 5JXIA 1SQ4A 2W39A 3JCIA 1TG7A 2VMCA 2W94A 1GWLA 3DEMA 1NG0A 5ERLA 3VL9A 3SQOA 3SMHA 2RDQA 5L9VA 1Q56A 3TEWA 1FYUA 5C5UA 4K21A 4N53B 2K9ZA 2J1VA 2MHFA 4HG6B 3VKFC 4ASLA 3JD71 4JDMA 5GALA 4UI9L 3UGFA 2WLQA 4AI8A 1D4M1 3LWCA 3TN91 3NV2A 1FV2A 1GQGA 4CCCA 4EE2A 2E9QA 4MHUA 1Y9GA 5EFUA 2C9AA 3ASIA 1YFUA 4HN1A 4H7MA 2WO2A 2YC2A 5T5JA 5K0UC 1G9BA 3CEWA 3LD8A 4CDQB 4QKFA 3SH3A 4O61A 3ZFEA 2JXAA 3PUIA 4UBHA 4AEJA 3J7NA 5B4XA 4A41A 3ZN6A 1W0PA 5FMBA 2GH2A 3F2ZA 1RUOA 3HQUA 2VUJA 5GLWA 1OF3A 1WCQA 1HW5A 3ZXLA 1GOGA 1Q3EA 1R083 3B7MA 1WCDJ 4WM7C 2B8MA 5BNNC 2IVIB 1LHVA 2BDRA 3AJYA 3C7EA 5A3UA 3O1OA 3X29B 3PURA 4YVWC 4ZU7A 5ACA2 4BK4A 1VPHA 5FYSA 4AL9A 2ZKNA 3QACA 1A78A 3V64A 1OOPB 3NV4A 2O1QA 4KMQA 2D98A 5DAXA 4AG4A 3NAPC 4I0BA 5EJZB 4RFRB 4F83A 1SPPA 4L11A 3OD0A 4XZPA 3ILNA 1YFXA 3OOXA 4OCTA 4PJYA 5EJ1B 2VTFA 1B35B 2X29A 4AI0A 4GIQA 4R9CA 3JBG1 4XMAA 2ET7A 1NA1C 3A7QA 1NX9A 1AXZA 3SHRA 5F3EA 3BIWE 1CJPA 3MW4A 4D6RA 1AF9A 2MNGA 4CTEA 2YG0A 2W52A 2Y0IA 5IVYA 3R4UA 3U37A 4RL7A 2BUKA 5BPXA 4CEWC 2ZGMA 4GJZA 1DQ6A 2XJQA 5H9RA 5C3QA 2R043 3KCXA 4QM9A 4CE8A 5KHJA 1REDA 1JZ2A 2I07B 3WCSA 4M3CB 2D93A 1PIV1 3WUDA 1VAMA 3HMYA 4IE6A 4A7YA 5FYMA 1FNYA 3ZMOA 1NLRA 4JKMA 1W6QB 3NKTA 1KFXL 4FTBA 3CBNA 1G9CA 3OYWB 4LQRA 5FJKA 3LAGA 3P6BA 4XTMA 1AR73 2DCZA 5DAQA 4NRPA 1GNHA 3ZFGB 1XE0A 2CWMA 2C4XA 2HEWF 2RJKA 4IUGA 4V2WA 5CISA 4KGGA 2WWSA 5FZCA 2OPWA 2XHKA 2DFBA 1RUF3 3R0RA 1IPSA 4N43C 5FLHA 3PL0A 3IDBB 1XSQA 5FMOS 3POSA 2VJXA 1H8TC 3OGVA 2C6SA 4QPGA 4TSVA 2CU5A 1LGBA 1A8DA 5FZ8A 4NRQA 5DZFA 1VBC1 3NKGA 4LK7A 1L7LA 4UF0A 2WN2A 1OQDA 4LHSA 4KH9A 4K9SA 3ORJA 1C5IA 4AVSA 1WLCA 3ZYFA 1W8OA 1JTZX 2BGOA 2JG8C 4MVTA 3ZXEA 1MEC3 1VBA3 2UWAA 2WT0A 4RSUA 5EYXA 1GU3A 3T2OA 1LOGA 2CHHA 4UOJA 3WP6A 1UZYA 4XQ4A 1PZ8A 4OI0A 2Y64A 2W5FA 4NHXA 5FPBA 5K7PA 4K3UA 2GNDA 3P3NA 2R49A 4D69A 2Z79A 4XIOA 4AYUA 2Y6GA 4DXZA 2QCSB 2PAMA 3T4HB 2LM3A 1H1IA 1XNBA 1EUUA 2QDRA 3ZSMA 4R8HA 1PO11 2PFWA 3M3CA 2IXCA 3EHKA 2JG9C 2BZDA 4I0WB 3O1TA 1UWWA 3THTA 3MBWA 2GN3A 3AMQA 1LOFC 5EV7A 5CKNA 5FQ0A 1X9PA 1FV3A 2CWSA 2E63A 2YY1A 4BLJA 5KR7A 4QX1A 4W6WA 4Q1PA 1CZTA 1QF3A 2GP3A 3NSTA 3GBFA 2HWD2 4UFMA 3NNMA 1MZEA 2WS91 1BBT3 2PHUA 1R1ZA 1DGWX 4Q1RA 2Y38A 3N9PA 1QU0A 3R05A 1YJLA 3VBFC 4QQ2A 2C0ZA 4B7EA 2J1UA 1JZ4A 1YFWA 4P08A 1OUXA 1QJY2 2JJ6A 4XXAA 5FLIA 3U4XA 2W1SA 1F5FA 1O4TA 1C5HA 4RR3C 2PAEA 5F5QA 2QJVA 3WDUA 1RUI2 3L2HA 1OOPA 1MR5A 5C8CB 5JIUA 4K1ZA 2JENA 4AFAA 2ZX0A 1LHWA 1DQ1A 4QB6A 4UFKA 2V4AA 5D8AC 1B35A 1ND2A 2XKPA 3WV6A 3H3LA 5DPNA 1XYPA 1AL0G 1QHDA 1VE0A 3A0NA 4LO4B 1KQRA 3FHAA 1JI6A 4XJZA 4G4FA 3HAGA 2RS11 3T30A 1RUJ1 3IT8A 1S2BA 5DG2A 5FBZA 5F5IA 1W8UA 3MLLA 1ASJ1 1NUKA 2P6HA 2Q1ZB 4OQ9A 1JYVA 4E4HA 1HRV3 1KD7A 2VVEA 3C7FA 2V72A 5JPNB 4NHLA 3RGBA 2JE7A 1W90A 1GP4A 2PELA 1AR62 2WZPP 4IEZA 5F2SA 4LPLA 2N7GA 4Q4X1 4M3CA 1BHGA 1ZRRA 3NV3A 5KXEA 2LS6A 3ZX7A 3VD5A 1SEFA 1SFYA 1R092 3ETQA 1CX1A 5IAVA 3VKMA 1DGWA 5BV6A 5TSWA 4YNIA 3DYOA 2OKXA 3H3UA 4N9HA 3VBUC 1H1MA 2VPVA 1YQCA 1ZBA2 2XUMA 3POJA 1HN1A 4JVAA 1BKZA 5KC5A 4BDVB 5CVRA 4AEDC 3MV01 1UIJA 3BCWA 4JQRA 4W65A 5LCWL 4CP2A 4CP9A 4LHKA 3V0BB 2OQ7A 3OJBA 3IM0A 3K4DA 4JAAA 2FCUA 1UY2A 1NT0A 3TOJA 4EJRA 2HWE1 2JD4A 3WP3A 2EAKA 4B7KA 1FATA 1DQ4A 1G9AA 1COV2 4IETA 1UW8A 5A7SA 1UX6A 4XZUG 2AH2A 1TMF1 1BXHA 4W8JA 4GH4A 5A7OA 4FVVA 3U11A 1R082 1RUG1 4QD2A 3ZVXA 1XQNA 2Y6JA 4L97A 1OQ1A 5FMCA 1S55A 3I2OA 4BQXA 4CU8A 1JZ5A 4ATFA 4BMEA 3HNBM 1SG3A 1WCUA 5FZ7A 5FZLA 3VBOC 1CVNA 4Q4W2 4W6YA 2V5DA 2IXLA 2R073 4FP2A 4K8FA 1CWPA 4XC9A 5BNPA 1JHNA 5CEHA 3ME2A 1RUNA 1PNFA 1LHUA 1Q8PA 2JE9A 3T2TA 1IS5A 5JR7B 1EV11 1QJFA 3LZZA 4JV4A 3M8LA 3U14A 5LA2A 2FZ2A 1NCQB 2VXJA 1GNZA 2J7MA 1LOEA 3U07A 3JU9A 1Q5OA 4AVVA 2DCYA 2VMFA 1GZWA 3LEIA 1JODA 4I02A 4N53C 2SLIA 2ZGNA 1RVF1 1N3QA 3WZ1A 2OA2A 1SACA 2WINB 1JZ8A 2DURA 4QX7A 1TZOA 2VD7A 2VZUA 3UKTA 3S6PA 5FXWA 4CEYA 1UYZA 1LCLA 4LUKA 4PQ9A 2XBO1 2ZZJA 5JWPA 2ID4A 2H6BA 2RS53 2VNGA 3ZM8A 1QJX3 4EWAA 4CDQC 1CONA 5C8CA 5BYNA 3KF5A 3D6EA 3KZ4C 3WNPA 3VBHC 1XU2A 1UZ0A 1W9WA 4WVWA 2ZGPA 4Q0PA 1X36A 5LBCA 4C1WA 1N47A 2QQUA 1MS0A 4YLZA 2ZEWA 4JKLA 2K46A 3WQBA 2NP0A 1ENRA 1N3OA 2JIGA 4XDOA 2OYZA 5I8YA 3AYEA 1APNA 1HV0A 1AR72 1PX4A 1CAXB 3G7DA 4CU6A 3AKTA 1OUSA 3E6DA 3FUQA 5FMOL 5FZDA 3BTYA 4GWIA 2KD7A 1RUF2 3CNAA 5KWRA 3KD4A 4N7IA 1PO21 5T55A 1AYM3 1UOGA 3J4UH 1UY3A 5IHRA 1VBE1 3LOBA 3GHNA 3LDRA 2P3KA 4UFJA 4AAPA 3BIEA 3VD3A 4AQ2A 2HJIA 1QXJA 2NPIA 3AK0A 1Q8SA 3T3YA 2DTWA 2DU1A 2D44A 3LSDA 1W9YA 4JQTA 1W8HA 1K5MA 1JOBA 1BLZA 2WZR1 2WYSA 1FAYA 2XOMA 4ITCA 1AR92 2DVGA 3HQRA 1RUE3 3ILFA 1FT9A 2DFCA 3IMMA 1WGPA 2DVAA 4G9SB 3THCA 3VLBB 4FPKA 5FZBA 2IC1A 4HOOA 3AMMA 1MS9A 1VRBA 3URFA 5LRSA 1QOOA 2JE8A 1FX5A 4TZDA 4DXTA 3J7MA 1XXNA 4IXLA 5FYTA 1E5SA 1NOVA 4ARYA 4AVAA 5FPXA 1AZDA 3N4MA 2NYYA 1DQ5A 2D3PA 4IE0A 3UESA 2RE9A 1MACA 3CF6E 4Q0SA 1RUC1 3MF9A 2X5IB 3O1MA 2WFF3 3UKNA 2BERA 5FZKA 5E1RA 2VAUA 3U10A 4NN0A 3VKOA 1XYOA 3ZFGC 1DP0A 1YCIA 3WNNA 2WFPA 3ECQA 3M4FA 4CUBA 3WF1A 2VG9A 1T2XA 1LEDA 2FDFA 1N1SA 2BFUL 1T6BX 1I9RA 3OPWA 3WNKA 1W2OA 4LBQB 2WNUC 1W8ZA 4YVSC 4LBQD 1W8TA 1UN1A 3P3PA 4OI2A 4B4PA 3IDAA 1DF0A 2RDSA 3KVBA 3CMGA 2MEV3 3V65A 4FPYA 2BNMA 1CZSA 4WM8B 1NCQA 4IE4A 1RIRA 4DNYA 3PTRB 5ISLA 1OVPA 1JYCA 4A2UA 2VE1A 4AVTA 5GZEA 4ISQA 3T09A 3WDXA 3LB9A 2ARBA 1AUYA 2P3IA 1SZBA 1DQ2A 1LNSA 2EIBA 2VOTA 4HMZA 3NVCA 4PLOA 4CXYA 3Q8EA 4RQPB 4E2SA 2R0FA 2IXKA 1R64A 2BGPA 2JDKA 5FK8A 3K77A 1HRV2 2HEVF 4URTA 4B8EA 2CGPA 5JOWA 4CXWA 5IVCA 3OGSA 3CLPA 4R4XA 3K3NA 4A6SA 5A3TA 2VM9A 1TME3 3FLRA 3I7DA 4Y20A 4Z82A 1YQ8A 3B9IA 1OKOA 4FOYA 3BPSA 4E9KA 2XWBB 2ZXQA 3EMRA 3ZR5A 5SV8A 1HLCA 4OHZA 4AHYA 4P9JA 1AX2A 4HK8A 2OW4A 4RYDA 3OCPA 4IGOA 3TB0A 4YGBA 1S1AA 1BVVA 1W99A 2B39A 4P5YA 4YM3A 1SBEA 2QE3A 4CDUB 1CAXA 4MHRA 4JRLA 4Y3OA 4BQ3A 4AWDA 2VTXA 4ZONA 3S7EA 3LA2A 3ZXKA 5FXZA 3NJZA 4TLFA 3OUHA 5FWEA 2EXHA 1H0BA 3ZIWA 3O1UA 4UW3A 2XUEA 1ULCA 1BEV3 3J26N 2XJVA 4MGIE 5F6KA 4EROA 5FZ0A 3AVRA 3ACGA 3POIA 3GM8A 3BN6A 1MQTC 2DCKA 2BNNA 4FPLA 3AFGA 4IV1A 4XEZA 4JGZA 4QM8A 5IFPA 1V9U3 2FMDA 1ND3A 4QX3A 4FOWA 1GMMA 1W04A 5FZIA 1JYIA 2VNRA 1OA3A 3IWZA 1UPSA 2DUQA 4JTNA 4XOGA 1S0DA 1QJU2 3LF7A 5DAWA 2WO7A 3PU3A 5K4LA 1QKQA 3VHOA 3DGTA 2QZ3A 3HEIA 4LT5A 4E8DA 1D0GA 1IQDC 1G9DA 4QQLA 2RV9A 4CDWB 2R072 3SCFA 5FZHA 2DTYA 5J36A 5FZMA 3OUJA 2D5FA 2P1BA 5CIRA 5FRAA 4XAEA 2UWBA 4QPWA 1W9TA 2PN5A 1D2QA 2VOWA 3WNLA 4ORFA 2VXRA 3M2MA 4IERA 4FI9A 1AR82 2HWB1 3WW1A 1RUD3 5F5AA 2YUEA 3ZPYA 1IG3A 1QH6A 2VECA 5KBFA 2ZMLA 1QEXA 2VC9A 1UY0A 4NPLA 5JLVA 3U75A 3AVSA 1NZIA 5E88A 1WMEA 3RZZA 4Q0UA 4I2OA 2E6VA 3ZKYA 1XE7A 3D3AA 3QLQA 4FOVA 4OI4A 4COYA 4MGTA 3ATGA 1VALA 4IV3B 2RS52 4LBQA 1HKDA 4XUTA 5IVEA 1VRH3 5EP9A 1QJX2 2XQXA 3C2UA 4DB5A 1EAH2 1H2LA 5APAA 4WBBA 4UFHA 5FP9A 2X09A 2YB7A 1WLTA 4F7ZA 2WBKA 4ES8A 3NNGA 4GZ9A 3WNXA 4QPIC 3GDBA 4E8CA 1CX4A 1FI2A 1ULOA 2O8OA 2PHTA 2RR12 3GALA 1IG0A 3VBRB 3B93A 4P00B 5KHKA 2RMU3 5FO7B 3BUCA 1X7NA 4BQYA 4CCJA 2F4LA 4Q4Y3 5JZGA 3D8CA 4ZXKA 1AYM2 3DPRA 1ENSA 4LUMA 2R1DA 1C1LA 1QJY1 3ZFEB 4EN6B 4Q4V3 4RD7A 1GYKA 1U5IA 1EYBA 3N9OA 1JHJA 3VDCA 3GYDA 5CFCB 4YW5A 1SLBA 1ZZBA 3PUAA 4FXKB 1RUI1 3I3DA 1QQP3 1RITA 1ZYBA 3HNMA 2VZQA 1SLCA 1DBNA 3ACIA 4L9BA 4XVHA 3ZO0B 5FKCA 5KXCA 1C28A 1IHMA 3FZ3A 1BK0A 3WR0A 4BQWA 5K8SA 4Z1VA 1H2KA 4D3WA 3OBTA 5IW0A 4RHV3 3PVOA 1YI9A 4UW4A 2PYTA 2VNVA 1YXWA 4BIFA 3U0ZA 1VLNA 1O3RA 1DCSA 1NYWA 5HCFA 2KM2A 2P6CA 2JWPA 3RYPA 4COVA 3RYRA 2EALA 3PVNA 4C90A 2BW8A 1KXGA 1S0FA 3AZXA 3CJXA 4R9BA 1S0CA 2Z5WA 2TBVA 3ZOIA 2PMWB 3I2DA 2HH9A 1HQWA 3RG0A 2ZHKA 1AR61 1POV3 1YQ5A 1WZXA 3USSA 4YSFA 2WFF2 1PM4A 4FOQA 1SBFA 2ERFA 5L9RA 2IFRA 1W8NA 3CZJA 5LBBA 4CU7A 5C71A 2VOKA 2RS32 4KU8A 4D6SA 3VKLA 4ZKTB 2ZGOA 3I54A 4OHXA 5FZ1A 1YIFA 1R091 2VMDA 3RWNA 1Y9MA 3H42B 3KHBA 3T4VA 2DUPA 4S2DA 4XFAA 3VDAA 2RM22 1ZREA 1HQNA 4DEQA 3ST7A 4GMP3 2D6KA 5A1FA 3C7GA 3RRDA 5CA6A 2G9GA 1FOD3 2XLGA 4CDWA 4DRVA 2W9XA 1ZBA1 2HBTA 4YW4A 3MPPG 1XU1A 1OFSA 5JOYA 4C8DA 4HSLA 1IKPA 1JXNA 4OULA 4BJ0A 4QWNA 1L7QA 2GMEA 4CCNA 1DLLA 5FCCA 5T54A 2JDMA 2VZTA 3VZLA 1QGLA 2WZ8A 2YMZA 1OF4A 4DRRA 3LEMA 4FAGA 1H9WA 5I0RA 1HXS3 5A6YA 3I3EA 5IVFA 2XMLA 1LRHA 1RHI3 3BOPA 3EBRA 1COV1 1PGW2 1LENA 5FYBA 1R081 5A7WB 2EXKA 4EN9B 2AYHA 4QKBA 3B02A 4UF0B 5FY5A 3SKJE 1JZ3A 3OGRA 5GZGA 1TME2 1YRZA 2BWAA 2ZGSA 4BISA 1UNBA 4IV3A 1V6MA 2CDOA 1LU1A 2VBDA 4Q4W1 4EV0A 5DDJ3 4YZ2A 4PIZA 4ARXA 2X5IC 1CAWB 1IZ3A 1IS3A 1ZBE1 4CRQA 5I93A 4IEYA 1HRI3 3WDTA 2R063 4BZ4A 3AXEA 3WSOA 4CXXA 5C70A 3VZOA 4BK5A 1C57A 1JYXA 2VGDA 4XCAA 1SCSA 4CPBD 2ZACA 4LBMA 3B94A 2Z4FA 4PDWB 1V70A 4ES9A 2BWCA 4OUSA 3HT2A 3VBRA 2F6BA 3LGRA 3RI8A 4FSJA 2AEYA 5KXDA 1D0HA 3B69A 2EXJA 1DG6A 1Q8VA 