2Y33A

S-nitrosylated phd2 (gsno soaked) in complex with zn(ii) and un9
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
216
structure length
215
Chain Sequence
b'LPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMVAYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EGL NINE HOMOLOG 1
publication title Studies on the Reaction of Nitric Oxide with the Hypoxia-Inducible Factor Prolyl Hydroxylase Domain 2 (Egln1)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 63
structure length 215
sequence length 216
ec nomenclature ec 1.14.11.29: Hypoxia-inducible factor-proline dioxygenase.
pdb deposition date 2010-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 2y33A00
3NNFA 5M0TA 3OUJA 5EPAA 3BVCA 4ZPIA 2HBUA 2FCVA 5C5UA 4NAOA 4NHYA 5LASA 4NHXA 4BQXA 4KBZA 5ERLA 5L9RA 3KT1A 2G19A 4Q5OA 4XCAA 2A1XA 3GJBA 2FCUA 3GJAA 2RDNA 2RDSA 3PL0A 2HBTA 2RG4A 4NHKA 5EQUA 4XCBA 3EMRA 3NNJA 4J25A 5LB6A 5DAQA 5HV0A 3NNMA 5IATA 2G1MA 5LA9A 5IAXA 4ZONA 3GZEA 5LATA 5A3UA 4NMIA 3OBZA 4NHMA 5L9VA 5LBFA 5LBBA 4Y5SA 4XACA 3DKQA 3ITQA 3W20A 5LBEA 5C5TA 2V4AA 2Y33A 4NHLA 4BQWA 3HQRA 4XC9A 3OUHA 2Y34A 5EP9A 5DAWA 3KT4A 5DAVA 5DAPA 4XAAA 2RDQA 5DAXA 3W21A 3HQUA 4IW3A 4MHRA 4JZRA 2FCTA 5IAVA 5HV4A 5L9BA 3KT7A 3MGUA 2JIJA 4XABA 3NNLA 4MHUA 2RDRA 2JIGA 4Y5TA 2OPWA 3OUIA 4BQYA 5LBCA 4UWDA
chains in the Genus database with same CATH superfamily
3D8CA 1KJLA 1VBB3 1SQ4A 3AP7A 4LLFA 3VHRA 4GIQA 1GP5A 1TE1B 2ZBJA 2ZGUA 4GH4C 5I0TA 4XUPA 1RC6A 3OYWA 1N1TA 5KHKA 3NJZA 5AC93 4Q2FA 1U5ZA 1JYWA 1KFUL 1K45A 4LIVA 1CJDA 2HWE3 4HZFA 4XJ9A 1GNYA 5FYVA 4J6GA 5A1LA 1QQP2 1YI7A 2J7MA 3I2IA 2ORZA 2DTWA 3OGVA 1JMUB 3I2DA 4M4PA 4DRRA 2VMGA 4YM3A 3N7LA 3WDVA 1RMU2 1V6NA 1S0JA 4N90A 3WZ1A 2RR12 2BTVC 1E5SA 2PAMA 5FJHA 4HOOA 5JXJA 3MUZ1 5G05L 5ACA1 2R6QA 4Q0UA 2YFZA 5T5JA 2AZ5A 3BTAA 4P9YA 2WAAA 5HI0A 3VBOA 4E2SA 3IDBB 2ARXA 3AYEA 2Z79A 3V65A 3HN1A 2Y64A 3T1MA 4YW5A 3KGZA 3NNMA 2WABA 2W5FA 3FHAA 3DKWA 4OQ9A 1VR3A 3ZYRA 4E2QA 1H8TB 4OI1A 1A8DA 4XBNA 4Y1YA 5JPNB 1TNRA 1C8M2 2Y38A 3AL6A 5FK8A 2PAEA 2FHRA 3N9PA 4FPHA 4J1XA 4AVTA 5F8PA 2VMHA 4ZONA 1RUG2 5FRAA 4P14A 4HK8A 1H0BA 1HQWA 4QB6A 2WA4A 5DUXA 2YGMA 3WDTA 1H30A 1ZZBA 3K46A 1ULDA 5F9TA 1OHFA 2YC2A 5FOJB 5C3RA 5HCAA 4D94A 1NLRA 3NJXA 4NPLA 5DABA 2Y0IA 4PI2A 4AGVA 1IGOA 5FY1A 2ZHNA 3VKOA 2BNMA 3PU8A 5LBFA 4OI4A 3P3NA 4P02B 4AVVA 4CE8A 3I59A 3UGGA 4FO9A 1VBE1 1YEWA 3ZSKA 4XACA 4DZGA 1JZ4A 2R1DA 2J1AA 3VZLA 1KEXA 3M8LA 2AH2A 4Y24A 2P6HA 2UWCA 2CU5A 5LBEA 3VV1A 2K46A 1CAVA 2Y33A 3AFKA 4YYOA 3D3AA 3U10A 1L7LA 1WMXA 4WVZA 3BTYA 1UZWA 4L2NA 4YZ5A 2VOXA 4PIZA 3MDPA 4HKLA 5FZCA 3WW1A 5D2AA 3ZFFA 3O0VA 2ARAA 2Y34A 3LDBA 5EJZB 2Q8EA 4QKFA 1QNWA 4GH4B 4L0PA 5DAVA 1LKNA 1POV0 3ROUA 3SH5A 5J48A 2OW4A 2D40A 2YBPA 5GJ6A 4WM7C 1ULFA 5GZDA 3VD4A 5D1IA 1JTZX 3FLTA 3ZM8A 4XDPA 4KG0A 3N9NA 2ZS6B 1R091 3SISA 1VAVA 3GZUC 1CAUA 1YJKA 1CR7A 3APBA 1DQ0A 3KLSA 3T2TA 3H7YA 4XPVA 4P5HA 3ZXDA 4N53A 1XPWA 4OHXA 5ACA2 3ZSLA 2WZEA 3NV3A 1JBCA 2NPIA 2OPWA 2WO7A 2A3XA 3KGLA 1CAXB 4XDOA 2B42B 1W8OA 4CDUC 4IQPA 1EPZA 4IXLA 4QB2A 2RHPA 2EXJA 1OSGA 1O6UA 1SBFA 2WINB 1EUUA 1V9U1 2VQ0A 3Q8FA 2P37A 3OUJA 3H9AA 3I3DA 4MV2A 4AQ6A 4DEQA 5E89A 4CDXA 5T5PA 2WQZC 2X5IA 4A45A 1O3TA 2ZGKA 3E97A 3WP3A 3KV9A 4GKXA 5FP3A 3WCRA 1SBDA 1XSQA 4NHYA 4MGQA 3RMYA 1UMHA 1WLWA 2ZPXA 1CGPA 1OD5A 4BWOA 3MEPA 4W6XA 2G19A 3E5XA 1DP0A 1G8WA 1GZWB 4ITCA 4Q5OA 5FP9A 1QJU3 3BUCA 5TSWA 2WZR2 2VMCA 2ZTNA 2PMWB 1C4RA 1XE7A 1VBE2 3AMPA 4EN0A 1LU2A 1LEDA 1D4M3 3ACHA 1JZ3A 1ND2C 4WM8A 2VTXA 1SLIA 1W0PA 2QQWA 3M2MA 4OHZA 1CX1A 3WDWA 2J1UA 1F2NA 1JUHA 2Y26A 2Y6GA 3U78A 4N7UA 1UOJA 3DECA 5HV0A 2XHKA 1CD3G 1OQEA 3N9QA 4F3JA 4JKMA 1VBC2 1QJFA 1QOTA 3AZYA 3SCFA 4A3XA 1PO23 5EXOA 1Y7BA 5DN2A 4BDVB 1RB8G 4KMQA 2GNMA 5ANNA 3AP4A 3SEEA 3R6SA 4BZ4A 1W3VA 4BCUA 1OPMA 4IE6A 5DQ0A 2LUWA 5JI7A 2XUMA 2VOVA 3FMGA 4WM7B 4UT5A 4URAA 4BQ4A 3DUIA 4P9LA 1R092 4EN8B 3OBTA 1B35B 4BQ1A 1PNGA 2BRTA 4XFBA 4UAPA 1HRI3 1CZTA 1WLCA 2WL1A 3WT3A 5LEKA 3ITQA 2PHLA 3NL1A 5FKCA 3LSDA 3TYJA 3WQ7A 3ZSJA 5C6CA 5J96B 1X9PA 4LT5A 1WUVA 2QDNA 3LAGA 1YHFA 5JI9A 1GICA 4YSFA 4XJZA 4ES8A 3AKSA 3J8F3 3FN9A 1XNTA 1OVPA 4PIYA 4BK5A 1V9U2 4UF0A 4W50A 3PVBB 4XC9A 3ZKYA 3BI3A 3FLRA 2XG3A 4XHXA 4ARXA 4DXRA 1WW7A 4GJZA 4XF3A 2XJPA 5FPAA 1W8HA 1S2KA 1PGL1 4K40A 4CP9B 3TN91 4NVPA 1H1MA 2MEV3 2OUHA 2IZWA 4NOTA 1FAYA 4D7SA 1C57A 3LSEA 4CDQA 1AUYA 1OXCA 5H9RA 1LR5A 2D3PA 1F4AA 4E8DA 4XURA 4JVAA 1IS3A 3LF7A 3N4MA 4XABA 2N7GA 3VBRC 4LBMA 4RFRB 4QPIA 1UZVA 3QACA 4LUKA 4Y22B 3WP5A 2CYFA 2YMZA 1ND2B 5LBCA 2WS93 1DYPA 2QQJA 4RR3A 4I3GA 1RITA 3LEKA 2B39A 5FUIA 1EAH1 3SNMA 1X8EA 4XQ4A 3I3QA 3NAPB 4Y20A 5GLZA 4E4DX 4HL0A 3SC7X 3H8XA 4YW2A 1NT0A 4JTOA 5FMDA 5FQ0B 4COUA 4CTEA 3AZZA 1BJQA 3HT1A 3H8RA 3JD71 2GU9A 3LIGA 3C7OA 3BVCA 5LRSA 1V6JA 1RUE3 5FYTA 4Q4Y1 1W8ZA 5A6XA 4WVMA 4CU7A 3ASIA 1COV3 4JKLA 2E63A 4A3ZA 5FMOL 4GULA 1DZRA 1JYCA 4LPLA 1GWKA 4XFFA 4JCKA 5JMCA 5DPNA 3OEAA 3VBHB 2Q1ZB 2NYYA 2FMDA 2VUCA 4Z1VA 3UK9A 3LOBA 1R081 1WLDA 4ZU7A 1CIWA 4CEYA 3POGA 4FXGB 2HWF1 5D8AC 3POIA 5T5LA 4X6RB 2WSUA 5KXDA 5FZ0A 5FK7A 4QHOA 1WCKA 2QDRA 1YC61 2VR4A 3OJBA 5F2SA 4B29A 4C90A 4IV1C 4YVWA 4CP2A 5BNQA 2PLV3 4QMAA 1OC1A 1J83A 1RUJ1 1VB2A 4MVTA 4H55A 4MX3A 1W9FA 2VOWA 4TSVA 5FV3A 3NJYA 3LEIA 4ZXEA 1OH3A 3PIGA 1RUC3 4SBVA 4LR4A 3WUCA 2HWB3 1J58A 2VNOA 3VBSA 1QXJA 1GQHA 4IGOA 4RS5C 4YW6A 1T2XA 4CDUA 1XU1A 1RYYA 1PGL2 2VBBA 4NMIA 3MIGA 3TN92 3AX4A 4FCAA 5GZGA 3PURA 4TLFA 5FYSA 5FZ7A 2JKXA 2WA3A 2ZXQA 1I5PA 3A21A 1JYNA 5FYMA 3V64A 2D7FA 2ZAAA 2IXJA 4PLOA 1IPJA 3O7OA 5JAXA 3HNYM 3DPRB 4FI9A 1EV13 2VW1A 4HMZA 2Y60A 4CCOA 1T6BX 5T54A 1Z7S3 2OPKA 3BPZA 1W8WA 3VBRB 1GNZA 5GLVA 5FBJA 3IIIA 3MYXA 4NHLA 3ZDVA 1VIWB 1EAH2 2YHJA 5C8WA 2XLFA 3AMHA 5C9AA 1F5JA 4JX0A 3RS6A 5I93A 4P9JA 2NMOA 5IFPA 1IHMA 3JD72 1XYOA 2LS6A 4YARA 4D3WA 5LW9A 1QDCA 4FAGA 2J1EA 4Q4Y2 5A3NA 1DQ1A 3I2OA 2W1WA 3WY6A 1TVGA 1UKGA 3CNAA 1REFA 3KV4A 5DAXA 3ZR6A 1JZ5A 1G86A 3R4UA 3CQOA 4N43C 1DFQA 4INDA 5FZAA 3AVRA 3SKVA 5C71A 4FFFA 4IW3A 5JOYA 2DUOA 3B7MA 4Q26A 1QJY1 2RJ2A 4GMP0 4JGZC 4QX5A 1RUH1 3WG2A 1R082 2BU9A 5EHDA 3POWA 5KC5A 1WW5A 2HWF2 1REDA 3C8XA 2VW0A 2R0HA 4IEZA 3VZMA 1MS8A 1OOPA 1OF3A 2RJKA 3WCSA 5D8AB 3ZX7A 5IVBA 2IXHA 1AR91 1UQXA 2XVKA 5C7GA 4FQZA 3NV2A 2P4EA 4MXWB 1POV3 1YQ8A 4IV1B 1NCRA 1ULPA 3NO8A 4QPYA 3INAA 5FP8A 1QGLA 1I9RA 3O1OA 1SPPA 3C7GA 5M0TA 1ULGA 3AKRA 1X50A 1J3PA 4AI0A 5C8CA 3TWIA 3WNOA 3IM0A 2QQLA 2WNUA 4PDWC 4GQ7A 1S4CA 2VGDA 1RUI1 1Y9QA 2KM2A 2ZKLA 2GSYA 1Q43A 4WZCA 1LOFA 4RS5B 1MS1A 2F4LA 2QQVA 1H6XA 1H9WA 1O8PA 4COWA 1AR71 2AUYA 1DQ2A 1ZA7A 2EXKA 2GNDA 5L9RA 3MO4A 4OULA 3SXWA 5J3UA 1E57A 5CKMA 5GLUA 1R1ZA 1RXGA 1EYBA 3K51A 4XE9A 2TUNA 5EWSA 3M3OA 3KM5A 1W6NB 3VGIA 2RG4A 4JDOA 3RZMA 4JDNA 1AL21 3TOJA 1SLTA 1TNFA 1ZX5A 4AI3A 4AQSA 1PGW1 2OQ6A 4PQ9A 3WG3A 5FLHA 4YGBA 3VBUA 1RUNA 2JE8A 2JDAA 4D6QA 4JGYC 1KD7A 4L97A 4Q1RA 2BBVA 3RQ0A 3AP6A 2PELA 1XOYA 3H8OA 1SDWA 2CGOA 1K3IA 5JXIA 1XU2A 2PN5A 3FX3A 4IV3C 5J37A 4RHV1 3P1IA 3HEIA 5FZHA 3WF1A 1WCDJ 5L7OA 3CLPA 2XONA 4W6WA 3ZXKA 2XR4A 2UY8A 3ZPOA 3LFMA 4M3CF 2AGSA 1MEC3 3POSA 4AFDA 3ACGA 4AI9A 1VRBA 4I30A 3HBKA 4M4RA 3A0NA 1H2LA 2WZ8A 1Q8QA 1JXNA 4N43B 4LE4A 3F2ZA 4Q27A 4ZU5A 1K5JA 3IPVB 4LOTA 1LHVA 1QJY2 2B9VA 2DVBA 2FQPA 2VY0A 3WW4A 4AFBA 2VQTA 1RUH2 5IK7A 4Z92B 1L3JA 1DU3D 2PA7A 4JGZB 2BWCA 3OPWA 5A7WB 3T0BA 2DCYA 2XJUA 2ZX4A 5FZ3A 4LNVA 3OGGA 5GZCA 2CWSA 4P08A 4LHKA 4JQRA 1AYM3 1AJKA 1N1SA 4OMCA 1UOGA 4P9WA 1NA1C 3VD5A 3WV6A 3ZFEA 1AR92 1Y9MA 3ZPYA 1ENRA 1NQJA 5A3PA 4OQ8A 2PHDA 2R041 5JXGA 3ZSEA 5E88A 1HB3A 4QDRA 1J59A 1U5XA 4BMEA 4BYYA 1POQA 3J4UH 4CU8A 2LM3A 1W6OA 2RV9A 3OD0A 3ZXEA 3H50A 4PT6A 5A32B 2ZZQA 4ARYA 4PBPA 5FUNA 2JG8B 1DDLA 2OYZA 1PIV2 3SEPA 1RUI2 2WT2A 2RE9A 4LQRA 4PDWB 4COZA 1OUSA 2A5ZA 2VVDA 2W94A 3V0AB 4HKOA 1LB2A 1AR72 5JR7B 4BXSV 5AFBA 3WDYA 2J42A 2WN2A 2BFUL 4LUMA 3BU7A 4LE3A 1PMIA 4YZ1A 3KQRA 5HXVA 2BPA2 1TMF2 4LA2A 2WUHA 5FZKA 1LOGA 2GNBA 1VBB1 2PYTA 4Q4V3 3PDQA 2XBO2 2ZJCA 4CEWC 4QAWA 3A0KA 1PGW2 1SCRA 3O0XA 4MYEA 5FXXA 2Q8DA 3UGHA 2A3WA 3IN9A 1A8MA 3GCWA 3JZVA 3ILNA 4MADA 2QBXA 2CAUA 2EXHA 2ZGTA 4LKSA 4GWIA 1W6PA 1XXNA 4JGYB 1JH5A 4K6BA 3WOGA 5AC91 1OD3A 4F7ZA 5JLVA 4YGEA 1YI9A 4RHV2 4IEYA 2WZPP 4IE0A 4IV3B 2VNVA 2NLRA 3VLBB 2W08A 2W92A 3GBFA 4YVSC 2LTNA 4AQ2A 3EB7A 5JSPA 1AX0A 1UY4A 4CPBD 5HCBA 4DS0A 4IEPA 4K1YA 3SMHA 4XILA 3BB6A 5EFUA 2IFRA 4UFKA 1OF4A 5FPXA 4LLOA 2VUJA 1NX9A 1XE0A 2ZX0A 3T09A 1ZBA2 4MLOA 4RGAA 4BMBA 1ASJ1 3SQOA 4A42A 4XMAA 2RMU2 5CG8A 4MOAA 4YWAA 4B7EA 5LCWL 2WT1A 1LECA 4WVVA 4I0WB 2XPJA 4C8DA 5K0UC 1JYTA 2P3IA 2ERFA 1HV1A 3ZXFA 4XOGA 1O4ZA 1OKQA 4ATEA 1G9CA 2VTXJ 3BN6A 