3I97A 4FCAA 1W9SA 5FZ3A 2WN3A 3D82A 3THDA 2WWJA 5FQ0B 5FP7A 1M4WA 4COZA 5LK7B 1K3IA 4QXKA 1LU2A 1S0JA 1Z0HA 2J1RA 1CJDA 4WM8C 5FYVA 3O1RA 3GJBA 1Z7S3 4J6GA 1KITA 2K0GA 2BVVA 5C3PA 5CFCA 1LGNA 3IIIA 2QBXA 3PJYA 1C4RA 4DXRA 3PJQA 1PX3A 1V9U2 3DYPA 4LHNA 5A32B 1PZ9A 3ZR6A 4WV8A 4FTEA 4QX0A 4RQPC 3SXWA 3KWVA 3OTFA 1GOHA 1YO8A 1UOFA 3JXSA 3RWKX 5I91A 3LIGA 2OUHA 2Y34A 4L8QA 5FOBB 1PGL2 2Q1MA 1UU4A 1PZ7A 2LROA 2AC1A 4GWMA 3OGGA 1OVSA 4BA6A 3MO4A 3A21A 4A3XA 4DY3A 2XJPA 3CIHA 4XTPA 1ND2B 1RUF1 2BJSA 1U5XA 3BODA 3LPFA 4MADA 4PLMA 3W59A 4CCDA 3AZYA 3SCHA 3AMHA 3UT0A 1J3QA 3A4UA 4MUVA 2G4IA 1LR5A 2CNAA 5A1LA 4YM1A 1YQ2A 1OKQA 4CDUC 2R7EB 4HPKB 3IKWA 4XDQA 2HWF3 4RS5A 1JN2P 1Q43A 1KS4A 4AI1A 4GWJA 3UNPA 2ATFA 3SLIA 4FO9A 4YARA 1AR91 3W21A 3IDEA 4BXFA 2P3YA 2ADDA 4JC1A 1C8M3 1YEWA 4H55A 2C9KA 3BB6A 4M3CE 1D4M3 3WEZA 3TN93 5CNAA 1NKGA 1OMIA 1WUVA 1Y4WA 3CKHA 4XJ9A 5FZ4A 1AL22 1ZZ9A 2JKXA 4NJ4A 2EF6A 2A6VA 2PHXA 2PHRA 3H8XA 3VZKA 3IAQA 2ZOEB 3MHZA 4K20A 2QQJA 4IESA 3O7OA 4DOUA 2WA3A 2YBSA 1FXZA 5DUVA 3E97A 5E89A 1RUH1 3POEA 4H7LA 1PVC2 4XJWA 4B29A 4QQPA 5C4WB 4MX3A 4QU1A 1W05A 1UXZA 4YRDA 2RMU2 2VCAA 2O8QA 3POBA 4CP9B 3VL8A 1XE8A 4Q4Y2 5FOJB 1HJFA 3WQ1A 4IQPA 2DCTA 4A44A 5A7WA 3KV9A 1V6NA 2BNOA 3TNPB 3DKWA 3O14A 4Q4V2 5JOZA 2XPJA 4GA9A 4JGYA 4Y4RA 5CADA 3LDBA 1LB2A 2C24A 1O3SA 1ZRCA 4D0QA 4LKEA 3NNJA 2QFEA 1QQP2 3AM2A 4GH4B 4OMDA 4U36A 3K3OA 4UFIA 4OI1A 1CAWA 3WP4A 1OLMA 2ZTNA 1HQLA 1UKRA 4PLNA 1F9KA 1F2NA 2D6PA 3A0KA 3KQRA 4LO8A 1MS1A 3DCQA 3MF6A 3JBG3 4CCMA 3VZMA 4CPBA 1MS4A 5C9AA 1TQ5A 3J8F2 4YWAA 2I74A 4RHV2 5BNPB 2P5BA 3RZKA 1C3HA 2ZMNA 3FX3A 2BOJA 4PDWA 5T5LA 3WF3A 4QQHA 4RN5A 2FD8A 5BNOA 2Q8OA 3DXTA 2EVXA 1HRV1 2IVJA 5GM0A 3D4KA 4URAA 1GZWB 2QZ2A 2XKOA 3IIAA 3M3OA 5CAZA 3T0DA 2ZCWA 3AMNA 2AENA 4MGQA 1MVEA 1ZA4A 1FPN1 1CIWA 3FLTA 3MEPA 3NJXA 5LA9A 4B4RA 3BKZA 3BTZA 1LODA 1PIV3 3AKSA 1OBNA 3RZMA 4GAZA 4IEWA 3GF6A 2I2SA 1V6OA 3IZOA 2XB6C 4PHZA 4Q27A 1VP6A 5A32A 1OHFA 4BPZA 1JU3A 1VJ2A 4CEYB 5GLUA 2Q8DA 4XHXA 4J1XA 2BV4A 4GWNA 4QGNA 4M00A 3T1LA 3WF4A 2GC0A 1YWKA 4GJYA 5FZAA 2OVUA 2XL7A 3RYKA 3ZFEC 5DAPA 2BFUS 2PLV2 5LB6A 1KS5A 4JTOA 1S0BA 2JDUA 1J3RA 4XE9A 4NWWA 5A3NA 3L2YA 5FXVA 5FFOC 2ARAA 2VZVA 2V5YA 3R4DB 2UYAA 3M3EA 1JYWA 1X33A 1XNAA 2VCCA 5JDBA 5C3RA 5J96B 3DKQA 4NPRA 3H9AA 2D7FA 5HI0A 4XQDA 1I3HA 4QXCA 2D6NA 4HPKA 3FMGA 1RHI2 3KGLA 2V73A 2A5ZA 2XQRA 2ZABA 2VCMA 4QQOA 5KC6A 4JKKA 2VZOA 4MGYE 3SKVA 4QDQA 5LBEA 2XDVA 2Y6KA 5G04L 1VBB3 1WKYA 5DZGA 1QJU1 5FBJA 1V0AA 2A6YA 2YFZA 2VY0A 4WVZA 1O3QA 3IN9A 1K5MB 2XG3A 1UQXA 2D6MA 2R071 2P3JA 3WW3A 2RVAA 4A45A 2JDZA 1PO13 5JI9A 2Y0OA 4D7YA 3EO6A 3ZSJA 1HRI2 4A3ZA 2R062 4DUXA 1UOJA 1HB1A 3VD9A 1TNRA 2QQWA 2IXJA 5JMOA 1VMJA 1AR81 1RMU3 2VBPA 4H3WA 3H8OA 2W91A 5FPUA 3AP7A 4DY5A 1KFUL 3R4SA 1DZTA 3HVDA 2WS93 1GZ9A 3LPGA 5C4WA 1QOSA 4K8RB 4GALA 3MFCA 3NJYA 4H14A 3KF3A 3ZXAC 2ZJCA 2WNOA 2GAUA 4TXWA 3AZVA 3N36A 2E7QA 1RJ7A 1UMIA 5FAXA 2CL2A 3POWA 1IOAA 1JOJA 1Z7S2 4M0NA 1FMD3 4LK6A 3KMHA 1NZCA 4Z07A 2YPDA 4LO7A 1QJX1 5FP8A 4BMBA 1OSGA 5I0DA 1EAH1 2F4PA 2WDBA 3SCGA 1UPIA 3HOBA 2VW0A 4WZCA 4V1PA 1W6MB 1ZZ8A 1CIYA 4XUNA 4QPGC 2X10A 5T3NA 3I3QA 3CDZB 1PHMA 2J1SA 3RFRA 1PM7A 3MZHA 2W1UA 4BU2A 5ANNA 3GJAA 2RS13 2KA3A 4DO0A 1RUJ3 3K46A 3O5SA 1YI7A 3ZSKA 1DZRA 2RR11 5LY2A 4FPCA 1J1TA 4AVCA 3OBZA 1JH5A 3WF0A 2J42A 2LRPA 3JZVA 4DINB 2QVSB 2W95A 1SLTA 3N7MA 3E5QA 3LFIA 4E4ZA 5FKBA 2W3JA 5I0UA 5IVVA 1UO9A 2WYFA 2VO5A 4OMCA 3VDDA 1OQEA 4QU2A 4LOSA 4MSVA 2CV6A 3L9JT 4BQ1A 4NIGA 4GQ7A 2ZGLA 4AI2A 2CAUA 5FZGA 2HWF2 5HCAA 1PMIA 3CL1A 5FMDA 2R042 3WW2A 4Y24A 1IS6A 1RTVA 4Y20B 3PU8A 1C8M2 4N8MA 1D4M2 5B4NA 4N9IA 4QT6A 5JOXA 5IFTA 1GP6A 1WW7A 1K42A 4QX5A 1JZ7A 4RGAA 4X8NA 2XXZA 4MYEA 4GB33 4JDNA 2B4KA 1XPWA 2H6CA 1UZWA 2JDNA 2YC0A 3J7HA 3JB8A 2HWE3 3P1IA 4I0AA 4UW6A 4WZFA 1B09A 4J25A 2A3XA 1WMFA 2X8KA 2FDHA 1L3JA 3VD7A 1OOPC 2YGMA 2WFF1 2C26A 1TMF3 2YBPA 5C3SA 4N90A 2RS31 4F8AA 1RUG3 3TWIA 1B35C 1URXA 1LHOA 1ND2C 2A75A 2ZS6B 3CJIA 5A3WA 4YFZA 2FHRA 2RM21 4AGGA 4IV1B 3GNEA 2A1XA 4JGZB 4K40A 4M0HA 1A6CA 1ZZCA 4S2FA 1ND3B 3AX4A 4PIYA 5ANQA 3QH6A 1EV13 3ZYBA 1MEC2 1VBA2 4P9WA 5FWJA 3N7JA 5A6QA 2XVLA 4R9AA 1E5HA 1VAKA 4NAMA 5C3OA 5IVBA 3HPNA 4MGKE 2WRAA 3WG1A 3WLUA 1JS9A 5HCBA 5FY7A 1RVF3 3OPTA 2BOIA 3ALQA 3WUCA 2EIDA 3O0VA 1BCXA 3OY8A 4ZU5A 3HQXA 1US3A 3VN4A 1X8EA 1PGW1 2D40A 2LALA 3EB7A 4GKYA 4O7XA 4Y1XA 5DN2A 1O4YA 2F17A 4Y5TA 1NY71 1VIWB 3WG2A 2R1BA 1G6NA 1NCRA 4AI3A 1TME1 1BBT2 4LXLA 5IJRA 1XSRA 2WO1A 2UY8A 4S2HA 4BE3A 4YZ3A 3B5LB 2Z69A 5C4WC 3ZDVA 4OFGA 4XABA 1GWMA 4AEKA 1KGYA 5FLJA 3VZJA 3KCCA 4Z2AA 1W6MA 2XJSA 4HXCA 5BUVA 3I2IA 4LULA 1VMFA 4JZRA 4XBQA 1LAJA 1OD5A 2A7AA 5IWFA 3WNMA 4K6BA 4R52A 1POQA 4D7SA 1A8MA 1AX0A 2X53S 5IK5A 1H2NA 2O0OA 3OBRA 3MI8A 4I01A 4ZZ5A 2W1QA 2ZX3A 3AL6A 4LBNA 5JUVA 5L7OA 3IBMA 4Q29A 4QKNA 5A7NA 2ZX2A 4GH4C 1PO23 4LO5B 2E7AA 3W9AA 3ZSLA 2YZ4A 1GICA 1LTEA 2VZRA 3WXPA 3TYJA 1NQDA 1OXCA 1QDOA 1PMJX 4XACA 4CUGA 3KQ4B 4NMIA 2NZ9A 2QDNA 5A3PA 4NRMA 4D8MA 5IK4A 1DGRA 1UIKA 1ZRIA 2HKXA 2PTMA 1LOBA 2WR9A 3M70A 3ZLIA 5BNPC 5I0SA 5J1XA 3EXUA 2WZR3 5JZGB 4B1MA 1OH3A 1VMHA 1WCKA 1PNGA 3DPRB 4FFGA 1X8MA 3HN3A 4DZGA 4FPHA 2ZEYA 2RG4A 2NMNA 2AZ5A 1CD3G 5IT6A 4AF9A 1VBB2 1Q8OA 3I3BA 5ACA1 1J1LA 1RL3A 4BQ4A 1I1EA 4Z8BA 4KU7A 3AZWA 1PGL1 1JUHA 5KHIA 1F4AA 3ZXGA 2HYKA 3I4IA 3KLSA 3GZTB 4CDXA 2Q1FA 4NAOA 4QGMA 3MLKA 3C3VA 1PO12 2HYXA 3A22A 4FPOB 5BNNB 1RB8G 1E5IA 3H7YA 4Y5SA 4LBKA 4C0HA 1MS3A 1MZ6A 1YHFA 3Q8CA 1F15A 1JMUB 1GOFA 2DYCA 3PHMA 4I3PA 4CEYC 4XHBA 4IE7A 3UV9A 4FQ4A 5J48A 1RMU2 2DBNA 3LQCA 4E4SA 2AR6A 1KRIA 5CG8A 5C33A 1UYXA 2AGSA 2UU8A 3EQEA 3ZYIB 5C8CC 4OZXA 5C8WA 5JXGA 3PMSA 4CP1A 4XQWA 2RDRA 5DXDA 1GANA 5F6LB 1T6GC 2OT7A 2ETEA 1W6OA 1Y7BA 3H7JA 3WG3A 4D6QA 4XBNA 5FPAA 1QWRA 2ADEA 2DDUA 3HBZA 1DIWA 3MPBA 5JVVA 3UL2A 3ZN4A 4EYUA 4XFBA 2HLEA 3P5BA 5J7MA 3SEPA 1FMD2 1XYNA 1JYTA 4AVBA 4BHPA 1X82A 1O4ZA 2TUNA 2B45X 5GZDA 5A7QA 1AL21 1WD3A 4MGSA 1IPKA 3PUSA 4QB2A 2J1AA 2VQTA 3LCPA 1W03A 1CPNA 1ZRDA 1CAVB 2IZWA 2FDKA 4XETA 4K1YA 4WVVA 3I2KA 2W46A 3JUUA 3GZUC 2NLRA 4Y1ZA 2RS12 1RUJ2 4E4DX 1OC1A 2P34A 4AFBA 2CSGA 3O1VA 1PVC1 3ZFFB 4YZ1A 2ZAAA 4LLOA 1K5MC 4LIUA 4LBOA 3B00A 4AGRA 4Q4Y1 3HT1A 1GWKA 3WVJA 3KCYA 3KV4A 2BGCA 5FV3A 4CCOA 3N35A 4HT1T 5T52A 2R0HA 5E6HA 3KGZA 4YG3A 5FXXA 3VHPA 2Q8CA 1BK1A 3WQ7A 5B2GB 2NM1A 4HK9A 3AKQA 2B5HA 5FP3A 1K45A 1QQP1 4AHXA 1UMZA 3AYCA 1H8TB 3BPZA 3RJ2X 1DYOA 1Y3TA 5F32A 4FBFA 1K5JA 2VBBA 4LOTA 4Q2FA 1TNFA 2QQOA 2ZX4A 2CTVA 3J8F1 2DWRA 2CGNA 1MPXA 2FCTA 2NMOA 2VQ0A 2Z2SB 1JW6A 2EAAA 2GH8A 1IGOA 2ORZA 3ZYHA 2JX9A 2W08A 1HJGA 4Y1UA 1IS4A 3JQXA 3M7AA 4GB32 4LTAA 4UYBA 1V00A 3MW3A 4HVQA 2IXIA 4I3GA 2GMMA 2Q30A 2RJLA 4LLFA 5CFDB 4HSJA 3TEYA 3PUQA 5FZFA 3BVCA 2HWD1 1VB4A 2D3RA 5EWSA 2V4VA 3H1YA 4UT5A 2G9ZA 2JG9B 3KT4A 2QQKA 3LE0A 5HXVA 1F35A 2OZ6A 3ON7A 1IQAA 1GKBA 3SISA 4AOCA 4DUVA 1O3TA 3ZPOA 3MIEA 1V6LA 5JI7A 3RDIA 4XXPA 1NCQC 4AQ6A 1M06G 1WBFA 3K4ZA 5BNQA 3HBKA 3B01A 1J59A 1HB4A 2PQQA 1UZZA 1WMDA 2E53A 4Y5Z0 1I5PA 3NRUA 5CKQA 4DQAA 4YG0A 2PLV1 2ZGRA 2Y8KA 2B9VA 2NN8A 2AUYA 1EV12 5FDBA 1KEXA 3MYXA 5C6CA 4XBLA 1RUE2 2HWC3 4P9LA 4WM7A 5BNNA 5F9TA 1DYPA 2JDPA 3AZZA 3H8UA 2JKBA 2WQZC 4RR3B 2HWB3 3ELNA 4YVWA 4C0BA 1IPJA 3OGJA 4HFSA 4OHYA 2WNEA 4LE3A 1XNDA 1UOBA 3FBMA 3HNYM 3LA3A 1NAEA 2WKKA 3NAPA 1ENQA 2ENRA 2FQPA 1YYNA 3E5UA 1SFNA 4WVMB 5F7UA 2W2IA 2ZHMA 4INDA 1O6UA 4LA2A 5D8AB 3C7OA 5EJ3A 4QGLA 4ZZ8A 3K51A 3H3ZA 4DMIA 4META 4QAWA 3WDVA 1A3KA 1F31A 3UETA 5AFEA 4RFT0 3ZSEA 3OBAA 4N7UA 2JB4A 2DU0A 4TLGA 3UKVA 1N1YA 5FO8B 2WQ8A 4Q0QA 4RS5B 4XFFA 4DFSA 3NV1A 3U1XA 1W2NA 4AEMA 2WIIB 5T50A 1JYNA 4PI2A 3KB5A 2WLPA 4CEWA 3APBA 4D7TA 3I49A 5F39A 2XLFA 3J9SA 1HRI1 1CAVA 4IEVA 4P9YA 4COWA 2VULA 5A3MA 4B1LA 4XF3A 3USUB 4QKDA 5D2AA 2QQPA 1TE1B 1LEMA 2XVKA 4XIKA 4XMIA 1YQ6A 1NQJA 2G19A 3LKJA 4IV1C 2MEV2 3DUIA 3IPVA 4JGZC 3ZFFA 2QQMA 5FK7A 1ND3C 3E1F1 3GZAA 5F1RA 1DGLA 4OHVA 1SLIA 3RZLA 1W2AX 1EPWA 1MVQA 1UX7A 1XB9A 2OZJA 4IEXA 2L9LA 4YW2A 4DEVA 5I0TA 5EHDA 1QJY3 2AREA 3O0XA 5FY0A 3FWEA 4BXSV 4B3NA 4LJHA 1AYN3 2XVGA 1RUI3 3R6SA 5DABA 1Z7S1 4EN0A 4AEDB 2VU9A 4ZY9A 4XUPA 3THPA 3RS6A 2VOXA 3Q8FA 4N43A 1WA4A 1WW6A 2WZR2 4RA0A 5LWBA 1NLQA 3LSEA 2D6OX 1H8TA 4Y1YA 4P14A 5DQ0A 4CUCA 5K9YA 5BXXA 1YC61 2A6WA 4NE9A 3EJKA 3PTYA 4JGYB 2XLAA 1MZFA 2AACA 2YROA 3KM5A 3NNLA 5LA0A 4HONA 1S0GA 1WD4A 3KSCA 3AXDA 3C8XA 3NMBA 2PHLA 4Q5OA 1MS5A 1O8PA 5FZ6A 2E31A 2YBKA 3RJRA 1XNCA 4CSWA 1GZCA 5F37A 1YNAA 2YFUA 3DL3A 2QQLA 2JG8A 3RZJA 4XW3A 4MO3M 4XAAA 5LY1A 1QIQA 1PGSA 1DU3D 3VB9A 2XJTA 2V09A 5D1IA 1G86A 5C9AB 1ENXA 2VVDA 3SITA 4C91A 5HCHA 2W92A 3CHXA 1FNZA 2ZGTA 5L19A 3AFKA 1AR63 5FIXA 5CFDA 4XDPA 1W6PA 3BTAA 3FUOA 3KVAA 5JSRA 4NHKA 4PBOA 2DBIA 4PQQA 4TWTA 4UBGA 4Y22A 2JD9A 1DZQA 4W4ZA 5J37A 4JRAA 4ZS3A 5BNOB 1KJRA 4ASMB 4HN0A 4QHZA 5JPMB 2JG9A 3KV6A 4FPGA 5HV0A 2HWF1 1LOAA 5IK8A 1BEV2 1R1A3 1R093 1LOFA 1W8FA 2R30A 2JB8A 1G7YA 2H0BA 1UD1A 4GKXA 2CDPA 2R041 5JAXA 2UYBA 4XFCA 1NE6A 4O9EA 1RJ8A 3QCWA 4U2AA 5A1AA 1W0OA 5CG9A 1ZBA3 1C8M1 2WSUA 5FY8A 4Z2WA 1QJZA 4Y33A 2FZ1A 2VZ1A 2XJUA 4IE5A 3VBFA 4AHZA 4Q8KA 4XCBA 5LZ6A 3TRSB 2VUAA 2VQAA 4CCLA 5JMCA 1VBD3 2VMGA 1SLAA 1GR3A 5JZGC 3AC0A 3ZXJA 3H0OA 2GNTA 4IEUA 3DPRC 4RR3A 4OUEA 1U0AA 2DVBA 1AR71 3BALA 5IUQA 4AGVA 1CQ9A 5JCTA 1HB3A 1VR3A 3FHIB 4AQSA 2NQYA 4FPFA 4SBVA 1WLDA 4WVMA 3VBHB 2KXLA 1COV3 4LO6B 1DHKB 1QJEA 5D8AA 4IW3A 5CYYA 4ASKA 1J84A 2D3SA 1H1AA 3ABZA 3TNQA 3ZXDA 3AKPA 1PVXA 1RUD2 5F5CA 2JDAA 2B7YA 4GULA 1X50A 2W68A 2BBVA 1F5JA 4Q4W3 5FTTC 1D7PM 2VH9A 2Y6LA 2YU1A 4MXVA 1PK6B 3UJQA 3W5MA 5EIYB 5AVAA 3HD8B 2W87A 5EPAA 1ZBE3 3LIHA 3N3HA 3MFAA 1MEC1 1VBA1 2YV8A 3N7LA 1HIXA 4KG8A 5LRRA 4OYUA 5LEKA 4NIDA 3JD73 2XHNA 3S5AA 4UFLA 2Y60A 5FJHA 2SBAA 2W47A 4HKOA 1VRH2 4YZ4A 3USUA 2BYVE 2E33A 2VZSA 2XGXA 3K2OA 4L92A 5IK7A 2H0VA 1OI6A 3QD6A 5LK5A 4KWLA 3FC0A 1QMJA 2VQUA 3WCRA 3WF2A 1W2UA 3VZNA 3WP5A 4BQ5A 3NNFA 3I2JA 1LGCA 3KT7A 4AK3A 1QH7A 5HPOA 3VBUA 4YGEA 4BYYA 2E51A 1CESA 4E2GA 1OLRA 4CDWC 1V6IA 3T08A 4AEDA 1BBT1 3NL1A 3GGLA 4BOWA 5AFBA 4KBZA 5IYYA 3VUOA 1RXGA 3AYDA 4CVUA 1E5RA 3ZFFC 3I3MA 3WDWA 2PQSA 1IKQA 3Q8BA 1REFA 3Q9OA 4XF4A 4FXGB 1ODMA 2GU9A 3IMNA 3W58A 4SLIA 5GLTA 2FDIA 5AC93 1NE4A 1I6XA 5GZCA 3GXUA 4UAPA 5I8SA 5GLVA 2XL9A 2ARXA 3ZMNA 2BQPA 2TNFA 4PF1A 3UJOA 2OQ6A 3MICA 4HETA 4NO4A 3WD5A 1AHSA 2HWC2 3OB8A 3VV1A 1CR7A 2RDNA 3NJVA 2RHPA 2HWB2 3VBOA 1SCRA 2WNUB 4YVSB 2BRTA 1W6NA 3AP5A 3FFQA 4IV3C 2Y6HA 4O65A 1W2TA 2ZX1A 3M1HA 4H2AA 3RSJA 1OD3A 4DS0A 2GNMA 3E6BA 1DYKA 2EIEA 4CP0A 3FL7A 4ONUA 1AR93 2CGOA 5SV5A 2J1TA 5LBFA 1YJKA 3WT3A 1GUIA 4N53A 3VDDB 5LEJA 2CAVA 1JU4A 1VBB1 2QUOA 5LASA 1UU6A 2WAAA 2VVFA 3E5XA 4COUA 5CFDC 3VBRC 1EUTA 5L36A 3HJRA 1K12A 3TEXA 2QQIA 3DN7A 1BZWA 5DZEA 2OIIA 2TEPA 3IB3A 3FFZA 3VKNA 3E6CC 5CB7A 2JECA 2Q5TA 1FOD2 1XNTA 1RUH3 5E8AA 2GSYA 4CDQA 2BPA2 2VMHA 5AVPA 1RMU1 1U5ZA 2J22A 1J58A 5CFCC 1BMV2 1JBCA 3VHNA 3VBHA 3WQ0A 4NIIA 4UWDA 4AHWA 4LMFA 4FFHA 3CQOA 3GHMA 3MUY1 3T2PA 2B46X 5JXJA 3WHUA 4E2QA 1VBC3 1HX6A 4YW7A 5JSOA 4V2VA 2FCVA 4KWKA 4NIAA 1BQPA 1HXS2 2LW8A 3AKRA 4LKDA 3MV11 4HZFA 1AYN2 1DFQA 2D6LX 1QNYA 3QBQA 1XOYA 2GC1A 5H9SA 1PK6A 1FMD1 2ORXA 4P9IA 3S5QA 5H9QA 4XJ8A 3CJIB 4PBPA 4S2GA 1D2SA 4Q26A 4QHBA 3VBSB 4OVEA 3MIDA 1JUIA 1SLLA 3H1WA 4JX0A 4NUBA 5FUPA 3ZYJB 3TEZA 3OD4A 4YM2A 1MQTB 2VL4A 2BTVC 3IDCB 3CU7A 5CBLA 2B9UA 4CCEA 4P5HA 1OA4A 4PIXA 5DDJ2 4HBNA 2P17A 4MV2A 5CU1A 3HN1A 3ACLA 4YM0A 3OF1A 3IAPA 5EYYA 4RS5C 1C1FA 1OPOA 4Q8LA 3K75B 4P9GA 3G6JB 3MLJA 2ZGUA 2ZGKA 1UY4A 2B42B 2VTXJ 2YU2A 4I09A 4EN8B 4M4RA 4BCUA 4TN7A 3LA7A 1FPN3 1STMA 3PVEA 5A3LA 1HN0A 2P37A 3JB4C 3ETPA 2WT1A 3OY8B 4AXOA 1W8WA 4CU9A 1GV9A 3FJSA 1F4HA 3AP4A 1O91A 4NWVA 3AP9A 5A70A 4X8PA 1GLHA 1R1A2 2UURA 3VD4A 2G9FA 1OFNA 1W6QA 5FPVA 1NCRB 4IEOA 3OSDA 4UW5A 3A23A 1P8JA 3OYWA 1HB2A 4C1XA 1ALYA 1CZVA 3MIFA 5F2WA 1UYYA 2RS51 4IGPA 5FYIA 3S7IA 2Z42A 3D0SA 1UKGA 3D0JA 3ZYPA 3ZFGA 3TAYA 2QNKA 4EZ4A 2A6XA 1O5LA 3H1MA 4IEQA 1ULGA 2E26A 4OLLA 1SMVA 4XURA 2P4EA 2Y33A 4KG0A 1W9FA 2DCJA 2VNOA 1VBD2 3ILRA 5FZ9A 5JXHA 4EWEA 4ISRA 3LEGA 1ZZ7A 2ILMA 4GB31 5DG1A 4W6XA 2HEYF 2R6QA 4P02B 2WNUA 4O9GA 1D4VB 2Y6FA 4YVSA 4YZ5A 4L2NA 4JGYC 4QDRA 4OZOA 1ASJ3 2VMEA 5L7OB 5H9PA 5HV4A 1ZZ6A 2WNVB 4AAXA 3U78A 5A6XA 4XFIA 1TEIA 4QPIB 1AYM1 2A3YA 2WSVA 3J7LA 3LEKA 2BEOA 4XUOA 4FFFA 5GZFA 1VB2A 1LECA 1QJU3 3U4SA 2A3WA 2DVDA 2WQ4A 4Q4X3 2R32A 4ZU4A 1LESA 5C9AC 1GSLA 2ZHLA 4PDWC 5A80A 2QTWB 1RINA 2GNBA 1GFF2 1ZBE2 3BGAA 4YW6A 3WX5A 5BNOC 1RUE1 3JD72 3MIBA 1OPMA 3ITQA 3S57A 1EY2A 3I2FA 1RXFA 1AR83 2P2KA 1YIPA 2PXJA 5FR3A 4PI0A 1W06A 3TN92 4AFMA 4P9XA 1OLQA 1Z78A 4FQZA 4CDXB 4AW7A 3BTXA 3MIHA 1ZM1A 2BVBA 5FP4A 4ATEA 3T0AA 1KJLA 3KT1A 5LW9A 4HVOA 5DAVA 1H6XA 1LHNA 3N9QA 3Q8AA 4NHYA 1H2MA 4W50A 5GJ6A 5ABJB 1ZX5A 4HKWA 5C5TA 2IXHA 1ZA7A 4QX2A 5FY4A 2VZPA 2GDFA 4E27A 1I5ZA 1OURA 2ZEZA 4CYDA 3MIGA 1EAH3 4KGQA 5A7PA 3TBDA 4AZZA 1UXXX 2EA7A 1W6OB 3KS7A 1DLCA 1Y43B 1W39A 3VBSA 3DXUA 4NPMA 1GZTA 3SNMA 3CZUA 4JDOA 1MQTA 5AC92 5JIAA 5T5PA 2PA7A 3M3IA 1W3VA 4QMAA 2RR13 3W20A 3GZEA 2Q8EA 3C7HA 1RC6A 4FTSA 5T5OA 4AR2A 1WBLA 1UL9A 2MEV1 2VCBA 3FE5A 4XF1A 1V6JA 3S30A 3JBG2 1PK6C 1XRUA 2W1WA 1REEA 3FN9A 5FUNA 1N3PA 1U12A 1ODNA 5DUUA 4CUAA 5FREA 2YGLA 3OG2A 4BIOA 1TVGA 4G3YC 3I2HA 3PVBB 1UYPA 3N9MA 4DIQA 1J3PA 2I45A 2JEMA 4JCKA 1WW4A 2K2SA 4XFGA 4YG6A 2XBO3 4MLOA 2QQNA 1ULDA 3H50A 4PCRA 4Y1VA 4LIVA 4XJAA 1NXD1 4LNVA 5GKAC 1PIV2 2GALA 4LEJA 1HDKA 2GMPA 5CKMA 3V0AB 4M4PA 1XC6A 1AJKA 1O8SA 5HBAA 1H9PA 2D43A 2ZHNA 3RNSA 4EN7B 3N9NA 3V0BA 3K4AA 3ZYGA 5FZOB 4FT8A 1GQHA 4TYSA 2DV9A 3FHQA 1RUH2 4FP3A 4XFHA 1EP0A 2VZ3A 1GQPA 1Y9QA 2WZEA 5FYHA 3PDQA 4AFDA 1W0NA 4A6OA 2OXBA 2WNVA 3ZN5A 3KV5A 2ES3A 3B9CA 4YGDA 2RS33 1VBE3 3NWKA 3B3QE 4YPJA 1QXRA 5FYUA 3V56A 4LKSA 4QPIA 1VBC2 1BEV1 1BVP1 2QKDA 1Q8QA 4YW1A 1BJQA 5JSPA 3H8RA 2RM23 2BU9A 3OPZA 1JZ6A 2YPJA 5EZWA 2RJ2A 1WLWA 3DF0A 1ZRFA 2A6ZA 1V9U1 2VW2A 5J98B 2OS2A 4FFIA 3F95A 3ZXFA 4FPEA 5IAXA 3QH7A 5K0UB 5I8TA 4KNCA 3BU0A 5F3GA 2PHFA 4ET7A 2BBAA 4MXWB 3ES4A 4IEPA 4Y4YA 3BU7A 4FAHA 4LA3A 1DDLA 3I8TA 2VR4A 1ULFA 2ZA9A 2ZBJA 4A42A 2ZMKA 3GBWA 5LATA 5J09A 3VDDC 1CAUB 3SEEA 1DQ0A 1MS8A 3POYA 4KQ7A 1SHWB 4X6RB 3ACHA 4WM7B 4ZPIA 3WHTA 2R16A 3D5OA 4YGCA 4XYXA 2E7TA 3AMPA 3ENRA 2EIGA 4BLIA 4YVWB 4QB1A 4KWUA 1AVBA 2Y26A 2YHJA 1RUC3 1RUD1 4X6QB 5ABJA 3EYPA 1G8WA 1QNWA 3NAPB 2O14A 5A6ZA 4ZXEA 3FLPA 1FPN2 4XPVA 1YUDA 2GN7A 2WS92 4BH9A 1W3XA 4CCKA 5IVJA 4EQVA 3BI3A 4GXLA 1ST8A 1H4HA 1HV1A 5A33B 1W28A 4QXHA 2PHDA 5EQUA 3RI9A 1RYYA 2C1FA 1NA1B 2LUWA 3ZKUA 1DGRN 5DUWA 2ET1A 1LKNA 3LDKA 2WWUA 4IL7A 4A7ZA 1H8VA 1US2A 3ES1A 4A7KA 4AE2A 2JIJA 3RMYA 1XNKA 4NOTA 1ACCA 1VRH1 4K7JA 3SH4A 3HR9A 1AJOA 1WWYA 1N1VA 1V6KA 3UYJA 4CEWB 3T2QA 1GBGA 4LHLA 2WUHA 4OQ8A 3O1SA 3PIGA 4UXAA 3ZDSA 4CA9A 2KR2A 4I30A 4KI5M 4DXSA 1UMHA 4NHMA 3I59B 3CJIC 3PUHA 4AI9A 4BWOA 3NW4A 3WINE 3INAA 4JHZA 3VBSC 4HVRA 1PMHX 5M0TA 4QHOA 3IPVB 1ASJ2 4EZHA 1S2KA 5D21A 4YW3A 2E32A 1KDKA 2RMU1 2HBUA 3AYAA 4NROA 4Z92B 4LR4A 4Q0VA 4RGKA 2FDGA 3ACFA 5FPLA 4B4QA 1UZVA 3UK9A 5JR2A 4TTGA 2QQVA 5KXBA 1RGSA 3RPQA 2EICA 4LORA 5EXOA 5FY1A 4AQTA 5AC91 1LJ7A 5ACA3 3O12A 5FYYA 4Q4V1 3NQHA 5A3OA 4Q4X2 5KHHA 1LOCA 5FUIA 1OA2A 2Q4SA 4N43B 4FPJA 4PF5A 1S4CA 5J3UA 3V0AA 1J83A 3PIJA 4LBJA 2MPFA 3T0BA 4ZHNA 1YFYA 1UU5A 2DUOA 1E57A 2HWC1 3FBYA 3OEAA 2ZPXA 3HWJA 3QOPA 4LKFA 2XWJB 3MW2A 5GLZA 2FMYA 4XF9A 2BP6A 4RHV1 5FZOA 4F3JA 5KHGA 3DYMA 1EPZA 1NCRC 2WA4A 3AP6A 2JDHA 5FYCA 4NR1A 2JG8B 1SFPA 2X5IA 5FYZA 2VUCA 3MDPA 4MZUA 2DF7A 3O0WA 2WABA 1G9FA 1SDWA 2EXIA 1GNYA 2XONA 2ZGQA 2XH6A 1SBDA 3MUZ1 1WMXA
chains in the Genus database with same CATH topology
1VRBA 4IGQA 4QXCA 5FZ1A 5FZCA 4CCLA 3PU3A 5K4LA 5A80A 5FYTA 5F3CA 2YBPA 5FZHA 5FZ8A 5A1FA 3AL5A 3N9LA 5FZMA 4BXFA 2OQ7A 2OS2A 2XDVA 3RVHA 4UF0A 5A3WA 2W2IA 5F3GA 5FBJA 4C8DA 2OT7A 4D6SA 5FZ4A 2OX0A 2PXJA 4QWNA 4CCNA 4ASKA 4D6QA 5F5AA 5FPAA 4EYUA 5FZKA 5A7SA 5ANQA 5F5CA 5FP4A 5A7OA 4GD4A 5FWJA 2YBSA 5FPBA 4V2VA 5LW9A 5A7QA 3N9QA 5IVBA 3AVSA 5IVFA 2XMLA 3PUSA 2YU1A 5FZ7A 5FZLA 5FPUA 5F3IA 4QU1A 3OPWA 5F39A 5CEHA 5FY7A 5FYBA 5FY4A 3OPTA 4LITA 5A7WB 3NJYA 5FY5A 4UF0B 4CCKA 5IVJA 3LD8A 5IVEA 5A7PA 5A7WA 3KV9A 4BISA 3KVBA 4QXHA 5FJHA 4NUBA 5KR7A 4Y4RA 5FUPA 3K2OA 5FP9A 4LIUA 3LDBA 3DXUA 2GP3A 3PTRB 5ISLA 2WWUA 3K3OA 3KV4A 5FV3A 4CCOA 3N9PA 2YPDA 5FP8A 2Q8EA 4LXLA 5E6HA 5FXXA 2Q8CA 4CCMA 5FY0A 4QX7A 3PURA 2VD7A 3UYJA 4QX8A 5FYSA 5FXWA 2YU2A 5FP3A 2P5BA 4CCJA 5IVCA 4TN7A 4BU2A 5LWBA 5FUNA 3K3NA 4DO0A 5F32A 5IWFA 5FZ3A 5A3TA 4AI9A 2WWJA 5FP7A 5LY2A 5FY9A 3N9OA 4EZHA 3DXTA 5FYVA 3AL6A 4HONA 3N9MA 4DIQA 3PUAA 4URAA 5A7NA 4CSWA 5FZ6A 2YBKA 5FPVA 5F37A 5F3EA 4IGOA 5FPLA 4D6RA 2GP5A 4XDOA 5F2WA 5IVVA 4IGPA 5FYIA 5LY1A 5FY1A 5F5IA 2OQ6A 4GAZA 4LIVA 5IVYA 4CUGA 4EZ4A 5FYYA 5FZDA 4Y3OA 5IW0A 4E4HA 5A3PA 4QXBA 4GJZA 5FZGA 2Q8DA 3PUQA 5FZ9A 5FZFA 3ZLIA 5FXZA 4XDPA 3KVAA 5FWEA 4GJYA 5FZAA 2XUEA 5F2SA 4AAPA 3N9NA 3PU8A 3ZPOA 5FZOB 3KV6A 5A3NA 5FZ0A 3AVRA 5FYMA 5FXVA 5FZOA 3U78A 5FYHA 3PDQA 5FYCA 5FJKA 5FYZA 3KV5A 5FZEA 2XXZA 5A1LA 5FYUA 5FY8A 4V2WA 4Y33A 5FZIA 3U4SA 5FZBA 4HOOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VRB A;  4IGQ A;  4QXC A;  5FZ1 A;  5FZC A;  4CCL A;  3PU3 A;  5K4L A;  5A80 A;  5FYT A;  5F3C A;  2YBP A;  5FZH A;  5FZ8 A;  5A1F A;  3AL5 A;  3N9L A;  5FZM A;  4BXF A;  2OQ7 A;  2OS2 A;  2XDV A;  3RVH