3EBRA 3WQ1A 4OI2A 1NA1B 2VXJA 5HCFA 2EAAA 3WUDA 2J22A 2R042 5FFOC 3WF3A 1W05A 4YNIA 1ZREA 3I54A 4ONUA 1CAWB 2WNVC 1QF3A 5FXZA 3I2GA 1YWKA 4LBLA 2Y6KA 2P6CA 5EZWA 5A6YA 1S1AA 2J1RA 3OGRA 1REEA 4QGLA 4KU7A 3JBG3 3I3BA 2OT7A 1D2SA 2P1BA 3MZHA 1E5HA 3KV5A 4K21A 2VBDA 3HQXA 1K5MC 4FQ4A 4Y5SA 4CUBA 1UYXA 4Y1VA 1YXWA 5FP7A 4ASLA 4NIGA 1GANA 4XFHA 2ZMNA 3JCIA 4V2WA 3AP9A 4DUVA 3HNBM 1VBB2 4O61A 1WD4A 3VKFC 1S0BA 2I74A 1OUXA 1JZ8A 1CPMA 3BCWA 4H3WA 1KGYA 3NRUA 4CEWB 1FI2A 1RIRA 1DIWA 2JJ6A 2WNOA 2XMLA 3T2PA 3I49A 1R1A3 5JOWA 4BJ0A 5BXXA 2W87A 4TLGA 5IHRA 3AMQA 5AC92 2ZHMA 3H3UA 1BBT3 2SLIA 3GNEA 1AXZA 4LJHA 4MSVA 3SHRA 2FD8A 3O0WA 1UU4A 4LEJA 1C8NA 2VMIA 2BFUS 3MLKA 2VULA 5CKQA 5KXEA 1ZVFA 4CU9A 2RS33 5FJKA 4GWMA 3THCA 1RVF3 3JXSA 1VBA3 3W21A 5KHIA 1O3SA 1EUTA 3G6JB 4YVSB 4CDWC 5A33A 2GNTA 3L2YA 3WW3A 4WZFA 2OA2A 1LOAA 1TQ5A 1ZA4A 2XDVA 5L36A 3I8TA 3KT7A 3O14A 2JECA 3V0BA 2D93A 1RUD3 1ASJ2 2EIEA 1NUKA 4UBGA 1H8TC 5DDJ3 2PFWA 1V0AA 2CDOA 2FMYA 4AG4A 2VJXA 3F95A 3R4SA 2ADDA 3OGJA 5K0UB 1RUG1 4UWDA 4A7ZA 4HVQA 1FV3A 1ODNA 3S5QA 1SLBA 1WD3A 1Y3TA 2XKPA 2YV8A 2ZGSA 3CO2A 3N7MA 4QM9A 2Q8CA 1OA2A 2WC2A 2WNVB 3NSTA 4YG3A 2BOJA 2R0FA 4TYSA 3RJRA 4GMP3 4RQPC 5FDBA 2D6NA 4R9CA 5C3OA 5H9SA 3T2QA 4Q4W3 2HYKA 3I3EA 4PBOA 1QJU1 3VKMA 4Y5Z0 2Z42A 5GKAC 3BKZA 3GXUA 5ABJC 2X8KA 1JZ6A 2PQQA 2ES3A 3T1LA 1D4M1 1US2A 3KWVA 3I2JA 3ME2A 1LOEA 4LITA 4CZSA 5A80A 2FCUA 1AJOA 2VTFA 2JEMA 2R30A 4LA3A 2R1BA 3RZKA 4F8AA 2AEZA 1UL9A 2B45X 3AXEA 1WBLA 5FY5A 4XCBA 1AR63 3NNJA 1BHGA 4IE7A 5A3OA 1OA4A 2YBSA 1PO21 2QTWB 1RINA 2JDZA 3GM8A 3ES1A 2W1QA 4IEWA 2ZHLA 5A7QA 1CESA 4HXCA 4LBQA 4XUTA 3AJYA 2DF7A 3T30A 1FV2A 4PLMA 2D6OX 1LNSA 5APAA 1BK1A 1VB4A 3DN7A 1BEV1 2BQPA 2BGCA 2WWSA 4XXPA 2MPFA 5LK5A 4OLLA 1LJ7A 1I6XA 4XVHA 5A3UA 4LULA 4IESA 1GWMA 1HV0A 1OURA 1XE8A 4BISA 4P00B 4I0AA 2BNOA 1QDOA 1O8SA 1F15A 4UW3A 2XJTA 1TME3 3LPGA 2VZ1A 1HRI1 1QJX3 3FUQA 4MGYE 5F3GA 3ZMOA 3OSDA 4CDWB 3U0ZA 3K3NA 1HJFA 1JOPA 4M3CA 3ZFGC 4LHSA 5A7NA 3PIJA 4DXZA 3S5AA 3IDAA 4L8QA 4L92A 1BVVA 4TXWA 1YFUA 3VBFC 1STMA 2YGLA 3W59A 4YPJA 5F5QA 1A6CA 4MUVA 3J26N 5LA2A 3J8F1 4N9HA 2FBEA 3J7HA 5FZDA 4CCJA 2VCMA 4XJWA 2JG9A 4C1WA 1PHMA 1UO9A 3VKLA 2LROA 2BZDA 1XYNA 2DCKA 3AB0A 3WEZA 3N36A 3ZN5A 3ZN6A 4D7YA 1KRIA 3ZYHA 3ACLA 1C5IA 2MEV1 4AAXA 1OI6A 5LWBA 4FAHA 4YFZA 5CFCB 2HEYF 2WZR1 4XAAA 4AOCA 4RQPB 2CTVA 4KG8A 5FR3A 4ATFA 4Q0SA 5CADA 1QJU2 2NQYA 4COVA 1N3QA 1KITA 4JZRA 4GD4A 1YUDA 4PF5A 2HWD3 2DU0A 1D4M2 5ABJB 4QX0A 2JX9A 4NE9A 1WCQA 3W5NA 4E8CA 1HKDA 3I2KA 4HKWA 3WHUA 3NNLA 4YLZA 4KNCA 5IT6A 1VBC1 5KHGA 1ALYA 1MS0A 5CAZA 3MIBA 3OD4A 1PO22 3Q8CA 3I2HA 1K5MA 5DZFA 3CEWA 1RUE1 1JOJA 1RJ8A 5FY0A 2X10A 1S2BA 4MGKE 1Q8OA 1BEV2 1UXZA 1B35C 3VDDB 2H0BA 3AKPA 2TEPA 3FHIB 4ISRA 2CL2A 3O5SA 2ARCA 4XTPA 5CVRA 2WWJA 4FT8A 1MQTC 1UNBA 1ND3C 1W9SA 3GHMA 1YYNA 4M00A 3C3VA 1K42A 3POEA 1GKBA 1HRI2 4DEVA 2B46X 4HPKB 3FZ3A 3GJBA 4OUSA 4P9GA 4YGCA 2QVSB 4B4QA 4L99A 4ZHNA 3BOWA 4A7YA 4X6QB 4CVUA 3POFA 2JICA 2PLV1 3ZFGB 3RI8A 3RZHA 3TBDA 4QKBA 2YXSA 2EICA 3VBFB 1ST8A 3J8F2 2Y6LA 1IS6A 5LEJA 1LAJA 1M06G 4LKDA 2HWB1 2V4VA 5FZ9A 1HN0A 3GZAA 2DVFA 4QX7A 3N7JA 1H8VA 1KDKA 3UESA 1H8TA 5LA9A 4QHZA 4ES9A 1H2KA 4C0HA 2MEV2 3O1RA 3E6DA 4JHTA 1SCSA 2Y8KA 1QJEA 1ZBE3 2VQUA 4FPCA 5EV7A 4DFSA 1O3QA 2X53S 2Z69A 1LESA 1NE6A 2QQMA 4BPZA 4LK7A 1EV11 3K4ZA 2E26A 4NIHA 4AL9A 1DLLA 1Z7S1 1VBD3 2OS2A 3NAPC 4YM1A 2WS92 1UF2C 1XYPA 3SH4A 3WD5A 3QH7A 1YQCA 4LIUA 1AX1A 1W8FA 4XZPA 5KXBA 5JUVA 1ONAA 3LB9A 1W03A 1UYPA 4BQWA 1VJ2A 5FYYA 1NE4A 5KHHA 1RUE2 4QX1A 3DL3A 4O9GA 5FAXA 2HWC3 3OUHA 4DRVA 2BNNA 4YW7A 1COV2 2HLEA 3O1MA 2A6ZA 3VBHC 1W2AX 2LALA 3KT4A 1HB2A 3KHBA 3WNKA 5LK7B 2BBAA 4PI0A 4GH4A 3D0JA 4WBBA 4OYUA 5KC6A 4BM8A 5IK4A 3USUB 4BQ2A 1V6KA 1UY1A 4I0BA 3WG4A 1MQTB 2FDJA 1ND3B 2O0OA 2QQIA 4GZ9A 4U36A 4A6OA 3WNMA 4CXYA 3HJRA 1WZXA 5AVAA 5J36A 3TEXA 5FO8B 2VZUA 3URFA 2DV9A 2VU9A 2O14A 1X8MA 1URXA 2PLV2 4Y5TA 2VE1A 3J7LA 4FPFA 3N9LA 5JSOA 2CY6A 1CAXA 4DXTA 2VZOA 4JAAA 3AMMA 3I2FA 5K7PA 3BTZA 2HWB2 1QIQA 3AZXA 2IXCA 5A1FA 2WDBA 1AYN3 1JODA 4XF4A 4QXKA 2DVGA 3K77A 1W90A 3U07A 1N3OA 3W58A 1FOD3 4FOVA 4NROA 4EWEA 1FPN3 3LIHA 4JHZA 2YPDA 2VVEA 1AX2A 3DPRC 4S2DA 4E4SA 1U5YA 3C7FA 4FP2A 1I1EA 1CPNA 2OVUA 4HG6B 4E4ZA 3IZOA 2AC1A 1EV12 1F31A 1UU6A 3N35A 3LEMA 1GZWA 2ZX2A 1Z7S2 1VP6A 4JRLA 5FXWA 4AI8A 1LULA 3WSOA 4Y26A 4XTMA 3FWEA 5BY5A 4NPRA 3ZN4A 1WWYA 5KHJA 5CKNA 1CVNA 1HLCA 5I0RA 2ZMLA 2G9FA 3K2OA 4UW5A 4B1LA 3O1SA 3ACIA 1W6MB 2GH2A 3MI8A 4AXOA 3S0MA 3NWKA 4B8EA 5FO7B 1HB4A 2BUKA 1LHNA 4E4HA 1OLME 3PUAA 3CF6E 1MEC1 3ILFA 3R4DB 4KWJA 4L11A 1JW6A 3PTRB 3KHCA 1PZ7A 2XJRA 2JDMA 5F32A 2P3YA 4UW6A 4GJYA 3SH3A 1GLHA 4YM0A 2A71A 2EALA 3OBZA 3CZJA 3WVJA 3N9MA 3IAPA 3LE0A 4BOWA 4Y1UA 4ZXKA 1ZRRA 3CHXA 2JE9A 5FXVA 2QZ3A 2VECA 3CL1A 2O1QA 4WM7A 3ZXJA 1GZTA 4ASMB 2YY1A 1B35A 1AYM1 1W2TA 1JYVA 2KR2A 2W52A 3B9IA 2XJSA 1H4HA 1QXPA 1W2UA 4M01A 3W20A 5BNPC 1NZIA 3AVSA 2PHRA 1BVP1 3KVBA 4RGGA 5C3SA 3ZXAC 1O5UA 1OT5A 1QKQA 5LY1A 1OH4A 1TZOA 3CBNA 5BNOC 1GZ9A 2CSGA 1MS3A 2YB7A 4Z07A 5A70A 3ZKUA 1IS4A 2VZRA 1NCQC 5E1RA 1DGLA 4A44A 3ON7A 2B9UA 1VMJA 3RSJA 4Q0PA 4FFGA 3TRSB 3PMEA 3KF5A 1GP4A 3SCHA 5IK5A 2FZ1A 4UBHA 2BJSA 4CP9A 5JR2A 5CBLA 1UY0A 2Y0OA 5FPLA 1OBNA 3S7IA 2NZ9A 2D6KA 1JU4A 4KWUA 1JZ7A 4FP3A 4WV8A 2JKBA 4FOWA 5DMYA 5SV8A 4XFGA 2BP6A 3P5BA 4DPNA 3CJIC 1OFSA 1GQGA 4IE4A 2YYOA 5HPOA 4LXLA 1ZZ6A 3WQBA 4FPLA 3ZXGA 4MGIE 5GLWA 5FPZA 5FY7A 4A7KA 1VRH3 4GB33 4XUOA 1S0DA 1C1LA 4Y22A 1DQ6A 5C33A 2QQUA 4AF9A 5GZFA 3S57A 1ND2A 5HCHA 3VZKA 3RZZA 1O4TA 3WDUA 5FOBB 3TAYA 4R9BA 2GDFA 2GC0A 1LGCA 1Q5OA 2I07B 4K20A 5JIUA 3NAPA 1W0NA 3N7KA 1DZQA 1GSLA 1UWWA 5K4LA 2DFCA 1LODA 3E6BA 5CFDB 3OBRA 1MEC2 3P6BA 3R0RA 5FQ0A 3WG1A 4YG0A 2H6CA 3D82A 3OBAA 5DUUA 3VZNA 4A2UA 3HOBA 5C4WB 2UU8A 3E5UA 3ZMNA 2F4PA 1ULCA 1WCUA 2DYCA 1UOBA 2GP3A 4BLIA 2GZWA 2XGXA 3DF0A 1TEIA 2VD7A 2XL7A 3AC0A 1YJLA 4KU8A 1UXXX 4CCKA 2W2IA 1DGRA 3GYDA 2D3SA 1WKYA 2VNGA 3JQWA 2DCJA 1MPXA 2ILMA 2PHUA 3GJAA 2BOIA 3K3OA 3QH6A 3L9JT 4MH0E 3QBQA 1AYM2 2KD7A 2PTMA 2W39A 2VZSA 4M0NA 3FE5A 3Q8AA 5IYYA 1PMJX 1PK6C 3GZTB 5LB6A 3VKNA 3WF4A 1LHUA 4GA9A 1O4YA 5BNPB 1QEXA 1QWRA 4R52A 1UYYA 1RHI3 2JG8C 2BGPA 3BYWA 1MZFA 4XF0A 5JXHA 4UYBA 4XQDA 3I4IA 1JU3A 1PIV1 4U2AA 3S30A 2RS53 5BNOB 4IEXA 5FZIA 1O5LA 2D5FA 3JBG1 1NCQB 3MUY1 4Q4X3 2EF6A 2WIIB 2GN7A 4NUBA 4Q0VA 4AEJA 4KBBA 4BLJA 2IWGB 4IGPA 2P5BA 1BXHA 1H1AA 3DYMA 5DUWA 1LGBA 1PVXA 3OGSA 1OKOA 1W28A 4LTAA 4GXLA 4JQTA 2ADEA 2EVXA 1TMF1 4NHMA 1SFPA 3B00A 1JS9A 3OPZA 3Q8EA 1FNYA 4J1WA 2BVVA 3LWCA 2XBO1 3PUHA 2UYAA 3FC0A 2VOTA 4IEVA 4Q4V2 2XQXA 2QQKA 1EP0A 2ZGNA 3TN93 1OQDA 1QY4A 4XQWA 4B4RA 2E7QA 2PXJA 4AYUA 5KXCA 3CJIB 3DPRA 4XJUA 3WP6A 5BNNC 1UPIA 2C9AA 4QPGC 1D2QA 4EQVA 4JV4A 1SZBA 4ZZ8A 4EROA 3VBRA 2QCSB 1BBT1 4D6SA 2R073 1G7YA 2B5HA 3EHKA 3BPSA 4FFHA 5F3CA 4XIKA 2OZJA 2ZKNA 3HQRA 2ZZJA 2BW8A 2OQ7A 1WMFA 1LOCA 1W06A 2RS31 4GAZA 1RVF1 5FZEA 3LEGA 4W4ZA 2A6WA 1DQ5A 3G7DA 2WAOA 3M7AA 1OMIA 2VXRA 3BALA 4ZU4A 4AVCA 4LBJA 2RDQA 4W6YA 2VUDA 1ZBA1 2GC1A 1IQDC 4IERA 1Z78A 1I5ZA 2BWAA 1I3HA 3CIHA 2RMU1 4QGMA 5K9YA 1ZM1A 2WFPA 5IAVA 1AR83 1DBNA 2UURA 3B02A 2JDPA 2O8OA 5DDJ1 2DUQA 2XXZA 5GLTA 4Q1PA 5JZGB 3H3LA 2YG0A 4NRQA 3MPBA 4LO4B 1JHJA 1YFXA 1VALA 2JD4A 2VO5A 2VBPA 1GOHA 4ET7A 3WP4A 1WA4A 3HNMA 5F39A 1IG0A 2W46A 2DU1A 1PK6B 5LA0A 5D8AA 1C28A 2BYVE 3FHQA 2QKDA 1R083 4IETA 1S0CA 2V73A 4QB1A 3ZYGA 3VN4A 1G9FA 4JKKA 4MXWA 2C26A 4QXHA 1W6QB 2B4KA 2EIGA 2HWF3 1ENXA 4GMP1 4IV1A 4YG6A 1XNKA 3ZR5A 3N3HA 4LK6A 4AW7A 2ARBA 2UYBA 5KWRA 3JBG2 4CP1A 2Y6FA 4UFLA 1RUJ3 5FZLA 3IWZA 5LASA 5FZ1A 5FZ4A 5FTTC 1O91A 3PNAA 2JDYA 3UJQA 3KT1A 1MVQA 4RS5A 3IT8A 2G4IA 5CEHA 1BYHA 4ORFA 3JQXA 4QQPA 4R9AA 1AR61 4HETA 4FPYA 1ULEA 4PF1A 5IVYA 5CB7A 1RXFA 1W6NA 2WBKA 4F83A 4O7XA 4I3PA 3MW3A 3THDA 1R1A2 4UW4A 4ASKA 2VL4A 5BNNB 1H6YA 2HWE1 2UWAA 3MLLA 4QPGB 1RL3A 1BBT2 2ZEYA 5B2GB 4MXVA 3RNSA 1JN2P 3NV1A 3UL2A 1OLRA 4XAEA 3KCYA 4W8JA 4LBOA 2OXBA 3O1VA 2RS32 3J7NA 2XH6A 1Q8VA 1RVF2 4N8MA 1VBA2 3W9AA 1TME1 4AEDB 2WO1A 2QUOA 2D6PA 1IPKA 2BGOA 4AEKA 4FPGA 5JOZA 2ZEWA 3FFZA 5FYUA 5CNAA 3RRDA 3AP5A 1RUD2 1PX3A 2Q30A 3H42B 5DG1A 3VBOC 3MIHA 5A3MA 1ODMA 4O9EA 3WF0A 3MICA 1YQ2A 2FDHA 4N43A 5DDJ2 5JOXA 3ILRA 3P3PA 3EYPA 3IPVA 2R16A 1SMVA 1U0AA 1AF9A 3GHNA 4FTBA 4JGZA 3OB8A 1PM7A 1DHKB 2Q5TA 1PMHX 3B69A 4UFMA 3DGTA 2GC3A 5DUVA 5FZMA 3HD8B 1PGSA 2WYSA 3H1MA 3MIEA 2YFUA 3U4SA 3FLPA 5FUPA 2AEYA 1XB9A 3NJVA 1XJAA 1RTVA 3M1HA 1QXRA 4Q0QA 1SHWB 1J1TA 2WLQA 3MV01 4K8RB 4JTNA 1N47A 5A32A 1CQ9A 3QOPA 4KWKA 4LORA 2GAUA 2JG8A 4KI5M 5FZOB 1G9DA 4K3UA 4MGSA 2Y6JA 4PDWA 4D69A 3V0AA 4QDQA 2DCZA 4K9SA 2W47A 4XBLA 2XVGA 