A;  4UF0 A;  5A3W A;  2W2I A;  5F3G A;  5FBJ A;  4C8D A;  2OT7 A;  4D6S A;  5FZ4 A;  2OX0 A;  2PXJ A;  4QWN A;  4CCN A;  4ASK A;  4D6Q A;  5F5A A;  5FPA A;  4EYU A;  5FZK A;  5A7S A;  5ANQ A;  5F5C A;  5FP4 A;  5A7O A;  4GD4 A;  5FWJ A;  2YBS A;  5FPB A;  4V2V A;  5LW9 A;  5A7Q A;  3N9Q A;  5IVB A;  3AVS A;  5IVF A;  2XML A;  3PUS A;  2YU1 A;  5FZ7 A;  5FZL A;  5FPU A;  5F3I A;  4QU1 A;  3OPW A;  5F39 A;  5CEH A;  5FY7 A;  5FYB A;  5FY4 A;  3OPT A;  4LIT A;  5A7W B;  3NJY A;  5FY5 A;  4UF0 B;  4CCK A;  5IVJ A;  3LD8 A;  5IVE A;  5A7P A;  5A7W A;  3KV9 A;  4BIS A;  3KVB A;  4QXH A;  5FJH A;  4NUB A;  5KR7 A;  4Y4R A;  5FUP A;  3K2O A;  5FP9 A;  4LIU A;  3LDB A;  3DXU A;  2GP3 A;  3PTR B;  5ISL A;  2WWU A;  3K3O A;  3KV4 A;  5FV3 A;  4CCO A;  3N9P A;  2YPD A;  5FP8 A;  2Q8E A;  4LXL A;  5E6H A;  5FXX A;  2Q8C A;  4CCM A;  5FY0 A;  4QX7 A;  3PUR A;  2VD7 A;  3UYJ A;  4QX8 A;  5FYS A;  5FXW A;  2YU2 A;  5FP3 A;  2P5B A;  4CCJ A;  5IVC A;  4TN7 A;  4BU2 A;  5LWB A;  5FUN A;  3K3N A;  4DO0 A;  5F32 A;  5IWF A;  5FZ3 A;  5A3T A;  4AI9 A;  2WWJ A;  5FP7 A;  5LY2 A;  5FY9 A;  3N9O A;  4EZH A;  3DXT A;  5FYV A;  3AL6 A;  4HON A;  3N9M A;  4DIQ A;  3PUA A;  4URA A;  5A7N A;  4CSW A;  5FZ6 A;  2YBK A;  5FPV A;  5F37 A;  5F3E A;  4IGO A;  5FPL A;  4D6R A;  2GP5 A;  4XDO A;  5F2W A;  5IVV A;  4IGP A;  5FYI A;  5LY1 A;  5FY1 A;  5F5I A;  2OQ6 A;  4GAZ A;  4LIV A;  5IVY A;  4CUG A;  4EZ4 A;  5FYY A;  5FZD A;  4Y3O A;  5IW0 A;  4E4H A;  5A3P A;  4QXB A;  4GJZ A;  5FZG A;  2Q8D A;  3PUQ A;  5FZ9 A;  5FZF A;  3ZLI A;  5FXZ A;  4XDP A;  3KVA A;  5FWE A;  4GJY A;  5FZA A;  2XUE A;  5F2S A;  4AAP A;  3N9N A;  3PU8 A;  3ZPO A;  5FZO B;  3KV6 A;  5A3N A;  5FZ0 A;  3AVR A;  5FYM A;  5FXV A;  5FZO A;  3U78 A;  5FYH A;  3PDQ A;  5FYC A;  5FJK A;  5FYZ A;  3KV5 A;  5FZE A;  2XXZ A;  5A1L A;  5FYU A;  5FY8 A;  4V2W A;  4Y33 A;  5FZI A;  3U4S A;  5FZB A;  4HOO A; 
#chains in the Genus database with same CATH topology
 3GBG A;  3DEC A;  4IGQ A;  3AJZ A;  3KHC A;  4IDZ A;  2HWE 2;  3UGH A;  1WW5 A;  1W6P B;  1ZNP A;  3WNO A;  3O1P A;  2ARC A;  5F3C A;  3VHR A;  4A4A A;  3SH5 A;  1POV 1;  4Y22 B;  1WA6 X;  3AL5 A;  3N9L A;  1VAV A;  1TMF 2;  3WW4 A;  3RVH A;  2WC2 A;  1N1T A;  3LOI A;  1S0I A;  4XF0 A;  4Y26 A;  5IAT A;  1AL2 3;  1JOP A;  1RUG 2;  1UY1 A;  2ZAH A;  4JHT A;  4ZS2 A;  5K0U A;  5L7O C;  2WNV C;  3VDB A;  2OX0 A;  1ULE A;  1QY4 A;  2VUD A;  2WAO A;  4WM8 A;  1OT5 A;  4MXW A;  3BYW A;  3ZYR A;  2WJS A;  2A73 B;  4GMP 1;  3RQ0 A;  4NVP A;  3UGG A;  1FOD 1;  3PNA A;  1CAU A;  4GD4 A;  3VBF B;  1A34 A;  1PVC 3;  3M3Q A;  4DPN A;  1BMV 1;  1ONA A;  3JQW A;  2C5D A;  1ZVF A;  4XUQ A;  4RQP A;  5F3I A;  1AX1 A;  4KL1 A;  2G1M A;  3RMX A;  3VGI A;  1CGP A;  1O7F A;  1QDC A;  2PAK A;  4LIT A;  5C7G A;  1AXY A;  1RVF 2;  1UF2 C;  1WCS A;  2CY6 A;  4M3C F;  2UWC A;  3ZN6 B;  1F8V A;  5HXM A;  1HXS 1;  3CO2 A;  1QOT A;  4AFC A;  2JDY A;  1AYN 1;  1O5U A;  1POV 0;  5A33 A;  1RHI 1;  3MGU A;  4KWJ A;  2AEZ A;  4CDX C;  1NA1 A;  1X9T A;  4QDS A;  3ROU A;  2XBO 2;  3BOW A;  4R9D A;  4XIL A;  3SC7 X;  2YXS A;  1H30 A;  3J8F 3;  2VOV A;  3OUI A;  5DMY A;  4L99 A;  4CDU A;  3PME A;  4QX8 A;  5ABJ C;  5CZK A;  1XBF A;  4GMP 0;  5L9B A;  5DDJ 1;  3RZG A;  2ZKL A;  1SPP B;  3RZH A;  2YYO A;  5L73 A;  4BM8 A;  1NLS A;  2J1E A;  5F8P A;  5BY5 A;  3GCX A;  1S0E A;  2GC3 A;  1YLL A;  4MH0 E;  2GC2 A;  2OUJ A;  1KDM A;  2R06 1;  2VMI A;  4YYO A;  2GZW A;  2LTN A;  3T1M A;  2UY9 A;  5FY9 A;  3I59 A;  1CPM A;  4CZS A;  2XR4 A;  2OPK A;  2ZZQ A;  2IUW A;  1S2E A;  1UAI A;  1ULP A;  2W0X A;  2VW1 A;  3OEB A;  4HLT A;  2HWD 3;  5FO9 B;  2CYF A;  4L0P A;  4PT6 A;  1SDD B;  3WDY A;  2FDJ A;  2JIC A;  2GP5 A;  2D5H A;  1L7R A;  2YDE A;  1PO2 2;  1C8N A;  4R4Z A;  4OHW A;  2IWG B;  5DUX A;  1VBE 2;  1O59 A;  5G05 L;  2A70 A;  3AB0 A;  4HAN A;  4HKL A;  2FBE A;  3PLQ A;  3VBU B;  1MZ5 A;  4BQ2 A;  1R1A 1;  2ZEX A;  4EWD A;  3W5N A;  4QXB A;  4J1W A;  3WY6 A;  3K48 A;  3S0M A;  3LFM A;  2PLV 3;  3WG4 A;  2X05 A;  2WL1 A;  2YC4 A;  4LE4 A;  4MGZ E;  1QXP A;  2D97 A;  1GP5 A;  1CN1 A;  3NO8 A;  2XJR A;  5E16 A;  4HL0 A;  1VBD 1;  4XJU A;  2Q0A A;  4NIH A;  1H4G A;  3POG A;  4RGG A;  1NXM A;  1H6Y A;  2DVF A;  4LBL A;  3POF A;  3WOG A;  3I2G A;  5FPZ A;  4DUW A;  5FZE A;  2PHW A;  1OLM E;  4QPY A;  3ZIX A;  2WT2 A;  1AXK A;  1LUL A;  1UCX A;  2A71 A;  4MOA A;  4BB3 A;  1XJA A;  4QPG B;  2WO3 A;  3GCW A;  3VBO B;  4M01 A;  1BYH A;  1OH4 A;  2IFW A;  4D94 A;  4OUM A;  1U5Y A;  1NY7 2;  3N7K A;  1RUC 2;  4MG2 A;  5LA1 A;  1W6N B;  3HIF A;  3DV8 A;  4KBB A;  4YFW A;  5JXI A;  1SQ4 A;  2W39 A;  3JCI A;  1TG7 A;  2VMC A;  2W94 A;  1GWL A;  3DEM A;  1NG0 A;  5ERL A;  3VL9 A;  3SQO A;  3SMH A;  2RDQ A;  5L9V A;  1Q56 A;  3TEW A;  1FYU A;  5C5U A;  4K21 A;  4N53 B;  2K9Z A;  2J1V A;  2MHF A;  4HG6 B;  3VKF C;  4ASL A;  3JD7 1;  4JDM A;  5GAL A;  4UI9 L;  3UGF A;  2WLQ A;  4AI8 A;  1D4M 1;  3LWC A;  3TN9 1;  3NV2 A;  1FV2 A;  1GQG A;  4CCC A;  4EE2 A;  2E9Q A;  4MHU A;  1Y9G A;  5EFU A;  2C9A A;  3ASI A;  1YFU A;  4HN1 A;  4H7M A;  2WO2 A;  2YC2 A;  5T5J A;  5K0U C;  1G9B A;  3CEW A;  3LD8 A;  4CDQ B;  4QKF A;  3SH3 A;  4O61 A;  3ZFE A;  2JXA A;  3PUI A;  4UBH A;  4AEJ A;  3J7N A;  5B4X A;  4A41 A;  3ZN6 A;  1W0P A;  5FMB A;  2GH2 A;  3F2Z A;  1RUO A;  3HQU A;  2VUJ A;  5GLW A;  1OF3 A;  1WCQ A;  1HW5 A;  3ZXL A;  1GOG A;  1Q3E A;  1R08 3;  3B7M A;  1WCD J;  4WM7 C;  2B8M A;  5BNN C;  2IVI B;  1LHV A;  2BDR A;  3AJY A;  3C7E A;  5A3U A;  3O1O A;  3X29 B;  3PUR A;  4YVW C;  4ZU7 A;  5ACA 2;  4BK4 A;  1VPH A;  5FYS A;  4AL9 A;  2ZKN A;  3QAC A;  1A78 A;  3V64 A;  1OOP B;  3NV4 A;  2O1Q A;  4KMQ A;  2D98 A;  5DAX A;  4AG4 A;  3NAP C;  4I0B A;  5EJZ B;  4RFR B;  4F83 A;  1SPP A;  4L11 A;  3OD0 A;  4XZP A;  3ILN A;  1YFX A;  3OOX A;  4OCT A;  4PJY A;  5EJ1 B;  2VTF A;  1B35 B;  2X29 A;  4AI0 A;  4GIQ A;  4R9C A;  3JBG 1;  4XMA A;  2ET7 A;  1NA1 C;  3A7Q A;  1NX9 A;  1AXZ A;  3SHR A;  5F3E A;  3BIW E;  1CJP A;  3MW4 A;  4D6R A;  1AF9 A;  2MNG A;  4CTE A;  2YG0 A;  2W52 A;  2Y0I A;  5IVY A;  3R4U A;  3U37 A;  4RL7 A;  2BUK A;  5BPX A;  4CEW C;  2ZGM A;  4GJZ A;  1DQ6 A;  2XJQ A;  5H9R A;  5C3Q A;  2R04 3;  3KCX A;  4QM9 A;  4CE8 A;  5KHJ A;  1RED A;  1JZ2 A;  2I07 B;  3WCS A;  4M3C B;  2D93 A;  1PIV 1;  3WUD A;  1VAM A;  3HMY A;  4IE6 A;  4A7Y A;  5FYM A;  1FNY A;  3ZMO A;  1NLR A;  4JKM A;  1W6Q B;  3NKT A;  1KFX L;  4FTB A;  3CBN A;  1G9C A;  3OYW B;  4LQR A;  5FJK A;  3LAG A;  3P6B A;  4XTM A;  1AR7 3;  2DCZ A;  5DAQ A;  4NRP A;  1GNH A;  3ZFG B;  1XE0 A;  2CWM A;  2C4X A;  2HEW F;  2RJK A;  4IUG A;  4V2W A;  5CIS A;  4KGG A;  2WWS A;  5FZC A;  2OPW A;  2XHK A;  2DFB A;  1RUF 3;  3R0R A;  1IPS A;  4N43 C;  5FLH A;  3PL0 A;  3IDB B;  1XSQ A;  5FMO S;  3POS A;  2VJX A;  1H8T C;  3OGV A;  2C6S A;  4QPG A;  4TSV A;  2CU5 A;  1LGB A;  1A8D A;  5FZ8 A;  4NRQ A;  5DZF A;  1VBC 1;  3NKG A;  4LK7 A;  1L7L A;  4UF0 A;  2WN2 A;  1OQD A;  4LHS A;  4KH9 A;  4K9S A;  3ORJ A;  1C5I A;  4AVS A;  1WLC A;  3ZYF A;  1W8O A;  1JTZ X;  2BGO A;  2JG8 C;  4MVT A;  3ZXE A;  1MEC 3;  1VBA 3;  2UWA A;  2WT0 A;  4RSU A;  5EYX A;  1GU3 A;  3T2O A;  1LOG A;  2CHH A;  4UOJ A;  3WP6 A;  1UZY A;  4XQ4 A;  1PZ8 A;  4OI0 A;  2Y64 A;  2W5F A;  4NHX A;  5FPB A;  5K7P A;  4K3U A;  2GND A;  3P3N A;  2R49 A;  4D69 A;  2Z79 A;  4XIO A;  4AYU A;  2Y6G A;  4DXZ A;  2QCS B;  2PAM A;  3T4H B;  2LM3 A;  1H1I A;  1XNB A;  1EUU A;  2QDR A;  3ZSM A;  4R8H A;  1PO1 1;  2PFW A;  3M3C A;  2IXC A;  3EHK A;  2JG9 C;  2BZD A;  4I0W B;  3O1T A;  1UWW A;  3THT A;  3MBW A;  2GN3 A;  3AMQ A;  1LOF C;  5EV7 A;  5CKN A;  5FQ0 A;  1X9P A;  1FV3 A;  2CWS A;  2E63 A;  2YY1 A;  4BLJ A;  5KR7 A;  4QX1 A;  4W6W A;  4Q1P A;  1CZT A;  1QF3 A;  2GP3 A;  3NST A;  3GBF A;  2HWD 2;  4UFM A;  3NNM A;  1MZE A;  2WS9 1;  1BBT 3;  2PHU A;  1R1Z A;  1DGW X;  4Q1R A;  2Y38 A;  3N9P A;  1QU0 A;  3R05 A;  1YJL A;  3VBF C;  4QQ2 A;  2C0Z A;  4B7E A;  2J1U A;  1JZ4 A;  1YFW A;  4P08 A;  1OUX A;  1QJY 2;  2JJ6 A;  4XXA A;  5FLI A;  3U4X A;  2W1S A;  1F5F A;  1O4T A;  1C5H A;  4RR3 C;  2PAE A;  5F5Q A;  2QJV A;  3WDU A;  1RUI 2;  3L2H A;  1OOP A;  1MR5 A;  5C8C B;  5JIU A;  4K1Z A;  2JEN A;  4AFA A;  2ZX0 A;  1LHW A;  1DQ1 A;  4QB6 A;  4UFK A;  2V4A A;  5D8A C;  1B35 A;  1ND2 A;  2XKP A;  3WV6 A;  3H3L A;  5DPN A;  1XYP A;  1AL0 G;  1QHD A;  1VE0 A;  3A0N A;  4LO4 B;  1KQR A;  3FHA A;  1JI6 A;  4XJZ A;  4G4F A;  3HAG A;  2RS1 1;  3T30 A;  1RUJ 1;  3IT8 A;  1S2B