4DXSA 3HBZA 1GYKA 3T4HB 4COYA 4K1ZA 3OY8B 2JIJA 4I01A 4META 1AR62 1W04A 1SBEA 3ETQA 1UIKA 2FDFA 3JUUA 3DEMA 1QH7A 3TEZA 3VD3A 2WFF3 4YZ2A 5F5IA 3ZIWA 3ZFFC 3WHTA 4M0HA 1J1LA 2AACA 4RL7A 1G6NA 4HK9A 4PHZA 2D97A 2HWE2 5CYYA 5E8AA 3UKNA 3OYWB 5FYZA 4BIFA 4ZZ5A 1AL23 1KQRA 1T6GC 2RJLA 2RM23 5A3WA 2I45A 5F7UA 3IB3A 2DVAA 1H2NA 1EPWA 2K9ZA 4JGYA 1KS4A 3OOXA 4XF9A 3DV8A 2XB6C 1Q8PA 4IL7A 4KGQA 1GNHA 1TME2 5C5UA 1JOBA 2GMEA 4IV3A 4NAMA 3O12A 4XJAA 1QJX2 5LZ6A 4N53C 1W2OA 1WW6A 2ZOEB 1ZRCA 2VPVA 2YC4A 1MVEA 4YRDA 4HVRA 4XMIA 3T2OA 5J09A 2FZ2A 1NY71 3POJA 3UKTA 4KL1A 3VZOA 1BLZA 3HVDA 3PTYA 5B4XA 5CA6A 3VBOB 1PVC3 4H7MA 2RDNA 1CONA 2RDSA 4QGNA 5I0DA 2DFBA 4XF1A 4NPMA 3MHZA 1RUF3 2CGNA 2ZEZA 2A6XA 2WYFA 5I91A 3ZYFA 5K8SA 3AMNA 3H0OA 1UMIA 4RGKA 3TNPB 3GBWA 2VZVA 4QQLA 4R9DA 3RGBA 4CDXC 2X5IC 3GALA 4R4XA 1N3PA 2UWBA 2XKOA 2A6VA 5CFCC 1SFNA 5FZGA 4B7KA 4H2AA 2DURA 1G9AA 2GMMA 1NA1A 2QQNA 4ZKTB 2AENA 3HN3A 2ZGPA 1YIFA 4XFAA 1CAWA 2WQ8A 5JCTA 1YLLA 4S2HA 3SITA 4FBFA 4CYDA 4NRMA 2HWD2 3TNQA 1Q3EA 3I59B 1NG0A 1VBD1 3T0AA 2VG9A 4MG2A 4WM8C 5CZKA 5LBBA 4OUMA 4EZHA 4UFIA 1HRV3 2VCCA 3FL7A 4GWNA 3L2HA 1GUIA 3THPA 3VL8A 2WO3A 1CAVB 3MBWA 1GR3A 1TG7A 3C2UA 2E51A 3ZVXA 4C1XA 1UW8A 2L9LA 4GKYA 3DXUA 2DDUA 4Y3OA 3VB9A 3SKJE 1U12A 1SLLA 3VDDC 3AFGA 2HWC1 4QM8A 3KMHA 3ZFFB 3T3YA 4AVBA 4Y1XA 1VAMA 3WDXA 4N7IA 3C7EA 4CEWA 5F1RA 2LW8A 4LBKA 1SEFA 2H0VA 3ACFA 3AXDA 3UV9A 4AVAA 3HR9A 3IDCB 1H4GA 1GZCA 1SLCA 2OIIA 3LPFA 3POYA 4QKDA 3B5LB 3E6CC 1DQ4A 1NQDA 3RI9A 1F8VA 4NIDA 1CAUB 1Y43B 5BPXA 3VDBA 1WGPA 3QCWA 1IZ3A 2GALA 2VMDA 2WJSA 4N53B 3M3CA 1H1IA 3IMNA 4YVSA 3PMSA 3PJQA 1NY72 3J9SA 1MZ5A 3IBMA 4S2FA 5HV4A 2JENA 4OZOA 3MGUA 4NIIA 1S55A 1PO13 2EA7A 3KCXA 3A7QA 2IXIA 4OHYA 4MHUA 1Y4WA 2QJVA 2XHNA 1YFWA 3OUIA 2ZGOA 3KF3A 4YZ3A 2Q4SA 3FBMA 4XIOA 2R063 2GC2A 2X05A 2QFEA 4BH9A 1C5HA 2XWBB 1AYN1 1HX6A 1W99A 4TZDA 4XETA 1D4VB 1ASJ3 1MS9A 3ATGA 1D0HA 1RJ7A 4UXAA 3LA3A 2X5IB 5K0UA 1FOD1 4CDXB 3VZJA 1FPN1 4HSJA 1UX7A 2JDHA 3ETPA 4AAPA 4LO8A 4DY3A 1ZBE2 4BB3A 5LA1A 4AWDA 2A70A 1FMD3 1R64A 2ZEXA 1W3XA 3CDZB 4CDQC 1KS5A 1OLMA 4CSWA 4NAOA 2BVBA 2WNVA 5ISLA 4CP0A 1F35A 1QNYA 4OI0A 1W0OA 1DGWX 3V56A 2WS91 3LDRA 2WR9A 1VBD2 3VD7A 4XCAA 4QPIC 2RS13 1W8TA 1D0GA 4WM8B 2Q8OA 4XBQA 3H1YA 3POBA 4RR3C 2V72A 4AFAA 2QQOA 5EQUA 1WBFA 3H3ZA 5FMBA 3WQ0A 4OCTA 1IS5A 1HXS3 4E27A 4NR1A 1COV1 1VLNA 1VPHA 1ZNPA 3WLUA 4XFCA 4XEZA 2HWC2 3RYPA 4BE3A 2AREA 3GF6A 5FPBA 3D6EA 4EE2A 1Z0HA 1C3HA 1XSRA 3WINE 5FZBA 4HFSA 1PZ9A 3U37A 3RYRA 1UPSA 4LBQD 1J3QA 3I7DA 3T0DA 2J1VA 1LRHA 4AHXA 3AYAA 4AHWA 4HLTA 2EAKA 1SG3A 2DUPA 2ET1A 3WX5A 2WKKA 1XNDA 2C9KA 4LKEA 4CEYC 4OFGA 2JB8A 1ENQA 2TBVA 4AHYA 1QQP3 3MIFA 1UZ0A 2E31A 4XXAA 3A23A 1W9WA 3IAQA 4AGGA 1RMU3 4YVWC 4S2GA 4QX2A 4CDWA 2RR13 2OX0A 2E33A 1RUC1 2ZHKA 4HVOA 4Y33A 5C5TA 1XC6A 4L9BA 2C5DA 3KSCA 4RSUA 5I0SA 2D6LX 4LBNA 2R32A 5T50A 1SDDB 2DBNA 1QOSA 1NKGA 4HBNA 2ZAHA 3VBSC 4FPEA 1V6MA 4UF0B 1AYN2 1J3RA 5FWEA 1U5IA 3VUOA 1XNBA 1FOD2 1N1VA 3MF6A 2FDIA 3NNGA 1FPN2 4D0QA 1LOBA 1C8M3 4RN5A 4XHBA 3WR0A 5EJ1B 1UCXA 2VZTA 3LDKA 4CXWA 1RUG3 3DYOA 5A6ZA 3KV6A 3RMXA 3TEWA 4CDQB 1IOAA 2ORXA 4MZUA 1AVBA 5CFCA 2WRAA 3AJZA 1DG6A 2G9GA 4RQPA 3QD6A 1O59A 3FBYA 3T08A 5A3LA 1YFYA 2VQAA 2VZ3A 2ID4A 3ZYIB 2CAVA 2CNAA 4QPIB 3IDEA 3NW4A 5ABJA 1VRH1 4TWTA 4GB31 1NLQA 3NKTA 2KA3A 4RR3B 3B9CA 5C9AC 1NXD1 1UOFA 4LHLA 1H2MA 4O65A 1GMMA 1US3A 3KVAA 1X82A 4Y20B 4BQYA 5JDBA 5IK8A 3LCPA 5J1XA 5FREA 2WO2A 1BZWA 4XZUG 4UOJA 4CCLA 2CV6A 2P34A 1WA6X 2XWJB 3OF1A 2YZ4A 3CJXA 4B1MA 3PUIA 5DXDA 3IKWA 3N9OA 5FP4A 4NRPA 4WVMB 3B01A 2X09A 4IE5A 4HN0A 2W1SA 4SLIA 4IEQA 3NKGA 3HIFA 1N1YA 5L73A 3WW2A 2FCVA 3OEBA 5F37A 1V6LA 3VDDA 4C0BA 3O1TA 2VZPA 4KBZA 3ZLIA 4A6SA 4RYDA 4CCCA 3W5MA 2FDKA 3B3QE 2VW2A 1W8NA 1BEV3 1FYUA 1VAKA 2A1XA 1OOPC 2E53A 1POV1 2WLPA 2Y6HA 4CEYB 5FO9B 1RUOA 2KXLA 5C3PA 1BMV1 2HBTA 5AVPA 2ZGQA 1DYKA 3QLQA 4HPKA 4NHKA 3RPQA 2C4XA 3ALQA 5KR7A 1AZDA 1NCRC 1RHI1 2VAUA 3CZUA 1RUC2 1GBGA 4YVWB 1HQLA 4J25A 5ACA3 5DAQA 4JRAA 3ZFGA 3K4AA 5C8CC 1CJPA 2EIBA 2CHHA 1UAIA 2RS51 2WNUC 5FYHA 1HQNA 2FDGA 1HW5A 2OUJA 1S0GA 1YNAA 3VBFA 5CISA 4Q4X1 1V00A 3UKVA 2XUEA 4XJ8A 3VBSB 5FMCA 3E5QA 4IEUA 1LOFC 1FT9A 5DZGA 4CDUB 2V5DA 4JC1A 5FYIA 1MS5A 5FLIA 1HN1A 3UT0A 1J84A 2GH8A 4YW4A 3D5OA 4I2OA 1B09A 4HN1A 5T5OA 2E7AA 3NMBA 3GDBA 4MGZE 3UETA 5LRRA 5A7PA 1L7RA 5L9VA 1Y9GA 3KD4A 4AGRA 5FIXA 3J7MA 3KQ4B 4AI2A 4IDZA 2XOMA 1ACCA 2D3RA 2ZGLA 3U11A 3VBUC 4I02A 4M3CE 2WZR3 1VRH2 1OLQA 2BV4A 1O7FA 4GB32 4LO5B 4AHZA 1ZRDA 4NWVA 1VBE3 4AQTA 1KXGA 2V4AA 3AKTA 1CZSA 3WNXA 2R071 4UFHA 1CZVA 5CFDC 4D6RA 1PX4A 5C9AB 2W95A 5A6QA 1UZZA 1YRZA 5C4WC 1AXKA 1PNFA 5L7OC 4NIAA 5DG2A 4QXCA 1S2EA 3JB8A 1XNAA 1VBC3 2XL9A 4KQ7A 1DLCA 5EP9A 3ZO0B 1MACA 4NN0A 5DAWA 1HB1A 2IVJA 4QQHA 3HT2A 3ZOIA 1AHSA 2UY9A 1UZYA 2WQ4A 3ABZA 1IQAA 1AR81 3FJSA 4AFCA 5JWPA 1FX5A 5ANQA 4YZ4A 1Q8SA 3ORJA 4KH9A 4LKFA 3BTXA 1CX4A 3USUA 5CG9A 4D8MA 1MQTA 1ND3A 5H9PA 3ZFEC 3ZYBA 1OOPB 1R093 1VMFA 1BMV2 1GOGA 2VMFA 2WNEA 1VE0A 3BGAA 5JIAA 3RZLA 1RHI2 4FPOB 1KJRA 2W91A 3HAGA 1NCRB 3M70A 2J1SA 3PVEA 2P3JA 4E9KA 2RVAA 3EQEA 5GM0A 4FXKB 4MO3M 5AFEA 1SPPB 2RS52 2IXLA 1GOFA 1F4HA 3Q9OA 5C8CB 1PZ8A 2CWMA 2WNUB 2YU1A 3EJKA 4JDMA 3MFCA 4GWJA 4NO4A 4Q4X2 4R8HA 1XNCA 4B4PA 3VL9A 2E7TA 1CIYA 5GZEA 1WLTA 3K48A 1V9U3 1XBFA 2C24A 2A6YA 3AYCA 3LA7A 3PVOA 4Z2WA 2HBUA 2Q0AA 2D5HA 2K2SA 4HANA 5IVJA 2CDPA 3KZ4C 4Q8LA 1JHNA 4Q4V1 1ZYBA 2TNFA 3BIWE 3DCQA 5E6HA 4AVSA 3S6PA 5F5AA 1W9TA 4D7TA 1ZRFA 2HYXA 1QHDA 3U1XA 1KDMA 2D98A 4LHNA 1ZZ8A 2B7YA 1UMZA 3HWJA 3LFIA 4G9SB 1DZTA 4FVVA 3B94A 2OZ6A 4BA6A 2JDKA 4OZXA 5IFTA 1V70A 4BQ3A 4OHWA 3VBUB 3EMRA 1W2NA 4EZ4A 1QMJA 5I8SA 4XW3A 3U14A 2R072 4XFIA 5GALA 1XRUA 2W3JA 3D4KA 2MNGA 3ELNA 1BCXA 1F9KA 2D43A 2NM1A 1OFNA 2V5YA 4CCDA 2BEOA 4LO6B 5IWFA 4FPKA 3NQHA 5BV6A 3PU3A 1YIPA 3PVNA 4DQAA 1NXMA 2ZABA 4TTGA 3UYJA 5L7OB 2PHFA 1X7NA 4P9IA 1UYZA 1W6MA 4CUAA 5IAXA 3KS7A 4XUNA 2QZ2A 2D6MA 5T52A 2XQRA 3AKQA 3Q8BA 2PHTA 4W65A 1DYOA 2WSVA 2E32A 5JZGC 5F3EA 4QPWA 5FY9A 3SCGA 4AFMA 4UI9L 5F6KA 2VZQA 1AR82 2A75A 2I2SA 1SFYA 3AZWA 1GV9A 3WF2A 4A41A 3O1UA 2DWRA 3GBGA 4PLNA 5A7OA 2NMNA 4BXFA 2JB4A 4FTEA 1UN1A 5IW0A 1O3RA 1NAEA 2GP5A 1E5IA 4OUEA 3LD8A 3ZFEB 2NP0A 2F6BA 4FSJA 4Y1ZA 1ENSA 1JZ2A 1A3KA 3FUOA 4UFJA 5FPVA 5FY8A 4QHBA 1V6OA 2ZA9A 4DMIA 1RGSA 3LQCA 4GALA 1W6OB 2JDUA 2P3KA 4TN7A 2Q1MA 3JB4C 2H6BA 2D44A 1X36A 3WXPA 1Q56A 4IGQA 4AI1A 1SLAA 4DO0A 5CU1A 3LA2A 4ZY9A 5F3IA 1RUJ2 2C6SA 2YPJA 4PQQA 5DAPA 1UU5A 2ET7A 3M3EA 5FMOS 1UD1A 3T4VA 1G9BA 2JXAA 5JVVA 4QXBA 1W39A 2HJIA 4PIXA 2A3YA 1H9PA 4V2VA 3VHNA 4EWAA 4MHRA 3S7EA 2FCTA 3M4FA 1GFF2 3I3MA 1IG3A 1QJZA 1WMDA 1F5FA 1GQPA 1LHOA 1KFXL 2E9QA 2VOKA 1R1A1 3M3QA 3MPPG 2ZCWA 4PJYA 2WFF1 1GP6A 4IEOA 5EYYA 3VBHA 1XQNA 1MS4A 2JIGA 4CCMA 4H14A 4CU6A 3E1F1 4FPJA 4NWWA 4YGDA 2DCTA 1A78A 3MIDA 1BQPA 3NV4A 4KGGA 4YM2A 2C1FA 3ZDSA 1LU1A 1W6PB 3PHMA 2E6VA 2MHFA 4OVEA 1HJGA 4CUGA 2RM21 4AE2A 3JU9A 4Y4RA 2QE3A 1VBA1 4AEDC 2EXIA 4DNYA 4HT1T 3NNFA 4CPBA 1EAH3 1EY2A 2V09A 4QX3A 4EJRA 3H8UA 1NOVA 5BUVA 4KWLA 4MGTA 2LRPA 3JD73 1RUD1 2JWPA 5CFDA 2OKXA 1S0FA 3UGFA 3SLIA 4NHXA 1WW4A 4HONA 5C4WA 1APNA 4Q4Y3 4BQXA 2ZACA 5I8TA 4AEMA 2YROA 3D0SA 4YW1A 1PVC1 1GU3A 3PJYA 1AL0G 4QKNA 4YW3A 4QD2A 1GWLA 2ZX1A 4CCNA 1RUF1 5FZ8A 5IJRA 3VDCA 5F6LB 3WNPA 3BODA 5JSRA 5J7MA 2PQSA 3I97A 3VHPA 5FYBA 4FTSA 2HEVF 1IKQA 1HDKA 2VUAA 2XVLA 4C91A 4Q4W1 5KBFA 1CN1A 1ZRIA 4V1PA 5BNPA 2EIDA 5FY4A 2W9XA 2YU2A 3LGRA 1UKRA 1ULOA 1MZEA 5DZEA 2PAKA 1W9YA 2HH9A 2J1TA 3GZEA 2A7AA 3CU7A 3MV11 5LATA 1E5RA 2XJVA 1NLSA 4OHVA 4BIOA 5BNOA 2Q1FA 1X9TA 5A7SA 3RVHA 3X29B 1NCQA 1ZZ9A 1ZZCA 2CGPA 2G9ZA 5I0UA 5T3NA 1HRV1 3HMYA 3MF9A 4NJ4A 2NN8A 3THTA 3ST7A 1K12A 3VD9A 1NZCA 1C1FA 3BIEA 4XYXA 2VM9A 2HKXA 1S0IA 3KB5A 4AR2A 4QQOA 4FFIA 3MFAA 4AZZA 2AYHA 4XDQA 3ECQA 4CXXA 3U75A 1DGRN 4RFT0 2WFF2 3TB0A 4A4AA 2ATFA 1IKPA 1LGNA 3DKQA 3MW2A 4DB5A 1S0EA 4EV0A 4DOUA 5F5CA 4DUWA 5B4NA 2WN3A 2JD9A 3B93A 4ISQA 3CJIA 2JE7A 1AL22 2R49A 2RM22 2XJQA 5FCCA 5FZ6A 3RZGA 5FLJA 3ZYJB 2VC9A 2ENRA 4N9IA 2A73B 1JUIA 1LEMA 1QJX1 2IXKA 4QU1A 3DYPA 3H7JA 1WMEA 3OCPA 4CRQA 4XUQA 2W0XA 1CWPA 4X8NA 1JI6A 3GGLA 3AL5A 1FATA 4QT6A 4ZS2A 1UY2A 4QWNA 5A33B 4IUGA 5IVFA 1W8UA 1UX6A 3EO6A 3ZIXA 3O1PA 3HQUA 4QX8A 4P9XA 2W68A 3LOIA 5FYCA 1OVSA 2Z5WA 3EXUA 1PVC2 1PO11 4R4ZA 2VVFA 3V0BB 1OA3A 2DTYA 3MLJA 4PCRA 4URTA 1FXZA 1NYWA 1RUF2 4QDSA 5A7WA 2ZX3A 2R061 2JG9C 2SBAA 3NVCA 3CMGA 1QJY3 2DBIA 4P5YA 3TEYA 1PM4A 2XLAA 2RDRA 1QH6A 3RYKA 2YC0A 1RUH3 3K4DA 2O8QA 4RA0A 2VH9A 2VNRA 5JZGA 2R7EB 2QQPA 4DY5A 4HSLA 5IVEA 4Z82A 5IVCA 1SACA 2PHXA 2VCBA 4Q4W2 5J98B 3RJ2X 3USSA 1AR93 1PK6A 4K7JA 3LZZA 3GCXA 