A;  5DG2 A;  5FBZ A;  5F5I A;  1W8U A;  3MLL A;  1ASJ 1;  1NUK A;  2P6H A;  2Q1Z B;  4OQ9 A;  1JYV A;  4E4H A;  1HRV 3;  1KD7 A;  2VVE A;  3C7F A;  2V72 A;  5JPN B;  4NHL A;  3RGB A;  2JE7 A;  1W90 A;  1GP4 A;  2PEL A;  1AR6 2;  2WZP P;  4IEZ A;  5F2S A;  4LPL A;  2N7G A;  4Q4X 1;  4M3C A;  1BHG A;  1ZRR A;  3NV3 A;  5KXE A;  2LS6 A;  3ZX7 A;  3VD5 A;  1SEF A;  1SFY A;  1R09 2;  3ETQ A;  1CX1 A;  5IAV A;  3VKM A;  1DGW A;  5BV6 A;  5TSW A;  4YNI A;  3DYO A;  2OKX A;  3H3U A;  4N9H A;  3VBU C;  1H1M A;  2VPV A;  1YQC A;  1ZBA 2;  2XUM A;  3POJ A;  1HN1 A;  4JVA A;  1BKZ A;  5KC5 A;  4BDV B;  5CVR A;  4AED C;  3MV0 1;  1UIJ A;  3BCW A;  4JQR A;  4W65 A;  5LCW L;  4CP2 A;  4CP9 A;  4LHK A;  3V0B B;  2OQ7 A;  3OJB A;  3IM0 A;  3K4D A;  4JAA A;  2FCU A;  1UY2 A;  1NT0 A;  3TOJ A;  4EJR A;  2HWE 1;  2JD4 A;  3WP3 A;  2EAK A;  4B7K A;  1FAT A;  1DQ4 A;  1G9A A;  1COV 2;  4IET A;  1UW8 A;  5A7S A;  1UX6 A;  4XZU G;  2AH2 A;  1TMF 1;  1BXH A;  4W8J A;  4GH4 A;  5A7O A;  4FVV A;  3U11 A;  1R08 2;  1RUG 1;  4QD2 A;  3ZVX A;  1XQN A;  2Y6J A;  4L97 A;  1OQ1 A;  5FMC A;  1S55 A;  3I2O A;  4BQX A;  4CU8 A;  1JZ5 A;  4ATF A;  4BME A;  3HNB M;  1SG3 A;  1WCU A;  5FZ7 A;  5FZL A;  3VBO C;  1CVN A;  4Q4W 2;  4W6Y A;  2V5D A;  2IXL A;  2R07 3;  4FP2 A;  4K8F A;  1CWP A;  4XC9 A;  5BNP A;  1JHN A;  5CEH A;  3ME2 A;  1RUN A;  1PNF A;  1LHU A;  1Q8P A;  2JE9 A;  3T2T A;  1IS5 A;  5JR7 B;  1EV1 1;  1QJF A;  3LZZ A;  4JV4 A;  3M8L A;  3U14 A;  5LA2 A;  2FZ2 A;  1NCQ B;  2VXJ A;  1GNZ A;  2J7M A;  1LOE A;  3U07 A;  3JU9 A;  1Q5O A;  4AVV A;  2DCY A;  2VMF A;  1GZW A;  3LEI A;  1JOD A;  4I02 A;  4N53 C;  2SLI A;  2ZGN A;  1RVF 1;  1N3Q A;  3WZ1 A;  2OA2 A;  1SAC A;  2WIN B;  1JZ8 A;  2DUR A;  4QX7 A;  1TZO A;  2VD7 A;  2VZU A;  3UKT A;  3S6P A;  5FXW A;  4CEY A;  1UYZ A;  1LCL A;  4LUK A;  4PQ9 A;  2XBO 1;  2ZZJ A;  5JWP A;  2ID4 A;  2H6B A;  2RS5 3;  2VNG A;  3ZM8 A;  1QJX 3;  4EWA A;  4CDQ C;  1CON A;  5C8C A;  5BYN A;  3KF5 A;  3D6E A;  3KZ4 C;  3WNP A;  3VBH C;  1XU2 A;  1UZ0 A;  1W9W A;  4WVW A;  2ZGP A;  4Q0P A;  1X36 A;  5LBC A;  4C1W A;  1N47 A;  2QQU A;  1MS0 A;  4YLZ A;  2ZEW A;  4JKL A;  2K46 A;  3WQB A;  2NP0 A;  1ENR A;  1N3O A;  2JIG A;  4XDO A;  2OYZ A;  5I8Y A;  3AYE A;  1APN A;  1HV0 A;  1AR7 2;  1PX4 A;  1CAX B;  3G7D A;  4CU6 A;  3AKT A;  1OUS A;  3E6D A;  3FUQ A;  5FMO L;  5FZD A;  3BTY A;  4GWI A;  2KD7 A;  1RUF 2;  3CNA A;  5KWR A;  3KD4 A;  4N7I A;  1PO2 1;  5T55 A;  1AYM 3;  1UOG A;  3J4U H;  1UY3 A;  5IHR A;  1VBE 1;  3LOB A;  3GHN A;  3LDR A;  2P3K A;  4UFJ A;  4AAP A;  3BIE A;  3VD3 A;  4AQ2 A;  2HJI A;  1QXJ A;  2NPI A;  3AK0 A;  1Q8S A;  3T3Y A;  2DTW A;  2DU1 A;  2D44 A;  3LSD A;  1W9Y A;  4JQT A;  1W8H A;  1K5M A;  1JOB A;  1BLZ A;  2WZR 1;  2WYS A;  1FAY A;  2XOM A;  4ITC A;  1AR9 2;  2DVG A;  3HQR A;  1RUE 3;  3ILF A;  1FT9 A;  2DFC A;  3IMM A;  1WGP A;  2DVA A;  4G9S B;  3THC A;  3VLB B;  4FPK A;  5FZB A;  2IC1 A;  4HOO A;  3AMM A;  1MS9 A;  1VRB A;  3URF A;  5LRS A;  1QOO A;  2JE8 A;  1FX5 A;  4TZD A;  4DXT A;  3J7M A;  1XXN A;  4IXL A;  5FYT A;  1E5S A;  1NOV A;  4ARY A;  4AVA A;  5FPX A;  1AZD A;  3N4M A;  2NYY A;  1DQ5 A;  2D3P A;  4IE0 A;  3UES A;  2RE9 A;  1MAC A;  3CF6 E;  4Q0S A;  1RUC 1;  3MF9 A;  2X5I B;  3O1M A;  2WFF 3;  3UKN A;  2BER A;  5FZK A;  5E1R A;  2VAU A;  3U10 A;  4NN0 A;  3VKO A;  1XYO A;  3ZFG C;  1DP0 A;  1YCI A;  3WNN A;  2WFP A;  3ECQ A;  3M4F A;  4CUB A;  3WF1 A;  2VG9 A;  1T2X A;  1LED A;  2FDF A;  1N1S A;  2BFU L;  1T6B X;  1I9R A;  3OPW A;  3WNK A;  1W2O A;  4LBQ B;  2WNU C;  1W8Z A;  4YVS C;  4LBQ D;  1W8T A;  1UN1 A;  3P3P A;  4OI2 A;  4B4P A;  3IDA A;  1DF0 A;  2RDS A;  3KVB A;  3CMG A;  2MEV 3;  3V65 A;  4FPY A;  2BNM A;  1CZS A;  4WM8 B;  1NCQ A;  4IE4 A;  1RIR A;  4DNY A;  3PTR B;  5ISL A;  1OVP A;  1JYC A;  4A2U A;  2VE1 A;  4AVT A;  5GZE A;  4ISQ A;  3T09 A;  3WDX A;  3LB9 A;  2ARB A;  1AUY A;  2P3I A;  1SZB A;  1DQ2 A;  1LNS A;  2EIB A;  2VOT A;  4HMZ A;  3NVC A;  4PLO A;  4CXY A;  3Q8E A;  4RQP B;  4E2S A;  2R0F A;  2IXK A;  1R64 A;  2BGP A;  2JDK A;  5FK8 A;  3K77 A;  1HRV 2;  2HEV F;  4URT A;  4B8E A;  2CGP A;  5JOW A;  4CXW A;  5IVC A;  3OGS A;  3CLP A;  4R4X A;  3K3N A;  4A6S A;  5A3T A;  2VM9 A;  1TME 3;  3FLR A;  3I7D A;  4Y20 A;  4Z82 A;  1YQ8 A;  3B9I A;  1OKO A;  4FOY A;  3BPS A;  4E9K A;  2XWB B;  2ZXQ A;  3EMR A;  3ZR5 A;  5SV8 A;  1HLC A;  4OHZ A;  4AHY A;  4P9J A;  1AX2 A;  4HK8 A;  2OW4 A;  4RYD A;  3OCP A;  4IGO A;  3TB0 A;  4YGB A;  1S1A A;  1BVV A;  1W99 A;  2B39 A;  4P5Y A;  4YM3 A;  1SBE A;  2QE3 A;  4CDU B;  1CAX A;  4MHR A;  4JRL A;  4Y3O A;  4BQ3 A;  4AWD A;  2VTX A;  4ZON A;  3S7E A;  3LA2 A;  3ZXK A;  5FXZ A;  3NJZ A;  4TLF A;  3OUH A;  5FWE A;  2EXH A;  1H0B A;  3ZIW A;  3O1U A;  4UW3 A;  2XUE A;  1ULC A;  1BEV 3;  3J26 N;  2XJV A;  4MGI E;  5F6K A;  4ERO A;  5FZ0 A;  3AVR A;  3ACG A;  3POI A;  3GM8 A;  3BN6 A;  1MQT C;  2DCK A;  2BNN A;  4FPL A;  3AFG A;  4IV1 A;  4XEZ A;  4JGZ A;  4QM8 A;  5IFP A;  1V9U 3;  2FMD A;  1ND3 A;  4QX3 A;  4FOW A;  1GMM A;  1W04 A;  5FZI A;  1JYI A;  2VNR A;  1OA3 A;  3IWZ A;  1UPS A;  2DUQ A;  4JTN A;  4XOG A;  1S0D A;  1QJU 2;  3LF7 A;  5DAW A;  2WO7 A;  3PU3 A;  5K4L A;  1QKQ A;  3VHO A;  3DGT A;  2QZ3 A;  3HEI A;  4LT5 A;  4E8D A;  1D0G A;  1IQD C;  1G9D A;  4QQL A;  2RV9 A;  4CDW B;  2R07 2;  3SCF A;  5FZH A;  2DTY A;  5J36 A;  5FZM A;  3OUJ A;  2D5F A;  2P1B A;  5CIR A;  5FRA A;  4XAE A;  2UWB A;  4QPW A;  1W9T A;  2PN5 A;  1D2Q A;  2VOW A;  3WNL A;  4ORF A;  2VXR A;  3M2M A;  4IER A;  4FI9 A;  1AR8 2;  2HWB 1;  3WW1 A;  1RUD 3;  5F5A A;  2YUE A;  3ZPY A;  1IG3 A;  1QH6 A;  2VEC A;  5KBF A;  2ZML A;  1QEX A;  2VC9 A;  1UY0 A;  4NPL A;  5JLV A;  3U75 A;  3AVS A;  1NZI A;  5E88 A;  1WME A;  3RZZ A;  4Q0U A;  4I2O A;  2E6V A;  3ZKY A;  1XE7 A;  3D3A A;  3QLQ A;  4FOV A;  4OI4 A;  4COY A;  4MGT A;  3ATG A;  1VAL A;  4IV3 B;  2RS5 2;  4LBQ A;  1HKD A;  4XUT A;  5IVE A;  1VRH 3;  5EP9 A;  1QJX 2;  2XQX A;  3C2U A;  4DB5 A;  1EAH 2;  1H2L A;  5APA A;  4WBB A;  4UFH A;  5FP9 A;  2X09 A;  2YB7 A;  1WLT A;  4F7Z A;  2WBK A;  4ES8 A;  3NNG A;  4GZ9 A;  3WNX A;  4QPI C;  3GDB A;  4E8C A;  1CX4 A;  1FI2 A;  1ULO A;  2O8O A;  2PHT A;  2RR1 2;  3GAL A;  1IG0 A;  3VBR B;  3B93 A;  4P00 B;  5KHK A;  2RMU 3;  5FO7 B;  3BUC A;  1X7N A;  4BQY A;  4CCJ A;  2F4L A;  4Q4Y 3;  5JZG A;  3D8C A;  4ZXK A;  1AYM 2;  3DPR A;  1ENS A;  4LUM A;  2R1D A;  1C1L A;  1QJY 1;  3ZFE B;  4EN6 B;  4Q4V 3;  4RD7 A;  1GYK A;  1U5I A;  1EYB A;  3N9O A;  1JHJ A;  3VDC A;  3GYD A;  5CFC B;  4YW5 A;  1SLB A;  1ZZB A;  3PUA A;  4FXK B;  1RUI 1;  3I3D A;  1QQP 3;  1RIT A;  1ZYB A;  3HNM A;  2VZQ A;  1SLC A;  1DBN A;  3ACI A;  4L9B A;  4XVH A;  3ZO0 B;  5FKC A;  5KXC A;  1C28 A;  1IHM A;  3FZ3 A;  1BK0 A;  3WR0 A;  4BQW A;  5K8S A;  4Z1V A;  1H2K A;  4D3W A;  3OBT A;  5IW0 A;  4RHV 3;  3PVO A;  1YI9 A;  4UW4 A;  2PYT A;  2VNV A;  1YXW A;  4BIF A;  3U0Z A;  1VLN A;  1O3R A;  1DCS A;  1NYW A;  5HCF A;  2KM2 A;  2P6C A;  2JWP A;  3RYP A;  4COV A;  3RYR A;  2EAL A;  3PVN A;  4C90 A;  2BW8 A;  1KXG A;  1S0F A;  3AZX A;  3CJX A;  4R9B A;  1S0C A;  2Z5W A;  2TBV A;  3ZOI A;  2PMW B;  3I2D A;  2HH9 A;  1HQW A;  3RG0 A;  2ZHK A;  1AR6 1;  1POV 3;  1YQ5 A;  1WZX A;  3USS A;  4YSF A;  2WFF 2;  1PM4 A;  4FOQ A;  1SBF A;  2ERF A;  5L9R A;  2IFR A;  1W8N A;  3CZJ A;  5LBB A;  4CU7 A;  5C71 A;  2VOK A;  2RS3 2;  4KU8 A;  4D6S A;  3VKL A;  4ZKT B;  2ZGO A;  3I54 A;  4OHX A;  5FZ1 A;  1YIF A;  1R09 1;  2VMD A;  3RWN A;  1Y9M A;  3H42 B;  3KHB A;  3T4V A;  2DUP A;  4S2D A;  4XFA A;  3VDA A;  2RM2 2;  1ZRE A;  1HQN A;  4DEQ A;  3ST7 A;  4GMP 3;  2D6K A;  5A1F A;  3C7G A;  3RRD A;  5CA6 A;  2G9G A;  1FOD 3;  2XLG A;  4CDW A;  4DRV A;  2W9X A;  1ZBA 1;  2HBT A;  4YW4 A;  3MPP G;  1XU1 A;  1OFS A;  5JOY A;  4C8D A;  4HSL A;  1IKP A;  1JXN A;  4OUL A;  4BJ0 A;  4QWN A;  1L7Q A;  2GME A;  4CCN A;  1DLL A;  5FCC A;  5T54 A;  2JDM A;  2VZT A;  3VZL A;  1QGL A;  2WZ8 A;  2YMZ A;  1OF4 A;  4DRR A;  3LEM A;  4FAG A;  1H9W A;  5I0R A;  1HXS 3;  5A6Y A;  3I3E A;  5IVF A;  2XML A;  1LRH A;  1RHI 3;  3BOP A;  3EBR A;  1COV 1;  1PGW 2;  1LEN A;  5FYB A;  1R08 1;  5A7W B;  2EXK A;  4EN9 B;  2AYH A;  4QKB A;  3B02 A;  4UF0 B;  5FY5 A;  3SKJ E;  1JZ3 A;  3OGR A;  5GZG A;  1TME 2;  1YRZ A;  2BWA A;  2ZGS A;  4BIS A;  1UNB A;  4IV3 A;  1V6M A;  2CDO A;  1LU1 A;  2VBD A;  4Q4W 1;  4EV0 A;  5DDJ 3;  4YZ2 A;  4PIZ A;  4ARX A;  2X5I C;  1CAW B;  1IZ3 A;  1IS3 A;  1ZBE 1;  4CRQ A;  5I93 A;  4IEY A;  1HRI 3;  3WDT A;  2R06 3;  4BZ4 A;  3AXE A;  3WSO A;  4CXX A;  5C70 A;  3VZO A;  4BK5 A;  1C57 A;  1JYX A;  2VGD A;  4XCA A;  1SCS A;  4CPB D;  2ZAC A;  4LBM A;  3B94 A;  2Z4F A;  4PDW B;  1V70 A;  4ES9 A;  2BWC A;  4OUS A;  3HT2 A;  3VBR A;  2F6B A;  3LGR A;  3RI8 A;  4FSJ A;  2AEY A;  5KXD A;  1D0H A;  3B69 A;  2EXJ A;  1DG6 A;  1Q8V A;  3I97 A;  4FCA A;  1W9S A;  5FZ3 A;  2WN3 A;  3D82 A;  3THD A;  2WWJ A;  5FQ0 B;  5FP7 A;  1M4W A;  4COZ A;  5LK7 B;  1K3I A;  4QXK A;  1LU2 A;  1S0J A;  1Z0H A;  2J1R A;  1CJD A;  4WM8 C;  5FYV A;  3O1R A;  3GJB A;  1Z7S 3;  4J6G A;  1KIT A;  2K0G A;  2BVV A;  5C3P A;  5CFC A;  1LGN A;  3III A;  2QBX A;  3PJY A;  1C4R A;  4DXR A;  3PJQ A;  1PX3 A;  1V9U 2;  3DYP A;  4LHN A;  5A32 B;  1PZ9 A;  3ZR6 A;  4WV8 A;  4FTE A;  4QX0 A;  4RQP C;  3SXW A;  3KWV A;  3OTF A;  1GOH A;  1YO8 A;  1UOF A;  3JXS A;  3RWK X;  5I91 A;  3LIG A;  2OUH A;  2Y34 A;  4L8Q A;  5FOB B;  1PGL 2;  2Q1M A;  1UU4 A;  1PZ7 A;  2LRO A;  2AC1 A;  4GWM A;  3OGG A;  1OVS A;  4BA6 A;  3MO4 A;  3A21 A;  4A3X A;  4DY3 A;  2XJP A;  3CIH A;  4XTP A;  1ND2 B;  1RUF 1;  2BJS A;  1U5X A;  3BOD A;  3LPF A;  4MAD A;  4PLM A;  3W59 A;  4CCD A;  3AZY A;  3SCH A;  3AMH A;  3UT0 A;  1J3Q A;  3A4U A;  4MUV A;  2G4I A;  1LR5 A;  2CNA A;  5A1L A;  4YM1 A;  1YQ2 A;  1OKQ A;  4CDU C;  2R7E B;  4HPK B;  3IKW A;  4XDQ A;  2HWF 3;  4RS5 A;  1JN2 P;  1Q43 A;  1KS4 A;  4AI1 A;  4GWJ A;  3UNP A;  2ATF A;  3SLI A;  4FO9 A;  4YAR A;  1AR9 1;  3W21 A;  3IDE A;  4BXF A;  2P3Y A;  2ADD A;  4JC1 A;  1C8M 3;  1YEW A;  4H55 A;  2C9K A;  3BB6 A;  4M3C E;  1D4M 3;  3WEZ A;  3TN9 3;  5CNA A;  1NKG A;  1OMI A;  1WUV A;  1Y4W A;  3CKH A;  4XJ9 A;  5FZ4 A;  1AL2 2;  1ZZ9 A;  2JKX A;  4NJ4 A;  2EF6 A;  2A6V A;  2PHX A;  2PHR A;  3H8X A;  3VZK A;  3IAQ A;  2ZOE B;  3MHZ A;  4K20 A;  2QQJ A;  4IES A;  3O7O A;  4DOU A;  2WA3 A;  2YBS A;  1FXZ A;  5DUV A;  3E97 A;  5E89 A;  1RUH 1;  3POE A;  4H7L A;  1PVC 2;  4XJW A;  4B29 A;  4QQP A;  5C4W B;  4MX3 A;  4QU1 A;  1W05 A;  1UXZ A;  4YRD A;  2RMU 2;  2VCA A;  2O8Q A;  3POB A;  4CP9 B;  3VL8 A;  1XE8 A;  4Q4Y 2;  5FOJ B;  1HJF A;  3WQ1 A;  4IQP A;  2DCT A;  4A44 A;  5A7W A;  3KV9 A;  1V6N A;  2BNO A;  3TNP B;  3DKW A;  3O14 A;  4Q4V 2;  5JOZ A;  2XPJ A;  4GA9 A;  4JGY A;  4Y4R A;  5CAD A;  3LDB A;  1LB2 A;  2C24 A;  1O3S A;  1ZRC A;  4D0Q A;  4LKE A;  3NNJ A;  2QFE A;  1QQP 2;  3AM2 A;  4GH4 B;  4OMD A;  4U36 A;  3K3O A;  4UFI A;  4OI1 A;  1CAW A;  3WP4 A;  1OLM A;  2ZTN A;  1HQL A;  1UKR A;  4PLN A;  1F9K A;  1F2N A;  2D6P A;  3A0K A;  3KQR A;  4LO8 A;  1MS1 A;  3DCQ A;  3MF6 A;  3JBG 3;  4CCM A;  3VZM A;  4CPB A;  1MS4 A;  5C9A A;  1TQ5 A;  3J8F 2;  4YWA A;  2I74 A;  4RHV 2;  5BNP B;  2P5B A;  3RZK A;  1C3H A;  2ZMN A;  3FX3 A;  2BOJ A;  4PDW A;  5T5L A;  3WF3 A;  4QQH A;  4RN5 A;  2FD8 A;  5BNO A;  2Q8O A;  3DXT A;  2EVX A;  1HRV 1;  2IVJ A;  5GM0 A;  3D4K A;  4URA A;  1GZW B;  2QZ2 A;  2XKO A;  3IIA A;  3M3O A;  5CAZ A;  3T0D A;  2ZCW A;  3AMN A;  2AEN A;  4MGQ A;  1MVE A;  1ZA4 A;  1FPN 1;  1CIW A;  3FLT A;  3MEP A;  3NJX A;  5LA9 A;  4B4R A;  3BKZ A;  3BTZ A;  1LOD A;  1PIV 3;  3AKS A;  1OBN A;  3RZM A;  4GAZ A;  4IEW A;  3GF6 A;  2I2S A;  1V6O A;  3IZO A;  2XB6 C;  4PHZ A;  4Q27 A;  1VP6 A;  5A32 A;  1OHF A;  4BPZ A;  1JU3 A;  1VJ2 A;  4CEY B;  5GLU A;  2Q8D A;  4XHX A;  4J1X A;  2BV4 A;  4GWN A;  4QGN A;  4M00 A;  3T1L A;  3WF4 A;  2GC0 A;  1YWK A;  4GJY A;  5FZA A;  2OVU A;  2XL7 A;  3RYK A;  3ZFE C;  5DAP A;  2BFU S;  2PLV 2;  5LB6 A;  1KS5 A;  4JTO A;  1S0B A;  2JDU A;  1J3R A;  4XE9 A;  4NWW A;  5A3N A;  3L2Y A;  5FXV A;  5FFO C;  2ARA A;  2VZV A;  2V5Y A;  3R4D B;  2UYA A;  3M3E A;  1JYW A;  1X33 A;  1XNA A;  2VCC A;  5JDB A;  5C3R A;  5J96 B;  3DKQ A;  4NPR A;  3H9A A;  2D7F A;  5HI0 A;  4XQD A;  1I3H A;  4QXC A;  2D6N A;  4HPK A;  3FMG A;  1RHI 2;  3KGL A;  2V73 A;  2A5Z A;  2XQR A;  2ZAB A;  2VCM A;  4QQO A;  5KC6 A;  4JKK A;  2VZO A;  4MGY E;  3SKV A;  4QDQ A;  5LBE A;  2XDV A;  2Y6K A;  5G04 L;  1VBB 3;  1WKY A;  5DZG A;  1QJU 1;  5FBJ A;  1V0A A;  2A6Y A;  2YFZ A;  2VY0 A;  4WVZ A;  1O3Q A;  3IN9 A;  1K5M B;  2XG3 A;  1UQX A;  2D6M A;  2R07 1;  2P3J A;  3WW3 A;  2RVA A;  4A45 A;  2JDZ A;  1PO1 3;  5JI9 A;  2Y0O A;  4D7Y A;  3EO6 A;  3ZSJ A;  1HRI 2;  4A3Z A;  2R06 2;  4DUX A;  1UOJ A;  1HB1 A;  3VD9 A;  1TNR A;  2QQW A;  2IXJ A;  5JMO A;  1VMJ A;  1AR8 1;  1RMU 3;  2VBP A;  4H3W A;  3H8O A;  2W91 A;  5FPU A;  3AP7 A;  4DY5 A;  1KFU L;  3R4S A;  1DZT A;  3HVD A;  2WS9 3;  1GZ9 A;  3LPG A;  5C4W A;  1QOS A;  4K8R B;  4GAL A;  3MFC A;  3NJY A;  4H14 A;  3KF3 A;  3ZXA C;  2ZJC A;  2WNO A;  2GAU A;  4TXW A;  3AZV A;  3N36 A;  2E7Q A;  1RJ7 A;  1UMI A;  5FAX A;  2CL2 A;  3POW A;  1IOA A;  1JOJ A;  1Z7S 2;  4M0N A;  1FMD 3;  4LK6 A;  3KMH A;  1NZC A;  4Z07 A;  2YPD A;  4LO7 A;  1QJX 1;  5FP8 A;  4BMB A;  1OSG A;  5I0D A;  1EAH 1;  2F4P A;  2WDB A;  3SCG A;  1UPI A;  3HOB A;  2VW0 A;  4WZC A;  4V1P A;  1W6M B;  1ZZ8 A;  1CIY A;  4XUN A;  4QPG C;  2X10 A;  5T3N A;  3I3Q A;  3CDZ B;  1PHM A;  2J1S A;  3RFR A;  1PM7 A;  3MZH A;  2W1U A;  4BU2 A;  5ANN A;  3GJA A;  2RS1 3;  2KA3 A;  4DO0 A;  1RUJ 3;  3K46 A;  3O5S A;  1YI7 A;  3ZSK A;  1DZR A;  2RR1 1;  5LY2 A;  4FPC A;  1J1T A;  4AVC A;  3OBZ A;  1JH5 A;  3WF0 A;  2J42 A;  2LRP A;  3JZV A;  4DIN B;  2QVS B;  2W95 A;  1SLT A;  3N7M A;  3E5Q A;  3LFI A;  4E4Z A;  5FKB A;  2W3J A;  5I0U A;  5IVV A;  1UO9 A;  2WYF A;  2VO5 A;  4OMC A;  3VDD A;  1OQE A;  4QU2 A;  4LOS A;  4MSV A;  2CV6 A;  3L9J T;  4BQ1 A;  4NIG A;  4GQ7 A;  2ZGL A;  4AI2 A;  2CAU A;  5FZG A;  2HWF 2;  5HCA A;  1PMI A;  3CL1 A;  5FMD A;  2R04 2;  3WW2 A;  4Y24 A;  1IS6 A;  1RTV A;  4Y20 B;  3PU8 A;  1C8M 2;  4N8M A;  1D4M 2;  5B4N A;  4N9I A;  4QT6 A;  5JOX A;  5IFT A;  1GP6 A;  1WW7 A;  1K42 A;  4QX5 A;  1JZ7 A;  4RGA A;  4X8N A;  2XXZ A;  4MYE A;  4GB3 3;  4JDN A;  2B4K A;  1XPW A;  2H6C A;  1UZW A;  2JDN A;  2YC0 A;  3J7H A;  3JB8 A;  2HWE 3;  3P1I A;  4I0A A;  4UW6 A;  4WZF A;  1B09 A;  4J25 A;  2A3X A;  1WMF A;  2X8K A;  2FDH A;  1L3J A;  3VD7 A;  1OOP C;  2YGM A;  2WFF 1;  2C26 A;  1TMF 3;  2YBP A;  5C3S A;  4N90 A;  2RS3 1;  4F8A A;  1RUG 3;  3TWI A;  1B35 C;  1URX A;  1LHO A;  1ND2 C;  2A75 A;  2ZS6 B;  3CJI A;  5A3W A;  4YFZ A;  2FHR A;  2RM2 1;  4AGG A;  4IV1 B;  3GNE A;  2A1X A;  4JGZ B;  4K40 A;  4M0H A;  1A6C A;  1ZZC A;  4S2F A;  1ND3 B;  3AX4 A;  4PIY A;  5ANQ A;  3QH6 A;  1EV1 3;  3ZYB A;  1MEC 2;  1VBA 2;  4P9W A;  5FWJ A;  3N7J A;  5A6Q A;  2XVL A;  4R9A A;  1E5H A;  1VAK A;  4NAM A;  5C3O A;  5IVB A;  3HPN A;  4MGK E;  2WRA A;  3WG1 A;  3WLU A;  1JS9 A;  5HCB A;  5FY7 A;  1RVF 3;  3OPT A;  2BOI A;  3ALQ A;  3WUC A;  2EID A;  3O0V A;  1BCX A;  3OY8 A;  4ZU5 A;  3HQX A;  1US3 A;  3VN4 A;  1X8E A;  1PGW 1;  2D40 A;  2LAL A;  3EB7 A;  4GKY A;  4O7X A;  4Y1X A;  5DN2 A;  1O4Y A;  2F17 A;  4Y5T A;  1NY7 1;  1VIW B;  3WG2 A;  2R1B A;  1G6N A;  1NCR A;  4AI3 A;  1TME 1;  1BBT 2;  4LXL A;  5IJR A;  1XSR A;  2WO1 A;  2UY8 A;  4S2H A;  4BE3 A;  4YZ3 A;  3B5L B;  2Z69 A;  5C4W C;  3ZDV A;  4OFG A;  4XAB A;  1GWM A;  4AEK A;  1KGY A;  5FLJ A;  3VZJ A;  3KCC A;  4Z2A A;  1W6M A;  2XJS A;  4HXC A;  5BUV A;  3I2I A;  4LUL A;  1VMF A;  4JZR A;  4XBQ A;  1LAJ A;  1OD5 A;  2A7A A;  5IWF A;  3WNM A;  4K6B A;  4R52 A;  1POQ A;  4D7S A;  1A8M A;  1AX0 A;  2X53 S;  5IK5 A;  1H2N A;  2O0O A;  3OBR A;  3MI8 A;  4I01 A;  4ZZ5 A;  2W1Q A;  2ZX3 A;  3AL6 A;  4LBN A;  5JUV A;  5L7O A;  3IBM A;  4Q29 A;  4QKN A;  5A7N A;  2ZX2 A;  4GH4 C;  1PO2 3;  4LO5 B;  2E7A A;  3W9A A;  3ZSL A;  2YZ4 A;  1GIC A;  1LTE A;  2VZR A;  3WXP A;  3TYJ A;  1NQD A;  1OXC A;  1QDO A;  1PMJ X;  4XAC A;  4CUG A;  3KQ4 B;  4NMI A;  2NZ9 A;  2QDN A;  5A3P A;  4NRM A;  4D8M A;  5IK4 A;  1DGR A;  1UIK A;  1ZRI A;  2HKX A;  2PTM A;  1LOB A;  2WR9 A;  3M70 A;  3ZLI A;  5BNP C;  5I0S A;  5J1X A;  3EXU A;  2WZR 3;  5JZG B;  4B1M A;  1OH3 A;  1VMH A;  1WCK A;  1PNG A;  3DPR B;  4FFG A;  1X8M A;  3HN3 A;  4DZG A;  4FPH A;  2ZEY A;  2RG4 A;  2NMN A;  2AZ5 A;  1CD3 G;  5IT6 A;  4AF9 A;  1VBB 2;  1Q8O A;  3I3B A;  5ACA 1;  1J1L A;  1RL3 A;  4BQ4 A;  1I1E A;  4Z8B A;  4KU7 A;  3AZW A;  1PGL 1;  1JUH A;  5KHI A;  1F4A A;  3ZXG A;  2HYK A;  3I4I A;  3KLS A;  3GZT B;  4CDX A;  2Q1F A;  4NAO A;  4QGM A;  3MLK A;  3C3V A;  1PO1 2;  2HYX A;  3A22 A;  4FPO B;  5BNN B;  1RB8 G;  1E5I A;  3H7Y A;  4Y5S A;  4LBK A;  4C0H A;  1MS3 A;  1MZ6 A;  1YHF A;  3Q8C A;  1F15 A;  1JMU B;  1GOF A;  2DYC A;  3PHM A;  4I3P A;  4CEY C;  4XHB