1FMD1 3AK0A 5T55A 1X33A 2PHWA 5EPAA 2W1UA 2HWD1 4DUXA 4I09A 1V6IA 1LTEA 4ZPIA 1W6QA 1YQ5A 4EN6B 3MW4A 3RFRA 3PLQA 3M3IA 3OG2A 5CIRA 3ZSMA 3AZVA 5A1AA 2ZGRA 4BU2A 2RS11 1PIV3 1HRV2 1RUI3 2C0ZA 2XLGA 3AYDA 5ERLA 3KCCA 5FZFA 5FWJA 2GMPA 4LOSA 2Z2SB 3IIAA 1VMHA 1BKZA 1AR73 1LCLA 5L19A 3U4XA 3PL0A 1DCSA 1HXS1 1QOOA 5FBZA 2ZGMA 5FPUA 5EIYB 1JYIA 2YDEA 2WWUA 3IMMA 1DGWA 4LBQB 2ETEA 1TMF3 1FNZA 5H9QA 4BQ5A 5E16A 4DIQA 2XBO3 2YBKA 4Y4YA 2K0GA 5BNNA 4QU2A 5IATA 4K8FA 4QPGA 1AXYA 2G1MA 4LO7A 4QQ2A 4CCEA 1LENA 5BYNA 2B8MA 3ES4A 1A34A 5HBAA 5JPMB 3OTFA 4YFWA 5IVVA 1UY3A 3UNPA 3OPTA 3RDIA 5HXMA 4RHV3 5F2WA 2IFWA 1QQP1 1L7QA 3HPNA 4AK3A 4EYUA 1QU0A 1WCSA 4LMFA 4Q29A 1RMU1 4WVWA 2AR6A 3UJOA 5FKBA 3RG0A 4AEDA 2RR11 1M4WA 4M3CB 3RWNA 1JYXA 1PO12 3R05A 2IC1A 3LKJA 4X8PA 3CKHA 2WT0A 3AM2A 3BU0A 1ZZ7A 3ZYPA 1YQ6A 3WNLA 4ZS3A 5SV5A 5C3QA 5A3TA 5G04L 2R062 4OMDA 4RD7A 1ZBA3 2YUEA 1MZ6A 2DVDA 2VMEA 4CA9A 2JG9B 4DINB 2RMU3 3DXTA 4G3YC 5EYXA 5IUQA 2QNKA 2VCAA 2Z4FA 3FFQA 1ZBE1 5LY2A 4BHPA 2GN3A 4CUCA 5I8YA 3WNNA 3A22A 3ZN6B 1C8M1 2HEWF 4Z2AA 1HIXA 1P8JA 1FMD2 1OQ1A 1UIJA 1DF0A 3ENRA 4H7LA 2R043 4EN9B 2IVIB 3RWKX 4EN7B 3RZJA 4E2GA 1YCIA 2JDNA 1MR5A 1BK0A 4FOQA 4FOYA 4EWDA 3ZXLA 4Q8KA 2RS12 3VHOA 3PUSA 1IPSA 5FZOA 2IUWA 2BERA 4Z8BA 2X29A 2P2KA 3PUQA 5L9BA 4BK4A 1D7PM 1OPOA 1YO8A 5D21A 1LHWA 5EJ3A 4B3NA 3VDAA 1HXS2 4G4FA 5C70A 3OY8A 3K75B 2P17A 1K5MB 3BOPA 2F17A 3H1WA 3C7HA 5JMOA 3A4UA 2ZMKA 2BDRA
chains in the Genus database with same CATH topology
3NNFA 5M0TA 3OUJA 5EPAA 3BVCA 4ZPIA 2HBUA 2FCVA 5C5UA 4NAOA 4NHYA 5LASA 4NHXA 4BQXA 4KBZA 5ERLA 5L9RA 3KT1A 2G19A 4Q5OA 4XCAA 2A1XA 3GJBA 2FCUA 3GJAA 2RDNA 2RDSA 3PL0A 2HBTA 2RG4A 4NHKA 5EQUA 4XCBA 3EMRA 3NNJA 4J25A 5LB6A 5DAQA 5HV0A 3NNMA 5IATA 2G1MA 5LA9A 5IAXA 4ZONA 3GZEA 5LATA 5A3UA 4NMIA 3OBZA 4NHMA 5L9VA 5LBFA 5LBBA 4Y5SA 4XACA 3DKQA 3ITQA 3W20A 5LBEA 5C5TA 2V4AA 2Y33A 4NHLA 4BQWA 3HQRA 4XC9A 3OUHA 2Y34A 5EP9A 5DAWA 3KT4A 5DAVA 5DAPA 4XAAA 2RDQA 5DAXA 3W21A 3HQUA 4IW3A 4MHRA 4JZRA 2FCTA 5IAVA 5HV4A 5L9BA 3KT7A 3MGUA 2JIJA 4XABA 3NNLA 4MHUA 2RDRA 2JIGA 4Y5TA 2OPWA 3OUIA 4BQYA 5LBCA 4UWDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NNF A;  5M0T A;  3OUJ A;  5EPA A;  3BVC A;  4ZPI A;  2HBU A;  2FCV A;  5C5U A;  4NAO A;  4NHY A;  5LAS A;  4NHX A;  4BQX A;  4KBZ A;  5ERL A;  5L9R A;  3KT1 A;  2G19 A;  4Q5O A;  4XCA A;  2A1X A;  3GJB A;  2FCU A;  3GJA A;  2RDN A;  2RDS A;  3PL0 A;  2HBT A;  2RG4 A;  4NHK A;  5EQU A;  4XCB A;  3EMR A;  3NNJ A;  4J25 A;  5LB6 A;  5DAQ A;  5HV0 A;  3NNM A;  5IAT A;  2G1M A;  5LA9 A;  5IAX A;  4ZON A;  3GZE A;  5LAT A;  5A3U A;  4NMI A;  3OBZ A;  4NHM A;  5L9V A;  5LBF A;  5LBB A;  4Y5S A;  4XAC A;  3DKQ A;  3ITQ A;  3W20 A;  5LBE A;  5C5T A;  2V4A A;  2Y33 A;  4NHL A;  4BQW A;  3HQR A;  4XC9 A;  3OUH A;  2Y34 A;  5EP9 A;  5DAW A;  3KT4 A;  5DAV A;  5DAP A;  4XAA A;  2RDQ A;  5DAX A;  3W21 A;  3HQU A;  4IW3 A;  4MHR A;  4JZR A;  2FCT A;  5IAV A;  5HV4 A;  5L9B A;  3KT7 A;  3MGU A;  2JIJ A;  4XAB A;  3NNL A;  4MHU A;  2RDR A;  2JIG A;  4Y5T A;  2OPW A;  3OUI A;  4BQY A;  5LBC A;  4UWD A; 
#chains in the Genus database with same CATH topology
 3D8C A;  1KJL A;  1VBB 3;  1SQ4 A;  3AP7 A;  4LLF A;  3VHR A;  4GIQ A;  1GP5 A;  1TE1 B;  2ZBJ A;  2ZGU A;  4GH4 C;  5I0T A;  4XUP A;  1RC6 A;  3OYW A;  1N1T A;  5KHK A;  3NJZ A;  5AC9 3;  4Q2F A;  1U5Z A;  1JYW A;  1KFU L;  1K45 A;  4LIV A;  1CJD A;  2HWE 3;  4HZF A;  4XJ9 A;  1GNY A;  5FYV A;  4J6G A;  5A1L A;  1QQP 2;  1YI7 A;  2J7M A;  3I2I A;  2ORZ A;  2DTW A;  3OGV A;  1JMU B;  3I2D A;  4M4P A;  4DRR A;  2VMG A;  4YM3 A;  3N7L A;  3WDV A;  1RMU 2;  1V6N A;  1S0J A;  4N90 A;  3WZ1 A;  2RR1 2;  2BTV C;  1E5S A;  2PAM A;  5FJH A;  4HOO A;  5JXJ A;  3MUZ 1;  5G05 L;  5ACA 1;  2R6Q A;  4Q0U A;  2YFZ A;  5T5J A;  2AZ5 A;  3BTA A;  4P9Y A;  2WAA A;  5HI0 A;  3VBO A;  4E2S A;  3IDB B;  2ARX A;  3AYE A;  2Z79 A;  3V65 A;  3HN1 A;  2Y64 A;  3T1M A;  4YW5 A;  3KGZ A;  3NNM A;  2WAB A;  2W5F A;  3FHA A;  3DKW A;  4OQ9 A;  1VR3 A;  3ZYR A;  4E2Q A;  1H8T B;  4OI1 A;  1A8D A;  4XBN A;  4Y1Y A;  5JPN B;  1TNR A;  1C8M 2;  2Y38 A;  3AL6 A;  5FK8 A;  2PAE A;  2FHR A;  3N9P A;  4FPH A;  4J1X A;  4AVT A;  5F8P A;  2VMH A;  4ZON A;  1RUG 2;  5FRA A;  4P14 A;  4HK8 A;  1H0B A;  1HQW A;  4QB6 A;  2WA4 A;  5DUX A;  2YGM A;  3WDT A;  1H30 A;  1ZZB A;  3K46 A;  1ULD A;  5F9T A;  1OHF A;  2YC2 A;  5FOJ B;  5C3R A;  5HCA A;  4D94 A;  1NLR A;  3NJX A;  4NPL A;  5DAB A;  2Y0I A;  4PI2 A;  4AGV A;  1IGO A;  5FY1 A;  2ZHN A;  3VKO A;  2BNM A;  3PU8 A;  5LBF A;  4OI4 A;  3P3N A;  4P02 B;  4AVV A;  4CE8 A;  3I59 A;  3UGG A;  4FO9 A;  1VBE 1;  1YEW A;  3ZSK A;  4XAC A;  4DZG A;  1JZ4 A;  2R1D A;  2J1A A;  3VZL A;  1KEX A;  3M8L A;  2AH2 A;  4Y24 A;  2P6H A;  2UWC A;  2CU5 A;  5LBE A;  3VV1 A;  2K46 A;  1CAV A;  2Y33 A;  3AFK A;  4YYO A;  3D3A A;  3U10 A;  1L7L A;  1WMX A;  4WVZ A;  3BTY A;  1UZW A;  4L2N A;  4YZ5 A;  2VOX A;  4PIZ A;  3MDP A;  4HKL A;  5FZC A;  3WW1 A;  5D2A A;  3ZFF A;  3O0V A;  2ARA A;  2Y34 A;  3LDB A;  5EJZ B;  2Q8E A;  4QKF A;  1QNW A;  4GH4 B;  4L0P A;  5DAV A;  1LKN A;  1POV 0;  3ROU A;  3SH5 A;  5J48 A;  2OW4 A;  2D40 A;  2YBP A;  5GJ6 A;  4WM7 C;  1ULF A;  5GZD A;  3VD4 A;  5D1I A;  1JTZ X;  3FLT A;  3ZM8 A;  4XDP A;  4KG0 A;  3N9N A;  2ZS6 B;  1R09 1;  3SIS A;  1VAV A;  3GZU C;  1CAU A;  1YJK A;  1CR7 A;  3APB A;  1DQ0 A;  3KLS A;  3T2T A;  3H7Y A;  4XPV A;  4P5H A;  3ZXD A;  4N53 A;  1XPW A;  4OHX A;  5ACA 2;  3ZSL A;  2WZE A;  3NV3 A;  1JBC A;  2NPI A;  2OPW A;  2WO7 A;  2A3X A;  3KGL A;  1CAX B;  4XDO A;  2B42 B;  1W8O A;  4CDU C;  4IQP A;  1EPZ A;  4IXL A;  4QB2 A;  2RHP A;  2EXJ A;  1OSG A;  1O6U A;  1SBF A;  2WIN B;  1EUU A;  1V9U 1;  2VQ0 A;  3Q8F A;  2P37 A;  3OUJ A;  3H9A A;  3I3D A;  4MV2 A;  4AQ6 A;  4DEQ A;  5E89 A;  4CDX A;  5T5P A;  2WQZ C;  2X5I A;  4A45 A;  1O3T A;  2ZGK A;  3E97 A;  3WP3 A;  3KV9 A;  4GKX A;  5FP3 A;  3WCR A;  1SBD A;  1XSQ A;  4NHY A;  4MGQ A;  3RMY A;  1UMH A;  1WLW A;  2ZPX A;  1CGP A;  1OD5 A;  4BWO A;  3MEP A;  4W6X A;  2G19 A;  3E5X A;  1DP0 A;  1G8W A;  1GZW B;  4ITC A;  4Q5O A;  5FP9 A;  1QJU 3;  3BUC A;  5TSW A;  2WZR 2;  2VMC A;  2ZTN A;  2PMW B;  1C4R A;  1XE7 A;  1VBE 2;  3AMP A;  4EN0 A;  1LU2 A;  1LED A;  1D4M 3;  3ACH A;  1JZ3 A;  1ND2 C;  4WM8 A;  2VTX A;  1SLI A;  1W0P A;  2QQW A;  3M2M A;  4OHZ A;  1CX1 A;  3WDW A;  2J1U A;  1F2N A;  1JUH A;  2Y26 A;  2Y6G A;  3U78 A;  4N7U A;  1UOJ A;  3DEC A;  5HV0 A;  2XHK A;  1CD3 G;  1OQE A;  3N9Q A;  4F3J A;  4JKM A;  1VBC 2;  1QJF A;  1QOT A;  3AZY A;  3SCF A;  4A3X A;  1PO2 3;  5EXO A;  1Y7B A;  5DN2 A;  4BDV B;  1RB8 G;  4KMQ A;  2GNM A;  5ANN A;  3AP4 A;  3SEE A;  3R6S A;  4BZ4 A;  1W3V A;  4BCU A;  1OPM A;  4IE6 A;  5DQ0 A;  2LUW A;  5JI7 A;  2XUM A;  2VOV A;  3FMG A;  4WM7 B;  4UT5 A;  4URA A;  4BQ4 A;  3DUI A;  4P9L A;  1R09 2;  4EN8 B;  3OBT A;  1B35 B;  4BQ1 A;  1PNG A;  2BRT A;  4XFB A;  4UAP A;  1HRI 3;  1CZT A;  1WLC A;  2WL1 A;  3WT3 A;  5LEK A;  3ITQ A;  2PHL A;  3NL1 A;  5FKC A;  3LSD A;  3TYJ A;  3WQ7 A;  3ZSJ A;  5C6C A;  5J96 B;  1X9P A;  4LT5 A;  1WUV A;  2QDN A;  3LAG A;  1YHF A;  5JI9 A;  1GIC A;  4YSF A;  4XJZ A;  4ES8 A;  3AKS A;  3J8F 3;  3FN9 A;  1XNT A;  1OVP A;  4PIY A;  4BK5 A;  1V9U 2;  4UF0 A;  4W50 A;  3PVB B;  4XC9 A;  3ZKY A;  3BI3 A;  3FLR A;  2XG3 A;  4XHX A;  4ARX A;  4DXR A;  1WW7 A;  4GJZ A;  4XF3 A;  2XJP A;  5FPA A;  1W8H A;  1S2K A;  1PGL 1;  4K40 A;  4CP9 B;  3TN9 1;  4NVP A;  1H1M A;  2MEV 3;  2OUH A;  2IZW A;  4NOT A;  1FAY A;  4D7S A;  1C57 A;  3LSE A;  4CDQ A;  1AUY A;  1OXC A;  5H9R A;  1LR5 A;  2D3P A;  1F4A A;  4E8D A;  4XUR A;  4JVA A;  1IS3 A;  3LF7 A;  3N4M A;  4XAB A;  2N7G A;  3VBR C;  4LBM A;  4RFR B;  4QPI A;  1UZV A;  3QAC A;  4LUK A;  4Y22 B;  3WP5 A;  2CYF A;  2YMZ A;  1ND2 B;  5LBC A;  2WS9 3;  1DYP A;  2QQJ A;  4RR3 A;  4I3G A;  1RIT A;  3LEK A;  2B39 A;  5FUI A;  1EAH 1;  3SNM A;  1X8E A;  4XQ4 A;  3I3Q A;  3NAP B;  4Y20 A;  5GLZ A;  4E4D X;  4HL0 A;  3SC7 X;  3H8X A;  4YW2 A;  1NT0 A;  4JTO A;  5FMD A;  5FQ0 B;  4COU A;  4CTE A;  3AZZ A;  1BJQ A;  3HT1 A;  3H8R A;  3JD7 1;  2GU9 A;  3LIG A;  3C7O A;  3BVC A;  5LRS A;  1V6J A;  1RUE 3;  5FYT A;  4Q4Y 1;  1W8Z A;  5A6X A;  4WVM A;  4CU7 A;  3ASI A;  1COV 3;  4JKL A;  2E63 A;  4A3Z A;  5FMO L;  4GUL A;  1DZR A;  1JYC A;  4LPL A;  1GWK A;  4XFF A;  4JCK A;  5JMC A;  5DPN A;  3OEA A;  3VBH B;  2Q1Z B;  2NYY A;  2FMD A;  2VUC A;  4Z1V A;  3UK9 A;  3LOB A;  1R08 1;  1WLD A;  4ZU7 A;  1CIW A;  4CEY A;  3POG A;  