A;  4IE7 A;  3UV9 A;  4FQ4 A;  5J48 A;  1RMU 2;  2DBN A;  3LQC A;  4E4S A;  2AR6 A;  1KRI A;  5CG8 A;  5C33 A;  1UYX A;  2AGS A;  2UU8 A;  3EQE A;  3ZYI B;  5C8C C;  4OZX A;  5C8W A;  5JXG A;  3PMS A;  4CP1 A;  4XQW A;  2RDR A;  5DXD A;  1GAN A;  5F6L B;  1T6G C;  2OT7 A;  2ETE A;  1W6O A;  1Y7B A;  3H7J A;  3WG3 A;  4D6Q A;  4XBN A;  5FPA A;  1QWR A;  2ADE A;  2DDU A;  3HBZ A;  1DIW A;  3MPB A;  5JVV A;  3UL2 A;  3ZN4 A;  4EYU A;  4XFB A;  2HLE A;  3P5B A;  5J7M A;  3SEP A;  1FMD 2;  1XYN A;  1JYT A;  4AVB A;  4BHP A;  1X82 A;  1O4Z A;  2TUN A;  2B45 X;  5GZD A;  5A7Q A;  1AL2 1;  1WD3 A;  4MGS A;  1IPK A;  3PUS A;  4QB2 A;  2J1A A;  2VQT A;  3LCP A;  1W03 A;  1CPN A;  1ZRD A;  1CAV B;  2IZW A;  2FDK A;  4XET A;  4K1Y A;  4WVV A;  3I2K A;  2W46 A;  3JUU A;  3GZU C;  2NLR A;  4Y1Z A;  2RS1 2;  1RUJ 2;  4E4D X;  1OC1 A;  2P34 A;  4AFB A;  2CSG A;  3O1V A;  1PVC 1;  3ZFF B;  4YZ1 A;  2ZAA A;  4LLO A;  1K5M C;  4LIU A;  4LBO A;  3B00 A;  4AGR A;  4Q4Y 1;  3HT1 A;  1GWK A;  3WVJ A;  3KCY A;  3KV4 A;  2BGC A;  5FV3 A;  4CCO A;  3N35 A;  4HT1 T;  5T52 A;  2R0H A;  5E6H A;  3KGZ A;  4YG3 A;  5FXX A;  3VHP A;  2Q8C A;  1BK1 A;  3WQ7 A;  5B2G B;  2NM1 A;  4HK9 A;  3AKQ A;  2B5H A;  5FP3 A;  1K45 A;  1QQP 1;  4AHX A;  1UMZ A;  3AYC A;  1H8T B;  3BPZ A;  3RJ2 X;  1DYO A;  1Y3T A;  5F32 A;  4FBF A;  1K5J A;  2VBB A;  4LOT A;  4Q2F A;  1TNF A;  2QQO A;  2ZX4 A;  2CTV A;  3J8F 1;  2DWR A;  2CGN A;  1MPX A;  2FCT A;  2NMO A;  2VQ0 A;  2Z2S B;  1JW6 A;  2EAA A;  2GH8 A;  1IGO A;  2ORZ A;  3ZYH A;  2JX9 A;  2W08 A;  1HJG A;  4Y1U A;  1IS4 A;  3JQX A;  3M7A A;  4GB3 2;  4LTA A;  4UYB A;  1V00 A;  3MW3 A;  4HVQ A;  2IXI A;  4I3G A;  2GMM A;  2Q30 A;  2RJL A;  4LLF A;  5CFD B;  4HSJ A;  3TEY A;  3PUQ A;  5FZF A;  3BVC A;  2HWD 1;  1VB4 A;  2D3R A;  5EWS A;  2V4V A;  3H1Y A;  4UT5 A;  2G9Z A;  2JG9 B;  3KT4 A;  2QQK A;  3LE0 A;  5HXV A;  1F35 A;  2OZ6 A;  3ON7 A;  1IQA A;  1GKB A;  3SIS A;  4AOC A;  4DUV A;  1O3T A;  3ZPO A;  3MIE A;  1V6L A;  5JI7 A;  3RDI A;  4XXP A;  1NCQ C;  4AQ6 A;  1M06 G;  1WBF A;  3K4Z A;  5BNQ A;  3HBK A;  3B01 A;  1J59 A;  1HB4 A;  2PQQ A;  1UZZ A;  1WMD A;  2E53 A;  4Y5Z 0;  1I5P A;  3NRU A;  5CKQ A;  4DQA A;  4YG0 A;  2PLV 1;  2ZGR A;  2Y8K A;  2B9V A;  2NN8 A;  2AUY A;  1EV1 2;  5FDB A;  1KEX A;  3MYX A;  5C6C A;  4XBL A;  1RUE 2;  2HWC 3;  4P9L A;  4WM7 A;  5BNN A;  5F9T A;  1DYP A;  2JDP A;  3AZZ A;  3H8U A;  2JKB A;  2WQZ C;  4RR3 B;  2HWB 3;  3ELN A;  4YVW A;  4C0B A;  1IPJ A;  3OGJ A;  4HFS A;  4OHY A;  2WNE A;  4LE3 A;  1XND A;  1UOB A;  3FBM A;  3HNY M;  3LA3 A;  1NAE A;  2WKK A;  3NAP A;  1ENQ A;  2ENR A;  2FQP A;  1YYN A;  3E5U A;  1SFN A;  4WVM B;  5F7U A;  2W2I A;  2ZHM A;  4IND A;  1O6U A;  4LA2 A;  5D8A B;  3C7O A;  5EJ3 A;  4QGL A;  4ZZ8 A;  3K51 A;  3H3Z A;  4DMI A;  4MET A;  4QAW A;  3WDV A;  1A3K A;  1F31 A;  3UET A;  5AFE A;  4RFT 0;  3ZSE A;  3OBA A;  4N7U A;  2JB4 A;  2DU0 A;  4TLG A;  3UKV A;  1N1Y A;  5FO8 B;  2WQ8 A;  4Q0Q A;  4RS5 B;  4XFF A;  4DFS A;  3NV1 A;  3U1X A;  1W2N A;  4AEM A;  2WII B;  5T50 A;  1JYN A;  4PI2 A;  3KB5 A;  2WLP A;  4CEW A;  3APB A;  4D7T A;  3I49 A;  5F39 A;  2XLF A;  3J9S A;  1HRI 1;  1CAV A;  4IEV A;  4P9Y A;  4COW A;  2VUL A;  5A3M A;  4B1L A;  4XF3 A;  3USU B;  4QKD A;  5D2A A;  2QQP A;  1TE1 B;  1LEM A;  2XVK A;  4XIK A;  4XMI A;  1YQ6 A;  1NQJ A;  2G19 A;  3LKJ A;  4IV1 C;  2MEV 2;  3DUI A;  3IPV A;  4JGZ C;  3ZFF A;  2QQM A;  5FK7 A;  1ND3 C;  3E1F 1;  3GZA A;  5F1R A;  1DGL A;  4OHV A;  1SLI A;  3RZL A;  1W2A X;  1EPW A;  1MVQ A;  1UX7 A;  1XB9 A;  2OZJ A;  4IEX A;  2L9L A;  4YW2 A;  4DEV A;  5I0T A;  5EHD A;  1QJY 3;  2ARE A;  3O0X A;  5FY0 A;  3FWE A;  4BXS V;  4B3N A;  4LJH A;  1AYN 3;  2XVG A;  1RUI 3;  3R6S A;  5DAB A;  1Z7S 1;  4EN0 A;  4AED B;  2VU9 A;  4ZY9 A;  4XUP A;  3THP A;  3RS6 A;  2VOX A;  3Q8F A;  4N43 A;  1WA4 A;  1WW6 A;  2WZR 2;  4RA0 A;  5LWB A;  1NLQ A;  3LSE A;  2D6O X;  1H8T A;  4Y1Y A;  4P14 A;  5DQ0 A;  4CUC A;  5K9Y A;  5BXX A;  1YC6 1;  2A6W A;  4NE9 A;  3EJK A;  3PTY A;  4JGY B;  2XLA A;  1MZF A;  2AAC A;  2YRO A;  3KM5 A;  3NNL A;  5LA0 A;  4HON A;  1S0G A;  1WD4 A;  3KSC A;  3AXD A;  3C8X A;  3NMB A;  2PHL A;  4Q5O A;  1MS5 A;  1O8P A;  5FZ6 A;  2E31 A;  2YBK A;  3RJR A;  1XNC A;  4CSW A;  1GZC A;  5F37 A;  1YNA A;  2YFU A;  3DL3 A;  2QQL A;  2JG8 A;  3RZJ A;  4XW3 A;  4MO3 M;  4XAA A;  5LY1 A;  1QIQ A;  1PGS A;  1DU3 D;  3VB9 A;  2XJT A;  2V09 A;  5D1I A;  1G86 A;  5C9A B;  1ENX A;  2VVD A;  3SIT A;  4C91 A;  5HCH A;  2W92 A;  3CHX A;  1FNZ A;  2ZGT A;  5L19 A;  3AFK A;  1AR6 3;  5FIX A;  5CFD A;  4XDP A;  1W6P A;  3BTA A;  3FUO A;  3KVA A;  5JSR A;  4NHK A;  4PBO A;  2DBI A;  4PQQ A;  4TWT A;  4UBG A;  4Y22 A;  2JD9 A;  1DZQ A;  4W4Z A;  5J37 A;  4JRA A;  4ZS3 A;  5BNO B;  1KJR A;  4ASM B;  4HN0 A;  4QHZ A;  5JPM B;  2JG9 A;  3KV6 A;  4FPG A;  5HV0 A;  2HWF 1;  1LOA A;  5IK8 A;  1BEV 2;  1R1A 3;  1R09 3;  1LOF A;  1W8F A;  2R30 A;  2JB8 A;  1G7Y A;  2H0B A;  1UD1 A;  4GKX A;  2CDP A;  2R04 1;  5JAX A;  2UYB A;  4XFC A;  1NE6 A;  4O9E A;  1RJ8 A;  3QCW A;  4U2A A;  5A1A A;  1W0O A;  5CG9 A;  1ZBA 3;  1C8M 1;  2WSU A;  5FY8 A;  4Z2W A;  1QJZ A;  4Y33 A;  2FZ1 A;  2VZ1 A;  2XJU A;  4IE5 A;  3VBF A;  4AHZ A;  4Q8K A;  4XCB A;  5LZ6 A;  3TRS B;  2VUA A;  2VQA A;  4CCL A;  5JMC A;  1VBD 3;  2VMG A;  1SLA A;  1GR3 A;  5JZG C;  3AC0 A;  3ZXJ A;  3H0O A;  2GNT A;  4IEU A;  3DPR C;  4RR3 A;  4OUE A;  1U0A A;  2DVB A;  1AR7 1;  3BAL A;  5IUQ A;  4AGV A;  1CQ9 A;  5JCT A;  1HB3 A;  1VR3 A;  3FHI B;  4AQS A;  2NQY A;  4FPF A;  4SBV A;  1WLD A;  4WVM A;  3VBH B;  2KXL A;  1COV 3;  4LO6 B;  1DHK B;  1QJE A;  5D8A A;  4IW3 A;  5CYY A;  4ASK A;  1J84 A;  2D3S A;  1H1A A;  3ABZ A;  3TNQ A;  3ZXD A;  3AKP A;  1PVX A;  1RUD 2;  5F5C A;  2JDA A;  2B7Y A;  4GUL A;  1X50 A;  2W68 A;  2BBV A;  1F5J A;  4Q4W 3;  5FTT C;  1D7P M;  2VH9 A;  2Y6L A;  2YU1 A;  4MXV A;  1PK6 B;  3UJQ A;  3W5M A;  5EIY B;  5AVA A;  3HD8 B;  2W87 A;  5EPA A;  1ZBE 3;  3LIH A;  3N3H A;  3MFA A;  1MEC 1;  1VBA 1;  2YV8 A;  3N7L A;  1HIX A;  4KG8 A;  5LRR A;  4OYU A;  5LEK A;  4NID A;  3JD7 3;  2XHN A;  3S5A A;  4UFL A;  2Y60 A;  5FJH A;  2SBA A;  2W47 A;  4HKO A;  1VRH 2;  4YZ4 A;  3USU A;  2BYV E;  2E33 A;  2VZS A;  2XGX A;  3K2O A;  4L92 A;  5IK7 A;  2H0V A;  1OI6 A;  3QD6 A;  5LK5 A;  4KWL A;  3FC0 A;  1QMJ A;  2VQU A;  3WCR A;  3WF2 A;  1W2U A;  3VZN A;  3WP5 A;  4BQ5 A;  3NNF A;  3I2J A;  1LGC A;  3KT7 A;  4AK3 A;  1QH7 A;  5HPO A;  3VBU A;  4YGE A;  4BYY A;  2E51 A;  1CES A;  4E2G A;  1OLR A;  4CDW C;  1V6I A;  3T08 A;  4AED A;  1BBT 1;  3NL1 A;  3GGL A;  4BOW A;  5AFB A;  4KBZ A;  5IYY A;  3VUO A;  1RXG A;  3AYD A;  4CVU A;  1E5R A;  3ZFF C;  3I3M A;  3WDW A;  2PQS A;  1IKQ A;  3Q8B A;  1REF A;  3Q9O A;  4XF4 A;  4FXG B;  1ODM A;  2GU9 A;  3IMN A;  3W58 A;  4SLI A;  5GLT A;  2FDI A;  5AC9 3;  1NE4 A;  1I6X A;  5GZC A;  3GXU A;  4UAP A;  5I8S A;  5GLV A;  2XL9 A;  2ARX A;  3ZMN A;  2BQP A;  2TNF A;  4PF1 A;  3UJO A;  2OQ6 A;  3MIC A;  4HET A;  4NO4 A;  3WD5 A;  1AHS A;  2HWC 2;  3OB8 A;  3VV1 A;  1CR7 A;  2RDN A;  3NJV A;  2RHP A;  2HWB 2;  3VBO A;  1SCR A;  2WNU B;  4YVS B;  2BRT A;  1W6N A;  3AP5 A;  3FFQ A;  4IV3 C;  2Y6H A;  4O65 A;  1W2T A;  2ZX1 A;  3M1H A;  4H2A A;  3RSJ A;  1OD3 A;  4DS0 A;  2GNM A;  3E6B A;  1DYK A;  2EIE A;  4CP0 A;  3FL7 A;  4ONU A;  1AR9 3;  2CGO A;  5SV5 A;  2J1T A;  5LBF A;  1YJK A;  3WT3 A;  1GUI A;  4N53 A;  3VDD B;  5LEJ A;  2CAV A;  1JU4 A;  1VBB 1;  2QUO A;  5LAS A;  1UU6 A;  2WAA A;  2VVF A;  3E5X A;  4COU A;  5CFD C;  3VBR C;  1EUT A;  5L36 A;  3HJR A;  1K12 A;  3TEX A;  2QQI A;  3DN7 A;  1BZW A;  5DZE A;  2OII A;  2TEP A;  3IB3 A;  3FFZ A;  3VKN A;  3E6C C;  5CB7 A;  2JEC A;  2Q5T A;  1FOD 2;  1XNT A;  1RUH 3;  5E8A A;  2GSY A;  4CDQ A;  2BPA 2;  2VMH A;  5AVP A;  1RMU 1;  1U5Z A;  2J22 A;  1J58 A;  5CFC C;  1BMV 2;  1JBC A;  3VHN A;  3VBH A;  3WQ0 A;  4NII A;  4UWD A;  4AHW A;  4LMF A;  4FFH A;  3CQO A;  3GHM A;  3MUY 1;  3T2P A;  2B46 X;  5JXJ A;  3WHU A;  4E2Q A;  1VBC 3;  1HX6 A;  4YW7 A;  5JSO A;  4V2V A;  2FCV A;  4KWK A;  4NIA A;  1BQP A;  1HXS 2;  2LW8 A;  3AKR A;  4LKD A;  3MV1 1;  4HZF A;  1AYN 2;  1DFQ A;  2D6L X;  1QNY A;  3QBQ A;  1XOY A;  2GC1 A;  5H9S A;  1PK6 A;  1FMD 1;  2ORX A;  4P9I A;  3S5Q A;  5H9Q A;  4XJ8 A;  3CJI B;  4PBP A;  4S2G A;  1D2S A;  4Q26 A;  4QHB A;  3VBS B;  4OVE A;  3MID A;  1JUI A;  1SLL A;  3H1W A;  4JX0 A;  4NUB A;  5FUP A;  3ZYJ B;  3TEZ A;  3OD4 A;  4YM2 A;  1MQT B;  2VL4 A;  2BTV C;  3IDC B;  3CU7 A;  5CBL A;  2B9U A;  4CCE A;  4P5H A;  1OA4 A;  4PIX A;  5DDJ 2;  4HBN A;  2P17 A;  4MV2 A;  5CU1 A;  3HN1 A;  3ACL A;  4YM0 A;  3OF1 A;  3IAP A;  5EYY A;  4RS5 C;  1C1F A;  1OPO A;  4Q8L A;  3K75 B;  4P9G A;  3G6J B;  3MLJ A;  2ZGU A;  2ZGK A;  1UY4 A;  2B42 B;  2VTX J;  2YU2 A;  4I09 A;  4EN8 B;  4M4R A;  4BCU A;  4TN7 A;  3LA7 A;  1FPN 3;  1STM A;  3PVE A;  5A3L A;  1HN0 A;  2P37 A;  3JB4 C;  3ETP A;  2WT1 A;  3OY8 B;  4AXO A;  1W8W A;  4CU9 A;  1GV9 A;  3FJS A;  1F4H A;  3AP4 A;  1O91 A;  4NWV A;  3AP9 A;  5A70 A;  4X8P A;  1GLH A;  1R1A 2;  2UUR A;  3VD4 A;  2G9F A;  1OFN A;  1W6Q A;  5FPV A;  1NCR B;  4IEO A;  3OSD A;  4UW5 A;  3A23 A;  1P8J A;  3OYW A;  1HB2 A;  4C1X A;  1ALY A;  1CZV A;  3MIF A;  5F2W A;  1UYY A;  2RS5 1;  4IGP A;  5FYI A;  3S7I A;  2Z42 A;  3D0S A;  1UKG A;  3D0J A;  3ZYP A;  3ZFG A;  3TAY A;  2QNK A;  4EZ4 A;  2A6X A;  1O5L A;  3H1M A;  4IEQ A;  1ULG A;  2E26 A;  4OLL A;  1SMV A;  4XUR A;  2P4E A;  2Y33 A;  4KG0 A;  1W9F A;  2DCJ A;  2VNO A;  1VBD 2;  3ILR A;  5FZ9 A;  5JXH A;  4EWE A;  4ISR A;  3LEG A;  1ZZ7 A;  2ILM A;  4GB3 1;  5DG1 A;  4W6X A;  2HEY F;  2R6Q A;  4P02 B;  2WNU A;  4O9G A;  1D4V B;  2Y6F A;  4YVS A;  4YZ5 A;  4L2N A;  4JGY C;  4QDR A;  4OZO A;  1ASJ 3;  2VME A;  5L7O B;  5H9P A;  5HV4 A;  1ZZ6 A;  2WNV B;  4AAX A;  3U78 A;  5A6X A;  4XFI A;  1TEI A;  4QPI B;  1AYM 1;  2A3Y A;  2WSV A;  3J7L A;  3LEK A;  2BEO A;  4XUO A;  4FFF A;  5GZF A;  1VB2 A;  1LEC A;  1QJU 3;  3U4S A;  2A3W A;  2DVD A;  2WQ4 A;  4Q4X 3;  2R32 A;  4ZU4 A;  1LES A;  5C9A C;  1GSL A;  2ZHL A;  4PDW C;  5A80 A;  2QTW B;  1RIN A;  2GNB A;  1GFF 2;  1ZBE 2;  3BGA A;  4YW6 A;  3WX5 A;  5BNO C;  1RUE 1;  3JD7 2;  3MIB A;  1OPM A;  3ITQ A;  3S57 A;  1EY2 A;  3I2F A;  1RXF A;  1AR8 3;  2P2K A;  1YIP A;  2PXJ A;  5FR3 A;  4PI0 A;  1W06 A;  3TN9 2;  4AFM A;  4P9X A;  1OLQ A;  1Z78 A;  4FQZ A;  4CDX B;  4AW7 A;  3BTX A;  3MIH A;  1ZM1 A;  2BVB A;  5FP4 A;  4ATE A;  3T0A A;  1KJL A;  3KT1 A;  5LW9 A;  4HVO A;  5DAV A;  1H6X A;  1LHN A;  3N9Q A;  3Q8A A;  4NHY A;  1H2M A;  4W50 A;  5GJ6 A;  5ABJ B;  1ZX5 A;  4HKW A;  5C5T A;  2IXH A;  1ZA7 A;  4QX2 A;  5FY4 A;  2VZP A;  2GDF A;  4E27 A;  1I5Z A;  1OUR A;  2ZEZ A;  4CYD A;  3MIG A;  1EAH 3;  4KGQ A;  5A7P A;  3TBD A;  4AZZ A;  1UXX X;  2EA7 A;  1W6O B;  3KS7 A;  1DLC A;  1Y43 B;  1W39 A;  3VBS A;  3DXU A;  4NPM A;  1GZT A;  3SNM A;  3CZU A;  4JDO A;  1MQT A;  5AC9 2;  5JIA A;  5T5P A;  2PA7 A;  3M3I A;  1W3V A;  4QMA A;  2RR1 3;  3W20 A;  3GZE A;  2Q8E A;  3C7H A;  1RC6 A;  4FTS A;  5T5O A;  4AR2 A;  1WBL A;  1UL9 A;  2MEV 1;  2VCB A;  3FE5 A;  4XF1 A;  1V6J A;  3S30 A;  3JBG 2;  1PK6 C;  1XRU A;  2W1W A;  1REE A;  3FN9 A;  5FUN A;  1N3P A;  1U12 A;  1ODN A;  5DUU A;  4CUA A;  5FRE A;  2YGL A;  3OG2 A;  4BIO A;  1TVG A;  4G3Y C;  3I2H A;  3PVB B;  1UYP A;  3N9M A;  4DIQ A;  1J3P A;  2I45 A;  2JEM A;  4JCK A;  1WW4 A;  2K2S A;  4XFG A;  4YG6 A;  2XBO 3;  4MLO A;  2QQN A;  1ULD A;  3H50 A;  4PCR A;  4Y1V A;  4LIV A;  4XJA A;  1NXD 1;  4LNV A;  5GKA C;  1PIV 2;  2GAL A;  4LEJ A;  1HDK A;  2GMP A;  5CKM A;  3V0A B;  4M4P A;  1XC6 A;  1AJK A;  1O8S A;  5HBA A;  1H9P A;  2D43 A;  2ZHN A;  3RNS A;  4EN7 B;  3N9N A;  3V0B A;  3K4A A;  3ZYG A;  5FZO B;  4FT8 A;  1GQH A;  4TYS A;  2DV9 A;  3FHQ A;  1RUH 2;  4FP3 A;  4XFH A;  1EP0 A;  2VZ3 A;  1GQP A;  1Y9Q A;  2WZE A;  5FYH A;  3PDQ A;  4AFD A;  1W0N A;  4A6O A;  2OXB A;  2WNV A;  3ZN5 A;  3KV5 A;  2ES3 A;  3B9C A;  4YGD A;  2RS3 3;  1VBE 3;  3NWK A;  3B3Q E;  4YPJ A;  1QXR A;  5FYU A;  3V56 A;  4LKS A;  4QPI A;  1VBC 2;  1BEV 1;  1BVP 1;  2QKD A;  1Q8Q A;  4YW1 A;  1BJQ A;  5JSP A;  3H8R A;  2RM2 3;  2BU9 A;  3OPZ A;  1JZ6 A;  2YPJ A;  5EZW A;  2RJ2 A;  1WLW A;  3DF0 A;  1ZRF A;  2A6Z A;  1V9U 1;  2VW2 A;  5J98 B;  2OS2 A;  4FFI A;  3F95 A;  3ZXF A;  4FPE A;  5IAX A;  3QH7 A;  5K0U B;  5I8T A;  4KNC A;  3BU0 A;  5F3G A;  2PHF A;  4ET7 A;  2BBA A;  4MXW B;  3ES4 A;  4IEP A;  4Y4Y A;  3BU7 A;  4FAH A;  4LA3 A;  1DDL A;  3I8T A;  2VR4 A;  1ULF A;  2ZA9 A;  2ZBJ A;  4A42 A;  2ZMK A;  3GBW A;  5LAT A;  5J09 A;  3VDD C;  1CAU B;  3SEE A;  1DQ0 A;  1MS8 A;  3POY A;  4KQ7 A;  1SHW B;  4X6R B;  3ACH A;  4WM7 B;  4ZPI A;  3WHT A;  2R16 A;  3D5O A;  4YGC A;  4XYX A;  2E7T A;  3AMP A;  3ENR A;  2EIG A;  4BLI A;  4YVW B;  4QB1 A;  4KWU A;  1AVB A;  2Y26 A;  2YHJ A;  1RUC 3;  1RUD 1;  4X6Q B;  5ABJ A;  3EYP A;  1G8W A;  1QNW A;  3NAP B;  2O14 A;  5A6Z A;  4ZXE A;  3FLP A;  1FPN 2;  4XPV A;  1YUD A;  2GN7 A;  2WS9 2;  4BH9 A;  1W3X A;  4CCK A;  5IVJ A;  4EQV A;  3BI3 A;  4GXL A;  1ST8 A;  1H4H A;  1HV1 A;  5A33 B;  1W28 A;  4QXH A;  2PHD A;  5EQU A;  3RI9 A;  1RYY A;  2C1F A;  1NA1 B;  2LUW A;  3ZKU A;  1DGR N;  5DUW A;  2ET1 A;  1LKN A;  3LDK A;  2WWU A;  4IL7 A;  4A7Z A;  1H8V A;  1US2 A;  3ES1 A;  4A7K A;  4AE2 A;  2JIJ A;  3RMY A;  1XNK A;  4NOT A;  1ACC A;  1VRH 1;  4K7J A;  3SH4 A;  3HR9 A;  1AJO A;  1WWY A;  1N1V A;  1V6K A;  3UYJ A;  4CEW B;  3T2Q A;  1GBG A;  4LHL A;  2WUH A;  4OQ8 A;  3O1S A;  3PIG A;  4UXA A;  3ZDS A;  4CA9 A;  2KR2 A;  4I30 A;  4KI5 M;  4DXS A;  1UMH A;  4NHM A;  3I59 B;  3CJI C;  3PUH A;  4AI9 A;  4BWO A;  3NW4 A;  3WIN E;  3INA A;  4JHZ A;  3VBS C;  4HVR A;  1PMH X;  5M0T A;  4QHO A;  3IPV B;  1ASJ 2;  4EZH A;  1S2K A;  5D21 A;  4YW3 A;  2E32 A;  1KDK A;  2RMU 1;  2HBU A;  3AYA A;  4NRO A;  4Z92 B;  4LR4 A;  4Q0V A;  4RGK A;  2FDG A;  3ACF A;  5FPL A;  4B4Q A;  1UZV A;  3UK9 A;  5JR2 A;  4TTG A;  2QQV A;  5KXB A;  1RGS A;  3RPQ A;  2EIC A;  4LOR A;  5EXO A;  5FY1 A;  4AQT A;  5AC9 1;  1LJ7 A;  5ACA 3;  3O12 A;  5FYY A;  4Q4V 1;  3NQH A;  5A3O A;  4Q4X 2;  5KHH A;  1LOC A;  5FUI A;  1OA2 A;  2Q4S A;  4N43 B;  4FPJ A;  4PF5 A;  1S4C A;  5J3U A;  3V0A A;  1J83 A;  3PIJ A;  4LBJ A;  2MPF A;  3T0B A;  4ZHN A;  1YFY A;  1UU5 A;  2DUO A;  1E57 A;  2HWC 1;  3FBY A;  3OEA A;  2ZPX A;  3HWJ A;  3QOP A;  4LKF A;  2XWJ B;  3MW2 A;  5GLZ A;  2FMY A;  4XF9 A;  2BP6 A;  4RHV 1;  5FZO A;  4F3J A;  5KHG A;  3DYM A;  1EPZ A;  1NCR C;  2WA4 A;  3AP6 A;  2JDH A;  5FYC A;  4NR1 A;  2JG8 B;  1SFP A;  2X5I A;  5FYZ A;  2VUC A;  3MDP A;  4MZU A;  2DF7 A;  3O0W A;  2WAB A;  1G9F A;  1SDW A;  2EXI A;  1GNY A;  2XON A;  2ZGQ A;  2XH6 A;  1SBD A;  3MUZ 1;  1WMX A; 
#chains in the Genus database with same CATH homology
 1VRB A;  4IGQ A;  4QXC A;  5FZ1 A;  5FZC A;  4CCL A;  3PU3 A;  5K4L A;  5A80 A;  5FYT A;  5F3C A;  2YBP A;  5FZH A;  5FZ8 A;  5A1F A;  3AL5 A;  3N9L A;  5FZM A;  4BXF A;  2OQ7 A;  2OS2 A;  2XDV A;  3RVH A;  4UF0 A;  5A3W A;  2W2I A;  5F3G A;  5FBJ A;  4C8D A;  2OT7 A;  4D6S A;  5FZ4 A;  2OX0 A;  2PXJ A;  4QWN A;  4CCN A;  4ASK A;  4D6Q A;  5F5A A;  5FPA A;  4EYU A;  5FZK A;  5A7S A;  5ANQ A;  5F5C A;  5FP4 A;  5A7O A;  4GD4 A;  5FWJ A;  2YBS A;  5FPB A;  4V2V A;  5LW9 A;  5A7Q A;  3N9Q A;  5IVB A;  3AVS A;  5IVF A;  2XML A;  3PUS A;  2YU1 A;  5FZ7 A;  5FZL A;  5FPU A;  5F3I A;  4QU1 A;  3OPW A;  5F39 A;  5CEH A;  5FY7 A;  5FYB A;  5FY4 A;  3OPT A;  4LIT A;  5A7W B;  3NJY A;  5FY5 A;  4UF0 B;  4CCK A;  5IVJ A;  3LD8 A;  5IVE A;  5A7P A;  5A7W A;  3KV9 A;  4BIS A;  3KVB A;  4QXH A;  5FJH A;  4NUB A;  5KR7 A;  4Y4R A;  5FUP A;  3K2O A;  5FP9 A;  4LIU A;  3LDB A;  3DXU A;  2GP3 A;  3PTR B;  5ISL A;  2WWU A;  3K3O A;  3KV4 A;  5FV3 A;  4CCO A;  3N9P A;  2YPD A;  5FP8 A;  2Q8E A;  4LXL A;  5E6H A;  5FXX A;  2Q8C A;  4CCM A;  5FY0 A;  4QX7 A;  3PUR A;  2VD7 A;  3UYJ A;  4QX8 A;  5FYS A;  5FXW A;  2YU2 A;  5FP3 A;  2P5B A;  4CCJ A;  5IVC A;  4TN7 A;  4BU2 A;  5LWB A;  5FUN A;  3K3N A;  4DO0 A;  5F32 A;  5IWF A;  5FZ3 A;  5A3T A;  4AI9 A;  2WWJ A;  5FP7 A;  5LY2 A;  5FY9 A;  3N9O A;  4EZH A;  3DXT A;  5FYV A;  3AL6 A;  4HON A;  3N9M A;  4DIQ A;  3PUA A;  4URA A;  5A7N A;  4CSW A;  5FZ6 A;  2YBK A;  5FPV A;  5F37 A;  5F3E A;  4IGO A;  5FPL A;  4D6R A;  2GP5 A;  4XDO A;  5F2W A;  5IVV A;  4IGP A;  5FYI A;  5LY1 A;  5FY1 A;  5F5I A;  2OQ6 A;  4GAZ A;  4LIV A;  5IVY A;  4CUG A;  4EZ4 A;  5FYY A;  5FZD A;  4Y3O A;  5IW0 A;  4E4H A;  5A3P A;  4QXB A;  4GJZ A;  5FZG A;  2Q8D A;  3PUQ A;  5FZ9 A;  5FZF A;  3ZLI A;  5FXZ A;  4XDP A;  3KVA A;  5FWE A;  4GJY A;  5FZA A;  2XUE A;  5F2S A;  4AAP A;  3N9N A;  3PU8 A;  3ZPO A;  5FZO B;  3KV6 A;  5A3N A;  5FZ0 A;  3AVR A;  5FYM A;  5FXV A;  5FZO A;  3U78 A;  5FYH A;  3PDQ A;  5FYC A;  5FJK A;  5FYZ A;  3KV5 A;  5FZE A;  2XXZ A;  5A1L A;  5FYU A;  5FY8 A;  4V2W A;  4Y33 A;  5FZI A;  3U4S A;  5FZB A;  4HOO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...