4FXG B;  2HWF 1;  5D8A C;  3POI A;  5T5L A;  4X6R B;  2WSU A;  5KXD A;  5FZ0 A;  5FK7 A;  4QHO A;  1WCK A;  2QDR A;  1YC6 1;  2VR4 A;  3OJB A;  5F2S A;  4B29 A;  4C90 A;  4IV1 C;  4YVW A;  4CP2 A;  5BNQ A;  2PLV 3;  4QMA A;  1OC1 A;  1J83 A;  1RUJ 1;  1VB2 A;  4MVT A;  4H55 A;  4MX3 A;  1W9F A;  2VOW A;  4TSV A;  5FV3 A;  3NJY A;  3LEI A;  4ZXE A;  1OH3 A;  3PIG A;  1RUC 3;  4SBV A;  4LR4 A;  3WUC A;  2HWB 3;  1J58 A;  2VNO A;  3VBS A;  1QXJ A;  1GQH A;  4IGO A;  4RS5 C;  4YW6 A;  1T2X A;  4CDU A;  1XU1 A;  1RYY A;  1PGL 2;  2VBB A;  4NMI A;  3MIG A;  3TN9 2;  3AX4 A;  4FCA A;  5GZG A;  3PUR A;  4TLF A;  5FYS A;  5FZ7 A;  2JKX A;  2WA3 A;  2ZXQ A;  1I5P A;  3A21 A;  1JYN A;  5FYM A;  3V64 A;  2D7F A;  2ZAA A;  2IXJ A;  4PLO A;  1IPJ A;  3O7O A;  5JAX A;  3HNY M;  3DPR B;  4FI9 A;  1EV1 3;  2VW1 A;  4HMZ A;  2Y60 A;  4CCO A;  1T6B X;  5T54 A;  1Z7S 3;  2OPK A;  3BPZ A;  1W8W A;  3VBR B;  1GNZ A;  5GLV A;  5FBJ A;  3III A;  3MYX A;  4NHL A;  3ZDV A;  1VIW B;  1EAH 2;  2YHJ A;  5C8W A;  2XLF A;  3AMH A;  5C9A A;  1F5J A;  4JX0 A;  3RS6 A;  5I93 A;  4P9J A;  2NMO A;  5IFP A;  1IHM A;  3JD7 2;  1XYO A;  2LS6 A;  4YAR A;  4D3W A;  5LW9 A;  1QDC A;  4FAG A;  2J1E A;  4Q4Y 2;  5A3N A;  1DQ1 A;  3I2O A;  2W1W A;  3WY6 A;  1TVG A;  1UKG A;  3CNA A;  1REF A;  3KV4 A;  5DAX A;  3ZR6 A;  1JZ5 A;  1G86 A;  3R4U A;  3CQO A;  4N43 C;  1DFQ A;  4IND A;  5FZA A;  3AVR A;  3SKV A;  5C71 A;  4FFF A;  4IW3 A;  5JOY A;  2DUO A;  3B7M A;  4Q26 A;  1QJY 1;  2RJ2 A;  4GMP 0;  4JGZ C;  4QX5 A;  1RUH 1;  3WG2 A;  1R08 2;  2BU9 A;  5EHD A;  3POW A;  5KC5 A;  1WW5 A;  2HWF 2;  1RED A;  3C8X A;  2VW0 A;  2R0H A;  4IEZ A;  3VZM A;  1MS8 A;  1OOP A;  1OF3 A;  2RJK A;  3WCS A;  5D8A B;  3ZX7 A;  5IVB A;  2IXH A;  1AR9 1;  1UQX A;  2XVK A;  5C7G A;  4FQZ A;  3NV2 A;  2P4E A;  4MXW B;  1POV 3;  1YQ8 A;  4IV1 B;  1NCR A;  1ULP A;  3NO8 A;  4QPY A;  3INA A;  5FP8 A;  1QGL A;  1I9R A;  3O1O A;  1SPP A;  3C7G A;  5M0T A;  1ULG A;  3AKR A;  1X50 A;  1J3P A;  4AI0 A;  5C8C A;  3TWI A;  3WNO A;  3IM0 A;  2QQL A;  2WNU A;  4PDW C;  4GQ7 A;  1S4C A;  2VGD A;  1RUI 1;  1Y9Q A;  2KM2 A;  2ZKL A;  2GSY A;  1Q43 A;  4WZC A;  1LOF A;  4RS5 B;  1MS1 A;  2F4L A;  2QQV A;  1H6X A;  1H9W A;  1O8P A;  4COW A;  1AR7 1;  2AUY A;  1DQ2 A;  1ZA7 A;  2EXK A;  2GND A;  5L9R A;  3MO4 A;  4OUL A;  3SXW A;  5J3U A;  1E57 A;  5CKM A;  5GLU A;  1R1Z A;  1RXG A;  1EYB A;  3K51 A;  4XE9 A;  2TUN A;  5EWS A;  3M3O A;  3KM5 A;  1W6N B;  3VGI A;  2RG4 A;  4JDO A;  3RZM A;  4JDN A;  1AL2 1;  3TOJ A;  1SLT A;  1TNF A;  1ZX5 A;  4AI3 A;  4AQS A;  1PGW 1;  2OQ6 A;  4PQ9 A;  3WG3 A;  5FLH A;  4YGB A;  3VBU A;  1RUN A;  2JE8 A;  2JDA A;  4D6Q A;  4JGY C;  1KD7 A;  4L97 A;  4Q1R A;  2BBV A;  3RQ0 A;  3AP6 A;  2PEL A;  1XOY A;  3H8O A;  1SDW A;  2CGO A;  1K3I A;  5JXI A;  1XU2 A;  2PN5 A;  3FX3 A;  4IV3 C;  5J37 A;  4RHV 1;  3P1I A;  3HEI A;  5FZH A;  3WF1 A;  1WCD J;  5L7O A;  3CLP A;  2XON A;  4W6W A;  3ZXK A;  2XR4 A;  2UY8 A;  3ZPO A;  3LFM A;  4M3C F;  2AGS A;  1MEC 3;  3POS A;  4AFD A;  3ACG A;  4AI9 A;  1VRB A;  4I30 A;  3HBK A;  4M4R A;  3A0N A;  1H2L A;  2WZ8 A;  1Q8Q A;  1JXN A;  4N43 B;  4LE4 A;  3F2Z A;  4Q27 A;  4ZU5 A;  1K5J A;  3IPV B;  4LOT A;  1LHV A;  1QJY 2;  2B9V A;  2DVB A;  2FQP A;  2VY0 A;  3WW4 A;  4AFB A;  2VQT A;  1RUH 2;  5IK7 A;  4Z92 B;  1L3J A;  1DU3 D;  2PA7 A;  4JGZ B;  2BWC A;  3OPW A;  5A7W B;  3T0B A;  2DCY A;  2XJU A;  2ZX4 A;  5FZ3 A;  4LNV A;  3OGG A;  5GZC A;  2CWS A;  4P08 A;  4LHK A;  4JQR A;  1AYM 3;  1AJK A;  1N1S A;  4OMC A;  1UOG A;  4P9W A;  1NA1 C;  3VD5 A;  3WV6 A;  3ZFE A;  1AR9 2;  1Y9M A;  3ZPY A;  1ENR A;  1NQJ A;  5A3P A;  4OQ8 A;  2PHD A;  2R04 1;  5JXG A;  3ZSE A;  5E88 A;  1HB3 A;  4QDR A;  1J59 A;  1U5X A;  4BME A;  4BYY A;  1POQ A;  3J4U H;  4CU8 A;  2LM3 A;  1W6O A;  2RV9 A;  3OD0 A;  3ZXE A;  3H50 A;  4PT6 A;  5A32 B;  2ZZQ A;  4ARY A;  4PBP A;  5FUN A;  2JG8 B;  1DDL A;  2OYZ A;  1PIV 2;  3SEP A;  1RUI 2;  2WT2 A;  2RE9 A;  4LQR A;  4PDW B;  4COZ A;  1OUS A;  2A5Z A;  2VVD A;  2W94 A;  3V0A B;  4HKO A;  1LB2 A;  1AR7 2;  5JR7 B;  4BXS V;  5AFB A;  3WDY A;  2J42 A;  2WN2 A;  2BFU L;  4LUM A;  3BU7 A;  4LE3 A;  1PMI A;  4YZ1 A;  3KQR A;  5HXV A;  2BPA 2;  1TMF 2;  4LA2 A;  2WUH A;  5FZK A;  1LOG A;  2GNB A;  1VBB 1;  2PYT A;  4Q4V 3;  3PDQ A;  2XBO 2;  2ZJC A;  4CEW C;  4QAW A;  3A0K A;  1PGW 2;  1SCR A;  3O0X A;  4MYE A;  5FXX A;  2Q8D A;  3UGH A;  2A3W A;  3IN9 A;  1A8M A;  3GCW A;  3JZV A;  3ILN A;  4MAD A;  2QBX A;  2CAU A;  2EXH A;  2ZGT A;  4LKS A;  4GWI A;  1W6P A;  1XXN A;  4JGY B;  1JH5 A;  4K6B A;  3WOG A;  5AC9 1;  1OD3 A;  4F7Z A;  5JLV A;  4YGE A;  1YI9 A;  4RHV 2;  4IEY A;  2WZP P;  4IE0 A;  4IV3 B;  2VNV A;  2NLR A;  3VLB B;  2W08 A;  2W92 A;  3GBF A;  4YVS C;  2LTN A;  4AQ2 A;  3EB7 A;  5JSP A;  1AX0 A;  1UY4 A;  4CPB D;  5HCB A;  4DS0 A;  4IEP A;  4K1Y A;  3SMH A;  4XIL A;  3BB6 A;  5EFU A;  2IFR A;  4UFK A;  1OF4 A;  5FPX A;  4LLO A;  2VUJ A;  1NX9 A;  1XE0 A;  2ZX0 A;  3T09 A;  1ZBA 2;  4MLO A;  4RGA A;  4BMB A;  1ASJ 1;  3SQO A;  4A42 A;  4XMA A;  2RMU 2;  5CG8 A;  4MOA A;  4YWA A;  4B7E A;  5LCW L;  2WT1 A;  1LEC A;  4WVV A;  4I0W B;  2XPJ A;  4C8D A;  5K0U C;  1JYT A;  2P3I A;  2ERF A;  1HV1 A;  3ZXF A;  4XOG A;  1O4Z A;  1OKQ A;  4ATE A;  1G9C A;  2VTX J;  3BN6 A;  3EBR A;  3WQ1 A;  4OI2 A;  1NA1 B;  2VXJ A;  5HCF A;  2EAA A;  3WUD A;  2J22 A;  2R04 2;  5FFO C;  3WF3 A;  1W05 A;  4YNI A;  1ZRE A;  3I54 A;  4ONU A;  1CAW B;  2WNV C;  1QF3 A;  5FXZ A;  3I2G A;  1YWK A;  4LBL A;  2Y6K A;  2P6C A;  5EZW A;  5A6Y A;  1S1A A;  2J1R A;  3OGR A;  1REE A;  4QGL A;  4KU7 A;  3JBG 3;  3I3B A;  2OT7 A;  1D2S A;  2P1B A;  3MZH A;  1E5H A;  3KV5 A;  4K21 A;  2VBD A;  3HQX A;  1K5M C;  4FQ4 A;  4Y5S A;  4CUB A;  1UYX A;  4Y1V A;  1YXW A;  5FP7 A;  4ASL A;  4NIG A;  1GAN A;  4XFH A;  2ZMN A;  3JCI A;  4V2W A;  3AP9 A;  4DUV A;  3HNB M;  1VBB 2;  4O61 A;  1WD4 A;  3VKF C;  1S0B A;  2I74 A;  1OUX A;  1JZ8 A;  1CPM A;  3BCW A;  4H3W A;  1KGY A;  3NRU A;  4CEW B;  1FI2 A;  1RIR A;  1DIW A;  2JJ6 A;  2WNO A;  2XML A;  3T2P A;  3I49 A;  1R1A 3;  5JOW A;  4BJ0 A;  5BXX A;  2W87 A;  4TLG A;  5IHR A;  3AMQ A;  5AC9 2;  2ZHM A;  3H3U A;  1BBT 3;  2SLI A;  3GNE A;  1AXZ A;  4LJH A;  4MSV A;  3SHR A;  2FD8 A;  3O0W A;  1UU4 A;  4LEJ A;  1C8N A;  2VMI A;  2BFU S;  3MLK A;  2VUL A;  5CKQ A;  5KXE A;  1ZVF A;  4CU9 A;  2RS3 3;  5FJK A;  4GWM A;  3THC A;  1RVF 3;  3JXS A;  1VBA 3;  3W21 A;  5KHI A;  1O3S A;  1EUT A;  3G6J B;  4YVS B;  4CDW C;  5A33 A;  2GNT A;  3L2Y A;  3WW3 A;  4WZF A;  2OA2 A;  1LOA A;  1TQ5 A;  1ZA4 A;  2XDV A;  5L36 A;  3I8T A;  3KT7 A;  3O14 A;  2JEC A;  3V0B A;  2D93 A;  1RUD 3;  1ASJ 2;  2EIE A;  1NUK A;  4UBG A;  1H8T C;  5DDJ 3;  2PFW A;  1V0A A;  2CDO A;  2FMY A;  4AG4 A;  2VJX A;  3F95 A;  3R4S A;  2ADD A;  3OGJ A;  5K0U B;  1RUG 1;  4UWD A;  4A7Z A;  4HVQ A;  1FV3 A;  1ODN A;  3S5Q A;  1SLB A;  1WD3 A;  1Y3T A;  2XKP A;  2YV8 A;  2ZGS A;  3CO2 A;  3N7M A;  4QM9 A;  2Q8C A;  1OA2 A;  2WC2 A;  2WNV B;  3NST A;  4YG3 A;  2BOJ A;  2R0F A;  4TYS A;  3RJR A;  4GMP 3;  4RQP C;  5FDB A;  2D6N A;  4R9C A;  5C3O A;  5H9S A;  3T2Q A;  4Q4W 3;  2HYK A;  3I3E A;  4PBO A;  1QJU 1;  3VKM A;  4Y5Z 0;  2Z42 A;  5GKA C;  3BKZ A;  3GXU A;  5ABJ C;  2X8K A;  1JZ6 A;  2PQQ A;  2ES3 A;  3T1L A;  1D4M 1;  1US2 A;  3KWV A;  3I2J A;  3ME2 A;  1LOE A;  4LIT A;  4CZS A;  5A80 A;  2FCU A;  1AJO A;  2VTF A;  2JEM A;  2R30 A;  4LA3 A;  2R1B A;  3RZK A;  4F8A A;  2AEZ A;  1UL9 A;  2B45 X;  3AXE A;  1WBL A;  5FY5 A;  4XCB A;  1AR6 3;  3NNJ A;  1BHG A;  4IE7 A;  5A3O A;  1OA4 A;  2YBS A;  1PO2 1;  2QTW B;  1RIN A;  2JDZ A;  3GM8 A;  3ES1 A;  2W1Q A;  4IEW A;  2ZHL A;  5A7Q A;  1CES A;  4HXC A;  4LBQ A;  4XUT A;  3AJY A;  2DF7 A;  3T30 A;  1FV2 A;  4PLM A;  2D6O X;  1LNS A;  5APA A;  1BK1 A;  1VB4 A;  3DN7 A;  1BEV 1;  2BQP A;  2BGC A;  2WWS A;  4XXP A;  2MPF A;  5LK5 A;  4OLL A;  1LJ7 A;  1I6X A;  4XVH A;  5A3U A;  4LUL A;  4IES A;  1GWM A;  1HV0 A;  1OUR A;  1XE8 A;  4BIS A;  4P00 B;  4I0A A;  2BNO A;  1QDO A;  1O8S A;  1F15 A;  4UW3 A;  2XJT A;  1TME 3;  3LPG A;  2VZ1 A;  1HRI 1;  1QJX 3;  3FUQ A;  4MGY E;  5F3G A;  3ZMO A;  3OSD A;  4CDW B;  3U0Z A;  3K3N A;  1HJF A;  1JOP A;  4M3C A;  3ZFG C;  4LHS A;  5A7N A;  3PIJ A;  4DXZ A;  3S5A A;  3IDA A;  4L8Q A;  4L92 A;  1BVV A;  4TXW A;  1YFU A;  3VBF C;  1STM A;  2YGL A;  3W59 A;  4YPJ A;  5F5Q A;  1A6C A;  4MUV A;  3J26 N;  5LA2 A;  3J8F 1;  4N9H A;  2FBE A;  3J7H A;  5FZD A;  4CCJ A;  2VCM A;  4XJW A;  2JG9 A;  4C1W A;  1PHM A;  1UO9 A;  3VKL A;  2LRO A;  2BZD A;  1XYN A;  2DCK A;  3AB0 A;  3WEZ A;  3N36 A;  3ZN5 A;  3ZN6 A;  4D7Y A;  1KRI A;  3ZYH A;  3ACL A;  1C5I A;  2MEV 1;  4AAX A;  1OI6 A;  5LWB A;  4FAH A;  4YFZ A;  5CFC B;  2HEY F;  2WZR 1;  4XAA A;  4AOC A;  4RQP B;  2CTV A;  4KG8 A;  5FR3 A;  4ATF A;  4Q0S A;  5CAD A;  1QJU 2;  2NQY A;  4COV A;  1N3Q A;  1KIT A;  4JZR A;  4GD4 A;  1YUD A;  4PF5 A;  2HWD 3;  2DU0 A;  1D4M 2;  5ABJ B;  4QX0 A;  2JX9 A;  4NE9 A;  1WCQ A;  3W5N A;  4E8C A;  1HKD A;  3I2K A;  4HKW A;  3WHU A;  3NNL A;  4YLZ A;  4KNC A;  5IT6 A;  1VBC 1;  5KHG A;  1ALY A;  1MS0 A;  5CAZ A;  3MIB A;  3OD4 A;  1PO2 2;  3Q8C A;  3I2H A;  1K5M A;  5DZF A;  3CEW A;  1RUE 1;  1JOJ A;  1RJ8 A;  5FY0 A;  2X10 A;  1S2B A;  4MGK E;  1Q8O A;  1BEV 2;  1UXZ A;  1B35 C;  3VDD B;  2H0B A;  3AKP A;  2TEP A;  3FHI B;  4ISR A;  2CL2 A;  3O5S A;  2ARC A;  4XTP A;  5CVR A;  2WWJ A;  4FT8 A;  1MQT C;  1UNB A;  1ND3 C;  1W9S A;  3GHM A;  1YYN A;  4M00 A;  3C3V A;  1K42 A;  3POE A;  1GKB A;  1HRI 2;  4DEV A;  2B46 X;  4HPK B;  3FZ3 A;  3GJB A;  4OUS A;  4P9G A;  4YGC A;  2QVS B;  4B4Q A;  4L99 A;  4ZHN A;  3BOW A;  4A7Y A;  4X6Q B;  4CVU A;  3POF A;  2JIC A;  2PLV 1;  3ZFG B;  3RI8 A;  3RZH A;  3TBD A;  4QKB A;  2YXS A;  2EIC A;  3VBF B;  1ST8 A;  3J8F 2;  2Y6L A;  1IS6 A;  5LEJ A;  1LAJ A;  1M06 G;  4LKD A;  2HWB 1;  2V4V A;  5FZ9 A;  1HN0 A;  3GZA A;  2DVF A;  4QX7 A;  3N7J A;  1H8V A;  1KDK A;  3UES A;  1H8T A;  5LA9 A;  4QHZ A;  4ES9 A;  1H2K A;  4C0H A;  2MEV 2;  3O1R A;  3E6D A;  4JHT A;  1SCS A;  2Y8K A;  1QJE A;  1ZBE 3;  2VQU A;  4FPC A;  5EV7 A;  4DFS A;  1O3Q A;  2X53 S;  2Z69 A;  1LES A;  1NE6 A;  2QQM A;  4BPZ A;  4LK7 A;  1EV1 1;  3K4Z A;  2E26 A;  4NIH A;  4AL9 A;  1DLL A;  1Z7S 1;  1VBD 3;  2OS2 A;  3NAP C;  4YM1 A;  2WS9 2;  1UF2 C;  1XYP A;  3SH4 A;  3WD5 A;  3QH7 A;  1YQC A;  4LIU A;  1AX1 A;  1W8F A;  4XZP A;  5KXB A;  5JUV A;  1ONA A;  3LB9 A;  1W03 A;  1UYP A;  4BQW A;  1VJ2 A;  5FYY A;  1NE4 A;  5KHH A;  1RUE 2;  4QX1 A;  3DL3 A;  4O9G A;  5FAX A;  2HWC 3;  3OUH A;  4DRV A;  2BNN A;  4YW7 A;  1COV 2;  2HLE A;  3O1M A;  2A6Z A;  3VBH C;  1W2A X;  2LAL A;  3KT4 A;  1HB2 A;  3KHB A;  3WNK A;  5LK7 B;  2BBA A;  4PI0 A;  4GH4 A;  3D0J A;  4WBB A;  4OYU A;  5KC6 A;  4BM8 A;  5IK4 A;  3USU B;  4BQ2 A;  1V6K A;  1UY1 A;  4I0B A;  3WG4 A;  1MQT B;  2FDJ A;  1ND3 B;  2O0O A;  2QQI A;  4GZ9 A;  4U36 A;  4A6O A;  3WNM A;  4CXY A;  3HJR A;  1WZX A;  5AVA A;  5J36 A;  3TEX A;  5FO8 B;  2VZU A;  3URF A;  2DV9 A;  2VU9 A;  2O14 A;  1X8M A;  1URX A;  2PLV 2;  4Y5T A;  2VE1 A;  3J7L A;  4FPF A;  3N9L A;  5JSO A;  2CY6 A;  1CAX A;  4DXT A;  2VZO A;  4JAA A;  3AMM A;  3I2F A;  5K7P A;  3BTZ A;  2HWB 2;  1QIQ A;  3AZX A;  2IXC A;  5A1F A;  2WDB A;  1AYN 3;  1JOD A;  4XF4 A;  4QXK A;  2DVG A;  3K77 A;  1W90 A;  3U07 A;  1N3O A;  3W58 A;  1FOD 3;  4FOV A;  4NRO A;  4EWE A;  1FPN 3;  3LIH A;  4JHZ A;  2YPD A;  2VVE A;  1AX2 A;  3DPR C;  4S2D A;  4E4S A;  1U5Y A;  3C7F A;  4FP2 A;  1I1E A;  1CPN A;  2OVU A;  4HG6 B;  4E4Z A;  3IZO A;  2AC1 A;  1EV1 2;  1F31 A;  1UU6 A;  3N35 A;  3LEM A;  1GZW A;  2ZX2 A;  1Z7S 2;  1VP6 A;  4JRL A;  5FXW A;  4AI8 A;  1LUL A;  3WSO A;  4Y26 A;  4XTM A;  3FWE A;  5BY5 A;  4NPR A;  3ZN4 A;  1WWY A;  5KHJ A;  5CKN A;  1CVN A;  1HLC A;  5I0R A;  2ZML A;  2G9F A;  3K2O A;  4UW5 A;  4B1L A;  3O1S A;  3ACI A;  1W6M B;  2GH2 A;  3MI8 A;  4AXO A;  3S0M A;  3NWK A;  4B8E A;  5FO7 B;  1HB4 A;  2BUK A;  1LHN A;  4E4H A;  1OLM E;  3PUA A;  3CF6 E;  1MEC 1;  3ILF A;  3R4D B;  4KWJ A;  4L11 A;  1JW6 A;  3PTR B;  3KHC A;  1PZ7 A;  2XJR A;  2JDM A;  5F32 A;  2P3Y A;  4UW6 A;  4GJY A;  3SH3 A;  1GLH A;  4YM0 A;  2A71 A;  2EAL A;  3OBZ A;  3CZJ A;  3WVJ A;  3N9M A;  3IAP A;  3LE0 A;  4BOW A;  4Y1U A;  4ZXK A;  1ZRR A;  3CHX A;  2JE9 A;  5FXV A;  2QZ3 A;  2VEC A;  3CL1 A;  2O1Q A;  4WM7 A;  3ZXJ A;  1GZT A;  4ASM B;  2YY1 A;  1B35 A;  1AYM 1;  1W2T A;  1JYV A;  2KR2 A;  2W52 A;  3B9I A;  2XJS A;  1H4H A;  1QXP A;  1W2U A;  4M01 A;  3W20 A;  5BNP C;  1NZI A;  3AVS A;  2PHR A;  1BVP 1;  3KVB A;  4RGG A;  5C3S A;  3ZXA C;  1O5U A;  1OT5 A;  1QKQ A;  5LY1 A;  1OH4 A;  1TZO A;  3CBN A;  5BNO C;  1GZ9 A;  2CSG A;  1MS3 A;  2YB7 A;  4Z07 A;  5A70 A;  3ZKU A;  1IS4 A;  2VZR A;  1NCQ C;  5E1R A;  1DGL A;  4A44 A;  3ON7 A;  2B9U A;  1VMJ A;  3RSJ A;  4Q0P A;  4FFG A;  3TRS B;  3PME A;  3KF5 A;  1GP4 A;  3SCH A;  5IK5 A;  2FZ1 A;  4UBH A;  2BJS A;  4CP9 A;  5JR2 A;  5CBL A;  1UY0 A;  2Y0O A;  5FPL A;  1OBN A;  3S7I A;  2NZ9 A;  2D6K A;  1JU4 A;  4KWU A;  1JZ7 A;  4FP3 A;  4WV8 A;  2JKB A;  4FOW A;  5DMY A;  5SV8 A;  4XFG A;  2BP6 A;  3P5B A;  4DPN A;  3CJI C;  1OFS A;  1GQG A;  4IE4 A;  2YYO A;  5HPO A;  4LXL A;  1ZZ6 A;  3WQB A;  4FPL A;  3ZXG A;  4MGI E;  5GLW A;  5FPZ A;  5FY7 A;  4A7K A;  1VRH 3;  4GB3 3;  4XUO A;  1S0D A;  1C1L A;  4Y22 A;  1DQ6 A;  5C33 A;  2QQU A;  4AF9 A;  5GZF A;  3S57 A;  1ND2 A;  5HCH A;  3VZK A;  3RZZ A;  1O4T A;  3WDU A;  5FOB B;  3TAY A;  4R9B A;  2GDF A;  2GC0 A;  1LGC A;  1Q5O A;  2I07 B;  4K20 A;  5JIU A;  3NAP A;  1W0N A;  3N7K A;  1DZQ A;  1GSL A;  1UWW A;  5K4L A;  2DFC A;  1LOD A;  3E6B A;  5CFD B;  3OBR A;  1MEC 2;  3P6B A;  3R0R A;  5FQ0 A;  3WG1 A;  4YG0 A;  2H6C A;  3D82 A;  3OBA A;  5DUU A;  3VZN A;  4A2U A;  3HOB A;  5C4W B;  2UU8 A;  3E5U A;  3ZMN A;  2F4P A;  1ULC A;  1WCU A;  2DYC A;  1UOB A;  2GP3 A;  4BLI A;  2GZW A;  2XGX A;  3DF0 A;  1TEI A;  2VD7 A;  2XL7 A;  3AC0 A;  1YJL A;  4KU8 A;  1UXX X;  4CCK A;  2W2I A;  1DGR A;  3GYD A;  2D3S A;  1WKY A;  2VNG A;  3JQW A;  2DCJ A;  1MPX A;  2ILM A;  2PHU A;  3GJA A;  2BOI A;  3K3O A;  3QH6 A;  3L9J T;  4MH0 E;  3QBQ A;  1AYM 2;  2KD7 A;  2PTM A;  2W39 A;  2VZS A;  4M0N A;  3FE5 A;  3Q8A A;  5IYY A;  1PMJ X;  1PK6 C;  3GZT B;  5LB6 A;  3VKN A;  3WF4 A;  1LHU A;  4GA9 A;  1O4Y A;  5BNP B;  1QEX A;  1QWR A;  4R52 A;  1UYY A;  1RHI 3;  2JG8 C;  2BGP A;  3BYW A;  1MZF A;  4XF0 A;  5JXH A;  4UYB A;  4XQD A;  3I4I A;  1JU3 A;  1PIV 1;  4U2A A;  3S30 A;  2RS5 3;  5BNO B;  4IEX A;  5FZI A;  1O5L A;  2D5F A;  3JBG 1;  1NCQ B;  3MUY 1;  4Q4X 3;  2EF6 A;  2WII B;  2GN7 A;  4NUB A;  4Q0V A;  4AEJ A;  4KBB A;  4BLJ A;  2IWG B;  4IGP A;  2P5B A;  1BXH A;  1H1A A;  3DYM A;  5DUW A;  1LGB A;  1PVX A;  3OGS A;  1OKO A;  1W28 A;  4LTA A;  4GXL A;  4JQT A;  2ADE A;  2EVX A;  1TMF 1;  4NHM A;  1SFP A;  3B00 A;  1JS9 A;  3OPZ A;  3Q8E A;  1FNY A;  4J1W A;  2BVV A;  3LWC A;  2XBO 1;  3PUH A;  2UYA A;  3FC0 A;  2VOT A;  4IEV A;  4Q4V 2;  2XQX A;  2QQK A;  1EP0 A;  2ZGN A;  3TN9 3;  1OQD A;  1QY4 A;  4XQW A;  4B4R A;  2E7Q A;  2PXJ A;  4AYU A;  5KXC A;  3CJI B;  3DPR A;  4XJU A;  3WP6 A;  5BNN C;  1UPI A;  2C9A A;  4QPG C;  1D2Q A;  4EQV A;  4JV4 A;  1SZB A;  4ZZ8 A;  4ERO A;  3VBR A;  2QCS B;  1BBT 1;  4D6S A;  2R07 3;  1G7Y A;  2B5H A;  3EHK A;  3BPS A;  4FFH A;  5F3C A;  4XIK A;  2OZJ A;  2ZKN A;  3HQR A;  2ZZJ A;  2BW8 A;  2OQ7 A;  1WMF A;  1LOC A;  1W06 A;  2RS3 1;  4GAZ A;  1RVF 1;  5FZE A;  3LEG A;  4W4Z A;  2A6W A;  1DQ5 A;  3G7D A;  2WAO A;  3M7A A;  1OMI A;  2VXR A;  3BAL A;  4ZU4 A;  4AVC A;  4LBJ A;  2RDQ A;  4W6Y A;  2VUD A;  1ZBA 1;  2GC1 A;  1IQD C;  4IER A;  1Z78 A;  1I5Z A;  2BWA A;  1I3H A;  3CIH A;  2RMU 1;  4QGM A;  5K9Y A;  1ZM1 A;  2WFP A;  5IAV A;  1AR8 3;  1DBN A;  2UUR A;  3B02 A;  2JDP A;  2O8O A;  5DDJ 1;  2DUQ A;  2XXZ A;  5GLT A;  4Q1P A;  5JZG B;  3H3L A;  2YG0 A;  4NRQ A;  3MPB A;  4LO4 B;  1JHJ A;  1YFX A;  1VAL A;  2JD4 A;  2VO5 A;  2VBP A;  1GOH A;  4ET7 A;  3WP4 A;  1WA4 A;  3HNM A;  5F39 A;  1IG0 A;  2W46 A;  2DU1 A;  1PK6 B;  5LA0 A;  5D8A A;  1C28 A;  2BYV E;  3FHQ A;  2QKD A;  1R08 3;  4IET A;  1S0C A;  2V73 A;  4QB1 A;  3ZYG A;  3VN4 A;  1G9F A;  4JKK A;  4MXW A;  2C26 A;  4QXH A;  1W6Q B;  2B4K A;  2EIG A;  2HWF 3;  1ENX A;  4GMP 1;  4IV1 A;  4YG6 A;  1XNK A;  3ZR5 A;  3N3H A;  4LK6 A;  4AW7 A;  2ARB A;  2UYB A;  5KWR A;  3JBG 2;  4CP1 A;  2Y6F A;  4UFL A;  1RUJ 3;  5FZL A;  3IWZ A;  5LAS A;  5FZ1 A;  5FZ4 A;  5FTT C;  1O91 A;  3PNA A;  2JDY A;  3UJQ A;  3KT1 A;  1MVQ A;  4RS5 A;  3IT8 A;  2G4I A;  5CEH A;  1BYH A;  4ORF A;  3JQX A;  4QQP A;  4R9A A;  1AR6 1;  4HET A;  4FPY A;  1ULE A;  4PF1 A;  5IVY A;  5CB7 A;  1RXF A;  1W6N A;  2WBK A;  4F83 A;  4O7X A;  4I3P A;  3MW3 A;  3THD A;  1R1A 2;  4UW4 A;  4ASK A;  2VL4 A;  5BNN B;  1H6Y A;  2HWE 1;  2UWA A;  3MLL A;  4QPG B;  1RL3 A;  1BBT 2;  2ZEY A;  5B2G B;  4MXV A;  3RNS A;  1JN2 P;  3NV1 A;  3UL2 A;  1OLR A;  4XAE A;  3KCY A;  4W8J A;  4LBO A;  2OXB A;  3O1V A;  2RS3 2;  3J7N A;  2XH6 A;  1Q8V A;  1RVF 2;  4N8M A;  1VBA 2;  3W9A A;  1TME 1;  4AED B;  2WO1 A;  2QUO A;  2D6P A;  1IPK A;  2BGO A;  4AEK A;  4FPG A;  5JOZ A;  2ZEW A;  3FFZ A;  5FYU A;  5CNA A;  3RRD A;  3AP5 A;  1RUD 2;  1PX3 A;  2Q30 A;  3H42 B;  5DG1 A;  3VBO C;  3MIH A;  5A3M A;  1ODM A;  4O9E A;  3WF0 A;  3MIC A;  1YQ2 A;  2FDH A;  4N43 A;  5DDJ 2;  5JOX A;  3ILR A;  3P3P A;  3EYP A;  3IPV A;  2R16 A;  1SMV A;  1U0A A;  1AF9 A;  3GHN A;  4FTB A;  4JGZ A;  3OB8 A;  1PM7 A;  1DHK B;  2Q5T A;  1PMH X;  3B69 A;  4UFM A;  3DGT A;  2GC3 A;  5DUV A;  5FZM A;  3HD8 B;  1PGS A;  2WYS A;  3H1M A;  3MIE A;  2YFU A;  3U4S A;  3FLP A;  5FUP A;  2AEY A;  1XB9 A;  3NJV A;  1XJA A;  1RTV A;  3M1H A;  1QXR A;  4Q0Q A;  1SHW B;  1J1T A;  2WLQ A;  3MV0 1;  4K8R B;  4JTN A;  1N47 A;  5A32 A;  1CQ9 A;  3QOP A;  4KWK A;  4LOR A;  2GAU A;  2JG8 A;  4KI5 M;  5FZO B;  1G9D A;  4K3U A;  4MGS A;  2Y6J A;  4PDW A;  4D69 A;  3V0A A;  4QDQ A;  2DCZ A;  4K9S A;  2W47 A;  4XBL A;  2XVG A;  4DXS A;  3HBZ A;  1GYK A;  3T4H B;  4COY A;  4K1Z A;  3OY8 B;  2JIJ A;  4I01 A;  4MET A;  1AR6 2;  1W04 A;  1SBE A;  3ETQ A;  1UIK A;  2FDF A;  3JUU A;  3DEM A;  1QH7 A;  3TEZ A;  3VD3 A;  2WFF 3;  4YZ2 A;  5F5I A;  3ZIW A;  3ZFF C;  3WHT A;  4M0H A;  1J1L A;  2AAC A;  4RL7 A;  1G6N A;  4HK9 A;  4PHZ A;  2D97 A;  2HWE 2;  5CYY A;  5E8A A;  3UKN A;  3OYW B;  5FYZ A;  4BIF A;  4ZZ5 A;  1AL2 3;  1KQR A;  1T6G C;  2RJL A;  2RM2 3;  5A3W A;  2I45 A;  5F7U A;  3IB3 A;  2DVA A;  1H2N A;  1EPW A;  2K9Z A;  4JGY A;  1KS4 A;  3OOX A;  4XF9 A;  3DV8 A;  2XB6 C;  1Q8P A;  4IL7 A;  4KGQ A;  1GNH A;  1TME 2;  5C5U A;  1JOB A;  2GME A;  4IV3 A;  4NAM A;  3O12 A;  4XJA A;  1QJX 2;  5LZ6 A;  4N53 C;  1W2O A;  1WW6 A;  2ZOE B;  1ZRC A;  2VPV A;  2YC4 A;  1MVE A;  4YRD A;  4HVR A;  4XMI A;  3T2O A;  5J09 A;  2FZ2 A;  1NY7 1;  3POJ A;  3UKT A;  4KL1 A;  3VZO A;  1BLZ A;  3HVD A;  3PTY A;  5B4X A;  5CA6 A;  3VBO B;  1PVC 3;  4H7M A;  2RDN A;  1CON A;  2RDS A;  4QGN A;  5I0D A;  2DFB A;  4XF1 A;  4NPM A;  3MHZ A;  1RUF 3;  2CGN A;  2ZEZ A;  2A6X A;  2WYF A;  5I91 A;  3ZYF A;  5K8S A;  3AMN A;  3H0O A;  1UMI A;  4RGK A;  3TNP B;  3GBW A;  2VZV A;  4QQL A;  4R9D A;  3RGB A;  4CDX C;  2X5I C;  3GAL A;  4R4X A;  1N3P A;  2UWB A;  2XKO A;  2A6V A;  5CFC C;  1SFN A;  5FZG A;  4B7K A;  4H2A A;  2DUR A;  1G9A A;  2GMM A;  1NA1 A;  2QQN A;  4ZKT B;  2AEN A;  3HN3 A;  2ZGP A;  1YIF A;  4XFA A;  1CAW A;  2WQ8 A;  5JCT A;  1YLL A;  4S2H A;  3SIT A;  4FBF A;  4CYD A;  4NRM A;  2HWD 2;  3TNQ A;  1Q3E A;  3I59 B;  1NG0 A;  1VBD 1;  3T0A A;  2VG9 A;  4MG2 A;  4WM8 C;  5CZK A;  5LBB A;  4OUM A;  4EZH A;  4UFI A;  1HRV 3;  2VCC A;  3FL7 A;  4GWN A;  3L2H A;  1GUI A;  3THP A;  3VL8 A;  2WO3 A;  1CAV B;  3MBW A;  1GR3 A;  1TG7 A;  3C2U A;  2E51 A;  3ZVX A;  4C1X A;  1UW8 A;  2L9L A;  4GKY A;  3DXU A;  2DDU A;  4Y3O A;  3VB9 A;  3SKJ E;  1U12 A;  1SLL A;  3VDD C;  3AFG A;  2HWC 1;  4QM8 A;  3KMH A;  3ZFF B;  3T3Y A;  4AVB A;  4Y1X A;  1VAM A;  3WDX A;  4N7I A;  3C7E A;  4CEW A;  5F1R A;  2LW8 A;  4LBK A;  1SEF A;  2H0V A;  3ACF A;  3AXD A;  3UV9 A;  4AVA A;  3HR9 A;  3IDC B;  1H4G A;  1GZC A;  1SLC A;  2OII A;  3LPF A;  3POY A;  4QKD A;  3B5L B;  3E6C C;  1DQ4 A;  1NQD A;  3RI9 A;  1F8V A;  4NID A;  1CAU B;  1Y43 B;  5BPX A;  3VDB A;  1WGP A;  3QCW A;  1IZ3 A;  2GAL A;  2VMD A;  2WJS A;  4N53 B;  3M3C A;  1H1I A;  3IMN A;  4YVS A;  3PMS A;  3PJQ A;  1NY7 2;  3J9S A;  1MZ5 A;  3IBM A;  4S2F A;  5HV4 A;  2JEN A;  4OZO A;  3MGU A;  4NII A;  1S55 A;  1PO1 3;  2EA7 A;  3KCX A;  3A7Q A;  2IXI A;  4OHY A;  4MHU A;  1Y4W A;  2QJV A;  2XHN A;  1YFW A;  3OUI A;  2ZGO A;  3KF3 A;  4YZ3 A;  2Q4S A;  3FBM A;  4XIO A;  2R06 3;  2GC2 A;  2X05 A;  2QFE A;  4BH9 A;  1C5H A;  2XWB B;  1AYN 1;  1HX6 A;  1W99 A;  4TZD A;  4XET A;  1D4V B;  1ASJ 3;  1MS9 A;  3ATG A;  1D0H A;  1RJ7 A;  4UXA A;  3LA3 A;  2X5I B;  5K0U A;  1FOD 1;  4CDX B;  3VZJ A;  1FPN 1;  4HSJ A;  1UX7 A;  2JDH A;  3ETP A;  4AAP A;  4LO8 A;  4DY3 A;  1ZBE 2;  4BB3 A;  5LA1 A;  4AWD A;  2A70 A;  1FMD 3;  1R64 A;  2ZEX A;  1W3X A;  3CDZ B;  4CDQ C;  1KS5 A;  1OLM A;  4CSW A;  4NAO A;  2BVB A;  2WNV A;  5ISL A;  4CP0 A;  1F35 A;  1QNY A;  4OI0 A;  1W0O A;  1DGW X;  3V56 A;  2WS9 1;  3LDR A;  2WR9 A;  1VBD 2;  3VD7 A;  4XCA A;  4QPI C;  2RS1 3;  1W8T A;  1D0G A;  4WM8 B;  2Q8O A;  4XBQ A;  3H1Y A;  3POB A;  4RR3 C;  2V72 A;  4AFA A;  2QQO A;  5EQU A;  1WBF A;  3H3Z A;  5FMB A;  3WQ0 A;  4OCT A;  1IS5 A;  1HXS 3;  4E27 A;  4NR1 A;  1COV 1;  1VLN A;  1VPH A;  1ZNP A;  3WLU A;  4XFC A;  4XEZ A;  2HWC 2;  3RYP A;  4BE3 A;  2ARE A;  3GF6 A;  5FPB A;  3D6E A;  4EE2 A;  1Z0H A;  1C3H A;  1XSR A;  3WIN E;  5FZB A;  4HFS A;  1PZ9 A;  3U37 A;  3RYR A;  1UPS A;  4LBQ D;  1J3Q A;  3I7D A;  3T0D A;  2J1V A;  1LRH A;  4AHX A;  3AYA A;  4AHW A;  4HLT A;  2EAK A;  1SG3 A;  2DUP A;  2ET1 A;  3WX5 A;  2WKK A;  1XND A;  2C9K A;  4LKE A;  4CEY C;  4OFG A;  2JB8 A;  1ENQ A;  2TBV A;  4AHY A;  1QQP 3;  3MIF A;  1UZ0 A;  2E31 A;  4XXA A;  3A23 A;  1W9W A;  3IAQ A;  4AGG A;  1RMU 3;  4YVW C;  4S2G A;  4QX2 A;  4CDW A;  2RR1 3;  2OX0 A;  2E33 A;  1RUC 1;  2ZHK A;  4HVO A;  4Y33 A;  5C5T A;  1XC6 A;  4L9B A;  2C5D A;  3KSC A;  4RSU A;  5I0S A;  2D6L X;  4LBN A;  2R32 A;  5T50 A;  1SDD B;  2DBN A;  1QOS A;  1NKG A;  4HBN A;  2ZAH A;  3VBS C;  4FPE A;  1V6M A;  4UF0 B;  1AYN 2;  1J3R A;  5FWE A;  1U5I A;  3VUO A;  1XNB A;  1FOD 2;  1N1V A;  3MF6 A;  2FDI A;  3NNG A;  1FPN 2;  4D0Q A;  1LOB A;  1C8M 3;  4RN5 A;  4XHB A;  3WR0 A;  5EJ1 B;  1UCX A;  2VZT A;  3LDK A;  4CXW A;  1RUG 3;  3DYO A;  5A6Z A;  3KV6 A;  3RMX A;  3TEW A;  4CDQ B;  1IOA A;  2ORX A;  4MZU A;  1AVB A;  5CFC A;  2WRA A;  3AJZ A;  1DG6 A;  2G9G A;  4RQP A;  3QD6 A;  1O59 A;  3FBY A;  3T08 A;  5A3L A;  1YFY A;  2VQA A;  2VZ3 A;  2ID4 A;  3ZYI B;  2CAV A;  2CNA A;  4QPI B;  3IDE A;  3NW4 A;  5ABJ A;  1VRH 1;  4TWT A;  4GB3 1;  1NLQ A;  3NKT A;  2KA3 A;  4RR3 B;  3B9C A;  5C9A C;  1NXD 1;  1UOF A;  4LHL A;  1H2M A;  4O65 A;  1GMM A;  1US3 A;  3KVA A;  1X82 A;  4Y20 B;  4BQY A;  5JDB A;  5IK8 A;  3LCP A;  5J1X A;  5FRE A;  2WO2 A;  1BZW A;  4XZU G;  4UOJ A;  4CCL A;  2CV6 A;  2P34 A;  1WA6 X;  2XWJ B;  3OF1 A;  2YZ4 A;  3CJX A;  4B1M A;  3PUI A;  5DXD A;  3IKW A;  3N9O A;  5FP4 A;  4NRP A;  4WVM B;  3B01 A;  2X09 A;  4IE5 A;  4HN0 A;  2W1S A;  4SLI A;  4IEQ A;  3NKG A;  3HIF A;  1N1Y A;  5L73 A;  3WW2 A;  2FCV A;  3OEB A;  5F37 A;  1V6L A;  3VDD A;  4C0B A;  3O1T A;  2VZP A;  4KBZ A;  3ZLI A;  4A6S A;  4RYD A;  4CCC A;  3W5M A;  2FDK A;  3B3Q E;  2VW2 A;  1W8N A;  1BEV 3;  1FYU A;  1VAK A;  2A1X A;  1OOP C;  2E53 A;  1POV 1;  2WLP A;  2Y6H A;  4CEY B;  5FO9 B;  1RUO A;  2KXL A;  5C3P A;  1BMV 1;  2HBT A;  5AVP A;  2ZGQ A;  1DYK A;  3QLQ A;  4HPK A;  4NHK A;  3RPQ A;  2C4X A;  3ALQ A;  5KR7 A;  1AZD A;  1NCR C;  1RHI 1;  2VAU A;  3CZU A;  1RUC 2;  1GBG A;  4YVW B;  1HQL A;  4J25 A;  5ACA 3;  5DAQ A;  4JRA A;  3ZFG A;  3K4A A;  5C8C C;  1CJP A;  2EIB A;  2CHH A;  1UAI A;  2RS5 1;  2WNU C;  5FYH A;  1HQN A;  2FDG A;  1HW5 A;  2OUJ A;  1S0G A;  1YNA A;  3VBF A;  5CIS A;  4Q4X 1;  1V00 A;  3UKV A;  2XUE A;  4XJ8 A;  3VBS B;  5FMC A;  3E5Q A;  4IEU A;  1LOF C;  1FT9 A;  5DZG A;  4CDU B;  2V5D A;  4JC1 A;  5FYI A;  1MS5 A;  5FLI A;  1HN1 A;  3UT0 A;  1J84 A;  2GH8 A;  4YW4 A;  3D5O A;  4I2O A;  1B09 A;  4HN1 A;  5T5O A;  2E7A A;  3NMB A;  3GDB A;  4MGZ E;  3UET A;  5LRR A;  5A7P A;  1L7R A;  5L9V A;  1Y9G A;  3KD4 A;  4AGR A;  5FIX A;  3J7M A;  3KQ4 B;  4AI2 A;  4IDZ A;  2XOM A;  1ACC A;  2D3R A;  2ZGL A;  3U11 A;  3VBU C;  4I02 A;  4M3C E;  2WZR 3;  1VRH 2;  1OLQ A;  2BV4 A;  1O7F A;  4GB3 2;  4LO5 B;  4AHZ A;  1ZRD A;  4NWV A;  1VBE 3;  4AQT A;  1KXG A;  2V4A A;  3AKT A;  1CZS A;  3WNX A;  2R07 1;  4UFH A;  1CZV A;  5CFD C;  4D6R A;  1PX4 A;  5C9A B;  2W95 A;  5A6Q A;  1UZZ A;  1YRZ A;  5C4W C;  1AXK A;  1PNF A;  5L7O C;  4NIA A;  5DG2 A;  4QXC A;  1S2E A;  3JB8 A;  1XNA A;  1VBC 3;  2XL9 A;  4KQ7 A;  1DLC A;  5EP9 A;  3ZO0 B;  1MAC A;  4NN0 A;  5DAW A;  1HB1 A;  2IVJ A;  4QQH A;  3HT2 A;  3ZOI A;  1AHS A;  2UY9 A;  1UZY A;  2WQ4 A;  3ABZ A;  1IQA A;  1AR8 1;  3FJS A;  4AFC A;  5JWP A;  1FX5 A;  5ANQ A;  4YZ4 A;  1Q8S A;  3ORJ A;  4KH9 A;  4LKF A;  3BTX A;  1CX4 A;  3USU A;  5CG9 A;  4D8M A;  1MQT A;  1ND3 A;  5H9P A;  3ZFE C;  3ZYB A;  1OOP B;  1R09 3;  1VMF A;  1BMV 2;  1GOG A;  2VMF A;  2WNE A;  1VE0 A;  3BGA A;  5JIA A;  3RZL A;  1RHI 2;  4FPO B;  1KJR A;  2W91 A;  3HAG A;  1NCR B;  3M70 A;  2J1S A;  3PVE A;  2P3J A;  4E9K A;  2RVA A;  3EQE A;  5GM0 A;  4FXK B;  4MO3 M;  5AFE A;  1SPP B;  2RS5 2;  2IXL A;  1GOF A;  1F4H A;  3Q9O A;  5C8C B;  1PZ8 A;  2CWM A;  2WNU B;  2YU1 A;  3EJK A;  4JDM A;  3MFC A;  4GWJ A;  4NO4 A;  4Q4X 2;  4R8H A;  1XNC A;  4B4P A;  3VL9 A;  2E7T A;  1CIY A;  5GZE A;  1WLT A;  3K48 A;  1V9U 3;  1XBF A;  2C24 A;  2A6Y A;  3AYC A;  3LA7 A;  3PVO A;  4Z2W A;  2HBU A;  2Q0A A;  2D5H A;  2K2S A;  4HAN A;  5IVJ A;  2CDP A;  3KZ4 C;  4Q8L A;  1JHN A;  4Q4V 1;  1ZYB A;  2TNF A;  3BIW E;  3DCQ A;  5E6H A;  4AVS A;  3S6P A;  5F5A A;  1W9T A;  4D7T A;  1ZRF A;  2HYX A;  1QHD A;  3U1X A;  1KDM A;  2D98 A;  4LHN A;  1ZZ8 A;  2B7Y A;  1UMZ A;  3HWJ A;  3LFI A;  4G9S B;  1DZT A;  4FVV A;  3B94 A;  2OZ6 A;  4BA6 A;  2JDK A;  4OZX A;  5IFT A;  1V70 A;  4BQ3 A;  4OHW A;  3VBU B;  3EMR A;  1W2N A;  4EZ4 A;  1QMJ A;  5I8S A;  4XW3 A;  3U14 A;  2R07 2;  4XFI A;  5GAL A;  1XRU A;  2W3J A;  3D4K A;  2MNG A;  3ELN A;  1BCX A;  1F9K A;  2D43 A;  2NM1 A;  1OFN A;  2V5Y A;  4CCD A;  2BEO A;  4LO6 B;  5IWF A;  4FPK A;  3NQH A;  5BV6 A;  3PU3 A;  1YIP A;  3PVN A;  4DQA A;  1NXM A;  2ZAB A;  4TTG A;  3UYJ A;  5L7O B;  2PHF A;  1X7N A;  4P9I A;  1UYZ A;  1W6M A;  4CUA A;  5IAX A;  3KS7 A;  4XUN A;  2QZ2 A;  2D6M A;  5T52 A;  2XQR A;  3AKQ A;  3Q8B A;  2PHT A;  4W65 A;  1DYO A;  2WSV A;  2E32 A;  5JZG C;  5F3E A;  4QPW A;  5FY9 A;  3SCG A;  4AFM A;  4UI9 L;  5F6K A;  2VZQ A;  1AR8 2;  2A75 A;  2I2S A;  1SFY A;  3AZW A;  1GV9 A;  3WF2 A;  4A41 A;  3O1U A;  2DWR A;  3GBG A;  4PLN A;  5A7O A;  2NMN A;  4BXF A;  2JB4 A;  4FTE A;  1UN1 A;  5IW0 A;  1O3R A;  1NAE A;  2GP5 A;  1E5I A;  4OUE A;  3LD8 A;  3ZFE B;  2NP0 A;  2F6B A;  4FSJ A;  4Y1Z A;  1ENS A;  1JZ2 A;  1A3K A;  3FUO A;  4UFJ A;  5FPV A;  5FY8 A;  4QHB A;  1V6O A;  2ZA9 A;  4DMI A;  1RGS A;  3LQC A;  4GAL A;  1W6O B;  2JDU A;  2P3K A;  4TN7 A;  2Q1M A;  3JB4 C;  2H6B A;  2D44 A;  1X36 A;  3WXP A;  1Q56 A;  4IGQ A;  4AI1 A;  1SLA A;  4DO0 A;  5CU1 A;  3LA2 A;  4ZY9 A;  5F3I A;  1RUJ 2;  2C6S A;  2YPJ A;  4PQQ A;  5DAP A;  1UU5 A;  2ET7 A;  3M3E A;  5FMO S;  1UD1 A;  3T4V A;  1G9B A;  2JXA A;  5JVV A;  4QXB A;  1W39 A;  2HJI A;  4PIX A;  2A3Y A;  1H9P A;  4V2V A;  3VHN A;  4EWA A;  4MHR A;  3S7E A;  2FCT A;  3M4F A;  1GFF 2;  3I3M A;  1IG3 A;  1QJZ A;  1WMD A;  1F5F A;  1GQP A;  1LHO A;  1KFX L;  2E9Q A;  2VOK A;  1R1A 1;  3M3Q A;  3MPP G;  2ZCW A;  4PJY A;  2WFF 1;  1GP6 A;  4IEO A;  5EYY A;  3VBH A;  1XQN A;  1MS4 A;  2JIG A;  4CCM A;  4H14 A;  4CU6 A;  3E1F 1;  4FPJ A;  4NWW A;  4YGD A;  2DCT A;  1A78 A;  3MID A;  1BQP A;  3NV4 A;  4KGG A;  4YM2 A;  2C1F A;  3ZDS A;  1LU1 A;  1W6P B;  3PHM A;  2E6V A;  2MHF A;  4OVE A;  1HJG A;  4CUG A;  2RM2 1;  4AE2 A;  3JU9 A;  4Y4R A;  2QE3 A;  1VBA 1;  4AED C;  2EXI A;  4DNY A;  4HT1 T;  3NNF A;  4CPB A;  1EAH 3;  1EY2 A;  2V09 A;  4QX3 A;  4EJR A;  3H8U A;  1NOV A;  5BUV A;  4KWL A;  4MGT A;  2LRP A;  3JD7 3;  1RUD 1;  2JWP A;  5CFD A;  2OKX A;  1S0F A;  3UGF A;  3SLI A;  4NHX A;  1WW4 A;  4HON A;  5C4W A;  1APN A;  4Q4Y 3;  4BQX A;  2ZAC A;  5I8T A;  4AEM A;  2YRO A;  3D0S A;  4YW1 A;  1PVC 1;  1GU3 A;  3PJY A;  1AL0 G;  4QKN A;  4YW3 A;  4QD2 A;  1GWL A;  2ZX1 A;  4CCN A;  1RUF 1;  5FZ8 A;  5IJR A;  3VDC A;  5F6L B;  3WNP A;  3BOD A;  5JSR A;  5J7M A;  2PQS A;  3I97 A;  3VHP A;  5FYB A;  4FTS A;  2HEV F;  1IKQ A;  1HDK A;  2VUA A;  2XVL A;  4C91 A;  4Q4W 1;  5KBF A;  1CN1 A;  1ZRI A;  4V1P A;  5BNP A;  2EID A;  5FY4 A;  2W9X A;  2YU2 A;  3LGR A;  1UKR A;  1ULO A;  1MZE A;  5DZE A;  2PAK A;  1W9Y A;  2HH9 A;  2J1T A;  3GZE A;  2A7A A;  3CU7 A;  3MV1 1;  5LAT A;  1E5R A;  2XJV A;  1NLS A;  4OHV A;  4BIO A;  5BNO A;  2Q1F A;  1X9T A;  5A7S A;  3RVH A;  3X29 B;  1NCQ A;  1ZZ9 A;  1ZZC A;  2CGP A;  2G9Z A;  5I0U A;  5T3N A;  1HRV 1;  3HMY A;  3MF9 A;  4NJ4 A;  2NN8 A;  3THT A;  3ST7 A;  1K12 A;  3VD9 A;  1NZC A;  1C1F A;  3BIE A;  4XYX A;  2VM9 A;  2HKX A;  1S0I A;  3KB5 A;  4AR2 A;  4QQO A;  4FFI A;  3MFA A;  4AZZ A;  2AYH A;  4XDQ A;  3ECQ A;  4CXX A;  3U75 A;  1DGR N;  4RFT 0;  2WFF 2;  3TB0 A;  4A4A A;  2ATF A;  1IKP A;  1LGN A;  3DKQ A;  3MW2 A;  4DB5 A;  1S0E A;  4EV0 A;  4DOU A;  5F5C A;  4DUW A;  5B4N A;  2WN3 A;  2JD9 A;  3B93 A;  4ISQ A;  3CJI A;  2JE7 A;  1AL2 2;  2R49 A;  2RM2 2;  2XJQ A;  5FCC A;  5FZ6 A;  3RZG A;  5FLJ A;  3ZYJ B;  2VC9 A;  2ENR A;  4N9I A;  2A73 B;  1JUI A;  1LEM A;  1QJX 1;  2IXK A;  4QU1 A;  3DYP A;  3H7J A;  1WME A;  3OCP A;  4CRQ A;  4XUQ A;  2W0X A;  1CWP A;  4X8N A;  1JI6 A;  3GGL A;  3AL5 A;  1FAT A;  4QT6 A;  4ZS2 A;  1UY2 A;  4QWN A;  5A33 B;  4IUG A;  5IVF A;  1W8U A;  1UX6 A;  3EO6 A;  3ZIX A;  3O1P A;  3HQU A;  4QX8 A;  4P9X A;  2W68 A;  3LOI A;  5FYC A;  1OVS A;  2Z5W A;  3EXU A;  1PVC 2;  1PO1 1;  4R4Z A;  2VVF A;  3V0B B;  1OA3 A;  2DTY A;  3MLJ A;  4PCR A;  4URT A;  1FXZ A;  1NYW A;  1RUF 2;  4QDS A;  5A7W A;  2ZX3 A;  2R06 1;  2JG9 C;  2SBA A;  3NVC A;  3CMG A;  1QJY 3;  2DBI A;  4P5Y A;  3TEY A;  1PM4 A;  2XLA A;  2RDR A;  1QH6 A;  3RYK A;  2YC0 A;  1RUH 3;  3K4D A;  2O8Q A;  4RA0 A;  2VH9 A;  2VNR A;  5JZG A;  2R7E B;  2QQP A;  4DY5 A;  4HSL A;  5IVE A;  4Z82 A;  5IVC A;  1SAC A;  2PHX A;  2VCB A;  4Q4W 2;  5J98 B;  3RJ2 X;  3USS A;  1AR9 3;  1PK6 A;  4K7J A;  3LZZ A;  3GCX A;  1FMD 1;  3AK0 A;  5T55 A;  1X33 A;  2PHW A;  5EPA A;  2W1U A;  2HWD 1;  4DUX A;  4I09 A;  1V6I A;  1LTE A;  4ZPI A;  1W6Q A;  1YQ5 A;  4EN6 B;  3MW4 A;  3RFR A;  3PLQ A;  3M3I A;  3OG2 A;  5CIR A;  3ZSM A;  3AZV A;  5A1A A;  2ZGR A;  4BU2 A;  2RS1 1;  1PIV 3;  1HRV 2;  1RUI 3;  2C0Z A;  2XLG A;  3AYD A;  5ERL A;  3KCC A;  5FZF A;  5FWJ A;  2GMP A;  4LOS A;  2Z2S B;  3IIA A;  1VMH A;  1BKZ A;  1AR7 3;  1LCL A;  5L19 A;  3U4X A;  3PL0 A;  1DCS A;  1HXS 1;  1QOO A;  5FBZ A;  2ZGM A;  5FPU A;  5EIY B;  1JYI A;  2YDE A;  2WWU A;  3IMM A;  1DGW A;  4LBQ B;  2ETE A;  1TMF 3;  1FNZ A;  5H9Q A;  4BQ5 A;  5E16 A;  4DIQ A;  2XBO 3;  2YBK A;  4Y4Y A;  2K0G A;  5BNN A;  4QU2 A;  5IAT A;  4K8F A;  4QPG A;  1AXY A;  2G1M A;  4LO7 A;  4QQ2 A;  4CCE A;  1LEN A;  5BYN A;  2B8M A;  3ES4 A;  1A34 A;  5HBA A;  5JPM B;  3OTF A;  4YFW A;  5IVV A;  1UY3 A;  3UNP A;  3OPT A;  3RDI A;  5HXM A;  4RHV 3;  5F2W A;  2IFW A;  1QQP 1;  1L7Q A;  3HPN A;  4AK3 A;  4EYU A;  1QU0 A;  1WCS A;  4LMF A;  4Q29 A;  1RMU 1;  4WVW A;  2AR6 A;  3UJO A;  5FKB A;  3RG0 A;  4AED A;  2RR1 1;  1M4W A;  4M3C B;  3RWN A;  1JYX A;  1PO1 2;  3R05 A;  2IC1 A;  3LKJ A;  4X8P A;  3CKH A;  2WT0 A;  3AM2 A;  3BU0 A;  1ZZ7 A;  3ZYP A;  1YQ6 A;  3WNL A;  4ZS3 A;  5SV5 A;  5C3Q A;  5A3T A;  5G04 L;  2R06 2;  4OMD A;  4RD7 A;  1ZBA 3;  2YUE A;  1MZ6 A;  2DVD A;  2VME A;  4CA9 A;  2JG9 B;  4DIN B;  2RMU 3;  3DXT A;  4G3Y C;  5EYX A;  5IUQ A;  2QNK A;  2VCA A;  2Z4F A;  3FFQ A;  1ZBE 1;  5LY2 A;  4BHP A;  2GN3 A;  4CUC A;  5I8Y A;  3WNN A;  3A22 A;  3ZN6 B;  1C8M 1;  2HEW F;  4Z2A A;  1HIX A;  1P8J A;  1FMD 2;  1OQ1 A;  1UIJ A;  1DF0 A;  3ENR A;  4H7L A;  2R04 3;  4EN9 B;  2IVI B;  3RWK X;  4EN7 B;  3RZJ A;  4E2G A;  1YCI A;  2JDN A;  1MR5 A;  1BK0 A;  4FOQ A;  4FOY A;  4EWD A;  3ZXL A;  4Q8K A;  2RS1 2;  3VHO A;  3PUS A;  1IPS A;  5FZO A;  2IUW A;  2BER A;  4Z8B A;  2X29 A;  2P2K A;  3PUQ A;  5L9B A;  4BK4 A;  1D7P M;  1OPO A;  1YO8 A;  5D21 A;  1LHW A;  5EJ3 A;  4B3N A;  3VDA A;  1HXS 2;  4G4F A;  5C70 A;  3OY8 A;  3K75 B;  2P17 A;  1K5M B;  3BOP A;  2F17 A;  3H1W A;  3C7H A;  5JMO A;  3A4U A;  2ZMK A;  2BDR A; 
#chains in the Genus database with same CATH homology
 3NNF A;  5M0T A;  3OUJ A;  5EPA A;  3BVC A;  4ZPI A;  2HBU A;  2FCV A;  5C5U A;  4NAO A;  4NHY A;  5LAS A;  4NHX A;  4BQX A;  4KBZ A;  5ERL A;  5L9R A;  3KT1 A;  2G19 A;  4Q5O A;  4XCA A;  2A1X A;  3GJB A;  2FCU A;  3GJA A;  2RDN A;  2RDS A;  3PL0 A;  2HBT A;  2RG4 A;  4NHK A;  5EQU A;  4XCB A;  3EMR A;  3NNJ A;  4J25 A;  5LB6 A;  5DAQ A;  5HV0 A;  3NNM A;  5IAT A;  2G1M A;  5LA9 A;  5IAX A;  4ZON A;  3GZE A;  5LAT A;  5A3U A;  4NMI A;  3OBZ A;  4NHM A;  5L9V A;  5LBF A;  5LBB A;  4Y5S A;  4XAC A;  3DKQ A;  3ITQ A;  3W20 A;  5LBE A;  5C5T A;  2V4A A;  2Y33 A;  4NHL A;  4BQW A;  3HQR A;  4XC9 A;  3OUH A;  2Y34 A;  5EP9 A;  5DAW A;  3KT4 A;  5DAV A;  5DAP A;  4XAA A;  2RDQ A;  5DAX A;  3W21 A;  3HQU A;  4IW3 A;  4MHR A;  4JZR A;  2FCT A;  5IAV A;  5HV4 A;  5L9B A;  3KT7 A;  3MGU A;  2JIJ A;  4XAB A;  3NNL A;  4MHU A;  2RDR A;  2JIG A;  4Y5T A;  2OPW A;  3OUI A;  4BQY A;  5LBC A;  4UWD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...